3E0PB

The x-ray structure of human prostasin in complex with a covalent benzoxazole inhibitor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
246
structure length
246
Chain Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPAAQASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNSLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Prostasin
publication title Discovery of inhibitors of the channel-activating protease prostasin (CAP1/PRSS8) utilizing structure-based design.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e0pB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e0pB01
1Z8RA 3ODFA 4FXGH 1A5GH 1G3DA 2FYRA 2JETB 4ZHMU 1O34A 4MNVA 1QR3E 1LHGH 4MLFB 4WY3A 3P8OA 1QNJA 2BD9A 3IWMA 1HIAB 1YPMH 4UFFH 1LPZB 3LGTA 3CS0A 1BQYA 1A1RA 4JCNA 5IDKA 3QN7A 3FZDA 4BAOB 1GI5A 1GDNA 3T29A 1O2QA 1VITG 3M3VA 3T26A 2VIPA 1K21H 3UNSA 4ZROA 1O5GH 1QJ7B 2TGDA 3W94A 2UUFB 2C8WB 4X8UH 3URDA 1ELBA 4MQAA 2H1UA 4Z0KA 3SOSA 1W10U 2C90B 4K60A 1V2QT 1UHBB 2STAE 1C2LA 1AWHB 2V6NA 2A32A 1S82A 1C4Y2 1TRMA 2ZTYA 5JB9S 1Z71A 2NU0E 2SGAA 1HCGA 3S9BA 3SU6A 1O2GH 1W11U 3P8GA 1UK4A 3FFGA 1HAOH 5I25A 5BRRE 1ELEE 3A83A 4NIVA 3ZZ9A 2KAIA 1QL9A 3E0PB 3L6PA 2A31A 1SC8U 2XC4A 1FONA 2H2ZA 4KKDA 1G3EA 1MKWH 4AB9A 2EA3A 2RA3A 3I78A 1C2MA 3SU4A 1PPBH 1F0RA 1JOUB 1W7XH 2FXRA 1P2KA 5ETXA 1K9OE 2FMJA 1YM0A 1C5XB 1TOMH 1AQ7A 3UTUH 3VGCB 1HAHH 2CHAB 4UDWH 1ANBA 3SQHE 3A87A 1RD3B 1TX6A 5EG4A 4ABHA 1O32A 1BA8B 1QJ6B 4JZFH 1BZXE 4D76A 1EAWA 1O2LA 1RGQA 2H9EH 1GMCG 4ASHA 3P8FA 1TALA 3A7ZA 1UCYK 1JWTA 1HAIH 1FY3A 4Y8XA 1UVOA 1GJ7B 2VGCB 2ZP0H 1CU1A 4INLA 4UFEH 3SGBE 3BTEE 3SUGA 5EW1H 4NA9H 3TH4H 2AGIX 2ZGJA 4WMFA 2ANKH 1T32A 2UWOA 1WV7H 1AUJA 1ORFA 3PWBA 4CBNA 1C1WH 3A7XA 2ZA5A 1W3CA 2ZFTA 5C5OA 2Z9IA 1GBJA 1SOTA 1GMHF 2SNVA 2XWAA 1C9TA 1FPHH 4UEHH 4PROA 1LDTT 2ZU1A 1KIGH 2PUQH 4WWYA 1O3MA 4LXBH 1O3NA 1O3GA 1UTLM 2UWLA 1FUJA 1LPGB 2ULLA 1GGDC 3SGQE 2F91A 3PLBA 5EGMA 3FP7E 1VCPA 4CH2B 2QAAA 1LCYA 1ANDA 3TGIE 1DE7H 1XUJA 1NFXA 3EA9A 2BDIA 1O38A 2ALPA 3GY6A 2BX4A 1ZR0A 1GHBG 2G55A 3LIWA 2B0FA 4E7RG 2ZPRA 4O97A 3F9HA 1O3KA 4U2WA 5FPYA 2GT8A 4SGAE 3UY9A 4CH8B 2HNTE 3ZVBA 3R3GB 1AB9B 1T4UH 2O8MA 1HBTH 3M35A 1SLWB 2ZU4A 3NUMA 3RXGA 1TB6H 3GY2A 3P95A 1Y3YA 1JMOH 4ZHLU 4K5ZA 4B1TA 3RC4A 2F9PA 4TY6A 2OXSA 2YOLA 1M9UA 3P17H 1O5EH 2VIVA 1Z8JB 2QN5T 4ZHAA 4MPXA 1V2VT 1GCDA 3SV2H 4A1XA 2VWLA 6CHAB 2Z9GA 3SJOA 1OP2A 4OS7A 1LO6A 2AMQA 2ZU2A 2GCTB 1O2SA 2H9TH 1NU7B 2OTVA 1W14U 3BTHE 3RXOA 1H9IE 2P3TB 3SU0A 1VJAU 1O33A 3OYPA 3MH4A 1KLJH 5GCHG 1EB2A 4XSKU 1SGEE 2BDBA 2ZWLH 1BIOA 1Z6EA 1HJ8A 7KMEH 2FI3E 6GCHG 2GDDA 1O2VA 2HALA 2G4TA 2C93B 5DP7A 1E34B 5AFYH 3QLPH 1O2OA 1WQSA 3BSQA 1O2TA 2TPIZ 2WUBA 4R0IA 2O8TA 2CN0H 1DOJA 5JDUB 5EOKA 2AIQA 1GHVH 2XC0A 3U1IB 2QYIA 4B2AA 1FAKH 1PPEE 4K3JA 1EXFA 1K1OA 3UREA 2VVCA 2QIQA 3GCOA 2Z6BD 1GHAF 4D7GA 5CE1A 1V2WT 3OY6U 5DO4H 3BTKE 1MTSA 4M7GA 1C5UA 5HM2A 3LH1A 3E6PH 2BM2A 1JBUH 2ZQ2A 1QCPA 1QFKH 1O2KA 2QCYA 1CHGA 2O8LA 3M5MA 3S7KB 2RG3A 2R0LA 1GJCB 4AG1A 1GI4A 3GCNA 1ZMJA 3E16B 4Y7AA 3MU1A 2FDAA 1W0ZU 3MH7A 5DG6A 4RSPA 4OS6A 4ZKNU 1EPTA 3SV6A 3ENSB 2O8WA 3ATIA 3SJ9A 1LMWB 4I32A 3P6ZB 2VU8E 5LH8A 4NSVA 1SLUB 3ZZBA 1AGJA 2OC1A 3SV8A 4NFFA 5EXMA 1Q3XA 2SNWA 3BTTE 3ZV9A 1RRKA 4TPIZ 2RDLA 3ZYEA 1UCYH 1C5WB 4A7IB 3P92A 2BD7A 1VITF 1RS0A 1BTZA 1ZSLA 1GGDB 4BAKB 1E38B 5C1XA 3MWIU 3SBKA 2BLWA 1W12U 3LT3A 1HPGA 1PPCE 5GPIB 2F9NA 5A8ZA 2EC9H 4MNXA 1QBVH 1HAPH 2FOEA 1VGCB 2WPKS 1DSUA 3C27B 2PTCE 8KME2 2P16A 2BD2A 2BVSH 4K1SA 5DP3A 2FS8A 1GDQA 1TNHA 4GSOA 4X1NU 1OPHB 2QA9E 2P95A 2GV6A 1EZXC 1DX5M 4E05H 3RXMA 3V12A 4AGKA 1D6WA 4J2YB 1B7XB 3RXPA 1G3CA 2Q6FA 1K1IA 2W5EA 3UNRA 1RXPA 3K6YA 1GVLA 1ETSH 4X2WA 5BPEA 5E0JA 1KTTB 3KN2A 1DANH 2XBWA 5A8YA 1O3OA 1PQ7A 2NU3E 3KQEA 2ILNA 1MH0A 1ELFA 3RXIA 1LVYA 3MU5A 4KTUA 3KNXA 2YNAA 1MD7A 2F9VA 3TJNA 1V2LT 3NKKA 1MZAA 1A2CH 1RTKA 3B23B 5FCKA 4JZEH 2UWPA 1SGTA 1AMHA 4FVDA 4K8BA 1NPMA 4NG9H 2Z7FE 1ABIH 5F8XA 4NSYA 1KDQA 2BLVA 2BOKA 3U8OH 1GL0E 1C2IA 1CT0E 1GMCF 4THNH 2QC2A 3KHVA 1QA0A 1JRSA 5GWZA 1WSSH 3T2NA 1UTPA 1O2YA 1ZOMA 1GI2A 3QWCH 1SI5H 1L4ZA 1B0EA 1ZGVA 4MPVA 4BNRA 5GDSH 1SGFG 3UNQA 1DY8A 4RKJB 1HAYB 1MBMA 2ZDKA 2GV7A 4GVUA 1AKSB 4XBBA 4X1PU 1DWEH 2BQWB 1C2JA 3WY8A 4AFQA 4MNWA 3PM3A 4TWYA 1GDUA 1Y3WA 1S0RA 3AAVA 2VVVA 5AFZH 3HKJB 1J16A 4YLQH 2ALVA 1SHHB 1ELCA 1W7GH 4GAWA 4FUIA 3PMJA 1UHBA 4MPUA 1WOFA 3S69A 1GJ6A 1C1NA 1TABE 2BY5X 2I6SA 2QF3A 1MCVA 1BBRK 1G36A 6LPRA 1SBWA 3MHWU 2FM2A 2FOHA 1C5NH 1MBQA 1GJ5H 2ANMH 1TBRH 3GY8A 2ZFPH 1GHBF 1V2OT 3Q3YA 2PUXB 1NC6A 1MU6B 2FPZA 3KEEA 1P2MA 3UFAA 5CHAC 5HM9A 2W7UA 2RCEA 3M37A 4B71A 5FAHA 4ZH8A 3BEIB 3ZZCA 5ABWA 1KTSB 1ZHPA 2B8OH 3T25A 5HGGA 4J1YA 1CGIE 3QGNB 5GJ4B 3SJKA 5EXLA 1BTPA 1H9LB 1P2IA 4JYVH 1MKXK 4CRAA 4OGXA 1GPZA 1O39A 1ARCA 4D7FA 2ZDLA 2A2QH 2WV4A 2ZPQA 1C1VH 2NU2E 3U69H 1ABJH 1SGPE 2GCHF 2FZZA 1BMAA 1KXFA 2OCVB 1O2UA 2Z9KA 2A2XH 2FI5E 2C8YB 4MDSA 1XX9A 3SJIA 3MH6A 3ZVEA 4IW4E 1N1LA 1IQKA 3B9FH 2SGEE 1QB9A 4NA8A 2AFQB 1RFNA 1NFWA 1ZHMA 4X2XA 1MD8A 2FTLE 3A7YA 5GCHF 3EAJA 3KQBA 1PQAA 1DLEA 4VGCC 3AW0A 3UIRA 1KY9A 2FX6A 6GCHF 2A4QA 3NWUA 4ZXYH 1C1MA 2HPQH 5GIBA 2Q6GA 2ZO3H 4ABDA 5T6FA 3SJ8A 2Z9LA 2ZFRH 1YPEH 5DGJA 2ZHFH 2D26C 4BAHB 3V0XA 2BQ6B 1N6XA 2A0QB 3RXVA 2PFEA 1KLTA 5DP4A 2P59A 5FCRA 1P57B 1O2RA 3A7WA 1SGQE 4WVPE 1YGCH 1TBZH 4YLUA 1WQVH 1C5LH 2BD8A 1BHXB 1C1RA 4Y0ZE 1CHOF 3V7TA 1UK3A 3MH5A 3RMOH 1XUFA 3SZNA 1TGTA 4AGJA 1AIXH 1K1MA 5HXFA 1CO7E 1V2ST 1GJ9B 1SOZA 3S9AA 1PPGE 2XCFA 3BTME 1W8BH 1P9UA 1DLKB 1FAXA 2Y5FA 5JBTA 5TJXA 4UE7H 1C5ZB 1O2JA 1DXPA 1UVTH 2HNTF 1GHXH 3EE0B 3ZZ4A 5A0CA 1GVZA 2G52A 4BTIB 1TGNA 4NZLA 5DP6A 2ZGCA 1GI0A 2G8TA 3CENA 1EB1H 2HOBA 1TNLA 1A3EH 4AORA 2AEIH 1VJ9U 4A1VA 3B8JA 1QQUA 1GBKA 1ZYOA 3RXUA 1BITA 1P10A 1QA7A 4DY7B 1O3BA 4INHA 1NO9H 3F9EA 4WH6A 1CA8B 3E1XB 1HJAC 3RXKA 2JKHA 2WPMS 3W95A 1ZRBA 1ESTA 1QY6A 2GZ9A 1YC0A 3LPRA 1IQFA 1ZLRA 2B7DH 3PTBA 4AFUA 1CSOE 3Q00A 4K1TA 6CHAC 1FQ3A 2HNTC 5CHAB 4I8LA 2VWOA 5EW2H 3AAUA 1OKXA 2GCTC 5JBCS 5DP9A 4NIYA 3ODDA 1VR1H 4ESTE 4JYTA 1BBRH 2Y82A 1MQ5A 2BB4A 1OWDA 3OX7U 2Y7ZA 3SORA 1BDAA 8GCHG 1AUTC 1T4VH 3PV4A 1Z1JA 1L0ZA 1GG6B 4OS5A 1AZZA 1GHWH 2BMGB 1ID5H 3PLPA 2ZDVH 2O8UA 1HAVB 1EKBB 1O31A 1OYQA 1L2EA 2FX4A 5FBIA 4K8YA 1AFQC 4SGBE 1EP5A 1ZPZA 1Z7KA 4AN7A 1KXDA 1KXCA 3OSYA 1MKXH 1UTKA 5JB8S 4B75A 3GY5A 2GVFA 1E36B 3F9GA 3PMBB 4Q7YA 3FVFB 2J94A 5IYTA 2VNTA 1TPPA 4VGCB 4CRCA 1RJXB 1L1GA 1O5FH 1MU8B 2CGAA 1O3EA 1S6HA 1Y5AT 3TH2H 1FN8A 1TMTH 3QDZB 1EQ9A 1GCTC 1W2KH 2FWWA 1LHEH 3A84A 1TNJA 3GY4A 2VH6A 3DFJA 2BVRH 1HGTH 3NCLA 1SGFA 1FXYA 3EGKH 2AIPA 1OSSA 2OQ5A 5F8TA 1O3AA 1MTVA 1HRTH 4OS1A 4Y6DA 1P05A 5LPEA 1UTOA 1Y3UA 3EQ0H 2BDHA 2VH0A 4DIIH 2QXHA 3O8RA 3VB7A 1LVMA 3SNAA 2ZTXA 2CXVA 4ISOA 2ZHWH 1F5RA 2R9PA 4BANB 1T8OA 2ZHDA 4ABAA 5A09A 2XCNA 1YCPH 3RXHA 1ZMLA 1NZQH 2VWNA 3SV7A 1C5VA 5B6OA 4Y0YE 1TPOA 4LK4A 1QTFA 3F68H 2Z9JA 4DG4A 3HGPA 1EAIA 4JZDH 3ESTA 2XBYA 2XBXA 1UTNA 1Y3XA 2XTTB 3E3TA 1XKAC 2BDCA 2WUCA 1C1SA 8LPRA 5LGOA 1UCYE 3LH3A 1CA0B 3M5OA 1VGCC 4HI3A 5GXPA 4GCHG 2PW8H 4AYVB 2BXTH 3A7VA 4LZ4B 1WBGB 1XVOA 2BD5A 1CBWC 1HXEH 1P02A 1S0QA 2TGTA 4X8SH 3T27A 1MTUA 5ESTE 3SV9A 5L2ZH 2O9QA 3MNSA 5AVDA 3M36A 3U1JB 4YZUA 3M5LA 1HJAB 5J4SA 1UTMA 4CRDA 2PLXA 4CR9A 4TYDA 1H1BA 3RXAA 1EATA 1GI8B 1T7CA 3T28A 2I6QA 1NN6A 3H7OA 1TX7A 3NPSA 4WMEA 3RDZA 1DUEA 1C4U2 1DWBH 1GL1A 2ZEBA 1F0TA 1O3JA 2JH0D 3BV9B 4NWKA 5E8EH 2G5VA 1Y5BT 3PO1B 4NIXA 5C3NA 2BY6X 2FOGA 1C9PA 1C1OA 1LHCH 1HXFH 1NRNH 1AE5A 3TH3H 1TAWA 3ZZ7A 4X8VH 3K65B 3ITIA 1MCTA 3E91A 1KSNA 1BTUA 1HNEE 2P93A 2ZGBH 1OWIA 1K1NA 1ZRKA 1PPFE 3RXCA 5T6GA 3A8BA 1WYKA 1P2JA 1XM1A 2PKAB 3M3TA 3D65E 2GZ8A 1SSXA 4H6SB 1YPJH 3RUOA 1TQ7B 1BRCE 2PGBB 1MTNC 2J38A 3NK8A 2C4FH 3IITA 2ODPA 1DSTA 1GI1A 3TK6A 1XUKA 1SGIB 1AFQB 4DIHH 3JZ1B 1A0LA 1PQ5A 2C3SA 1FN6A 2BD4A 1C5QA 1TRYA 1J9CH 1KXBA 1GWAA 1SFIA 3LGWA 1THRH 1V2UT 1WCZA 5L2YH 5FPTA 1T8LA 1G3BA 3Q76A 1DFPA 4U01A 3DA9B 4E06H 1V2TT 2PGQB 1GCTB 2OINA 3FZZA 1IQEA 1K1JA 1O3DA 3KGPA 2AMDA 2FOBA 3KCGH 3PROA 1SLVB 1CQQA 1HAGE 1AD8H 1BJVA 2H5DA 5C1YA 2BZ6H 1P8VC 5FX6A 2BDAA 2VIQA 2ZFSA 2XRCA 1QRZA 1D4PB 1QRXA 4UONA 4AG2A 4A5TS 1AFEH 5JBBS 3RXBA 1IQNA 2A4RA 3M7UA 1L1NA 2KAIB 3GCTG 1L1JA 3TGJE 2W3KA 3PB1E 1WTHD 3RU4E 3RXQA 1K22H 2SGDE 1WU1A 2EI8A 4FUEA 2TGPZ 1AWFH 1EX3A 2UUKB 1C5SA 2PV9B 1NFYA 1IQGA 2VB0A 5JBAS 2JH5D 1C5MD 3SUEA 2D8WA 3CP7A 4FUDA 1O3FA 2VIWA 1SQTA 1O37A 2Q1JA 1HAZB 1SGDE 4DURA 2VIDA 1BHXF 1ANCA 1P2OA 3C1KA 1IQMA 3DUXH 1SR5C 7LPRA 1CBWB 1VZQH 2FYQA 2AMPA 1P11E 3A82A 2PSXA 1YP9A 5DJ7A 2ODYB 2A4GA 3JZ2B 2W7SA 3EA8A 1ZPCA 4U30A 1THSH 3LGUA 3EDXB 1F0SA 2WYJA 2ZPSA 1F7ZA 1UVPA 3ZVAA 3UR6A 3EYDA 3FP6E 1FI8A 1THPB 1YKTA 3SN8A 2J9NA 1MAYA 4RN6A 1PPZA 1SHYA 2WV5A 2EI7A 3RMNH 2ZTZA 1G32B 3K9XB 1PJPA 4UD9H 3BF6H 5TCAA 4ABGA 1NROH 3PYHA 4IN1A 3GDVA 1CT2E 4I8KA 2G4UA 1MTWA 4DVAU 1O2MA 1QB1A 1ZSKA 2AERH 1ZPBA 1GBTA 1YYY1 3O8BA 4YOGA 3LU9B 1D9IA 4RKOB 4Y71A 1TRNA 3ZVGA 3UQVA 2QXGA 2FLRH 5T3HA 4WF8A 3HGNA 4O9VA 1TONA 1O30A 1QBNA 2BDYA 4WH8A 4WMDA 1PYTD 2FOMB 1V2KT 2XYAA 1DWDH 3Q3XA 2NU1E 5JPMH 4ZMAH 1ELVA 5A8XA 1YPHE 1BJUA 1HIAA 1EAUA 1T8MA 1O2ZA 1TGBA 3MOCA 1MTNB 3Q3KA 1TYNA 2IN2A 4JZIA 3VB6A 3GY7A 1OWJA 1YPGH 3FANA 1HDTH 1IHTH 1SGCA 2STBE 2A5KA 4O03A 3U9AH 1YPLH 2EI6A 3E90B 2OC0A 2BLOA 3TLOA 2XBVA 1V3XA 2A5IA 3A8AA 5EQSA 1SQAA 3QZQA 4IS5A 4NGAH 1ANEA 4NWLA 1TA6A 3RXJA 1C5TA 2FEQH 1BTWA 3LGYA 3SUFA 1N8OC 1RTLA 1XXFA 2AH4X 2WPHS 3H7TA 4GCHF 4KTCA 1U6QA 1XMNB 3TNSA 1O3LA 3ZZ3A 3I29A 2C8XB 3R0FA 1GI6A 1V2PT 2CF8H 1GBHA 3VXFH 1HAVA 5I46H 1DUAA 4BAMB 1HUTH 1X7AC 4O3UA 1QL7A 3ZZ5A 1NU9A 1C1UH 2BQ7B 1GJ8B 1P06A 1TNGA 3HK3B 3VB3A 2P94A 3MU0A 1ZMNA 2GZ7A 1F5KU 3I77A 2TIOA 2VINA 4ISIH 4GUXA 3KF2A 1G9IE 3M5NA 4R8TB 1ESAA 1PPHE 1GG6C 1OS8A 4Y76A 1FY1A 1BBRE 5C5NA 1J14A 3SI4H 2QY0B 2GKVE 1UK2A 3SU3A 5DKMA 1CGJE 1GBBA 1FIZA 4TWWA 1XVMA 2G81E 1UJ1A 1P2NA 1O3PB 1P3CA 3P8NA 3MO3A 1AVGH 1EZSC 3QTVH 1GVKB 2LPRA 2ANWA 2ASUB 4ABBA 2JH6D 1C2GA 1FY8E 1GBDA 2VVUA 5K7RA 5J4QA 3RXTA 2BOHB 1P2QA 1KXAA 2ZCKP 4GPGA 1O5CB 1HJ9A 3RM0H 4X8TH 4CBOA 1TNKA 3A81A 5LPRA 3ATLA 4FUJA 3OU0A 4X1SU 4XFQA 2H5CA 3GISB 1FJSA 5A2MH 3RU4D 1V2JT 2Y81A 4H6TA 1SGYE 1E37B 2SGPE 3RMMH 1WUNH 4BTUB 1D3PB 1E35B 7ESTE 5FPSA 2ZGXH 3QO6A 1SGRE 1Y59T 2A7CA 1G30B 1ZJKA 1CGHA 1VCWA 3T5FH 5L30H 2ZG0H 3RXLA 4D9QA 2DE8A 4YTAA 1JXPA 4KGAA 4FU8A 2XW9A 2G51A 3D23A 4MNYA 1LKBA 9ESTA 1LPKB 2PWXA 2BDGA 3BG4B 2IOTA 3LJOA 1TMUH 5EPNA 1O5DH 3RC6A 3QX5H 1BRAA 1QGFA 1BRBE 5TCCA 5AHGH 2GMTB 4IC5A 1J15A 4FUGA 2BD3A 1CA0C 4X1RU 3ZVCA 1O2NA 4MG3A 3GCTF 1O2XA 1OWEA 1UO6A 1ZJDA 2F9BH 3UOPA 2BVXH 5EODA 4B73A 1BB0B 1C1PA 2FLBH 1AI8H 1TE0A 4B2BA 1IAUA 4JYUH 4ABJA 4AZ2B 4H4FA 3RM2H 3SNBA 3HPTB 4Q7XA 4TPYA 4B74A 1A7SA 1J8AA 3ZVDA 3MI4A 1N8OB 4ISHH 2P3FH 2GGVB 4ABEA 3A89A 2PR3A 3DT0H 1GBLA 4XE4A 1A61H 2PKAA 4AX9H 1GI7B 2A45B 1C2KA 3UQOA 4K1EA 4XBCA 4B2CA 1D3DB 1PYTC 1XUGA 1GJBB 3BIUH 3A8DA 4CR5A 1DITH 2PKSC 4CRGA 3MNCA 3PO1C 1EJNA 2SGFE 1DY9A 2R2MB 1GMDG 1INCA 1FZZA 3M61U 2PSYA 1MAXA 1S83A 2Y5HA 3BG8A 2BY9X 3ATKA 2ZC9H 3BTQE 1QL8A 1DVAH 3GOVB 4GHTA 5C20A 2OBQA 4LZ1H 3MNBA 1EAXA 4NZQA 5T6DA 2XXLA 2PHBA 1O36A 1AE8H 3BEFB 3GDSA 4F4OC 1B5GH 1VCQA 1LVOA 2ZFQH 2ZHQH 5FBEA 1DT2A 3SUDA 1C5YB 2R2WU 4AOQA 3RC5A 5H4IB 1SMFE 4IBLH 1YLDA 2Y7XA 1ELTA 5HYOA 1BT7A 1ZGIA 2BX3A 1FV9A 4MVNA 1ZTLA 1TQ0B 1QHRB 1VITH 1HFDA 3RXDA 3L33A 3GYMA 5F03A 4WJG2 3VEQB 3UOUA 1Y5UT 2FESH 3TPIZ 3V13A 5L6NH 1PFXC 4OS2A 3SNCA 1RIWC 1G2MA 1EZQA 4Q2KA 1K2I1 3ZVFA 2Z3DA 5EQRA 5E0GA 2Z3CA 3TU7H 2GP9B 4FUHA 3BTWE 3T62A 1SG8B 9LPRA 2J2UA 4CHAB 4Y8ZA 1Z8IB 2IPHA 2BXUH 3UR9A 4XDEA 1BTYA 3DHKH 3TITA 1O5AB 2CJIA 4I8GA 1O3CA 1OWHA 2GDEH 3ZZDA 3UWJH 3K6ZA 3RLYH 2B9LA 2H9HA 2HLCA 2F9UA 1KLIH 1NESE 1EOLA 2ZI2H 2YNBA 1A3BH 1GBEA 4DCDA 3QK1A 4XBDA 3N7OA 4FVBA 5A0AE 2LNCA 4HGCA 1AVXA 1ZTJA 5F6MA 1LTOA 2TBSA 5FHTA 3DFLA 1O2HA 4DT7B 4GLYA 2P3UB 4I7YH 3TK9A 1O35A 2OBOA 4YT6H 1O2WA 4BXWA 4UFDH 1FPCH 1TGSZ 1UTQA 2ODQA 1Q2WA 2OP9A 1O5BB 4X1QU 1GBAA 1AVWA 2WPLS 2ZIQH 4Y11E 3PTNA 4FUBA 5K0HA 1NM6A 1E0FD 2XWBI 3VB5A 1OP8A 1N6YA 2SFAA 3OY5U 3SU5A 1HAXB 4X6PA 3RXSA 2FTMA 5G4BA 1AU8A 1UVUH 2FI4E 4A1TA 3SU2A 5EPYA 4A6LA 1ZSJA 1P04A 2ZU3A 5E2PA 1AHTH 1YPKH 3KIDU 1DPOA 4HZHA 1P09A 3RU4T 3M7TA 1EZUC 2B5TB 2ZZUH 1TWXB 3V3MA 1W13U 1AKSA 2PKSB 2V3HH 2M5TA 3HATH 4K69A 2UUJB 3HK6B 1TOCB 3P70B 1ETRH 1BTHH 3ELAH 1DM4B 2OUAA 2OC8A 2ANYA 1K28D 3SNDA 1SB1H 2C8ZB 1XUHA 3VPKA 2GCHG 3UWIA 2R3YA 1Z8GA 4ZAEA 1P01A 1EP6A 1CE5A 1PQ8A 2A7JA 5EQQA 1D6RA 1S85A 1C5RA 2BHGA 1ESBA 2HPPH 4NFEA 2G5NA 4B76A 1DICA 2V0BA 1NRPH 2WPIS 3BTGE 5C67A 1EASA 1A0HB 2WYGA 1J17T 1FY5A 3SO3A 1TIOA 5PTPA 2DUCA 1A46H 4H42U 1OOKB 1S81A 2BYAX 2OC7A 5C2ZA 4F49A 1F5LA 1B0FA 3KL6A 3ZV8A 3GCHC 1YPHC 1Z1IA 1TPAE 1QQ4A 3AVZA 3PLKA 1C2DA 2Z3EA 3TJOA 1Q31A 2ESTE 2QGRA 1A4WH 1Z6JH 1T31A 1K1LA 3NZIA 1RIWB 1C5PA 1SQOA 4Y7BA 3TNTA 4DGJA 3H5CB 4Q7ZA 3STJA 1JRTA 3LJJA 2VWMA 5DPAA 2G00A 4LOYH 3LC3A 2H6MA 4BXSA 3ATMA 2SGQE 2A5AA 1FDPA 1JIMA 1CHOG 3QTOH 1W0YH 3LOXA 1ARBA 4I31A 5EU8A 3S9CA 2PTNA 1LHDH 3ATWA 2DE9A 2THFB 2D2DA 4X6NA 4NCYA 1F92A 4ABFA 3U98H 4Z6AH 5HMAA 4DOQA 2ZCLP 2R3UA 1GI9B 7GCHG 4MTBA 2EEKA 1IQJA 3GYLB 1OP0A 2F3CE 4YT7H 1TGCA 1TX8A 2K1QA 3G01A 1SVPA 2HVXA 1YCPM 1ZTKA 3SHAH 4A92A 3F9FA 1D3QB 3STIA 1DS2E 3U8TH 3MTYA 3E0NB 5SGAE 1A5HA 1OXGA 1F0UA 4UFGH 1UTJA 4IMQA 1OYTH 2A7HA 2FOAA 1GMDF 1WAYB 2IJOB 2V3OH 3VFEA 1LQDB 1XKBC 1FNIA 4QT8C 2VJ1A 2WINI 1P12E 2ZKSA 2BTCE 1QURH 2QV1A 1HV7A 2AGEX 2AYWA 4YO9A 3HKIB 4TY7A 1EJMA 2AS9A 8GCHF 1CT4E 4X6MA 4CRFA 1QBOA 1BCUH 3MO6A 4ZUHA 1C1QA 3A85A 4IC6A 1OX1A 2GTBA 3PMAB 1ZHRA 4JK6A 3VB4A 2BZAA 1HLTH 1NRSH 1DWCH 1EPTC 1A0JA 4FUFA 1GBIA 3SQEE 3UUZA 1SPJA 1NT1A 3IG6B 3FP8E 4ISNA 5F8ZA 2Y6TA 1GJAB 3BIVH 1IQLA 2OD3B 4AYYB 1K1PA 4CRBA 2CMYA 1S84A 5ESBA 5C1UA 3KQDA 3QGJA 4D9RA 1FLEE 1GI3A 3ZZ8A 3RXEA 1O0DH 1AN1E 3BEUA 1P0SH 3TJVA 1RTFB 1WTGH 4IN2A 5DK1A 3UPEA 4CREA 2CV3A 2FP7B 1MUEB 1IOEA 1HB0B 3NXPA 4OGYA 3A86A 3BG4C 1G2LA 3URCA 1KYNA 3MYWA 2ZDAH 2HRVA 2W3IA 4BTTB 4X2VA 1AZ8A 1C4V2 1Y8TA 4FUCA 5E0HA 2GMTC 1P3EA 4X0WU 3SHCH 3M7QA 1LHFH 1NFUA 3K2UA 3PWCA 3MFJA 1L4DA 1AO5A 3BTFE 1SFQB 1HYLA 1F2SE 1O2PA 2P8OC 3LGVA 2QF0A 3F1SB 5FXLA 4FU9A 1FIWA 3VXEH 1LKAA 4YESB 1T8NA 4ZKRU 1BMMH 2ZFFH 3QUMP 3TJUA 5JYIA 4YOIA 1IQIA 3GCHB 1H4WA 1NRRH 1C2EA 3BTDE 4Y10E 2HGTH 5A0BA 2OLGA 1BMNH 2GT7A 3EA7A 4X6OA 3CS7A 1SL3A 4ABIA 2D1JA 1BTXA 2VIOA 3OTJE 4NA7A 4ISLA 1AY6H 2XNIA 1H9HE 2BY8X 4YM9A 1NTPA 1H8IH 3BN9A 4BOHA 2FOCA 2GD4B 4JZ1A 2BY7X 4AFSA 1LVBA 4WXVA 3LKWA 3O8CA 2HWLB 1V6DA 3RXFA 1O2IA 4MPWA 1GHZA 1TMBH 3S0NA 1MZDA 1DDJA 4I33A 4ZKOU 1P03A 1V2NT 3LC5A 1ZZZA 4GHQA 4IGDA 1EJAA 1QRWA 2JETC 4O3TA 1MQ6A 2A4OA 2NU4E 4K2YA 1EUFA 4HFPB 2ZECA 1GJ4H 1GMHG 3MO9A 1FMGA 4U32A 1NRQH 1TNIA 4KTSA 1UMAH 1QJ1B 1O3IA 3MNXA 1NY22 3MU8A 3LDXH 1JIRA 1FY4A 3SNEA 2GX4A 3ZZAA 1YLCA 2TRMA 2XC5A 2ZGHA 1MKWK 1TBQH 1V2RT 1C2FA 3MU4A 3QZRA 3SGAE 1GBFA 3S7HB 3ZYDA 1TA2A 3E8LA 1EOJA 4NIWA 2NWNA 1IQHA 1OWKA 4Q80A 3TVJB 3MMGA 3RLWH 3GY3A 1G37A 2ZU5A 1ELDE 1SLXB 2WPJS 3RMLH 2AGGX 1XXDA 2QXIA 1ELGA 3FAOA 3U8RH 3F6UH 2Y80A 4ZXXH 3TK5A 2J92A 2J95A 1D3TB 1H8DH 2J4IA 2OQUA 2UUYA 2Z94A 1LQEA 3L3TA 5CMXH 4Y79A 1EPTB 4OS4A 3O8DA 3GDUA 2W26A 1ELAA 1C1TA 5EXNA 3TGKE 1BRUP 4ZKSU 1V2MT 4KELA 3VGCC 3ZZ6A 2CHAC 2ZF0H 2R0KA 2ZDMA 5DP5A 2FODA 4IMZA 2QXJA 4FU7A 3SW2B 1GJDB 4CHAC 2Q6DA 3LGIA 3A8CA 4AFZA 1ETTH 4X2YA 1KXEA 1Y3VA 2FO9A 1C5OH 4WXIA 4BAQB 1C2HA 1GHYH 4I8HA 3A88A 5LPFA 1XUIA 2ZHEH 8ESTE 1YCPK 1S5SA 4JK5A 4I8JA 1BOQA 6ESTA 1BUIA 4YOJA 5E2OA 2VGCC 1TLDA 2FIRH 3A80A 3SU1A 2FS9A 4JMYA 2A1DB 1O3HA 4KP0A 4Y8YA 3TIUA 5DP8A 2FOFA 4XOJA 4D8NA 1S6FA 2ZCHP 1A5IA 1UVSH 3RXRA 1QIXB 1MMJN 1YF4A 2ZNKH 3Q77A 4INKA 1ACBE 5FX5A 4E7NA 2Y5GA 1GBMA 2F9OA 4AB8A 7GCHF 1GBCA 2P8OB 3RP2A 4DJZB 5AF9H 1GHAG 1YBWA 3M3SA 2V35A 3AASA 3SI3H 3KQCA 1NS3A 3PMHB 2ZDNA 3D62A 2ZQ1A 3A7TA 4HTCH 1DXWA 1BMLA 1SGNE 3GICB 3D49H 3AW1A 2J34A 1P9SA 1TFXA 1QB6A 3LONA 2TGAA 3DD2H 2F83A 1KDQB 1TPSA 2CF9H 4DW2U 1CVWH 1AB9C 1IHSH 2BLQA 2RA0A
chains in the Genus database with same CATH superfamily
1Z8RA 3ODFA 4FXGH 1A5GH 1G3DA 2FYRA 2JETB 4ZHMU 1O34A 4MNVA 1QR3E 1LHGH 3H09A 4MLFB 4WY3A 3P8OA 1QNJA 2BD9A 3IWMA 1HIAB 1YPMH 4UFFH 1LPZB 3LGTA 3CS0A 1BQYA 1A1RA 4JCNA 5IDKA 2L6OA 3QN7A 3FZDA 4BAOB 1GI5A 1GDNA 3T29A 1O2QA 1VITG 3M3VA 3T26A 2VIPA 1K21H 3UNSA 4ZROA 1O5GH 1QJ7B 2TGDA 3W94A 3FN8A 2UUFB 2C8WB 2XOKD 4X8UH 3URDA 1ELBA 4MQAA 2H1UA 4Z0KA 3SOSA 1W10U 2C90B 4K60A 1V2QT 1UHBB 2F43B 2STAE 1C2LA 1AWHB 2V6NA 2A32A 1S82A 1C4Y2 1TRMA 2ZTYA 5JB9S 1Z71A 2NU0E 2SGAA 1HCGA 3S9BA 3SU6A 1O2GH 1W11U 3P8GA 1UK4A 3FFGA 1HAOH 5I25A 5BRRE 1ELEE 3A83A 4NIVA 3ZZ9A 2KAIA 1QL9A 3E0PB 3L6PA 2A31A 1SC8U 2XC4A 1FONA 2H2ZA 4KKDA 1G3EA 1MKWH 4AB9A 2EA3A 2RA3A 1EFRD 3I78A 1C2MA 3SU4A 1PPBH 1F0RA 1JOUB 1W7XH 2FXRA 1P2KA 5ETXA 1K9OE 2FMJA 1YM0A 1C5XB 5T1VA 1TOMH 1AQ7A 3UTUH 3VGCB 1HAHH 2CHAB 4UDWH 1ANBA 5EJ1A 3SQHE 3A87A 1RD3B 1TX6A 5EG4A 4ABHA 1O32A 1BA8B 1QJ6B 4JZFH 1BZXE 4D76A 1EAWA 1O2LA 1RGQA 2H9EH 1GMCG 4ASHA 3P8FA 1TALA 3A7ZA 1UCYK 1JWTA 1HAIH 1FY3A 4Y8XA 1UVOA 1GJ7B 2VGCB 2ZP0H 1CU1A 4INLA 4UFEH 3SGBE 3BTEE 3SUGA 5EW1H 4NA9H 3PV5A 3TH4H 2AGIX 2ZGJA 4WMFA 2ANKH 1T32A 2UWOA 1WV7H 1AUJA 1ORFA 4B6FA 3PWBA 5DSFA 4CBNA 2RFKC 1C1WH 3A7XA 2ZA5A 1W3CA 2ZFTA 5C5OA 2Z9IA 1GBJA 1S6LA 1GMHF 1SOTA 2SNVA 2XWAA 1C9TA 1FPHH 4UEHH 4PROA 1LDTT 5IK2D 2ZU1A 1KIGH 2PUQH 4WWYA 3SZEA 1O3MA 4LXBH 1O3NA 1O3GA 1UTLM 2UWLA 1FUJA 5KGOA 1LPGB 2ULLA 1GGDC 3SGQE 2F91A 3PLBA 5EGMA 3FP7E 1VCPA 2KR7A 4CH2B 2QAAA 1LCYA 1ANDA 3TGIE 1DE7H 1XUJA 1NFXA 1VKYA 2IJD1 3EA9A 2BDIA 1QZ8A 1O38A 2ALPA 3GY6A 2BX4A 2J97A 1ZR0A 1GHBG 2G55A 3LIWA 2B0FA 4E7RG 2ZPRA 4O97A 3F9HA 1O3KA 4U2WA 5FPYA 2GT8A 4SGAE 3UY9A 4CH8B 2HNTE 3ZVBA 4B6EA 3R3GB 1AB9B 1T4UH 2O8MA 1HBTH 3M35A 4TSFD 1SLWB 2ZU4A 3NUMA 3RXGA 1TB6H 3GY2A 2HLDD 3P95A 1Y3YA 1JMOH 4ZHLU 4K5ZA 4B1TA 3RC4A 2F9PA 4TY6A 2OXSA 2YOLA 1M9UA 3P17H 1O5EH 2VIVA 1Z8JB 2QN5T 1K0HA 4ZHAA 4MPXA 1V2VT 1GCDA 3SV2H 4A1XA 2VWLA 6CHAB 2Z9GA 3SJOA 1OP2A 4OS7A 1LO6A 2AMQA 2ZU2A 2GCTB 1O2SA 2H9TH 1NU7B 2OTVA 1W14U 3BTHE 3RXOA 1H9IE 2P3TB 3SU0A 1VJAU 1O33A 3OYPA 3MH4A 1KLJH 5GCHG 1EB2A 4XSKU 1SGEE 2BDBA 2ZWLH 1BIOA 1Z6EA 1HJ8A 7KMEH 2FI3E 6GCHG 2GDDA 1O2VA 2HALA 2G4TA 1UW7A 2C93B 5DP7A 1E34B 5AFYH 3QLPH 1O2OA 1WQSA 3BSQA 1O2TA 2TPIZ 2WUBA 4R0IA 2O8TA 2CN0H 1DOJA 5JDUB 5EOKA 2AIQA 1GHVH 2XC0A 3U1IB 2QYIA 4B2AA 1FAKH 1PPEE 4K3JA 1EXFA 1K1OA 3UREA 2VVCA 2QIQA 3GCOA 2Z6BD 1GHAF 1YY3A 4D7GA 3OEED 5CE1A 1V2WT 3OY6U 4F48B 5DO4H 3BTKE 1MTSA 4M7GA 1C5UA 5HM2A 3LH1A 3E6PH 2BM2A 1JBUH 2ZQ2A 2J98A 1QCPA 1QFKH 1O2KA 2QCYA 1CHGA 2O8LA 3MQKC 3M5MA 3S7KB 4Z1MD 2RG3A 2R0LA 1GJCB 4AG1A 1GI4A 3GCNA 1ZMJA 3E16B 4Y7AA 3MU1A 2FDAA 1W0ZU 3MH7A 5DG6A 4RSPA 4OS6A 4ZKNU 1EPTA 3SV6A 3ENSB 4RT0A 2O8WA 3ATIA 3SJ9A 1LMWB 4I32A 3P6ZB 2VU8E 5LH8A 4NSVA 1SLUB 3ZZBA 1AGJA 2OC1A 3SV8A 4NFFA 5EXMA 1Q3XA 2SNWA 3BTTE 3ZV9A 1RRKA 4TPIZ 2RDLA 3ZYEA 1UCYH 1C5WB 4A7IB 3P92A 2BD7A 1VITF 1RS0A 1BTZA 1ZSLA 1GGDB 4BAKB 1E38B 5C1XA 3MWIU 3SBKA 2BLWA 1W12U 3LT3A 1HPGA 1PPCE 5GPIB 2F9NA 5A8ZA 2EC9H 4MNXA 1QBVH 1HAPH 2FOEA 1VGCB 2WPKS 1DSUA 3C27B 2PTCE 8KME2 2P16A 2BD2A 2BVSH 4K1SA 5DP3A 2FS8A 1GDQA 1TNHA 2WHXA 4GSOA 4X1NU 4ZCNA 1OPHB 2QA9E 2P95A 3OEHD 2GV6A 1EZXC 1DX5M 4E05H 3RXMA 3V12A 4AGKA 1D6WA 4J2YB 1B7XB 3RXPA 1G3CA 2Q6FA 2L74A 1K1IA 2W5EA 3GS9A 3UNRA 1RXPA 3K6YA 1GVLA 1ETSH 4X2WA 5BPEA 5E0JA 1KTTB 3KN2A 1DANH 2XBWA 5A8YA 1O3OA 1PQ7A 2NU3E 3KQEA 2ILNA 1MH0A 1ELFA 3RXIA 1LVYA 3MU5A 4KTUA 3KNXA 2YNAA 1MD7A 2F9VA 3TJNA 1V2LT 3NKKA 2WPDD 5KEDA 1MZAA 1A2CH 1RTKA 3B23B 5FCKA 4JZEH 2UWPA 1SGTA 1AMHA 4FVDA 4K8BA 1E1QD 1NPMA 4NG9H 2Z7FE 1ABIH 5F8XA 3N99A 4NSYA 1KDQA 2BLVA 2BOKA 3U8OH 1GL0E 1OHHD 1C2IA 1CT0E 1GMCF 4THNH 2QC2A 3KHVA 1QA0A 1JRSA 5GWZA 1WSSH 3T2NA 1UTPA 1O2YA 1ZOMA 2V3MA 1GI2A 3QWCH 1SI5H 1L4ZA 1B0EA 1ZGVA 4MPVA 4BNRA 5GDSH 1SGFG 3UNQA 1DY8A 4RKJB 1HAYB 1MBMA 2ZDKA 2GV7A 4GVUA 1AKSB 4XBBA 4X1PU 1DWEH 2AHME 1C2JA 2BQWB 3WY8A 4AFQA 4MNWA 3PM3A 4TWYA 5C0TA 1GDUA 1Y3WA 1S0RA 3AAVA 2VVVA 5AFZH 2EY4C 3HKJB 1J16A 4YLQH 2ALVA 1SHHB 1ELCA 1W7GH 4GAWA 4FUIA 3PMJA 1UHBA 4MPUA 1WOFA 3S69A 1GJ6A 1C1NA 1TABE 2BY5X 2I6SA 2QF3A 1MCVA 1BBRK 1G36A 6LPRA 1SBWA 3MHWU 3U28C 2FM2A 2FOHA 1C5NH 1MBQA 1GJ5H 2ANMH 1TBRH 3GY8A 2ZFPH 1GHBF 1V2OT 3Q3YA 2PUXB 1NC6A 1MU6B 2FPZA 3KEEA 1P2MA 3UFAA 5CHAC 5HM9A 2W7UA 2RCEA 3M37A 4B71A 5FAHA 4ZH8A 3BEIB 3ZZCA 5ABWA 1KTSB 1ZHPA 2B8OH 3T25A 5HGGA 4J1YA 1CGIE 3QGNB 5GJ4B 3SJKA 5EXLA 1BTPA 1H9LB 1P2IA 4JYVH 1MKXK 3F0PA 4CRAA 4OGXA 1GPZA 1O39A 1ARCA 3DSGA 4D7FA 2ZDLA 2A2QH 2WV4A 2ZPQA 1C1VH 2NU2E 3U69H 1ABJH 1SGPE 2GCHF 2FZZA 1BMAA 1KXFA 2OCVB 1O2UA 2Z9KA 2A2XH 2FI5E 2C8YB 4MDSA 1XX9A 3SJIA 3MH6A 3W1EA 3ZVEA 4IW4E 1N1LA 1IQKA 3B9FH 2SGEE 1QB9A 4NA8A 2AFQB 1RFNA 1NFWA 1ZHMA 4X2XA 1MD8A 2FTLE 3A7YA 5GCHF 3EAJA 3KQBA 1PQAA 1DLEA 4VGCC 3AW0A 3UIRA 1KY9A 2FX6A 6GCHF 2A4QA 3NWUA 5HIZA 4ZXYH 1C1MA 2HPQH 5GIBA 2Q6GA 3F3BA 2ZO3H 4ABDA 5T6FA 3SJ8A 2JJ2D 2Z9LA 2ZFRH 1YPEH 5DGJA 2ZHFH 2D26C 4BAHB 1H8HD 3V0XA 2BQ6B 1N6XA 2A0QB 4HG6A 3RXVA 2PFEA 1KLTA 5DP4A 2P59A 5FCRA 1P57B 1O2RA 3A7WA 1SGQE 4WVPE 1YGCH 1TBZH 4YLUA 1WQVH 1C5LH 2BD8A 1BHXB 1C1RA 4Y0ZE 1CHOF 3V7TA 1UK3A 3MH5A 2WSSD 3RMOH 1XUFA 3SZNA 1TGTA 4AGJA 1AIXH 1K1MA 5HXFA 1CO7E 1V2ST 1GJ9B 1SOZA 3S9AA 3PRBA 1PPGE 2XCFA 3BTME 1W8BH 1P9UA 1DLKB 1FAXA 2Y5FA 5JBTA 5TJXA 4UE7H 1C5ZB 1O2JA 1DXPA 1UVTH 2HNTF 1GHXH 3EE0B 3ZZ4A 5A0CA 1GVZA 2G52A 4BTIB 1TGNA 4NZLA 5DP6A 2ZGCA 1GI0A 2G8TA 3CENA 1EB1H 2HOBA 1TNLA 5B6LA 4ACBA 1A3EH 4AORA 4RT1A 2AEIH 1VJ9U 4A1VA 3B8JA 1QQUA 1GBKA 1ZYOA 5CHBA 3RXUA 1BITA 1P10A 1QA7A 4DY7B 1O3BA 4INHA 1NO9H 3F9EA 4WH6A 1CA8B 3E1XB 1HJAC 3RXKA 2JKHA 2WPMS 3W95A 1ZRBA 1ESTA 1QY6A 2GZ9A 1YC0A 3LPRA 3OAAD 1IQFA 1ZLRA 2B7DH 3PTBA 4AFUA 1CSOE 3Q00A 4K1TA 6CHAC 1FQ3A 2HNTC 3DCLA 5CHAB 4I8LA 2VWOA 5EW2H 3AAUA 1OKXA 2GCTC 5JBCS 5DP9A 4NIYA 3ODDA 1VR1H 4ESTE 4JYTA 1BBRH 2Y82A 1MQ5A 2BB4A 1OWDA 3OX7U 2PP6A 2Y7ZA 3SORA 1BDAA 8GCHG 1AUTC 1T4VH 3PV4A 1Z1JA 1L0ZA 1GG6B 4OS5A 1AZZA 1GHWH 2BMGB 1ID5H 3PLPA 2ZDVH 3F2GA 2O8UA 1HAVB 1EKBB 1O31A 1OYQA 1L2EA 2FX4A 5FBIA 4K8YA 1AFQC 4SGBE 1EP5A 1ZPZA 1Z7KA 4AN7A 1KXDA 1KXCA 1BMFD 3OSYA 1MKXH 1UTKA 5JB8S 4B75A 3GY5A 2GVFA 1E36B 3F9GA 3N7EA 3PMBB 2KCOA 4Q7YA 3FVFB 2J94A 5IYTA 2VNTA 1TPPA 4VGCB 4CRCA 1RJXB 1L1GA 1O5FH 1MU8B 2CGAA 1O3EA 1S6HA 1Y5AT 3TH2H 1FN8A 1TMTH 3QDZB 1EQ9A 1GCTC 1W2KH 2FWWA 1LHEH 3A84A 1NBME 1TNJA 3GY4A 2VH6A 3DFJA 2BVRH 1HGTH 3NCLA 1SGFA 1FXYA 3EGKH 2AIPA 1OSSA 2OQ5A 5F8TA 1WDIA 1O3AA 1MTVA 1HRTH 4OS1A 4Y6DA 1P05A 5LPEA 1UTOA 1Y3UA 3EQ0H 2BDHA 2VH0A 4DIIH 2QXHA 3O8RA 3VB7A 1LVMA 3SNAA 2ZTXA 2CXVA 4ISOA 2ZHWH 1F5RA 2R9PA 4BANB 2RDEA 1T8OA 2ZHDA 4ABAA 5A09A 2XCNA 1YCPH 3RXHA 1ZMLA 1NZQH 2VWNA 3SV7A 1C5VA 5B6OA 4Y0YE 1TPOA 4LK4A 1QTFA 3F68H 2Z9JA 4DG4A 3HGPA 1EAIA 4JZDH 3ESTA 2XBYA 2XBXA 1UTNA 5C17A 1Y3XA 2XTTB 3E3TA 1XKAC 2BDCA 2WUCA 1C1SA 8LPRA 5LGOA 1UCYE 3LH3A 1CA0B 5GNDA 3M5OA 1VGCC 4HI3A 5GXPA 4GCHG 2PW8H 4Q63A 2BXTH 4AYVB 3A7VA 4LZ4B 1WBGB 1XVOA 2BD5A 1CBWC 1HXEH 1P02A 1S0QA 2TGTA 4X8SH 3T27A 3KYFA 1MTUA 5ESTE 3SV9A 2WV9A 2O9QA 5L2ZH 3MNSA 5AVDA 3M36A 3U1JB 4YZUA 3M5LA 1HJAB 5J4SA 1UTMA 4CRDA 2PLXA 4CR9A 4TYDA 1H1BA 3RXAA 1EATA 1GI8B 1T7CA 3T28A 2I6QA 1NN6A 3H7OA 1TX7A 3NPSA 4WMEA 3RDZA 1DUEA 1C4U2 1DWBH 1GL1A 2ZEBA 1F0TA 1O3JA 2JH0D 3BV9B 4NWKA 1YLNA 2G5VA 1Y5BT 3PO1B 4NIXA 5E8EH 2BY6X 5C3NA 2FOGA 2QF4A 1C9PA 1C1OA 1LHCH 1HXFH 1NRNH 1AE5A 2LELA 3TH3H 1TAWA 3ZZ7A 4X8VH 3K65B 3ITIA 1MCTA 2VBCA 3E91A 1KSNA 1BTUA 1HNEE 2P93A 2ZGBH 1OWIA 1K1NA 1E1RD 1ZRKA 1PPFE 3RXCA 5T6GA 3A8BA 1WYKA 1P2JA 1XM1A 2PKAB 3M3TA 3D65E 2GZ8A 1SSXA 2QF5A 4H6SB 1YPJH 3RUOA 1TQ7B 1BRCE 4XD7D 2PGBB 5CDFE 2KCYA 1MTNC 2J38A 3NK8A 2C4FH 3IITA 2ODPA 1DSTA 1GI1A 3TK6A 1XUKA 1SGIB 1AFQB 4FETA 4DIHH 3JZ1B 1A0LA 1PQ5A 2C3SA 1FN6A 2BD4A 1C5QA 1TRYA 1J9CH 1KXBA 1GWAA 1SFIA 3LGWA 1SQRA 1THRH 1V2UT 1WCZA 5L2YH 5FPTA 4ASUD 1T8LA 1G3BA 3Q76A 1DFPA 4U01A 3DA9B 4E06H 1V2TT 2PGQB 1GCTB 2OINA 3FZZA 1IQEA 1K1JA 1O3DA 3KGPA 2AMDA 2FOBA 4F55A 4YXWD 3KCGH 3PROA 1SLVB 1CQQA 1HAGE 1AD8H 1BJVA 2H5DA 5C1YA 2BZ6H 3ZIAD 1P8VC 5FX6A 2BDAA 2VIQA 2ZFSA 2XRCA 1QRZA 1D4PB 1COWD 1QRXA 4UONA 4AG2A 4A5TS 1AFEH 5JBBS 3RXBA 5C94A 1IQNA 2A4RA 3M7UA 1L1NA 2KAIB 3GCTG 1W0KD 1L1JA 3TGJE 3OFND 2W3KA 3PB1E 1WTHD 3PV2A 3RU4E 3RXQA 1K22H 2SGDE 1WU1A 2EI8A 4FUEA 2TGPZ 1AWFH 2XNDD 1EX3A 2UUKB 1C5SA 2PV9B 1NFYA 1IQGA 2VB0A 5JBAS 2JH5D 1C5MD 3SUEA 2D8WA 3CP7A 4FUDA 1O3FA 2VIWA 1SQTA 1O37A 2Q1JA 1HAZB 1NBMD 1SGDE 4DURA 2VIDA 1BHXF 1ANCA 1P2OA 3C1KA 1IQMA 3DUXH 1SR5C 7LPRA 3UAIC 1CBWB 1VZQH 5EJLA 2FYQA 2AMPA 1P11E 3A82A 2PSXA 1YP9A 5DJ7A 2ODYB 2A4GA 3JZ2B 2W7SA 3EA8A 1ZPCA 2KX4A 4U30A 1THSH 3LGUA 3EDXB 1F0SA 2WYJA 2ZPSA 1F7ZA 1UVPA 3ZVAA 3UR6A 3EYDA 3FP6E 1FI8A 1THPB 1YKTA 3SN8A 2J9NA 3N7DA 1MAYA 4RN6A 1PPZA 1SHYA 2WV5A 2EI7A 3RMNH 2ZTZA 1G32B 3K9XB 1PJPA 4UD9H 3BF6H 5TCAA 4ABGA 1NROH 3PYHA 4IN1A 3GDVA 1CT2E 4I8KA 2G4UA 1MTWA 4DVAU 1O2MA 1QB1A 1ZSKA 2AERH 2KFWA 1ZPBA 1GBTA 1YYY1 3O8BA 4YOGA 3LU9B 1D9IA 4RKOB 4Y71A 1TRNA 3ZVGA 3UQVA 2QXGA 2FLRH 5T3HA 4WF8A 3HGNA 4O9VA 1TONA 1O30A 1QBNA 2BDYA 4WH8A 4WMDA 1PYTD 2FOMB 1V2KT 2XYAA 1DWDH 3Q3XA 2NU1E 5JPMH 4I86A 4ZMAH 1ELVA 2KM0A 5A8XA 1YPHE 1BJUA 1HIAA 1EAUA 1T8MA 1O2ZA 1TGBA 3MOCA 1MTNB 3Q3KA 1TYNA 2IN2A 4JZIA 3VB6A 3GY7A 1OWJA 1YPGH 3FANA 1HDTH 1IHTH 1SGCA 2STBE 2A5KA 4O03A 3U9AH 1YPLH 2EI6A 3E90B 2OC0A 2BLOA 3TLOA 2XBVA 1V3XA 2A5IA 3A8AA 5EQSA 1SQAA 3QZQA 4IS5A 4NGAH 4P00A 1ANEA 4NWLA 1TA6A 3RXJA 1C5TA 2FEQH 1BTWA 3LGYA 3SUFA 1N8OC 1RTLA 1XXFA 2AH4X 2WPHS 3H7TA 4GCHF 4KTCA 1U6QA 1XMNB 3TNSA 1O3LA 2CK3D 3ZZ3A 3I29A 2C8XB 3R0FA 1GI6A 1V2PT 2CF8H 1GBHA 3VXFH 1HAVA 5I46H 1DUAA 4BAMB 1HUTH 1X7AC 3OE7D 4O3UA 1QL7A 3ZZ5A 1NU9A 1C1UH 2M2AA 2BQ7B 1GJ8B 1P06A 1TNGA 3HK3B 3VB3A 2P94A 3MU0A 1ZMNA 2GZ7A 1F5KU 3I77A 2TIOA 2VINA 4ISIH 4GUXA 3KF2A 1G9IE 3M5NA 4AC9A 4R8TB 1ESAA 1PPHE 1GG6C 1OS8A 4Y76A 1FY1A 1BBRE 5C5NA 1J14A 3SI4H 2QY0B 2GKVE 1UK2A 3SU3A 5DKMA 1CGJE 2K0QA 1GBBA 1FIZA 4TWWA 1XVMA 2G81E 1UJ1A 1P2NA 1O3PB 1P3CA 3P8NA 3MO3A 1AVGH 1EZSC 3QTVH 1GVKB 2LPRA 2ANWA 2ASUB 4ABBA 2JH6D 2J98B 1C2GA 1FY8E 1GBDA 2VVUA 5K7RA 2V7QD 5J4QA 3RXTA 2BOHB 2F4LA 1P2QA 1KXAA 2ZCKP 2JDID 4FOUC 4GPGA 1O5CB 1HJ9A 3RM0H 4X8TH 4CBOA 1TNKA 3A81A 5LPRA 3ATLA 4FUJA 3OU0A 4X1SU 4XFQA 2H5CA 3GISB 1FJSA 5A2MH 3RU4D 1V2JT 2Y81A 4H6TA 1SGYE 1E37B 2SGPE 3RMMH 4P02A 1WUNH 4BTUB 1D3PB 1E35B 7ESTE 5FPSA 2ZGXH 3QO6A 1SGRE 1Y59T 2KCAA 2A7CA 1G30B 1ZJKA 1CGHA 1VCWA 3T5FH 5L30H 2ZG0H 3RXLA 4D9QA 2DE8A 4YTAA 1JXPA 4KGAA 4FU8A 2XW9A 2G51A 3D23A 4MNYA 1LKBA 9ESTA 1LPKB 2PWXA 2BDGA 3BG4B 2IOTA 3AK5A 3LJOA 1TMUH 5EPNA 1O5DH 4OM9A 3RC6A 3QX5H 1BRAA 1QGFA 1BRBE 5TCCA 5AHGH 2GMTB 4IC5A 1J15A 4FUGA 2BD3A 1CA0C 4X1RU 3ZVCA 1O2NA 4MG3A 3GCTF 1O2XA 1OWEA 1UO6A 1ZJDA 2F9BH 3UOPA 2BVXH 5EODA 4B73A 1BB0B 1C1PA 2FLBH 1AI8H 1TE0A 4B2BA 1IAUA 3DSOA 4JYUH 4ABJA 4AZ2B 4H4FA 3RM2H 3SNBA 3HPTB 4Q7XA 4TPYA 4B74A 1A7SA 1J8AA 3ZVDA 3MI4A 1N8OB 4ISHH 2P3FH 2GGVB 4ABEA 3A89A 2PR3A 3DT0H 1GBLA 3NRLA 4XE4A 1A61H 2PKAA 4AX9H 1GI7B 2A45B 1C2KA 3UQOA 4K1EA 1H8ED 4XBCA 4B2CA 1D3DB 1PYTC 1XUGA 1GJBB 3BIUH 2JIZD 3A8DA 4CR5A 1DITH 2PKSC 4CRGA 3MNCA 3PO1C 1EJNA 2SGFE 1DY9A 2R2MB 1GMDG 5KECA 1INCA 1FZZA 3WW7A 3M61U 2PSYA 1MAXA 1S83A 2Y5HA 3BG8A 2BY9X 3ATKA 2ZC9H 3BTQE 1QL8A 1DVAH 3GOVB 4GHTA 5C20A 2OBQA 4LZ1H 3MNBA 1EAXA 4NZQA 5T6DA 2XXLA 2PHBA 1O36A 1AE8H 3BEFB 2WZQA 3GDSA 4F4OC 1B5GH 1VCQA 1LVOA 2ZFQH 2ZHQH 5FBEA 1E79D 5FL7D 1DT2A 3SUDA 1C5YB 2R2WU 4AOQA 3RC5A 5H4IB 1SMFE 4IBLH 1YLDA 2Y7XA 1ELTA 5HYOA 1BT7A 1ZGIA 3F2HA 2BX3A 1FV9A 4MVNA 1ZTLA 1TQ0B 1QHRB 1VITH 1HFDA 3RXDA 3L33A 2YMSB 3GYMA 5F03A 4WJG2 3VEQB 3UOUA 1Y5UT 2FESH 3TPIZ 3V13A 5EJZA 5L6NH 1PFXC 4OS2A 3SNCA 1RIWC 1G2MA 1EZQA 4Q2KA 1K2I1 3ZVFA 2Z3DA 5EQRA 5E0GA 2Z3CA 3TU7H 5HIYA 2GP9B 4FUHA 3BTWE 3T62A 1SG8B 9LPRA 2J2UA 4CHAB 2JJ1D 4Y8ZA 1Z8IB 2IPHA 2BXUH 3UR9A 4XDEA 1BTYA 3DHKH 3TITA 1KMHB 1O5AB 2CJIA 4I8GA 1O3CA 2GDEH 1OWHA 3UB0A 3ZZDA 3UWJH 3K6ZA 2J5UA 3RLYH 2B9LA 2H9HA 2HLCA 2F9UA 1KLIH 1NESE 1EOLA 2ZI2H 2YNBA 1A3BH 1GBEA 4DCDA 3QK1A 4XBDA 3N7OA 4FVBA 5A0AE 2LNCA 5HKKD 4HGCA 1AVXA 1ZTJA 5F6MA 1LTOA 2TBSA 5FHTA 3DFLA 1O2HA 4DT7B 4GLYA 2P3UB 4I7YH 3TK9A 1O35A 2OBOA 4YT6H 1O2WA 4BXWA 4UFDH 1FPCH 1TGSZ 1UTQA 2ODQA 1Q2WA 2OP9A 1O5BB 4X1QU 1GBAA 1AVWA 2WPLS 2ZIQH 4Y11E 3PTNA 2GJGA 4FUBA 5K0HA 1NM6A 1E0FD 2XWBI 3VB5A 1OP8A 1N6YA 2SFAA 3OY5U 3SU5A 1HAXB 4X6PA 3RXSA 2FTMA 5G4BA 1AU8A 1UVUH 2FI4E 4A1TA 3SU2A 5EPYA 4A6LA 1ZSJA 1P04A 2ZU3A 5E2PA 1AHTH 1YPKH 3KIDU 1DPOA 4HZHA 1P09A 3RU4T 3M7TA 1EZUC 2B5TB 2ZZUH 1TWXB 3V3MA 1W13U 1AKSA 2PKSB 2V3HH 2M5TA 3HATH 4K69A 2UUJB 5EIYA 3HK6B 1TOCB 3P70B 1ETRH 1BTHH 3ELAH 1DM4B 2OUAA 2OC8A 2ANYA 1K28D 3SNDA 1SB1H 2C8ZB 1XUHA 3VPKA 2GCHG 3UWIA 2R3YA 1Z8GA 4ZAEA 1P01A 4M9FA 1EP6A 1CE5A 1PQ8A 2A7JA 5EQQA 1D6RA 3DSPA 1S85A 1C5RA 2BHGA 1ESBA 2HPPH 4NFEA 4DT4A 2G5NA 4B76A 1DICA 2V0BA 1NRPH 2WPIS 3BTGE 5C67A 1EASA 1A0HB 2WYGA 2KZ4A 1J17T 1FY5A 3SO3A 1TIOA 5PTPA 3PRDA 2DUCA 1A46H 4H42U 1OOKB 1S81A 2BYAX 2OC7A 5C2ZA 4F49A 1F5LA 1B0FA 1FX0B 4Q4LA 3KL6A 3ZV8A 3GCHC 1YPHC 1Z1IA 1TPAE 3F0OA 1QQ4A 3AVZA 3PLKA 2LP6A 1C2DA 2Z3EA 3TJOA 1Q31A 2ESTE 2QGRA 1A4WH 3EE7A 1Z6JH 1T31A 1K1LA 3NZIA 1RIWB 1C5PA 1SQOA 4Y7BA 3TNTA 4DGJA 3H5CB 4Q7ZA 3STJA 1JRTA 3LJJA 3VG8A 2VWMA 5DPAA 2G00A 4LOYH 1YWUA 3LC3A 2H6MA 1W0JD 2K8IA 3ATMA 2YMSD 4BXSA 2SGQE 2A5AA 3KYGA 1FDPA 1JIMA 1CHOG 3QTOH 1W0YH 3LOXA 5DN6D 1ARBA 4I31A 5EU8A 3S9CA 2PTNA 1LHDH 3ATWA 2DE9A 2THFB 2D2DA 4X6NA 4NCYA 1F92A 1WXRA 4ABFA 3U98H 4Z6AH 5HMAA 4DOQA 2ZCLP 2R3UA 1GI9B 7GCHG 4MTBA 2EEKA 1IQJA 3GYLB 1OP0A 2F3CE 4YT7H 1TGCA 1TX8A 2K1QA 4ACAA 3G01A 1SVPA 2HVXA 1YCPM 1ZTKA 3SHAH 4A92A 3F9FA 1D3QB 3STIA 1DS2E 3U8TH 3MTYA 3E0NB 5SGAE 1A5HA 1OXGA 1F0UA 4UFGH 1UTJA 4IMQA 1OYTH 2A7HA 2FOAA 1GMDF 1WAYB 2IJOB 2V3OH 3VFEA 1LQDB 1XKBC 1FNIA 4QT8C 2VJ1A 2WINI 1P12E 2ZKSA 2BTCE 1QURH 2QV1A 1HV7A 2AGEX 2AYWA 4YO9A 3HKIB 4TY7A 1EJMA 2AS9A 8GCHF 1CT4E 4X6MA 4CRFA 1QBOA 1BCUH 3MO6A 4ZUHA 1C1QA 3SYJA 3A85A 4IC6A 1OX1A 2GTBA 3PMAB 1ZHRA 4JK6A 3VB4A 2BZAA 1HLTH 1NRSH 1DWCH 1EPTC 1A0JA 4FUFA 1GBIA 3SQEE 3UUZA 1SPJA 1NT1A 3IG6B 3FP8E 4ISNA 5F8ZA 2Y6TA 1GJAB 3BIVH 1IQLA 2OD3B 4AYYB 1K1PA 4CRBA 2CMYA 3WWBA 1S84A 5ESBA 5C1UA 3KQDA 3QGJA 4D9RA 1FLEE 1GI3A 3ZZ8A 3F2FA 3RXEA 1O0DH 1AN1E 3BEUA 1P0SH 3TJVA 1RTFB 1WTGH 4IN2A 5DK1A 3UPEA 4CREA 2CV3A 2FP7B 1MUEB 1IOEA 1HB0B 3NXPA 4OGYA 3A86A 3BG4C 4TT3D 1G2LA 3URCA 1KYNA 3FOAA 3MYWA 2ZDAH 2HRVA 2W3IA 4BTTB 4X2VA 1AZ8A 1C4V2 1Y8TA 4FUCA 5E0HA 2GMTC 1P3EA 4X0WU 3SHCH 3M7QA 1LHFH 1NFUA 3K2UA 3PWCA 3MFJA 1L4DA 1AO5A 3BTFE 1SFQB 1HYLA 1F2SE 1O2PA 2P8OC 3FKSD 3LGVA 2QF0A 3F1SB 5FXLA 4FU9A 1FIWA 3VXEH 1LKAA 4YESB 1T8NA 4ZKRU 1BMMH 2ZFFH 3QUMP 3TJUA 5JYIA 4YOIA 1IQIA 3GCHB 1H4WA 1NRRH 1C2EA 3BTDE 4Y10E 2HGTH 5A0BA 2OLGA 1BMNH 2GT7A 3EA7A 4X6OA 2QE7D 3CS7A 1SL3A 3KQ5A 2D1JA 4ABIA 1BTXA 2VIOA 1SKYE 3OTJE 4NA7A 4ISLA 1AY6H 2XNIA 1H9HE 2BY8X 4YM9A 1NTPA 1H8IH 3BN9A 4BOHA 2FOCA 1MABB 2GD4B 2BY7X 4JZ1A 4AFSA 1LVBA 4WXVA 3LKWA 3O8CA 2HWLB 1V6DA 3RXFA 1O2IA 4MPWA 1GHZA 1TMBH 3S0NA 1MZDA 1DDJA 4I33A 4ZKOU 1P03A 1V2NT 3LC5A 1ZZZA 4GHQA 4IGDA 1EJAA 1QRWA 2HVYB 2JETC 4O3TA 1MQ6A 2A4OA 2NU4E 4K2YA 1EUFA 4HFPB 2ZECA 3CNRA 1GJ4H 1GMHG 3MO9A 1FMGA 4U32A 1NRQH 1TNIA 4KTSA 1UMAH 1QJ1B 1O3IA 3MNXA 1NY22 3MU8A 3LDXH 1JIRA 1FY4A 3SNEA 2GX4A 3ZZAA 1YLCA 2TRMA 2XC5A 2ZGHA 1MKWK 1TBQH 1V2RT 1C2FA 3MU4A 3QZRA 3SGAE 1GBFA 3S7HB 2KCPA 3ZYDA 1TA2A 3E8LA 1EOJA 4NIWA 2NWNA 1IQHA 1OWKA 4Q80A 3TVJB 3MMGA 3RLWH 3GY3A 1G37A 2ZU5A 1ELDE 1SLXB 2WPJS 3RMLH 2AGGX 1XXDA 2QXIA 1ELGA 3FAOA 3U8RH 3F6UH 2YMSC 2Y80A 4ZXXH 3TK5A 2J92A 2J95A 4XRNA 1D3TB 1H8DH 2J4IA 2OQUA 2UUYA 2Z94A 1LQEA 3L3TA 5CMXH 4Y79A 1EPTB 4OS4A 3O8DA 3GDUA 2IPQX 2W26A 1ELAA 1C1TA 5EXNA 3TGKE 1BRUP 4ZKSU 1V2MT 4KELA 3VGCC 3ZZ6A 2CHAC 2ZF0H 2R0KA 2ZDMA 2OK5A 5DP5A 2FODA 4IMZA 2QXJA 4FU7A 3SW2B 1GJDB 4CHAC 2Q6DA 3FO8D 3LGIA 2W6ID 3A8CA 4AFZA 1ETTH 4X2YA 1KXEA 1Y3VA 2FO9A 1C5OH 3OTPA 4WXIA 4BAQB 1C2HA 1GHYH 4I8HA 3A88A 5LPFA 1XUIA 2ZHEH 8ESTE 1YCPK 1S5SA 4JK5A 4I8JA 1BOQA 6ESTA 2EQNA 1BUIA 4YOJA 5E2OA 2VGCC 1TLDA 2FIRH 3A80A 3SU1A 2FS9A 4JMYA 2A1DB 1O3HA 4KP0A 4Y8YA 3TIUA 5DP8A 2FOFA 5F53A 4XOJA 4D8NA 1S6FA 5C0UA 2ZCHP 1A5IA 4RI0A 1UVSH 3RXRA 1QIXB 1MMJN 1YF4A 2ZNKH 2W6JD 3Q77A 1ACBE 4INKA 5FX5A 4E7NA 2Y5GA 1GBMA 2F9OA 4AB8A 7GCHF 1GBCA 2P8OB 3RP2A 4DJZB 5AF9H 1GHAG 1YBWA 3M3SA 2V35A 3AASA 3SI3H 3KQCA 1NS3A 3PMHB 2ZDNA 3D62A 2ZQ1A 3A7TA 4HTCH 1DXWA 1BMLA 1SGNE 3GICB 3D49H 3AW1A 2J34A 1P9SA 1TFXA 1QB6A 3WWFA 3LONA 2TGAA 3DD2H 2F83A 1KDQB 1TPSA 2CF9H 4DW2U 1CVWH 1AB9C 1IHSH 2BLQA 2RA0A
chains in the Genus database with same CATH topology
1Z8RA 3ODFA 4FXGH 1A5GH 1G3DA 2FYRA 2JETB 4ZHMU 1O34A 4MNVA 1QR3E 1LHGH 4MLFB 4WY3A 3P8OA 1QNJA 2BD9A 3IWMA 1HIAB 1YPMH 4UFFH 1LPZB 3LGTA 3CS0A 1BQYA 1A1RA 4JCNA 5IDKA 3QN7A 3FZDA 4BAOB 1GI5A 1GDNA 3T29A 1O2QA 1VITG 3M3VA 3T26A 2VIPA 1K21H 3UNSA 4ZROA 1O5GH 1QJ7B 2TGDA 3W94A 2UUFB 2C8WB 4X8UH 3URDA 1ELBA 4MQAA 2H1UA 4Z0KA 3SOSA 1W10U 2C90B 4K60A 1V2QT 1UHBB 2STAE 1C2LA 1AWHB 2V6NA 2A32A 1S82A 1C4Y2 1TRMA 2ZTYA 5JB9S 1Z71A 2NU0E 2SGAA 1HCGA 3S9BA 3SU6A 1O2GH 1W11U 3P8GA 1UK4A 3FFGA 1HAOH 5I25A 5BRRE 1ELEE 3A83A 4NIVA 3ZZ9A 2KAIA 1QL9A 3E0PB 3L6PA 2A31A 1SC8U 2XC4A 1FONA 2H2ZA 4KKDA 1G3EA 1MKWH 4AB9A 2EA3A 2RA3A 3I78A 1C2MA 3SU4A 1PPBH 1F0RA 1JOUB 1W7XH 2FXRA 1P2KA 5ETXA 1K9OE 2FMJA 1YM0A 1C5XB 1TOMH 1AQ7A 3UTUH 3VGCB 1HAHH 2CHAB 4UDWH 1ANBA 3SQHE 3A87A 1RD3B 1TX6A 5EG4A 4ABHA 1O32A 1BA8B 1QJ6B 4JZFH 1BZXE 4D76A 1EAWA 1O2LA 1RGQA 2H9EH 1GMCG 4ASHA 3P8FA 1TALA 3A7ZA 1UCYK 1JWTA 1HAIH 1FY3A 4Y8XA 1UVOA 1GJ7B 2VGCB 2ZP0H 1CU1A 4INLA 4UFEH 3SGBE 3BTEE 3SUGA 5EW1H 4NA9H 3TH4H 2AGIX 2ZGJA 4WMFA 2ANKH 1T32A 2UWOA 1WV7H 1AUJA 1ORFA 3PWBA 4CBNA 1C1WH 3A7XA 2ZA5A 1W3CA 2ZFTA 5C5OA 2Z9IA 1GBJA 1SOTA 1GMHF 2SNVA 2XWAA 1C9TA 1FPHH 4UEHH 4PROA 1LDTT 2ZU1A 1KIGH 2PUQH 4WWYA 1O3MA 4LXBH 1O3NA 1O3GA 1UTLM 2UWLA 1FUJA 1LPGB 2ULLA 1GGDC 3SGQE 2F91A 3PLBA 5EGMA 3FP7E 1VCPA 4CH2B 2QAAA 1LCYA 1ANDA 3TGIE 1DE7H 1XUJA 1NFXA 3EA9A 2BDIA 1O38A 2ALPA 3GY6A 2BX4A 1ZR0A 1GHBG 2G55A 3LIWA 2B0FA 4E7RG 2ZPRA 4O97A 3F9HA 1O3KA 4U2WA 5FPYA 2GT8A 4SGAE 3UY9A 4CH8B 2HNTE 3ZVBA 3R3GB 1AB9B 1T4UH 2O8MA 1HBTH 3M35A 1SLWB 2ZU4A 3NUMA 3RXGA 1TB6H 3GY2A 3P95A 1Y3YA 1JMOH 4ZHLU 4K5ZA 4B1TA 3RC4A 2F9PA 4TY6A 2OXSA 2YOLA 1M9UA 3P17H 1O5EH 2VIVA 1Z8JB 2QN5T 4ZHAA 4MPXA 1V2VT 1GCDA 3SV2H 4A1XA 2VWLA 6CHAB 2Z9GA 3SJOA 1OP2A 4OS7A 1LO6A 2AMQA 2ZU2A 2GCTB 1O2SA 2H9TH 1NU7B 2OTVA 1W14U 3BTHE 3RXOA 1H9IE 2P3TB 3SU0A 1VJAU 1O33A 3OYPA 3MH4A 1KLJH 5GCHG 1EB2A 4XSKU 1SGEE 2BDBA 2ZWLH 1BIOA 1Z6EA 1HJ8A 7KMEH 2FI3E 6GCHG 2GDDA 1O2VA 2HALA 2G4TA 2C93B 5DP7A 1E34B 5AFYH 3QLPH 1O2OA 1WQSA 3BSQA 1O2TA 2TPIZ 2WUBA 4R0IA 2O8TA 2CN0H 1DOJA 5JDUB 5EOKA 2AIQA 1GHVH 2XC0A 3U1IB 2QYIA 4B2AA 1FAKH 1PPEE 4K3JA 1EXFA 1K1OA 3UREA 2VVCA 2QIQA 3GCOA 2Z6BD 1GHAF 4D7GA 5CE1A 1V2WT 3OY6U 5DO4H 3BTKE 1MTSA 4M7GA 1C5UA 5HM2A 3LH1A 3E6PH 2BM2A 1JBUH 2ZQ2A 1QCPA 1QFKH 1O2KA 2QCYA 1CHGA 2O8LA 3M5MA 3S7KB 2RG3A 2R0LA 1GJCB 4AG1A 1GI4A 3GCNA 1ZMJA 3E16B 4Y7AA 3MU1A 2FDAA 1W0ZU 3MH7A 5DG6A 4RSPA 4OS6A 4ZKNU 1EPTA 3SV6A 3ENSB 2O8WA 3ATIA 3SJ9A 1LMWB 4I32A 3P6ZB 2VU8E 5LH8A 4NSVA 1SLUB 3ZZBA 1AGJA 2OC1A 3SV8A 4NFFA 5EXMA 1Q3XA 2SNWA 3BTTE 3ZV9A 1RRKA 4TPIZ 2RDLA 3ZYEA 1UCYH 1C5WB 4A7IB 3P92A 2BD7A 1VITF 1RS0A 1BTZA 1ZSLA 1GGDB 4BAKB 1E38B 5C1XA 3MWIU 3SBKA 2BLWA 1W12U 3LT3A 1HPGA 1PPCE 5GPIB 2F9NA 5A8ZA 2EC9H 4MNXA 1QBVH 1HAPH 2FOEA 1VGCB 2WPKS 1DSUA 3C27B 2PTCE 8KME2 2P16A 2BD2A 2BVSH 4K1SA 5DP3A 2FS8A 1GDQA 1TNHA 4GSOA 4X1NU 1OPHB 2QA9E 2P95A 2GV6A 1EZXC 1DX5M 4E05H 3RXMA 3V12A 4AGKA 1D6WA 4J2YB 1B7XB 3RXPA 1G3CA 2Q6FA 1K1IA 2W5EA 3UNRA 1RXPA 3K6YA 1GVLA 1ETSH 4X2WA 5BPEA 5E0JA 1KTTB 3KN2A 1DANH 2XBWA 5A8YA 1O3OA 1PQ7A 2NU3E 3KQEA 2ILNA 1MH0A 1ELFA 3RXIA 1LVYA 3MU5A 4KTUA 3KNXA 2YNAA 1MD7A 2F9VA 3TJNA 1V2LT 3NKKA 1MZAA 1A2CH 1RTKA 3B23B 5FCKA 4JZEH 2UWPA 1SGTA 1AMHA 4FVDA 4K8BA 1NPMA 4NG9H 2Z7FE 1ABIH 5F8XA 4NSYA 1KDQA 2BLVA 2BOKA 3U8OH 1GL0E 1C2IA 1CT0E 1GMCF 4THNH 2QC2A 3KHVA 1QA0A 1JRSA 5GWZA 1WSSH 3T2NA 1UTPA 1O2YA 1ZOMA 1GI2A 3QWCH 1SI5H 1L4ZA 1B0EA 1ZGVA 4MPVA 4BNRA 5GDSH 1SGFG 3UNQA 1DY8A 4RKJB 1HAYB 1MBMA 2ZDKA 2GV7A 4GVUA 1AKSB 4XBBA 4X1PU 1DWEH 2BQWB 1C2JA 3WY8A 4AFQA 4MNWA 3PM3A 4TWYA 1GDUA 1Y3WA 1S0RA 3AAVA 2VVVA 5AFZH 3HKJB 1J16A 4YLQH 2ALVA 1SHHB 1ELCA 1W7GH 4GAWA 4FUIA 3PMJA 1UHBA 4MPUA 1WOFA 3S69A 1GJ6A 1C1NA 1TABE 2BY5X 2I6SA 2QF3A 1MCVA 1BBRK 1G36A 6LPRA 1SBWA 3MHWU 2FM2A 2FOHA 1C5NH 1MBQA 1GJ5H 2ANMH 1TBRH 3GY8A 2ZFPH 1GHBF 1V2OT 3Q3YA 2PUXB 1NC6A 1MU6B 2FPZA 3KEEA 1P2MA 3UFAA 5CHAC 5HM9A 2W7UA 2RCEA 3M37A 4B71A 5FAHA 4ZH8A 3BEIB 3ZZCA 5ABWA 1KTSB 1ZHPA 2B8OH 3T25A 5HGGA 4J1YA 1CGIE 3QGNB 5GJ4B 3SJKA 5EXLA 1BTPA 1H9LB 1P2IA 4JYVH 1MKXK 4CRAA 4OGXA 1GPZA 1O39A 1ARCA 4D7FA 2ZDLA 2A2QH 2WV4A 2ZPQA 1C1VH 2NU2E 3U69H 1ABJH 1SGPE 2GCHF 2FZZA 1BMAA 1KXFA 2OCVB 1O2UA 2Z9KA 2A2XH 2FI5E 2C8YB 4MDSA 1XX9A 3SJIA 3MH6A 3ZVEA 4IW4E 1N1LA 1IQKA 3B9FH 2SGEE 1QB9A 4NA8A 2AFQB 1RFNA 1NFWA 1ZHMA 4X2XA 1MD8A 2FTLE 3A7YA 5GCHF 3EAJA 3KQBA 1PQAA 1DLEA 4VGCC 3AW0A 3UIRA 1KY9A 2FX6A 6GCHF 2A4QA 3NWUA 4ZXYH 1C1MA 2HPQH 5GIBA 2Q6GA 2ZO3H 4ABDA 5T6FA 3SJ8A 2Z9LA 2ZFRH 1YPEH 5DGJA 2ZHFH 2D26C 4BAHB 3V0XA 2BQ6B 1N6XA 2A0QB 3RXVA 2PFEA 1KLTA 5DP4A 2P59A 5FCRA 1P57B 1O2RA 3A7WA 1SGQE 4WVPE 1YGCH 1TBZH 4YLUA 1WQVH 1C5LH 2BD8A 1BHXB 1C1RA 4Y0ZE 1CHOF 3V7TA 1UK3A 3MH5A 3RMOH 1XUFA 3SZNA 1TGTA 4AGJA 1AIXH 1K1MA 5HXFA 1CO7E 1V2ST 1GJ9B 1SOZA 3S9AA 1PPGE 2XCFA 3BTME 1W8BH 1P9UA 1DLKB 1FAXA 2Y5FA 5JBTA 5TJXA 4UE7H 1C5ZB 1O2JA 1DXPA 1UVTH 2HNTF 1GHXH 3EE0B 3ZZ4A 5A0CA 1GVZA 2G52A 4BTIB 1TGNA 4NZLA 5DP6A 2ZGCA 1GI0A 2G8TA 3CENA 1EB1H 2HOBA 1TNLA 1A3EH 4AORA 2AEIH 1VJ9U 4A1VA 3B8JA 1QQUA 1GBKA 1ZYOA 3RXUA 1BITA 1P10A 1QA7A 4DY7B 1O3BA 4INHA 1NO9H 3F9EA 4WH6A 1CA8B 3E1XB 1HJAC 3RXKA 2JKHA 2WPMS 3W95A 1ZRBA 1ESTA 1QY6A 2GZ9A 1YC0A 3LPRA 1IQFA 1ZLRA 2B7DH 3PTBA 4AFUA 1CSOE 3Q00A 4K1TA 6CHAC 1FQ3A 2HNTC 5CHAB 4I8LA 2VWOA 5EW2H 3AAUA 1OKXA 2GCTC 5JBCS 5DP9A 4NIYA 3ODDA 1VR1H 4ESTE 4JYTA 1BBRH 2Y82A 1MQ5A 2BB4A 1OWDA 3OX7U 2Y7ZA 3SORA 1BDAA 8GCHG 1AUTC 1T4VH 3PV4A 1Z1JA 1L0ZA 1GG6B 4OS5A 1AZZA 1GHWH 2BMGB 1ID5H 3PLPA 2ZDVH 2O8UA 1HAVB 1EKBB 1O31A 1OYQA 1L2EA 2FX4A 5FBIA 4K8YA 1AFQC 4SGBE 1EP5A 1ZPZA 1Z7KA 4AN7A 1KXDA 1KXCA 3OSYA 1MKXH 1UTKA 5JB8S 4B75A 3GY5A 2GVFA 1E36B 3F9GA 3PMBB 4Q7YA 3FVFB 2J94A 5IYTA 2VNTA 1TPPA 4VGCB 4CRCA 1RJXB 1L1GA 1O5FH 1MU8B 2CGAA 1O3EA 1S6HA 1Y5AT 3TH2H 1FN8A 1TMTH 3QDZB 1EQ9A 1GCTC 1W2KH 2FWWA 1LHEH 3A84A 1TNJA 3GY4A 2VH6A 3DFJA 2BVRH 1HGTH 3NCLA 1SGFA 1FXYA 3EGKH 2AIPA 1OSSA 2OQ5A 5F8TA 1O3AA 1MTVA 1HRTH 4OS1A 4Y6DA 1P05A 5LPEA 1UTOA 1Y3UA 3EQ0H 2BDHA 2VH0A 4DIIH 2QXHA 3O8RA 3VB7A 1LVMA 3SNAA 2ZTXA 2CXVA 4ISOA 2ZHWH 1F5RA 2R9PA 4BANB 1T8OA 2ZHDA 4ABAA 5A09A 2XCNA 1YCPH 3RXHA 1ZMLA 1NZQH 2VWNA 3SV7A 1C5VA 5B6OA 4Y0YE 1TPOA 4LK4A 1QTFA 3F68H 2Z9JA 4DG4A 3HGPA 1EAIA 4JZDH 3ESTA 2XBYA 2XBXA 1UTNA 1Y3XA 2XTTB 3E3TA 1XKAC 2BDCA 2WUCA 1C1SA 8LPRA 5LGOA 1UCYE 3LH3A 1CA0B 3M5OA 1VGCC 4HI3A 5GXPA 4GCHG 2PW8H 4AYVB 2BXTH 3A7VA 4LZ4B 1WBGB 1XVOA 2BD5A 1CBWC 1HXEH 1P02A 1S0QA 2TGTA 4X8SH 3T27A 1MTUA 5ESTE 3SV9A 5L2ZH 2O9QA 3MNSA 5AVDA 3M36A 3U1JB 4YZUA 3M5LA 1HJAB 5J4SA 1UTMA 4CRDA 2PLXA 4CR9A 4TYDA 1H1BA 3RXAA 1EATA 1GI8B 1T7CA 3T28A 2I6QA 1NN6A 3H7OA 1TX7A 3NPSA 4WMEA 3RDZA 1DUEA 1C4U2 1DWBH 1GL1A 2ZEBA 1F0TA 1O3JA 2JH0D 3BV9B 4NWKA 5E8EH 2G5VA 1Y5BT 3PO1B 4NIXA 5C3NA 2BY6X 2FOGA 1C9PA 1C1OA 1LHCH 1HXFH 1NRNH 1AE5A 3TH3H 1TAWA 3ZZ7A 4X8VH 3K65B 3ITIA 1MCTA 3E91A 1KSNA 1BTUA 1HNEE 2P93A 2ZGBH 1OWIA 1K1NA 1ZRKA 1PPFE 3RXCA 5T6GA 3A8BA 1WYKA 1P2JA 1XM1A 2PKAB 3M3TA 3D65E 2GZ8A 1SSXA 4H6SB 1YPJH 3RUOA 1TQ7B 1BRCE 2PGBB 1MTNC 2J38A 3NK8A 2C4FH 3IITA 2ODPA 1DSTA 1GI1A 3TK6A 1XUKA 1SGIB 1AFQB 4DIHH 3JZ1B 1A0LA 1PQ5A 2C3SA 1FN6A 2BD4A 1C5QA 1TRYA 1J9CH 1KXBA 1GWAA 1SFIA 3LGWA 1THRH 1V2UT 1WCZA 5L2YH 5FPTA 1T8LA 1G3BA 3Q76A 1DFPA 4U01A 3DA9B 4E06H 1V2TT 2PGQB 1GCTB 2OINA 3FZZA 1IQEA 1K1JA 1O3DA 3KGPA 2AMDA 2FOBA 3KCGH 3PROA 1SLVB 1CQQA 1HAGE 1AD8H 1BJVA 2H5DA 5C1YA 2BZ6H 1P8VC 5FX6A 2BDAA 2VIQA 2ZFSA 2XRCA 1QRZA 1D4PB 1QRXA 4UONA 4AG2A 4A5TS 1AFEH 5JBBS 3RXBA 1IQNA 2A4RA 3M7UA 1L1NA 2KAIB 3GCTG 1L1JA 3TGJE 2W3KA 3PB1E 1WTHD 3RU4E 3RXQA 1K22H 2SGDE 1WU1A 2EI8A 4FUEA 2TGPZ 1AWFH 1EX3A 2UUKB 1C5SA 2PV9B 1NFYA 1IQGA 2VB0A 5JBAS 2JH5D 1C5MD 3SUEA 2D8WA 3CP7A 4FUDA 1O3FA 2VIWA 1SQTA 1O37A 2Q1JA 1HAZB 1SGDE 4DURA 2VIDA 1BHXF 1ANCA 1P2OA 3C1KA 1IQMA 3DUXH