1AZZA

Fiddler crab collagenase complexed to ecotin
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
226
structure length
226
Chain Sequence
IVGGVEAVPNSWPHQAALFIDDMYFCGGSLISPEWILTAAHCMDGAGFVDVVLGAHNIREDEATQVTIQSTDFTVHENYNSFVISNDIAVIRLPVPVTLTAAIATVGLPSTDVGVGTVVTPTGWGLPSDSALGISDVLRQVDVPIMSNADCDAVYGIVTDGNICIDSTGGKGTCNGDSGGPLNYNGLTYGITSFGAAAGCEAGYPDAFTRVTYFLDWIQTQTGITP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (serine protease/inhibitor)
molecule keywords COLLAGENASE
publication title Crystal structure of an ecotin-collagenase complex suggests a model for recognition and cleavage of the collagen triple helix.
pubmed doi rcsb
total genus 50
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.32: Brachyurin.
pdb deposition date 1997-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1azzA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1azzA01
3FANA 4D7GA 3HKJB 3QZRA 1DLEA 1O2YA 2Z9IA 1O31A 1J17T 1T32A 1A2CH 2BD9A 1O2IA 3MOCA 1P2NA 4INKA 2OC8A 2GT8A 2FOMB 1HYLA 3SNDA 2B9LA 4AN7A 2BLOA 4TWYA 2THFB 2F91A 3ZZ6A 3FP8E 1GHBF 4YOJA 2F9PA 2C93B 1AB9C 1QRZA 3TH3H 3F9HA 3E16B 1UK2A 1SGFA 1GI4A 1NS3A 3RXOA 4E7NA 3F1SB 4ZHLU 4H6TA 1WUNH 2HNTF 3LJJA 1MTSA 2SGEE 3ENSB 3VGCB 4DURA 3TJVA 2ZHDA 1BCUH 2QF3A 1GMHF 4AGKA 5EXMA 2BX3A 1P10A 5C2ZA 1ABIH 2OLGA 2XCNA 4ABGA 5C20A 1PPCE 3M5OA 4B74A 2G8TA 2TIOA 3KQEA 1O3LA 4HZHA 2P3TB 1ACBE 1O5GH 1EOLA 3PLBA 3P17H 1KDQB 1BMNH 4JCNA 4ABAA 1VCPA 4GCHG 5EU8A 3URCA 2HNTE 1TA2A 1TALA 4YLQH 1S82A 2BDYA 1GGDB 1OP2A 2Q6FA 3TVJB 1DSUA 2FXRA 2V35A 4D7FA 2I6QA 4XDEA 1KIGH 1VZQH 2GVFA 1NU7B 3RUOA 3MH7A 3PWBA 1GI6A 1LPKB 4NFFA 3QK1A 5T6GA 1IQNA 1TIOA 1O2MA 2QXGA 3K65B 4K2YA 2VB0A 1V2UT 4CHAC 3VPKA 3SV7A 3ZZ5A 2W7SA 1UCYK 2GZ7A 1KY9A 2G55A 4UONA 1BBRE 1ZYOA 1O2VA 1ABJH 1C4U2 4UFEH 2EI8A 1YYY1 2R2WU 5DP7A 3VB7A 1ZMJA 2B8OH 3EYDA 3V7TA 3TJNA 3W95A 2LPRA 3VFEA 2Y6TA 1TMUH 1SGCA 3QX5H 2ZU4A 4H42U 4BTTB 2TGDA 5EW1H 5FPYA 1P04A 1P2KA 2YNAA 2FI5E 1QBOA 3FFGA 1EAUA 2F9UA 1GDUA 3C1KA 1GVZA 1SLVB 2ZPSA 2EA3A 4ABIA 3RLWH 3UR6A 2J92A 1DITH 1C5VA 2C8XB 2ZU3A 4DY7B 1Z7KA 1PYTD 1EQ9A 1J14A 3K6YA 4MNWA 1ZRBA 1WV7H 2UWPA 2Z94A 1UVUH 1G37A 3TJOA 2ZQ1A 1ANCA 3LONA 2G5VA 4UD9H 3NPSA 1HIAA 4E06H 1C2EA 5FXLA 2FDAA 3OX7U 5GCHG 3M3TA 2ZDMA 1TABE 4FUFA 4Y11E 1KLJH 1MZDA 1TE0A 1D6WA 5EPYA 1NESE 1SQTA 2W7UA 1EP5A 3L3TA 2Y5HA 1ZJDA 1BTHH 1K9OE 1WU1A 3QDZB 3NUMA 1Z71A 4WVPE 4CBNA 2XWAA 5EXNA 3RXEA 1O2LA 1O2KA 2ZHWH 5LPFA 3TH4H 3MNXA 3TIUA 4BXSA 1QBNA 2BDIA 4ZXXH 4O9VA 3SUEA 1GJ8B 4D9RA 1UMAH 4U30A 4CRGA 3RXFA 2QIQA 5E0JA 2AGEX 3SJOA 1NT1A 2ZWLH 5T6DA 1MTUA 1YGCH 3P8OA 3PMAB 4UE7H 3UOUA 2WYJA 2W5EA 1BIOA 5C5OA 1SLUB 2J95A 2Q6DA 1EUFA 1Z1JA 4MTBA 3S69A 3UOPA 2ZA5A 3SJKA 1J9CH 1O33A 4X6PA 3NXPA 4Q7YA 5FPSA 1W7GH 5K7RA 2F9OA 4WH6A 3OU0A 1TNJA 4AB9A 2H5CA 3F9GA 1TWXB 5A8YA 3GCTG 3ZVDA 2VIPA 2R2MB 1GG6B 3KIDU 2EI7A 1W0ZU 2OUAA 1OXGA 3E0PB 1LHDH 3RMOH 1SGTA 1GJ6A 1M9UA 1HAZB 1HJAB 1S6HA 4MNXA 7KMEH 1TNIA 3SW2B 1LKBA 4BNRA 4X2WA 3LH3A 1DUEA 2JH0D 3GCHC 4ZHAA 1THRH 2GD4B 2LNCA 1SBWA 2NU3E 3LU9B 3V13A 2ESTE 1EASA 1LQEA 1G2LA 2DE8A 3GCNA 4KTSA 1GBEA 2ZCLP 4R8TB 3S9BA 1KXFA 4OS7A 2BMGB 3ZV9A 5DKMA 1N6XA 1UVSH 4Q7XA 2IOTA 1EKBB 1AB9B 1TB6H 4K8BA 4UFFH 4TPYA 5CHAC 1P8VC 1MUEB 1XUFA 2YNBA 1B0FA 2XXLA 4OGXA 4AG1A 2FEQH 3T5FH 3SU4A 3EDXB 3K6ZA 2FODA 3M61U 1F7ZA 1NO9H 1O39A 2P8OC 4ZKOU 3LGVA 4ZKSU 2CN0H 5L2YH 5EQQA 2ZPRA 1SGEE 3PWCA 1SQAA 1QFKH 1DPOA 2A32A 4A5TS 1L0ZA 4O3UA 2FI3E 1RFNA 1K22H 1AZ8A 1GI9B 1QURH 4INLA 1Z8JB 3ZZ4A 2VU8E 4WF8A 4M7GA 2KAIA 2SNVA 1JIMA 5EG4A 1VJ9U 1HUTH 1DWDH 3MH6A 1TBQH 2PWXA 1S83A 3U9AH 1LQDB 1ELCA 3RXGA 1OX1A 4OS5A 5DP4A 1BJVA 2WPJS 1YBWA 3M7UA 3U8TH 1JRTA 1AMHA 1G2MA 2Q6GA 5C67A 2YOLA 1D3QB 1ZPZA 2Z7FE 1AD8H 1KXBA 3BEFB 4E7RG 4JK6A 4CHAB 4DT7B 1AHTH 3PV4A 2PW8H 2BVRH 4WXIA 1K1IA 1BMAA 1HJ9A 4WMFA 4QT8C 1J8AA 4FU8A 5FBIA 5AF9H 3AW1A 2XC5A 3GY3A 3UUZA 1IQHA 1ZTKA 1AY6H 5JPMH 1MQ5A 3Q3XA 2VVCA 2A2QH 1C1VH 1GI2A 1CGHA 2GDEH 2P16A 1SVPA 2EI6A 3W94A 1PQAA 2NU2E 1OKXA 3RXBA 3RXTA 2GTBA 3KCGH 3SU5A 2HNTC 3LH1A 3LC5A 1YP9A 1H8IH 4FU7A 1K1NA 1VITF 3Q3YA 4ABJA 3QGJA 1IHSH 3TITA 3TGJE 5F8XA 1Y3WA 1F0SA 1NFWA 1L2EA 3UR9A 3UNRA 1L4ZA 5FX6A 3F9EA 3RXVA 1T4UH 1N1LA 1O36A 2A7HA 2A4GA 1ZR0A 5JYIA 3FP6E 2WPKS 1W14U 4MNYA 3H7TA 2HLCA 1O2UA 2ZECA 3FZZA 3VB6A 1MBQA 1FMGA 2WPLS 5DP6A 5C1YA 2A4QA 4OS6A 3P70B 2PTNA 3M7TA 4NCYA 1O3BA 4TY6A 2ZCKP 1OWIA 3MMGA 1SGNE 1O37A 4AZ2B 1BITA 3MU8A 4BAQB 3M36A 1C1WH 1KXAA 1SGFG 1G9IE 3D62A 5C1XA 1DM4B 1ELFA 1U6QA 3PLPA 2V0BA 1ELBA 1BZXE 2A31A 3GY2A 1S0RA 1O3KA 2QC2A 1V2WT 5JBTA 8KME2 1Z6EA 1SSXA 1SL3A 1MD8A 1P0SH 4B1TA 2ZTXA 1BBRK 1E37B 1SLWB 2BLWA 1O2TA 2Z3CA 1EZXC 1BRAA 1TX6A 1C5PA 3LC3A 1JBUH 2PSXA 1QNJA 2PUXB 1L1JA 4DG4A 3EE0B 4DGJA 4AOQA 2FTLE 1C2IA 1WTHD 3LGYA 3DFJA 1ID5H 1ZHMA 3QO6A 2OC0A 3AAUA 3EQ0H 1K2I1 4F49A 2WUCA 2QYIA 2C8WB 3UWJH 4FVDA 4IGDA 1SOZA 1MCVA 4IBLH 1QIXB 2O9QA 1IQFA 2TPIZ 1ELAA 1WTGH 1O2OA 2PV9B 1C1QA 1H8DH 1MAXA 1TRMA 1O5CB 3RMNH 4ISOA 1QJ1B 3MO6A 2ZG0H 1BTPA 3SO3A 1W7XH 2NU0E 2ZGJA 3F6UH 3SJ9A 2WPHS 1GHXH 3GCHB 4FUEA 3K2UA 1ANBA 2ZHEH 5HXFA 3T62A 2EC9H 3B23B 1BOQA 1GMCG 4I8JA 5DK1A 3KL6A 3BV9B 1AZZA 1GI1A 1PPZA 4X1QU 5CHAB 4X8VH 1ESAA 4K8YA 1VCWA 7GCHG 2G00A 2SFAA 1P03A 3KNXA 4NSYA 1LVYA 1OWJA 3VB4A 3TK6A 1VGCC 2J94A 2B0FA 1O30A 4ABFA 1MZAA 2Z6BD 2ANMH 2P8OB 4CRDA 1JMOH 3AVZA 2PFEA 1BRBE 1BMMH 1ELGA 2XCFA 1DWBH 2WYGA 2R3YA 1ESTA 1KTTB 1BMLA 2G4UA 1QRXA 2ZEBA 3LOXA 1AE5A 3A89A 1MBMA 4IS5A 1Y3XA 1BTYA 2BDCA 1MTVA 1A5GH 1EAWA 1EPTC 2F3CE 2G5NA 4CRCA 5F8TA 3ZVEA 5JBCS 1SFIA 3O8DA 3ZYDA 3SORA 1FXYA 2AEIH 2ZGHA 2XYAA 1KLTA 1UCYH 3GCOA 1AWFH 4IC5A 3RM2H 1AU8A 2ZGBH 1UTOA 3MTYA 3A7ZA 2VINA 1FI8A 3Q00A 4LOYH 4X1NU 1C4Y2 3ZZ8A 1O2NA 4FVBA 3SU1A 2ZGCA 3UY9A 1GPZA 1AWHB 2GDDA 2RA0A 2FOGA 3FVFB 4JK5A 4FUHA 3RC4A 4DIIH 1RXPA 1O38A 1MTNC 2XRCA 3BG8A 4UFGH 1QJ7B 2P94A 1BUIA 4H4FA 2GZ8A 2FOCA 3ZZAA 1N6YA 2BQWB 3SQEE 9ESTA 3A7YA 1O2JA 4PROA 3PMJA 4GVUA 1DXWA 4Q7ZA 1O2SA 2ZTZA 3GDVA 1WSSH 2PGQB 1S5SA 4BXWA 1C1PA 3MO3A 1JRSA 2D2DA 1ZLRA 1FN8A 1K1MA 3TNTA 1D9IA 1LHFH 2XBWA 4AFZA 3VB5A 1QCPA 1DLKB 3MO9A 4FUIA 2AS9A 2AIQA 5IDKA 1C2LA 1E34B 5GCHF 2RG3A 3TJUA 1XXDA 2K1QA 5FCRA 1BTUA 1QA7A 3A8CA 1ZGIA 4UDWH 1NPMA 3GISB 3KQDA 3NKKA 1C5TA 1O2PA 3MH5A 2WPIS 2G51A 1EB1H 2XTTB 2XC0A 1O35A 1FZZA 2BYAX 1P05A 3U69H 3ZZ9A 2GKVE 1C2GA 5FHTA 5C3NA 4NWLA 2H9HA 3O8BA 1G30B 3E0NB 4AYVB 4J1YA 1YLCA 1Y5UT 1SR5C 2XBYA 1V2PT 8LPRA 2BD2A 3PTBA 4XE4A 2CF8H 3M5NA 1SOTA 1GBDA 2BB4A 1QHRB 1Y8TA 4Y8ZA 1AUJA 4I33A 1GI8B 4NFEA 4HTCH 2QGRA 4YLUA 4AFSA 1OYQA 2UWOA 1CHGA 2BLVA 4X6NA 2XBXA 1V2NT 4I8HA 1ELEE 3GCTF 1QGFA 4YT6H 3UQOA 1YC0A 3BTKE 1S84A 2XNIA 1ZPBA 1O0DH 4D76A 2ZF0H 5J4SA 2FOHA 4E05H 5BPEA 2AMQA 1HDTH 1RIWC 1YM0A 4NWKA 1O3DA 4GHQA 1TOCB 1ELVA 1TQ0B 2CF9H 1T31A 3SI3H 2F83A 3A7WA 4MNVA 4AFQA 1NY22 3B9FH 4X6MA 1F0TA 4XBCA 2HPPH 5I46H 1GBBA 1WAYB 2F9BH 2ZDLA 2ZNKH 2A1DB 4I8LA 3A82A 5FCKA 3RXQA 2RDLA 4B2CA 1MU6B 4YOIA 3GOVB 1CT0E 5DPAA 1P57B 1ZHRA 1NFUA 2J38A 4A92A 5HM9A 3E1XB 4Q80A 1GBJA 2FO9A 1BRUP 2GP9B 2GCHG 3T2NA 1F2SE 4HGCA 3U8OH 3BTGE 4CREA 4D9QA 3MU1A 4TYDA 4LZ4B 3MU0A 2R0LA 1RTFB 3QTVH 1AUTC 3AW0A 4U01A 1KXDA 1VGCB 1G32B 3ZVGA 1RTLA 4GSOA 4ZHMU 4Y7AA 4NZLA 1J15A 4X2YA 2Y5FA 1FY3A 4D8NA 1EXFA 3SV8A 2PKSC 1W13U 4A1XA 1WYKA 1P9UA 2Z9KA 1GI7B 4AYYB 4X8TH 1P2IA 1NFYA 2PSYA 4LXBH 2BDGA 3A7TA 2BY8X 3SU2A 1UK3A 1GMDG 1P2QA 1EB2A 4FUBA 1LMWB 1RS0A 2FPZA 1SPJA 1CO7E 4B73A 3OY5U 1C2JA 1A1RA 1LHCH 3R0FA 2PGBB 1YKTA 1Z8GA 1TX7A 1X7AC 1C1TA 2G81E 3QLPH 3ZZBA 1OPHB 4NG9H 2OD3B 1CHOF 1Z1IA 1O3NA 2P3UB 4BAKB 8ESTE 2ALPA 3H7OA 1K1OA 1GHZA 4YZUA 1C1SA 3PO1C 2ZO3H 1L1GA 1T8OA 1SGPE 3SJIA 3RMLH 3A87A 1QTFA 1P9SA 2FOAA 5T6FA 1TNHA 2ZCHP 2ODYB 1KLIH 1EZSC 1GJ4H 1SQOA 3B8JA 4X0WU 3UNSA 3S0NA 3MHWU 6LPRA 1GMHG 4FUDA 4ISHH 1FPHH 2C3SA 2JH6D 1C9PA 2VGCC 2A2XH 1A0JA 1JXPA 2WUBA 1XKBC 1GHWH 4X2VA 1G3CA 4ABEA 2TGAA 1SB1H 1V2KT 1TQ7B 1MKXK 4CRBA 5CMXH 1XM1A 4AB8A 4WH8A 1TOMH 1MCTA 1C2DA 2NWNA 4RKJB 1SHYA 3U1JB 3N7OA 2OBOA 1CQQA 2CGAA 3UTUH 2SGDE 5E0HA 1C1MA 1SGDE 1V2LT 1O2HA 5L6NH 2IN2A 2BDAA 1DOJA 1GWAA 1OSSA 2EEKA 5EPNA 5A2MH 1ZTJA 2PHBA 4Z6AH 2ZHFH 3L6PA 2AFQB 2HVXA 2VVVA 5A0AE 1DT2A 3GICB 1BBRH 3SI4H 2BXTH 1JIRA 2A5KA 1GJ5H 1C1OA 2W3IA 4ZKNU 4CR9A 1FY4A 2OCVB 2UWLA 3ATIA 3RC6A 1C2FA 1P3EA 1W3CA 1TONA 3RXIA 1GJAB 1CT4E 2SGFE 3BTHE 1P09A 5A0BA 2FWWA 1P2OA 2BX4A 3GY7A 2ZFTA 2ZDKA 4A6LA 1K1PA 2PLXA 3SNCA 3URDA 5FPTA 2ULLA 1IQKA 3SOSA 1GBFA 5DG6A 1DVAH 1LDTT 1RIWB 1DSTA 3KF2A 1D3PB 1Q31A 4Y6DA 1FUJA 1E38B 1FIZA 3SUDA 1O3IA 2A45B 1LTOA 1V2QT 4MPUA 3VXFH 1GVLA 1H9LB 4K3JA 3ZV8A 5EW2H 5K0HA 1UTQA 4JZEH 1YPHE 3K9XB 1GL0E 3U98H 2VWOA 1WBGB 1SGYE 3BG4C 4ABHA 1LHEH 4GUXA 4BANB 1TRYA 4Y8XA 2FESH 1T8NA 3T29A 3SZNA 1SGQE 5GDSH 2JETC 4X6OA 1C5MD 3EGKH 1GJ9B 2OTVA 4NIXA 3QUMP 4K5ZA 5FX5A 2TRMA 3S7HB 1OWKA 4JZFH 3RXPA 1GCTC 3D65E 2ZFSA 3TNSA 1C5WB 5I25A 3RXLA 1OS8A 1QL8A 3NK8A 1L4DA 3UFAA 4NIVA 4GAWA 1W10U 1Y5AT 2UUFB 1ZRKA 1S81A 2XW9A 3P92A 2TGPZ 1IHTH 5J4QA 2PKSB 2FLBH 1NZQH 1ZJKA 4A1TA 5ESTE 1RRKA 2C90B 2Z9LA 6CHAC 4ESTE 1UCYE 1OWDA 3EAJA 1GHYH 3SUGA 5GWZA 4AGJA 5E8EH 2OQUA 1XUIA 2R0KA 4LZ1H 1BHXF 5DO4H 1EP6A 4TPIZ 3P8GA 2QXIA 2XWBI 3ZZ3A 1CA0C 1ANEA 1NFXA 3F9FA 1HFDA 5HGGA 1FY8E 1YPEH 3PMHB 3E6PH 1F92A 1LPZB 2FOBA 1O3HA 1PPEE 5E2OA 3VXEH 2R9PA 1OOKB 1TMTH 3MYWA 3RXSA 1YPMH 1IQIA 2AH4X 2P59A 2D8WA 4ZXYH 1GBCA 3UIRA 3ZVBA 4K1EA 1GBMA 1GJBB 3ATWA 1TPOA 1UHBB 2ZKSA 4Y7BA 3MNCA 3PO1B 3RP2A 6GCHG 1O3FA 1ZMLA 1C5XB 1BJUA 3E8LA 1WCZA 2WPMS 3BIVH 1DY8A 2C4FH 3Q77A 2STBE 3A8AA 2DE9A 3RC5A 3HKIB 3MI4A 1A61H 1GJCB 1EJMA 1GCDA 3MNSA 4A1VA 4MPWA 1V2MT 3M35A 4JYVH 1FONA 4FUGA 2FS9A 2VGCB 2ODQA 3G01A 2FS8A 5LPEA 4IN2A 3ELAH 3OTJE 1A46H 3ESTA 3TGIE 1YPGH 3A7VA 1AI8H 4Y8YA 2ZDVH 5C5NA 3U8RH 1W2KH 5HMAA 5JB8S 3GY6A 1Y59T 1HAPH 2F9VA 2AMPA 2Y82A 3MFJA 2Y5GA 1HAGE 4RKOB 2G4TA 4IMZA 4IC6A 4O03A 2BVXH 1YPLH 1EAIA 2ZFPH 3T27A 1UTLM 2W26A 2BD5A 2CV3A 1MQ6A 2CHAC 1E35B 1C5OH 1Y5BT 2J4IA 4MQAA 3S9AA 1DICA 1PPHE 2ILNA 1AIXH 2JH5D 5L30H 3RU4D 1EOJA 4X1SU 1C4V2 5A8ZA 2GCTC 1TGNA 1QL9A 3M37A 1QBVH 3BN9A 1EX3A 3TLOA 1HAVA 1V3XA 2IJOB 2NU1E 4GCHF 2QCYA 4ZAEA 4DOQA 2ASUB 1FY1A 2GZ9A 1HGTH 3RXAA 2FX4A 4H6SB 1Q3XA 4BTUB 1O3GA 2ZGXH 1AO5A 1C5ZB 1Y3YA 3PMBB 1FY5A 4MVNA 1JWTA 1P02A 4ASHA 1BRCE 1TA6A 1FAXA 5AHGH 5F6MA 1J16A 5ABWA 1FLEE 3HATH 1C5YB 1ANDA 1C5RA 2OBQA 4AG2A 3ATKA 1O3EA 1UVPA 5TCAA 1EZUC 3KEEA 2XC4A 1S6FA 2ZFQH 8GCHG 2ZFRH 2D26C 2PKAB 2O8MA 1TNLA 1O32A 1OWEA 1UTMA 3ZVFA 3UQVA 6ESTA 3BG4B 1EJNA 2GCHF 4DJZB 7LPRA 3SV6A 1AVXA 2BQ7B 1VITH 1FDPA 2ALVA 5CE1A 4WWYA 1O2GH 1BTXA 2AIPA 3OY6U 1HRTH 1DANH 1TGCA 1AFQC 1ELDE 3RU4T 1CSOE 1FNIA 4K60A 1TYNA 3A84A 2JETB 4CR5A 1ZMNA 4ISLA 3TPIZ 3A80A 1C5SA 4NSVA 1O3CA 4OS1A 7ESTE 4Y71A 2BZAA 3ATLA 3ODDA 1HB0B 4MPVA 1O3AA 1PQ5A 1V2ST 4THNH 3SJ8A 5BRRE 1GCTB 2A5AA 1GBAA 3OYPA 1Z6JH 1DY9A 4B2BA 3IG6B 2BM2A 1YPJH 1CVWH 3O8CA 1O3PB 5IYTA 3DD2H 4SGAE 2PTCE 1LO6A 1TNKA 2O8UA 1YPHC 4I8GA 1HAOH 1GMDF 5SGAE 3LDXH 1DFPA 4DIHH 4X8UH 5FAHA 6CHAB 3S9CA 1OWHA 3NCLA 3JZ2B 1HJAC 3FP7E 1SFQB 1SHHB 2BTCE 1XUHA 1EPTA 3C27B 1QJ6B 4GHTA 5H4IB 1JOUB 3A83A 1NC6A 1DS2E 4ZH8A 3FZDA 2BY5X 3SHCH 3NWUA 1S85A 1A0LA 1WQVH 1XX9A 3TH2H 2BY9X 4KTCA 1P12E 1NRSH 2QXJA 2VWLA 1DE7H 1XXFA 1HAVB 1CGIE 4JYUH 5FBEA 3VB3A 1TAWA 1GBLA 1FJSA 3Q3KA 1MKWK 1IQGA 1HNEE 5AVDA 1E0FD 2Y81A 1ARBA 3D49H 5GJ4B 1P01A 2AGGX 1O3OA 4A7IB 1TMBH 3WY8A 3ZVCA 2BD8A 2H2ZA 2CXVA 2F9NA 1HBTH 4TY7A 3BF6H 4Y79A 3BTFE 4KELA 4K69A 1HXFH 2ZDAH 3MWIU 3O8RA 1DWEH 1EZQA 1O5FH 4CH8B 3RU4E 1IQEA 1BTZA 1MKXH 3SNAA 4YT7H 4UFDH 2PR3A 1CE5A 1HCGA 1YCPM 2IPHA 4FU9A 2P93A 5AFZH 3ITIA 3A8DA 3ZZCA 1UTNA 2VWMA 4ABDA 4JZDH 3A7XA 1QQUA 1HV7A 2B7DH 3PROA 4NA7A 1THSH 2O8TA 2FZZA 1ELTA 3SNEA 2GT7A 3R3GB 1GBKA 4XOJA 1QA0A 2BVSH 3LJOA 1O3MA 1GVKB 3U1IB 3TK9A 1XUJA 4WJG2 1GL1A 2ZTYA 2R3UA 3DHKH 3RLYH 1BTWA 1GI5A 3E91A 1YCPH 1EATA 2VH0A 3RXUA 3V12A 1LKAA 3T26A 4OS4A 2ZU2A 3L33A 1HAIH 2CHAB 2BXUH 1O2RA 4YTAA 1XVMA 1W12U 3P8FA 4BAHB 1UJ1A 3DA9B 3HK6B 1NROH 2GCTB 2STAE 1UVTH 2VJ1A 4FUCA 1SMFE 3SBKA 4J2YB 4RSPA 4FXGH 2ANYA 3SHAH 1Q2WA 2ZPQA 3UNQA 1K1JA 1ZTLA 2FM2A 1GJDB 1G3DA 3KQCA 3LGUA 3LT3A 1LVMA 1C1UH 3SGBE 1TPAE 1VJAU 1P2MA 1Z8RA 1B7XB 1QR3E 1TNGA 4I32A 1EPTB 2VVUA 4HFPB 4OGYA 1C2MA 4ISIH 1OYTH 1O2QA 1H9HE 3HPTB 1QB9A 3BSQA 1SGIB 2UUJB 1PJPA 5JDUB 1O3JA 3GY4A 1YLDA 2D1JA 2ZI2H 3I29A 1C2KA 1MU8B 4ZUHA 3S7KB 4AORA 1GHAG 2I6SA 4Y76A 1DWCH 3BTWE 1Z8IB 4XFQA 1MMJN 1PFXC 1KYNA 1XUGA 4BAOB 1PQ7A 3STIA 1A3BH 1F0UA 1MTNB 2DUCA 4OS2A 2SNWA 1Y3VA 2FIRH 2HPQH 5ESBA 1H4WA 3DFLA 3RXDA 2A7CA 1GHBG 3BTME 3P6ZB 4X2XA 1W0YH 4CRAA 5A0CA 1AFQB 3A85A 1QY6A 1OP0A 1RGQA 5DP5A 1P2JA 3A81A 3LIWA 4YOGA 1F5LA 5PTPA 1D3TB 1DDJA 2WINI 3BTEE 1BA8B 3M5LA 3NZIA 1YPKH 1FIWA 2GV6A 3RXJA 5A09A 2J34A 1A3EH 2VIVA 4DVAU 1F5KU 1BT7A 3UPEA 4GLYA 1FV9A 3CENA 2XBVA 2O8LA 1LVOA 2H5DA 4O97A 1TRNA 2ZU5A 3STJA 3VEQB 1KSNA 1UK4A 5EQSA 1AVWA 1T8MA 1ZOMA 4AX9H 1WOFA 2Y80A 4MDSA 4ZROA 3HGNA 1AKSA 1NTPA 1T7CA 3SV2H 3SU6A 3GYMA 1AVGH 1GBIA 4WY3A 3JZ1B 4KKDA 4RN6A 1ZGVA 3MH4A 2ZIQH 4JMYA 3LPRA 1EJAA 1GBHA 4SGBE 1UTJA 2BY7X 3BTDE 1NM6A 1A5IA 4LK4A 1B0EA 1GHVH 4WXVA 4IW4E 6GCHF 2QF0A 1RTKA 1YCPK 2GMTC 2ZQ2A 3V3MA 1C5NH 1GDNA 2BOHB 1CBWC 1IQLA 1LPGB 1HLTH 2BD4A 1DUAA 2QAAA 3EA9A 1UHBA 2FI4E 1V2RT 4VGCC 2VH6A 2OINA 5TCCA 1SG8B 1TX8A 5AFYH 2VIWA 3OSYA 1PPGE 1HJ8A 2NU4E 4Y0YE 1O5BB 1ZSLA 2ZU1A 1A4WH 3BTTE 3TU7H 1HAYB 2BY6X 2OQ5A 1O5DH 3IITA 1NRNH 4YM9A 2CMYA 5GIBA 1TFXA 3RXRA 1D4PB 5L2ZH 1XMNB 1HIAB 1PPFE 2FYQA 1CA8B 3E90B 1DXPA 2SGAA 1O2ZA 5E2PA 3RMMH 4MG3A 4AFUA 3RXHA 2AYWA 2BZ6H 4NGAH 1V2JT 1FN6A 1C2HA 4FUJA 1GMCF 2G52A 3EA7A 2CJIA 3A8BA 3P8NA 1AE8H 3M5MA 1ARCA 1C5UA 1ETSH 3T25A 1G36A 3PB1E 3SUFA 3QGNB 7GCHF 3T28A 1GBTA 1BHXB 2RCEA 1MTWA 1NRRH 1TPSA 4NIYA 4BOHA 3SN8A 1SC8U 2BD7A 3BEIB 2J9NA 1LCYA 4F4OC 2BLQA 1QB6A 5B6OA 1GDQA 1QB1A 1TPPA 3LKWA 1UVOA 2GX4A 3AASA 4B75A 4CRFA 2QA9E 5EODA 1O5AB 1ETTH 1ETRH 2A5IA 4XSKU 2HOBA 1E36B 2QV1A 1CHOG 3SQHE 4O3TA 4IN1A 2OC1A 4BTIB 2Z3EA 2QN5T 3CS0A 1THPB 4WMDA 2HGTH 3SV9A 3UREA 1N8OC 2SGPE 3H5CB 1GJ7B 2O8WA 1G3BA 3TK5A 1CT2E 4K1TA 2ZFFH 1P11E 2UUKB 1MD7A 2P3FH 4Q2KA 3I78A 2ODPA 9LPRA 5LH8A 4GPGA 1A5HA 1SGRE 5GXPA 1AKSB 1ZZZA 5HM2A 2V3OH 2V6NA 5G4BA 1P3CA 4DW2U 4MPXA 1KTSB 2GGVB 8GCHF 2Z9JA 3I77A 3PTNA 3ZYEA 2OP9A 1IOEA 1QQ4A 2ZC9H 4ISNA 1A0HB 5F8ZA 3SNBA 3M3VA 5EOKA 2FX6A 1B5GH 3MU4A 3QN7A 2ZP0H 4KTUA 3SGQE 2FYRA 4Y0ZE 2Z3DA 5JBAS 3IWMA 2PKAA 4JYTA 5DP9A 4NA9H 1C1NA 1C5QA 2ANWA 5A8XA 3RDZA 4MLFB 3M7QA 2QXHA 3MU5A 2AGIX 4HI3A 2B5TB 4I8KA 3VGCC 3BEUA 1IQJA 2FTMA 3SGAE 3PYHA 1O34A 3GDUA 1Y3UA 2ZHQH 2FMJA 2H6MA 4R0IA 4INHA 1CU1A 1UTKA 1A7SA 1PPBH 2AERH 2M5TA 2ANKH 4U2WA 3Q76A 2H9TH 4I7YH 1EAXA 5C1UA 5HYOA 1BB0B 2KAIB 2OXSA 1K28D 2VWNA 1S0QA 3QTOH 2A4RA 1PQ8A 3A86A 1SI5H 4CH2B 3CP7A 1GGDC 1TGTA 4B71A 3GYLB 1L1NA 1H1BA 1FPCH 1ORFA 2BQ6B 3F68H 4KGAA 1G3EA 3EA8A 1C9TA 3GY8A 2FLRH 1NN6A 1VCQA 1ZHPA 1NU9A 4JZIA 1H9IE 5JBBS 2BDHA 1KXEA 3AAVA 3ZVAA 1GI3A 4Y10E 5F03A 1BDAA 2A0QB 1VR1H 2C8ZB 2H1UA 3ZZDA 4K1SA 2BHGA 5JB9S 3GDSA 4XBBA 2VNTA 2HRVA 4UEHH 1W8BH 1CGJE 1MKWH 1C1RA 1RJXB 2SGQE 2UUYA 1T4VH 3DUXH 3HK3B 2J2UA 3RXMA 2FP7B 2GMTB 1MH0A 4NA8A 3KN2A 2A4OA 5TJXA 1NRQH 5LGOA 4DCDA 2Y7ZA 5ETXA 1RD3B 2VIDA 3KGPA 3ODFA 3CS7A 1CBWB 2Q1JA 2BOKA 1TBRH 4VGCB 4X1PU 3PLKA 3E3TA 4I31A 2C8YB 1GI0A 3A88A 1ZSKA 3ATMA 5T3HA 3BTQE 1YF4A 2FOFA 2BD3A 1F0RA 1VITG 4NZQA 5LPRA 3SU3A 1QL7A 4YESB 1T8LA 2OC7A 1HPGA 2QY0B 2TBSA 3KHVA 3KQBA 4Z0KA 4JZ1A 2GV7A 5DP3A 2TGTA 4IMQA 2W3KA 2H9EH 1XVOA 1F5RA 4ABBA 2RA3A 1ZSJA 2JKHA 3ZZ7A 1KDQA 1DX5M 1SLXB 2V3HH 5DP8A 1K21H 3TGKE 1XUKA 1INCA 1AQ7A 1FQ3A 4X1RU 1V2VT 1IQMA 5EQRA 4XBDA 1BQYA 2ZZUH 1O5EH 4YO9A 4ZMAH 3GY5A 1XKAC 4U32A 3MNBA 5EXLA 3UWIA 5GPIB 4BAMB 1ESBA 2VIOA 1HAHH 1V2TT 2HALA 1O2XA 3FAOA 3QZQA 3SU0A 1HXEH 2A7JA 2WV4A 3P95A 4B76A 2P95A 4TWWA 4B2AA 1TBZH 2BDBA 4X8SH 3RXKA 1OP8A 2Z9GA 1AFEH 1ZPCA 3QWCH 1W11U 1QRWA 5E0GA 1K1LA 3LGTA 2PUQH 3LGWA 3V0XA 2VIQA 1V6DA 4NIWA 1MAYA 1O2WA 1N8OB 1D6RA 1NRPH 1LHGH 2HWLB 3HGPA 3M3SA 1D3DB 3DT0H 1FAKH 1IAUA 3RM0H 1UTPA 3PM3A 1TGBA 3RXCA 4KP0A 5DGJA 1WQSA 2ZDNA 1GG6C 1C5LH 1KXCA 4WMEA 3D23A 2FOEA 5EGMA 4CBOA 5DJ7A 2WV5A 1PYTC 1HAXB 3LGIA 4ZKRU 1TGSZ 1LVBA 1P06A 3BIUH 1AGJA 1GHAF 2Y7XA 1AN1E 1UO6A 2AMDA 1CA0B 1TLDA 1V2OT
chains in the Genus database with same CATH superfamily
3FANA 4D7GA 3HKJB 3QZRA 1DLEA 1O2YA 2Z9IA 1O31A 1J17T 1T32A 1A2CH 2BD9A 1O2IA 3MOCA 1P2NA 4INKA 5EIYA 2OC8A 2GT8A 2FOMB 1HYLA 3SNDA 2B9LA 1SQRA 2BLOA 4AN7A 4TWYA 2THFB 2F91A 3ZZ6A 3FP8E 1GHBF 4YOJA 2F9PA 2C93B 1AB9C 1QRZA 3TH3H 3F9HA 3E16B 1UK2A 1SGFA 1GI4A 1NS3A 3RXOA 4E7NA 3F1SB 4ZHLU 4H6TA 1WUNH 4AC9A 2HNTF 3LJJA 1MTSA 2SGEE 3ENSB 3VGCB 4DURA 3TJVA 2ZHDA 1BCUH 2QF3A 1GMHF 4AGKA 5EXMA 2BX3A 1P10A 5C2ZA 1ABIH 3GS9A 1EFRD 2OLGA 2XCNA 4ABGA 5C20A 1PPCE 3F2HA 3M5OA 4B74A 2G8TA 2TIOA 3KQEA 1O3LA 4HZHA 2P3TB 1ACBE 1O5GH 1EOLA 3PLBA 3P17H 1KDQB 1BMNH 4JCNA 4ABAA 1VCPA 4GCHG 5EU8A 3URCA 2HNTE 1TA2A 1TALA 4YLQH 1S82A 2BDYA 1GGDB 1OP2A 2Q6FA 3TVJB 1DSUA 2FXRA 2V35A 4D7FA 2I6QA 4XDEA 1KIGH 1VZQH 2GVFA 1NU7B 3RUOA 3MH7A 3PWBA 1GI6A 1LPKB 4NFFA 3QK1A 5T6GA 1IQNA 1TIOA 1O2MA 2QXGA 3K65B 4K2YA 2VB0A 2J98B 1V2UT 2JJ1D 4CHAC 3N7EA 3VPKA 3SV7A 3ZZ5A 2W7SA 1UCYK 2GZ7A 1KY9A 2G55A 4UONA 1BBRE 1ZYOA 1O2VA 1ABJH 1C4U2 4UFEH 2EI8A 1YYY1 2R2WU 5DP7A 3VB7A 1ZMJA 4HG6A 2B8OH 3EYDA 3V7TA 3TJNA 3W95A 2LPRA 2KM0A 2Y6TA 1TMUH 1SGCA 3QX5H 2ZU4A 4H42U 3VFEA 4BTTB 2TGDA 5EW1H 5FPYA 1P04A 1P2KA 2YNAA 2FI5E 1QBOA 3FFGA 1EAUA 2F9UA 1GDUA 3C1KA 1GVZA 1SLVB 2ZPSA 2EA3A 4ABIA 3RLWH 3UR6A 2J92A 1DITH 1C5VA 2C8XB 2ZU3A 4DY7B 1Z7KA 5DN6D 1PYTD 1EQ9A 1J14A 3K6YA 4MNWA 1ZRBA 1WV7H 2UWPA 2Z94A 1UVUH 1G37A 3TJOA 2ZQ1A 1ANCA 3LONA 2G5VA 4UD9H 3NPSA 1HIAA 4E06H 1C2EA 5FXLA 2FDAA 3OX7U 5GCHG 3M3TA 2ZDMA 1TABE 4FUFA 4Y11E 1KLJH 1MZDA 1TE0A 1D6WA 5EPYA 1NESE 1SQTA 2W7UA 1EP5A 3L3TA 2Y5HA 1ZJDA 1BTHH 1K9OE 1WU1A 3QDZB 3NUMA 1Z71A 4WVPE 4CBNA 2XWAA 5EXNA 3RXEA 1O2LA 1O2KA 2ZHWH 5LPFA 3TH4H 3MNXA 3TIUA 4BXSA 1QBNA 2BDIA 2KCYA 4ZXXH 4O9VA 3SUEA 1GJ8B 4D9RA 1UMAH 4U30A 4CRGA 3KYGA 3RXFA 2QIQA 5E0JA 2AGEX 3SJOA 1NT1A 2ZWLH 5T6DA 1MTUA 1YGCH 3P8OA 3PMAB 4UE7H 3UOUA 2WYJA 2W5EA 1BIOA 5C5OA 1SLUB 2J95A 2Q6DA 1EUFA 1Z1JA 4MTBA 3S69A 3UOPA 2ZA5A 3SJKA 1J9CH 1O33A 4X6PA 3NXPA 4Q7YA 3SYJA 5FPSA 1W7GH 5K7RA 2F9OA 4WH6A 3OU0A 1TNJA 4AB9A 2H5CA 3F9GA 1TWXB 4P02A 5A8YA 3GCTG 3ZVDA 2VIPA 3UAIC 2R2MB 1GG6B 3KIDU 2EI7A 1W0ZU 2OUAA 1OXGA 3E0PB 1LHDH 3RMOH 1SGTA 1GJ6A 1M9UA 1HAZB 1HJAB 1S6HA 4MNXA 7KMEH 1TNIA 3SW2B 1LKBA 4BNRA 4X2WA 3LH3A 1DUEA 2JH0D 3GCHC 4ZHAA 1THRH 2GD4B 2LNCA 3KQ5A 4DT4A 1SBWA 2NU3E 3LU9B 3V13A 2ESTE 1EASA 1LQEA 1G2LA 2DE8A 3GCNA 4KTSA 1GBEA 2ZCLP 4R8TB 3S9BA 1KXFA 4OS7A 2BMGB 3ZV9A 5DKMA 1N6XA 1UVSH 4Q7XA 2IOTA 4XD7D 1EKBB 3FKSD 1AB9B 1TB6H 4K8BA 4UFFH 4TPYA 5CHAC 1P8VC 1MUEB 1XUFA 2YNBA 1B0FA 2XXLA 4OGXA 4AG1A 2FEQH 2WZQA 3T5FH 3SU4A 3EDXB 3K6ZA 2FODA 3M61U 1F7ZA 1NO9H 1O39A 2KFWA 2P8OC 3LGVA 4ZKOU 4ZKSU 2CN0H 2IJD1 5L2YH 5EQQA 2ZPRA 1SGEE 3PWCA 1SQAA 1QFKH 1DPOA 2A32A 4A5TS 1L0ZA 4O3UA 2FI3E 1SKYE 2VBCA 1RFNA 1K22H 1AZ8A 1GI9B 1QURH 4INLA 1Z8JB 3ZZ4A 2K8IA 2VU8E 4WF8A 4M7GA 2KAIA 2SNVA 1JIMA 5EG4A 1VJ9U 1HUTH 1DWDH 3MH6A 1TBQH 2PWXA 1S83A 3U9AH 1LQDB 1ELCA 3RXGA 3ZIAD 2QE7D 1OX1A 4OS5A 5DP4A 1BJVA 1WDIA 2WPJS 1YBWA 3M7UA 3W1EA 3WW7A 3U8TH 1JRTA 1AMHA 1G2MA 2Q6GA 5C67A 2YOLA 1D3QB 1ZPZA 2Z7FE 1AD8H 1KXBA 3BEFB 4E7RG 4JK6A 4CHAB 4DT7B 1AHTH 3PV4A 2PW8H 5FL7D 2BVRH 4WXIA 1K1IA 2L74A 1BMAA 1HJ9A 4WMFA 4QT8C 1J8AA 4FU8A 5FBIA 5AF9H 3AW1A 2XC5A 3GY3A 3UUZA 1IQHA 1ZTKA 1AY6H 5JPMH 1MQ5A 3Q3XA 2VVCA 2A2QH 1C1VH 1GI2A 1CGHA 2GDEH 2GJGA 2P16A 1SVPA 2EI6A 3W94A 1PQAA 2NU2E 1OKXA 3RXBA 3RXTA 2GTBA 3KCGH 3SU5A 2HNTC 3LH1A 3LC5A 1YP9A 1H8IH 4FU7A 1K1NA 1VITF 3Q3YA 4ABJA 3QGJA 1IHSH 3TITA 3TGJE 5F8XA 1Y3WA 1F0SA 1NFWA 1L2EA 2L6OA 3UR9A 3UNRA 1L4ZA 5FX6A 3F9EA 3RXVA 1T4UH 1N1LA 5EJLA 1O36A 2A7HA 2A4GA 1ZR0A 5JYIA 3FP6E 2WPKS 1W14U 4MNYA 3H7TA 5HIZA 2HLCA 1O2UA 2ZECA 3FZZA 1OHHD 3VB6A 1MBQA 1FMGA 2WPLS 5DP6A 5C1YA 2A4QA 4OS6A 3P70B 2PTNA 3M7TA 4NCYA 1O3BA 4TY6A 2ZCKP 1OWIA 3MMGA 3DSPA 1SGNE 1O37A 4AZ2B 1BITA 3MU8A 4BAQB 3M36A 1C1WH 1KXAA 1SGFG 1G9IE 3D62A 5C1XA 1DM4B 1ELFA 1U6QA 3PLPA 2V0BA 1ELBA 1BZXE 2A31A 3GY2A 1S0RA 1O3KA 2QC2A 3N99A 1V2WT 5JBTA 8KME2 1Z6EA 1SSXA 1SL3A 1MD8A 1P0SH 4B1TA 2ZTXA 1BBRK 1E37B 1SLWB 2KCAA 2BLWA 1O2TA 2Z3CA 1EZXC 1BRAA 1TX6A 1C5PA 3LC3A 1JBUH 2PSXA 1QNJA 2PUXB 1L1JA 4DG4A 3EE0B 4DGJA 4AOQA 2FTLE 1C2IA 1WTHD 3LGYA 3DFJA 1ID5H 1ZHMA 3OTPA 3QO6A 2OC0A 3AAUA 3EQ0H 1K2I1 4F49A 2WUCA 2QYIA 2C8WB 3UWJH 4FVDA 4IGDA 1SOZA 1MCVA 4IBLH 1QIXB 2O9QA 2LP6A 1IQFA 2TPIZ 1ELAA 1WTGH 1O2OA 2PV9B 1C1QA 1H8DH 1MAXA 1TRMA 1O5CB 3RMNH 4ISOA 1QJ1B 3MO6A 2ZG0H 1BTPA 3SO3A 4TSFD 1W7XH 2NU0E 2ZGJA 3F6UH 3SJ9A 2WPHS 1GHXH 3GCHB 4FUEA 3K2UA 1ANBA 2ZHEH 5HXFA 3T62A 2EC9H 3B23B 1BOQA 1GMCG 4F55A 4I8JA 1YLNA 5DK1A 3KL6A 3BV9B 1AZZA 1GI1A 1PPZA 4X1QU 5CHAB 4X8VH 1ESAA 4K8YA 1VCWA 7GCHG 2G00A 2SFAA 2WSSD 1P03A 3KNXA 4NSYA 1LVYA 1OWJA 3VB4A 3TK6A 1VGCC 2J94A 2B0FA 1O30A 4ABFA 1MZAA 2Z6BD 2ANMH 2P8OB 4CRDA 1JMOH 3AVZA 2PFEA 1BRBE 1BMMH 1ELGA 2XCFA 1DWBH 2WYGA 2R3YA 1ESTA 1KTTB 1BMLA 2G4UA 1QRXA 2ZEBA 3LOXA 1AE5A 3A89A 1MBMA 4IS5A 1Y3XA 1BTYA 2BDCA 1MTVA 1A5GH 1EAWA 1EPTC 2F3CE 2G5NA 4CRCA 5F8TA 3ZVEA 5JBCS 1SFIA 3O8DA 3ZYDA 3SORA 1FXYA 2AEIH 2ZGHA 2XYAA 1KLTA 1UCYH 3GCOA 1AWFH 4IC5A 3RM2H 1AU8A 5C0UA 2ZGBH 1UTOA 3MTYA 3A7ZA 2VINA 1FI8A 3Q00A 4LOYH 4X1NU 1C4Y2 3ZZ8A 1O2NA 4FVBA 3SU1A 2ZGCA 3UY9A 1GPZA 1AWHB 2GDDA 2RA0A 2FOGA 3FVFB 4JK5A 4FUHA 2CK3D 3RC4A 4DIIH 1RXPA 1O38A 1MTNC 2XRCA 3BG8A 4UFGH 2XNDD 1QJ7B 2JDID 1BUIA 2P94A 4H4FA 2GZ8A 2FOCA 3VG8A 2J97A 3ZZAA 1N6YA 2BQWB 3SQEE 9ESTA 3A7YA 1O2JA 4PROA 3PMJA 4GVUA 1DXWA 4Q7ZA 4OM9A 1O2SA 2ZTZA 3GDVA 1WSSH 2PGQB 1S5SA 4BXWA 1C1PA 2LELA 3MO3A 1JRSA 2D2DA 1ZLRA 1FN8A 1K1MA 3TNTA 1D9IA 1LHFH 2XBWA 4AFZA 3VB5A 1QCPA 1DLKB 3MO9A 4FUIA 2AS9A 2AIQA 5IDKA 1C2LA 1E34B 5GCHF 2RG3A 3TJUA 1XXDA 2J5UA 2K1QA 5FCRA 1BTUA 1QA7A 3A8CA 1ZGIA 4UDWH 1NPMA 2WHXA 3GISB 3KQDA 3NKKA 1C5TA 1O2PA 3MH5A 2WPIS 2G51A 1EB1H 2XTTB 2XC0A 1O35A 1FZZA 2BYAX 1P05A 3U69H 4YXWD 3ZZ9A 2F4LA 2GKVE 1C2GA 5FHTA 5C3NA 4NWLA 2AHME 2H9HA 3O8BA 1G30B 3E0NB 4AYVB 4J1YA 1YLCA 1Y5UT 1SR5C 2XBYA 1V2PT 8LPRA 3SZEA 2BD2A 3PTBA 4XE4A 2CF8H 3M5NA 1SOTA 1GBDA 2BB4A 1QHRB 1Y8TA 4Y8ZA 1AUJA 4I33A 1GI8B 4NFEA 4HTCH 2QGRA 4YLUA 4AFSA 1OYQA 2UWOA 1CHGA 2BLVA 4X6NA 2XBXA 1V2NT 4I8HA 1ELEE 3GCTF 1QGFA 4YT6H 3UQOA 1YC0A 3BTKE 1S84A 2XNIA 1ZPBA 1O0DH 4D76A 2ZF0H 2EQNA 5J4SA 2FOHA 4E05H 5BPEA 2AMQA 1HDTH 1RIWC 2KX4A 1YM0A 5GNDA 4NWKA 1O3DA 4GHQA 4RT0A 1TOCB 1ELVA 1TQ0B 2CF9H 1T31A 3SI3H 2F83A 3A7WA 4MNVA 2XOKD 4AFQA 5CDFE 1NY22 3F2FA 5HIYA 3B9FH 4X6MA 1F0TA 4XBCA 2HPPH 5I46H 1GBBA 1WAYB 2F9BH 2ZDLA 2ZNKH 2A1DB 4I8LA 3A82A 5FCKA 3RXQA 2RDLA 4B2CA 1MU6B 4YOIA 3GOVB 1CT0E 5DPAA 1P57B 1ZHRA 1NFUA 2J38A 4A92A 5HM9A 3E1XB 4Q80A 1GBJA 2FO9A 1BRUP 2GP9B 2GCHG 3T2NA 1F2SE 4HGCA 3U8OH 3BTGE 4CREA 4D9QA 3MU1A 4TYDA 3MQKC 4LZ4B 3EE7A 3MU0A 2R0LA 1RTFB 3QTVH 1AUTC 3AW0A 4U01A 1KXDA 1VGCB 1G32B 3ZVGA 1RTLA 4GSOA 4ZHMU 4Y7AA 4NZLA 1K0HA 1J15A 4X2YA 2JJ2D 2Y5FA 1FY3A 4D8NA 1EXFA 3SV8A 2PKSC 1W13U 4A1XA 1WYKA 1P9UA 2Z9KA 1GI7B 4AYYB 4X8TH 1P2IA 1NFYA 2PSYA 4LXBH 2BDGA 3A7TA 2BY8X 3SU2A 2KR7A 1UK3A 1GMDG 1P2QA 1EB2A 4FUBA 1LMWB 1RS0A 2FPZA 1SPJA 1CO7E 4B73A 3OY5U 1C2JA 1A1RA 1LHCH 3R0FA 2PGBB 1YKTA 1Z8GA 1TX7A 1X7AC 1C1TA 2G81E 3QLPH 3ZZBA 3PRBA 1OPHB 4NG9H 2OD3B 1CHOF 1Z1IA 1O3NA 2P3UB 4BAKB 8ESTE 2ALPA 2K0QA 3H7OA 1K1OA 1GHZA 4YZUA 1C1SA 3PO1C 2ZO3H 1L1GA 1T8OA 1SGPE 3SJIA 3RMLH 3A87A 1QTFA 1P9SA 1MABB 2FOAA 5T6FA 1TNHA 2ZCHP 2ODYB 1KLIH 1EZSC 1GJ4H 1SQOA 3B8JA 4X0WU 3UNSA 3OEED 3S0NA 3MHWU 6LPRA 1GMHG 4FUDA 4ISHH 1FPHH 2C3SA 2JH6D 1C9PA 2VGCC 2A2XH 1A0JA 1JXPA 2WUBA 1XKBC 1GHWH 4X2VA 1G3CA 4ABEA 2TGAA 1SB1H 1V2KT 1TQ7B 1MKXK 4CRBA 5KECA 5CMXH 1XM1A 3KYFA 4AB8A 4WH8A 1TOMH 1MCTA 1C2DA 2NWNA 4RKJB 4F48B 1SHYA 3U1JB 3N7OA 2OBOA 1CQQA 2CGAA 3UTUH 2SGDE 5E0HA 1C1MA 1SGDE 1V2LT 2YMSC 1O2HA 5L6NH 2IN2A 2BDAA 1DOJA 1GWAA 1OSSA 2EEKA 5EPNA 5A2MH 1ZTJA 2PHBA 4Z6AH 2ZHFH 3L6PA 2AFQB 2HVXA 2VVVA 5A0AE 1DT2A 3GICB 4ZCNA 1BBRH 3SI4H 2BXTH 1JIRA 2A5KA 1GJ5H 1C1OA 2W3IA 2V7QD 1UW7A 4ZKNU 4CR9A 1FY4A 2OCVB 2UWLA 3ATIA 3RC6A 5HKKD 1C2FA 1P3EA 1W3CA 1TONA 3RXIA 1GJAB 1CT4E 2SGFE 3BTHE 1P09A 5A0BA 2FWWA 1P2OA 2BX4A 3GY7A 2ZFTA 2ZDKA 4A6LA 1K1PA 2PLXA 3SNCA 3URDA 5FPTA 2ULLA 1IQKA 3SOSA 1GBFA 5DG6A 1DVAH 1LDTT 1RIWB 1DSTA 3KF2A 1D3PB 1Q31A 4Y6DA 1FUJA 1E38B 3WWFA 1FIZA 3SUDA 1O3IA 5KEDA 2A45B 1LTOA 1V2QT 4MPUA 3VXFH 1GVLA 1H9LB 4K3JA 5EJZA 3ZV8A 5EW2H 5K0HA 1UTQA 3PV2A 5F53A 4JZEH 1YPHE 3K9XB 1GL0E 3U98H 2VWOA 1WBGB 1SGYE 3BG4C 4ABHA 1LHEH 4GUXA 4BANB 1TRYA 4Y8XA 2FESH 1T8NA 3T29A 3SZNA 1SGQE 5GDSH 2JETC 4X6OA 1E79D 1C5MD 3EGKH 1GJ9B 2OTVA 4NIXA 2EY4C 3QUMP 4K5ZA 5FX5A 2TRMA 4B6EA 3S7HB 1OWKA 4JZFH 3RXPA 1GCTC 3D65E 2ZFSA 3TNSA 1C5WB 5I25A 3RXLA 1OS8A 1QL8A 3NK8A 1L4DA 3UFAA 4NIVA 4GAWA 1W10U 2HLDD 1Y5AT 2UUFB 1ZRKA 3U28C 1S81A 2XW9A 3P92A 2TGPZ 1IHTH 5J4QA 2PKSB 2FLBH 1NZQH 1ZJKA 4A1TA 5ESTE 1RRKA 2C90B 2Z9LA 6CHAC 4ESTE 1UCYE 1OWDA 3EAJA 1GHYH 3SUGA 5GWZA 4AGJA 5E8EH 2OQUA 1XUIA 2R0KA 4LZ1H 1NBME 1BHXF 5DO4H 1EP6A 4TPIZ 3P8GA 2QXIA 2XWBI 3ZZ3A 1CA0C 2YMSD 1ANEA 1NFXA 3F9FA 1HFDA 5HGGA 1FY8E 1YPEH 3PMHB 3E6PH 1F92A 1LPZB 2FOBA 1O3HA 1PPEE 5E2OA 3VXEH 2R9PA 1OOKB 1TMTH 3MYWA 3RXSA 1YPMH 1IQIA 2AH4X 2P59A 2D8WA 4ZXYH 1GBCA 3UIRA 3ZVBA 4K1EA 1GBMA 1GJBB 3ATWA 1TPOA 1UHBB 2ZKSA 4Y7BA 3MNCA 3PO1B 3RP2A 6GCHG 2M2AA 1O3FA 1ZMLA 1C5XB 1BJUA 3E8LA 1WCZA 2WPMS 3BIVH 1DY8A 2C4FH 3Q77A 2STBE 3A8AA 2DE9A 3RC5A 2KCOA 3HKIB 3MI4A 1A61H 1GJCB 1EJMA 1GCDA 3MNSA 4A1VA 4MPWA 1E1QD 1V2MT 3M35A 1WXRA 4JYVH 1FONA 4FUGA 2FS9A 5C0TA 2VGCB 2ODQA 3G01A 2FS8A 5LPEA 1W0KD 1KMHB 3OFND 4IN2A 3ELAH 3OTJE 1A46H 3ESTA 3TGIE 1YPGH 3A7VA 1QZ8A 1AI8H 4Y8YA 2ZDVH 5C5NA 3U8RH 1W2KH 5HMAA 5JB8S 3GY6A 1Y59T 1HAPH 2F9VA 2AMPA 2Y82A 3MFJA 2Y5GA 1HAGE 4RKOB 2G4TA 4IMZA 4IC6A 4O03A 2BVXH 1YPLH 1EAIA 2ZFPH 3T27A 1UTLM 2W26A 2BD5A 2WV9A 2CV3A 1MQ6A 2CHAC 1E35B 1C5OH 1Y5BT 2J4IA 4MQAA 3S9AA 5B6LA 1DICA 1PPHE 2ILNA 1AIXH 2JH5D 5L30H 3RU4D 1EOJA 4ACBA 4X1SU 1C4V2 1VKYA 5A8ZA 2GCTC 1TGNA 1QL9A 3M37A 1QBVH 3BN9A 1EX3A 3TLOA 1HAVA 1V3XA 2IJOB 2NU1E 4GCHF 2QCYA 5CHBA 4ZAEA 4DOQA 5KGOA 2ASUB 2PP6A 1FY1A 2GZ9A 1HGTH 4Q4LA 3RXAA 2FX4A 4H6SB 1Q3XA 4BTUB 1O3GA 2ZGXH 1AO5A 1C5ZB 1Y3YA 3OEHD 3PMBB 1FY5A 4MVNA 1JWTA 1P02A 4ASHA 1BRCE 1TA6A 1FAXA 5AHGH 5F6MA 1J16A 1YY3A 5ABWA 1FLEE 3HATH 1C5YB 2QF5A 2HVYB 1ANDA 1C5RA 2OBQA 4AG2A 3ATKA 1O3EA 1UVPA 5TCAA 1EZUC 3KEEA 2XC4A 1S6FA 2ZFQH 8GCHG 2ZFRH 2D26C 2PKAB 2O8MA 1TNLA 2JIZD 1O32A 1BMFD 1OWEA 1UTMA 3ZVFA 3UQVA 3F3BA 6ESTA 3BG4B 1EJNA 2GCHF 4DJZB 7LPRA 3SV6A 1AVXA 2BQ7B 1VITH 1E1RD 1FDPA 2ALVA 5CE1A 4WWYA 1O2GH 1BTXA 2AIPA 3OY6U 1HRTH 1DANH 1TGCA 1AFQC 1ELDE 3RU4T 1CSOE 1FNIA 4K60A 1TYNA 3A84A 2JETB 4CR5A 1ZMNA 4ISLA 3TPIZ 3A80A 3NRLA 1C5SA 4NSVA 1O3CA 4OS1A 7ESTE 4Y71A 2BZAA 3ATLA 3ODDA 1HB0B 4MPVA 1O3AA 1PQ5A 1V2ST 4THNH 3SJ8A 5BRRE 1GCTB 2A5AA 1GBAA 3OYPA 1Z6JH 1DY9A 4B2BA 3IG6B 2BM2A 1YPJH 1CVWH 3O8CA 1O3PB 5IYTA 3DD2H 4SGAE 2PTCE 1LO6A 1TNKA 2O8UA 1YPHC 4I8GA 1HAOH 1GMDF 5SGAE 3LDXH 1DFPA 4DIHH 4X8UH 5FAHA 6CHAB 3S9CA 1OWHA 3NCLA 3JZ2B 1HJAC 3FP7E 1SFQB 1SHHB 2BTCE 1XUHA 1EPTA 3C27B 1QJ6B 4GHTA 5H4IB 1JOUB 3A83A 1NC6A 1DS2E 4ZH8A 3FZDA 4B6FA 2BY5X 3SHCH 3NWUA 1S85A 1A0LA 1WQVH 1XX9A 3TH2H 2BY9X 4KTCA 1P12E 1NRSH 2QXJA 2VWLA 1DE7H 1XXFA 1HAVB 1CGIE 4JYUH 5FBEA 3VB3A 1TAWA 1GBLA 1FJSA 3Q3KA 1MKWK 1IQGA 1HNEE 5AVDA 1E0FD 2Y81A 1ARBA 3D49H 5GJ4B 1P01A 2AGGX 1O3OA 4A7IB 1TMBH 3DCLA 3WY8A 3ZVCA 2BD8A 2H2ZA 2CXVA 2F9NA 1HBTH 4TY7A 3BF6H 4Y79A 3BTFE 3H09A 1S6LA 4KELA 4K69A 1HXFH 2ZDAH 3MWIU 3O8RA 1DWEH 1EZQA 1O5FH 4CH8B 3RU4E 1IQEA 1BTZA 1MKXH 3DSGA 3SNAA 4YT7H 4UFDH 2PR3A 1CE5A 1HCGA 1YCPM 2IPHA 4FU9A 2P93A 5AFZH 3ITIA 3A8DA 3ZZCA 1UTNA 2VWMA 4ABDA 4JZDH 3A7XA 1QQUA 1HV7A 2B7DH 3F0PA 2RDEA 3PROA 4NA7A 1THSH 2O8TA 2FZZA 1ELTA 3SNEA 2GT7A 3R3GB 1GBKA 4XOJA 1QA0A 2BVSH 3LJOA 1O3MA 1GVKB 3U1IB 3TK9A 1XUJA 4WJG2 1GL1A 2ZTYA 2R3UA 3DHKH 3RLYH 1BTWA 1GI5A 2QF4A 3E91A 1YCPH 1EATA 2VH0A 3RXUA 4ASUD 3V12A 1LKAA 3T26A 4OS4A 2ZU2A 3FN8A 3L33A 1HAIH 2CHAB 2BXUH 1O2RA 4YTAA 1XVMA 1W12U 3P8FA 4BAHB 1UJ1A 3DA9B 3HK6B 1NROH 2GCTB 2STAE 1UVTH 2VJ1A 4FUCA 1SMFE 3SBKA 4J2YB 4RSPA 4FXGH 2ANYA 3SHAH 1Q2WA 2ZPQA 3UNQA 1K1JA 1ZTLA 2FM2A 1GJDB 1G3DA 3KQCA 3LGUA 3LT3A 1LVMA 1C1UH 3SGBE 1TPAE 1VJAU 1P2MA 1Z8RA 1B7XB 1QR3E 1TNGA 4I32A 1EPTB 2VVUA 4HFPB 4OGYA 1C2MA 4ISIH 1OYTH 1O2QA 1H9HE 3HPTB 1QB9A 1H8HD 3BSQA 1SGIB 2UUJB 1PJPA 5JDUB 1O3JA 3GY4A 1YLDA 2D1JA 2ZI2H 3I29A 1C2KA 1MU8B 4ZUHA 3S7KB 4AORA 1GHAG 2I6SA 4Y76A 1DWCH 4FETA 3BTWE 1Z8IB 4XFQA 1MMJN 1PFXC 1KYNA 3N7DA 1XUGA 4BAOB 1PQ7A 3STIA 1A3BH 1F0UA 1MTNB 2DUCA 4OS2A 2SNWA 2WPDD 1Y3VA 2FIRH 2HPQH 5ESBA 1H4WA 3DFLA 3RXDA 2A7CA 1GHBG 3BTME 3P6ZB 4X2XA 1W0YH 4CRAA 5A0CA 1AFQB 1FX0B 3A85A 1QY6A 1OP0A 4Z1MD 1RGQA 5DP5A 2W6ID 1P2JA 2W6JD 3A81A 1NBMD 3LIWA 4YOGA 1F5LA 5PTPA 1D3TB 1DDJA 2WINI 4P00A 3BTEE 1BA8B 3M5LA 3NZIA 1YPKH 1FIWA 2GV6A 3RXJA 5A09A 2J34A 1A3EH 1W0JD 2VIVA 4DVAU 1F5KU 3PV5A 1BT7A 3UPEA 4GLYA 1FV9A 3CENA 2XBVA 2H5DA 1LVOA 2O8LA 4O97A 1TRNA 2ZU5A 3STJA 3VEQB 1KSNA 1UK4A 5EQSA 1AVWA 1T8MA 1ZOMA 4AX9H 1WOFA 2Y80A 4MDSA 4ZROA 3HGNA 1AKSA 1NTPA 1T7CA 3SV2H 3SU6A 3GYMA 1AVGH 1GBIA 3PRDA 3DSOA 4WY3A 3JZ1B 4KKDA 4RN6A 1ZGVA 3MH4A 2ZIQH 4JMYA 2V3MA 3LPRA 1EJAA 1GBHA 4SGBE 1UTJA 2BY7X 3BTDE 1NM6A 1A5IA 4LK4A 1B0EA 1GHVH 4WXVA 4IW4E 6GCHF 2QF0A 5T1VA 1RTKA 1YCPK 2GMTC 2ZQ2A 3V3MA 1C5NH 1GDNA 2BOHB 1CBWC 1IQLA 1LPGB 1HLTH 2BD4A 1DUAA 2QAAA 3EA9A 1UHBA 2FI4E 1V2RT 4VGCC 2VH6A 5EJ1A 2OINA 5TCCA 1SG8B 1TX8A 5AFYH 2VIWA 3OSYA 1COWD 1PPGE 1HJ8A 2NU4E 4Y0YE 1O5BB 1ZSLA 3FOAA 2ZU1A 1A4WH 3BTTE 3TU7H 1HAYB 2BY6X 2OQ5A 1O5DH 3IITA 1NRNH 4ACAA 4YM9A 2CMYA 5GIBA 1TFXA 4RI0A 3RXRA 1D4PB 5L2ZH 1XMNB 1HIAB 1PPFE 2FYQA 1CA8B 3E90B 1DXPA 2SGAA 1O2ZA 5E2PA 3RMMH 4MG3A 4AFUA 3RXHA 2AYWA 2BZ6H 4NGAH 1V2JT 1FN6A 1C2HA 4FUJA 1GMCF 2G52A 3EA7A 2CJIA 3A8BA 3P8NA 1AE8H 3M5MA 1ARCA 1C5UA 1ETSH 3T25A 1G36A 3PB1E 3SUFA 3QGNB 7GCHF 3T28A 1GBTA 1BHXB 2RCEA 1MTWA 1NRRH 1TPSA 4NIYA 4BOHA 3SN8A 1SC8U 2BD7A 3BEIB 2J9NA 1LCYA 4F4OC 2BLQA 1QB6A 5B6OA 1GDQA 1QB1A 1TPPA 3LKWA 1UVOA 2GX4A 2KZ4A 3AASA 4B75A 4CRFA 2QA9E 5EODA 1O5AB 1ETTH 1ETRH 2A5IA 4XSKU 2HOBA 1E36B 2QV1A 1CHOG 3SQHE 4O3TA 4IN1A 2OC1A 4BTIB 2Z3EA 2QN5T 3CS0A 1THPB 4WMDA 2HGTH 3SV9A 3UREA 1N8OC 2SGPE 3H5CB 1GJ7B 2O8WA 1G3BA 3TK5A 1CT2E 4K1TA 2ZFFH 1P11E 2UUKB 1MD7A 2P3FH 4Q2KA 3I78A 2ODPA 9LPRA 5LH8A 4GPGA 1A5HA 1SGRE 5GXPA 1AKSB 1ZZZA 5HM2A 2V3OH 2V6NA 5G4BA 1P3CA 4DW2U 4MPXA 1KTSB 2GGVB 8GCHF 2Z9JA 3I77A 3PTNA 1YWUA 3ZYEA 2OP9A 1IOEA 1QQ4A 2ZC9H 4ISNA 1A0HB 5F8ZA 3SNBA 3M3VA 5EOKA 2FX6A 1B5GH 3MU4A 3QN7A 2ZP0H 4KTUA 3SGQE 2FYRA 4Y0ZE 2Z3DA 5JBAS 3IWMA 2PKAA 4JYTA 5DP9A 4NA9H 1C1NA 1C5QA 2ANWA 5A8XA 3RDZA 4MLFB 3M7QA 2QXHA 3CNRA 3MU5A 2AGIX 4HI3A 2B5TB 4I8KA 3VGCC 4XRNA 3BEUA 1IQJA 2FTMA 3SGAE 3PYHA 1O34A 3GDUA 1Y3UA 3OAAD 2ZHQH 2KCPA 5C17A 2FMJA 2H6MA 4R0IA 4INHA 3FO8D 1CU1A 1UTKA 1A7SA 1PPBH 2AERH 2M5TA 2ANKH 4U2WA 3Q76A 2H9TH 4I7YH 1EAXA 5C1UA 5HYOA 1BB0B 2KAIB 2OXSA 1K28D 2VWNA 1S0QA 3QTOH 2A4RA 1PQ8A 3A86A 1SI5H 4CH2B 3CP7A 1GGDC 1TGTA 4I86A 4B71A 3GYLB 1L1NA 1H1BA 1FPCH 1ORFA 2BQ6B 3F68H 4KGAA 1G3EA 3EA8A 1C9TA 3GY8A 2FLRH 1NN6A 1VCQA 1ZHPA 1NU9A 3F2GA 4JZIA 1H9IE 5JBBS 2BDHA 1KXEA 3AAVA 3ZVAA 1GI3A 4Y10E 5F03A 1BDAA 2A0QB 1VR1H 2C8ZB 2H1UA 2YMSB 3ZZDA 4K1SA 2BHGA 5IK2D 5JB9S 5C94A 3GDSA 4XBBA 2VNTA 2HRVA 4UEHH 1W8BH 1CGJE 2RFKC 1MKWH 1C1RA 1RJXB 2SGQE 2UUYA 1T4VH 3DUXH 3HK3B 2J2UA 3RXMA 2FP7B 2GMTB 1MH0A 4NA8A 3KN2A 2A4OA 5TJXA 1NRQH 5LGOA 4DCDA 2Y7ZA 5ETXA 1RD3B 2VIDA 3KGPA 3ODFA 3CS7A 1CBWB 2Q1JA 2BOKA 1TBRH 4VGCB 4X1PU 3PLKA 3E3TA 4I31A 2C8YB 1GI0A 3A88A 1ZSKA 3ATMA 5T3HA 3BTQE 1YF4A 2FOFA 2BD3A 1F0RA 1VITG 4NZQA 5LPRA 3SU3A 1QL7A 4YESB 1T8LA 2OC7A 1HPGA 2QY0B 2TBSA 3KHVA 3KQBA 4Z0KA 4JZ1A 2GV7A 5DP3A 2TGTA 4IMQA 2W3KA 2H9EH 1XVOA 1F5RA 4ABBA 2RA3A 1ZSJA 5DSFA 2JKHA 3ZZ7A 1KDQA 1DX5M 1SLXB 2V3HH 5DP8A 4FOUC 1K21H 3TGKE 1XUKA 4Q63A 4TT3D 1INCA 1AQ7A 1FQ3A 4X1RU 1V2VT 1IQMA 5EQRA 4XBDA 1BQYA 2ZZUH 1O5EH 4YO9A 4ZMAH 3GY5A 1XKAC 4U32A 3MNBA 5EXLA 3UWIA 5GPIB 4BAMB 1ESBA 2VIOA 1HAHH 1V2TT 2HALA 1O2XA 3FAOA 2J98A 3OE7D 3QZQA 3SU0A 1HXEH 2A7JA 2WV4A 2OK5A 3P95A 2IPQX 4B76A 2P95A 4TWWA 4RT1A 1TBZH 2BDBA 4B2AA 3F0OA 4X8SH 3RXKA 1OP8A 2Z9GA 1AFEH 1ZPCA 3QWCH 1W11U 1QRWA 5E0GA 1K1LA 3LGTA 1H8ED 2PUQH 3LGWA 3V0XA 2VIQA 1V6DA 4NIWA 1MAYA 1O2WA 1N8OB 1D6RA 1NRPH 1LHGH 2F43B 2HWLB 3HGPA 3M3SA 1D3DB 3DT0H 4M9FA 1FAKH 1IAUA 3RM0H 1UTPA 3PM3A 1TGBA 3RXCA 3AK5A 4KP0A 5DGJA 1WQSA 2ZDNA 1GG6C 1C5LH 1KXCA 4WMEA 3D23A 2FOEA 5EGMA 3WWBA 4CBOA 5DJ7A 2WV5A 1PYTC 1HAXB 3LGIA 4ZKRU 1TGSZ 1LVBA 1P06A 3BIUH 1AGJA 1GHAF 2Y7XA 1AN1E 3UB0A 1UO6A 2AMDA 1CA0B 1TLDA 1V2OT
chains in the Genus database with same CATH topology
3FANA 4D7GA 3HKJB 3QZRA 1DLEA 1O2YA 2Z9IA 1O31A 1J17T 1T32A 1A2CH 2BD9A 1O2IA 3MOCA 1P2NA 4INKA 2OC8A 2GT8A 2FOMB 1HYLA 3SNDA 2B9LA 4AN7A 2BLOA 4TWYA 2THFB 2F91A 3ZZ6A 3FP8E 1GHBF 4YOJA 2F9PA 2C93B 1AB9C 1QRZA 3TH3H 3F9HA 3E16B 1UK2A 1SGFA 1GI4A 1NS3A 3RXOA 4E7NA 3F1SB 4ZHLU 4H6TA 1WUNH 2HNTF 3LJJA 1MTSA 2SGEE 3ENSB 3VGCB 4DURA 3TJVA 2ZHDA 1BCUH 2QF3A 1GMHF 4AGKA 5EXMA 2BX3A 1P10A 5C2ZA 1ABIH 2OLGA 2XCNA 4ABGA 5C20A 1PPCE 3M5OA 4B74A 2G8TA 2TIOA 3KQEA 1O3LA 4HZHA 2P3TB 1ACBE 1O5GH 1EOLA 3PLBA 3P17H 1KDQB 1BMNH 4JCNA 4ABAA 1VCPA 4GCHG 5EU8A 3URCA 2HNTE 1TA2A 1TALA 4YLQH 1S82A 2BDYA 1GGDB 1OP2A 2Q6FA 3TVJB 1DSUA 2FXRA 2V35A 4D7FA 2I6QA 4XDEA 1KIGH 1VZQH 2GVFA 1NU7B 3RUOA 3MH7A 3PWBA 1GI6A 1LPKB 4NFFA 3QK1A 5T6GA 1IQNA 1TIOA 1O2MA 2QXGA 3K65B 4K2YA 2VB0A 1V2UT 4CHAC 3VPKA 3SV7A 3ZZ5A 2W7SA 1UCYK 2GZ7A 1KY9A 2G55A 4UONA 1BBRE 1ZYOA 1O2VA 1ABJH 1C4U2 4UFEH 2EI8A 1YYY1 2R2WU 5DP7A 3VB7A 1ZMJA 2B8OH 3EYDA 3V7TA 3TJNA 3W95A 2LPRA 3VFEA 2Y6TA 1TMUH 1SGCA 3QX5H 2ZU4A 4H42U 4BTTB 2TGDA 5EW1H 5FPYA 1P04A 1P2KA 2YNAA 2FI5E 1QBOA 3FFGA 1EAUA 2F9UA 1GDUA 3C1KA 1GVZA 1SLVB 2ZPSA 2EA3A 4ABIA 3RLWH 3UR6A 2J92A 1DITH 1C5VA 2C8XB 2ZU3A 4DY7B 1Z7KA 1PYTD 1EQ9A 1J14A 3K6YA 4MNWA 1ZRBA 1WV7H 2UWPA 2Z94A 1UVUH 1G37A 3TJOA 2ZQ1A 1ANCA 3LONA 2G5VA 4UD9H 3NPSA 1HIAA 4E06H 1C2EA 5FXLA 2FDAA 3OX7U 5GCHG 3M3TA 2ZDMA 1TABE 4FUFA 4Y11E 1KLJH 1MZDA 1TE0A 1D6WA 5EPYA 1NESE 1SQTA 2W7UA 1EP5A 3L3TA 2Y5HA 1ZJDA 1BTHH 1K9OE 1WU1A 3QDZB 3NUMA 1Z71A 4WVPE 4CBNA 2XWAA 5EXNA 3RXEA 1O2LA 1O2KA 2ZHWH 5LPFA 3TH4H 3MNXA 3TIUA 4BXSA 1QBNA 2BDIA 4ZXXH 4O9VA 3SUEA 1GJ8B 4D9RA 1UMAH 4U30A 4CRGA 3RXFA 2QIQA 5E0JA 2AGEX 3SJOA 1NT1A 2ZWLH 5T6DA 1MTUA 1YGCH 3P8OA 3PMAB 4UE7H 3UOUA 2WYJA 2W5EA 1BIOA 5C5OA 1SLUB 2J95A 2Q6DA 1EUFA 1Z1JA 4MTBA 3S69A 3UOPA 2ZA5A 3SJKA 1J9CH 1O33A 4X6PA 3NXPA 4Q7YA 5FPSA 1W7GH 5K7RA 2F9OA 4WH6A 3OU0A 1TNJA 4AB9A 2H5CA 3F9GA 1TWXB 5A8YA 3GCTG 3ZVDA 2VIPA 2R2MB 1GG6B 3KIDU 2EI7A 1W0ZU 2OUAA 1OXGA 3E0PB 1LHDH 3RMOH 1SGTA 1GJ6A 1M9UA 1HAZB 1HJAB 1S6HA 4MNXA 7KMEH 1TNIA 3SW2B 1LKBA 4BNRA 4X2WA 3LH3A 1DUEA 2JH0D 3GCHC 4ZHAA 1THRH 2GD4B 2LNCA 1SBWA 2NU3E 3LU9B 3V13A 2ESTE 1EASA 1LQEA 1G2LA 2DE8A 3GCNA 4KTSA 1GBEA 2ZCLP 4R8TB 3S9BA 1KXFA 4OS7A 2BMGB 3ZV9A 5DKMA 1N6XA 1UVSH 4Q7XA 2IOTA 1EKBB 1AB9B 1TB6H 4K8BA 4UFFH 4TPYA 5CHAC 1P8VC 1MUEB 1XUFA 2YNBA 1B0FA 2XXLA 4OGXA 4AG1A 2FEQH 3T5FH 3SU4A 3EDXB 3K6ZA 2FODA 3M61U 1F7ZA 1NO9H 1O39A 2P8OC 4ZKOU 3LGVA 4ZKSU 2CN0H 5L2YH 5EQQA 2ZPRA 1SGEE 3PWCA 1SQAA 1QFKH 1DPOA 2A32A 4A5TS 1L0ZA 4O3UA 2FI3E 1RFNA 1K22H 1AZ8A 1GI9B 1QURH 4INLA 1Z8JB 3ZZ4A 2VU8E 4WF8A 4M7GA 2KAIA 2SNVA 1JIMA 5EG4A 1VJ9U 1HUTH 1DWDH 3MH6A 1TBQH 2PWXA 1S83A 3U9AH 1LQDB 1ELCA 3RXGA 1OX1A 4OS5A 5DP4A 1BJVA 2WPJS 1YBWA 3M7UA 3U8TH 1JRTA 1AMHA 1G2MA 2Q6GA 5C67A 2YOLA 1D3QB 1ZPZA 2Z7FE 1AD8H 1KXBA 3BEFB 4E7RG 4JK6A 4CHAB 4DT7B 1AHTH 3PV4A 2PW8H 2BVRH 4WXIA 1K1IA 1BMAA 1HJ9A 4WMFA 4QT8C 1J8AA 4FU8A 5FBIA 5AF9H 3AW1A 2XC5A 3GY3A 3UUZA 1IQHA 1ZTKA 1AY6H 5JPMH 1MQ5A 3Q3XA 2VVCA 2A2QH 1C1VH 1GI2A 1CGHA 2GDEH 2P16A 1SVPA 2EI6A 3W94A 1PQAA 2NU2E 1OKXA 3RXBA 3RXTA 2GTBA 3KCGH 3SU5A 2HNTC 3LH1A 3LC5A 1YP9A 1H8IH 4FU7A 1K1NA 1VITF 3Q3YA 4ABJA 3QGJA 1IHSH 3TITA 3TGJE 5F8XA 1Y3WA 1F0SA 1NFWA 1L2EA 3UR9A 3UNRA 1L4ZA 5FX6A 3F9EA 3RXVA 1T4UH 1N1LA 1O36A 2A7HA 2A4GA 1ZR0A 5JYIA 3FP6E 2WPKS 1W14U 4MNYA 3H7TA 2HLCA 1O2UA 2ZECA 3FZZA 3VB6A 1MBQA 1FMGA 2WPLS 5DP6A 5C1YA 2A4QA 4OS6A 3P70B 2PTNA 3M7TA 4NCYA 1O3BA 4TY6A 2ZCKP 1OWIA 3MMGA 1SGNE 1O37A 4AZ2B 1BITA 3MU8A 4BAQB 3M36A 1C1WH 1KXAA 1SGFG 1G9IE 3D62A 5C1XA 1DM4B 1ELFA 1U6QA 3PLPA 2V0BA 1ELBA 1BZXE 2A31A 3GY2A 1S0RA 1O3KA 2QC2A 1V2WT 5JBTA 8KME2 1Z6EA 1SSXA 1SL3A 1MD8A 1P0SH 4B1TA 2ZTXA 1BBRK 1E37B 1SLWB 2BLWA 1O2TA 2Z3CA 1EZXC 1BRAA 1TX6A 1C5PA 3LC3A 1JBUH 2PSXA 1QNJA 2PUXB 1L1JA 4DG4A 3EE0B 4DGJA 4AOQA 2FTLE 1C2IA 1WTHD 3LGYA 3DFJA 1ID5H 1ZHMA 3QO6A 2OC0A 3AAUA 3EQ0H 1K2I1 4F49A 2WUCA 2QYIA 2C8WB 3UWJH 4FVDA 4IGDA 1SOZA 1MCVA 4IBLH 1QIXB 2O9QA 1IQFA 2TPIZ 1ELAA 1WTGH 1O2OA 2PV9B 1C1QA 1H8DH 1MAXA 1TRMA 1O5CB 3RMNH 4ISOA 1QJ1B 3MO6A 2ZG0H 1BTPA 3SO3A 1W7XH 2NU0E 2ZGJA 3F6UH 3SJ9A 2WPHS 1GHXH 3GCHB 4FUEA 3K2UA 1ANBA 2ZHEH 5HXFA 3T62A 2EC9H 3B23B 1BOQA 1GMCG 4I8JA 5DK1A 3KL6A 3BV9B 1AZZA 1GI1A 1PPZA 4X1QU 5CHAB 4X8VH 1ESAA 4K8YA 1VCWA 7GCHG 2G00A 2SFAA 1P03A 3KNXA 4NSYA 1LVYA 1OWJA 3VB4A 3TK6A 1VGCC 2J94A 2B0FA 1O30A 4ABFA 1MZAA 2Z6BD 2ANMH 2P8OB 4CRDA 1JMOH 3AVZA 2PFEA 1BRBE 1BMMH 1ELGA 2XCFA 1DWBH 2WYGA 2R3YA 1ESTA 1KTTB 1BMLA 2G4UA 1QRXA 2ZEBA 3LOXA 1AE5A 3A89A 1MBMA 4IS5A 1Y3XA 1BTYA 2BDCA 1MTVA 1A5GH 1EAWA 1EPTC 2F3CE 2G5NA 4CRCA 5F8TA 3ZVEA 5JBCS 1SFIA 3O8DA 3ZYDA 3SORA 1FXYA 2AEIH 2ZGHA 2XYAA 1KLTA 1UCYH 3GCOA 1AWFH 4IC5A 3RM2H 1AU8A 2ZGBH 1UTOA 3MTYA 3A7ZA 2VINA 1FI8A 3Q00A 4LOYH 4X1NU 1C4Y2 3ZZ8A 1O2NA 4FVBA 3SU1A 2ZGCA 3UY9A 1GPZA 1AWHB 2GDDA 2RA0A 2FOGA 3FVFB 4JK5A 4FUHA 3RC4A 4DIIH 1RXPA 1O38A 1MTNC 2XRCA 3BG8A 4UFGH 1QJ7B 2P94A 1BUIA 4H4FA 2GZ8A 2FOCA 3ZZAA 1N6YA 2BQWB 3SQEE 9ESTA 3A7YA 1O2JA 4PROA 3PMJA 4GVUA 1DXWA 4Q7ZA 1O2SA 2ZTZA 3GDVA 1WSSH 2PGQB 1S5SA 4BXWA 1C1PA 3MO3A 1JRSA 2D2DA 1ZLRA 1FN8A 1K1MA 3TNTA 1D9IA 1LHFH 2XBWA 4AFZA 3VB5A 1QCPA 1DLKB 3MO9A 4FUIA 2AS9A 2AIQA 5IDKA 1C2LA 1E34B 5GCHF 2RG3A 3TJUA 1XXDA 2K1QA 5FCRA 1BTUA 1QA7A 3A8CA 1ZGIA 4UDWH 1NPMA 3GISB 3KQDA 3NKKA 1C5TA 1O2PA 3MH5A 2WPIS 2G51A 1EB1H 2XTTB 2XC0A 1O35A 1FZZA 2BYAX 1P05A 3U69H 3ZZ9A 2GKVE 1C2GA 5FHTA 5C3NA 4NWLA 2H9HA 3O8BA 1G30B 3E0NB 4AYVB 4J1YA 1YLCA 1Y5UT 1SR5C 2XBYA 1V2PT 8LPRA 2BD2A 3PTBA 4XE4A 2CF8H 3M5NA 1SOTA 1GBDA 2BB4A 1QHRB 1Y8TA 4Y8ZA 1AUJA 4I33A 1GI8B 4NFEA 4HTCH 2QGRA 4YLUA 4AFSA 1OYQA 2UWOA 1CHGA 2BLVA 4X6NA 2XBXA 1V2NT 4I8HA 1ELEE 3GCTF 1QGFA 4YT6H 3UQOA 1YC0A 3BTKE 1S84A 2XNIA 1ZPBA 1O0DH 4D76A 2ZF0H 5J4SA 2FOHA 4E05H 5BPEA 2AMQA 1HDTH 1RIWC 1YM0A 4NWKA 1O3DA 4GHQA 1TOCB 1ELVA 1TQ0B 2CF9H 1T31A 3SI3H 2F83A 3A7WA 4MNVA 4AFQA 1NY22 3B9FH 4X6MA 1F0TA 4XBCA 2HPPH 5I46H 1GBBA 1WAYB 2F9BH 2ZDLA 2ZNKH 2A1DB 4I8LA 3A82A 5FCKA 3RXQA 2RDLA 4B2CA 1MU6B 4YOIA 3GOVB 1CT0E 5DPAA 1P57B 1ZHRA 1NFUA 2J38A 4A92A 5HM9A 3E1XB 4Q80A 1GBJA 2FO9A 1BRUP 2GP9B 2GCHG 3T2NA 1F2SE 4HGCA 3U8OH 3BTGE 4CREA 4D9QA 3MU1A 4TYDA 4LZ4B 3MU0A 2R0LA 1RTFB 3QTVH 1AUTC 3AW0A 4U01A 1KXDA 1VGCB 1G32B 3ZVGA 1RTLA 4GSOA 4ZHMU 4Y7AA 4NZLA 1J15A 4X2YA 2Y5FA 1FY3A 4D8NA 1EXFA 3SV8A 2PKSC 1W13U 4A1XA 1WYKA 1P9UA 2Z9KA 1GI7B 4AYYB 4X8TH 1P2IA 1NFYA 2PSYA 4LXBH 2BDGA 3A7TA 2BY8X 3SU2A 1UK3A 1GMDG 1P2QA 1EB2A 4FUBA 1LMWB 1RS0A 2FPZA 1SPJA 1CO7E 4B73A 3OY5U 1C2JA 1A1RA 1LHCH 3R0FA 2PGBB 1YKTA 1Z8GA 1TX7A 1X7AC 1C1TA 2G81E 3QLPH 3ZZBA 1OPHB 4NG9H 2OD3B 1CHOF 1Z1IA 1O3NA 2P3UB 4BAKB 8ESTE 2ALPA 3H7OA 1K1OA 1GHZA 4YZUA 1C1SA 3PO1C 2ZO3H 1L1GA 1T8OA 1SGPE 3SJIA 3RMLH 3A87A 1QTFA 1P9SA 2FOAA 5T6FA 1TNHA 2ZCHP 2ODYB 1KLIH 1EZSC 1GJ4H 1SQOA 3B8JA 4X0WU 3UNSA 3S0NA 3MHWU 6LPRA 1GMHG 4FUDA 4ISHH 1FPHH 2C3SA 2JH6D 1C9PA 2VGCC 2A2XH 1A0JA 1JXPA 2WUBA 1XKBC 1GHWH 4X2VA 1G3CA 4ABEA 2TGAA 1SB1H 1V2KT 1TQ7B 1MKXK 4CRBA 5CMXH 1XM1A 4AB8A 4WH8A 1TOMH 1MCTA 1C2DA 2NWNA 4RKJB 1SHYA 3U1JB 3N7OA 2OBOA 1CQQA 2CGAA 3UTUH 2SGDE 5E0HA 1C1MA 1SGDE 1V2LT 1O2HA 5L6NH 2IN2A 2BDAA 1DOJA 1GWAA 1OSSA 2EEKA 5EPNA 5A2MH 1ZTJA 2PHBA 4Z6AH 2ZHFH 3L6PA 2AFQB 2HVXA 2VVVA 5A0AE 1DT2A 3GICB 1BBRH 3SI4H 2BXTH 1JIRA 2A5KA 1GJ5H 1C1OA 2W3IA 4ZKNU 4CR9A 1FY4A 2OCVB 2UWLA 3ATIA 3RC6A 1C2FA 1P3EA 1W3CA 1TONA 3RXIA 1GJAB 1CT4E 2SGFE 3BTHE 1P09A 5A0BA 2FWWA 1P2OA 2BX4A 3GY7A 2ZFTA 2ZDKA 4A6LA 1K1PA 2PLXA 3SNCA 3URDA 5FPTA 2ULLA 1IQKA 3SOSA 1GBFA 5DG6A 1DVAH 1LDTT 1RIWB 1DSTA 3KF2A 1D3PB 1Q31A 4Y6DA 1FUJA 1E38B 1FIZA 3SUDA 1O3IA 2A45B 1LTOA 1V2QT 4MPUA 3VXFH 1GVLA 1H9LB 4K3JA 3ZV8A 5EW2H 5K0HA 1UTQA 4JZEH 1YPHE 3K9XB 1GL0E 3U98H 2VWOA 1WBGB 1SGYE 3BG4C 4ABHA 1LHEH 4GUXA 4BANB 1TRYA 4Y8XA 2FESH 1T8NA 3T29A 3SZNA 1SGQE 5GDSH 2JETC