1AZZA

Fiddler crab collagenase complexed to ecotin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
226
structure length
226
Chain Sequence
IVGGVEAVPNSWPHQAALFIDDMYFCGGSLISPEWILTAAHCMDGAGFVDVVLGAHNIREDEATQVTIQSTDFTVHENYNSFVISNDIAVIRLPVPVTLTAAIATVGLPSTDVGVGTVVTPTGWGLPSDSALGISDVLRQVDVPIMSNADCDAVYGIVTDGNICIDSTGGKGTCNGDSGGPLNYNGLTYGITSFGAAAGCEAGYPDAFTRVTYFLDWIQTQTGITP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLLAGENASE
publication title Crystal structure of an ecotin-collagenase complex suggests a model for recognition and cleavage of the collagen triple helix.
pubmed doi rcsb
molecule tags Complex (serine protease/inhibitor)
total genus 50
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.32: Brachyurin.
pdb deposition date 1997-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1azzA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1azzA01
1MKWK 4NZQA 3SJ9A 1KXEA 3SV8A 4CRBA 3URDA 2GZ7A 1KYNA 5GWZA 4QT8C 2AMDA 1C5YB 1VCWA 3ATLA 1ZYOA 1Y5BT 1GVKB 1TLDA 2TIOA 3A8CA 1Z8GA 1SFQB 3M3SA 3SU6A 4CREA 1WTHD 1C2JA 1QNJA 3TJUA 1E35B 3QWCH 1E0FD 4BTIB 1D4PB 1EAIA 3I78A 1P8VC 2V3OH 2GV6A 3PO1B 1AKSA 2VWNA 2FOCA 3RXKA 4D9QA 2Y5GA 1O3HA 1DSTA 3QGNB 2TGDA 3U1IB 1GHZA 5A0BA 1BHXB 2XBXA 3URCA 3AW1A 3ESTA 3Q00A 1RFNA 1V2OT 2FO9A 2FMJA 1F0SA 3OYPA 8ESTE 3G01A 4FUGA 1C5LH 2J92A 1S6HA 2P3FH 1J15A 4B1TA 1V2UT 1O35A 1O38A 1DY9A 1SGRE 3HK6B 2IJOB 4LXBH 4TPIZ 5J4QA 3EA8A 1XMNB 1ZSLA 4AB8A 1O3PB 2D2DA 1BT7A 2ZDVH 2P8OB 2K1QA 3F68H 2JETB 1MQ5A 1O3KA 3ZZ4A 2OBOA 1V2MT 1TNHA 3FAOA 4K1SA 1MTSA 1O2JA 3O8RA 4UEHH 3KL6A 2WPKS 1ACBE 1C5UA 2ZTYA 5C5OA 1H9IE 1YF4A 1S0QA 4DW2U 1W0ZU 2BTCE 1F5KU 3LGYA 1FIWA 3P8GA 3MO3A 1C2FA 4CR5A 3BG8A 2RA0A 2SGAA 2GMTB 3UWJH 1S83A 3KIDU 7GCHF 3OTJE 4KTSA 2VVUA 5C67A 2ZU3A 2B9LA 2G5VA 1YPLH 5T6GA 2A5AA 2CGAA 3TGKE 3M3VA 1C2IA 1C1VH 1IQHA 1YPHC 3A83A 2VWLA 1T4UH 5TCAA 3SGQE 2ZWLH 5GDSH 3UFAA 1XVOA 3BTHE 4K8BA 3RU4T 3QZRA 3EA9A 3TIUA 3RC4A 3TJVA 2ZQ1A 4B71A 1NC6A 2EC9H 3MH4A 4IC6A 2ZFRH 1BRUP 3BF6H 3HGNA 2Q6GA 1T32A 5BPEA 4E7RG 2BDHA 3HKIB 2UUYA 1SLUB 3K6ZA 3TK5A 4Y7AA 3MFJA 2QF3A 3MU5A 1QBVH 1A1RA 4MQAA 4OS2A 4Y8XA 3GCOA 3KQBA 1YKTA 4ABIA 3FP6E 4VGCC 4X6MA 1EZSC 2FYRA 1C2MA 1J17T 4KTUA 4X1SU 4WY3A 1WOFA 4DOQA 2QYIA 7ESTE 1MTUA 4Y79A 1G3CA 2FX6A 5TJXA 4DG4A 2P3UB 2FLBH 2CV3A 1GMDF 2SGPE 2OTVA 1SLWB 4TWYA 2AEIH 2ZI2H 4BXSA 1LTOA 1LQEA 1YPEH 3GCHC 3EYDA 4Q80A 2C90B 4HGCA 3SU4A 1O3AA 3LGUA 3RXGA 4HFPB 1QA0A 2VB0A 1MTNB 2BDAA 1YGCH 5GPIB 1A0LA 4K60A 1L1GA 1QL9A 4M7GA 3KF2A 3SJ8A 1TPAE 4I8LA 1BCUH 5EXLA 1ELDE 1Z7KA 3GOVB 3LGVA 1QRWA 1OYTH 1UVSH 2ODQA 1BTXA 1C9TA 3BSQA 2G5NA 1P2MA 1P2QA 1EUFA 1OP2A 1Y5UT 1QQUA 1JWTA 2HVXA 1C2GA 3SQEE 1HAGE 2ANMH 1WCZA 1F0TA 4Y10E 5DPAA 5JDUB 2VIDA 2B7DH 4AFSA 5FHTA 1D3PB 2OUAA 1WU1A 2TBSA 3ZVGA 2WINI 2PHBA 1O3IA 5F8ZA 4WF8A 2HRVA 1IQJA 3P95A 3Q76A 1O3NA 2H5DA 1K1MA 2FWWA 2AYWA 4A6LA 3PWCA 1DDJA 4CH2B 3QZQA 1BTUA 1KXFA 1C5VA 3HGPA 3KNXA 3ZZBA 1FUJA 1ETRH 1JBUH 5EW1H 4YOJA 1HAHH 3ZVEA 1RD3B 1GBAA 1ANDA 1NESE 2GCHG 2ZHEH 1H8DH 2BZ6H 4MPWA 4IBLH 3MI4A 3RU4D 4BOHA 1SSXA 1YCPM 2W26A 1TQ0B 2HGTH 1DLKB 1VCPA 2ZDAH 5I25A 1JIMA 2UWPA 2GT7A 1O31A 1IQFA 1MCVA 1GBCA 1ZHRA 2GGVB 1ZTLA 4B74A 3LT3A 3GY2A 1W0YH 1QJ1B 1WQSA 1IHTH 3TGJE 2F9VA 1OXGA 3BTGE 5EW2H 2VINA 1CE5A 2QCYA 3TH3H 3KHVA 3PMHB 1Y59T 3RXLA 1ZPZA 1TNGA 4INHA 1LKAA 3SNCA 1SOZA 3MTYA 1WYKA 1PJPA 2P93A 1NROH 2H9HA 1GI6A 3NXPA 3KQEA 4KELA 3BTTE 4A1XA 2ZGBH 3DA9B 1O3LA 4R0IA 1EZQA 2O8LA 1C5OH 4MNWA 5H4IB 1NT1A 1QB1A 3BEIB 2FS9A 2EI7A 3LIWA 3B8JA 5PTPA 2ASUB 1AUTC 1HJAB 5A2MH 1XUJA 1K1NA 2BD8A 3SV9A 2O9QA 2WV4A 1B5GH 3LOXA 3IWMA 1O39A 1EJAA 2ULLA 4AGJA 3M37A 1A0JA 1WBGB 1NS3A 3P92A 4MPVA 1ABJH 1NM6A 2A31A 5HM2A 2HPQH 3EA7A 5LGOA 1A5GH 2VGCB 2ZECA 3VEQB 3RC5A 2A0QB 1BRCE 3ZZ3A 1HCGA 3FP8E 4H42U 2R9PA 1K2I1 3PTNA 1KTSB 5F6MA 1EP6A 2XWBI 3KQDA 5C20A 1MU8B 3A86A 1S6FA 5C5NA 1ZLRA 3D62A 1TNKA 2R3YA 1ANEA 3OSYA 1P02A 1INCA 1Z1IA 1TYNA 4FUCA 1NRQH 1AO5A 2LPRA 1TRNA 3RMMH 5FAHA 8LPRA 1UJ1A 2BX4A 1SVPA 1TA6A 4FUEA 5EGMA 1LHCH 3RMNH 4AB9A 1ZRBA 4D7FA 4X8UH 4Y7BA 3ZYDA 9LPRA 2ODYB 1ZJDA 3VGCB 5L30H 1AVGH 3KEEA 3FANA 1EPTB 3K2UA 2FOAA 1FV9A 3RXIA 1GDNA 3DUXH 3OU0A 4UFFH 3CP7A 5GCHF 1A0HB 4BTUB 2DE8A 2TPIZ 1OX1A 3N7OA 1DXWA 2EA3A 2C3SA 3SI3H 1ZHMA 1F2SE 1UTKA 3UY9A 1HV7A 2G4TA 1RTFB 2OC7A 2C4FH 1SQAA 1HDTH 1Y3WA 1HIAB 1QL7A 1P3CA 1UK4A 3MU0A 3ZZ6A 2XBWA 3CENA 4CRGA 2CMYA 1EQ9A 3ATIA 2P59A 1UTNA 3EAJA 2A1DB 3AAVA 4X2WA 1G2LA 2XBVA 2P16A 3M5NA 4ISLA 4CR9A 1AIXH 3LDXH 1OYQA 1C5NH 2XYAA 1BBRE 3ELAH 4J1YA 2Z3CA 1SGIB 1V2PT 1UK2A 1BIOA 3CS0A 1O3JA 4CHAC 1C5QA 5DP6A 1TMBH 2H2ZA 1GBKA 4X6PA 1EASA 1A2CH 1TOMH 3IITA 1P2JA 1GHBF 1EAUA 1ZOMA 3U1JB 3NUMA 2TGPZ 1SGTA 4YOGA 1GJ6A 1MBQA 3GCTF 2VH6A 1GG6B 3QN7A 3UWIA 3PMAB 5CE1A 5EQSA 1AVXA 2Z3DA 1VJ9U 1LMWB 1KTTB 2ZZUH 1MZAA 3RMOH 4U01A 5E0GA 1KLIH 2VIVA 3FZZA 4U2WA 4NIYA 3DFLA 3BTFE 4I33A 1GI9B 2XTTB 1A46H 3T25A 3UR6A 1UCYE 1QB6A 2VIWA 3A80A 1O3DA 2FOMB 1DOJA 1XUHA 3Q3YA 4Q7XA 4NA9H 1RIWC 2V0BA 4HTCH 1C1RA 2NWNA 5SGAE 3K9XB 5T6FA 2BY7X 1BTYA 2P95A 2A45B 1UO6A 2ZCHP 1CGJE 1DM4B 2O8UA 3GDSA 1HUTH 2D26C 1TALA 4K1TA 4AOQA 3E0NB 5DP5A 2QXIA 1DSUA 1KDQA 1BTZA 1F0UA 1K1PA 3TH4H 4YOIA 1HGTH 1EOLA 2SNWA 5BRRE 1GJDB 4JK5A 4ZMAH 5K0HA 5T6DA 1MD8A 1YCPH 3L6PA 3SU1A 1H9HE 1TIOA 2SGFE 2TGAA 3NPSA 3GY4A 1CT2E 2XC5A 1TONA 3GCNA 1OWIA 3GCTG 1C1SA 2WPMS 2VJ1A 1W10U 2F9OA 1K28D 1GDQA 1ZJKA 3M36A 2Y6TA 1NU9A 4BAMB 1DS2E 3KCGH 1SC8U 3BTDE 5E2PA 4FU7A 2EI6A 3HKJB 1J9CH 3GY5A 1YBWA 4BXWA 3VB5A 1S81A 3ODFA 1TNJA 2AMQA 1O2KA 4BAKB 1ETTH 3OY5U 1TRYA 1AZ8A 2AERH 4X8SH 2SGEE 3RXFA 1G3EA 3SUDA 1P9SA 4XBBA 4HZHA 4JZ1A 4CRCA 1SPJA 1EPTA 1GDUA 2FI5E 3KQCA 1GJBB 2GT8A 1G9IE 1NRSH 3RP2A 4D9RA 3RLYH 4J2YB 5FBEA 4ABHA 4JZIA 1NFXA 4K2YA 1GBEA 2ALVA 2W7UA 1F7ZA 4I8HA 4AX9H 1XM1A 1O2PA 4A5TS 4DY7B 4IN1A 4AFUA 2UUKB 4INLA 1FPHH 4FUIA 4LZ1H 3A8DA 3TLOA 3P6ZB 5C1UA 1HIAA 1EZXC 1QL8A 2QN5T 2ZDMA 1O5EH 5JPMH 3RXTA 1CHGA 1A3EH 1GBMA 1Z1JA 1A5HA 2ZHFH 1QA7A 3QUMP 3MNSA 2HNTC 2M5TA 3PMJA 4CBOA 1HXFH 1QRXA 5FPTA 3SUFA 3SHCH 1NRNH 1RTLA 3A81A 2GTBA 3H7TA 2BDIA 1CVWH 2HNTF 3RC6A 4NA8A 4BNRA 1ZTJA 1ESAA 1QY6A 1QB9A 5FCKA 1V2LT 1BBRH 2QXJA 1QURH 1KLTA 1N6XA 1FPCH 1UTOA 4Y0YE 1LHGH 3STJA 4NCYA 3TGIE 2BY9X 2ZDLA 1V2KT 1DFPA 3LGWA 1P03A 4GHTA 1C1PA 3DT0H 2SFAA 4FXGH 1QGFA 2ZFPH 2PV9B 4JYTA 5EG4A 3E8LA 4I8GA 1GVLA 1UMAH 5EQRA 1UHBA 1AE5A 1HBTH 2KAIB 3SU2A 2B5TB 1E34B 2ZDNA 4B2CA 1CGIE 1V2VT 1H4WA 1TGNA 1VR1H 2ZHDA 2VWOA 5AFYH 1W11U 1S82A 3PLKA 3K6YA 1TQ7B 1HAZB 3BN9A 4WMEA 1PPFE 3E1XB 1V6DA 4WWYA 2ZDKA 2PSXA 1LQDB 1UCYH 1KXCA 3TNSA 3TITA 1MZDA 1MKWH 4YTAA 1SQOA 1H8IH 2QXGA 2VIOA 3UQOA 4B2BA 2YOLA 2ZFSA 4X6OA 3QDZB 1UTPA 1FY5A 1O5FH 2PUXB 4GSOA 3M35A 3U69H 6ESTA 1ANBA 1A61H 4O03A 4YLQH 3AVZA 1TNIA 1RGQA 4GVUA 3E0PB 3ATMA 3FFGA 3U9AH 3SUGA 1O2XA 1GHAF 2XW9A 2GCTC 4TY6A 3QTVH 3E91A 4F4OC 3GDUA 5A8XA 3M3TA 1HPGA 4OGXA 5DGJA 1Q2WA 3SU3A 4Y0ZE 3D23A 4X6NA 4NG9H 2ZG0H 3O8BA 1VITH 3ZZ7A 2BY5X 1GBDA 1AD8H 1AFQB 1PQ7A 1QRZA 5HM9A 3A84A 1Q31A 3P8OA 5JBAS 2GZ8A 2R0KA 1YPKH 3RLWH 3SV6A 2A7CA 2B0FA 2BY8X 1QIXB 4MNVA 2H9TH 2QA9E 3MOCA 5FXLA 3P17H 1UVUH 2Z9LA 1QBNA 1TMUH 5ABWA 3A7WA 4WJG2 3QGJA 3ZVDA 1GMHF 1O2MA 5DJ7A 1W3CA 4NFEA 3VB6A 2V3HH 3NK8A 1GHWH 1S5SA 4I32A 3PO1C 2C8WB 2FEQH 1DWCH 1TOCB 1TX8A 3L3TA 1GHAG 2OXSA 3RXOA 1RTKA 4JZEH 4ZH8A 2BD5A 1XVMA 1N1LA 3SUEA 1T7CA 3A7YA 1HJ9A 4LZ4B 1C1MA 2NU1E 5FX6A 4ZAEA 1TBQH 4Q7ZA 1BHXF 1LHFH 2ZPRA 2PGQB 3SGBE 4YO9A 1FONA 2Z6BD 2BLOA 3E16B 4X0WU 4AYYB 2R0LA 1DVAH 3BIUH 2XC4A 2GCHF 1IQLA 1P2IA 1NTPA 3T29A 1BJVA 4WH6A 3MYWA 4JCNA 2STBE 1JMOH 4FU9A 3H7OA 4E06H 3MU1A 2P8OC 1HAXB 3RXJA 1IHSH 1PQ8A 1ORFA 2VIPA 4BAOB 1W7XH 1TNLA 2JETC 4FUDA 4IGDA 3EE0B 1OSSA 4D8NA 1E38B 1C4Y2 3R0FA 1GPZA 2A4OA 1T8LA 3QK1A 5ESTE 3STIA 2F91A 1UTQA 4ABFA 1GMHG 1N8OB 2QIQA 3S9BA 3FVFB 4F49A 1UVPA 1GBBA 2BZAA 3I29A 1LDTT 2GMTC 1DWDH 1ELBA 1K22H 5ESBA 2KAIA 3UTUH 3RXCA 4GHQA 1ZTKA 2DUCA 2ZU4A 4DJZB 1DWBH 1GBIA 3GYLB 2GX4A 3PV4A 3ZVAA 1CSOE 4GCHF 3TNTA 3I77A 1UK3A 1FY1A 5CHAB 1GI7B 2PTNA 4MTBA 2BDBA 2A4RA 2HALA 1FN6A 3NZIA 2A32A 2HOBA 4Z6AH 4NZLA 4ZROA 1K1IA 1C5WB 4U32A 1LHEH 1QR3E 2W3IA 4NIVA 3SN8A 2CHAB 2FDAA 2C93B 3ZVCA 5LH8A 4SGAE 2ODPA 1O37A 2YNBA 1Z8JB 3SV2H 6CHAB 1GCDA 1TPPA 2UUFB 5FPYA 4U30A 2F9NA 1MH0A 3QO6A 4LK4A 4WXVA 7LPRA 1ZGIA 4X8TH 2ZNKH 2Y5HA 4O97A 1LPZB 4NA7A 2UWOA 2R3UA 3CS7A 2NU3E 4SGBE 1PPEE 3TK6A 1WAYB 4ABGA 2JH6D 2ZU5A 1EX3A 3W95A 1O5CB 4ABAA 1HNEE 4TWWA 2F9BH 3ZVBA 2XXLA 1GHVH 1NRRH 2AGEX 4ZHAA 2RG3A 3T2NA 4I8JA 2ZGCA 5JB9S 1IQIA 1PPBH 1S85A 1ELFA 1GVZA 1HAVB 4KKDA 4K8YA 1RXPA 1C5RA 4GCHG 1LO6A 1SLXB 3VB3A 2W5EA 1FIZA 2Z9JA 4AG1A 1XUGA 2FYQA 2G81E 4CRAA 1VITG 1ZPCA 2BD7A 1D3QB 1O2WA 2Z94A 5A8YA 3MNXA 5DKMA 4THNH 2BHGA 3LH1A 3ITIA 2BYAX 1SGNE 1ESTA 1O3MA 1MTNC 1SQTA 4OS6A 2AGGX 3PROA 1EJNA 2WYGA 3DHKH 2AS9A 4BANB 3HK3B 1AWHB 5FCRA 4DVAU 1O2YA 2ZFTA 5GJ4B 4NGAH 1ZSJA 1ZMJA 1WTGH 4NIXA 1EAWA 1QQ4A 3DFJA 4E7NA 1J14A 2FPZA 2Q6FA 1XXFA 2FM2A 3SU5A 1BMNH 4ISHH 4GAWA 3TJOA 4UDWH 1LPKB 1TA2A 1AHTH 1G30B 3Q3XA 2SNVA 5LPRA 1TFXA 4E05H 1J16A 1OWEA 1SI5H 1KXDA 1LKBA 1O2ZA 1ZGVA 1TGCA 3ZZCA 5A0AE 1YYY1 1ARCA 3BG4B 2CN0H 3M5LA 2ZEBA 4RSPA 4WVPE 1DY8A 3SNDA 3F9FA 1PQAA 4ABJA 2H6MA 3RXQA 4ZXYH 3RXSA 1SBWA 1C4V2 2WUCA 2XCFA 3SW2B 3ZZAA 1H9LB 1C2DA 1ZHPA 1NFUA 1GJAB 2Y82A 1TPOA 3RXHA 1GL1A 4YZUA 1WSSH 8KME2 1MUEB 1ESBA 1NZQH 2AMPA 1FY3A 1OP0A 2A7HA 2CHAC 2ESTE 4ZKSU 4H4FA 1BMLA 3D65E 2BVXH 2Y5FA 3LC3A 2BQWB 1DICA 2VWMA 1VGCB 3RMLH 1P11E 2F3CE 1CT0E 1B7XB 1ZMLA 1G36A 1Z71A 2DE9A 1SB1H 1G2MA 3M61U 3M5OA 3O8DA 1P2NA 6GCHG 2QGRA 1O32A 3S0NA 1THRH 1FLEE 3W94A 3T62A 1O3CA 4ABDA 4XSKU 1CA0B 4X1RU 3UNRA 1HJ8A 3EQ0H 5AVDA 1VZQH 5DP8A 2FOHA 1YM0A 1BTPA 1AB9B 2UUJB 1YPHE 3GY6A 4RN6A 1GGDB 1FY8E 2PR3A 4FU8A 1FAKH 2QV1A 4UFEH 1O2NA 1BJUA 3VB4A 1ZMNA 1TBRH 2FOBA 1OKXA 4MDSA 2R2MB 1F5RA 1GCTB 1GI8B 3U98H 5C2ZA 1HB0B 1BTHH 1O2HA 3ODDA 2PGBB 2ILNA 3U8TH 2ZHQH 1P01A 3F1SB 1HJAC 3PMBB 3UIRA 3HPTB 2C8ZB 1YCPK 3UOPA 3AAUA 2YNAA 1DX5M 2GKVE 3MO9A 4XOJA 2BDGA 3RXVA 1AUJA 2O8MA 1JOUB 1BTWA 2GDDA 2HWLB 3PLPA 2VNTA 2XBYA 5T3HA 1MQ6A 3UUZA 3SU0A 4A1VA 1HAVA 1AU8A 1SGFA 2BOKA 3AW0A 1NRPH 2PTCE 2RDLA 2VGCC 1W12U 5F8XA 3RXEA 5E0HA 1AY6H 4OS5A 3PTBA 1QJ7B 1SGQE 2H1UA 3SI4H 3E90B 2GD4B 1V2ST 3A8AA 1SR5C 3MH6A 3VPKA 4DURA 3NCLA 2OD3B 5A8ZA 2ZGHA 4ZXXH 1LHDH 2P3TB 1ELAA 1GL0E 1S84A 4R8TB 3EGKH 1KY9A 5EPYA 3T28A 2WPIS 1SGFG 1FZZA 2OLGA 2OP9A 2NU2E 4DGJA 3C27B 1UVOA 4Q7YA 1NO9H 1BUIA 2A5KA 3TK9A 5DO4H 2BOHB 1GMCF 1GJ5H 2GVFA 3M7UA 1Y3UA 1MKXK 5E2OA 2J38A 1O2TA 1FDPA 3VGCC 2J9NA 1E36B 1EPTC 2THFB 1TE0A 1C1TA 1BQYA 4ZKNU 5AF9H 1Z8RA 2H9EH 1WUNH 3UNQA 2ANYA 4MPUA 5LPEA 3A8BA 3RU4E 4Y11E 1EB2A 1BA8B 4DCDA 2FTMA 4B75A 4IN2A 3SGAE 1JRSA 4X2YA 1CGHA 4CRDA 3P70B 1JXPA 2Y7XA 1FY4A 3KGPA 3MHWU 1C1QA 1TPSA 2BXTH 3BTEE 1EXFA 3MO6A 1HRTH 4BTTB 1TGSZ 1GI0A 2UWLA 1DITH 4WMFA 3VFEA 3F6UH 4XFQA 1CHOF 2FS8A 4JYUH 3NWUA 2J94A 1SGDE 4RKOB 1O3EA 1AQ7A 1IOEA 1L2EA 3RXPA 1GCTC 3H5CB 1GMCG 2JKHA 2G55A 1U6QA 3SOSA 2Z9KA 1HAOH 1L1JA 4JMYA 4WMDA 1O34A 3MNCA 1CQQA 3SHAH 3PLBA 1GG6C 2SGDE 1BDAA 4ISOA 4MNYA 4Q2KA 1C5SA 1SMFE 2CF8H 2I6SA 1G3DA 4TY7A 4B2AA 1KXBA 1T4VH 1O33A 1ELCA 4KTCA 2R2WU 3QX5H 3RXRA 1EJMA 3F9HA 5E0JA 1XKBC 3RUOA 3SJIA 1MTWA 1RS0A 1HFDA 1C4U2 2AH4X 4Y8YA 4RKJB 4ISIH 2FP7B 1K1OA 2OINA 2V35A 1GI1A 1C1WH 1MD7A 3MNBA 1CHOG 1PPGE 2FX4A 3GYMA 4GPGA 4AFQA 3C1KA 3MMGA 4VGCB 1PYTC 4PROA 2AIPA 2RCEA 2JH0D 3A89A 1LCYA 2C8XB 2OBQA 1QCPA 1F5LA 1SHHB 1C5PA 1LVMA 2STAE 4ZKOU 1EZUC 1ABIH 1NPMA 2BD4A 1P04A 4FUHA 1ID5H 4ABBA 1PFXC 3GCHB 1HAYB 1AI8H 1O3FA 1P06A 1YPGH 4FVBA 2BVRH 4A1TA 1EKBB 1HAPH 1TMTH 5JBCS 3S69A 1C2KA 1MU6B 1G37A 2ZC9H 3GISB 2B8OH 4O9VA 3UREA 1O30A 2O8TA 2OC0A 1EB1H 2BQ7B 1PYTD 3S9CA 4DT7B 5JBTA 2FOEA 2BMGB 2XWAA 2ZQ2A 4B76A 2BDYA 3OX7U 2JH5D 2F9UA 1Q3XA 3RXAA 3V12A 2ZU1A 3ENSB 3LJOA 4KP0A 1M9UA 1BOQA 2I6QA 2ZIQH 2BDCA 2Z9IA 3P8FA 1A3BH 1MBMA 8GCHF 1C2EA 2IN2A 4AORA 1V2WT 1BRAA 1T8OA 9ESTA 4UD9H 4GLYA 2OC8A 4MPXA 1QFKH 1ELTA 3MH7A 1GBTA 2PKSB 3E6PH 4UFDH 2A2QH 5FBIA 1O3OA 2FTLE 3B23B 1OS8A 1O0DH 4AG2A 1UTLM 3PM3A 4K69A 1K21H 2AGIX 3V13A 3U8RH 5F03A 1P2KA 2ZPQA 1HLTH 1S0RA 2G00A 2FIRH 4X2XA 5DP9A 1W7GH 3JZ2B 1Y3VA 4OS7A 4IMZA 2GV7A 2WUBA 4JZDH 1QHRB 4YT7H 1GI2A 3K65B 2PKAB 3A87A 1IQMA 3MU8A 1V2NT 1RRKA 1V2TT 5L2ZH 2ZCKP 3ATWA 2D8WA 4CBNA 2FI3E 1OP8A 4FUJA 5TCCA 4NSYA 1EAXA 1XKAC 4X1NU 1P9UA 1VCQA 3RM2H 3NKKA 8GCHG 1K1LA 2AFQB 5HGGA 2NU0E 4XBCA 4ABEA 2BX3A 1GWAA 1C5XB 1K9OE 2BVSH 2Q1JA 1P57B 1V2QT 3TVJB 3V3MA 1VJAU 1MCTA 5DP3A 7GCHG 1TB6H 4AYVB 1FNIA 2QY0B 2EI8A 3BTME 2ZFQH 1FQ3A 5DK1A 3ZZ8A 3LGTA 1EOJA 3RM0H 4O3TA 1T8NA 2BY6X 4CH8B 4JYVH 2RA3A 4IC5A 4XDEA 1ELVA 3A7VA 2CJIA 5GXPA 1Z8IB 3SNEA 1SGCA 3R3GB 3A82A 1IAUA 3TPIZ 5C1YA 4X8VH 4FVDA 2WYJA 2Y80A 3VXEH 1C1OA 3A7XA 4NFFA 1AN1E 1W14U 2WV5A 1O3GA 4JK6A 3Q77A 3FZDA 4I7YH 1THSH 3SO3A 1L0ZA 1D3TB 3V7TA 2BD2A 4ZKRU 3KN2A 3PB1E 1WV7H 2W7SA 2Z3EA 1O5GH 1O2IA 3A85A 3E3TA 2QXHA 1KSNA 1Y3YA 4FUBA 2ZKSA 2W3KA 1V3XA 2D1JA 3UNSA 1O2RA 2SGQE 3WY8A 4ZHLU 1T8MA 1IQGA 1C5MD 1WQVH 1GBJA 2BD9A 4IS5A 1O5DH 3JZ1B 2PKSC 1VITF 2QC2A 3ATKA 1YPMH 1T31A 3SZNA 1CT4E 1GMDG 5EODA 4X2VA 2FI4E 3VXFH 2PW8H 5K7RA 1O5BB 3BTKE 1GBLA 3SJOA 1ELGA 3T5FH 1IQNA 2WPHS 4NWKA 1AFQC 1EP5A 4NIWA 1SGEE 1JIRA 2ZCLP 2ZPSA 1L1NA 4UFGH 5J4SA 5HMAA 3AASA 1L4DA 1D3DB 1DUAA 2G51A 1FXYA 1YLDA 5JB8S 5LPFA 2ZTZA 1LVBA 1BB0B 1DXPA 3LGIA 4XE4A 1GHYH 2G8TA 5A0CA 2WPLS 5C1XA 1D6RA 3ZYEA 2O8WA 3SBKA 4JZFH 1TRMA 1XX9A 1EATA 4YT6H 3RXDA 3RXUA 5F8TA 1G32B 5A09A 1AFEH 2QAAA 2ZP0H 1V2RT 4X1PU 3LU9B 4YLUA 5FX5A 1Y5AT 4H6SB 3BIVH 1W13U 3MU4A 1P0SH 1K1JA 1DUEA 4H6TA 3GICB 2CF9H 2A5IA 1LPGB 3S9AA 1SL3A 2PKAA 7KMEH 1GI3A 2NU4E 1YP9A 4B73A 3UR9A 2HPPH 1F0RA 4AZ2B 3BEUA 5AFZH 2J34A 1LVOA 2FXRA 5GIBA 1ZZZA 3LJJA 1UVTH 4GUXA 3LC5A 1TGTA 1J8AA 2BQ6B 2HNTE 3SNBA 4ESTE 1TWXB 4CHAB 3S7KB 4D76A 4I31A 2P94A 1AGJA 1TABE 1ZSKA 3FP7E 5ETXA 3ZVFA 1B0FA 5L2YH 1FAXA 3P8NA 1TAWA 2FODA 1A4WH 2BLVA 1OWHA 1E37B 3Q3KA 3GY7A 2PSYA 1GJCB 5E8EH 6GCHF 1N8OC 1F92A 5G4BA 1KDQB 4INKA 1IQEA 4ZHMU 1MAYA 1TBZH 1ZR0A 3ZZ9A 4BAHB 3TH2H 5JBBS 3SQHE 1AWFH 1N6YA 4TYDA 2ZGXH 3IG6B 2GZ9A 3ZZ5A 5DP7A 2ZO3H 1FN8A 5AHGH 2IPHA 2ZHWH 1RIWB 5CHAC 2G52A 3MWIU 3RDZA 6LPRA 1DLEA 2LNCA 4AFZA 2BLWA 2FESH 1DT2A 4MLFB 1C2HA 4K5ZA 1Y3XA 2BD3A 1PPZA 1AMHA 4OS4A 3QTOH 1IQKA 4DIIH 2VIQA 2G4UA 1P3EA 3T26A 2ZGJA 2ALPA 2Y7ZA 1OWKA 3BEFB 6CHAC 2XRCA 1CU1A 3LPRA 2BXUH 3QLPH 2XCNA 1BRBE 1BMMH 1DANH 3RXBA 4K1EA 3TJNA 1FI8A 3M7QA 3MH5A 2ANKH 2WPJS 2FZZA 4A7IB 4IW4E 1GJ7B 3M7TA 1LVYA 4AGKA 1HAIH 2BB4A 3SJKA 5IDKA 1P2OA 1NFYA 1O3BA 1L4ZA 1GHXH 1P10A 1BITA 1ETSH 2ZA5A 3GY8A 4BAQB 1PQ5A 3BTWE 5JYIA 4OS1A 1ARBA 4ISNA 1GBFA 1MAXA 1YPJH 1P05A 1CBWB 1O36A 1QBOA 1C5ZB 1G3BA 3LKWA 1OWDA 3F9EA 4YM9A 2TRMA 4Z0KA 1ELEE 3LONA 1O2UA 3O8CA 1CO7E 1Y8TA 1TGBA 2A4QA 3SORA 2Z7FE 1XXDA 5HXFA 4ASHA 3GDVA 3LH3A 1NU7B 1A5IA 1D9IA 1SGPE 4HI3A 3ZV9A 1PPCE 4I8KA 4D7GA 1C5TA 1QJ6B 1H1BA 5EU8A 1DE7H 5EPNA 2J4IA 1AKSB 1AZZA 1GJ9B 4IMQA 2J2UA 3SV7A 1C2LA 3PYHA 1UTJA 1KIGH 2PUQH 1O2GH 4MVNA 1GI5A 1QTFA 1C1NA 2GDEH 5DP4A 3RXMA 1SGYE 2ANWA 2F9PA 1V2JT 3L33A 2OCVB 5GCHG 5HYOA 3B9FH 2BM2A 3GY3A 5EXNA 2Z9GA 1SLVB 2PFEA 2CXVA 1UHBB 4YESB 1D6WA 2FOFA 3BG4C 2J95A 1O2LA 3A7TA 4MG3A 2XNIA 1W2KH 3EDXB 2Q6DA 5C3NA 3A88A 4Y6DA 1TX6A 1FJSA 2C8YB 1GJ8B 1TX7A 5EQQA 1MTVA 2OQUA 4O3UA 2HLCA 2Y81A 2FOGA 1BZXE 4Y8ZA 5IYTA 1PPHE 2A7JA 1JRTA 4XBDA 3VB7A 3OY6U 4AN7A 2ZU2A 2EEKA 1GBHA 1DPOA 1CA8B 2ZF0H 4MNXA 3BTQE 1AVWA 2A4GA 1NFWA 2ZFFH 5CMXH 1GI4A 1NN6A 3DD2H 4FUFA 2QF0A 1OOKB 2ZTXA 1O2OA 2VH0A 3SNAA 2FLRH 3S7HB 1SHYA 1W8BH 2VU8E 1BMAA 2VVCA 2AIQA 1O2SA 1YLCA 3U8OH 1UTMA 2TGTA 3D49H 3UQVA 1VGCC 2OQ5A 5FPSA 5B6OA 1X7AC 4A92A 1OPHB 1AE8H 1GHBG 2A2XH 5L6NH 3M5MA 1THPB 1Z6EA 1XUIA 4UONA 2BLQA 1C9PA 1O2VA 4Y76A 1O2QA 4CRFA 1RJXB 1B0EA 1CA0C 4ZUHA 1XUKA 1XUFA 1YC0A 3ZV8A 1GJ4H 2PWXA 1C1UH 3ZZDA 1DWEH 3UPEA 1AB9C 1BBRK 2VVVA 2PLXA 1SOTA 2F83A 1HXEH 1Z6JH 4X1QU 2V6NA 3TU7H 1CBWC 1KLJH 5EOKA 1GGDC 5EXMA 1SFIA 1O5AB 2OC1A 3UOUA 4DIHH 3T27A 4LOYH 3A7ZA 1ZRKA 2IOTA 1FMGA 3V0XA 1P12E 1NY22 1P09A 1ZPBA 4OGYA 2GCTB 3BV9B 3HATH 2GP9B 4UE7H 1KXAA 4TPYA 3F9GA 4KGAA 4Y71A 1MMJN 1MKXH 1OWJA 4NSVA 2XC0A 1SG8B 4K3JA 1HYLA 5DG6A 1ANCA 4WH8A 4NWLA 1A7SA 3PWBA 1UCYK 2H5CA 5I46H 4WXIA
chains in the Genus database with same CATH superfamily
1MKWK 4NZQA 3SJ9A 1KXEA 2W6ID 3SV8A 4CRBA 3URDA 2GZ7A 1KYNA 5GWZA 4QT8C 2AMDA 1C5YB 1VCWA 3ATLA 1ZYOA 1Y5BT 1GVKB 1TLDA 2TIOA 3A8CA 1Z8GA 1SFQB 3M3SA 3SU6A 4CREA 1WTHD 1C2JA 1QNJA 3TJUA 1E35B 3QWCH 1E0FD 4BTIB 1D4PB 1EAIA 3I78A 1P8VC 2V3OH 2GV6A 1E1QD 3PO1B 1AKSA 2VWNA 2FOCA 3RXKA 4D9QA 2Y5GA 1O3HA 1DSTA 3QGNB 2TGDA 3U1IB 1GHZA 5A0BA 1BHXB 2IJD1 2XBXA 3URCA 3AW1A 3ESTA 3Q00A 1RFNA 1V2OT 2FO9A 2FMJA 1F0SA 3OYPA 8ESTE 3G01A 4FUGA 1C5LH 2J92A 1S6HA 2P3FH 1J15A 4B1TA 1V2UT 1O35A 1O38A 1DY9A 1SGRE 3HK6B 2IJOB 4LXBH 4TPIZ 5J4QA 3EA8A 1XMNB 1ZSLA 4AB8A 1O3PB 2D2DA 1BT7A 2ZDVH 2P8OB 1K0HA 2K1QA 3F68H 2JETB 1MQ5A 2VBCA 1O3KA 3ZZ4A 2OBOA 1WXRA 1V2MT 3N99A 1TNHA 3FAOA 4K1SA 4FETA 1MTSA 1O2JA 3O8RA 4UEHH 3KL6A 2WPKS 1ACBE 1C5UA 2ZTYA 5C5OA 1H9IE 1YF4A 1S0QA 4DW2U 1W0ZU 2BTCE 1F5KU 3LGYA 1FIWA 3P8GA 3MO3A 1C2FA 4CR5A 3BG8A 2RA0A 2SGAA 2GMTB 3UWJH 1S83A 3KIDU 7GCHF 3OTJE 4KTSA 4F48B 2VVUA 5C67A 5C0TA 2ZU3A 2B9LA 2G5VA 1YPLH 5T6GA 2A5AA 2CGAA 3TGKE 3M3VA 1C2IA 1C1VH 1IQHA 1YPHC 3A83A 2VWLA 2QF5A 1T4UH 5TCAA 3SGQE 2ZWLH 5GDSH 3UFAA 1XVOA 3BTHE 4K8BA 3RU4T 3QZRA 3EA9A 3TIUA 3RC4A 3TJVA 2ZQ1A 4B71A 1NC6A 2EC9H 3MH4A 4IC6A 2ZFRH 1BRUP 3BF6H 3HGNA 2Q6GA 1T32A 5BPEA 4E7RG 2BDHA 2F43B 3HKIB 2UUYA 1SLUB 3K6ZA 3TK5A 4Y7AA 3MFJA 2QF3A 3MU5A 1QBVH 1EFRD 1A1RA 4MQAA 4OS2A 4Y8XA 3GCOA 3KQBA 1YKTA 4ABIA 3FP6E 4VGCC 4RT0A 4X6MA 1EZSC 2FYRA 1C2MA 1J17T 4KTUA 4X1SU 4WY3A 1WOFA 4DOQA 2QYIA 3N7DA 7ESTE 1MTUA 4Y79A 1G3CA 2FX6A 5TJXA 4DG4A 2P3UB 2FLBH 2CV3A 1GMDF 2SGPE 2OTVA 1SLWB 4TWYA 2AEIH 2ZI2H 4BXSA 1LTOA 1LQEA 1YPEH 3GCHC 3EYDA 4Q80A 2C90B 4HGCA 3KYFA 3SU4A 1O3AA 3LGUA 3RXGA 4HFPB 1QA0A 2VB0A 1MTNB 2BDAA 1YGCH 5GPIB 1A0LA 2RDEA 1L1GA 1QL9A 4K60A 4M7GA 3KF2A 3SJ8A 1TPAE 4I8LA 1BCUH 5EXLA 2KCAA 1ELDE 1Z7KA 3GOVB 3LGVA 1QRWA 1OYTH 5HIYA 1UVSH 2ODQA 1BTXA 4ACAA 1C9TA 3BSQA 2G5NA 1P2MA 1P2QA 1EUFA 1OP2A 1Y5UT 1QQUA 1JWTA 1W0JD 2HVXA 5HIZA 1C2GA 3SQEE 1HAGE 2ANMH 1WCZA 1F0TA 4Y10E 5DPAA 5JDUB 2VIDA 2B7DH 4AFSA 5FHTA 1D3PB 2OUAA 1WU1A 2TBSA 3ZVGA 2WINI 2PHBA 1O3IA 5F8ZA 4WF8A 2HRVA 3F2HA 1IQJA 3P95A 3Q76A 1O3NA 2H5DA 1K1MA 2FWWA 2AYWA 4A6LA 3PWCA 1DDJA 4CH2B 3QZQA 1BTUA 1KXFA 1C5VA 3HGPA 3KNXA 3ZZBA 1FUJA 1ETRH 1JBUH 5EW1H 4YOJA 1HAHH 3ZVEA 1RD3B 1GBAA 1ANDA 1NESE 2GCHG 2ZHEH 1H8DH 2BZ6H 4MPWA 4IBLH 3MI4A 3RU4D 4BOHA 1SSXA 1YCPM 2W26A 1TQ0B 2HGTH 1DLKB 1VCPA 2ZDAH 3DSOA 5I25A 1JIMA 2UWPA 2GT7A 1O31A 1IQFA 1MCVA 1GBCA 1ZHRA 2GGVB 1ZTLA 4B74A 3LT3A 3GY2A 1W0YH 1QJ1B 1WQSA 1IHTH 3TGJE 2F9VA 1OXGA 3BTGE 4ACBA 5EW2H 2VINA 1CE5A 2QCYA 3TH3H 3KHVA 3PMHB 1Y59T 3RXLA 1ZPZA 1TNGA 4INHA 1LKAA 3SNCA 1SOZA 3MTYA 1WYKA 1PJPA 2P93A 1NROH 2H9HA 1GI6A 3NXPA 3KQEA 4KELA 3BTTE 4A1XA 2ZGBH 3DA9B 1O3LA 4R0IA 1EZQA 2O8LA 1C5OH 4MNWA 5H4IB 1NT1A 1QB1A 3BEIB 2FS9A 2EI7A 3LIWA 3B8JA 5PTPA 2ASUB 1AUTC 1HJAB 5A2MH 1XUJA 1K1NA 2BD8A 3SV9A 2O9QA 2WV4A 1B5GH 3LOXA 3IWMA 1O39A 2K0QA 4XD7D 1EJAA 2ULLA 4AGJA 3M37A 1A0JA 1WBGB 1NS3A 3P92A 4MPVA 1ABJH 1NM6A 2A31A 5HM2A 2HPQH 3EA7A 5LGOA 1A5GH 2VGCB 2ZECA 5F53A 3VEQB 3RC5A 2A0QB 1BRCE 3ZZ3A 3UAIC 1HCGA 3FP8E 4H42U 2R9PA 1K2I1 2LELA 3PTNA 1KTSB 5F6MA 1EP6A 2XWBI 3KQDA 5C20A 1MU8B 3A86A 1S6FA 5C5NA 1ZLRA 3D62A 1TNKA 2R3YA 1ANEA 3OSYA 1P02A 1INCA 1Z1IA 1TYNA 4FUCA 1NRQH 1AO5A 2LPRA 3WWBA 1TRNA 2KCOA 3RMMH 5FAHA 8LPRA 1UJ1A 2BX4A 5IK2D 1SVPA 1TA6A 4FUEA 5EGMA 1LHCH 3RMNH 4B6FA 4AB9A 1ZRBA 4D7FA 4X8UH 4Y7BA 3ZYDA 9LPRA 2ODYB 1ZJDA 3VGCB 5L30H 1AVGH 3KEEA 3FANA 1EPTB 3K2UA 2FOAA 1FV9A 3RXIA 1GDNA 3DUXH 3OU0A 4UFFH 2HVYB 1WDIA 3CP7A 5GCHF 1A0HB 4BTUB 2DE8A 2TPIZ 1OX1A 3N7OA 1DXWA 2EA3A 2C3SA 3SI3H 3DSPA 1ZHMA 1F2SE 1UTKA 3UY9A 1HV7A 2G4TA 1RTFB 2OC7A 2C4FH 1SQAA 1HDTH 1E1RD 1Y3WA 1HIAB 1QL7A 1QZ8A 1P3CA 1UK4A 3MU0A 3ZZ6A 2XBWA 3CENA 4CRGA 2F4LA 2CMYA 1EQ9A 3ATIA 2P59A 1UTNA 3EAJA 2A1DB 3AAVA 4X2WA 1G2LA 2XBVA 2P16A 3M5NA 4ISLA 4CR9A 1AIXH 5EIYA 3LDXH 1OYQA 1C5NH 2XYAA 1BBRE 3ELAH 4J1YA 5DN6D 2Z3CA 1SGIB 1V2PT 1UK2A 1BIOA 3CS0A 1O3JA 4CHAC 1C5QA 5DP6A 1TMBH 2H2ZA 1GBKA 4X6PA 1EASA 1A2CH 1TOMH 3IITA 4P00A 1P2JA 1GHBF 1EAUA 1ZOMA 3U1JB 3NUMA 2TGPZ 1SGTA 4YOGA 1GJ6A 1MBQA 3GCTF 2VH6A 1GG6B 3QN7A 3UWIA 3F0OA 3PMAB 5CE1A 5EQSA 1AVXA 2Z3DA 1VJ9U 1LMWB 1KTTB 2ZZUH 1MZAA 3RMOH 3WW7A 4U01A 5E0GA 1KLIH 2VIVA 3FZZA 4U2WA 4NIYA 3FO8D 3DFLA 3BTFE 4I33A 1GI9B 2XTTB 1A46H 2KCPA 3T25A 3F2GA 1UCYE 1QB6A 2VIWA 3A80A 1O3DA 2FOMB 1DOJA 1XUHA 3Q3YA 4Q7XA 4NA9H 1RIWC 2V0BA 4HTCH 1C1RA 2NWNA 5SGAE 3K9XB 5T6FA 2BY7X 1BTYA 2P95A 2A45B 1UO6A 2ZCHP 1CGJE 1DM4B 2O8UA 3GDSA 1HUTH 2D26C 1TALA 4K1TA 4AOQA 3E0NB 5DP5A 2J5UA 2QXIA 1DSUA 1KDQA 1BTZA 1F0UA 1K1PA 3TH4H 4YOIA 1HGTH 1EOLA 2SNWA 5BRRE 1GJDB 4JK5A 4ZMAH 5K0HA 5T6DA 1MD8A 1YCPH 3L6PA 3SU1A 1H9HE 1TIOA 2SGFE 2TGAA 3NPSA 3GY4A 1CT2E 2XC5A 2WZQA 1TONA 3GCNA 1OWIA 3GCTG 1C1SA 2WPMS 2VJ1A 1E79D 1W10U 2F9OA 1K28D 1GDQA 1ZJKA 3M36A 2Y6TA 1NU9A 4BAMB 1DS2E 3KCGH 1SC8U 4YXWD 3BTDE 5E2PA 4FU7A 2EI6A 3HKJB 1J9CH 3GY5A 1YBWA 4BXWA 2WSSD 3VB5A 1S81A 3ODFA 1TNJA 2AMQA 1O2KA 4BAKB 1ETTH 3OY5U 4ZCNA 1TRYA 1AZ8A 2AERH 4X8SH 2SGEE 3RXFA 1G3EA 3SUDA 1P9SA 4XBBA 4HZHA 4JZ1A 4FOUC 4CRCA 1SPJA 5T1VA 1EPTA 1GDUA 2FI5E 3KQCA 1GJBB 2GT8A 1G9IE 1NRSH 3RP2A 4D9RA 3RLYH 4J2YB 5FBEA 4ABHA 4JZIA 1NFXA 4K2YA 1GBEA 2ALVA 2W7UA 1F7ZA 4I8HA 4AX9H 1XM1A 1O2PA 4A5TS 4DY7B 4IN1A 4AFUA 2UUKB 5B6LA 2KFWA 4INLA 1FPHH 4FUIA 4LZ1H 3A8DA 3TLOA 3P6ZB 5C1UA 5CDFE 1HIAA 1EZXC 1QL8A 2QN5T 2YMSC 2ZDMA 1O5EH 2GJGA 5JPMH 3RXTA 1CHGA 4HG6A 1A3EH 1GBMA 1Z1JA 1A5HA 2ZHFH 1QA7A 3QUMP 3EE7A 2HNTC 2M5TA 3MNSA 3PMJA 4CBOA 1YWUA 1HXFH 1QRXA 5FPTA 3SUFA 3SHCH 1NRNH 1RTLA 3A81A 2GTBA 3H7TA 2BDIA 1OHHD 3AK5A 1CVWH 2HNTF 3RC6A 4NA8A 4BNRA 1ZTJA 1ESAA 1QY6A 1QB9A 1NBMD 5FCKA 1V2LT 2KZ4A 1BBRH 2QXJA 1QURH 1KLTA 1N6XA 1FPCH 1UTOA 4Y0YE 1LHGH 3STJA 4NCYA 3PV2A 2BY9X 3TGIE 2ZDLA 1V2KT 1DFPA 3LGWA 1P03A 2YMSD 4GHTA 1C1PA 3DT0H 2SFAA 4FXGH 1QGFA 2ZFPH 2PV9B 4JYTA 5EG4A 3E8LA 5KGOA 4I8GA 1GVLA 1UMAH 5EQRA 1UHBA 1AE5A 1HBTH 2KAIB 3SU2A 2B5TB 1E34B 2ZDNA 4B2CA 1CGIE 1V2VT 1H4WA 1TGNA 1VR1H 2ZHDA 2VWOA 5AFYH 1W11U 1S82A 3PLKA 2QF4A 3K6YA 1TQ7B 1HAZB 3BN9A 4WMEA 1PPFE 3E1XB 1V6DA 4WWYA 2ZDKA 2PSXA 1LQDB 1UCYH 3FN8A 1KXCA 3TNSA 3TITA 1MZDA 3UB0A 1MKWH 4YTAA 1SQOA 1H8IH 2QXGA 2VIOA 3UQOA 4B2BA 2YOLA 2ZFSA 4X6OA 3QDZB 1UTPA 1FY5A 1O5FH 2PUXB 4GSOA 3M35A 3U69H 6ESTA 1ANBA 1A61H 4O03A 3OE7D 4YLQH 3AVZA 1TNIA 1RGQA 4GVUA 3E0PB 3ATMA 2XNDD 3FFGA 3U9AH 3SUGA 1O2XA 1GHAF 2XW9A 2GCTC 4TY6A 3QTVH 3E91A 4F4OC 2EQNA 3GDUA 5A8XA 2RFKC 3M3TA 1HPGA 4M9FA 4OGXA 5DGJA 1Q2WA 3SU3A 4Y0ZE 3D23A 4X6NA 3DCLA 4NG9H 2ZG0H 3O8BA 1VITH 3ZZ7A 2BY5X 1GBDA 1AD8H 1AFQB 1PQ7A 1QRZA 5HM9A 3A84A 1Q31A 3P8OA 5JBAS 2GZ8A 2R0KA 1YPKH 3RLWH 3SV6A 2A7CA 2B0FA 2BY8X 1QIXB 4MNVA 2H9TH 5KEDA 2QA9E 3MOCA 5FXLA 3P17H 1UVUH 2JJ2D 2Z9LA 1QBNA 1TMUH 5ABWA 3A7WA 2KX4A 4WJG2 3QGJA 3ZVDA 1GMHF 1O2MA 5DJ7A 1W3CA 4NFEA 3VB6A 2V3HH 3NK8A 1GHWH 1S5SA 2QE7D 4I32A 3PO1C 2C8WB 2FEQH 1DWCH 1TOCB 1TX8A 3L3TA 1GHAG 2OXSA 3RXOA 1RTKA 4JZEH 2J98B 4ZH8A 3F2FA 2BD5A 5C94A 1XVMA 1N1LA 3SUEA 1T7CA 3A7YA 1HJ9A 4LZ4B 1C1MA 2NU1E 5FX6A 4ZAEA 1TBQH 4Q7ZA 1BHXF 1LHFH 2ZPRA 2PGQB 3SGBE 4YO9A 1FONA 3U28C 2Z6BD 2BLOA 3E16B 4X0WU 4AYYB 2R0LA 1DVAH 3BIUH 2XC4A 2GCHF 1IQLA 1P2IA 1NTPA 3T29A 1BJVA 4WH6A 3MYWA 2WHXA 4JCNA 2STBE 1JMOH 4FU9A 3H7OA 4E06H 3MU1A 2P8OC 1HAXB 3RXJA 1IHSH 1PQ8A 1ORFA 2VIPA 4BAOB 1W7XH 1UW7A 1TNLA 2JETC 4FUDA 4IGDA 3EE0B 1OSSA 1VKYA 4D8NA 1E38B 1C4Y2 3R0FA 1GPZA 2A4OA 1T8LA 3QK1A 5ESTE 3STIA 2F91A 1UTQA 4ABFA 1GMHG 1N8OB 2QIQA 3S9BA 3FVFB 4F49A 1UVPA 1GBBA 2BZAA 3I29A 3KQ5A 1LDTT 2GMTC 1DWDH 1ELBA 1K22H 5ESBA 2KAIA 3UTUH 3RXCA 4GHQA 1ZTKA 2DUCA 2ZU4A 4DJZB 1DWBH 1GBIA 3SYJA 3GYLB 2GX4A 3PV4A 3ZVAA 1CSOE 4GCHF 3TNTA 3I77A 4DT4A 1UK3A 1FY1A 5CHAB 1GI7B 2PTNA 4MTBA 2BDBA 2A4RA 2HALA 1FN6A 3NZIA 2A32A 2HOBA 5CHBA 4Z6AH 4NZLA 4ZROA 1K1IA 1C5WB 4U32A 1LHEH 1QR3E 2W3IA 4NIVA 3SN8A 2CHAB 2FDAA 2C93B 3ZVCA 5LH8A 4SGAE 2ODPA 1O37A 2YNBA 1Z8JB 3OFND 3SV2H 6CHAB 1GCDA 1TPPA 2UUFB 5FPYA 4U30A 2F9NA 1MH0A 3QO6A 4LK4A 4WXVA 7LPRA 1ZGIA 4X8TH 2ZNKH 2Y5HA 4O97A 1LPZB 4NA7A 2UWOA 2R3UA 3CS7A 2NU3E 4SGBE 1PPEE 3TK6A 1WAYB 4ABGA 2JH6D 2ZU5A 1EX3A 3W95A 1O5CB 4ABAA 1HNEE 4TWWA 2F9BH 3ZVBA 2XXLA 1GHVH 1NRRH 2AGEX 5GNDA 2RG3A 4ZHAA 3T2NA 4I8JA 2ZGCA 5JB9S 3FKSD 1IQIA 1PPBH 1S85A 1ELFA 1GVZA 1HAVB 2WPDD 4KKDA 4K8YA 1RXPA 1C5RA 4GCHG 1LO6A 1SLXB 4Q4LA 1S6LA 3VB3A 2W5EA 1FIZA 2Z9JA 3F0PA 1XUGA 2FYQA 2G81E 4AG1A 4B6EA 1VITG 4CRAA 1ZPCA 2BD7A 1D3QB 2PP6A 1O2WA 2Z94A 5A8YA 3MNXA 5DKMA 1SKYE 2BHGA 3LH1A 4THNH 3ITIA 2BYAX 1SGNE 1ESTA 1O3MA 1MTNC 1SQTA 4OS6A 2AGGX 2JJ1D 2KM0A 3PROA 1EJNA 2WYGA 3DHKH 2AS9A 2HLDD 4BANB 3HK3B 1AWHB 5FCRA 4TSFD 4DVAU 1O2YA 2ZFTA 5GJ4B 4NGAH 1ZSJA 1ZMJA 1WTGH 4NIXA 1EAWA 1QQ4A 3DFJA 4E7NA 1J14A 2FPZA 2Q6FA 1XXFA 2FM2A 3SU5A 1BMNH 4ISHH 3OEHD 4GAWA 3TJOA 4UDWH 1LPKB 1TA2A 1AHTH 1G30B 3Q3XA 2SNVA 5LPRA 1TFXA 4E05H 1J16A 1OWEA 4P02A 1SI5H 1KXDA 1LKBA 1O2ZA 1ZGVA 1TGCA 3ZZCA 5A0AE 4Z1MD 1YYY1 1ARCA 3BG4B 2CN0H 3FOAA 3M5LA 2ZEBA 4RSPA 4WVPE 1DY8A 3KYGA 3SNDA 3F9FA 1PQAA 4ABJA 2H6MA 3RXQA 1MABB 4ZXYH 3RXSA 1SBWA 1C4V2 2WUCA 3N7EA 2XCFA 1H8ED 3SW2B 3ZZAA 1H9LB 1C2DA 1ZHPA 1NFUA 1GJAB 2Y82A 1TPOA 3RXHA 1GL1A 4YZUA 1WSSH 8KME2 1MUEB 1ESBA 1NZQH 2AMPA 1FY3A 1OP0A 2A7HA 2CHAC 2ESTE 4ZKSU 4H4FA 1BMLA 3D65E 3W1EA 2BVXH 2Y5FA 3LC3A 2BQWB 1DICA 2VWMA 1VGCB 3RMLH 1P11E 2F3CE 1CT0E 1B7XB 1ZMLA 1G36A 1Z71A 2DE9A 1SB1H 3NRLA 1G2MA 2KR7A 3M61U 3M5OA 3O8DA 1P2NA 6GCHG 2QGRA 1O32A 3S0NA 1THRH 1FLEE 3W94A 3T62A 1O3CA 4ABDA 4XSKU 1CA0B 4X1RU 3UNRA 1HJ8A 3EQ0H 5AVDA 1VZQH 5DP8A 2FOHA 1YM0A 1BTPA 1AB9B 2UUJB 1YPHE 3UR6A 3GY6A 4RN6A 1GGDB 1FY8E 2PR3A 4FU8A 1FAKH 2QV1A 4UFEH 1O2NA 1BJUA 3VB4A 1ZMNA 1TBRH 2FOBA 1OKXA 4MDSA 2R2MB 1F5RA 1GCTB 1GI8B 3U98H 5C2ZA 1HB0B 1BTHH 1O2HA 3ODDA 2PGBB 4TT3D 2ILNA 3U8TH 2ZHQH 1P01A 3F1SB 1HJAC 3PMBB 3UIRA 3HPTB 2C8ZB 1YCPK 3UOPA 3AAUA 2YNAA 1DX5M 2GKVE 3MO9A 4XOJA 2BDGA 3RXVA 1AUJA 2O8MA 1JOUB 3H09A 1BTWA 2GDDA 2HWLB 3PLPA 2VNTA 2XBYA 5T3HA 1MQ6A 3UUZA 3SU0A 2V3MA 3DSGA 4A1VA 1HAVA 1AU8A 2L6OA 1SGFA 2BOKA 3AW0A 1NRPH 2PTCE 2RDLA 2VGCC 1W12U 5F8XA 3RXEA 5E0HA 1AY6H 4OS5A 3PTBA 1QJ7B 1SGQE 2H1UA 3SI4H 3E90B 2GD4B 1V2ST 3A8AA 1SR5C 3MH6A 3VPKA 4DURA 3NCLA 2OD3B 5A8ZA 2ZGHA 4ZXXH 1LHDH 2P3TB 1ELAA 1GL0E 1S84A 4R8TB 3EGKH 1KY9A 5EPYA 3T28A 2WPIS 1SGFG 1FZZA 2OLGA 2OP9A 2V7QD 2NU2E 4DGJA 3C27B 1UVOA 4Q7YA 1NO9H 1BUIA 2A5KA 3TK9A 5DO4H 2BOHB 1GMCF 1GJ5H 1KMHB 2GVFA 3M7UA 1Y3UA 1MKXK 5E2OA 2J38A 1O2TA 1FDPA 3VGCC 2J9NA 1E36B 1EPTC 2THFB 1TE0A 1C1TA 1BQYA 4ZKNU 5AF9H 1Z8RA 2H9EH 1WUNH 3UNQA 2ANYA 4MPUA 5LPEA 3A8BA 3RU4E 4Y11E 1EB2A 1BA8B 4DCDA 2FTMA 4B75A 4IN2A 3SGAE 1JRSA 4X2YA 1CGHA 4CRDA 3P70B 1JXPA 2Y7XA 1FY4A 3KGPA 3MHWU 1C1QA 1TPSA 2BXTH 3BTEE 1EXFA 5EJZA 5C0UA 3MO6A 1HRTH 4BTTB 1TGSZ 1GI0A 2UWLA 1DITH 4WMFA 3VFEA 3F6UH 4XFQA 1CHOF 2FS8A 4JYUH 3NWUA 2J94A 1SGDE 4RKOB 1O3EA 1AQ7A 1IOEA 1L2EA 3RXPA 1GCTC 3H5CB 1GMCG 2JKHA 2G55A 1U6QA 3SOSA 2Z9KA 4Q63A 1L1JA 4JMYA 4WMDA 3PRDA 1HAOH 1O34A 3MNCA 1CQQA 4RI0A 3PLBA 3SHAH 1GG6C 2SGDE 1BDAA 4ISOA 4MNYA 4Q2KA 1C5SA 1SMFE 2CF8H 2I6SA 1G3DA 4TY7A 4B2AA 1KXBA 1T4VH 1O33A 4AC9A 1ELCA 4KTCA 1H8HD 2R2WU 3QX5H 3RXRA 1EJMA 3F9HA 5E0JA 1XKBC 3RUOA 3SJIA 1MTWA 1RS0A 1HFDA 2EY4C 1C4U2 2AH4X 4Y8YA 4RKJB 4ISIH 2FP7B 1K1OA 2OINA 2V35A 1GI1A 1C1WH 1MD7A 3MNBA 1CHOG 1PPGE 2FX4A 3GYMA 4GPGA 4AFQA 3C1KA 3MMGA 4VGCB 1PYTC 4PROA 2AIPA 2RCEA 2JH0D 3A89A 1LCYA 2C8XB 2OBQA 1QCPA 1F5LA 1SHHB 1C5PA 2IPQX 1LVMA 2STAE 4ZKOU 1EZUC 1ABIH 1NPMA 2BD4A 1P04A 4FUHA 5HKKD 1ID5H 2J97A 4ABBA 1PFXC 3GCHB 1HAYB 1AI8H 1O3FA 1P06A 1YPGH 4FVBA 2BVRH 4A1TA 1EKBB 1HAPH 1TMTH 5JBCS 3S69A 1C2KA 1MU6B 1G37A 2ZC9H 3GISB 2B8OH 4O9VA 3UREA 1O30A 2O8TA 2OC0A 1EB1H 2BQ7B 1PYTD 3S9CA 4DT7B 5JBTA 2FOEA 2BMGB 2XWAA 2ZQ2A 4B76A 2XOKD 2BDYA 3OX7U 2JH5D 2F9UA 1Q3XA 3RXAA 3V12A 2ZU1A 3ENSB 3LJOA 4KP0A 1M9UA 1BOQA 2I6QA 2ZIQH 2BDCA 2Z9IA 3P8FA 3PRBA 1A3BH 5KECA 1MBMA 8GCHF 1C2EA 2IN2A 4AORA 1V2WT 1BRAA 1T8OA 9ESTA 4UD9H 4GLYA 2OC8A 4MPXA 1QFKH 1ELTA 3MH7A 1GBTA 2PKSB 3E6PH 4UFDH 3GS9A 2A2QH 5FBIA 1O3OA 2FTLE 3B23B 1OS8A 1O0DH 4AG2A 1UTLM 3PM3A 4K69A 1K21H 2AGIX 3V13A 3U8RH 5F03A 1P2KA 2ZPQA 1HLTH 1S0RA 2G00A 2FIRH 4X2XA 5DP9A 1W7GH 3JZ2B 1Y3VA 4OS7A 2CK3D 3CNRA 4IMZA 2GV7A 2WUBA 4JZDH 1QHRB 4YT7H 1GI2A 3K65B 2PKAB 3A87A 2K8IA 5FL7D 1IQMA 3MU8A 1V2NT 1RRKA 1V2TT 5L2ZH 2ZCKP 3ATWA 2D8WA 4CBNA 2FI3E 1OP8A 4FUJA 5TCCA 4NSYA 1EAXA 1XKAC 4X1NU 1P9UA 1VCQA 3RM2H 3NKKA 8GCHG 1K1LA 2AFQB 2JIZD 5HGGA 2NU0E 4XBCA 4ABEA 2BX3A 1GWAA 1C5XB 1K9OE 2BVSH 2Q1JA 2LP6A 1P57B 1V2QT 3TVJB 3PV5A 3V3MA 1VJAU 1MCTA 5DP3A 7GCHG 1TB6H 4AYVB 1FNIA 2QY0B 2AHME 2EI8A 3BTME 2ZFQH 1FQ3A 5DK1A 3ZZ8A 3LGTA 1EOJA 3RM0H 4O3TA 1T8NA 2BY6X 4CH8B 4JYVH 2RA3A 4IC5A 4XDEA 1ELVA 3A7VA 2CJIA 5GXPA 1Z8IB 2JDID 4ASUD 3SNEA 1SGCA 3R3GB 3A82A 1IAUA 3TPIZ 5C1YA 4X8VH 4FVDA 5C17A 2WYJA 2Y80A 3VXEH 1C1OA 3A7XA 4NFFA 1AN1E 1W14U 2WV5A 1O3GA 4JK6A 3Q77A 3FZDA 4I7YH 1THSH 3SO3A 1L0ZA 1D3TB 3V7TA 3VG8A 2BD2A 4ZKRU 3KN2A 3PB1E 1WV7H 2W7SA 2Z3EA 1O5GH 1O2IA 3A85A 3E3TA 2QXHA 1KSNA 1Y3YA 4FUBA 2ZKSA 2W3KA 1V3XA 2D1JA 3UNSA 1O2RA 2SGQE 3WY8A 4ZHLU 2WV9A 1T8MA 1IQGA 1C5MD 1WQVH 1GBJA 2BD9A 4IS5A 1O5DH 3JZ1B 2PKSC 1VITF 2QC2A 3ATKA 1YPMH 1T31A 3SZNA 1CT4E 1GMDG 5EODA 4X2VA 2FI4E 3VXFH 2PW8H 5K7RA 1O5BB 3BTKE 1GBLA 3SJOA 1ELGA 3T5FH 1IQNA 2WPHS 4NWKA 1AFQC 1EP5A 4NIWA 1SGEE 1JIRA 2ZCLP 2ZPSA 1L1NA 4UFGH 5J4SA 5HMAA 3AASA 1L4DA 1D3DB 2OK5A 1DUAA 2G51A 1FXYA 1YLDA 5JB8S 5LPFA 2ZTZA 1LVBA 1BB0B 1DXPA 3LGIA 4XE4A 1GHYH 2G8TA 5A0CA 2WPLS 5C1XA 1D6RA 3ZYEA 2O8WA 3SBKA 4JZFH 1TRMA 1XX9A 1EATA 4YT6H 3RXDA 3RXUA 5F8TA 1G32B 5A09A 1AFEH 2QAAA 2ZP0H 1V2RT 4X1PU 3LU9B 4YLUA 5FX5A 1Y5AT 4H6SB 3BIVH 1W13U 3MU4A 1NBME 1K1JA 1DUEA 1P0SH 3GICB 4H6TA 2CF9H 2A5IA 1LPGB 3S9AA 1SL3A 2PKAA 7KMEH 1GI3A 2NU4E 1YP9A 4B73A 3UR9A 2HPPH 1F0RA 4RT1A 4AZ2B 3BEUA 5AFZH 2J34A 1LVOA 2FXRA 5GIBA 1ZZZA 3LJJA 1UVTH 4GUXA 3LC5A 1TGTA 1J8AA 2BQ6B 2HNTE 3SNBA 4ESTE 1TWXB 4CHAB 3S7KB 3WWFA 4I31A 4D76A 1BMFD 2P94A 1AGJA 1TABE 1ZSKA 3FP7E 5ETXA 3ZVFA 1B0FA 5L2YH 1FAXA 3P8NA 1TAWA 2FODA 1A4WH 2BLVA 1OWHA 2J98A 1E37B 3Q3KA 3GY7A 2PSYA 1GJCB 5E8EH 6GCHF 3OEED 1N8OC 1F92A 5G4BA 1KDQB 4INKA 1IQEA 4ZHMU 1MAYA 1TBZH 4XRNA 1ZR0A 3ZZ9A 4BAHB 3TH2H 5JBBS 3SQHE 1AWFH 1N6YA 4TYDA 2ZGXH 3IG6B 2GZ9A 3ZZ5A 5DP7A 2ZO3H 1FN8A 4OM9A 5AHGH 2IPHA 2ZHWH 1RIWB 5CHAC 2G52A 3MWIU 1YLNA 3RDZA 1DLEA 2LNCA 4AFZA 6LPRA 2BLWA 2FESH 1DT2A 4MLFB 1C2HA 4K5ZA 1Y3XA 2BD3A 1PPZA 1AMHA 4OS4A 3QTOH 1IQKA 4DIIH 2VIQA 2G4UA 1P3EA 3T26A 2ZGJA 2ALPA 2Y7ZA 1OWKA 3BEFB 6CHAC 2XRCA 1CU1A 3LPRA 2BXUH 3QLPH 3OAAD 2XCNA 1BRBE 1BMMH 1DANH 3RXBA 4K1EA 3TJNA 1FI8A 3M7QA 3MH5A 2ANKH 2WPJS 2FZZA 4A7IB 4IW4E 1GJ7B 3M7TA 1LVYA 4AGKA 1HAIH 2BB4A 3SJKA 5IDKA 2KCYA 1P2OA 1NFYA 1O3BA 1L4ZA 1GHXH 4I86A 1P10A 1BITA 1ETSH 2ZA5A 3GY8A 4BAQB 1PQ5A 2L74A 3BTWE 5JYIA 4OS1A 1ARBA 4ISNA 1GBFA 1MAXA 1YPJH 1P05A 1CBWB 1O36A 1QBOA 3F3BA 1C5ZB 1G3BA 3LKWA 1OWDA 3F9EA 4YM9A 2TRMA 4Z0KA 1ELEE 3LONA 1O2UA 3O8CA 2M2AA 1CO7E 1Y8TA 1TGBA 2A4QA 3SORA 2Z7FE 1XXDA 5HXFA 4ASHA 3GDVA 3LH3A 1NU7B 1A5IA 1D9IA 1SGPE 4HI3A 3ZV9A 1PPCE 4I8KA 4D7GA 1C5TA 1QJ6B 1H1BA 5EU8A 1DE7H 5EPNA 2J4IA 1AKSB 1AZZA 1GJ9B 4IMQA 2J2UA 3SV7A 1C2LA 3PYHA 1UTJA 1KIGH 2PUQH 1O2GH 4MVNA 1GI5A 1QTFA 1C1NA 2GDEH 2YMSB 5DP4A 3RXMA 1SGYE 2ANWA 2F9PA 1V2JT 3L33A 1SQRA 2OCVB 5GCHG 5HYOA 1COWD 3B9FH 5EJLA 2BM2A 3GY3A 3MQKC 5EXNA 2Z9GA 1SLVB 2PFEA 2CXVA 1UHBB 4YESB 3SZEA 1D6WA 2FOFA 3BG4C 2J95A 1O2LA 3A7TA 4MG3A 2XNIA 1W2KH 3EDXB 2Q6DA 5C3NA 3A88A 4Y6DA 1TX6A 1FJSA 2C8YB 1GJ8B 1TX7A 5EQQA 1MTVA 2OQUA 4O3UA 2HLCA 2Y81A 2FOGA 1BZXE 4Y8ZA 5IYTA 1PPHE 2A7JA 1JRTA 4XBDA 3VB7A 3OY6U 4AN7A 2ZU2A 2EEKA 1GBHA 1W0KD 3ZIAD 1DPOA 1CA8B 2ZF0H 4MNXA 3BTQE 1AVWA 2A4GA 1NFWA 2ZFFH 5CMXH 1GI4A 1NN6A 3DD2H 4FUFA 2QF0A 1OOKB 2ZTXA 1O2OA 2VH0A 3SNAA 4F55A 2FLRH 3S7HB 1SHYA 1W8BH 2VU8E 1BMAA 2VVCA 2AIQA 1O2SA 1YLCA 3U8OH 1UTMA 2TGTA 3D49H 3UQVA 1VGCC 5EJ1A 2OQ5A 5FPSA 5B6OA 1X7AC 4A92A 1OPHB 1AE8H 1GHBG 1YY3A 2A2XH 5L6NH 3M5MA 1THPB 1Z6EA 1XUIA 4UONA 2BLQA 1C9PA 1O2VA 4Y76A 1O2QA 4CRFA 1RJXB 1B0EA 1CA0C 4ZUHA 1XUKA 1XUFA 1YC0A 3ZV8A 1GJ4H 2PWXA 1C1UH 3ZZDA 1DWEH 3UPEA 1AB9C 1BBRK 2VVVA 2PLXA 1SOTA 2F83A 5DSFA 1HXEH 1Z6JH 4X1QU 2V6NA 3TU7H 1CBWC 1KLJH 5EOKA 1GGDC 5EXMA 1SFIA 1O5AB 2OC1A 3UOUA 4DIHH 3T27A 4LOYH 3A7ZA 1ZRKA 2IOTA 1FMGA 3V0XA 1P12E 1NY22 1P09A 1ZPBA 4OGYA 1FX0B 2GCTB 3BV9B 3HATH 2GP9B 4UE7H 1KXAA 4TPYA 3OTPA 3F9GA 4KGAA 4Y71A 1MMJN 1MKXH 1OWJA 4NSVA 2XC0A 1SG8B 4K3JA 1HYLA 5DG6A 1ANCA 4WH8A 4NWLA 2W6JD 1A7SA 3PWBA 1UCYK 2H5CA 5I46H 4WXIA
chains in the Genus database with same CATH topology
1MKWK 4NZQA 3SJ9A 1KXEA 3SV8A 4CRBA 3URDA 2GZ7A 1KYNA 5GWZA 4QT8C 2AMDA 1C5YB 1VCWA 3ATLA 1ZYOA 1Y5BT 1GVKB 1TLDA 2TIOA 3A8CA 1Z8GA 1SFQB 3M3SA 3SU6A 4CREA 1WTHD 1C2JA 1QNJA 3TJUA 1E35B 3QWCH 1E0FD 4BTIB 1D4PB 1EAIA 3I78A 1P8VC 2V3OH 2GV6A 3PO1B 1AKSA 2VWNA 2FOCA 3RXKA 4D9QA 2Y5GA 1O3HA 1DSTA 3QGNB 2TGDA 3U1IB 1GHZA 5A0BA 1BHXB 2XBXA 3URCA 3AW1A 3ESTA 3Q00A 1RFNA 1V2OT 2FO9A 2FMJA 1F0SA 3OYPA 8ESTE 3G01A 4FUGA 1C5LH 2J92A 1S6HA 2P3FH 1J15A 4B1TA 1V2UT 1O35A 1O38A 1DY9A 1SGRE 3HK6B 2IJOB 4LXBH 4TPIZ 5J4QA 3EA8A 1XMNB 1ZSLA 4AB8A 1O3PB 2D2DA 1BT7A 2ZDVH 2P8OB 2K1QA 3F68H 2JETB 1MQ5A 1O3KA 3ZZ4A 2OBOA 1V2MT 1TNHA 3FAOA 4K1SA 1MTSA 1O2JA 3O8RA 4UEHH 3KL6A 2WPKS 1ACBE 1C5UA 2ZTYA 5C5OA 1H9IE 1YF4A 1S0QA 4DW2U 1W0ZU 2BTCE 1F5KU 3LGYA 1FIWA 3P8GA 3MO3A 1C2FA 4CR5A 3BG8A 2RA0A 2SGAA 2GMTB 3UWJH 1S83A 3KIDU 7GCHF 3OTJE 4KTSA 2VVUA 5C67A 2ZU3A 2B9LA 2G5VA 1YPLH 5T6GA 2A5AA 2CGAA 3TGKE 3M3VA 1C2IA 1C1VH 1IQHA 1YPHC 3A83A 2VWLA 1T4UH 5TCAA 3SGQE 2ZWLH 5GDSH 3UFAA 1XVOA 3BTHE 4K8BA 3RU4T 3QZRA 3EA9A 3TIUA 3RC4A 3TJVA 2ZQ1A 4B71A 1NC6A 2EC9H 3MH4A 4IC6A 2ZFRH 1BRUP 3BF6H 3HGNA 2Q6GA 1T32A 5BPEA 4E7RG 2BDHA 3HKIB 2UUYA 1SLUB 3K6ZA 3TK5A 4Y7AA 3MFJA 2QF3A 3MU5A 1QBVH 1A1RA 4MQAA 4OS2A 4Y8XA 3GCOA 3KQBA 1YKTA 4ABIA 3FP6E 4VGCC 4X6MA 1EZSC 2FYRA 1C2MA 1J17T 4KTUA 4X1SU 4WY3A 1WOFA 4DOQA 2QYIA 7ESTE 1MTUA 4Y79A 1G3CA 2FX6A 5TJXA 4DG4A 2P3UB 2FLBH 2CV3A 1GMDF 2SGPE 2OTVA 1SLWB 4TWYA 2AEIH 2ZI2H 4BXSA 1LTOA 1LQEA 1YPEH 3GCHC 3EYDA 4Q80A 2C90B 4HGCA 3SU4A 1O3AA 3LGUA 3RXGA 4HFPB 1QA0A 2VB0A 1MTNB 2BDAA 1YGCH 5GPIB 1A0LA 4K60A 1L1GA 1QL9A 4M7GA 3KF2A 3SJ8A 1TPAE 4I8LA 1BCUH 5EXLA 1ELDE 1Z7KA 3GOVB 3LGVA 1QRWA 1OYTH 1UVSH 2ODQA 1BTXA 1C9TA 3BSQA 2G5NA 1P2MA 1P2QA 1EUFA 1OP2A 1Y5UT 1QQUA 1JWTA 2HVXA 1C2GA 3SQEE 1HAGE 2ANMH 1WCZA 1F0TA 4Y10E 5DPAA 5JDUB 2VIDA 2B7DH 4AFSA 5FHTA 1D3PB 2OUAA 1WU1A 2TBSA 3ZVGA 2WINI 2PHBA 1O3IA 5F8ZA 4WF8A 2HRVA 1IQJA 3P95A 3Q76A 1O3NA 2H5DA 1K1MA 2FWWA 2AYWA 4A6LA 3PWCA 1DDJA 4CH2B 3QZQA 1BTUA 1KXFA 1C5VA 3HGPA 3KNXA 3ZZBA 1FUJA 1ETRH 1JBUH 5EW1H 4YOJA 1HAHH 3ZVEA 1RD3B 1GBAA 1ANDA 1NESE 2GCHG 2ZHEH 1H8DH 2BZ6H 4MPWA 4IBLH 3MI4A 3RU4D 4BOHA 1SSXA 1YCPM 2W26A 1TQ0B 2HGTH 1DLKB 1VCPA 2ZDAH 5I25A 1JIMA 2UWPA 2GT7A 1O31A 1IQFA 1MCVA 1GBCA 1ZHRA 2GGVB 1ZTLA 4B74A 3LT3A 3GY2A 1W0YH 1QJ1B 1WQSA 1IHTH 3TGJE 2F9VA 1OXGA 3BTGE 5EW2H 2VINA 1CE5A 2QCYA 3TH3H 3KHVA 3PMHB 1Y59T 3RXLA 1ZPZA 1TNGA 4INHA 1LKAA 3SNCA 1SOZA 3MTYA 1WYKA 1PJPA 2P93A 1NROH 2H9HA 1GI6A 3NXPA 3KQEA 4KELA 3BTTE 4A1XA 2ZGBH 3DA9B 1O3LA 4R0IA 1EZQA 2O8LA 1C5OH 4MNWA 5H4IB 1NT1A 1QB1A 3BEIB 2FS9A 2EI7A 3LIWA 3B8JA 5PTPA 2ASUB 1AUTC 1HJAB 5A2MH 1XUJA 1K1NA 2BD8A 3SV9A 2O9QA 2WV4A 1B5GH 3LOXA 3IWMA 1O39A 1EJAA 2ULLA 4AGJA 3M37A 1A0JA 1WBGB 1NS3A 3P92A 4MPVA 1ABJH 1NM6A 2A31A 5HM2A 2HPQH 3EA7A 5LGOA 1A5GH 2VGCB 2ZECA 3VEQB 3RC5A 2A0QB 1BRCE 3ZZ3A 1HCGA 3FP8E 4H42U 2R9PA 1K2I1 3PTNA 1KTSB 5F6MA 1EP6A 2XWBI 3KQDA 5C20A 1MU8B 3A86A 1S6FA 5C5NA 1ZLRA 3D62A 1TNKA 2R3YA 1ANEA 3OSYA 1P02A 1INCA 1Z1IA 1TYNA 4FUCA 1NRQH 1AO5A 2LPRA 1TRNA 3RMMH 5FAHA 8LPRA 1UJ1A 2BX4A 1SVPA 1TA6A 4FUEA 5EGMA 1LHCH 3RMNH 4AB9A 1ZRBA 4D7FA 4X8UH 4Y7BA 3ZYDA 9LPRA 2ODYB 1ZJDA 3VGCB 5L30H 1AVGH 3KEEA 3FANA 1EPTB 3K2UA 2FOAA 1FV9A 3RXIA 1GDNA 3DUXH 3OU0A 4UFFH 3CP7A 5GCHF 1A0HB 4BTUB 2DE8A 2TPIZ 1OX1A 3N7OA 1DXWA 2EA3A 2C3SA 3SI3H 1ZHMA 1F2SE 1UTKA 3UY9A 1HV7A 2G4TA 1RTFB 2OC7A 2C4FH 1SQAA 1HDTH 1Y3WA 1HIAB 1QL7A 1P3CA 1UK4A 3MU0A 3ZZ6A 2XBWA 3CENA 4CRGA 2CMYA 1EQ9A 3ATIA 2P59A 1UTNA 3EAJA 2A1DB 3AAVA 4X2WA 1G2LA 2XBVA 2P16A 3M5NA 4ISLA 4CR9A 1AIXH 3LDXH 1OYQA 1C5NH 2XYAA 1BBRE 3ELAH 4J1YA 2Z3CA 1SGIB 1V2PT 1UK2A 1BIOA 3CS0A 1O3JA 4CHAC 1C5QA 5DP6A 1TMBH 2H2ZA 1GBKA 4X6PA 1EASA 1A2CH 1TOMH 3IITA 1P2JA 1GHBF 1EAUA 1ZOMA 3U1JB 3NUMA 2TGPZ 1SGTA 4YOGA 1GJ6A 1MBQA 3GCTF 2VH6A 1GG6B 3QN7A 3UWIA 3PMAB 5CE1A 5EQSA 1AVXA 2Z3DA 1VJ9U 1LMWB 1KTTB 2ZZUH 1MZAA 3RMOH 4U01A 5E0GA 1KLIH 2VIVA 3FZZA 4U2WA 4NIYA 3DFLA 3BTFE 4I33A 1GI9B 2XTTB 1A46H 3T25A 3UR6A 1UCYE 1QB6A 2VIWA 3A80A 1O3DA 2FOMB 1DOJA 1XUHA 3Q3YA 4Q7XA 4NA9H 1RIWC 2V0BA 4HTCH 1C1RA 2NWNA 5SGAE 3K9XB 5T6FA 2BY7X 1BTYA 2P95A 2A45B 1UO6A 2ZCHP 1CGJE 1DM4B 2O8UA 3GDSA 1HUTH 2D26C 1TALA 4K1TA 4AOQA 3E0NB 5DP5A 2QXIA 1DSUA 1KDQA 1BTZA 1F0UA 1K1PA 3TH4H 4YOIA 1HGTH 1EOLA 2SNWA 5BRRE 1GJDB 4JK5A 4ZMAH 5K0HA 5T6DA 1MD8A 1YCPH 3L6PA 3SU1A 1H9HE 1TIOA 2SGFE 2TGAA 3NPSA 3GY4A 1CT2E 2XC5A 1TONA 3GCNA 1OWIA 3GCTG 1C1SA 2WPMS 2VJ1A 1W10U 2F9OA 1K28D 1GDQA 1ZJKA 3M36A 2Y6TA 1NU9A 4BAMB 1DS2E 3KCGH 1SC8U 3BTDE 5E2PA 4FU7A 2EI6A 3HKJB 1J9CH 3GY5A 1YBWA 4BXWA 3VB5A 1S81A 3ODFA 1TNJA 2AMQA 1O2KA 4BAKB 1ETTH 3OY5U 1TRYA 1AZ8A 2AERH 4X8SH 2SGEE 3RXFA 1G3EA 3SUDA 1P9SA 4XBBA 4HZHA 4JZ1A 4CRCA 1SPJA 1EPTA 1GDUA 2FI5E 3KQCA 1GJBB 2GT8A 1G9IE 1NRSH 3RP2A 4D9RA 3RLYH 4J2YB 5FBEA 4ABHA 4JZIA 1NFXA 4K2YA 1GBEA 2ALVA 2W7UA 1F7ZA 4I8HA 4AX9H 1XM1A 1O2PA 4A5TS 4DY7B 4IN1A 4AFUA 2UUKB 4INLA 1FPHH 4FUIA 4LZ1H 3A8DA 3TLOA 3P6ZB 5C1UA 1HIAA 1EZXC 1QL8A 2QN5T 2ZDMA 1O5EH 5JPMH 3RXTA 1CHGA 1A3EH 1GBMA 1Z1JA 1A5HA 2ZHFH 1QA7A 3QUMP 3MNSA 2HNTC 2M5TA 3PMJA 4CBOA 1HXFH 1QRXA 5FPTA 3SUFA 3SHCH 1NRNH 1RTLA 3A81A 2GTBA 3H7TA 2BDIA 1CVWH 2HNTF 3RC6A 4NA8A 4BNRA 1ZTJA 1ESAA 1QY6A 1QB9A 5FCKA 1V2LT 1BBRH 2QXJA 1QURH 1KLTA 1N6XA 1FPCH 1UTOA 4Y0YE 1LHGH 3STJA 4NCYA 3TGIE 2BY9X 2ZDLA 1V2KT 1DFPA 3LGWA 1P03A 4GHTA 1C1PA 3DT0H 2SFAA 4FXGH 1QGFA 2ZFPH 2PV9B 4JYTA 5EG4A 3E8LA 4I8GA 1GVLA 1UMAH 5EQRA 1UHBA 1AE5A 1HBTH 2KAIB 3SU2A 2B5TB 1E34B 2ZDNA 4B2CA 1CGIE 1V2VT 1H4WA 1TGNA 1VR1H 2ZHDA 2VWOA 5AFYH 1W11U 1S82A 3PLKA 3K6YA 1TQ7B 1HAZB 3BN9A 4WMEA 1PPFE 3E1XB 1V6DA 4WWYA 2ZDKA 2PSXA 1LQDB 1UCYH 1KXCA 3TNSA 3TITA 1MZDA 1MKWH 4YTAA 1SQOA 1H8IH 2QXGA 2VIOA 3UQOA 4B2BA 2YOLA 2ZFSA 4X6OA 3QDZB 1UTPA 1FY5A 1O5FH 2PUXB 4GSOA 3M35A 3U69H 6ESTA 1ANBA 1A61H 4O03A 4YLQH 3AVZA 1TNIA 1RGQA 4GVUA 3E0PB 3ATMA 3FFGA 3U9AH 3SUGA 1O2XA 1GHAF 2XW9A 2GCTC 4TY6A 3QTVH 3E91A 4F4OC 3GDUA 5A8XA 3M3TA 1HPGA 4OGXA 5DGJA 1Q2WA 3SU3A 4Y0ZE 3D23A 4X6NA 4NG9H 2ZG0H 3O8BA 1VITH 3ZZ7A 2BY5X 1GBDA 1AD8H 1AFQB 1PQ7A 1QRZA 5HM9A 3A84A 1Q31A 3P8OA 5JBAS 2GZ8A 2R0KA 1YPKH 3RLWH 3SV6A 2A7CA 2B0FA 2BY8X 1QIXB 4MNVA 2H9TH 2QA9E 3MOCA 5FXLA 3P17H 1UVUH 2Z9LA 1QBNA 1TMUH 5ABWA 3A7WA 4WJG2 3QGJA 3ZVDA 1GMHF 1O2MA 5DJ7A 1W3CA 4NFEA 3VB6A 2V3HH 3NK8A 1GHWH 1S5SA 4I32A 3PO1C 2C8WB 2FEQH 1DWCH 1TOCB 1TX8A 3L3TA 1GHAG 2OXSA 3RXOA 1RTKA 4JZEH 4ZH8A 2BD5A 1XVMA 1N1LA 3SUEA 1T7CA 3A7YA 1HJ9A 4LZ4B 1C1MA 2NU1E 5FX6A 4ZAEA 1TBQH 4Q7ZA 1BHXF 1LHFH 2ZPRA 2PGQB 3SGBE 4YO9A 1FONA 2Z6BD 2BLOA 3E16B 4X0WU 4AYYB 2R0LA 1DVAH 3BIUH 2XC4A 2GCHF 1IQLA 1P2IA 1NTPA 3T29A 1BJVA 4WH6A 3MYWA 4JCNA 2STBE 1JMOH 4FU9A 3H7OA 4E06H 3MU1A 2P8OC 1HAXB 3RXJA 1IHSH 1PQ8A 1ORFA 2VIPA 4BAOB 1W7XH 1TNLA 2JETC 4FUDA 4IGDA 3EE0B 1OSSA 4D8NA 1E38B 1C4Y2 3R0FA 1GPZA 2A4OA 1T8LA 3QK1A 5ESTE 3STIA 2F91A 1UTQA 4ABFA 1GMHG 1N8OB 2QIQA 3S9BA 3FVFB 4F49A 1UVPA 1GBBA 2BZAA 3I29A 1LDTT 2GMTC 1DWDH 1ELBA 1K22H 5ESBA 2KAIA 3UTUH 3RXCA 4GHQA 1ZTKA 2DUCA 2ZU4A 4DJZB 1DWBH 1GBIA 3GYLB 2GX4A 3PV4A 3ZVAA 1CSOE 4GCHF 3TNTA 3I77A 1UK3A 1FY1A 5CHAB 1GI7B 2PTNA 4MTBA 2BDBA 2A4RA 2HALA 1FN6A 3NZIA 2A32A 2HOBA 4Z6AH 4NZLA 4ZROA 1K1IA 1C5WB 4U32A 1LHEH 1QR3E 2W3IA 4NIVA 3SN8A 2CHAB 2FDAA 2C93B 3ZVCA 5LH8A 4SGAE 2ODPA 1O37A 2YNBA 1Z8JB 3SV2H 6CHAB 1GCDA 1TPPA 2UUFB 5FPYA 4U30A 2F9NA 1MH0A 3QO6A 4LK4A 4WXVA 7LPRA 1ZGIA 4X8TH 2ZNKH 2Y5HA 4O97A 1LPZB 4NA7A 2UWOA 2R3UA 3CS7A 2NU3E 4SGBE 1PPEE 3TK6A 1WAYB 4ABGA 2JH6D 2ZU5A 1EX3A 3W95A 1O5CB 4ABAA 1HNEE 4TWWA 2F9BH 3ZVBA 2XXLA 1GHVH 1NRRH 2AGEX 4ZHAA 2RG3A 3T2NA 4I8JA 2ZGCA 5JB9S 1IQIA 1PPBH 1S85A 1ELFA 1GVZA 1HAVB 4KKDA 4K8YA 1RXPA 1C5RA 4GCHG 1LO6A 1SLXB 3VB3A 2W5EA 1FIZA 2Z9JA 4AG1A 1XUGA 2FYQA 2G81E 4CRAA 1VITG 1ZPCA 2BD7A 1D3QB 1O2WA 2Z94A 5A8YA 3MNXA 5DKMA 4THNH 2BHGA 3LH1A 3ITIA