2ZU5A

Complex structure of sars-cov 3cl protease with tg-0205486
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
306
structure length
306
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
molecule tags Hydrolase/hydrolase inhibitor
source organism Sars coronavirus
publication title Structural Basis of Inhibition Specificities of 3C and 3C-like Proteases by Zinc-coordinating and Peptidomimetic Compounds
pubmed doi rcsb
total genus 87
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2zu5A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zu5A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zu5A02
2AIQA 3ZZCA 2Z7FE 3NKKA 2FX4A 1W13U 2ASUB 1A61H 2ZU5A 1P57B 1IQLA 1GJCB 1C1VH 1AUTC 6GCHF 1CVWH 2Z9LA 3F9HA 4LK4A 2PGBB 3U1JB 5A2MH 2A32A 1QRXA 1UK3A 2BY5X 1GI3A 2XC0A 2A7CA 1NM6A 1TX8A 2ANMH 1GI8B 4LZ4B 3M3TA 2HRVA 1NRQH 4JCNA 1AGJA 3LC5A 3DD2H 3GCHC 1LVMA 1CHOG 2GZ7A 1GBHA 1UMAH 4YLUA 1EB1H 1QB9A 3PYHA 5DJ7A 4B74A 3MNSA 2JKHA 4KTUA 2XXLA 2FYQA 2ZFSA 5FX6A 4WY3A 1EQ9A 1WTGH 2GCHF 1EXFA 3D23A 1C5SA 1P06A 2ESTE 2FPZA 2SGEE 5F6MA 2HWLB 1FQ3A 5B6OA 1YPGH 2GP9B 1S6FA 4R0IA 1BMAA 2ZDNA 2VINA 4MNWA 4YTAA 4ZXYH 4CH2B 3A85A 6GCHG 1O32A 1YP9A 1QJ1B 3ZZ9A 1AKSA 3BG8A 1GBKA 2ANKH 1QNJA 2ZTXA 2UWPA 3E0PB 2ZHWH 4F49A 1TA2A 3DFLA 3LKWA 3O8DA 2PWXA 3KCGH 4XBBA 4TYDA 1TMUH 1EKBB 3BN9A 3SU6A 1S6HA 4CBNA 1V2RT 1O3BA 2ZGHA 1O2ZA 1FZZA 1Q2WA 3Q00A 1VZQH 5GWZA 4Q7ZA 4ZH8A 1RIWB 1SQTA 3MU0A 4KGAA 5F8ZA 3RU4D 3F1SB 3UNRA 2VH0A 1DUEA 1HXFH 2P16A 3K6YA 1IQHA 1J17T 1K22H 4JYUH 4BAHB 2VGCB 1F2SE 1GVLA 8GCHF 1ZMNA 1AE5A 2FOCA 2ZGBH 4TY6A 1LKAA 2Z3DA 1GCTC 2WPLS 3UR6A 1AWFH 1D3DB 1OP8A 5HXFA 4U32A 1DPOA 1O2RA 1ZR0A 3LIWA 2BX3A 2ZGXH 3ZVBA 4WMEA 1K1IA 1O5BB 2GV7A 1ELFA 1S82A 3LGIA 1Z6JH 2C93B 1AB9C 3A89A 5EQSA 1ELGA 1TYNA 3ODDA 4K8BA 3V7TA 3LOXA 2EI6A 2WPMS 2FEQH 2GVFA 4MLFB 4ISNA 8GCHG 1DWEH 2NU2E 1DLKB 1HFDA 4E7RG 1C2LA 1C5QA 3RC6A 1KSNA 3UIRA 4ABBA 1AFQC 2XBXA 2IJOB 3ZZ4A 1DOJA 1DY9A 3AAVA 3OU0A 2G00A 2QY0B 4CREA 1C2KA 2JETC 1AN1E 3OSYA 1XUKA 4FUDA 5I25A 5J4SA 4F4OC 1UCYE 2FOFA 4INHA 2OC0A 1SGFA 7LPRA 4ISOA 1ZRBA 1IQMA 3SNCA 2O8UA 2ZZUH 1Q3XA 3KQEA 4CRFA 3M36A 5FHTA 2HGTH 1NPMA 1O3PB 3UY9A 5GPIB 3SQHE 4MPVA 2OINA 2LIZA 1V2OT 3TU7H 2O8WA 5E0HA 2Y6TA 2BY6X 2BVRH 3WY8A 2QXHA 2TGPZ 1OWKA 2WINI 3TVJB 3FP6E 2ZPSA 3NZIA 1G9IE 1K9OE 1YBWA 3M5MA 2CHAB 1YF4A 1OWHA 1WCZA 1LHDH 5EW1H 1HIAB 3TITA 2YNBA 1A7SA 3E91A 1HUTH 3HKIB 3KIDU 4X8VH 2QXGA 2LNCA 3SGAE 3UWJH 1F92A 1Y3YA 2ANYA 1MZAA 3QTOH 2PGQB 2ZHFH 3TGIE 2HNTF 1C5YB 4KELA 2P59A 3GYMA 1BB0B 4IC6A 1WQVH 4BTTB 3TGJE 1BIOA 1F5RA 5EU8A 3MNCA 1J14A 1GI4A 1CSOE 3BTGE 1C5VA 3ENSB 2ZQ1A 4FU8A 1ZRKA 4TPIZ 4IS5A 1N6YA 3SV2H 4BNRA 3RDZA 3ATIA 3SW2B 3U9AH 2VIQA 1XVMA 4O3UA 1BJVA 3O8CA 1EJNA 1YC0A 2BZ6H 1VJAU 1SSXA 4I8KA 5DP9A 1O30A 4CRBA 1GI5A 1ZYOA 4ZKRU 3G01A 1DSTA 3U1IB 2W7SA 2DE8A 1S0RA 2SFAA 4K69A 4OS5A 2Z3CA 3ZVFA 3EDXB 3ZVGA 4E7NA 1GHAF 3UOUA 5FCKA 1H8IH 1Z8JB 2STAE 1BRAA 1T31A 4UDWH 3ZZ6A 2PLXA 1T8NA 1UO6A 3CS7A 1HIAA 3TIUA 1PQ5A 1G3BA 2XCFA 1C1PA 2FI3E 1G2LA 1YKTA 1S0QA 4U01A 3ZV9A 2NWNA 2ZTZA 3EA7A 1SHYA 2J2UA 4Y8YA 3PLBA 2W3KA 3PWCA 3QN7A 5H4IB 3PMJA 1MTSA 3LGVA 4CBOA 1BHXF 1O2SA 1Y5AT 5DP8A 5EW2H 4AYYB 3QZQA 5CHAC 2HALA 1VITF 5ESBA 1Y3VA 3A87A 1N8OB 4DIIH 1OWJA 1EATA 4LOYH 1AWHB 1KLIH 2FX6A 5JBCS 2ALVA 1O39A 2BX4A 1C5LH 1XXDA 1W7XH 3M7UA 1VCQA 2BOHB 4TPYA 1O5CB 3S9CA 3L6PA 1DXPA 3P8FA 1AB9B 3K6ZA 1ARBA 4WH6A 2H5DA 3BIVH 1OX1A 2RCEA 2BHGA 4E05H 1CGIE 1GMDG 1P03A 4X8UH 4R8TB 2EI8A 1YCPM 1MAXA 1YPHE 3VGCC 1OWEA 7GCHG 1GBDA 3A7YA 1B0EA 2O8TA 1E35B 2BD2A 5T3HA 2J9NA 3M37A 4OS2A 4JZFH 1UVOA 4I31A 3VEQB 4KP0A 1K1LA 4X2XA 3A7ZA 1CBWB 2TGDA 3M3VA 1D3QB 1S85A 1C1QA 1GHYH 1P02A 1FN6A 1IOEA 1MTNB 2BM2A 5DP6A 1K1PA 1HJAC 1O2OA 3RC4A 1GJDB 1NU9A 1HJ8A 1SVPA 2QYIA 2ZA5A 1PPEE 1QB1A 1IQFA 1O2HA 3GCTG 3QZRA 2FDAA 4J2YB 1VCPA 4AGKA 1BMLA 2SGQE 5K0HA 2OC8A 3RXEA 2BDYA 1ANDA 1OP2A 2TRMA 2XWAA 3QLPH 4Y10E 3OY6U 1MCVA 4CR9A 1TNLA 5HGGA 3SN8A 5DPAA 1QB6A 3SV7A 5FPSA 3L3TA 1WU1A 4OS7A 2XC4A 3HPTB 2C8WB 1TONA 4LZ1H 4DT7B 4M7GA 1SFQB 5PTPA 4FUCA 5I46H 3DT0H 2FOEA 2J34A 1O2UA 1AD8H 2CV3A 5C20A 2BD7A 1CHGA 1ANBA 2CGAA 3Q76A 1TNGA 2W26A 1GMCG 4RN6A 4ABHA 3EQ0H 3KN2A 2FI5E 3M5OA 2FO9A 2QIQA 1MD8A 3NUMA 1SB1H 1AVGH 4K1TA 3RXCA 4BANB 1UTKA 1EZQA 2G5VA 2BB4A 1QURH 3VB4A 2ZG0H 4MNXA 5DK1A 3M5LA 3BTWE 4TWWA 5GCHF 4MPWA 3T26A 3KHVA 3URDA 1HXEH 4NWKA 5CE1A 4I8LA 1C1UH 4TY7A 1Z1JA 3D62A 1EZXC 3HGNA 5A8YA 7KMEH 5EPYA 1EZSC 1XXFA 3H7OA 2BY9X 3PV4A 5J4QA 1ZZZA 1JIRA 2A4OA 3VGCB 2R3YA 2Z9IA 1SQAA 2IPHA 1BT7A 1TX6A 1D4PB 4AG2A 2FOMB 4B75A 2BYAX 1IQIA 1UVUH 2BDGA 1ZGIA 4XFQA 4CRGA 1TX7A 1BTXA 1QTFA 2P93A 1BOQA 2TPIZ 4ABFA 2Y7ZA 4NIYA 3ZZDA 2VWOA 1ORFA 2ZGCA 3A82A 3P17H 1K1OA 1C5NH 4QT8C 1TPOA 1Z1IA 1UTQA 3BEFB 4LXBH 4BXSA 4I8HA 1OWDA 1DWDH 1TABE 5C1YA 3FVFB 4Y8XA 4X6PA 2VIOA 3U8RH 3EE0B 3KNXA 4WVPE 1GBCA 2VVUA 3GDVA 4CR5A 2NU0E 1BTZA 1PPZA 2FZZA 3E16B 4CRDA 1T8MA 1DT2A 2VB0A 3LGUA 4BAKB 1TB6H 1C9PA 1FY4A 1H8DH 1UHBB 3T62A 3NXPA 2NU1E 4WH8A 2AFQB 4YM9A 5GDSH 5JB9S 2SNWA 1MCTA 1KXCA 1QA0A 3LC3A 4YT6H 5ETXA 2I6SA 1TPAE 3QTVH 1KTSB 1KXDA 4NIVA 2CHAC 1UVPA 3RXBA 1O37A 3TH3H 2BLWA 1ELAA 1DUAA 1LPZB 3AASA 1D6RA 5BRRE 1QBVH 5CMXH 1G32B 3ZYEA 1NZQH 1QL7A 1QHRB 1SGCA 1HAVA 4OGYA 2DUCA 3MI4A 5JYIA 3RXMA 1J15A 1K1JA 3S69A 1P9UA 3MU4A 3RXQA 1C5ZB 5FXLA 2WPHS 4WF8A 2A7JA 1O2KA 4HGCA 1TOCB 1EX3A 1HRTH 1OOKB 2Z6BD 1MKXK 1J8AA 1ETTH 4MQAA 4Z6AH 2P8OC 2G8TA 1FUJA 3RP2A 1MMJN 2CXVA 1ZJDA 1FONA 1VGCC 1O3FA 3UUZA 2Y5FA 1O3AA 3F9FA 2Y82A 1Z6EA 1NFYA 1FN8A 1INCA 5JBBS 1O3KA 3SJ9A 3MFJA 2GCHG 2AGIX 3W95A 2CF8H 2PKSC 3VPKA 4RKOB 1O2GH 1TNIA 1GJ4H 1K21H 1SGIB 1ZJKA 1TGBA 3UQOA 4BXWA 1SG8B 3K2UA 3TJVA 2VU8E 5FCRA 4AFQA 2OLGA 1JWTA 1RFNA 1TRYA 2A5KA 1PYTC 3ATLA 2ZDVH 4GCHG 3F6UH 1HLTH 5A09A 2BXUH 2OUAA 3GCNA 8KME2 4FUEA 4D8NA 1Z7KA 1G36A 4Y71A 1IQEA 1LQDB 1SBWA 3VB3A 3MO6A 3Q3XA 1Y3UA 2HOBA 1GVZA 1OWIA 2AMQA 3EBNA 2DE9A 2BD5A 1BTYA 5E0GA 3SU1A 1SI5H 2K1QA 1SGPE 2VVCA 4X8SH 1O3EA 4B2BA 2ODQA 1UK2A 3I29A 2P94A 1KY9A 2D26C 1IHSH 3LH1A 3HKJB 2ZCLP 1OXGA 4A1XA 1DITH 2GMTB 3M3SA 2GD4B 1HAXB 1P3CA 5DGJA 1GBAA 3EA8A 2ZGJA 3JZ1B 8LPRA 2G4TA 4NA7A 3UNSA 2XRCA 1C2HA 2ANWA 1LMWB 1YPKH 4OS4A 1AVXA 2BDAA 4DVAU 5GJ4B 4JK5A 5T6FA 5ABWA 1GGDB 2ODYB 3GY7A 1FIZA 4SGBE 4I7YH 1ZTLA 1BBRK 3BEUA 3A7TA 2O8MA 2VWMA 1A46H 1EJAA 3FP7E 4Q7XA 8ESTE 5EODA 1C4V2 2QC2A 1E38B 1P01A 6CHAB 3SUDA 1C2GA 4OS6A 3RMOH 1MKXH 5DKMA 5FBEA 3SGQE 2BQWB 2XBVA 4D9RA 1ETSH 1EAWA 1GHBG 1LQEA 2SNVA 1KYNA 2HPQH 3LH3A 5FPTA 5FX5A 2UWOA 1P2JA 1OSSA 2ZP0H 1Y8TA 2OC7A 2W5EA 1GJ8B 1LHEH 1LVOA 2W7UA 3S7HB 1T8LA 2WYJA 2Z3EA 1F5KU 4ZXXH 4K1EA 1ZHRA 5A8XA 4Q7YA 1TFXA 3DFJA 1HV7A 7ESTE 1G30B 2WUCA 2C8XB 3P92A 1W11U 1K2I1 3MU8A 1ZSJA 1O2NA 1Z8GA 1HAHH 1PPCE 2VIVA 3A84A 1DWCH 1O3OA 5EQQA 2ZQ2A 3SV9A 1UVSH 1TE0A 3PTNA 2PTCE 1ZSLA 4KTSA 4BTIB 2BDBA 1QCPA 1THSH 5EPNA 3CP7A 5FPYA 3E6PH 5TCCA 3GY4A 5AFYH 1L1NA 3T25A 3TGKE 3SU2A 1F0TA 1MU8B 6ESTA 1GL0E 1EAXA 3LGTA 2F9BH 1HJAB 3U8OH 1BTUA 1TIOA 2OBQA 4MDSA 4DCDA 5EG4A 1E36B 1DM4B 5JPMH 1PQ8A 4ZMAH 1GBFA 1Q31A 1SGTA 1HNEE 1L4DA 2QGRA 4Y8ZA 4WWYA 1TGTA 1GJBB 2FOHA 2QF0A 3GOVB 3MO3A 4AFZA 5L2YH 1MQ6A 1C1NA 3PM3A 5ESTE 3UTUH 4UD9H 1RRKA 3BTDE 5AHGH 4H6TA 3SHCH 3PTBA 3R0FA 1JRSA 5JDUB 3BTTE 1UK4A 1TOMH 1L0ZA 3W94A 3GICB 1Y5UT 1AUJA 5EXLA 4ISIH 3RXAA 1C2MA 3ZZ3A 2FLRH 4IN2A 1GGDC 4I33A 3UQVA 1K1NA 1O3NA 1WV7H 4WMDA 2P3TB 3CS0A 3H5CB 2UUYA 3IG6B 1OKXA 1CHOF 1DSUA 1E0FD 2F9NA 1O36A 1GG6B 2SGAA 3ESTA 3RXTA 1UTJA 1QL9A 2VIPA 2UUJB 4K60A 3UREA 2Z9KA 1BBRH 4NGAH 5DP4A 1ZLRA 4O97A 1VITG 2SGDE 4GLYA 3SNEA 2OCVB 2IOTA 5SGAE 1C5OH 2D2DA 1FJSA 4AFSA 1GBTA 2VIWA 3RM0H 1O5FH 2HPPH 2UUKB 3LGWA 2A5AA 1CGJE 4A7IB 1ABJH 1HAPH 1P04A 1LHCH 3SZNA 1QGFA 1H1BA 3STIA 3TNTA 1ABIH 1QL8A 1Y3WA 5AFZH 2QV1A 5HM2A 4CRCA 4MG3A 1ELVA 1HDTH 2VIDA 3RMNH 3PO1B 1C2DA 1F0SA 1M9UA 3BIUH 1L4ZA 1O3IA 1TAWA 1T4UH 1GI6A 3RLYH 4A1VA 1C2IA 4FUFA 2J94A 1NRPH 1HAOH 5C67A 1TGCA 4ZAEA 1C1SA 1HAVB 1W10U 2ZFRH 2BD4A 1FPCH 1SOZA 1FY8E 2BDCA 3BEIB 1FIWA 2GTBA 2BQ7B 1H9LB 1GBIA 4XE4A 2VWNA 1MTUA 2PKSB 1NC6A 2FIRH 1JMOH 3BF6H 1GVKB 1O2QA 2PSXA 1AY6H 3M7TA 2WV4A 3JZ2B 1ANCA 3KQBA 3RXSA 3LONA 2A2QH 4DW2U 3AAUA 1ZPBA 3NWUA 4ABJA 2HNTE 5C2ZA 3K65B 3BTFE 1BTWA 2BOKA 2VNTA 1PYTD 1GCDA 2FOAA 1QQ4A 2P8OB 2TIOA 1QIXB 1AIXH 5T6DA 4GPGA 3RXOA 1C5XB 3A7VA 4DIHH 3T2NA 1V2NT 1ELEE 3SO3A 3ODFA 4B73A 3SU5A 2A4RA 4FU9A 2XTTB 3A83A 3F9EA 1TPSA 2F9OA 1RS0A 1NU7B 3SU3A 1G3EA 1MH0A 3BG4B 1EOLA 5C5OA 1X7AC 1SGNE 4X1PU 2Y80A 3KQCA 2A2XH 1F5LA 1SLXB 1P09A 4CHAB 5LPEA 1W0ZU 2XYAA 3SUEA 1CE5A 3TNSA 2A0QB 4K2YA 4NSYA 4NSVA 1WQSA 4SGAE 1MUEB 1PPHE 2AMPA 1LCYA 3ZYDA 4Y7AA 1TMTH 2CN0H 2BMGB 4X1NU 3A7WA 2H5CA 4X6MA 4FUBA 1BJUA 5IYTA 2OXSA 2ZHDA 2BTCE 3RXFA 3ZVAA 4XBDA 5HM9A 1NROH 1YPHC 4JZ1A 1C1RA 4IN1A 1V2QT 4OGXA 3V3MA 3S7KB 1T8OA 1V2VT 2ULLA 2ZCHP 1JBUH 1V2UT 2XBYA 1SQOA 2ZF0H 4ZROA 2ZDMA 3TH2H 4Y7BA 3ZZ7A 2AERH 2WUBA 1KTTB 4U2WA 3RXKA 5DP3A 4FU7A 3VFEA 3P8NA 1C5WB 4BAMB 3B9FH 4YOGA 3V0XA 3NCLA 5DP7A 3SUFA 2AMDA 5AVDA 3T29A 2F3CE 1P2OA 1C1MA 1P9SA 2YNAA 3FP8E 3SHAH 3OX7U 3ZZBA 2D8WA 1SGDE 1O33A 1IQNA 3VB6A 1V2WT 1MU6B 4AB9A 1QRWA 3SNAA 1ELBA 1O2MA 1XUGA 1KDQA 1QQUA 2WPJS 3RXUA 4ABIA 5C3NA 4ZHAA 2VWLA 2ZU1A 3H7TA 4Y6DA 2BD8A 4X0WU 1NT1A 1Y5BT 2XWBI 3SJKA 3LT3A 2OD3B 2QN5T 2NU4E 4K5ZA 3F9GA 3MH7A 3UR9A 1O34A 1GHXH 3AW1A 3C27B 4JMYA 3A86A 1C2JA 5E2PA 2XCNA 3P8OA 4UFGH 1QBNA 1TNJA 1BRCE 2G5NA 2EI7A 4OS1A 1HYLA 3RM2H 2PW8H 4IBLH 2GMTC 2FXRA 1VCWA 9LPRA 1PPGE 1AQ7A 1GHZA 1TNKA 2P95A 3MH4A 1NRSH 4A6LA 2VVVA 1A5HA 1SLWB 3Q77A 2AS9A 3VXFH 4IC5A 4ZUHA 1C1OA 5A8ZA 3SJ8A 1C2EA 1P3EA 1XUJA 5BPEA 3ZVDA 4ZHMU 3BTEE 3PO1C 4BAQB 2TBSA 3D49H 3RMLH 1F0RA 3QDZB 1Z71A 1YCPK 4B2CA 4FVBA 1FY5A 3PROA 3FZDA 4AYVB 2A5IA 1SMFE 1SR5C 5E2OA 4TWYA 1GBLA 1MAYA 2M5TA 3A8BA 5E0JA 2Y5GA 1DXWA 4A5TS 4HTCH 3RUOA 1O3HA 4ZKSU 4NG9H 3HATH 3PMAB 2B5TB 3TJNA 1FNIA 1IAUA 1GDUA 3P8GA 2J95A 1H4WA 3U8TH 1OYQA 4K1SA 2PV9B 3QWCH 3TJUA 1LDTT 1O2JA 3LGYA 1RJXB 3RXGA 1O3GA 9ESTA 4AFUA 2B9LA 1ELCA 1HCGA 1P2QA 1GG6C 2FI4E 3BTKE 3HGPA 4X2WA 5JBAS 1RTKA 1YPJH 2THFB 1SGQE 3RLWH 2ZU4A 4X8TH 1O35A 1OP0A 1LVYA 4X2VA 1FMGA 4B1TA 4VGCC 1GHAG 2O9QA 3SU0A 1C2FA 3IWMA 1TQ0B 3A81A 2FTLE 3SI3H 1WOFA 3PMBB 2BXTH 1A4WH 1KLJH 1O2YA 1TALA 2OP9A 2ZU2A 4ESTE 1CT0E 3SBKA 1O2PA 2A31A 3ITIA 3P70B 1J16A 4XOJA 4ABAA 2OBOA 3TLOA 1GMHF 1HAZB 1FAXA 1V2MT 1PJPA 3PLPA 2FMJA 4J1YA 2B7DH 4RSPA 5L6NH 1O31A 2ZTYA 1G3DA 1LTOA 1NRNH 3MHWU 1TPPA 1XKBC 1T32A 4NFFA 2ZFQH 1C5TA 3S9AA 1W14U 1FY3A 1ZTKA 4AN7A 4Y0YE 5F03A 1B5GH 2F83A 2A45B 2KAIA 1NY22 1OS8A 2FTMA 1DLEA 3A88A 1PQ7A 1T4VH 4DG4A 1P8VC 1O5AB 1RTLA 2P3FH 2SGPE 2F9UA 1L1GA 4KTCA 3ZZ5A 3B8JA 1YPLH 3GCTF 1EPTC 2BLVA 4MVNA 1QA7A 4B71A 1AFQB 1BBRE 1TA6A 4X2YA 5L30H 4ABDA 3M5NA 1EUFA 3ZVEA 1THPB 4B76A 5L2ZH 1AI8H 2FYRA 4X1SU 2GZ8A 2ZWLH 3SORA 2CF9H 1FLEE 4Q80A 1KLTA 1P0SH 2A4GA 1DANH 1PPBH 3RXIA 3V13A 1A5GH 3MH5A 1A2CH 3I77A 2UWLA 1ZOMA 3MH6A 4Y76A 3E1XB 1NFXA 1Y59T 4FXGH 4CHAC 1YYY1 1C4U2 3LU9B 3ZVCA 2Q6DA 3E0NB 1V6DA 3VB5A 3L33A 1MBMA 3BSQA 3ZZAA 1P05A 4JZEH 1V2ST 4AG1A 5HMAA 1TMBH 2ILNA 3MTYA 1C1WH 4DY7B 3AW0A 1L1JA 1GJ7B 1DVAH 1VR1H 4UEHH 1BTPA 2NU3E 4IMQA 4BTUB 3FFGA 1FDPA 4ABGA 4BAOB 1P10A 4H4FA 3Q3YA 2R9PA 1ELTA 4FVDA 2EEKA 4AX9H 2JH5D 5JB8S 5AF9H 2QXJA 1BRBE 2ZPQA 1UCYK 1W12U 3P6ZB 1TBQH 4I32A 1C5UA 4AZ2B 1HJ9A 2C4FH 2H9EH 1NO9H 1MQ5A 1ZHMA 2JH6D 1SPJA 4GUXA 5HYOA 1K1MA 1NTPA 2BD3A 2PSYA 1ZGVA 1DS2E 3D65E 4MPUA 2VJ1A 1EJMA 1GJ5H 5DG6A 1NFWA 2R2WU 2GT8A 1FI8A 1EOJA 1W0YH 1BMNH 4HI3A 1HAYB 1G3CA 1V2KT 4INLA 4GHTA 4WJG2 2J92A 2XW9A 1GJAB 3GY3A 5GIBA 2GT7A 1GHWH 4H42U 1O3JA 3ATMA 1QFKH 2O8LA 4D7GA 1EPTB 1A0LA 2ZO3H 1GI0A 2B0FA 2FODA 4FUGA 2TGTA 1DFPA 1D6WA 4YO9A 1A1RA 4PROA 1C5PA 1MKWK 2PHBA 4XBCA 5FAHA 1UVTH 1W2KH 2BLOA 1SLVB 3SNDA 2Y81A 5T6GA 3CENA 4NIWA 1RXPA 3U69H 1C9TA 3MYWA 2Q6FA 1GI9B 2R0LA 1SC8U 1THRH 4Q2KA 2XC5A 4KKDA 2PR3A 1CA0C 5A0BA 1TBRH 3DHKH 4DOQA 2AGEX 2CJIA 2F9VA 3QX5H 4GHQA 3E3TA 4IMZA 2FOGA 1OYTH 1GBEA 2BDHA 5G4BA 1A3EH 1O3CA 1T7CA 3A7XA 2GDDA 1AO5A 1GBJA 3GDSA 2QAAA 4IW4E 3KF2A 4XSKU 1TGNA 1H9HE 1NS3A 4O3TA 1TWXB 1BITA 2A7HA 1WYKA 1XUFA 2VGCC 4WXIA 2FOBA 1HAIH 1KIGH 1AU8A 2RDLA 2AYWA 2C90B 5FBIA 5LGOA 2ZFTA 1AVWA 1ETRH 1YPMH 1SLUB 1DWBH 1J9CH 1ACBE 3PLKA 1MTVA 4JYTA 3RXHA 1VITH 3KQDA 3MO9A 4YT7H 1UJ1A 4FUJA 1OPHB 1C5RA 5GCHG 3BTQE 3SNBA 1PQAA 1WSSH 3SV6A 2HLCA 1TLDA 2R3UA 1IQGA 1N8OC 1KXBA 2FESH 1BQYA 3QGNB 1UCYH 1UTNA 1SL3A 2IN2A 1L2EA 1YLCA 5CHAB 2BVXH 2ZFFH 1D3PB 1DE7H 1AKSB 3OTJE 2A1DB 2EA3A 4UE7H 1UTLM 1ZHPA 2RA3A 3SGBE 1ZTJA 4AB8A 4ABEA 4FUIA 4A92A 4WMFA 3MU1A 4I8JA 1EAIA 3ELAH 2ZFPH 3UFAA 5C1UA 5C5NA 2ZDLA 2P3UB 1V3XA 2ZDAH 3O8BA 1BZXE 2PKAA 4NZLA 2F91A 2QXIA 1QY6A 3RC5A 3EGKH 1C4Y2 3M61U 1O2LA 2GDEH 1O5DH 2FM2A 1EASA 2OQUA 1TBZH 2GCTB 4B2AA 1GCTB 1UTPA 1SGYE 2GKVE 2WV5A 2AGGX 2FWWA 5A0CA 5LH8A 1XUHA 1O2VA 1NRRH 1N6XA 4Y79A 5EXNA 1EP6A 2G55A 2V0BA 1V2JT 5JBTA 3GY2A 1BA8B 1CU1A 1VJ9U 3GYLB 4ZHLU 1N1LA 2C8YB 2BQ6B 2Y7XA 1UTOA 3QK1A 1AFEH 4Z0KA 4HFPB 3SI4H 3DUXH 1CQQA 4UONA 5F8XA 2R2MB 1ARCA 4X1RU 2Y5HA 1NESE 1W7GH 3T27A 1GJ9B 4DURA 1A0JA 3GY8A 2ZHEH 3KEEA 1C5MD 4X1QU 4K3JA 4DJZB 1D9IA 2Q6GA 1CBWC 3URCA 2ZHQH 1AHTH 4ISLA 2STBE 1QBOA 2BY8X 3FZZA 2PTNA 1ESBA 2PUQH 3SOSA 3S0NA 1XVOA 1ESTA 1GBBA 1LVBA 4ISHH 3DA9B 4O9VA 1O0DH 2PKAB 1AMHA 3E8LA 1K28D 1FPHH 1KDQB 1FXYA 4NIXA 4O03A 4CH8B 2CMYA 1BRUP 2QA9E 3PB1E 3V12A 1BHXB 4D9QA 4ZKOU 3RXVA 4K8YA 1ELDE 1CA8B 3NPSA 3E90B 4Y0ZE 1KXAA 2UUFB 3SUGA 2GZ9A 4NA8A 2RA0A 1CT2E 4YOIA 4CRAA 2QF3A 1GI2A 5TJXA 2H9TH 1NN6A 2I6QA 4UFDH 2FLBH 1HPGA 2BY7X 2HNTC 2HVXA 2OQ5A 5IDKA 1O2IA 2BVSH 1B0FA 1O2XA 1O2WA 2V6NA 3GISB 1PPFE 3S9BA 1LO6A 1WTHD 1JIMA 3ATKA 4ZKNU 4H6SB 3A80A 2JETB 1EZUC 3P95A 3QO6A 1S81A 4THNH 4I8GA 2G81E 3QGJA 5LPFA 5A0AE 3UNQA 1A3BH 1BUIA 2WPIS 1GHBF 1D3TB 1YCPH 1Z8RA 2GGVB 3TPIZ 2W3IA 3VXEH 1GDQA 2GCTC 1S5SA 2AEIH 2ZCKP 1G37A 1FV9A 1H9IE 1B7XB 3HK3B 3ZV8A 3F68H 3LJJA 3RU4T 4NFEA 1XM1A 1HB0B 2EC9H 3BG4C 3A8CA 1SFIA 1C1TA 1GHVH 1GMHG 4GCHF 3SU4A 2B8OH 4MNVA 1YM0A 1QJ6B 4FUHA 3UOPA 3SV8A 1GPZA 2F9PA 6CHAC 4U30A 1W3CA 3ZZ8A 3T28A 3UPEA 2BLQA 2H2ZA 1RIWC 1MBQA 1WBGB 2ZI2H 3BTHE 1MTNC 6LPRA 4MTBA 1IHTH 5TCAA 2WYGA 2ZIQH 1IQKA 1P2KA 1SGEE 3IITA 1JXPA 5F8TA 1CT4E 1U6QA 3MNBA 1V2LT 1E37B 1FAKH 2BZAA 3EA9A 1F0UA 1LKBA 4INKA 1O3MA 4NZQA 7GCHF 4JK6A 2TGAA 3OY5U 2G52A 4YESB 3RMMH 3MMGA 3A8AA 2GV6A 4A1TA 5DO4H 4YLQH 1P12E 1BCUH 2ZNKH 1ESAA 2XNIA 3STJA 2PUXB 1JRTA 1P2NA 4NWLA 3RXLA 1GWAA 1SOTA 1BDAA 1HAGE 1UTMA 3KGPA 2SGFE 3TK9A 2G4UA 3Q3KA 1GMDF 1AZZA 4YOJA 1HGTH 4UFFH 3T5FH 4ASHA 1RGQA 1GDNA 1PFXC 1SHHB 1EPTA 1YPEH 4AORA 2ZEBA 1GI1A 1UHBA 3BV9B 5DP5A 5EXMA 2PFEA 5GXPA 2FS8A 1ZPCA 3FAOA 1XKAC 1DDJA 1YLDA 4UFEH 3BTME 3QUMP 1EAUA 3PMHB 3OYPA 3NK8A 4GVUA 4JYVH 1AE8H 1BTHH 2Z9GA 1LPGB 4AOQA 1S84A 1P2MA 4NCYA 1ID5H 2ODPA 4X6OA 1P11E 4DGJA 2ZU3A 4WXVA 1HBTH 3LPRA 1SGFG 3TJOA 1Y3XA 1TQ7B 3SJIA 1DX5M 1S83A 2KAIB 1O3DA 4XDEA 3RXJA 3RXRA 3UWIA 5C1XA 1V2PT 4VGCB 2AH4X 3EAJA 4Y11E 5EQRA 2ZDKA 1VGCB 2BDIA 4JZIA 3GDUA 3LDXH 1LHFH 3HK6B 4AGJA 2ZKSA 2V35A 1ZSKA 3VB7A 1GJ6A 3N7OA 1IQJA 4GSOA 1ZMLA 1WUNH 3M7QA 1O2TA 1O38A 1EP5A 2V3HH 5EGMA 1BMMH 1E34B 2YOLA 4D7FA 4D76A 3RXDA 2J38A 1CO7E 2J4IA 1Z8IB 3GY6A 4HZHA 1ZMJA 2ZECA 1A5IA 1TGSZ 2R0KA 1XX9A 4E06H 2AIPA 2K7XA 2Z94A 1GL1A 2Q1JA 1G2MA 1O5EH 1TRMA 2H1UA 3LJOA 1DY8A 3SJOA 1YGCH 4IGDA 3M35A 2OC1A 2ALPA 2A4QA 2RG3A 3TH4H 3KL6A 3RU4E 1TNHA 3PWBA 1MKWH 2C3SA 2QCYA 1QRZA 4RKJB 4X6NA 4BOHA 3SQEE 4JZDH 1GI7B 2FS9A 1AZ8A 1DICA 5EOKA 3O8RA 1LPKB 1O3LA 5LPRA 1WAYB 2JH0D 1JOUB 3MWIU 2D1JA 1MZDA 3EYDA 5K7RA 3C1KA 3A8DA 1QR3E 3FANA 1TRNA 2VH6A 3TK5A 3MU5A 1KXFA 3GCOA 1SGRE 3R3GB 2C8ZB 2G51A 3B23B 2H9HA 4YZUA 1QJ7B 2XBWA 1EB2A 4MNYA 3RXPA 3GY5A 3I78A 1CGHA 1V2TT 3GCHB 1XMNB 2ZC9H 3K9XB 3TK6A 1MTWA 2H6MA 2WPKS 3MOCA 2GX4A 1FY1A 1ANEA 1GBMA 1A0HB 4GAWA 1F7ZA 1MD7A 1CA0B 2V3OH 1P2IA 2Z9JA 1W8BH 5E8EH 1KXEA 2LPRA 2BD9A 1GMCF 2OTVA 3ATWA 1ZPZA 4MPXA 1RTFB 3AVZA 1LHGH 2FP7B 2ZPRA 4NA9H 1NFUA 3MNXA 3U98H 1XUIA 1RD3B 1O5GH
chains in the Genus database with same CATH superfamily
2AIQA 3ZZCA 2Z7FE 3NKKA 2FX4A 1W13U 2ASUB 1A61H 2ZU5A 1P57B 1IQLA 1GJCB 1C1VH 1AUTC 6GCHF 1CVWH 2Z9LA 5DSFA 3F9HA 4LK4A 2PGBB 3U1JB 5A2MH 2A32A 1QRXA 1UK3A 2BY5X 1GI3A 2XC0A 2A7CA 1NM6A 1TX8A 2ANMH 1GI8B 4LZ4B 3M3TA 2HRVA 1NRQH 5EIYA 4JCNA 1AGJA 3LC5A 3DD2H 3GCHC 1LVMA 1CHOG 2GZ7A 1GBHA 1UMAH 4YLUA 1EB1H 1QB9A 3PYHA 5DJ7A 4B74A 3MNSA 2JKHA 4KTUA 2KCAA 2FYQA 2XXLA 2ZFSA 5FX6A 4WY3A 1EQ9A 1WTGH 2GCHF 1EXFA 1W0KD 3D23A 1C5SA 1P06A 2ESTE 2FPZA 2SGEE 5F6MA 2HWLB 1FQ3A 5B6OA 1YPGH 2GP9B 1S6FA 4R0IA 1BMAA 2ZDNA 2VINA 4MNWA 4YTAA 4ZXYH 4CH2B 3A85A 6GCHG 1O32A 1YP9A 1QJ1B 3ZZ9A 1AKSA 3BG8A 1GBKA 2ANKH 1QNJA 2ZTXA 2UWPA 3E0PB 2ZHWH 4F49A 1TA2A 3DFLA 3LKWA 3O8DA 2PWXA 3KCGH 4XBBA 4TYDA 1TMUH 1EKBB 3BN9A 3SU6A 1S6HA 4CBNA 1V2RT 1O3BA 2ZGHA 1O2ZA 1FZZA 1Q2WA 3Q00A 1VZQH 5GWZA 4Q7ZA 4ZH8A 1RIWB 1SQTA 3MU0A 4KGAA 5F8ZA 3RU4D 3F1SB 3UNRA 2VH0A 1DUEA 1VKYA 1HXFH 2P16A 3K6YA 1IQHA 1J17T 1K22H 4JYUH 4BAHB 2VGCB 1F2SE 1GVLA 8GCHF 1ZMNA 1AE5A 2FOCA 2ZGBH 3F2GA 4TY6A 1LKAA 2Z3DA 1GCTC 2WPLS 2RDEA 3UR6A 1AWFH 1D3DB 1OP8A 5HXFA 4U32A 1DPOA 1O2RA 1ZR0A 3LIWA 2BX3A 2ZGXH 3ZVBA 4WMEA 1K1IA 1O5BB 2GV7A 1ELFA 1S82A 3LGIA 1Z6JH 2C93B 1AB9C 3A89A 5EQSA 1ELGA 1TYNA 3ODDA 4K8BA 3V7TA 3LOXA 2EI6A 2WPMS 2KCOA 2FEQH 2GVFA 4MLFB 4ISNA 8GCHG 1DWEH 2NU2E 1DLKB 1HFDA 4E7RG 1C2LA 1C5QA 3RC6A 1KSNA 3UIRA 4ABBA 1AFQC 2XBXA 2IJOB 3SZEA 3ZZ4A 1DOJA 1DY9A 3AAVA 2PP6A 2G00A 2QY0B 3OU0A 4CREA 1C2KA 2JETC 1AN1E 3OSYA 1XUKA 3OFND 4FUDA 5I25A 5J4SA 4F4OC 1UCYE 2FOFA 4INHA 2OC0A 1SGFA 7LPRA 4ISOA 1ZRBA 1IQMA 3SNCA 2O8UA 2ZZUH 1Q3XA 3KQEA 4CRFA 3M36A 1BMFD 2HGTH 5FHTA 1NPMA 1O3PB 3UY9A 5GPIB 3SQHE 4MPVA 2OINA 2LIZA 1V2OT 3TU7H 2O8WA 5E0HA 2Y6TA 2BY6X 2BVRH 3WY8A 1MABB 2QXHA 2WSSD 2TGPZ 1OWKA 2WINI 3TVJB 3FP6E 2ZPSA 3NZIA 1G9IE 1K9OE 1YBWA 3M5MA 2CHAB 1YF4A 1OWHA 1WCZA 1LHDH 5EW1H 1HIAB 3TITA 2YNBA 1A7SA 3E91A 1HUTH 3HKIB 3KIDU 4X8VH 2QXGA 2LNCA 3SGAE 3UWJH 1F92A 1Y3YA 4RI0A 2ANYA 1MZAA 3QTOH 2PGQB 2ZHFH 3TGIE 2HNTF 1C5YB 4KELA 2P59A 3GYMA 1BB0B 4IC6A 1WQVH 4BTTB 3TGJE 1WDIA 1BIOA 1F5RA 5EU8A 3MNCA 1J14A 1GI4A 2JIZD 1CSOE 3BTGE 1C5VA 3ENSB 2ZQ1A 4FU8A 3MQKC 1ZRKA 4TPIZ 4IS5A 1N6YA 3SV2H 4BNRA 3RDZA 3ATIA 3SW2B 3U9AH 2VIQA 1XVMA 4O3UA 1BJVA 3O8CA 1EJNA 1YC0A 2BZ6H 1VJAU 1SSXA 4I8KA 5DP9A 1O30A 4CRBA 1GI5A 1S6LA 1ZYOA 4ZKRU 3G01A 1DSTA 2WPDD 3U1IB 2W7SA 2DE8A 1S0RA 2SFAA 4K69A 4OS5A 2Z3CA 4P02A 3ZVFA 3EDXB 3ZVGA 4E7NA 1GHAF 3UOUA 5FCKA 1H8IH 1Z8JB 2STAE 1BRAA 1T31A 4UDWH 3ZZ6A 2PLXA 1T8NA 2L6OA 1UO6A 3CS7A 1HIAA 3TIUA 1PQ5A 2VBCA 2YMSD 1G3BA 2XCFA 1C1PA 2FI3E 1G2LA 1YKTA 1S0QA 4U01A 2J98B 3ZV9A 2NWNA 3PV2A 2ZTZA 3EA7A 1SHYA 2J2UA 4Y8YA 4B6FA 3PLBA 2W3KA 3PWCA 3QN7A 5H4IB 3PMJA 1MTSA 3LGVA 4CBOA 1BHXF 1O2SA 1Y5AT 5DP8A 5EW2H 4AYYB 3QZQA 5CHAC 2HALA 1VITF 5ESBA 1Y3VA 3A87A 1N8OB 4DIIH 1OWJA 1EATA 4LOYH 1AWHB 1KLIH 2FX6A 3OE7D 5JBCS 2ALVA 1O39A 2BX4A 1C5LH 1XXDA 1W7XH 3M7UA 1VCQA 2BOHB 4TPYA 1O5CB 3S9CA 3L6PA 1DXPA 3P8FA 1AB9B 3K6ZA 1ARBA 4WH6A 2H5DA 3ZIAD 3BIVH 1OX1A 2RCEA 2BHGA 4E05H 1CGIE 1GMDG 1P03A 4X8UH 4R8TB 2EI8A 1YCPM 1MAXA 1YPHE 3VGCC 1OWEA 7GCHG 1GBDA 3A7YA 1B0EA 2O8TA 1E35B 2BD2A 5T3HA 2J9NA 3M37A 4OS2A 4JZFH 1UVOA 4I31A 3VEQB 4KP0A 1K1LA 4X2XA 3A7ZA 1CBWB 2TGDA 3M3VA 1D3QB 1S85A 1C1QA 1GHYH 1P02A 1FN6A 1IOEA 4Q4LA 1MTNB 2BM2A 5DP6A 1K1PA 1HJAC 1O2OA 3RC4A 1GJDB 1NU9A 1HJ8A 1SVPA 2QYIA 2ZA5A 1PPEE 1QB1A 1IQFA 1O2HA 3GCTG 3QZRA 2FDAA 4J2YB 1VCPA 4AGKA 1BMLA 2SGQE 5K0HA 2OC8A 3RXEA 2BDYA 1ANDA 1OP2A 2TRMA 2JJ2D 2XWAA 3QLPH 4Y10E 3OY6U 1MCVA 4B6EA 1TNLA 4CR9A 1E79D 5HGGA 3SN8A 5DPAA 1QB6A 3SV7A 5FPSA 3L3TA 1WU1A 4OS7A 2XC4A 3HPTB 2C8WB 3F3BA 1TONA 4LZ1H 4DT7B 4M7GA 1SFQB 5PTPA 4FUCA 5I46H 3DT0H 2FOEA 2J34A 1O2UA 1AD8H 2CV3A 5C20A 2BD7A 1CHGA 1ANBA 2CGAA 3Q76A 1TNGA 2W26A 1GMCG 4RN6A 4ABHA 3EQ0H 3KN2A 2FI5E 5KGOA 3M5OA 2FO9A 2QIQA 1MD8A 3NUMA 1SB1H 1AVGH 4K1TA 3RXCA 4BANB 1UTKA 5FL7D 1EZQA 2G5VA 2BB4A 1QURH 3VB4A 2ZG0H 4MNXA 5DK1A 3M5LA 4OM9A 3BTWE 3FKSD 4TWWA 5GCHF 4MPWA 3T26A 3KHVA 3URDA 1HXEH 4NWKA 5CE1A 4I8LA 3F2FA 1C1UH 4TY7A 1Z1JA 3D62A 1EZXC 3HGNA 5A8YA 7KMEH 5EPYA 1EZSC 1XXFA 3H7OA 2BY9X 3PV4A 5J4QA 1ZZZA 1JIRA 2A4OA 3VGCB 2R3YA 2Z9IA 1SQAA 2IPHA 1BT7A 1TX6A 3F0PA 5T1VA 5KECA 1D4PB 3WW7A 4AG2A 2FOMB 4B75A 2BYAX 1IQIA 1UVUH 2BDGA 1ZGIA 4XFQA 4CRGA 1TX7A 1BTXA 1QTFA 2P93A 1BOQA 2TPIZ 4ABFA 2Y7ZA 4NIYA 3ZZDA 2VWOA 1ORFA 2ZGCA 3A82A 3P17H 1K1OA 1C5NH 4QT8C 1TPOA 5C94A 1Z1IA 1UTQA 3BEFB 4LXBH 4BXSA 2CK3D 1COWD 4I8HA 1OWDA 1DWDH 1TABE 5C1YA 3FVFB 4Y8XA 4X6PA 2VIOA 3U8RH 3EE0B 3KNXA 4WVPE 1GBCA 2VVUA 3GDVA 4CR5A 2NU0E 1BTZA 1PPZA 2FZZA 3E16B 2F4LA 1T8MA 4CRDA 1DT2A 2VB0A 3LGUA 4BAKB 1TB6H 1C9PA 1FY4A 1H8DH 1UHBB 3T62A 3NXPA 2NU1E 4WH8A 2AFQB 4YM9A 5GDSH 5JB9S 2SNWA 1MCTA 1KXCA 1QA0A 3LC3A 4YT6H 5ETXA 2I6SA 1TPAE 3QTVH 1KTSB 1KXDA 4NIVA 2CHAC 1UVPA 2K8IA 3RXBA 1O37A 3TH3H 2BLWA 3U28C 1E1RD 1ELAA 1DUAA 2V3MA 1LPZB 3AASA 1D6RA 5BRRE 1QBVH 5CMXH 1G32B 3ZYEA 2L74A 1NZQH 1QL7A 1QHRB 1SGCA 1HAVA 4OGYA 3AK5A 2DUCA 3MI4A 5JYIA 3RXMA 1J15A 1K1JA 3S69A 1P9UA 3MU4A 3RXQA 4FETA 1C5ZB 5FXLA 2WPHS 4WF8A 2A7JA 1O2KA 4HGCA 1TOCB 1EX3A 1E1QD 1HRTH 1OOKB 2Z6BD 1MKXK 1J8AA 1ETTH 4MQAA 4Z6AH 2P8OC 2G8TA 1FUJA 3RP2A 2YMSC 1MMJN 2CXVA 1ZJDA 3PV5A 1FONA 1VGCC 1O3FA 3UUZA 2Y5FA 1O3AA 3F9FA 2Y82A 3VG8A 1Z6EA 1NFYA 1FN8A 1INCA 5JBBS 1O3KA 3SJ9A 3MFJA 4HG6A 2GCHG 2XNDD 2AGIX 3W95A 2CF8H 2PKSC 2F43B 3FOAA 3VPKA 4RKOB 1O2GH 1TNIA 1W0JD 1GJ4H 1K21H 1SGIB 1ZJKA 1TGBA 3UQOA 4BXWA 1SG8B 3K2UA 4FOUC 3TJVA 2VU8E 5FCRA 4AFQA 2OLGA 1JWTA 1RFNA 1TRYA 2A5KA 1PYTC 2JDID 3ATLA 2ZDVH 4GCHG 3F6UH 2V7QD 4Z1MD 1HLTH 5A09A 2BXUH 2OUAA 3GCNA 8KME2 4FUEA 4D8NA 1Z7KA 1G36A 4Y71A 2J98A 1IQEA 1LQDB 1SBWA 3VB3A 3MO6A 3Q3XA 1Y3UA 2HOBA 1GVZA 1OWIA 2AMQA 3EBNA 2DE9A 2BD5A 1BTYA 5E0GA 3SU1A 1SI5H 2K1QA 1SGPE 2VVCA 4X8SH 1O3EA 4B2BA 2ODQA 1UK2A 3I29A 2P94A 1KY9A 2D26C 1IHSH 3LH1A 3HKJB 2ZCLP 1OXGA 4A1XA 1DITH 2GMTB 5B6LA 3M3SA 2GD4B 1HAXB 1P3CA 5DGJA 1GBAA 3EA8A 4RT0A 2ZGJA 3JZ1B 1K0HA 8LPRA 2G4TA 4NA7A 3UNSA 2XRCA 1C2HA 2ANWA 1LMWB 1YPKH 4OS4A 1AVXA 2BDAA 4DVAU 5GJ4B 4JK5A 3KYFA 5T6FA 5ABWA 1GGDB 2ODYB 3GY7A 1FIZA 4SGBE 4I7YH 1ZTLA 1BBRK 3BEUA 3A7TA 2O8MA 2VWMA 1A46H 1EJAA 3FP7E 4Q7XA 8ESTE 5EODA 1C4V2 2QC2A 1E38B 1P01A 3DSOA 3SUDA 1C2GA 4OS6A 3RMOH 6CHAB 1MKXH 5DKMA 5FBEA 3SGQE 2BQWB 2XBVA 4D9RA 1ETSH 1EAWA 1GHBG 1LQEA 2SNVA 1KYNA 2HPQH 3LH3A 5FPTA 5FX5A 2UWOA 5C0TA 1P2JA 1OSSA 4XRNA 2ZP0H 1Y8TA 2OC7A 2W5EA 1GJ8B 1LHEH 1LVOA 2W7UA 3S7HB 1T8LA 2WYJA 2Z3EA 1F5KU 4ZXXH 4K1EA 1H8ED 1ZHRA 5A8XA 4Q7YA 1TFXA 3DFJA 1HV7A 2KCPA 7ESTE 1G30B 2WUCA 2C8XB 3P92A 1W11U 1K2I1 3MU8A 1ZSJA 1O2NA 1Z8GA 1HAHH 1PPCE 2VIVA 3A84A 1DWCH 1O3OA 5EQQA 2ZQ2A 1KMHB 3SV9A 1UVSH 1TE0A 3PTNA 2PTCE 1ZSLA 4KTSA 4BTIB 2BDBA 1QCPA 2XOKD 1THSH 5EPNA 3CP7A 5FPYA 3E6PH 5TCCA 3GY4A 5AFYH 1L1NA 3T25A 3TGKE 3SU2A 1F0TA 1MU8B 6ESTA 1GL0E 1EAXA 3LGTA 2F9BH 1HJAB 3U8OH 1BTUA 1TIOA 2OBQA 4MDSA 4DCDA 5EG4A 1E36B 1DM4B 5JPMH 1PQ8A 4ZMAH 1GBFA 1Q31A 1SGTA 1HNEE 1L4DA 2IJD1 2QGRA 4Y8ZA 4WWYA 1TGTA 1GJBB 2FOHA 2QF0A 3GOVB 3MO3A 4AFZA 5L2YH 1MQ6A 1C1NA 3PM3A 5ESTE 3UTUH 4UD9H 1RRKA 3BTDE 5AHGH 4H6TA 3SHCH 3PTBA 3R0FA 1JRSA 5JDUB 3BTTE 1UK4A 1TOMH 1L0ZA 3W94A 4DT4A 3GICB 1Y5UT 1AUJA 5EXLA 4ISIH 3RXAA 1C2MA 3ZZ3A 2FLRH 4IN2A 1GGDC 4TT3D 4I33A 3UQVA 1K1NA 1O3NA 1WV7H 4WMDA 2P3TB 3CS0A 3H5CB 2UUYA 3IG6B 1OKXA 1CHOF 1DSUA 1E0FD 2F9NA 1O36A 1GG6B 2SGAA 3ESTA 3RXTA 1UTJA 1QL9A 3N7DA 2VIPA 2UUJB 4K60A 3UREA 2Z9KA 1BBRH 4NGAH 5DP4A 1ZLRA 4O97A 1VITG 2SGDE 4GLYA 3SNEA 2OCVB 2IOTA 5SGAE 1C5OH 2D2DA 1FJSA 4AFSA 1GBTA 2VIWA 3RM0H 1O5FH 2HPPH 2UUKB 3LGWA 2A5AA 1CGJE 4A7IB 1ABJH 5DN6D 1HAPH 1P04A 1LHCH 3SZNA 1QGFA 1H1BA 3DCLA 3STIA 3TNTA 1ABIH 1QL8A 1Y3WA 5AFZH 2QV1A 5HM2A 4CRCA 4MG3A 1ELVA 1HDTH 2VIDA 3RMNH 3PO1B 1C2DA 1F0SA 1M9UA 3BIUH 3OAAD 1L4ZA 1O3IA 1TAWA 1T4UH 1GI6A 3RLYH 4A1VA 1C2IA 4FUFA 2J94A 1NRPH 2WZQA 1HAOH 5C67A 1TGCA 3DSGA 4ZAEA 1EFRD 1C1SA 1HAVB 1W10U 2ZFRH 2BD4A 1FPCH 1SOZA 1FY8E 2BDCA 3CNRA 3BEIB 1FIWA 2GTBA 2BQ7B 1H9LB 1GBIA 5KEDA 4XE4A 2VWNA 1MTUA 2PKSB 1NC6A 2FIRH 1JMOH 3BF6H 1GVKB 1O2QA 2PSXA 1AY6H 3M7TA 2WV4A 3JZ2B 1ANCA 3KQBA 3RXSA 3LONA 2A2QH 4DW2U 3AAUA 1ZPBA 3NWUA 4ABJA 2HNTE 5C2ZA 3K65B 3BTFE 1BTWA 2BOKA 2VNTA 1PYTD 5CDFE 1GCDA 2FOAA 1QQ4A 2P8OB 2TIOA 2W6JD 2KCYA 2KX4A 1QIXB 1AIXH 5T6DA 4GPGA 3RXOA 1C5XB 3A7VA 4DIHH 3T2NA 1V2NT 1ELEE 3SO3A 3ODFA 4B73A 5C17A 3SU5A 1UW7A 2A4RA 4FU9A 2XTTB 3A83A 3F0OA 3F9EA 1TPSA 2F9OA 1RS0A 1NU7B 3SU3A 1G3EA 1MH0A 3BG4B 1EOLA 5C5OA 1X7AC 1SGNE 4X1PU 2Y80A 3KQCA 2A2XH 1F5LA 1SLXB 1P09A 4CHAB 5LPEA 1W0ZU 2XYAA 3SUEA 1CE5A 3TNSA 2A0QB 4K2YA 4NSYA 4NSVA 1WQSA 4SGAE 1MUEB 1PPHE 2AMPA 4F48B 1LCYA 3ZYDA 4Y7AA 1TMTH 2CN0H 2BMGB 4X1NU 3A7WA 2H5CA 4X6MA 4FUBA 1BJUA 5IYTA 2OXSA 2ZHDA 2BTCE 3RXFA 3ZVAA 4XBDA 5HM9A 1NROH 1YPHC 4JZ1A 1C1RA 4IN1A 1V2QT 4OGXA 3V3MA 3S7KB 1T8OA 1V2VT 2ULLA 2ZCHP 1JBUH 1V2UT 1YWUA 2XBYA 1SQOA 2ZF0H 4ZROA 2ZDMA 3TH2H 4Y7BA 3ZZ7A 2AERH 2WUBA 1KTTB 4U2WA 3RXKA 5DP3A 4FU7A 3VFEA 3P8NA 1C5WB 4BAMB 3B9FH 4YOGA 3V0XA 3OEED 3NCLA 5DP7A 3SUFA 2AMDA 5AVDA 3T29A 2F3CE 1P2OA 1C1MA 1P9SA 2YNAA 3FP8E 3SHAH 3OX7U 5GNDA 3ZZBA 2D8WA 1SGDE 1O33A 3SYJA 1IQNA 3VB6A 1V2WT 1MU6B 4AB9A 1QRWA 3SNAA 1ELBA 1O2MA 1XUGA 1KDQA 1QQUA 2WPJS 3RXUA 4ABIA 5C3NA 4ZCNA 4ZHAA 2VWLA 2ZU1A 3H7TA 4Y6DA 2BD8A 4X0WU 1NT1A 1Y5BT 2XWBI 3SJKA 3LT3A 2OD3B 2QN5T 2NU4E 4K5ZA 3F9GA 3MH7A 3UR9A 1O34A 1GHXH 3AW1A 3C27B 4JMYA 3A86A 1C2JA 5E2PA 2XCNA 3P8OA 4UFGH 1QBNA 1TNJA 1BRCE 2G5NA 2EI7A 4OS1A 1HYLA 3RM2H 2PW8H 4IBLH 2GMTC 2FXRA 1VCWA 9LPRA 1PPGE 1AQ7A 1GHZA 1TNKA 5HIZA 2P95A 3MH4A 1NRSH 5EJ1A 4A6LA 2VVVA 1A5HA 1OHHD 1SLWB 3Q77A 2AS9A 3VXFH 4IC5A 4ZUHA 1C1OA 4YXWD 5A8ZA 3SJ8A 1C2EA 1P3EA 1XUJA 5BPEA 3ZVDA 4ZHMU 3BTEE 3PO1C 4BAQB 2TBSA 3D49H 3RMLH 1F0RA 3QDZB 1Z71A 1YCPK 4B2CA 4FVBA 1FY5A 3PROA 3FZDA 4AYVB 2A5IA 1SMFE 1SR5C 5E2OA 4TWYA 1GBLA 1MAYA 2M5TA 3A8BA 5E0JA 2Y5GA 1DXWA 4A5TS 4HTCH 3RUOA 1O3HA 4ZKSU 4NG9H 3HATH 3PMAB 2B5TB 3TJNA 1FNIA 1IAUA 1GDUA 3P8GA 2J95A 1H4WA 3U8TH 1OYQA 4K1SA 2PV9B 3QWCH 3TJUA 1LDTT 1O2JA 3LGYA 1RJXB 3RXGA 1O3GA 9ESTA 4AFUA 2B9LA 1ELCA 1HCGA 1P2QA 1GG6C 2FI4E 3BTKE 3HGPA 4X2WA 5JBAS 1RTKA 1YPJH 2THFB 1SGQE 3RLWH 2ZU4A 4X8TH 1O35A 1OP0A 1LVYA 4X2VA 4RT1A 1FMGA 4B1TA 2QF4A 4VGCC 1GHAG 2O9QA 3SU0A 1C2FA 3IWMA 1TQ0B 3A81A 2FTLE 2HLDD 3SI3H 1WOFA 3PMBB 2BXTH 4AC9A 1A4WH 1KLJH 1O2YA 1TALA 3UB0A 2OP9A 2ZU2A 4ESTE 1CT0E 3SBKA 1O2PA 2A31A 3ITIA 3P70B 1J16A 4XOJA 4ABAA 2OBOA 3TLOA 1GMHF 1HAZB 1FAXA 1V2MT 1PJPA 3PLPA 2FMJA 4J1YA 2B7DH 4RSPA 2RFKC 5L6NH 2OK5A 1O31A 2ZTYA 1G3DA 1LTOA 1NRNH 3MHWU 1TPPA 1XKBC 1T32A 4NFFA 2ZFQH 1C5TA 3S9AA 1W14U 1FY3A 1ZTKA 4AN7A 4Y0YE 1YY3A 5F03A 1B5GH 2F83A 2A45B 2KAIA 1NY22 1OS8A 2FTMA 1DLEA 3GS9A 3OEHD 3A88A 1PQ7A 1T4VH 4DG4A 1P8VC 1O5AB 1RTLA 2P3FH 2SGPE 2F9UA 1L1GA 4KTCA 3ZZ5A 3B8JA 1YPLH 3GCTF 1EPTC 2BLVA 4MVNA 1QA7A 4B71A 2HVYB 1AFQB 1BBRE 2IPQX 1WXRA 1TA6A 4X2YA 5L30H 4ABDA 5EJLA 1SKYE 3M5NA 1EUFA 2AHME 3ZVEA 1THPB 4B76A 5L2ZH 1AI8H 2FYRA 4X1SU 2GZ8A 3UAIC 2ZWLH 3SORA 2CF9H 1FLEE 4Q80A 1KLTA 1P0SH 2A4GA 1DANH 1PPBH 3RXIA 3V13A 1A5GH 3MH5A 1A2CH 3I77A 2UWLA 1ZOMA 3MH6A 4Y76A 3E1XB 1NFXA 1Y59T 2EY4C 4FXGH 4CHAC 1YYY1 1C4U2 3LU9B 3ZVCA 2Q6DA 3E0NB 1V6DA 3VB5A 3L33A 1MBMA 4Q63A 3BSQA 3ZZAA 1P05A 4JZEH 1V2ST 4AG1A 5HMAA 5CHBA 1TMBH 2ILNA 3MTYA 1C1WH 4DY7B 3AW0A 1L1JA 2WHXA 3NRLA 1GJ7B 1DVAH 1VR1H 4UEHH 1BTPA 2NU3E 4IMQA 4BTUB 3FFGA 1FDPA 4ABGA 4I86A 4BAOB 1P10A 4H4FA 3Q3YA 2R9PA 1ELTA 4FVDA 2EEKA 4AX9H 2JH5D 5JB8S 5AF9H 2QXJA 1BRBE 2ZPQA 1SQRA 1UCYK 1W12U 3P6ZB 1TBQH 4I32A 1C5UA 4AZ2B 1HJ9A 2C4FH 2H9EH 1NO9H 1MQ5A 1ZHMA 2JH6D 1SPJA 4GUXA 5HYOA 3OTPA 1K1MA 1NTPA 2BD3A 2PSYA 1ZGVA 1DS2E 3D65E 4MPUA 2VJ1A 1EJMA 1GJ5H 5DG6A 1NFWA 2GT8A 1W0YH 1FI8A 1EOJA 2R2WU 1BMNH 4HI3A 1HAYB 1G3CA 1V2KT 4INLA 4GHTA 4WJG2 2J92A 5EJZA 2XW9A 1GJAB 3GY3A 5GIBA 2GT7A 1GHWH 4H42U 2GJGA 1O3JA 3ATMA 1QFKH 2O8LA 4D7GA 1EPTB 1A0LA 2ZO3H 1GI0A 2B0FA 2EQNA 2FODA 4FUGA 2TGTA 1DFPA 1D6WA 4YO9A 1A1RA 4PROA 3FO8D 1C5PA 1MKWK 2PHBA 4XBCA 5FAHA 1UVTH 1W2KH 2BLOA 3KYGA 1SLVB 3SNDA 2Y81A 5T6GA 3CENA 4NIWA 1RXPA 3U69H 1C9TA 3MYWA 2Q6FA 1GI9B 2R0LA 1SC8U 1THRH 5HIYA 4Q2KA 2XC5A 4KKDA 2PR3A 1CA0C 5A0BA 1TBRH 3DHKH 4DOQA 2AGEX 2CJIA 2F9VA 3QX5H 4GHQA 3E3TA 4IMZA 2FOGA 1OYTH 1GBEA 2BDHA 5G4BA 1A3EH 1O3CA 1T7CA 3A7XA 2GDDA 1AO5A 1GBJA 3GDSA 2QAAA 4IW4E 3KF2A 4XSKU 1TGNA 1H9HE 1NS3A 4O3TA 2LELA 1TWXB 2A7HA 1BITA 1WYKA 1XUFA 2VGCC 4WXIA 2FOBA 5F53A 1HAIH 1KIGH 1AU8A 2RDLA 2AYWA 2C90B 5FBIA 5LGOA 2ZFTA 1AVWA 1ETRH 1YPMH 3N99A 1SLUB 1DWBH 1J9CH 1ACBE 3PLKA 1MTVA 4JYTA 3RXHA 1VITH 3KQDA 3MO9A 4YT7H 1UJ1A 4FUJA 1OPHB 1C5RA 5GCHG 4ACBA 3BTQE 3SNBA 1PQAA 1WSSH 3SV6A 2HLCA 1TLDA 2R3UA 1IQGA 1N8OC 1KXBA 2FESH 1BQYA 3QGNB 1UCYH 1UTNA 1SL3A 2IN2A 1L2EA 1YLCA 5CHAB 2BVXH 2ZFFH 1D3PB 1DE7H 1AKSB 3OTJE 2A1DB 2EA3A 4UE7H 5HKKD 1UTLM 1ZHPA 2RA3A 3SGBE 1ZTJA 4AB8A 4ABEA 4FUIA 4A92A 4WMFA 3MU1A 4I8JA 1EAIA 3ELAH 2ZFPH 3UFAA 4M9FA 5C1UA 5C5NA 2ZDLA 2P3UB 1V3XA 2ZDAH 3O8BA 1BZXE 2PKAA 4NZLA 2F91A 4P00A 2QXIA 1QY6A 3RC5A 3EGKH 1C4Y2 3M61U 1O2LA 2GDEH 1O5DH 2FM2A 1EASA 2OQUA 1TBZH 2GCTB 4B2AA 1GCTB 1UTPA 1SGYE 2GKVE 2WV5A 2AGGX 2FWWA 5A0CA 5LH8A 1XUHA 1O2VA 2KZ4A 1NRRH 2QF5A 3W1EA 1N6XA 4Y79A 3N7EA 5EXNA 1EP6A 2G55A 2V0BA 1V2JT 5JBTA 3GY2A 1BA8B 1CU1A 1VJ9U 3GYLB 4ZHLU 1N1LA 2C8YB 2BQ6B 2Y7XA 1UTOA 3QK1A 1AFEH 4Z0KA 4HFPB 3SI4H 3DUXH 1CQQA 4UONA 5F8XA 2R2MB 1ARCA 4X1RU 2Y5HA 1NESE 1W7GH 3T27A 1GJ9B 4DURA 1A0JA 2YMSB 3GY8A 2ZHEH 3KEEA 1C5MD 4X1QU 4K3JA 4DJZB 1D9IA 2Q6GA 1CBWC 3URCA 2ZHQH 1AHTH 4ISLA 2STBE 1QBOA 2BY8X 3FZZA 2PTNA 1ESBA 2PUQH 3SOSA 3S0NA 1XVOA 1ESTA 1GBBA 1LVBA 4ISHH 3DA9B 4O9VA 1O0DH 2PKAB 1AMHA 3E8LA 1K28D 1FPHH 1KDQB 1FXYA 4NIXA 4O03A 4CH8B 2J97A 2CMYA 1BRUP 2QA9E 3PB1E 3V12A 1BHXB 4D9QA 4ZKOU 3RXVA 4K8YA 1ELDE 1CA8B 3NPSA 3E90B 2J5UA 4Y0ZE 1KXAA 2UUFB 3SUGA 2GZ9A 4NA8A 2RA0A 1CT2E 4YOIA 4CRAA 2QF3A 1GI2A 5TJXA 2H9TH 1NN6A 2I6QA 4UFDH 2FLBH 1HPGA 2BY7X 2HNTC 2HVXA 2OQ5A 4F55A 5IDKA 1O2IA 2BVSH 1B0FA 1O2XA 1O2WA 2V6NA 3GISB 1PPFE 3S9BA 1LO6A 1WTHD 1JIMA 3ATKA 5IK2D 4ZKNU 4H6SB 3A80A 2JETB 1EZUC 3P95A 3QO6A 1S81A 4THNH 4I8GA 2G81E 3QGJA 5LPFA 5A0AE 3UNQA 1A3BH 1BUIA 2WPIS 1GHBF 1D3TB 1YCPH 1Z8RA 2GGVB 3TPIZ 2W3IA 2KR7A 3VXEH 1GDQA 2GCTC 1S5SA 2K0QA 2AEIH 2ZCKP 1G37A 1FV9A 1H9IE 1B7XB 3HK3B 3ZV8A 3F68H 3LJJA 3RU4T 4NFEA 1XM1A 1HB0B 2EC9H 3BG4C 3A8CA 1SFIA 5C0UA 1C1TA 1GHVH 1GMHG 4GCHF 3SU4A 2B8OH 4TSFD 4MNVA 1YM0A 1QJ6B 4FUHA 3UOPA 3SV8A 1GPZA 2F9PA 6CHAC 4U30A 1W3CA 4XD7D 3ZZ8A 3T28A 3UPEA 2BLQA 2H2ZA 1RIWC 1MBQA 1NBMD 1WBGB 2ZI2H 3BTHE 1MTNC 6LPRA 4MTBA 1IHTH 5TCAA 2WYGA 2ZIQH 1IQKA 1P2KA 1SGEE 3IITA 1JXPA 5F8TA 1CT4E 1U6QA 3MNBA 1V2LT 1E37B 1FAKH 2BZAA 3EA9A 1F0UA 1LKBA 4INKA 1O3MA 4NZQA 7GCHF 4JK6A 2TGAA 3OY5U 2G52A 4YESB 3RMMH 3MMGA 3A8AA 2GV6A 4A1TA 5DO4H 4YLQH 1P12E 1BCUH 1FX0B 2ZNKH 1ESAA 2XNIA 3STJA 2PUXB 1JRTA 1P2NA 4NWLA 3RXLA 1GWAA 1SOTA 1BDAA 1HAGE 1UTMA 2WV9A 2SGFE 3KGPA 3TK9A 2G4UA 3Q3KA 1GMDF 1AZZA 4YOJA 1HGTH 4UFFH 3T5FH 4ASHA 1RGQA 1GDNA 1PFXC 1SHHB 1EPTA 1YPEH 4AORA 2ZEBA 1GI1A 1UHBA 3BV9B 5DP5A 5EXMA 2PFEA 5GXPA 2FS8A 1ZPCA 2M2AA 3EE7A 3FAOA 1H8HD 1XKAC 1DDJA 1YLDA 4UFEH 3BTME 3QUMP 2KFWA 1EAUA 3PMHB 3OYPA 3NK8A 4GVUA 4JYVH 1AE8H 1BTHH 2Z9GA 1LPGB 4AOQA 1S84A 1P2MA 4NCYA 1ID5H 2ODPA 4X6OA 1P11E 4DGJA 2ZU3A 4WXVA 2KM0A 1HBTH 3LPRA 1SGFG 3TJOA 1Y3XA 1TQ7B 3SJIA 1DX5M 1S83A 2KAIB 1O3DA 3H09A 4XDEA 3RXJA 3RXRA 3UWIA 5C1XA 1V2PT 4VGCB 2AH4X 3EAJA 4Y11E 5EQRA 2ZDKA 1VGCB 2BDIA 4JZIA 3GDUA 3LDXH 1LHFH 3HK6B 4AGJA 2ZKSA 2V35A 1ZSKA 3VB7A 1GJ6A 3N7OA 1IQJA 4GSOA 1ZMLA 1WUNH 3M7QA 1O2TA 1O38A 1EP5A 2V3HH 3KQ5A 5EGMA 1BMMH 1E34B 2YOLA 4D7FA 4D76A 3RXDA 2J38A 1CO7E 2J4IA 1Z8IB 3GY6A 4HZHA 1ZMJA 2ZECA 1A5IA 1TGSZ 2R0KA 1XX9A 4E06H 2AIPA 2K7XA 2Z94A 1GL1A 2Q1JA 1G2MA 1O5EH 1TRMA 2H1UA 3LJOA 2W6ID 1DY8A 3SJOA 1YGCH 4IGDA 3M35A 2OC1A 2ALPA 2A4QA 2RG3A 3TH4H 3KL6A 3RU4E 1NBME 1TNHA 1YLNA 3PWBA 1MKWH 2C3SA 2QCYA 1QRZA 4RKJB 4X6NA 4BOHA 3SQEE 4JZDH 1GI7B 2FS9A 1AZ8A 1DICA 5EOKA 3O8RA 1LPKB 1O3LA 4ACAA 5LPRA 1WAYB 2JH0D 1JOUB 2QE7D 3MWIU 2D1JA 3FN8A 1MZDA 3EYDA 5K7RA 3C1KA 3A8DA 1QR3E 3FANA 1TRNA 2VH6A 3TK5A 3F2HA 3MU5A 3DSPA 1KXFA 3GCOA 1SGRE 3R3GB 2C8ZB 2G51A 3WWBA 3B23B 2H9HA 4YZUA 1QJ7B 2XBWA 1EB2A 4MNYA 3RXPA 3GY5A 3I78A 1CGHA 1V2TT 3GCHB 1XMNB 2ZC9H 2LP6A 3K9XB 3TK6A 1MTWA 2H6MA 2WPKS 3MOCA 2GX4A 1FY1A 1ANEA 1GBMA 3PRDA 1A0HB 4GAWA 2JJ1D 1F7ZA 1MD7A 1CA0B 2V3OH 1P2IA 3PRBA 4ASUD 2Z9JA 1W8BH 5E8EH 1KXEA 2LPRA 2BD9A 1GMCF 2OTVA 3ATWA 1ZPZA 4MPXA 1QZ8A 1RTFB 3WWFA 3AVZA 1LHGH 2FP7B 2ZPRA 4NA9H 1NFUA 3MNXA 3U98H 1XUIA 1RD3B 1O5GH
chains in the Genus database with same CATH topology
2AIQA 3ZZCA 2Z7FE 3NKKA 2FX4A 1W13U 2ASUB 1A61H 2ZU5A 1P57B 1IQLA 1GJCB 1C1VH 1AUTC 6GCHF 1CVWH 2Z9LA 3F9HA 4LK4A 2PGBB 3U1JB 5A2MH 2A32A 1QRXA 1UK3A 2BY5X 1GI3A 2XC0A 2A7CA 1NM6A 1TX8A 2ANMH 1GI8B 4LZ4B 3M3TA 2HRVA 1NRQH 4JCNA 1AGJA 3LC5A 3DD2H 3GCHC 1LVMA 1CHOG 2GZ7A 1GBHA 1UMAH 4YLUA 1EB1H 1QB9A 3PYHA 5DJ7A 4B74A 3MNSA 2JKHA 4KTUA 2XXLA 2FYQA 2ZFSA 5FX6A 4WY3A 1EQ9A 1WTGH 2GCHF 1EXFA 3D23A 1C5SA 1P06A 2ESTE 2FPZA 2SGEE 5F6MA 2HWLB 1FQ3A 5B6OA 1YPGH 2GP9B 1S6FA 4R0IA 1BMAA 2ZDNA 2VINA 4MNWA 4YTAA 4ZXYH 4CH2B 3A85A 6GCHG 1O32A 1YP9A 1QJ1B 3ZZ9A 1AKSA 3BG8A 1GBKA 2ANKH 1QNJA 2ZTXA 2UWPA 3E0PB 2ZHWH 4F49A 1TA2A 3DFLA 3LKWA 3O8DA 2PWXA 3KCGH 4XBBA 4TYDA 1TMUH 1EKBB 3BN9A 3SU6A 1S6HA 4CBNA 1V2RT 1O3BA 2ZGHA 1O2ZA 1FZZA 1Q2WA 3Q00A 1VZQH 5GWZA 4Q7ZA 4ZH8A 1RIWB 1SQTA 3MU0A 4KGAA 5F8ZA 3RU4D 3F1SB 3UNRA 2VH0A 1DUEA 1HXFH 2P16A 3K6YA 1IQHA 1J17T 1K22H 4JYUH 4BAHB 2VGCB 1F2SE 1GVLA 8GCHF 1ZMNA 1AE5A 2FOCA 2ZGBH 4TY6A 1LKAA 2Z3DA 1GCTC 2WPLS 3UR6A 1AWFH 1D3DB 1OP8A 5HXFA 4U32A 1DPOA 1O2RA 1ZR0A 3LIWA 2BX3A 2ZGXH 3ZVBA 4WMEA 1K1IA 1O5BB 2GV7A 1ELFA 1S82A 3LGIA 1Z6JH 2C93B 1AB9C 3A89A 5EQSA 1ELGA 1TYNA 3ODDA 4K8BA 3V7TA 3LOXA 2EI6A 2WPMS 2FEQH 2GVFA 4MLFB 4ISNA 8GCHG 1DWEH 2NU2E 1DLKB 1HFDA 4E7RG 1C2LA 1C5QA 3RC6A 1KSNA 3UIRA 4ABBA 1AFQC 2XBXA 2IJOB 3ZZ4A 1DOJA 1DY9A 3AAVA 3OU0A 2G00A 2QY0B 4CREA 1C2KA 2JETC 1AN1E 3OSYA 1XUKA 4FUDA 5I25A 5J4SA 4F4OC 1UCYE 2FOFA 4INHA 2OC0A 1SGFA 7LPRA 4ISOA 1ZRBA 1IQMA 3SNCA 2O8UA 2ZZUH 1Q3XA 3KQEA 4CRFA 3M36A 5FHTA 2HGTH 1NPMA 1O3PB 3UY9A 5GPIB 3SQHE 4MPVA 2OINA 2LIZA 1V2OT 3TU7H 2O8WA 5E0HA 2Y6TA 2BY6X 2BVRH 3WY8A 2QXHA 2TGPZ 1OWKA 2WINI 3TVJB 3FP6E 2ZPSA 3NZIA 1G9IE 1K9OE 1YBWA 3M5MA 2CHAB 1YF4A 1OWHA 1WCZA 1LHDH 5EW1H 1HIAB 3TITA 2YNBA 1A7SA 3E91A 1HUTH 3HKIB 3KIDU 4X8VH 2QXGA 2LNCA 3SGAE 3UWJH 1F92A 1Y3YA 2ANYA 1MZAA 3QTOH 2PGQB 2ZHFH 3TGIE 2HNTF 1C5YB 4KELA 2P59A 3GYMA 1BB0B 4IC6A 1WQVH 4BTTB 3TGJE 1BIOA 1F5RA 5EU8A 3MNCA 1J14A 1GI4A 1CSOE 3BTGE 1C5VA 3ENSB 2ZQ1A 4FU8A 1ZRKA 4TPIZ 4IS5A 1N6YA 3SV2H 4BNRA 3RDZA 3ATIA 3SW2B 3U9AH 2VIQA 1XVMA 4O3UA 1BJVA 3O8CA 1EJNA 1YC0A 2BZ6H 1VJAU 1SSXA 4I8KA 5DP9A 1O30A 4CRBA 1GI5A 1ZYOA 4ZKRU 3G01A 1DSTA 3U1IB 2W7SA 2DE8A 1S0RA 2SFAA 4K69A 4OS5A 2Z3CA 3ZVFA 3EDXB 3ZVGA 4E7NA 1GHAF 3UOUA 5FCKA 1H8IH 1Z8JB 2STAE 1BRAA 1T31A 4UDWH 3ZZ6A 2PLXA 1T8NA 1UO6A 3CS7A 1HIAA 3TIUA 1PQ5A 1G3BA 2XCFA 1C1PA 2FI3E 1G2LA 1YKTA 1S0QA 4U01A 3ZV9A 2NWNA 2ZTZA 3EA7A 1SHYA 2J2UA 4Y8YA 3PLBA 2W3KA 3PWCA 3QN7A 5H4IB 3PMJA 1MTSA 3LGVA 4CBOA 1BHXF 1O2SA 1Y5AT 5DP8A 5EW2H 4AYYB 3QZQA 5CHAC 2HALA 1VITF 5ESBA 1Y3VA 3A87A 1N8OB 4DIIH 1OWJA 1EATA 4LOYH 1AWHB 1KLIH 2FX6A 5JBCS 2ALVA 1O39A 2BX4A 1C5LH 1XXDA 1W7XH 3M7UA 1VCQA 2BOHB 4TPYA 1O5CB 3S9CA 3L6PA 1DXPA 3P8FA 1AB9B 3K6ZA 1ARBA 4WH6A 2H5DA 3BIVH 1OX1A 2RCEA 2BHGA 4E05H 1CGIE 1GMDG 1P03A 4X8UH 4R8TB 2EI8A 1YCPM 1MAXA 1YPHE 3VGCC 1OWEA 7GCHG 1GBDA 3A7YA 1B0EA 2O8TA 1E35B 2BD2A 5T3HA 2J9NA 3M37A 4OS2A 4JZFH 1UVOA 4I31A 3VEQB 4KP0A 1K1LA 4X2XA 3A7ZA 1CBWB 2TGDA 3M3VA 1D3QB 1S85A 1C1QA 1GHYH 1P02A 1FN6A 1IOEA 1MTNB 2BM2A 5DP6A 1K1PA 1HJAC 1O2OA 3RC4A 1GJDB 1NU9A 1HJ8A 1SVPA 2QYIA 2ZA5A 1PPEE 1QB1A 1IQFA 1O2HA 3GCTG 3QZRA 2FDAA 4J2YB 1VCPA 4AGKA 1BMLA 2SGQE 5K0HA 2OC8A 3RXEA 2BDYA 1ANDA 1OP2A 2TRMA 2XWAA 3QLPH 4Y10E 3OY6U 1MCVA 4CR9A 1TNLA 5HGGA 3SN8A 5DPAA 1QB6A 3SV7A 5FPSA 3L3TA 1WU1A 4OS7A 2XC4A 3HPTB 2C8WB 1TONA 4LZ1H 4DT7B 4M7GA 1SFQB 5PTPA 4FUCA 5I46H 3DT0H 2FOEA 2J34A 1O2UA 1AD8H 2CV3A 5C20A 2BD7A 1CHGA 1ANBA 2CGAA 3Q76A 1TNGA 2W26A 1GMCG 4RN6A 4ABHA 3EQ0H 3KN2A 2FI5E 3M5OA 2FO9A 2QIQA 1MD8A 3NUMA 1SB1H 1AVGH 4K1TA 3RXCA 4BANB 1UTKA 1EZQA 2G5VA 2BB4A 1QURH 3VB4A 2ZG0H 4MNXA 5DK1A 3M5LA 3BTWE 4TWWA 5GCHF 4MPWA 3T26A 3KHVA 3URDA 1HXEH 4NWKA 5CE1A 4I8LA 1C1UH 4TY7A 1Z1JA 3D62A 1EZXC 3HGNA 5A8YA 7KMEH 5EPYA 1EZSC 1XXFA 3H7OA 2BY9X 3PV4A 5J4QA 1ZZZA 1JIRA 2A4OA 3VGCB 2R3YA 2Z9IA 1SQAA 2IPHA 1BT7A 1TX6A 1D4PB 4AG2A 2FOMB 4B75A 2BYAX 1IQIA 1UVUH 2BDGA 1ZGIA 4XFQA 4CRGA 1TX7A 1BTXA 1QTFA 2P93A 1BOQA 2TPIZ 4ABFA 2Y7ZA 4NIYA 3ZZDA 2VWOA 1ORFA 2ZGCA 3A82A 3P17H 1K1OA 1C5NH 4QT8C 1TPOA 1Z1IA 1UTQA 3BEFB 4LXBH 4BXSA 4I8HA 1OWDA 1DWDH 1TABE 5C1YA 3FVFB 4Y8XA 4X6PA 2VIOA 3U8RH 3EE0B 3KNXA 4WVPE 1GBCA 2VVUA 3GDVA 4CR5A 2NU0E 1BTZA 1PPZA 2FZZA 3E16B 4CRDA 1T8MA 1DT2A 2VB0A 3LGUA 4BAKB 1TB6H 1C9PA 1FY4A 1H8DH 1UHBB 3T62A 3NXPA 2NU1E 4WH8A 2AFQB 4YM9A 5GDSH 5JB9S 2SNWA 1MCTA 1KXCA 1QA0A 3LC3A 4YT6H 5ETXA 2I6SA 1TPAE 3QTVH 1KTSB 1KXDA 4NIVA 2CHAC 1UVPA 3RXBA 1O37A 3TH3H 2BLWA 1ELAA 1DUAA 1LPZB 3AASA 1D6RA 5BRRE 1QBVH 5CMXH 1G32B 3ZYEA 1NZQH 1QL7A 1QHRB 1SGCA 1HAVA 4OGYA 2DUCA 3MI4A 5JYIA 3RXMA 1J15A 1K1JA 3S69A 1P9UA 3MU4A 3RXQA 1C5ZB 5FXLA 2WPHS 4WF8A 2A7JA 1O2KA 4HGCA 1TOCB 1EX3A 1HRTH 1OOKB 2Z6BD 1MKXK 1J8AA 1ETTH 4MQAA 4Z6AH 2P8OC 2G8TA 1FUJA 3RP2A 1MMJN 2CXVA 1ZJDA 1FONA 1VGCC 1O3FA 3UUZA 2Y5FA 1O3AA 3F9FA 2Y82A 1Z6EA 1NFYA 1FN8A 1INCA 5JBBS 1O3KA 3SJ9A 3MFJA 2GCHG 2AGIX 3W95A 2CF8H 2PKSC 3VPKA 4RKOB 1O2GH 1TNIA 1GJ4H 1K21H 1SGIB 1ZJKA 1TGBA 3UQOA 4BXWA 1SG8B 3K2UA 3TJVA 2VU8E 5FCRA 4AFQA 2OLGA 1JWTA 1RFNA 1TRYA 2A5KA 1PYTC 3ATLA 2ZDVH 4GCHG 3F6UH 1HLTH 5A09A 2BXUH 2OUAA 3GCNA 8KME2 4FUEA 4D8NA 1Z7KA 1G36A 4Y71A 1IQEA 1LQDB 1SBWA 3VB3A 3MO6A 3Q3XA 1Y3UA 2HOBA 1GVZA 1OWIA 2AMQA 3EBNA 2DE9A 2BD5A 1BTYA 5E0GA 3SU1A 1SI5H 2K1QA 1SGPE 2VVCA 4X8SH 1O3EA 4B2BA 2ODQA 1UK2A 3I29A 2P94A 1KY9A 2D26C 1IHSH 3LH1A 3HKJB 2ZCLP 1OXGA 4A1XA 1DITH 2GMTB 3M3SA 2GD4B 1HAXB 1P3CA 5DGJA 1GBAA 3EA8A 2ZGJA 3JZ1B 8LPRA 2G4TA 4NA7A 3UNSA 2XRCA 1C2HA 2ANWA 1LMWB 1YPKH 4OS4A 1AVXA 2BDAA 4DVAU 5GJ4B 4JK5A 5T6FA 5ABWA 1GGDB 2ODYB 3GY7A 1FIZA 4SGBE 4I7YH 1ZTLA 1BBRK 3BEUA 3A7TA 2O8MA 2VWMA 1A46H 1EJAA 3FP7E 4Q7XA 8ESTE 5EODA 1C4V2 2QC2A 1E38B 1P01A 6CHAB 3SUDA 1C2GA 4OS6A 3RMOH 1MKXH 5DKMA 5FBEA 3SGQE 2BQWB 2XBVA 4D9RA 1ETSH 1EAWA 1GHBG 1LQEA 2SNVA 1KYNA 2HPQH 3LH3A 5FPTA 5FX5A 2UWOA 1P2JA 1OSSA 2ZP0H 1Y8TA 2OC7A 2W5EA 1GJ8B 1LHEH 1LVOA 2W7UA 3S7HB 1T8LA 2WYJA 2Z3EA 1F5KU 4ZXXH 4K1EA 1ZHRA 5A8XA 4Q7YA 1TFXA 3DFJA 1HV7A 7ESTE 1G30B 2WUCA 2C8XB 3P92A 1W11U 1K2I1 3MU8A 1ZSJA 1O2NA 1Z8GA 1HAHH 1PPCE 2VIVA 3A84A 1DWCH 1O3OA 5EQQA 2ZQ2A 3SV9A 1UVSH 1TE0A 3PTNA 2PTCE 1ZSLA 4KTSA 4BTIB 2BDBA 1QCPA 1THSH 5EPNA 3CP7A 5FPYA 3E6PH 5TCCA 3GY4A 5AFYH 1L1NA 3T25A 3TGKE 3SU2A 1F0TA 1MU8B 6ESTA 1GL0E 1EAXA 3LGTA 2F9BH 1HJAB 3U8OH 1BTUA 1TIOA 2OBQA 4MDSA 4DCDA 5EG4A 1E36B 1DM4B 5JPMH 1PQ8A 4ZMAH 1GBFA 1Q31A 1SGTA 1HNEE 1L4DA 2QGRA 4Y8ZA 4WWYA 1TGTA 1GJBB 2FOHA 2QF0A 3GOVB 3MO3A 4AFZA 5L2YH 1MQ6A 1C1NA 3PM3A 5ESTE 3UTUH 4UD9H 1RRKA 3BTDE 5AHGH 4H6TA 3SHCH 3PTBA 3R0FA 1JRSA 5JDUB 3BTTE 1UK4A 1TOMH 1L0ZA 3W94A 3GICB 1Y5UT 1AUJA 5EXLA 4ISIH 3RXAA 1C2MA 3ZZ3A 2FLRH 4IN2A 1GGDC 4I33A 3UQVA 1K1NA 1O3NA 1WV7H 4WMDA 2P3TB 3CS0A 3H5CB 2UUYA 3IG6B 1OKXA 1CHOF 1DSUA 1E0FD 2F9NA 1O36A 1GG6B 2SGAA 3ESTA 3RXTA 1UTJA 1QL9A 2VIPA 2UUJB 4K60A 3UREA 2Z9KA 1BBRH 4NGAH 5DP4A 1ZLRA 4O97A 1VITG 2SGDE 4GLYA 3SNEA 2OCVB 2IOTA 5SGAE 1C5OH 2D2DA 1FJSA 4AFSA 1GBTA 2VIWA 3RM0H 1O5FH 2HPPH 2UUKB 3LGWA 2A5AA 1CGJE 4A7IB 1ABJH 1HAPH 1P04A 1LHCH 3SZNA 1QGFA 1H1BA 3STIA 3TNTA 1ABIH 1QL8A 1Y3WA 5AFZH 2QV1A 5HM2A 4CRCA 4MG3A 1ELVA 1HDTH 2VIDA 3RMNH 3PO1B 1C2DA 1F0SA 1M9UA 3BIUH 1L4ZA 1O3IA 1TAWA 1T4UH 1GI6A 3RLYH 4A1VA 1C2IA 4FUFA 2J94A 1NRPH 1HAOH 5C67A 1TGCA 4ZAEA 1C1SA 1HAVB 1W10U 2ZFRH 2BD4A 1FPCH 1SOZA 1FY8E 2BDCA 3BEIB 1FIWA 2GTBA 2BQ7B 1H9LB 1GBIA 4XE4A 2VWNA 1MTUA 2PKSB 1NC6A 2FIRH 1JMOH 3BF6H 1GVKB 1O2QA 2PSXA 1AY6H 3M7TA 2WV4A 3JZ2B 1ANCA 3KQBA 3RXSA 3LONA 2A2QH 4DW2U 3AAUA 1ZPBA 3NWUA 4ABJA 2HNTE 5C2ZA 3K65B 3BTFE 1BTWA 2BOKA 2VNTA 1PYTD 1GCDA 2FOAA 1QQ4A 2P8OB 2TIOA 1QIXB 1AIXH 5T6DA 4GPGA 3RXOA 1C5XB 3A7VA 4DIHH 3T2NA 1V2NT 1ELEE 3SO3A 3ODFA 4B73A 3SU5A 2A4RA 4FU9A 2XTTB 3A83A 3F9EA 1TPSA 2F9OA 1RS0A 1NU7B 3SU3A