3E0PB

The x-ray structure of human prostasin in complex with a covalent benzoxazole inhibitor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
246
structure length
246
Chain Sequence
b'ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPAAQASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNSLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostasin
publication title Discovery of inhibitors of the channel-activating protease prostasin (CAP1/PRSS8) utilizing structure-based design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 52
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e0pB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e0pB01
4NFFA 4OS6A 4ABAA 1V2LT 1T8NA 1SGRE 4Z0KA 1YPKH 2BD3A 4IMQA 1NRRH 5A0AE 9LPRA 1MTVA 3A8BA 3BG8A 2Y5GA 1MZAA 1GI4A 3MNCA 3QLPH 1C1QA 5GPIB 1W10U 1DT2A 2GZ8A 2PV9B 1PPGE 2XC4A 4MTBA 5L6NH 2FYQA 2DE9A 1KDQA 3LGVA 4NZLA 3RXTA 1J9CH 1D3PB 4TY7A 3KGPA 3AASA 4XBCA 1FY8E 4CBNA 1IQJA 3QX5H 4ZHLU 2CF8H 4Y7AA 1GVLA 3C27B 1MKXH 1JBUH 3RXQA 1PQ8A 2ZDKA 1GBDA 3CS7A 4INKA 4DW2U 1AIXH 1YCPK 2ZWLH 1DE7H 4NFEA 1FY4A 1DPOA 2ZFSA 5AFZH 2GVFA 2HVXA 1DWCH 1OWDA 2FX6A 1ANBA 2P8OB 1AQ7A 2R0LA 2PR3A 5IDKA 2BM2A 2BLQA 2ZGHA 4O3UA 1BDAA 1QB6A 2B5TB 2XXLA 1S81A 4A1TA 1WOFA 4A6LA 3DUXH 3GCTG 3Q77A 1O5CB 1CT0E 2AGEX 5DP9A 1NZQH 1A46H 4A5TS 1GI3A 3BTHE 4E7NA 1SFIA 1ANDA 3SORA 1AN1E 1SGNE 4AFSA 4H4FA 1C2EA 1O3EA 3VGCB 1FI8A 3IITA 2QGRA 1O3JA 1QBVH 4LZ4B 1CT2E 1O5AB 3SU6A 4BXWA 1O35A 1O2QA 5FPTA 1A7SA 2WV4A 3P92A 4Y8ZA 3D65E 4NG9H 1SMFE 2PUQH 5DP5A 1TQ7B 2V3HH 4Y8XA 3E6PH 3RXMA 3RXOA 1KYNA 3MNSA 1XX9A 3UY9A 2ZPRA 1PPZA 4B71A 2XCFA 4MNYA 2IJOB 1HAVB 5FX5A 4AG2A 3FP6E 5I25A 4A7IB 1EXFA 1O3HA 3ATKA 4X0WU 1MMJN 1O5DH 3SJ8A 1O3IA 4NA9H 4GVUA 2TGTA 3AAVA 3UUZA 5C2ZA 3UWIA 3AAUA 2AMPA 1BITA 2ZP0H 1NFYA 5ETXA 2AEIH 2P16A 2Z3CA 4Y79A 3RXKA 2QN5T 1O3MA 1HV7A 1BRBE 1UMAH 1V2TT 1MUEB 2SGPE 2BLOA 3ATIA 3A89A 3URDA 3EDXB 1VCPA 1TNLA 3EYDA 1W11U 2HRVA 1BZXE 3NZIA 3U9AH 3SU0A 1SOZA 3NUMA 3SV6A 4B76A 2BQ7B 3M5NA 1P2OA 1EPTA 4D7FA 3PB1E 1A5GH 3LKWA 1MZDA 1UK2A 2IN2A 5F8ZA 3PMBB 4TWWA 2F9OA 3CENA 1FAKH 1CHGA 1O3KA 1L1GA 1V2VT 3LH1A 3D62A 1SHYA 2BD8A 5JBAS 1KXBA 1AUJA 3EA7A 4CHAC 3V0XA 2ZDNA 1NRSH 1BTYA 1QTFA 2R2MB 1ESAA 4YO9A 1MTUA 3SHCH 1WAYB 4K3JA 3ZZDA 5DKMA 5CMXH 2ZA5A 1G3BA 3M7QA 2JH0D 4ISLA 2BDHA 1ZSJA 4RN6A 5DPAA 1ZSLA 1C1TA 3O8CA 1YPHC 3M3TA 1LHCH 3P6ZB 1M9UA 3JZ2B 5JDUB 1DWDH 1WU1A 1C5UA 1ZHMA 4GCHG 1CE5A 2OLGA 2OQUA 2IOTA 4K1EA 4Y0YE 1FN6A 1UTKA 1A0LA 1XXFA 1Z71A 3UQOA 3SJOA 2H9TH 4WWYA 1ZZZA 1GDUA 1OSSA 4GSOA 2J94A 1KY9A 2FIRH 1NRNH 1CBWC 1CU1A 1W7XH 4IN1A 5DGJA 1Y59T 1INCA 2Z9KA 4FUEA 3RXFA 1V2QT 1G3CA 4J2YB 3MO6A 1VR1H 3RC4A 4K1SA 4ZMAH 2G00A 2J38A 3SJ9A 2B9LA 2VU8E 5DK1A 3Q3KA 3GY4A 4AGJA 1C2LA 1QQUA 1C5RA 1BTXA 2PKAB 1FN8A 1DSTA 2Z3EA 4UFDH 1K22H 4UD9H 1NY22 4X6MA 1P01A 3P8FA 1O2RA 3TJOA 1S5SA 3AW0A 2VNTA 3HKIB 3PO1C 2F83A 1UCYH 1W0YH 1N6XA 1NM6A 1YLDA 2ASUB 4JK5A 2QV1A 4LXBH 4ABFA 3LDXH 3K65B 2QY0B 2FO9A 1TONA 4RKJB 2Z6BD 5FCKA 3GCTF 2Y81A 1SGEE 4U01A 1P0SH 2PKSC 4ABHA 4OS4A 1DVAH 4IMZA 3ZVGA 4CHAB 1V2NT 2Q6GA 1J16A 3SQHE 1Z8IB 2VWLA 1ELCA 5DP6A 3SGQE 1ZR0A 4CRFA 1JIMA 1HXEH 1CT4E 2XWAA 4B1TA 4CBOA 4MNWA 2V6NA 4FU7A 4GUXA 5DP8A 3TK6A 3QGNB 3PLKA 2ZGBH 1O33A 1WBGB 1SQTA 1F0RA 1F5RA 4BANB 3TH2H 6ESTA 4HFPB 2C8ZB 1AZZA 4ABGA 1GL0E 2Q1JA 1S82A 1G36A 1O31A 1O3GA 3GDVA 1LHDH 1EOLA 1UVUH 2BLWA 1FPHH 5EPNA 4X1SU 1OOKB 1DXWA 1P2KA 3QTOH 4TPYA 1ZRKA 1BJVA 3D23A 3RXHA 1XKBC 1N6YA 1ABJH 3QWCH 1H8DH 1A61H 1YP9A 1BTZA 1UVSH 2CMYA 2ESTE 1B7XB 1NN6A 1XUFA 4LK4A 2A31A 1OS8A 2UUJB 3OU0A 1C4Y2 1MTWA 3RM0H 1HXFH 2FOFA 1P3EA 1KXFA 4NIXA 4Y71A 3VB3A 2R2WU 6LPRA 1BT7A 1MCTA 4X1RU 5C5OA 3OYPA 3SUFA 5JBCS 1GBAA 4NWLA 1C1SA 1SGFG 2GDEH 1WYKA 3DD2H 4AFZA 2WPLS 1WQSA 1AHTH 1ZGIA 5GIBA 1RJXB 3TGKE 1VJ9U 1BIOA 5EPYA 2SGQE 1Z1JA 3PO1B 2J92A 4XOJA 3RMNH 3PMHB 3HKJB 2K1QA 1MBQA 2Y80A 1W12U 2XBVA 2FI4E 2R3YA 1BRAA 4A1XA 1OYTH 4UEHH 4AYVB 4Y0ZE 1Z6EA 1UTMA 3RXEA 2H2ZA 1XM1A 1O34A 2QC2A 1Y5BT 1K1IA 2FTLE 2YOLA 2Y7XA 1DX5M 1SG8B 2GV7A 3MYWA 3UREA 5GJ4B 1QY6A 3TNSA 4NSVA 3PM3A 1KDQB 1CA0C 1UO6A 1CGHA 1LDTT 2HNTC 1HLTH 2VB0A 1GBEA 3DT0H 2WUCA 2HPPH 2ZO3H 1P2IA 3HGNA 3P70B 1BMAA 2W5EA 1SLVB 1PPCE 2G8TA 4K1TA 4K8BA 1ELFA 4SGAE 3UTUH 1EB2A 2FEQH 1QURH 1EPTC 1YPJH 2ZHEH 2BTCE 2BVSH 3SW2B 1Z8RA 3F9EA 3ZV9A 1YKTA 1SGQE 1N8OB 5DG6A 2JKHA 3A7VA 1F2SE 2ZHQH 3A83A 1RRKA 1DLEA 1FJSA 4ESTE 3EAJA 2AFQB 2WINI 5GXPA 3M3SA 1YF4A 1XVMA 2H9HA 2LPRA 4K69A 4MNVA 1RTLA 1O5EH 1ETSH 1S83A 1C1RA 1ZSKA 4I8KA 2FODA 2FDAA 1AB9C 1NU7B 1HAXB 1LVMA 3ATWA 3D49H 3BTGE 2HWLB 4E06H 4Q7XA 3E0NB 2PWXA 1W8BH 2A4RA 1C9TA 1LQDB 4H6TA 3TPIZ 1GI8B 2OQ5A 2ZFFH 1E36B 2C8XB 5PTPA 4I31A 2YNBA 2FOAA 4DVAU 4AN7A 4TWYA 1LHGH 2GTBA 2RA0A 1P10A 4OS1A 3UQVA 2A0QB 1IQNA 1O5FH 1OX1A 1D4PB 3UNQA 3FAOA 1SOTA 5C67A 1GI0A 2BX3A 1D6WA 4AOQA 3BIUH 1GG6B 3MU1A 1S6FA 3ZZ6A 5E8EH 1IQLA 1KSNA 4NIWA 2FI5E 2UUFB 3M5OA 4U30A 1UTOA 1HAIH 1W3CA 1FDPA 2P8OC 1CVWH 1P05A 1GBJA 1RTFB 1ZPBA 1G3EA 3MH5A 1T7CA 4ISOA 3BTKE 3UNRA 7LPRA 3QUMP 3LJJA 1UTLM 1CA0B 2EEKA 5TJXA 1C5LH 3E91A 4YM9A 3L33A 5HYOA 3UFAA 3T5FH 3VGCC 3A7YA 4TPIZ 1ELBA 2ZTZA 5G4BA 3PROA 3T26A 2ZDAH 4A1VA 4KGAA 2BDAA 1FZZA 2GGVB 3V12A 1H4WA 3V7TA 4CR5A 3CS0A 3QZQA 1YC0A 3HK6B 1EPTB 2ZIQH 4H42U 4UE7H 3SI4H 2ZF0H 1BJUA 3GOVB 1EZUC 1TNKA 2H5CA 1TBQH 1GBFA 2P59A 1CHOG 1K1PA 4J1YA 1GJ5H 3A84A 1KLTA 1C2FA 5F8XA 1P11E 1Z6JH 4AYYB 1UTQA 4MLFB 1O3PB 3A7TA 2WV5A 1EAWA 2ZDLA 3A8DA 1ZRBA 3FZDA 1K1LA 3SU4A 2STAE 3NCLA 1NESE 5HMAA 4ABDA 2H5DA 1BOQA 3ZVCA 2PUXB 4YESB 3ZV8A 4MNXA 5SGAE 1AB9B 2RG3A 3F9GA 2FI3E 1KLIH 1JOUB 5HXFA 1VZQH 3K9XB 3GCHB 5FXLA 5ABWA 4OGYA 4XE4A 3MU0A 3TIUA 1PJPA 5DP7A 4D9RA 1DWEH 2HGTH 1RS0A 3SUEA 1G2MA 5C1XA 4JYTA 4DY7B 4CRGA 3ZYEA 1TALA 1TX7A 3RXBA 2HLCA 2A45B 1YLCA 2ZC9H 1ZTKA 1ZTLA 3M7TA 1F7ZA 3F6UH 1W13U 1AWFH 3ITIA 1F5LA 3LGIA 2QF0A 1OWIA 3HGPA 3KQEA 1O5BB 3GY7A 1BRUP 3RU4T 5FCRA 1Z8GA 1BRCE 2ZNKH 2ANKH 2P95A 1QL7A 2Q6DA 2XC5A 2AMDA 4A92A 1GI2A 3SU2A 3ZZ8A 4AX9H 1AUTC 4FUGA 4MPXA 3QO6A 3ZVBA 1EQ9A 4IC5A 1GDQA 5EQQA 1SGFA 3EE0B 3SNAA 4ZKOU 3MMGA 3TK5A 2SFAA 4ZKSU 3UOPA 1QIXB 2BY6X 1DUAA 1P57B 3KIDU 2G5VA 4IGDA 1O2IA 4XBBA 2OC7A 1ACBE 2NWNA 4FXGH 1IQFA 1AD8H 1BHXF 3ZVEA 1DFPA 1W7GH 3ENSB 1AVGH 5C5NA 5FPYA 1Y3WA 1AFQC 1H1BA 3BTDE 3ZZ9A 1YPLH 2V0BA 1EAUA 1GJ9B 1O2OA 4DJZB 1LKBA 2UUYA 1O2WA 1ETRH 1GHVH 2WPHS 2AIPA 2CHAC 1QB1A 1ETTH 1BQYA 4DT7B 2ZU1A 3SGBE 4CRBA 1XMNB 3TITA 1P3CA 1THSH 4IN2A 2BB4A 2I6QA 1JMOH 4KP0A 3T29A 1N1LA 5JYIA 1DLKB 2SNVA 5A0BA 1K2I1 1TPSA 1DOJA 1MKXK 1D3QB 2WPMS 3PMAB 5C1YA 1U6QA 1IOEA 3M5LA 1CO7E 3BN9A 1WCZA 2BD7A 1QFKH 2J34A 2B7DH 1EASA 1Y3YA 2VH0A 3MTYA 2BOHB 1FV9A 1NRPH 1O3BA 4Y10E 2ZPQA 4ZKNU 4DGJA 1QJ1B 5AHGH 3EQ0H 4PROA 4TY6A 3GY2A 1H9LB 1ZLRA 4WMDA 2AYWA 8KME2 3MFJA 2AGGX 1O2VA 3ODDA 3TJUA 2IPHA 5H4IB 2ANWA 3RXSA 1VCQA 1EUFA 1A3EH 1YPEH 1S0RA 2H6MA 2PSXA 3E90B 3GY3A 2XYAA 3OY5U 2D1JA 3S9CA 4H6SB 3M36A 1QA0A 1O3OA 3U98H 1GDNA 1O2MA 3UOUA 5FPSA 3F9FA 1BA8B 2ZTYA 1V2KT 2EI6A 2VIPA 3KEEA 3UNSA 8ESTE 1LQEA 1KIGH 3S9BA 1F0SA 2AH4X 2FM2A 1Z7KA 1SGDE 3MHWU 2Y5FA 4MG3A 5C20A 2J9NA 2BDYA 1OKXA 2R9PA 2VWNA 2C3SA 5T3HA 3MWIU 3K6ZA 1O2GH 1CHOF 1FNIA 1HJAC 1O2TA 1PQ7A 2A4OA 3GCOA 1A5HA 5DP4A 2CF9H 5F6MA 1TNGA 3BTQE 2GT7A 1HAOH 5BRRE 5DP3A 1PQ5A 3KHVA 2HPQH 1ZHRA 4F4OC 2VH6A 2H9EH 4YZUA 4FUBA 1AFQB 4YOIA 4BNRA 4YT7H 2WUBA 3BG4B 1IQHA 4FVDA 1A3BH 2F9UA 2VWOA 4GHQA 5I46H 3M5MA 2UUKB 1F0TA 1GVKB 1XUGA 3MNXA 1ZMLA 1EP6A 4GPGA 1GHXH 1Z8JB 2CHAB 7GCHF 3TK9A 2CJIA 2TRMA 2J4IA 1TAWA 1NPMA 1DSUA 1O3AA 3PTNA 4MQAA 1RTKA 4FUJA 1O2PA 1S0QA 2SGFE 3MH6A 3VPKA 3SNCA 1SHHB 4Q7YA 2DUCA 3FFGA 3RC5A 1TA6A 1D6RA 1HAPH 1P8VC 1GHWH 2PSYA 4JZ1A 1PYTD 4JMYA 1SL3A 1QGFA 1HGTH 1GI7B 1TQ0B 2ZHWH 2Z3DA 2FMJA 1RD3B 4X6OA 4ZHAA 4DIIH 4O03A 4Q7ZA 2Z7FE 3QK1A 1ZJKA 1V2OT 1BBRH 1THPB 2F9BH 3PMJA 4ABEA 1OWJA 2FS8A 3L6PA 2OC0A 3O8BA 4Y76A 1BTWA 2JETB 1TNJA 2P3UB 2PLXA 1D9IA 2D2DA 1LVOA 1L4ZA 2ZZUH 5ESTE 4ISIH 4FUIA 1A4WH 1GMCG 1NFXA 1SI5H 1GI5A 2C8WB 4I8LA 1IQKA 2A4GA 4MDSA 3TH3H 3S9AA 4X8TH 2QF3A 2F91A 2QYIA 1UJ1A 1C5QA 2ZTXA 1DY8A 4CRCA 2OP9A 1O2SA 1ARBA 2FYRA 1EZXC 1AE5A 2ANYA 3UIRA 1SQAA 1AVWA 4BAOB 3I78A 1V2RT 2FOEA 3K6YA 3OY6U 5T6FA 2ZU4A 1QA7A 3SBKA 1P12E 1HUTH 1C5MD 1YCPM 2A5AA 3BEUA 1BUIA 2ZDVH 1HJAB 1QRWA 1C5YB 2EI8A 2NU3E 1HIAA 4K60A 1N8OC 2GCHG 4LZ1H 1J8AA 1K28D 3Q00A 3OTJE 4KTCA 1UVPA 1KTTB 1E37B 2R3UA 2ZGJA 1T31A 2QAAA 2SGAA 4Y7BA 1T32A 1O39A 3MO9A 4ZXYH 1O2ZA 3ODFA 2ZHFH 1GBBA 2GV6A 3SO3A 1O3CA 2CN0H 1ID5H 4O9VA 2ZI2H 1P9SA 1BTUA 3Q3XA 2GZ9A 1JXPA 3QZRA 2XNIA 1LVBA 1E35B 4INLA 4UDWH 1LPZB 5AVDA 4CRAA 4DURA 4MPVA 2ZCKP 1D3TB 3RDZA 3SN8A 2TBSA 3L3TA 3MO3A 1JRTA 4TYDA 1GJBB 1UTNA 3RXLA 2ODYB 2UWOA 3MU4A 1BBRK 1UCYK 4FUFA 2ZU5A 1ESBA 3LPRA 1DXPA 5JB9S 5LPFA 4DIHH 3RLWH 4AFUA 1S6HA 1YPHE 3VEQB 1CA8B 1QRXA 4XDEA 2ZPSA 2BY9X 1TBZH 1EP5A 2ULLA 5B6OA 1E38B 3HATH 2YNAA 1V2ST 3A7XA 1H8IH 2G81E 4HZHA 1GG6C 4VGCB 3I77A 1V2WT 4OS7A 2BDCA 1BMLA 3AVZA 3FVFB 3PV4A 3PTBA 1K21H 4FU9A 4RKOB 1GI1A 1GL1A 4WH8A 3M35A 1KXCA 1V2PT 1Q3XA 3A87A 1IAUA 2Z9GA 3ZZ3A 2O8WA 1P02A 5F03A 1G2LA 4BAMB 2WPKS 3BTWE 1MBMA 1QNJA 2A5IA 2G4UA 3SV7A 1O5GH 2D26C 1TMBH 2VVCA 1ARCA 4IC6A 2FOBA 4FUHA 2BZAA 1AKSA 1ZTJA 5EOKA 3A80A 1TE0A 1ZHPA 1UHBA 1TBRH 3U8TH 3SGAE 1MTNC 5GDSH 4LOYH 3BF6H 1KTSB 1T8LA 1RXPA 5FBIA 1L1JA 1EB1H 4Y6DA 4I8GA 1G32B 1DUEA 2GP9B 4AFQA 3TJNA 5E0JA 3W94A 2FOMB 1ZGVA 4WMEA 4YLQH 4WMFA 2TGDA 2RA3A 1ZOMA 2DE8A 3NPSA 1GMHG 4AORA 2Y82A 2FS9A 2KAIA 3FZZA 2BZ6H 1L1NA 4UFGH 1SGYE 3BSQA 1O36A 1Y8TA 4B2AA 2VWMA 1O2NA 9ESTA 3P95A 1RFNA 3JZ1B 2Y5HA 1LMWB 1J15A 1WV7H 4U2WA 3SOSA 2Z9IA 3RXPA 3G01A 3T27A 5EQRA 4BTUB 5BPEA 2BY5X 3TNTA 1SLUB 2W26A 2GCTC 1LO6A 5LPEA 5JBTA 1ZYOA 4NSYA 2VVUA 1C5NH 1AZ8A 1ZJDA 1P04A 3LU9B 1ANEA 4YTAA 4MVNA 4IBLH 1Z1IA 2ODPA 1TNHA 1VITG 3B9FH 3GCHC 2CXVA 1BTHH 3STJA 1FIZA 1EJMA 5LH8A 5EW1H 1A2CH 2BX4A 1O32A 1OWEA 4JZEH 3MU8A 2SNWA 1GMCF 4X2VA 1T8MA 1QHRB 1IQGA 1GJ7B 1MU6B 1RGQA 1THRH 2PW8H 1WTHD 1SR5C 2BYAX 1XUJA 3MOCA 5J4QA 1C2GA 1MD8A 5T6GA 1WTGH 2EC9H 1UTPA 1HAYB 3RMLH 4IW4E 1YBWA 1ORFA 2F3CE 1UTJA 1HYLA 1TA2A 2W3KA 1LHFH 1BCUH 3QDZB 5EG4A 4YT6H 3S7HB 1QL8A 1GBIA 1HNEE 2W3IA 5TCAA 1IQMA 1AE8H 1DDJA 1ESTA 3SHAH 3A88A 1GGDC 2BHGA 4X2XA 3F68H 2V35A 4BTIB 2GDDA 1C2KA 1JIRA 2NU1E 1MTNB 1T4VH 4CH2B 2GCHF 1GJ6A 1GJAB 1K1JA 2O9QA 1AO5A 3ATMA 3LGTA 2V3OH 5F8TA 1BHXB 2WYJA 1BMMH 3F9HA 2GT8A 1G30B 1YCPH 4M7GA 3WY8A 1EJNA 1C5SA 3P8GA 2A1DB 2OD3B 3EA8A 3RLYH 4ABBA 2QXJA 3MU5A 4X1QU 2OCVB 4ABJA 2BVXH 1H9HE 3SNDA 1TGNA 2AIQA 2XBWA 3A82A 1GBKA 3KCGH 1C5XB 2FWWA 4Y8YA 1F0UA 1L2EA 1LHEH 3Q3YA 1V6DA 3T28A 3TLOA 5JBBS 1SC8U 1O38A 3P17H 2ZU3A 3BTEE 3RU4E 4D76A 1F5KU 4X8UH 1QRZA 2GCTB 3GCNA 4OGXA 4CR9A 3GYMA 4UONA 4XSKU 3PWBA 1O2JA 2RCEA 1GBHA 2A32A 2CV3A 3LH3A 5AF9H 1GI6A 2SGDE 1PFXC 5FHTA 2THFB 1TFXA 2Z9LA 3M37A 4D8NA 3DA9B 2TGAA 2HNTE 3H5CB 7GCHG 1AWHB 2TGPZ 1YYY1 2BD2A 1ELDE 2SGEE 4B2BA 4I33A 1O3NA 2TIOA 3W95A 2BOKA 1C9PA 2FOGA 3NXPA 2XRCA 3RXUA 4BAKB 2OXSA 4X6NA 3GYLB 4I8JA 7KMEH 3GDSA 1KXEA 1GCTB 1LVYA 2G51A 1C2HA 5AFYH 1TMTH 3U8RH 1SVPA 1Q2WA 4O97A 3U8OH 1V2JT 1P9UA 2P3TB 1TRYA 4WVPE 2HALA 1VGCB 2ZDMA 5FAHA 1J14A 2C93B 3NWUA 2PTNA 2ODQA 1TRMA 2BVRH 5EGMA 5E2PA 2HOBA 4FU8A 1FMGA 1TB6H 1GHZA 1ABIH 1YGCH 1T4UH 2VIWA 2PHBA 5A8XA 1S84A 1GGDB 1OWKA 3MI4A 5EQSA 4GAWA 4WY3A 1GMHF 2W7SA 1GJ8B 3VB7A 1NO9H 3A8AA 5ESBA 1ZPZA 3GY5A 2ILNA 4UFFH 3GY6A 3LC5A 1O37A 2ZU2A 3KL6A 1A1RA 1TX8A 1TGSZ 2OBQA 3M3VA 3IG6B 4NCYA 2OTVA 4D7GA 2PFEA 1P03A 4FUDA 2P3FH 5L30H 1FY3A 1ELGA 5A2MH 1JRSA 3BG4C 4K8YA 1WUNH 2FESH 1XKAC 2ZGXH 4HGCA 3KNXA 1OYQA 1Q31A 3ZZAA 6GCHG 5HGGA 4I7YH 1HDTH 2HNTF 2BDGA 1UVOA 1FQ3A 1VITF 2A7CA 3F1SB 2GMTC 4THNH 5HM9A 1S85A 2QXHA 3RXIA 2ZCLP 1TGBA 1GI9B 1K1NA 3H7OA 4BOHA 3S69A 5CHAC 1TLDA 3A85A 1C1VH 4IS5A 4ISHH 1RIWB 3SNBA 4OS2A 1C5VA 1L0ZA 2VIDA 3P8OA 5EXMA 2ZFRH 2A5KA 1HIAB 2C4FH 2EI7A 3RXAA 4YLUA 3VB5A 5JB8S 1GPZA 4XBDA 3LT3A 2NU2E 3ATLA 1FONA 2WPIS 4X1NU 1QJ7B 3HK3B 4JZFH 2ZG0H 2JETC 3RUOA 1EJAA 2GKVE 1BB0B 3BEIB 1PPHE 5T6DA 1IQEA 5E0HA 1ZMNA 1EOJA 1QQ4A 3A86A 2ZFPH 1AI8H 3DFJA 1EZQA 4NWKA 3LGYA 2A7HA 2C90B 2GZ7A 5GWZA 2AGIX 3SUDA 1IHTH 1HBTH 4I8HA 3SNEA 1FUJA 1L4DA 3FP7E 1HAZB 4WXVA 1XUIA 2VGCC 2PTCE 3A81A 3U1IB 2P94A 2XTTB 1C1NA 5L2ZH 2F9NA 4X8VH 1V2UT 3GISB 3EGKH 3BIVH 5C3NA 1HPGA 4AZ2B 1K1OA 1SLXB 4DG4A 3P8NA 1C5ZB 1B0EA 4X8SH 2O8LA 1K9OE 2VJ1A 3BTFE 1GHBF 4SGBE 4ZAEA 1WSSH 4O3TA 4FUCA 1GBLA 1SGIB 2BMGB 2VIOA 5E0GA 4K2YA 1B5GH 1GJ4H 2Y7ZA 3I29A 4X6PA 2ZFTA 4NA8A 4B74A 3O8DA 2AERH 4NIVA 4AB8A 1KXDA 4RSPA 1MD7A 2G55A 7ESTE 4MPUA 1VJAU 1GHYH 3FP8E 4AGKA 3VFEA 4KTUA 1DITH 3TVJB 5A8ZA 2FTMA 3E3TA 2O8TA 1AFEH 4ZKRU 5A09A 1AVXA 2FXRA 2FP7B 1DWBH 1EAIA 4Q2KA 4QT8C 3DHKH 3S0NA 1A0JA 4ABIA 1O2UA 2XBXA 1AKSB 3C1KA 2PGQB 1UHBB 5HM2A 2A2XH 4ZROA 2GMTB 3RMOH 3UWJH 1TABE 4BXSA 1C1UH 2VIQA 3Q76A 2BD4A 1VCWA 1NT1A 4KELA 5LGOA 2BDBA 3LC3A 5CHAB 3LJOA 3SZNA 2A7JA 5EU8A 1C5OH 3RXDA 1PQAA 3SV2H 1NU9A 1FIWA 3ZVDA 1YPMH 4D9QA 3MNBA 2OC8A 4WH6A 1DS2E 3U1JB 3TH4H 1X7AC 1TYNA 4U32A 2KAIB 1F92A 3TJVA 2WPJS 1LPGB 1OPHB 2PGBB 3SI3H 1QB9A 1O3FA 4VGCC 3VXFH 3CP7A 1MCVA 1HAGE 5A0CA 1QJ6B 1FY5A 1PPFE 2VVVA 2FOHA 3R3GB 1Y3UA 1C5TA 1GBCA 3PLPA 3E1XB 1TOMH 2BD9A 3MH4A 4WXIA 2ZQ1A 3RXRA 1O2LA 3BEFB 8GCHG 1GJCB 2F9VA 2ALVA 3A8CA 2OUAA 2VINA 3AW1A 3SJIA 1NFUA 2UWPA 1AU8A 2J2UA 2B8OH 4ASHA 2G5NA 1EKBB 2ZEBA 5GCHG 5K7RA 2OBOA 4YOJA 3SUGA 2VGCB 3MH7A 1HCGA 1O2YA 2ALPA 2BXUH 4AG1A 1HB0B 2OC1A 3B23B 3LONA 4AB9A 3NKKA 2QIQA 1G9IE 1KLJH 3RC6A 2EA3A 3ELAH 1Y5UT 4CREA 2JH6D 1HRTH 1XUHA 3B8JA 1O2KA 3R0FA 1HAVA 2FZZA 1SGPE 3PYHA 2J95A 2ZKSA 3HPTB 3RXCA 4X1PU 2TPIZ 1O3DA 2JH5D 2NU4E 1G3DA 2M5TA 1C5WB 3RU4D 6GCHF 1ANCA 1TGCA 3K2UA 3LIWA 2O8MA 1ZPCA 1O3LA 3M61U 5EXNA 3IWMA 1NFWA 1T8OA 3E0PB 1TPPA 1E0FD 3RXGA 3RXJA 1BTPA 5J4SA 1MQ5A 1MAXA 2ZECA 8LPRA 3A7ZA 1FY1A 1KXAA 1OWHA 2FLBH 1NS3A 3E8LA 3PLBA 1OP8A 1EATA 1GHAG 3TU7H 1TGTA 1UVTH 3NK8A 1B0FA 4KTSA 1UK4A 1DM4B 3E16B 1SPJA 4ZXXH 1ELTA 2BXTH 4JZDH 4UFEH 1GMDG 1O0DH 1FPCH 2Q6FA 1SSXA 2QXIA 1PYTC 3SU1A 4BAHB 2XW9A 4JK6A 3FANA 1V2MT 2BQWB 3SV9A 1CBWB 2O8UA 4YOGA 5LPRA 4NGAH 3QGJA 1D3DB 1GBMA 1EX3A 1YM0A 4E7RG 1E34B 1GBTA 1TMUH 4CRDA 4KKDA 1NROH 1XXDA 4JCNA 1ELVA 2AMQA 3ZZ7A 4ISNA 3BTME 2BD5A 3QTVH 4NIYA 3T2NA 4X2YA 1XUKA 3GICB 1SBWA 5A8YA 3SJKA 1NC6A 3A7WA 1ZMJA 1WQVH 1IQIA 1C4U2 2WYGA 3BTTE 2XWBI 3ZVAA 1BBRE 1UCYE 2QCYA 1IHSH 2UWLA 4GHTA 1W0ZU 2A2QH 2FX4A 1C1WH 1C1PA 1LKAA 4GLYA 4ZHMU 3UR9A 1GWAA 2XC0A 3GY8A 2FPZA 3LOXA 5JPMH 5IYTA 4Q80A 2Z94A 4HTCH 3SU5A 3ZZBA 1J17T 3TGJE 4F49A 3RMMH 1FAXA 1XVOA 1C2IA 1FXYA 1O2HA 2BY7X 1QCPA 1TPAE 3LGWA 3TGIE 4CH8B 1YPGH 1H9IE 1O2XA 1C4V2 1FLEE 1OP2A 1SGTA 1A0HB 4B73A 2PKSB 3O8RA 1HJ8A 4WJG2 1PPBH 5DJ7A 3T62A 5EW2H 1G37A 4R0IA 3SQEE 3EA9A 2LNCA 1TIOA 1DICA 2ZQ2A 1HJ9A 1PPEE 1HAHH 4GCHF 3SU3A 3RM2H 3ZZ5A 1GJDB 1BMNH 1P2JA 1SGCA 4R8TB 5K0HA 1P2QA 2D8WA 2PKAA 1V3XA 5E2OA 3V13A 1O30A 3KQDA 1NRQH 2BLVA 2Y6TA 1MAYA 1ELAA 6CHAC 3KQBA 1AGJA 5CE1A 1TX6A 2ZFQH 2H1UA 5C1UA 3QN7A 4JYVH 1P06A 2I6SA 3H7TA 1NTPA 1MQ6A 1P2NA 4JZIA 1TOCB 3LGUA 4B75A 2ZHDA 3RXVA 1C5PA 2Z9JA 4I32A 4NZQA 1A5IA 3STIA 3UR6A 1VITH 4B2CA 2AS9A 1W14U 2RDLA 1JWTA 1CGJE 1TRNA 3GDUA 2W7UA 1AY6H 2FOCA 1MH0A 1C1MA 1SFQB 2STBE 1GVZA 1GCDA 4FVBA 2XCNA 2QA9E 1TNIA 5EXLA 1UK3A 5TCCA 4MPWA 3M7UA 1GCTC 8GCHF 1MKWH 2P93A 3ESTA 3S7KB 1Y3VA 1CGIE 1LCYA 5GCHF 2OINA 3BV9B 1VGCC 4NA7A 1C2MA 2GX4A 3OX7U 3ZYDA 1CQQA 4ZH8A 3VB4A 4Z6AH 3KQCA 1DY9A 1LTOA 4DOQA 3N7OA 1Y5AT 2R0KA 4HI3A 2BQ6B 4DCDA 2BY8X 3ZZ4A 2ZGCA 3ZZCA 1DANH 1MU8B 3KN2A 1QBNA 1HFDA 3VXEH 5L2YH 1QBOA 2F9PA 3URCA 1C2DA 2FLRH 2B0FA 2G52A 3V3MA 1ELEE 4XFQA 3U69H 5DO4H 4OS5A 5FBEA 3PWCA 2G4TA 1MTSA 4JYUH 1EZSC 2GD4B 1TPOA 5EODA 3KF2A 4ZUHA 3ZVFA 1QR3E 1OXGA 1QL9A 1GHBG 3OSYA 1SQOA 3DFLA 1GHAF 1P09A 1SB1H 1LPKB 1SLWB 4INHA 5FX6A 4BAQB 2A4QA 1GMDF 2QXGA 4X2WA 3RP2A 2C8YB 1C2JA 1EAXA 1W2KH 1Y3XA 2ANMH 2NU0E 6CHAB 1CSOE 3UPEA 1C1OA 4Y11E 4K5ZA 2BDIA 3VB6A 1K1MA 1OP0A 3SV8A 1RIWC 1TWXB 3T25A 1P2MA 1AMHA 4BTTB 4E05H 2XBYA 2ZCHP 4WF8A 2VIVA 2CGAA 1MKWK
chains in the Genus database with same CATH superfamily
4NFFA 4OS6A 4ABAA 1V2LT 1T8NA 1SGRE 4Z0KA 1YPKH 2BD3A 4IMQA 1NRRH 5A0AE 9LPRA 1MTVA 3F2HA 3A8BA 3BG8A 2Y5GA 1MZAA 1GI4A 3MNCA 3QLPH 1C1QA 5GPIB 1W10U 1YLNA 1DT2A 2V3MA 2GZ8A 2PV9B 1PPGE 2XC4A 4MTBA 5L6NH 2FYQA 2DE9A 1KDQA 3LGVA 4NZLA 3RXTA 1J9CH 1D3PB 4TY7A 3SZEA 1WDIA 3KGPA 3AASA 4XBCA 1FY8E 4CBNA 1IQJA 3QX5H 4ZHLU 2CF8H 4Y7AA 1GVLA 5HKKD 3C27B 1MKXH 1JBUH 3RXQA 1PQ8A 2ZDKA 1GBDA 3CS7A 4INKA 4DW2U 1AIXH 1YCPK 1NBME 2ZWLH 1DE7H 3VG8A 4NFEA 1FY4A 1MABB 1DPOA 2ZFSA 5AFZH 2GVFA 2HVXA 1DWCH 1OWDA 2FX6A 1ANBA 2P8OB 1AQ7A 2R0LA 2PR3A 5IDKA 2BM2A 2BLQA 2ZGHA 4O3UA 1BDAA 1QB6A 2B5TB 2XXLA 2YMSB 1S81A 4A1TA 1WOFA 4A6LA 3DUXH 3GCTG 3Q77A 1O5CB 1CT0E 2AGEX 5DP9A 1NZQH 1A46H 4A5TS 1GI3A 3BTHE 4E7NA 1SFIA 1ANDA 3SORA 3U28C 1AN1E 1SGNE 4AFSA 3AK5A 4H4FA 1K0HA 1C2EA 1O3EA 3VGCB 1FI8A 3IITA 2QGRA 1O3JA 1QBVH 4LZ4B 2K0QA 1CT2E 1O5AB 3SU6A 4BXWA 1O35A 3F2GA 1O2QA 5FPTA 1A7SA 2WV4A 3P92A 4Y8ZA 3D65E 4NG9H 1SMFE 2PUQH 5DP5A 1TQ7B 2V3HH 4Y8XA 3E6PH 3RXMA 3RXOA 1KYNA 3MNSA 1XX9A 3UY9A 2ZPRA 1PPZA 4B71A 2XCFA 4MNYA 2IJOB 1HAVB 5FX5A 4AG2A 3FP6E 5I25A 4A7IB 1EXFA 1O3HA 3ATKA 4X0WU 1MMJN 1O5DH 3SJ8A 1O3IA 4NA9H 4GVUA 2TGTA 3AAVA 3UUZA 5C2ZA 2VBCA 3UWIA 3AAUA 2AMPA 1BITA 2ZP0H 1NFYA 5ETXA 2AEIH 2P16A 2Z3CA 4Y79A 3RXKA 2QN5T 1O3MA 1HV7A 1BRBE 1UMAH 1V2TT 1MUEB 2SGPE 2BLOA 3ATIA 3A89A 3URDA 3EDXB 1VCPA 1TNLA 3EYDA 1W11U 2HRVA 1BZXE 3NZIA 3U9AH 3SU0A 1SOZA 3NUMA 3SV6A 4ACAA 4B76A 2BQ7B 3M5NA 1P2OA 1EPTA 4D7FA 2WZQA 3PB1E 1A5GH 3LKWA 1MZDA 1UK2A 2IN2A 5F8ZA 3PMBB 4TWWA 2F9OA 3CENA 4ZCNA 1FAKH 1CHGA 1O3KA 1L1GA 1V2VT 3LH1A 3D62A 1SHYA 2BD8A 5JBAS 1KXBA 1AUJA 3OTPA 3EA7A 4CHAC 3V0XA 2ZDNA 1NRSH 1BTYA 1QTFA 2R2MB 1ESAA 4YO9A 1MTUA 3SHCH 1WAYB 4K3JA 3ZZDA 2QE7D 5DKMA 5CMXH 3UAIC 2ZA5A 1G3BA 3M7QA 2JH0D 4ISLA 2BDHA 1ZSJA 4RN6A 5DPAA 1ZSLA 1C1TA 3O8CA 1YPHC 3M3TA 1LHCH 3P6ZB 1M9UA 3JZ2B 5JDUB 5FL7D 1DWDH 1WU1A 1C5UA 1ZHMA 4GCHG 1CE5A 2OLGA 3DCLA 2OQUA 2IOTA 4K1EA 4Y0YE 1FN6A 1UTKA 1A0LA 1XXFA 1Z71A 3UQOA 2WHXA 3SJOA 2H9TH 4WWYA 1ZZZA 1GDUA 1OSSA 4GSOA 3DSGA 2J94A 1KY9A 2FIRH 1NRNH 1CBWC 1CU1A 1W7XH 4IN1A 5DGJA 1Y59T 1SQRA 1INCA 2Z9KA 4FUEA 3RXFA 1V2QT 1G3CA 4J2YB 3MO6A 1VR1H 3RC4A 4K1SA 4ZMAH 1KMHB 2G00A 2J38A 2B9LA 2VU8E 5DK1A 3SJ9A 3PV5A 3Q3KA 3GY4A 4AGJA 1C2LA 1QQUA 1C5RA 1BTXA 2PKAB 1FN8A 1DSTA 2Z3EA 4FETA 4UFDH 1K22H 4UD9H 1NY22 4X6MA 1P01A 3P8FA 1O2RA 3TJOA 1S5SA 3AW0A 3OEED 2VNTA 3HKIB 3PO1C 2F83A 1UCYH 1W0YH 1N6XA 1NM6A 1YLDA 2ASUB 4JK5A 2QV1A 4LXBH 4ABFA 3LDXH 3K65B 2QY0B 2FO9A 1BMFD 1TONA 4RKJB 4P00A 2Z6BD 5FCKA 3GCTF 2Y81A 1SGEE 4U01A 3WW7A 1P0SH 2PKSC 3UB0A 4ABHA 4OS4A 1DVAH 4IMZA 3ZVGA 4CHAB 1V2NT 2Q6GA 1J16A 3SQHE 1Z8IB 2VWLA 1ELCA 5DP6A 3SGQE 1ZR0A 4CRFA 1JIMA 1HXEH 1CT4E 2XWAA 4B1TA 4CBOA 4MNWA 2V6NA 4FU7A 4GUXA 5DP8A 3TK6A 3QGNB 3PLKA 2ZGBH 1O33A 1WBGB 1SQTA 1F0RA 1F5RA 4BANB 3TH2H 6ESTA 4HFPB 2C8ZB 1AZZA 2W6ID 4ABGA 5B6LA 1GL0E 2Q1JA 1S82A 1G36A 1O31A 1O3GA 3GDVA 1LHDH 1EOLA 4M9FA 1UVUH 2BLWA 1FPHH 5EPNA 4X1SU 1OOKB 1DXWA 1P2KA 3QTOH 4TPYA 1ZRKA 1BJVA 3D23A 3RXHA 1XKBC 1N6YA 1ABJH 3QWCH 5EJLA 4Q63A 1H8DH 1A61H 1YP9A 1BTZA 1UVSH 2CMYA 2ESTE 2J98B 1B7XB 1NN6A 1XUFA 4LK4A 2A31A 1OS8A 2UUJB 3OU0A 1C4Y2 1MTWA 3RM0H 1HXFH 2FOFA 1P3EA 1KXFA 4NIXA 4Y71A 3VB3A 2R2WU 6LPRA 1BT7A 1MCTA 1NBMD 4X1RU 5C5OA 3OYPA 3SUFA 5JBCS 1GBAA 4NWLA 1C1SA 1SGFG 2GDEH 1WYKA 3DD2H 4AFZA 2WPLS 1WQSA 1AHTH 1ZGIA 5GIBA 1RJXB 3TGKE 1VJ9U 1BIOA 5EPYA 2SGQE 1Z1JA 3PO1B 2J92A 4XOJA 3RMNH 3PMHB 2V7QD 3HKJB 2K1QA 1MBQA 2Y80A 1W12U 2XBVA 2FI4E 2R3YA 1BRAA 4A1XA 1OYTH 4UEHH 4AYVB 4Y0ZE 1Z6EA 1UTMA 3RXEA 2H2ZA 1XM1A 1O34A 2QC2A 1Y5BT 1K1IA 2FTLE 2YOLA 2Y7XA 1DX5M 1SG8B 2GV7A 5T1VA 3MYWA 3UREA 5GJ4B 1QY6A 3TNSA 4NSVA 3PM3A 5KEDA 2CK3D 1KDQB 1CA0C 1UO6A 3F0OA 1CGHA 1LDTT 2HNTC 1HLTH 2VB0A 1GBEA 3DT0H 2WUCA 2HPPH 2ZO3H 1P2IA 3HGNA 3P70B 1BMAA 2W5EA 1SLVB 1PPCE 2G8TA 4K1TA 4K8BA 1ELFA 4SGAE 3UTUH 1EB2A 2FEQH 1QURH 1EPTC 1YPJH 2ZHEH 2BTCE 5KECA 2BVSH 3SW2B 1Z8RA 3SYJA 3F9EA 3ZV9A 1YKTA 1SGQE 1N8OB 5DG6A 2JKHA 3A7VA 1F2SE 2ZHQH 3A83A 1RRKA 1DLEA 1FJSA 4ESTE 3EAJA 2AFQB 2WINI 5GXPA 3M3SA 1YF4A 1XVMA 2H9HA 2LPRA 4K69A 4MNVA 1RTLA 1O5EH 1ETSH 1S83A 1C1RA 4HG6A 1ZSKA 4I8KA 2FODA 2FDAA 1AB9C 1NU7B 1HAXB 1LVMA 3ATWA 3D49H 3BTGE 2HWLB 4E06H 4Q7XA 3E0NB 2AHME 2PWXA 1W8BH 2A4RA 1C9TA 1LQDB 4H6TA 3TPIZ 1GI8B 2OQ5A 2ZFFH 1E36B 2C8XB 5PTPA 4I31A 2YNBA 2FOAA 2LP6A 4AN7A 4DVAU 4TWYA 1LHGH 2GTBA 2RA0A 1P10A 4OS1A 3UQVA 2A0QB 1IQNA 1O5FH 1OX1A 1D4PB 3UNQA 3FAOA 1SOTA 5C67A 1GI0A 2BX3A 1D6WA 4AOQA 3BIUH 1GG6B 3MU1A 4P02A 2OK5A 1S6FA 3ZZ6A 5E8EH 1IQLA 1KSNA 4NIWA 2FI5E 2UUFB 3M5OA 4U30A 1UTOA 1HAIH 1W3CA 1FDPA 2P8OC 1CVWH 1P05A 1GBJA 1RTFB 1ZPBA 1G3EA 3MH5A 5CDFE 1T7CA 4ISOA 3BTKE 3UNRA 7LPRA 3DSOA 3QUMP 3LJJA 1UTLM 1CA0B 2EEKA 5TJXA 1C5LH 3E91A 4YM9A 3L33A 5HYOA 3UFAA 3T5FH 3VGCC 3A7YA 4TPIZ 1ELBA 2ZTZA 5G4BA 3PROA 3T26A 2ZDAH 4A1VA 4KGAA 2BDAA 1FZZA 2GGVB 3V12A 1H4WA 3V7TA 4CR5A 3CS0A 3F2FA 3QZQA 1YC0A 3HK6B 1EPTB 4TSFD 2ZIQH 4H42U 4UE7H 3SI4H 2ZF0H 1BJUA 3GOVB 1EZUC 1TNKA 2H5CA 1TBQH 1GBFA 2P59A 1CHOG 1K1PA 3KYGA 4J1YA 1GJ5H 3A84A 1KLTA 1C2FA 5F8XA 1P11E 1Z6JH 4AYYB 1UTQA 4MLFB 1O3PB 3A7TA 2WV5A 1E79D 1EAWA 2JDID 2ZDLA 3A8DA 1ZRBA 3FZDA 1K1LA 3SU4A 2STAE 3NCLA 1NESE 5HMAA 4ABDA 2H5DA 1BOQA 3ZVCA 2PUXB 4YESB 2JIZD 3ZV8A 4MNXA 5SGAE 3NRLA 1AB9B 2RG3A 3F9GA 2FI3E 1KLIH 1JOUB 5HXFA 1VZQH 3K9XB 3GCHB 5FXLA 5ABWA 4OGYA 4XE4A 3MU0A 3TIUA 1PJPA 5DP7A 4D9RA 1DWEH 2HGTH 1RS0A 3SUEA 1G2MA 5C1XA 4JYTA 4DY7B 4CRGA 3ZYEA 1TALA 1TX7A 3RXBA 2HLCA 2A45B 1YLCA 2ZC9H 1ZTKA 1ZTLA 3M7TA 1F7ZA 3F6UH 4F55A 1W13U 1AWFH 3ITIA 1F5LA 3LGIA 2RFKC 2QF0A 1OWIA 3HGPA 2KCPA 3KQEA 1O5BB 3GY7A 1BRUP 3RU4T 5FCRA 1Z8GA 1BRCE 2ZNKH 2ANKH 2J5UA 2P95A 1QL7A 2Q6DA 2XC5A 3FN8A 2AMDA 4A92A 1GI2A 4F48B 3SU2A 3ZZ8A 4AX9H 1AUTC 4FUGA 4MPXA 3QO6A 3ZVBA 1EQ9A 4IC5A 1GDQA 5EQQA 1SGFA 3EE0B 3SNAA 4ZKOU 3MMGA 3TK5A 1YY3A 2SFAA 4ZKSU 3UOPA 1QIXB 2BY6X 1DUAA 1P57B 3KIDU 2G5VA 4IGDA 1O2IA 4XBBA 2OC7A 1ACBE 2NWNA 3KQ5A 4FXGH 1IQFA 1AD8H 1BHXF 3ZVEA 1DFPA 1W7GH 3ENSB 1AVGH 5C5NA 5FPYA 1Y3WA 1AFQC 1H1BA 3BTDE 3ZZ9A 1YPLH 2V0BA 1EAUA 1GJ9B 1O2OA 5C0TA 4DJZB 1LKBA 2UUYA 1O2WA 1ETRH 1GHVH 2WPHS 2AIPA 2CHAC 1QB1A 1ETTH 1YWUA 1BQYA 4DT7B 2ZU1A 3SGBE 4CRBA 4RI0A 1XMNB 3TITA 1P3CA 1THSH 4IN2A 2BB4A 2I6QA 1JMOH 4KP0A 3T29A 1N1LA 5JYIA 1DLKB 2SNVA 1E1RD 5A0BA 1K2I1 1TPSA 1DOJA 1MKXK 1D3QB 2WPMS 3PMAB 5C1YA 1U6QA 1IOEA 3M5LA 1CO7E 3BN9A 1WCZA 2BD7A 1QFKH 2J34A 2B7DH 1EASA 1Y3YA 2VH0A 3MTYA 2BOHB 1FV9A 1NRPH 2KM0A 1O3BA 4Y10E 2ZPQA 4ZKNU 4DGJA 1QJ1B 5AHGH 3EQ0H 4PROA 4TY6A 3GY2A 1H9LB 1ZLRA 4WMDA 2AYWA 8KME2 3MFJA 2AGGX 1O2VA 3ODDA 3TJUA 2IPHA 5H4IB 2ANWA 3RXSA 1VCQA 1EUFA 1A3EH 1YPEH 1S0RA 2H6MA 2PSXA 3E90B 5HIZA 3GY3A 2XYAA 3OY5U 2D1JA 3S9CA 4H6SB 3M36A 1QA0A 1O3OA 3U98H 1GDNA 1O2MA 3UOUA 5FPSA 3F9FA 1BA8B 2ZTYA 1V2KT 2EI6A 2VIPA 3KEEA 3UNSA 8ESTE 1LQEA 1KIGH 3S9BA 1F0SA 2AH4X 3W1EA 2FM2A 1Z7KA 1SGDE 3MHWU 2Y5FA 4MG3A 5C20A 2J9NA 2BDYA 1OKXA 2R9PA 2VWNA 2C3SA 5T3HA 3MWIU 3K6ZA 1O2GH 1CHOF 1FNIA 1HJAC 1O2TA 1PQ7A 2A4OA 3GCOA 1A5HA 5DP4A 2CF9H 5F6MA 1TNGA 3BTQE 2GT7A 1HAOH 5BRRE 5DP3A 1PQ5A 3KHVA 2HPQH 1ZHRA 2KX4A 4F4OC 2VH6A 2H9EH 4YZUA 4FUBA 1AFQB 4YOIA 4BNRA 4YT7H 2WUBA 3BG4B 1IQHA 4FVDA 1A3BH 2F9UA 2VWOA 4GHQA 5I46H 3M5MA 2UUKB 1F0TA 1GVKB 1XUGA 3MNXA 1ZMLA 1EP6A 4GPGA 1GHXH 2WV9A 1Z8JB 2CHAB 7GCHF 3TK9A 2CJIA 2TRMA 2J4IA 1TAWA 1NPMA 1DSUA 1O3AA 3PTNA 4MQAA 1RTKA 4FUJA 1O2PA 1S0QA 2SGFE 3DSPA 3MH6A 3VPKA 3SNCA 3OE7D 1SHHB 4Q7YA 2GJGA 2DUCA 3FFGA 3RC5A 1TA6A 1D6RA 1HAPH 1P8VC 1GHWH 2PSYA 4JZ1A 1PYTD 4JMYA 1SL3A 1QGFA 1HGTH 1GI7B 1TQ0B 2ZHWH 5EJ1A 2Z3DA 2FMJA 3F0PA 1RD3B 5CHBA 4X6OA 4ZHAA 4DIIH 4O03A 4Q7ZA 2Z7FE 3QK1A 1ZJKA 1V2OT 1BBRH 1THPB 2F9BH 3PMJA 4ABEA 1OWJA 2FS8A 3L6PA 2OC0A 3O8BA 4Y76A 1BTWA 2JETB 4I86A 1TNJA 2P3UB 2PLXA 1D9IA 2D2DA 1LVOA 1L4ZA 2ZZUH 2F4LA 5ESTE 4ISIH 4FUIA 1A4WH 1GMCG 1NFXA 1SI5H 1GI5A 2C8WB 4I8LA 1IQKA 2A4GA 4MDSA 3TH3H 3S9AA 4X8TH 2QF3A 2F91A 5C94A 2QYIA 1UJ1A 1C5QA 2ZTXA 1DY8A 4CRCA 4B6EA 2KCAA 2OP9A 1O2SA 1ARBA 2FYRA 1EZXC 1AE5A 2ANYA 4OM9A 3UIRA 1SQAA 1AVWA 4BAOB 3I78A 1V2RT 2FOEA 3K6YA 3OY6U 5T6FA 2ZU4A 1QA7A 3SBKA 1P12E 2KFWA 1HUTH 1C5MD 1YCPM 2A5AA 3BEUA 1BUIA 2ZDVH 1HJAB 1QRWA 1C5YB 2EI8A 2NU3E 1HIAA 4K60A 1N8OC 2GCHG 4LZ1H 1J8AA 1K28D 3Q00A 3OTJE 3FO8D 4KTCA 1UVPA 1KTTB 1E37B 2R3UA 2ZGJA 1T31A 2QAAA 2SGAA 4Y7BA 1T32A 1O39A 3MO9A 4ZXYH 1O2ZA 3ODFA 2ZHFH 1GBBA 2GV6A 3SO3A 1O3CA 4RT1A 2CN0H 3MQKC 1ID5H 4O9VA 2ZI2H 2EQNA 1P9SA 1BTUA 3Q3XA 2GZ9A 1JXPA 3QZRA 2XNIA 1LVBA 1E35B 4INLA 4UDWH 1LPZB 5AVDA 3WWFA 4CRAA 4DURA 4MPVA 2ZCKP 1D3TB 3RDZA 3SN8A 2TBSA 3L3TA 3MO3A 1JRTA 4TYDA 1GJBB 1UTNA 3RXLA 2ODYB 2UWOA 3MU4A 1BBRK 1UCYK 4FUFA 2ZU5A 1ESBA 3LPRA 1DXPA 5JB9S 2K8IA 5LPFA 4DIHH 3RLWH 4AFUA 1S6HA 1YPHE 3VEQB 1CA8B 1QRXA 4XDEA 2ZPSA 2BY9X 1TBZH 1EP5A 2ULLA 5B6OA 1E38B 3HATH 2YNAA 1V2ST 3A7XA 1H8IH 2G81E 2WPDD 4HZHA 1GG6C 4VGCB 3I77A 1V2WT 4OS7A 2BDCA 1BMLA 3AVZA 3FVFB 3PV4A 3PTBA 1K21H 4FU9A 4RKOB 1GI1A 1GL1A 4WH8A 4XRNA 3M35A 1KXCA 1V2PT 1Q3XA 3A87A 1IAUA 2Z9GA 3ZZ3A 2O8WA 1P02A 5F03A 1G2LA 4BAMB 2WPKS 3BTWE 1MBMA 1QNJA 2A5IA 2G4UA 3PRDA 3SV7A 1O5GH 2D26C 1TMBH 2VVCA 1ARCA 3FKSD 4IC6A 2FOBA 4FUHA 2BZAA 2KCOA 1AKSA 1ZTJA 5EOKA 3A80A 1TE0A 1ZHPA 1UHBA 1TBRH 3U8TH 3SGAE 1MTNC 5GDSH 4LOYH 3BF6H 1KTSB 1T8LA 1RXPA 5FBIA 3EE7A 1L1JA 1EB1H 4Y6DA 4I8GA 1G32B 1DUEA 2GP9B 4AFQA 3TJNA 5E0JA 3W94A 2FOMB 1ZGVA 4WMEA 4YLQH 4WMFA 2TGDA 2RA3A 1ZOMA 2DE8A 3NPSA 1GMHG 4AORA 2Y82A 2YMSD 2FS9A 2KAIA 3FZZA 2BZ6H 1L1NA 4UFGH 1SGYE 3BSQA 1O36A 1Y8TA 4B2AA 2VWMA 1O2NA 9ESTA 3P95A 1RFNA 3JZ1B 2Y5HA 1LMWB 1J15A 1WV7H 4U2WA 3SOSA 2Z9IA 3RXPA 3G01A 3T27A 5EQRA 4BTUB 5BPEA 2BY5X 2PP6A 3TNTA 1SLUB 2W26A 2GCTC 1LO6A 5LPEA 5JBTA 1ZYOA 4NSYA 2VVUA 1C5NH 1AZ8A 1ZJDA 1P04A 3LU9B 1ANEA 4YTAA 4MVNA 4IBLH 1Z1IA 2ODPA 1TNHA 1VITG 3B9FH 3GCHC 2CXVA 1BTHH 3STJA 1FIZA 1EJMA 5LH8A 5EW1H 1A2CH 2BX4A 1O32A 1OWEA 4JZEH 3MU8A 2SNWA 1GMCF 4X2VA 1T8MA 1QHRB 1IQGA 1GJ7B 1MU6B 1RGQA 1THRH 2PW8H 4DT4A 1WTHD 1SR5C 2BYAX 1XUJA 3MOCA 5J4QA 1C2GA 1MD8A 5T6GA 1WTGH 2EC9H 2HVYB 1UTPA 1HAYB 3RMLH 4IW4E 1YBWA 1ORFA 2F3CE 1UTJA 1HYLA 1TA2A 2W3KA 1LHFH 1BCUH 3QDZB 5EG4A 4YT6H 3S7HB 1QL8A 1GBIA 1HNEE 2W3IA 5TCAA 1IQMA 1AE8H 1DDJA 1ESTA 3SHAH 3A88A 1GGDC 2BHGA 4X2XA 3F68H 2V35A 2J97A 4BTIB 2GDDA 1C2KA 1JIRA 2NU1E 1MTNB 1T4VH 4CH2B 2GCHF 1GJ6A 1GJAB 1K1JA 2O9QA 1AO5A 3ATMA 3LGTA 2V3OH 5F8TA 1BHXB 2WYJA 1BMMH 3F9HA 2GT8A 1G30B 1YCPH 4M7GA 3WY8A 1EJNA 1C5SA 3P8GA 2A1DB 2OD3B 3EA8A 3RLYH 4ASUD 4ABBA 2QXJA 3MU5A 4X1QU 2OCVB 4ABJA 2BVXH 1H9HE 3SNDA 1TGNA 2AIQA 2XBWA 3A82A 1GBKA 3KCGH 1C5XB 2FWWA 4Y8YA 1VKYA 1F0UA 1L2EA 1LHEH 1QZ8A 3Q3YA 1V6DA 3T28A 3TLOA 5JBBS 1SC8U 1O38A 3P17H 2ZU3A 3BTEE 3RU4E 4D76A 1F5KU 4X8UH 1QRZA 2GCTB 3GCNA 4OGXA 4CR9A 3GYMA 4UONA 4XSKU 3PWBA 1O2JA 2RCEA 1GBHA 2A32A 2CV3A 3LH3A 5AF9H 1GI6A 2SGDE 1PFXC 5FHTA 2THFB 1TFXA 2Z9LA 3M37A 4D8NA 3DA9B 2TGAA 2HNTE 3H5CB 7GCHG 1AWHB 2TGPZ 1YYY1 2BD2A 1ELDE 1FX0B 2SGEE 4B2BA 5C17A 4I33A 1O3NA 2TIOA 3W95A 2BOKA 1C9PA 2FOGA 3NXPA 2XRCA 3RXUA 4BAKB 2OXSA 4X6NA 3GYLB 4I8JA 3ZIAD 7KMEH 3GDSA 1KXEA 1GCTB 1LVYA 2G51A 1C2HA 5AFYH 1TMTH 3U8RH 3N99A 1SVPA 1Q2WA 4O97A 3U8OH 1V2JT 1P9UA 2P3TB 1TRYA 4WVPE 2HALA 3F3BA 1VGCB 2ZDMA 5FAHA 1J14A 2C93B 3NWUA 2PTNA 2ODQA 1TRMA 2BVRH 5EGMA 5E2PA 2HOBA 4FU8A 2W6JD 1FMGA 1TB6H 1GHZA 1ABIH 1YGCH 1T4UH 2VIWA 2PHBA 5A8XA 1W0KD 1S84A 2LELA 1GGDB 1OWKA 3MI4A 3PRBA 5EQSA 4GAWA 4WY3A 1GMHF 2W7SA 1GJ8B 3VB7A 1NO9H 3A8AA 5ESBA 1ZPZA 5DSFA 3GY5A 2XOKD 2ILNA 4UFFH 3GY6A 3LC5A 1O37A 2ZU2A 3KL6A 1A1RA 1TX8A 1TGSZ 4XD7D 3OAAD 2OBQA 3M3VA 3IG6B 4NCYA 2OTVA 4D7GA 2PFEA 1P03A 4FUDA 2P3FH 5L30H 1FY3A 1E1QD 1ELGA 5A2MH 1JRSA 3BG4C 4K8YA 1WUNH 2FESH 1XKAC 2ZGXH 4HGCA 3KNXA 1OYQA 1Q31A 4Q4LA 3ZZAA 6GCHG 5HGGA 4I7YH 1HDTH 2HNTF 2BDGA 1UVOA 4FOUC 1FQ3A 1VITF 2WSSD 2A7CA 3F1SB 2GMTC 1OHHD 3FOAA 4THNH 5HM9A 1S85A 2QXHA 3RXIA 2ZCLP 1TGBA 1GI9B 1K1NA 2IPQX 3H7OA 4BOHA 3S69A 5CHAC 1TLDA 3A85A 1C1VH 4IS5A 3OFND 4ISHH 1RIWB 3SNBA 4OS2A 1C5VA 1L0ZA 2VIDA 3P8OA 5EXMA 2ZFRH 2A5KA 1HIAB 2C4FH 2EI7A 3RXAA 4YLUA 3VB5A 5JB8S 1GPZA 4XBDA 3LT3A 2NU2E 3ATLA 1FONA 2WPIS 4X1NU 1QJ7B 3HK3B 4JZFH 2ZG0H 2JETC 3RUOA 1EJAA 2GKVE 1BB0B 3BEIB 1PPHE 5T6DA 3H09A 1IQEA 5E0HA 1EFRD 1ZMNA 1EOJA 1QQ4A 2JJ1D 3A86A 2ZFPH 1AI8H 3DFJA 1EZQA 4NWKA 3LGYA 2A7HA 2C90B 2GZ7A 5GWZA 2AGIX 3SUDA 1IHTH 1HBTH 4I8HA 3SNEA 1FUJA 1L4DA 3FP7E 1HAZB 4WXVA 1XUIA 2VGCC 2PTCE 3A81A 3U1IB 2P94A 2XTTB 1C1NA 5L2ZH 2F9NA 4X8VH 1S6LA 1V2UT 4TT3D 3GISB 3EGKH 3BIVH 5C3NA 1HPGA 4AZ2B 1K1OA 1SLXB 4DG4A 3P8NA 1C5ZB 1B0EA 4X8SH 2O8LA 1K9OE 2VJ1A 3BTFE 1GHBF 4SGBE 4ZAEA 1WSSH 4O3TA 4FUCA 1GBLA 1SGIB 2BMGB 2VIOA 5E0GA 4K2YA 1B5GH 1GJ4H 2Y7ZA 3I29A 4X6PA 2ZFTA 4NA8A 4B74A 3O8DA 2AERH 4NIVA 2QF5A 4AB8A 1KXDA 4RSPA 1MD7A 2G55A 7ESTE 4MPUA 1VJAU 1GHYH 3FP8E 4AGKA 3VFEA 4KTUA 1DITH 3TVJB 5A8ZA 2FTMA 3E3TA 2O8TA 1AFEH 4ZKRU 5A09A 1AVXA 2FXRA 2KZ4A 2FP7B 1DWBH 1EAIA 4Q2KA 4QT8C 3DHKH 3S0NA 1A0JA 4ABIA 1O2UA 2XBXA 1AKSB 3C1KA 2PGQB 1UHBB 5HM2A 2A2XH 4ZROA 2GMTB 3RMOH 3UWJH 1TABE 4BXSA 1C1UH 2VIQA 3Q76A 2BD4A 1VCWA 1NT1A 4KELA 5LGOA 2BDBA 3LC3A 5CHAB 3LJOA 5DN6D 3SZNA 2A7JA 5EU8A 1C5OH 3RXDA 1PQAA 3SV2H 5EIYA 1NU9A 1FIWA 3ZVDA 1YPMH 4D9QA 3MNBA 2OC8A 4WH6A 1DS2E 3U1JB 3TH4H 1X7AC 1TYNA 4U32A 2KAIB 1F92A 3TJVA 2WPJS 1LPGB 1OPHB 2PGBB 3SI3H 1QB9A 1O3FA 4VGCC 3VXFH 3CP7A 1MCVA 1HAGE 5C0UA 5A0CA 1QJ6B 1FY5A 1PPFE 2VVVA 2FOHA 3R3GB 1Y3UA 3N7EA 1C5TA 1GBCA 3PLPA 3E1XB 1TOMH 2BD9A 3MH4A 4WXIA 2ZQ1A 3RXRA 1O2LA 3BEFB 8GCHG 1GJCB 2F9VA 2ALVA 3A8CA 2OUAA 2VINA 3AW1A 3SJIA 1NFUA 2UWPA 1AU8A 2J2UA 2B8OH 4ASHA 2G5NA 1EKBB 2ZEBA 5GCHG 5K7RA 2OBOA 4YOJA 3SUGA 2VGCB 3MH7A 1HCGA 1O2YA 2ALPA 2BXUH 4AG1A 1HB0B 2OC1A 3B23B 3LONA 3WWBA 4AB9A 3NKKA 2QIQA 1G9IE 1KLJH 3RC6A 2EA3A 3ELAH 1Y5UT 4CREA 2JH6D 1HRTH 1XUHA 2KCYA 3B8JA 1O2KA 3R0FA 1HAVA 2FZZA 1SGPE 3PYHA 2J95A 2ZKSA 3HPTB 3RXCA 4X1PU 2TPIZ 1O3DA 2JH5D 2NU4E 1G3DA 2M5TA 1C5WB 3RU4D 6GCHF 1ANCA 1TGCA 3K2UA 3LIWA 2O8MA 1ZPCA 1O3LA 3M61U 5GNDA 5EXNA 3IWMA 1NFWA 1T8OA 1H8HD 3E0PB 1TPPA 1E0FD 3RXGA 3RXJA 1BTPA 5J4SA 1MQ5A 1MAXA 2ZECA 8LPRA 3A7ZA 1FY1A 1KXAA 1OWHA 2FLBH 1NS3A 3E8LA 3PLBA 1OP8A 1EATA 1GHAG 3TU7H 1TGTA 1UVTH 3NK8A 2HLDD 1B0FA 4KTSA 1UK4A 1DM4B 3E16B 1SPJA 4ZXXH 1ELTA 2BXTH 4JZDH 4UFEH 1GMDG 1O0DH 2QF4A 1FPCH 2Q6FA 1SSXA 2QXIA 1PYTC 3SU1A 4BAHB 1WXRA 2XW9A 4JK6A 3FANA 3CNRA 1V2MT 2BQWB 3SV9A 1CBWB 2O8UA 2L6OA 4YOGA 5LPRA 2F43B 4NGAH 3QGJA 1D3DB 1GBMA 1EX3A 2IJD1 1YM0A 4E7RG 1E34B 1GBTA 1TMUH 4CRDA 4KKDA 1NROH 1XXDA 4JCNA 1ELVA 2AMQA 3ZZ7A 4ISNA 3BTME 2BD5A 3QTVH 4NIYA 3T2NA 4X2YA 1XUKA 3GICB 1SBWA 5A8YA 3SJKA 1NC6A 3A7WA 1W0JD 1ZMJA 1WQVH 1IQIA 1C4U2 2WYGA 3N7DA 3BTTE 2XWBI 3ZVAA 1BBRE 1UCYE 2QCYA 1IHSH 2UWLA 3GS9A 4GHTA 2M2AA 1W0ZU 2A2QH 2FX4A 1C1WH 1C1PA 1LKAA 4GLYA 4ZHMU 3UR9A 1GWAA 2XC0A 3GY8A 2FPZA 3LOXA 4AC9A 5JPMH 5IYTA 4Q80A 2Z94A 3PV2A 4HTCH 3SU5A 1J17T 3ZZBA 4B6FA 3TGJE 4F49A 3RMMH 1FAXA 1XVOA 1C2IA 1FXYA 1O2HA 2BY7X 1QCPA 1TPAE 3LGWA 3TGIE 4CH8B 1YPGH 1H9IE 1O2XA 1C4V2 1FLEE 1OP2A 1SGTA 1A0HB 4B73A 2PKSB 3O8RA 1HJ8A 4WJG2 1PPBH 5DJ7A 3T62A 5F53A 5EW2H 1G37A 4R0IA 3SQEE 3EA9A 2LNCA 1TIOA 1DICA 2ZQ2A 1HJ9A 1PPEE 1HAHH 4GCHF 3SU3A 3RM2H 3ZZ5A 1GJDB 1BMNH 1P2JA 1SGCA 4R8TB 5K0HA 1P2QA 4ACBA 2D8WA 2PKAA 1V3XA 5E2OA 3V13A 1O30A 3KQDA 1NRQH 2BLVA 2Y6TA 1MAYA 1ELAA 6CHAC 3KQBA 1AGJA 5CE1A 1TX6A 2ZFQH 2H1UA 5C1UA 3QN7A 4JYVH 1P06A 1H8ED 2I6SA 1COWD 3H7TA 5EJZA 1NTPA 5KGOA 1MQ6A 1P2NA 4JZIA 1TOCB 3LGUA 4B75A 2ZHDA 3RXVA 1C5PA 2Z9JA 1SKYE 4I32A 4NZQA 1A5IA 3STIA 3UR6A 1VITH 4B2CA 2AS9A 1W14U 2RDLA 1JWTA 1CGJE 1TRNA 3GDUA 2W7UA 1AY6H 2FOCA 1MH0A 1C1MA 1SFQB 2STBE 3KYFA 1GVZA 1GCDA 3OEHD 2XCNA 2QA9E 4FVBA 1TNIA 5EXLA 1UK3A 5TCCA 4MPWA 3M7UA 1GCTC 8GCHF 1MKWH 2P93A 3ESTA 3S7KB 1Y3VA 1CGIE 1LCYA 2KR7A 5GCHF 2OINA 3BV9B 1VGCC 4NA7A 1C2MA 2GX4A 3OX7U 3ZYDA 1CQQA 4ZH8A 3VB4A 4Z6AH 3KQCA 1DY9A 1LTOA 4DOQA 3N7OA 1Y5AT 2R0KA 4HI3A 2BQ6B 4DCDA 2BY8X 2XNDD 3ZZ4A 5IK2D 2ZGCA 3ZZCA 1DANH 1MU8B 3KN2A 1QBNA 1HFDA 3VXEH 5L2YH 1QBOA 2F9PA 3URCA 4YXWD 1C2DA 2FLRH 2B0FA 2G52A 3V3MA 1ELEE 4XFQA 3U69H 5DO4H 4OS5A 5FBEA 3PWCA 2L74A 2YMSC 2G4TA 1MTSA 4JYUH 1EZSC 2JJ2D 2GD4B 2RDEA 1TPOA 5EODA 3KF2A 4ZUHA 3ZVFA 1QR3E 4RT0A 1OXGA 2J98A 5HIYA 1QL9A 1GHBG 3OSYA 1SQOA 3DFLA 1GHAF 1P09A 1SB1H 1LPKB 1SLWB 4INHA 5FX6A 4BAQB 2A4QA 4Z1MD 1GMDF 2QXGA 4X2WA 3RP2A 2C8YB 1C2JA 1EAXA 1W2KH 1Y3XA 2ANMH 2NU0E 6CHAB 1CSOE 3UPEA 1UW7A 1C1OA 4Y11E 4K5ZA 2BDIA 3VB6A 1K1MA 1OP0A 2EY4C 3SV8A 1RIWC 1TWXB 3T25A 1P2MA 1AMHA 4BTTB 4E05H 2XBYA 2ZCHP 4WF8A 2VIVA 2CGAA 1MKWK
chains in the Genus database with same CATH topology
4NFFA 4OS6A 4ABAA 1V2LT 1T8NA 1SGRE 4Z0KA 1YPKH 2BD3A 4IMQA 1NRRH 5A0AE 9LPRA 1MTVA 3A8BA 3BG8A 2Y5GA 1MZAA 1GI4A 3MNCA 3QLPH 1C1QA 5GPIB 1W10U 1DT2A 2GZ8A 2PV9B 1PPGE 2XC4A 4MTBA 5L6NH 2FYQA 2DE9A 1KDQA 3LGVA 4NZLA 3RXTA 1J9CH 1D3PB 4TY7A 3KGPA 3AASA 4XBCA 1FY8E 4CBNA 1IQJA 3QX5H 4ZHLU 2CF8H 4Y7AA 1GVLA 3C27B 1MKXH 1JBUH 3RXQA 1PQ8A 2ZDKA 1GBDA 3CS7A 4INKA 4DW2U 1AIXH 1YCPK 2ZWLH 1DE7H 4NFEA 1FY4A 1DPOA 2ZFSA 5AFZH 2GVFA 2HVXA 1DWCH 1OWDA 2FX6A 1ANBA 2P8OB 1AQ7A 2R0LA 2PR3A 5IDKA 2BM2A 2BLQA 2ZGHA 4O3UA 1BDAA 1QB6A 2B5TB 2XXLA 1S81A 4A1TA 1WOFA 4A6LA 3DUXH 3GCTG 3Q77A 1O5CB 1CT0E 2AGEX 5DP9A 1NZQH 1A46H 4A5TS 1GI3A 3BTHE 4E7NA 1SFIA 1ANDA 3SORA 1AN1E 1SGNE 4AFSA 4H4FA 1C2EA 1O3EA 3VGCB 1FI8A 3IITA 2QGRA 1O3JA 1QBVH 4LZ4B 1CT2E 1O5AB 3SU6A 4BXWA 1O35A 1O2QA 5FPTA 1A7SA 2WV4A 3P92A 4Y8ZA 3D65E 4NG9H 1SMFE 2PUQH 5DP5A 1TQ7B 2V3HH 4Y8XA 3E6PH 3RXMA 3RXOA 1KYNA 3MNSA 1XX9A 3UY9A 2ZPRA 1PPZA 4B71A 2XCFA 4MNYA 2IJOB 1HAVB 5FX5A 4AG2A 3FP6E 5I25A 4A7IB 1EXFA 1O3HA 3ATKA 4X0WU 1MMJN 1O5DH 3SJ8A 1O3IA 4NA9H 4GVUA 2TGTA 3AAVA 3UUZA 5C2ZA 3UWIA 3AAUA 2AMPA 1BITA 2ZP0H 1NFYA 5ETXA 2AEIH 2P16A 2Z3CA 4Y79A 3RXKA 2QN5T 1O3MA 1HV7A 1BRBE 1UMAH 1V2TT 1MUEB 2SGPE 2BLOA 3ATIA 3A89A 3URDA 3EDXB 1VCPA 1TNLA 3EYDA 1W11U 2HRVA 1BZXE 3NZIA 3U9AH 3SU0A 1SOZA 3NUMA 3SV6A 4B76A 2BQ7B 3M5NA 1P2OA 1EPTA 4D7FA 3PB1E 1A5GH 3LKWA 1MZDA 1UK2A 2IN2A 5F8ZA 3PMBB 4TWWA 2F9OA 3CENA 1FAKH 1CHGA 1O3KA 1L1GA 1V2VT 3LH1A 3D62A 1SHYA 2BD8A 5JBAS 1KXBA 1AUJA 3EA7A 4CHAC 3V0XA 2ZDNA 1NRSH 1BTYA 1QTFA 2R2MB 1ESAA 4YO9A 1MTUA 3SHCH 1WAYB 4K3JA 3ZZDA 5DKMA 5CMXH 2ZA5A 1G3BA 3M7QA 2JH0D 4ISLA 2BDHA 1ZSJA 4RN6A 5DPAA 1ZSLA 1C1TA 3O8CA 1YPHC 3M3TA 1LHCH 3P6ZB 1M9UA 3JZ2B 5JDUB 1DWDH 1WU1A 1C5UA 1ZHMA 4GCHG 1CE5A 2OLGA 2OQUA 2IOTA 4K1EA 4Y0YE 1FN6A 1UTKA 1A0LA 1XXFA 1Z71A 3UQOA 3SJOA 2H9TH 4WWYA 1ZZZA 1GDUA 1OSSA 4GSOA 2J94A 1KY9A 2FIRH 1NRNH 1CBWC 1CU1A 1W7XH 4IN1A 5DGJA 1Y59T 1INCA 2Z9KA 4FUEA 3RXFA 1V2QT 1G3CA 4J2YB 3MO6A 1VR1H 3RC4A 4K1SA 4ZMAH 2G00A 2J38A 3SJ9A 2B9LA 2VU8E 5DK1A 3Q3KA 3GY4A 4AGJA 1C2LA 1QQUA 1C5RA 1BTXA 2PKAB 1FN8A 1DSTA 2Z3EA 4UFDH 1K22H 4UD9H 1NY22 4X6MA 1P01A 3P8FA 1O2RA 3TJOA 1S5SA 3AW0A 2VNTA 3HKIB 3PO1C 2F83A 1UCYH 1W0YH 1N6XA 1NM6A 1YLDA 2ASUB 4JK5A 2QV1A 4LXBH 4ABFA 3LDXH 3K65B 2QY0B 2FO9A 1TONA 4RKJB 2Z6BD 5FCKA 3GCTF 2Y81A 1SGEE 4U01A 1P0SH 2PKSC 4ABHA 4OS4A 1DVAH 4IMZA 3ZVGA 4CHAB 1V2NT 2Q6GA 1J16A 3SQHE 1Z8IB 2VWLA 1ELCA 5DP6A 3SGQE 1ZR0A 4CRFA 1JIMA 1HXEH 1CT4E 2XWAA 4B1TA 4CBOA 4MNWA 2V6NA 4FU7A 4GUXA 5DP8A 3TK6A 3QGNB 3PLKA 2ZGBH 1O33A 1WBGB 1SQTA 1F0RA 1F5RA 4BANB 3TH2H 6ESTA 4HFPB 2C8ZB 1AZZA 4ABGA 1GL0E 2Q1JA 1S82A 1G36A 1O31A 1O3GA 3GDVA 1LHDH 1EOLA 1UVUH 2BLWA 1FPHH 5EPNA 4X1SU 1OOKB 1DXWA 1P2KA 3QTOH 4TPYA 1ZRKA 1BJVA 3D23A 3RXHA 1XKBC 1N6YA 1ABJH 3QWCH 1H8DH 1A61H 1YP9A 1BTZA 1UVSH 2CMYA 2ESTE 1B7XB 1NN6A 1XUFA 4LK4A 2A31A 1OS8A 2UUJB 3OU0A 1C4Y2 1MTWA 3RM0H 1HXFH 2FOFA 1P3EA 1KXFA 4NIXA 4Y71A 3VB3A 2R2WU 6LPRA 1BT7A 1MCTA 4X1RU 5C5OA 3OYPA 3SUFA 5JBCS 1GBAA 4NWLA 1C1SA 1SGFG 2GDEH 1WYKA 3DD2H 4AFZA 2WPLS 1WQSA 1AHTH 1ZGIA 5GIBA 1RJXB 3TGKE 1VJ9U 1BIOA 5EPYA 2SGQE 1Z1JA 3PO1B 2J92A 4XOJA 3RMNH 3PMHB 3HKJB 2K1QA 1MBQA 2Y80A 1W12U 2XBVA 2FI4E 2R3YA 1BRAA 4A1XA 1OYTH 4UEHH 4AYVB 4Y0ZE 1Z6EA 1UTMA 3RXEA 2H2ZA 1XM1A 1O34A 2QC2A 1Y5BT 1K1IA 2FTLE 2YOLA 2Y7XA 1DX5M 1SG8B 2GV7A 3MYWA 3UREA 5GJ4B 1QY6A 3TNSA 4NSVA 3PM3A 1KDQB 1CA0C 1UO6A 1CGHA 1LDTT 2HNTC 1HLTH 2VB0A 1GBEA 3DT0H 2WUCA 2HPPH 2ZO3H 1P2IA 3HGNA 3P70B 1BMAA 2W5EA 1SLVB 1PPCE 2G8TA 4K1TA 4K8BA 1ELFA 4SGAE 3UTUH 1EB2A 2FEQH 1QURH 1EPTC 1YPJH 2ZHEH 2BTCE 2BVSH 3SW2B 1Z8RA 3F9EA 3ZV9A 1YKTA 1SGQE 1N8OB 5DG6A 2JKHA 3A7VA 1F2SE 2ZHQH 3A83A 1RRKA 1DLEA 1FJSA 4ESTE 3EAJA 2AFQB 2WINI 5GXPA 3M3SA 1YF4A 1XVMA 2H9HA 2LPRA 4K69A 4MNVA 1RTLA 1O5EH 1ETSH 1S83A 1C1RA 1ZSKA 4I8KA 2FODA 2FDAA 1AB9C 1NU7B 1HAXB 1LVMA 3ATWA 3D49H 3BTGE 2HWLB 4E06H 4Q7XA 3E0NB 2PWXA 1W8BH 2A4RA 1C9TA 1LQDB 4H6TA 3TPIZ 1GI8B 2OQ5A 2ZFFH 1E36B 2C8XB 5PTPA 4I31A 2YNBA 2FOAA 4DVAU 4AN7A 4TWYA 1LHGH 2GTBA 2RA0A 1P10A 4OS1A 3UQVA 2A0QB 1IQNA 1O5FH 1OX1A 1D4PB 3UNQA 3FAOA 1SOTA 5C67A 1GI0A 2BX3A 1D6WA 4AOQA 3BIUH 1GG6B 3MU1A 1S6FA 3ZZ6A 5E8EH 1IQLA 1KSNA 4NIWA 2FI5E 2UUFB 3M5OA 4U30A 1UTOA 1HAIH 1W3CA 1FDPA 2P8OC 1CVWH 1P05A 1GBJA 1RTFB 1ZPBA 1G3EA 3MH5A 1T7CA 4ISOA 3BTKE 3UNRA 7LPRA 3QUMP 3LJJA 1UTLM 1CA0B 2EEKA 5TJXA 1C5LH 3E91A 4YM9A 3L33A 5HYOA 3UFAA 3T5FH 3VGCC 3A7YA 4TPIZ 1ELBA 2ZTZA 5G4BA 3PROA 3T26A 2ZDAH 4A1VA 4KGAA 2BDAA 1FZZA 2GGVB 3V12A 1H4WA 3V7TA 4CR5A 3CS0A 3QZQA 1YC0A 3HK6B 1EPTB 2ZIQH 4H42U 4UE7H 3SI4H 2ZF0H 1BJUA 3GOVB 1EZUC 1TNKA 2H5CA 1TBQH 1GBFA 2P59A 1CHOG 1K1PA 4J1YA 1GJ5H 3A84A 1KLTA 1C2FA 5F8XA 1P11E 1Z6JH 4AYYB 1UTQA 4MLFB 1O3PB 3A7TA 2WV5A 1EAWA 2ZDLA 3A8DA 1ZRBA 3FZDA 1K1LA 3SU4A 2STAE 3NCLA 1NESE 5HMAA 4ABDA 2H5DA 1BOQA 3ZVCA 2PUXB 4YESB 3ZV8A 4MNXA 5SGAE 1AB9B 2RG3A 3F9GA 2FI3E 1KLIH 1JOUB 5HXFA 1VZQH 3K9XB 3GCHB 5FXLA 5ABWA 4OGYA 4XE4A 3MU0A 3TIUA 1PJPA 5DP7A 4D9RA 1DWEH 2HGTH 1RS0A 3SUEA 1G2MA 5C1XA 4JYTA 4DY7B 4CRGA 3ZYEA 1TALA 1TX7A 3RXBA 2HLCA 2A45B 1YLCA 2ZC9H 1ZTKA 1ZTLA 3M7TA 1F7ZA 3F6UH 1W13U 1AWFH 3ITIA 1F5LA 3LGIA 2QF0A 1OWIA 3HGPA 3KQEA 1O5BB 3GY7A 1BRUP 3RU4T 5FCRA 1Z8GA 1BRCE 2ZNKH 2ANKH 2P95A 1QL7A 2Q6DA 2XC5A 2AMDA 4A92A 1GI2A 3SU2A 3ZZ8A 4AX9H 1AUTC 4FUGA 4MPXA 3QO6A 3ZVBA 1EQ9A 4IC5A 1GDQA 5EQQA 1SGFA 3EE0B 3SNAA 4ZKOU 3MMGA 3TK5A 2SFAA 4ZKSU 3UOPA 1QIXB 2BY6X 1DUAA 1P57B 3KIDU 2G5VA 4IGDA 1O2IA 4XBBA 2OC7A 1ACBE 2NWNA 4FXGH 1IQFA 1AD8H 1BHXF 3ZVEA 1DFPA 1W7GH 3ENSB 1AVGH 5C5NA 5FPYA 1Y3WA 1AFQC 1H1BA 3BTDE 3ZZ9A 1YPLH 2V0BA 1EAUA 1GJ9B 1O2OA 4DJZB 1LKBA 2UUYA 1O2WA 1ETRH 1GHVH 2WPHS 2AIPA 2CHAC 1QB1A 1ETTH 1BQYA 4DT7B 2ZU1A 3SGBE 4CRBA 1XMNB 3TITA 1P3CA 1THSH 4IN2A 2BB4A 2I6QA 1JMOH 4KP0A 3T29A 1N1LA 5JYIA 1DLKB 2SNVA 5A0BA 1K2I1 1TPSA 1DOJA 1MKXK 1D3QB 2WPMS 3PMAB 5C1YA 1U6QA 1IOEA 3M5LA 1CO7E 3BN9A 1WCZA 2BD7A 1QFKH 2J34A 2B7DH 1EASA 1Y3YA 2VH0A 3MTYA 2BOHB 1FV9A 1NRPH 1O3BA 4Y10E 2ZPQA 4ZKNU 4DGJA 1QJ1B 5AHGH 3EQ0H 4PROA 4TY6A 3GY2A 1H9LB 1ZLRA 4WMDA 2AYWA 8KME2 3MFJA 2AGGX 1O2VA 3ODDA 3TJUA 2IPHA 5H4IB 2ANWA 3RXSA 1VCQA 1EUFA 1A3EH 1YPEH 1S0RA 2H6MA 2PSXA 3E90B 3GY3A 2XYAA 3OY5U 2D1JA 3S9CA 4H6SB 3M36A 1QA0A 1O3OA 3U98H 1GDNA 1O2MA 3UOUA 5FPSA 3F9FA 1BA8B 2ZTYA 1V2KT 2EI6A 2VIPA 3KEEA 3UNSA 8ESTE 1LQEA 1KIGH 3S9BA 1F0SA 2AH4X 2FM2A 1Z7KA 1SGDE 3MHWU 2Y5FA 4MG3A 5C20A 2J9NA 2BDYA 1OKXA 2R9PA 2VWNA 2C3SA 5T3HA 3MWIU 3K6ZA 1O2GH 1CHOF 1FNIA 1HJAC 1O2TA 1PQ7A 2A4OA 3GCOA 1A5HA 5DP4A 2CF9H 5F6MA 1TNGA 3BTQE 2GT7A 1HAOH 5BRRE 5DP3A 1PQ5A 3KHVA 2HPQH 1ZHRA 4F4OC 2VH6A 2H9EH 4YZUA 4FUBA 1AFQB 4YOIA 4BNRA 4YT7H 2WUBA 3BG4B 1IQHA 4FVDA 1A3BH 2F9UA 2VWOA 4GHQA 5I46H 3M5MA 2UUKB 1F0TA 1GVKB 1XUGA 3MNXA 1ZMLA 1EP6A 4GPGA 1GHXH 1Z8JB 2CHAB 7GCHF 3TK9A 2CJIA 2TRMA 2J4IA 1TAWA 1NPMA 1DSUA 1O3AA 3PTNA 4MQAA 1RTKA 4FUJA 1O2PA 1S0QA 2SGFE 3MH6A 3VPKA 3SNCA 1SHHB 4Q7YA 2DUCA 3FFGA 3RC5A 1TA6A 1D6RA 1HAPH 1P8VC 1GHWH 2PSYA 4JZ1A 1PYTD 4JMYA 1SL3A 1QGFA 1HGTH 1GI7B 1TQ0B 2ZHWH 2Z3DA 2FMJA 1RD3B 4X6OA 4ZHAA 4DIIH 4O03A 4Q7ZA 2Z7FE 3QK1A 1ZJKA 1V2OT 1BBRH 1THPB 2F9BH 3PMJA 4ABEA 1OWJA 2FS8A 3L6PA 2OC0A 3O8BA 4Y76A 1BTWA 2JETB 1TNJA 2P3UB 2PLXA 1D9IA 2D2DA 1LVOA 1L4ZA 2ZZUH 5ESTE 4ISIH 4FUIA 1A4WH 1GMCG 1NFXA 1SI5H 1GI5A 2C8WB 4I8LA 1IQKA 2A4GA 4MDSA 3TH3H 3S9AA 4X8TH 2QF3A 2F91A 2QYIA 1UJ1A 1C5QA 2ZTXA 1DY8A 4CRCA 2OP9A 1O2SA 1ARBA 2FYRA 1EZXC 1AE5A 2ANYA 3UIRA 1SQAA 1AVWA 4BAOB 3I78A 1V2RT 2FOEA 3K6YA 3OY6U 5T6FA 2ZU4A 1QA7A 3SBKA 1P12E 1HUTH 1C5MD 1YCPM 2A5AA 3BEUA 1BUIA 2ZDVH 1HJAB 1QRWA 1C5YB 2EI8A 2NU3E 1HIAA 4K60A 1N8OC 2GCHG 4LZ1H 1J8AA 1K28D 3Q00A 3OTJE 4KTCA 1UVPA 1KTTB 1E37B 2R3UA 2ZGJA 1T31A 2QAAA 2SGAA 4Y7BA 1T32A 1O39A 3MO9A 4ZXYH 1O2ZA 3ODFA 2ZHFH 1GBBA 2GV6A 3SO3A 1O3CA 2CN0H 1ID5H 4O9VA 2ZI2H 1P9SA