2ZU5A

Complex structure of sars-cov 3cl protease with tg-0205486
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title Structural Basis of Inhibition Specificities of 3C and 3C-like Proteases by Zinc-coordinating and Peptidomimetic Compounds
pubmed doi rcsb
source organism Sars coronavirus
total genus 87
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2zu5A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zu5A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zu5A02
2ZDMA 4O9VA 2AIQA 4ZMAH 4HI3A 1FPCH 1TGCA 2FYRA 4K8BA 2GV6A 3QX5H 4R0IA 1ZSKA 3SV8A 1TOMH 1CT4E 1HV7A 2GMTB 1CE5A 2OCVB 3K6YA 2BY7X 1SI5H 1PFXC 1HAVA 2B9LA 3D65E 3A7YA 1GMHF 2GZ9A 1SGPE 3PO1C 2ZQ1A 3SU2A 1GJ7B 3RP2A 1CA0B 5FXLA 4Q80A 4CRCA 1C2IA 4Q7YA 1BTZA 2XNIA 3IWMA 1TA2A 4XBDA 4FUGA 1S6HA 1C2MA 4JZIA 2ANKH 3U8TH 1DPOA 2TPIZ 1BJUA 1JWTA 2ZECA 3BTGE 3F68H 2SGDE 3RXOA 2HPQH 1KY9A 1NO9H 1ELAA 1TYNA 2AS9A 1C5VA 2XW9A 5E0GA 1QCPA 1TNHA 1TNIA 4Y11E 3SUGA 3ELAH 1AE5A 4CBNA 3TGJE 2A7HA 3KF2A 1ABJH 2ZEBA 3QWCH 4CRGA 2AEIH 5I46H 4WMDA 1WCZA 2VWLA 1D3DB 6GCHF 1LQEA 3HK6B 1FY4A 1QJ1B 4KTUA 3LC5A 5T3HA 3KQCA 4ABEA 4GCHG 1HIAB 1FIWA 1TRYA 1ZPZA 3RXPA 1SR5C 4CR5A 2B8OH 1K1IA 2FDAA 1U6QA 2GV7A 2ESTE 4YLUA 5BRRE 2JETC 4H4FA 3TJOA 2O8LA 2Z6BD 1HAPH 4KELA 4AFSA 2B7DH 1GJ8B 4NFEA 3TNTA 1GGDB 1FPHH 4JYVH 1SQTA 2BD9A 1P2KA 5DP6A 2B5TB 4IMQA 1SLXB 3SNCA 1YPEH 1B0EA 1ZRBA 1QL8A 1CBWC 1TNJA 1AVGH 1HAZB 3NCLA 3FP7E 3PO1B 1O3DA 1P3EA 2VWNA 2Y80A 5GCHG 2G51A 3K6ZA 2WPJS 4IGDA 2O8WA 3NK8A 1INCA 2FZZA 1UCYH 1YLCA 3MU5A 1GHVH 4YTAA 1W7XH 3SU6A 5A8XA 5JB8S 3SU3A 1V2MT 4JZFH 2UUJB 1OS8A 1K22H 1RXPA 2V35A 3I29A 2P8OC 1C2KA 4U2WA 1HAGE 1E36B 5EW1H 2A2QH 1UVUH 4B1TA 4YESB 1HYLA 1NRPH 3S9BA 1TGSZ 1TMTH 4YZUA 4FU7A 2BVRH 3OYPA 1F7ZA 4WH6A 2BLVA 1VR1H 1HXFH 2QGRA 1VITF 3BN9A 5DP7A 2GT8A 1BBRK 3URCA 4O03A 2D8WA 3KIDU 3UREA 1IQHA 1MKXK 2ZDKA 2Y6TA 1GHBG 1BUIA 2PSYA 1F92A 4FVBA 2BY8X 3M5NA 3U98H 1EAUA 3F6UH 3TLOA 1P04A 3ZYDA 4NWLA 1TMBH 5EXNA 3TVJB 1DUEA 1S0QA 1GBLA 1O39A 1O2VA 1BQYA 1O5CB 1A7SA 4ZKRU 1DS2E 2QIQA 2GCHG 1F2SE 3F9HA 2QCYA 5C5NA 2JETB 1TPPA 4WF8A 2XBXA 4AB8A 5EODA 5FPYA 1SL3A 3QGJA 1CQQA 8GCHF 1WOFA 3SU0A 3MH4A 2BX3A 1NFYA 2Z3CA 3TJUA 1ELEE 1ANCA 4UE7H 1W14U 4MNVA 3BG4B 1P2NA 4IW4E 1ELVA 3AAVA 2HVXA 2NU4E 1MU6B 2BVSH 2BVXH 4PROA 4CH8B 7ESTE 1CBWB 2F9PA 2HNTC 3UOUA 1CHGA 2WINI 1AVWA 4FU9A 2WV5A 1OWJA 3BF6H 1WUNH 1KLTA 1VCQA 5TCCA 3MH6A 3MNBA 5LPRA 2ZPSA 1GI6A 1Z6EA 2QA9E 4NA7A 1MKWK 2P59A 2Q1JA 1Y5UT 3TPIZ 1FY8E 1XUHA 2WPLS 5L30H 1L1JA 1M9UA 4ABDA 2ZHFH 3MU0A 2FOBA 3LGVA 2SNVA 3VB4A 1H9LB 2P8OB 2O9QA 3QTVH 4ZKSU 2GVFA 3HGNA 3ZVCA 4Y8YA 4Y0YE 3BIUH 2ASUB 2FOHA 4AB9A 1AN1E 3SO3A 2XWBI 3BEIB 3TK9A 1UVPA 1H9IE 3STJA 4AFZA 2A5KA 2XXLA 3ZV8A 5EW2H 1SFQB 2FMJA 4Y71A 1FZZA 1SGRE 2V0BA 1BRCE 2HRVA 4MQAA 1Y5AT 1BB0B 1B5GH 3OX7U 1J15A 5F8ZA 3UR9A 2PKAB 3RXDA 2A1DB 4ABJA 3V12A 1C2DA 2Z9LA 2WUCA 1E37B 4X2YA 4AN7A 3BTQE 3SI3H 3ZVDA 3UNSA 1IQJA 4ZROA 1S84A 1RS0A 4JZEH 4F49A 1ETRH 3DFLA 1GJ5H 9LPRA 1C2GA 4AFQA 1EJAA 2A31A 1ZTKA 1T32A 3GYMA 1EAXA 1EB1H 1EB2A 5DO4H 2W3KA 4D76A 3P70B 2BZAA 1V2TT 3ATLA 1BBRE 2V3HH 2AERH 2QYIA 3CENA 3UWIA 4WMFA 1A5IA 1MBMA 3G01A 1FNIA 1C2FA 4ABFA 3PMHB 3U9AH 1W0ZU 2NU2E 1Z1IA 3L6PA 3MNSA 1YPJH 3BTHE 5J4QA 1T8OA 5C5OA 1IOEA 3RXQA 1MQ6A 2BY9X 1PQAA 2VH6A 1E38B 2ZZUH 2FI5E 1TAWA 1ANEA 1A46H 4I8KA 4X1NU 2TIOA 1QBOA 1UTNA 2I6SA 5JBTA 1SB1H 2OC0A 6LPRA 2OP9A 1SPJA 1UTMA 1UMAH 1A61H 3P8GA 5H4IB 2UUYA 1GBEA 1HRTH 2A4RA 1TX8A 3E8LA 1O2RA 2CV3A 3KQDA 3SQEE 3GCTF 3GDUA 1A0HB 1P2QA 4Q7XA 1Z8RA 2OXSA 4FUFA 1ANDA 1T8MA 1SGDE 2FXRA 1FLEE 3R0FA 3U8RH 1HB0B 5A0AE 4D8NA 3RU4E 3NWUA 4FXGH 2BXTH 4ZUHA 3U8OH 1D3PB 1P57B 3RMOH 1SSXA 3QLPH 2FX4A 1FDPA 5GDSH 4ZHAA 1ARBA 4X8TH 1JRSA 1CT0E 3I77A 1FN6A 3K2UA 1XKAC 3S69A 2AFQB 1IQIA 3Q3KA 2J95A 3E16B 2DE8A 5F6MA 3DFJA 2IJOB 1NFWA 1O2TA 1YCPK 1SGNE 1ZTLA 1C4Y2 2H9TH 2VVCA 1DSTA 3GY8A 1FIZA 3GY6A 1MTWA 1V2QT 1L2EA 1YPHE 1S85A 1BRAA 3SGAE 2OLGA 5ABWA 1WSSH 3RM0H 2VIVA 4B2AA 1G2MA 1O0DH 4X0WU 1HAIH 1OOKB 3PTBA 1BZXE 2GGVB 3ZZBA 2HWLB 2CMYA 3F9EA 1VJ9U 1PQ5A 3LGUA 3SGQE 1THPB 3VXEH 2I6QA 3SJOA 2EA3A 1NTPA 5DJ7A 3RXUA 4NZLA 4KKDA 1N6XA 1T31A 1TBQH 4K1TA 3EGKH 1LPZB 5JBCS 3VB3A 3ZZ5A 1A3EH 1GHXH 1P9SA 1TALA 4AYYB 2ODPA 1PJPA 4B76A 1J14A 5A09A 4HGCA 2H2ZA 1YC0A 8KME2 4XFQA 1LVYA 2WPIS 3KCGH 1SC8U 1DM4B 3RXLA 1Z71A 1W10U 2A4OA 4I8JA 5JPMH 3Q3YA 2ANWA 2GZ7A 1GMDG 3LH3A 3SHCH 4FUEA 4JMYA 2V6NA 4MNWA 2TBSA 1MU8B 2J2UA 3MO3A 3SOSA 4ABAA 1SLUB 3ZVAA 1O34A 2FEQH 1P3CA 3RXBA 2ZPRA 3A81A 3PYHA 2ZU2A 4ZXXH 1P06A 4JZDH 4AGJA 1NY22 1BMMH 1K1LA 3RXIA 3FAOA 1TX7A 4MNYA 3RMLH 1RD3B 2LPRA 1SGYE 2NWNA 3SUDA 1KDQA 4ZH8A 2FIRH 1O2QA 3IG6B 3SUEA 2FLBH 3LC3A 5E0JA 1SHYA 5DP4A 3UPEA 3QZQA 3A8BA 2JH5D 2RG3A 3SU1A 4IS5A 1RTFB 3L3TA 1Z6JH 1E34B 1DWDH 2J34A 4ZKOU 3FANA 4DIHH 5ETXA 1C4V2 2C93B 3SN8A 4MLFB 2R3UA 1C5ZB 1O37A 3P92A 1C5NH 3VGCC 1MCTA 2GZ8A 1DANH 1GI1A 2ZDAH 2BDCA 3LH1A 1EAWA 3KQBA 1ZHRA 4ABIA 5C2ZA 4IC6A 1SQAA 1G3CA 1O2GH 1T8NA 3RXEA 5CMXH 4VGCC 3MI4A 7LPRA 3ZV9A 3PLPA 2FOMB 2A5IA 1B7XB 1OWEA 3KQEA 1DX5M 1P0SH 3I78A 3A89A 1GBMA 2VU8E 1AB9C 3ITIA 8LPRA 1BA8B 4YM9A 3TNSA 2PSXA 1S6FA 3UIRA 1ELDE 4CRBA 3LT3A 1JOUB 4FUDA 2A32A 2C90B 1O2KA 3BTME 4OS1A 2AMQA 4Y10E 4UONA 2TGAA 2Z9KA 4UFEH 4I8HA 4INHA 1D4PB 1LVBA 2KAIB 4MNXA 3A8AA 1TE0A 1ZPCA 1AUTC 2NU0E 1GDQA 5DP3A 5EQSA 1L1NA 1K1NA 1H4WA 1SOZA 4MPVA 5T6DA 1ACBE 4IN1A 2ANMH 2ZDLA 3PB1E 1V2NT 3GY4A 4RKOB 4X8UH 1K21H 1OX1A 1F5LA 1PQ7A 1O3PB 1NROH 5C20A 5FBEA 2AYWA 2Z9GA 3RDZA 1ZJKA 1TOCB 5TJXA 2FX6A 4X6NA 1LHDH 2PUXB 1QB1A 4YLQH 3TH2H 1TRMA 3M5OA 3UQOA 3AASA 4BANB 2G4TA 3LONA 2FS8A 4Y76A 3SV7A 1ELGA 3BV9B 1FXYA 3OU0A 2Q6GA 1C5UA 1EASA 1JMOH 1QRZA 1TB6H 2ZP0H 1LMWB 1V2RT 5C1YA 4UFFH 4MVNA 1EJMA 5HYOA 4INKA 4HZHA 1T4VH 3A80A 3SNDA 3BTWE 4BTUB 5A0BA 2FS9A 2C8YB 3KHVA 4WXIA 1XMNB 4BOHA 4NZQA 1HBTH 2VVVA 2NU1E 1N1LA 1PPZA 3SJIA 4FUHA 1JXPA 1A5GH 3MYWA 1AD8H 2QXGA 1SHHB 1OSSA 2H6MA 2WPHS 2ZGXH 1Q3XA 1MD8A 3BIVH 1O3HA 3VGCB 1WQVH 3HKJB 3EA9A 3OY6U 3Q3XA 1P03A 2C8WB 1ORFA 1AVXA 1D9IA 4WXVA 1LVOA 1PPHE 2H9EH 1MMJN 4NWKA 5DGJA 1O2JA 2H5CA 1C5XB 2XBVA 1S82A 2G5VA 4KGAA 1H1BA 1K2I1 1GBBA 1A0JA 3A7XA 2UUFB 3A88A 1BCUH 2AH4X 3V0XA 1A5HA 1QA0A 3K65B 1GI2A 1GL0E 3N7OA 1AQ7A 1UHBA 2ZNKH 3QTOH 5JBBS 1GVZA 1AB9B 5A8YA 2PV9B 1V2PT 4BAHB 1CHOG 2PTCE 2DE9A 1L4DA 4JYUH 2Z3DA 2PGBB 2A0QB 4DCDA 4D9QA 4R8TB 1K9OE 2JKHA 2PW8H 3GICB 2OBOA 2BDAA 3M3SA 3LKWA 3M7UA 1DY8A 2ZFTA 2D26C 2WV4A 2CF8H 1GCTC 1XUIA 2G81E 1L1GA 2BY6X 3LJOA 4GUXA 2R0KA 3M5LA 3QGNB 1AHTH 3A7VA 4K5ZA 4UEHH 4Y0ZE 1TNLA 2BOHB 4B2BA 1C1WH 4AFUA 4MG3A 1O5DH 5F03A 1KTSB 2BDGA 5IYTA 1QQ4A 3MO9A 2C8XB 1J16A 1IAUA 1RGQA 1GHAF 4FUJA 1C5WB 2VVUA 4DIIH 5E0HA 2YNBA 1WTGH 1NRQH 4A1VA 3ZZCA 5BPEA 1Z1JA 5FCKA 4GSOA 2PUQH 3C1KA 4SGBE 3T62A 2ZTYA 3BTFE 1O2MA 4O3UA 1BIOA 3SI4H 5L2YH 2FPZA 2UWLA 1YKTA 2CXVA 3SV6A 1D6RA 2TRMA 4AG1A 3M3VA 1O5BB 1ETTH 2IOTA 1IQMA 1DY9A 3ZZ4A 1FY1A 2THFB 3SNAA 4LZ1H 4NSYA 1C2EA 4LZ4B 1QL9A 6CHAC 5L6NH 2Z7FE 1C9TA 1ZZZA 3UOPA 3RU4T 3MO6A 2Y7XA 1GI7B 1GDUA 3PM3A 4ESTE 3RMNH 1O2UA 1C5MD 1S5SA 4FU8A 1L4ZA 5DP5A 3RXVA 1UTPA 1V3XA 4Q7ZA 1O3OA 1QRXA 5EGMA 1GJDB 3BTDE 2R9PA 1LVMA 1O2IA 3PMJA 1NS3A 1PPCE 1O3GA 1G30B 1P11E 2VIDA 5ESBA 1C1MA 1Y59T 4DT7B 2P95A 1EPTC 1BJVA 4AORA 3NXPA 2P94A 4J1YA 1O3EA 1N6YA 1G3EA 1UTJA 1O5AB 1IQLA 1C5SA 1SGCA 5A0CA 2OINA 2NU3E 3RXAA 1JRTA 1NRSH 1GMCG 1DE7H 1DITH 2FI3E 3JZ1B 1O30A 4ISOA 2R2WU 3RXTA 5GWZA 5F8TA 4YT6H 2BDYA 1MTSA 1O33A 3ZZ3A 1TRNA 1HIAA 1JIRA 1ZPBA 2BB4A 2W7SA 2A4GA 3ZVBA 3MU4A 4K60A 7GCHG 2VIWA 3TITA 2A7JA 3FZZA 1W8BH 2SFAA 2BDHA 1Y5BT 5EQRA 4CRAA 1D6WA 1O2SA 1O3BA 1OWKA 1KTTB 2ODQA 2VINA 2QY0B 2W5EA 1QJ7B 4IC5A 4TY7A 1FN8A 3SNBA 3RLYH 2ZFQH 1D3QB 1DVAH 4KP0A 2PKSC 1V2LT 1KXDA 1Z7KA 1SGFA 4BAOB 4X1PU 3P6ZB 1L0ZA 1A0LA 4TPIZ 4DW2U 3V3MA 3QK1A 1SMFE 1GBDA 2VB0A 3GDSA 1QIXB 2BD3A 2CJIA 3LGTA 1F0RA 2ZCKP 4ZHLU 5HM9A 4H6TA 1TQ0B 4ABHA 1EX3A 1KXAA 5A2MH 2GT7A 2ZGCA 6CHAB 3MH7A 1FAKH 2OUAA 4ASHA 2WYJA 3LDXH 1KXFA 4NG9H 5HM2A 1K1JA 1G37A 2CF9H 1JIMA 3FFGA 1GBTA 1UTQA 5AHGH 2GX4A 5B6OA 4QT8C 4WY3A 2FOGA 1V6DA 1C9PA 2GDDA 1WU1A 1F0UA 1FI8A 2ZPQA 1LCYA 2GP9B 1N8OC 3H7OA 2XRCA 3E0NB 4TWWA 2CN0H 1ESBA 1QBVH 2W3IA 1OP2A 3H7TA 4K1EA 4YOIA 1HNEE 1GJCB 1EPTB 1AKSB 1UJ1A 2ZCLP 4Y8XA 1GI3A 2Y5FA 1OYTH 3P8FA 1GJ9B 1Y3WA 1QFKH 1HAXB 8ESTE 1NC6A 3EDXB 1TONA 2PTNA 4DJZB 2A7CA 3WY8A 3FZDA 1RIWC 4GCHF 2YNAA 3UNQA 2PGQB 2P3FH 3SV9A 2Q6DA 3E91A 2FOAA 5JYIA 1XUGA 1HUTH 1GCDA 1G2LA 1SLWB 1SGQE 1C5QA 3URDA 1V2WT 2ZKSA 2ZC9H 4CHAC 2VIQA 5EOKA 1GBIA 1ZHMA 1C2HA 3AVZA 3S7KB 2RCEA 4CRFA 5JB9S 1DXWA 2ZU3A 2OQ5A 2XC5A 4UFDH 1OXGA 1O5GH 4E7RG 1MTNC 1TA6A 2GTBA 1WYKA 3CS0A 2YOLA 3SV2H 2FTLE 1OYQA 3ZZ6A 2ZWLH 4OGXA 1BDAA 2PKSB 1HLTH 3T2NA 1F5KU 3EQ0H 1XX9A 3VFEA 3VEQB 2HNTF 4IMZA 4BAQB 2EC9H 5HGGA 1MAXA 3L33A 3M61U 2UWOA 1THRH 7KMEH 5GCHF 4GPGA 2H9HA 1O36A 3TU7H 4YT7H 1UTKA 1YYY1 3UY9A 2ODYB 1NRNH 1HJAC 1P2JA 1UCYK 5FAHA 1CVWH 1EATA 2JH0D 1B0FA 3RXKA 2CHAC 4Z6AH 3KNXA 4Y79A 3ZVGA 4X1RU 5F8XA 3ZZ8A 2FLRH 4E05H 4GLYA 2F83A 4BXSA 1O2HA 2O8MA 4JK6A 1EOLA 2BD2A 4DGJA 2PFEA 4TPYA 2P16A 1O32A 1O3MA 1EZQA 2PLXA 5EXLA 2W7UA 1N8OB 1FQ3A 2BLWA 3O8DA 1PPGE 1GMHG 4RN6A 1Y3YA 5HMAA 1HJ8A 1GHBF 3PLKA 1T7CA 3ATIA 2ZU4A 2OTVA 5C1XA 5LGOA 4NFFA 3EYDA 3HGPA 5GPIB 2PKAA 1H9HE 3M37A 3DD2H 1RIWB 1QA7A 1TFXA 5EQQA 1LDTT 4UDWH 1GI4A 1F5RA 1ABIH 3CP7A 1LHFH 2GCHF 5CHAC 1C1QA 1O35A 2QN5T 1TABE 4X2WA 2BDIA 4ISIH 4CHAB 5PTPA 1C1VH 3GY3A 2SGEE 3KEEA 4DOQA 2XCNA 3GOVB 1V2JT 3LGIA 5IDKA 1C5PA 3EBNA 1O2PA 3QDZB 1EP6A 3S9CA 2O8TA 4NCYA 3P8NA 4FUBA 3MNXA 1C1PA 2QXJA 4U32A 1O2LA 5A8ZA 3TJVA 6GCHG 4OS5A 2ZF0H 3PLBA 1UTLM 1Y3VA 1O2WA 3U1JB 2HNTE 1GG6C 3M5MA 1GHYH 1OWHA 1P02A 4JZ1A 1NFXA 4WVPE 2J4IA 1TGBA 1FV9A 3RXMA 4D7GA 1MD7A 5DG6A 1DT2A 1HJAB 1HXEH 2QC2A 3S7HB 2RA3A 2FTMA 3RXCA 2B0FA 2BY5X 1DWCH 2CHAB 4WMEA 1ZJDA 2VWOA 1ZR0A 3A8CA 3C27B 4XOJA 1AZZA 2ZO3H 1O5FH 1GI8B 1C5LH 3W95A 2Z3EA 2XCFA 1QL7A 1KXCA 1NM6A 1RRKA 2F3CE 1O2YA 3E90B 1HAVB 1LTOA 3GY7A 3MH5A 5DKMA 1C1OA 1CGHA 1EKBB 4I31A 1Z8GA 2F9VA 1CGJE 3UWJH 3A87A 2RA0A 4NIWA 3QZRA 4OS4A 2GMTC 1O3CA 2J94A 1DICA 3S0NA 2VIOA 1BT7A 1TQ7B 1W7GH 2FO9A 2ZFSA 3MU1A 1DXPA 2QXIA 1ELFA 1OP0A 2SNWA 1QB6A 4WJG2 4MPXA 3TIUA 1UCYE 2ZTZA 1ZMNA 4BTTB 4JYTA 1TGTA 3RXGA 1MAYA 3M36A 2WUBA 2FM2A 1MTUA 4X8SH 4A92A 1MH0A 3ODFA 4MPWA 5CHAB 1LPGB 1PPFE 2ZHQH 1EAIA 1AZ8A 2G52A 3KL6A 4J2YB 1C2LA 1LQDB 1E35B 2PHBA 3D49H 1HAOH 1BBRH 2ZI2H 2VGCC 4YOJA 1NU7B 1VITG 1LKAA 1MKXH 4LOYH 1AO5A 4K2YA 2FP7B 3LGYA 2A2XH 1UK3A 1O3NA 3A86A 2WYGA 2J9NA 3M3TA 1C2JA 2BYAX 4A1XA 3Q77A 2OC8A 1ELBA 5GJ4B 2G4UA 2ZGJA 3TGKE 2VJ1A 4B71A 1EUFA 1GI0A 1O3AA 6ESTA 1ELCA 1TWXB 1GG6B 1NN6A 3AAUA 4YO9A 1C1TA 2Z9JA 1KXEA 2ZHWH 3ZZ7A 4U30A 4TYDA 1Y8TA 3KN2A 2ZQ2A 3OTJE 2W26A 5J4SA 2AGEX 2BLQA 3VB5A 1O3KA 4DURA 3SU4A 3DA9B 2ZA5A 3Q00A 1HPGA 4I8LA 5AF9H 3Q76A 3LIWA 3RXJA 4H6SB 2XTTB 4K3JA 1MUEB 1ESTA 1QY6A 3MWIU 1K28D 1ID5H 1GI5A 4GAWA 1DLEA 4XBCA 4OGYA 2BOKA 2ZGHA 3QN7A 1CSOE 1GGDC 2DUCA 3A7ZA 2VIPA 2SGQE 1KYNA 4XE4A 1Q31A 2VNTA 5DK1A 2P93A 2TGDA 2QV1A 1AI8H 5LH8A 3HK3B 1AFEH 1QNJA 1O5EH 4ISLA 1MKWH 4ISNA 1AMHA 1EQ9A 1SGEE 1K1PA 1TBZH 2OC1A 3FP8E 2ZTXA 1AY6H 1EZSC 2C4FH 5C1UA 2ZGBH 1A1RA 1H8IH 1MCVA 3BEFB 3EA8A 2ZDNA 2BTCE 2QF0A 3ZZ9A 3PMBB 3ATWA 2XBWA 1HGTH 1GVKB 1C5TA 3NZIA 1XXDA 1C5RA 4DY7B 1BTWA 1HAHH 2SGFE 2VGCB 1GBCA 1ANBA 4VGCB 1OWIA 1GI9B 4CREA 4FUIA 1C1RA 4A5TS 4I33A 3MFJA 1IQEA 4UFGH 3ATMA 4GHTA 2BX4A 4AX9H 3M7QA 2F9OA 1SBWA 2QF3A 3E0PB 5CE1A 1DDJA 3AW0A 4X8VH 1PPBH 2SGAA 2XC4A 3RC6A 1P2IA 3F9GA 1GL1A 2ZU1A 3GCOA 1FONA 1WBGB 3SJ9A 1ZMJA 4MTBA 1V2OT 2BXUH 5E2OA 4I32A 1AWHB 1O2OA 3H5CB 1QBNA 3SU5A 2OBQA 5L2ZH 3UQVA 1C5YB 2ZFPH 1DLKB 2AIPA 1OKXA 2ZHEH 5FPTA 1GMDF 3JZ2B 1UVTH 3GCNA 3MOCA 4K1SA 1GBJA 1C1SA 4OS6A 2G5NA 3RU4D 3RXFA 3ZVEA 3E3TA 4XSKU 1LKBA 2F91A 1G36A 2KAIA 1SQOA 1QJ6B 1OWDA 2LIZA 2Z94A 1JBUH 1K1OA 1KXBA 3TK5A 2HGTH 4ISHH 3A82A 1UK4A 3SJ8A 2FOEA 3DHKH 4BNRA 5EU8A 3EA7A 1BMNH 3BG4C 3STIA 1CGIE 2TGTA 3LU9B 1XXFA 2BLOA 1DFPA 3O8BA 1NESE 4NA8A 5JBAS 4FUCA 2A45B 1ETSH 1O2ZA 1CA8B 1G32B 4NIVA 2WPKS 1BMAA 1C5OH 3S9AA 1PQ8A 2AMDA 1BTHH 2BMGB 1P05A 3TGIE 1XKBC 1YP9A 3PWCA 1W11U 1GPZA 2G00A 3BEUA 3T26A 1TX6A 3GCTG 4JCNA 4X1SU 4ZHMU 3ZZAA 4Y7AA 4Y7BA 4A1TA 4E7NA 2WPMS 4CH2B 1THSH 3RC5A 1P2OA 1SG8B 3SJKA 4K8YA 1BTXA 5E2PA 3GISB 1ESAA 2A5AA 1QRWA 1V2VT 2ANYA 2VWMA 3A8DA 1NFUA 1OPHB 4XBBA 4NSVA 1D3TB 5AFYH 3P8OA 1V2ST 2EI8A 1EP5A 1GHWH 3SGBE 1A2CH 1W0YH 3BTEE 1P2MA 1TGNA 2STBE 4B74A 3V13A 2UWPA 4D9RA 3AW1A 3LPRA 1MZAA 4LXBH 4NA9H 1GCTB 1O3LA 3ENSB 1CO7E 1HAYB 2VH0A 1RTLA 3RM2H 1VZQH 1YCPH 1XUFA 1P12E 1XM1A 4O3TA 3VPKA 4WH8A 2FYQA 1J8AA 1Q2WA 1YPHC 9ESTA 1BOQA 3V7TA 3RLWH 4X6PA 1RJXB 3PWBA 3MU8A 1DWBH 4MDSA 1BRBE 1YCPM 2FOCA 1AU8A 2IPHA 5C3NA 3NPSA 1UVSH 1ZLRA 1BRUP 1Z8IB 4I7YH 3A84A 4X2XA 5GIBA 2V3OH 3ODDA 2ZFFH 1MBQA 1GHZA 3OY5U 5K0HA 4X6MA 1NU9A 1ZTJA 3T28A 2QXHA 1QQUA 3E6PH 2QAAA 2XWAA 1ZMLA 1KSNA 5K7RA 2ZCHP 1RTKA 4HFPB 1C4U2 1T4UH 3QUMP 1O31A 4IN2A 4O97A 1GBHA 2IN2A 1TMUH 2P3UB 1T8LA 2ALPA 3BTTE 3K9XB 1QR3E 4A7IB 1V2KT 3PV4A 3W94A 1FUJA 2R2MB 4NIYA 5TCAA 4ZXYH 2A4QA 5SGAE 4DG4A 4X1QU 2HLCA 2TGPZ 1E0FD 4Z0KA 1A3BH 1ELTA 2OQUA 2XC0A 1S81A 1AIXH 3NUMA 2ZU5A 4OS7A 4FVDA 1GDNA 1ZRKA 3F9FA 1QB9A 4WWYA 1C1NA 2G55A 1P10A 3TJNA 4OS2A 3MHWU 3IITA 1EZXC 4DVAU 1DOJA 1ZGVA 1AFQC 3KGPA 5EPYA 1FAXA 2RDLA 1UK2A 1KLIH 3T29A 4NIXA 3VB6A 1QHRB 3TH3H 3O8RA 1YBWA 3FP6E 1O2XA 5E8EH 4LK4A 1YLDA 2FODA 1W13U 3BG8A 2OD3B 2D2DA 5G4BA 5JDUB 2K7XA 1BHXB 5DP9A 2BQ7B 2H5DA 1IHSH 5DP8A 5EG4A 1FMGA 1CHOF 1SGTA 2UUKB 4Y8ZA 4TY6A 1MTVA 1W2KH 1GJ6A 1WV7H 2XYAA 4ABGA 1BHXF 1UTOA 2HPPH 1TPOA 3SNEA 2GCTC 5FPSA 3LJJA 2J38A 3DT0H 4ABBA 3LGWA 1J17T 4X2VA 3VB7A 1MZDA 1FJSA 3HKIB 1HCGA 3GY5A 1ZGIA 2M5TA 3UNRA 5T6FA 4B75A 3UUZA 3SQHE 4IBLH 3U69H 3ZYEA 3A7TA 2ALVA 1YGCH 3UTUH 5FCRA 2P3TB 4INLA 1CU1A 1GBAA 1TNKA 1Y3XA 4B73A 2GKVE 3O8CA 2HALA 1TPSA 3B23B 1P09A 3RC4A 3T5FH 4RSPA 5HXFA 1EZUC 5LPEA 2ZG0H 1LHCH 1IQGA 2FOFA 1TPAE 2BHGA 1EOJA 1PPEE 3UR6A 2F9NA 2ZDVH 4ZAEA 3ZVFA 1HJ9A 5T6GA 2FWWA 3FVFB 3T25A 1ARCA 2BQWB 4HTCH 1ZSJA 1HDTH 1QGFA 1S0RA 1MQ5A 3ATKA 3SW2B 1G9IE 5I25A 3LOXA 1KDQB 3GDVA 1O38A 1F0TA 1GJ4H 1BITA 1WTHD 1HFDA 1AFQB 5ESTE 1W12U 1C1UH 1G3DA 2PR3A 2ILNA 1XUJA 4AGKA 5DPAA 1VCPA 1QURH 3PROA 1DSUA 5FX5A 3B8JA 1FY5A 2AMPA 3PTNA 4E06H 1Y3UA 1DUAA 3D62A 1S83A 1EPTA 4CR9A 1AKSA 1RFNA 1VCWA 3F1SB 3R3GB 2ZIQH 1SFIA 5C67A 1GMCF 1VJAU 1W3CA 1YPMH 1UVOA 1YPLH 4D7FA 2GCTB 1BTUA 1YM0A 1IQFA 2FI4E 3QO6A 1OP8A 3B9FH 1MTNB 2Y82A 3VXFH 4AYVB 2G8TA 2BM2A 4AOQA 1WAYB 4AZ2B 3P17H 7GCHF 3A83A 5FX6A 4A6LA 2Y5HA 4K69A 1TIOA 1YPGH 2C3SA 1IQKA 5EPNA 3D23A 3A7WA 2F9BH 5AFZH 1XVMA 1AWFH 2EI7A 1QTFA 2PWXA 2JH6D 1LHGH 3BSQA 3E1XB 4BAKB 1XUKA 1A4WH 1EXFA 4Q2KA 1TBRH 3RXSA 4AG2A 4GHQA 3HATH 4X6OA 3U1IB 1X7AC 1O2NA 3BTKE 3GCHC 4ZKNU 3RUOA 1AGJA 1GBFA 1NRRH 1SGIB 2GDEH 5EXMA 1WQSA 4CBOA 2AGIX 1GJBB 3TH4H 2BDBA 4MPUA 3A85A 1AE8H 1BTYA 1VGCC 2ULLA 2CGAA 1H8DH 1O3IA 1G3BA 1SLVB 3EE0B 1SOTA 2R3YA 1GHAG 1VITH 3P95A 4THNH 4H42U 1GBKA 1K1MA 5LPFA 3RXHA 2STAE 2Y5GA 4GVUA 2EI6A 3UFAA 1SGFG 1TLDA 1BMLA 5FBIA 1NT1A 4CRDA 4F4OC 3ESTA 5AVDA 4BTIB 2BZ6H 2Y81A 1Z8JB 2BD5A 4RKJB 1EJNA 4TWYA 1CA0C 3PMAB 2FESH 2HOBA 3SORA 4M7GA 3M35A 2Q6FA 1FY3A 1UO6A 2C8ZB 2ZFRH 1GWAA 1ZOMA 1P01A 1BTPA 3ZZDA 2AGGX 1PYTD 1ZSLA 3TK6A 4BAMB 1V2UT 4KTCA 4NGAH 3SHAH 3OSYA 3MMGA 4B2CA 1NPMA 1P8VC 4SGAE 2BD4A 1CT2E 2O8UA 2H1UA 1KLJH 1YPKH 2BD8A 3MTYA 1UHBB 3GY2A 2ZHDA 1IHTH 1AUJA 1J9CH 1LPKB 3NKKA 1XVOA 2F9UA 4KTSA 3RMMH 2Y7ZA 3DUXH 1IQNA 4UD9H 3EAJA 1O3JA 5GXPA 1SVPA 3GYLB 3RXRA 3SUFA 1LHEH 3M7TA 3CS7A 3SBKA 1O3FA 1KIGH 2SGPE 4JK5A 5FHTA 4I8GA 4Y6DA 2BD7A 1F0SA 2XBYA 4XDEA 1LO6A 3GCHB 4BXWA 3HPTB 2D1JA 8GCHG 2EEKA 1YF4A 2Z9IA 1P9UA 2J92A 1GVLA 2OC7A 2LNCA 2BQ6B 3T27A 3SZNA 2GD4B 1GJAB 1PYTC 2K1QA 2R0LA 3MNCA 1VGCB 1NZQH 1ZHPA 1ZYOA 4U01A 1TNGA 1DWEH 4YOGA
chains in the Genus database with same CATH superfamily
2ZDMA 4O9VA 2AIQA 5GNDA 4ZMAH 4HI3A 1FPCH 1TGCA 2FYRA 4K8BA 2GV6A 3QX5H 4R0IA 1ZSKA 3SV8A 1TOMH 1CT4E 1HV7A 2GMTB 1CE5A 2OCVB 3K6YA 1QZ8A 2BY7X 1SI5H 1PFXC 1HAVA 2B9LA 3D65E 3A7YA 1GMHF 2GZ9A 1SGPE 3PO1C 2ZQ1A 3SU2A 5FL7D 1GJ7B 4TSFD 1CA0B 3RP2A 5FXLA 4AC9A 3PV2A 4Q80A 4CRCA 1C2IA 4Q7YA 1BTZA 2XNIA 3IWMA 1TA2A 4XBDA 4FUGA 1S6HA 1C2MA 4F55A 2LELA 4JZIA 2ANKH 3U8TH 1DPOA 2TPIZ 1BJUA 1JWTA 2ZECA 3BTGE 3F68H 2SGDE 3RXOA 2HPQH 1KY9A 1NO9H 1ELAA 1TYNA 2AS9A 1C5VA 2XW9A 5E0GA 1QCPA 1TNHA 1TNIA 4Y11E 3SUGA 3ELAH 1AE5A 2F43B 4CBNA 3TGJE 2A7HA 3KF2A 1ABJH 2ZEBA 3QWCH 4CRGA 2AEIH 5I46H 4WMDA 1WCZA 2VWLA 1D3DB 6GCHF 1LQEA 3HK6B 1FY4A 1QJ1B 4KTUA 3LC5A 5T3HA 3KQCA 4ABEA 4GCHG 1HIAB 1FIWA 1TRYA 1ZPZA 3RXPA 1SR5C 4CR5A 2B8OH 1K1IA 2FDAA 2J98B 1U6QA 2GV7A 2ESTE 4YLUA 1VKYA 5BRRE 2JETC 4H4FA 3TJOA 2O8LA 2Z6BD 1HAPH 4KELA 4AFSA 2B7DH 1GJ8B 4NFEA 2RDEA 3TNTA 1GGDB 1FPHH 4JYVH 1SQTA 2BD9A 1P2KA 5DP6A 2B5TB 4IMQA 1SLXB 3SNCA 1YPEH 1B0EA 1ZRBA 1QL8A 1CBWC 1TNJA 1AVGH 1HAZB 3NCLA 3FP7E 3PO1B 1O3DA 1P3EA 2VWNA 2Y80A 5GCHG 2G51A 3K6ZA 4ZCNA 2WPJS 4IGDA 2O8WA 3NK8A 1INCA 1UCYH 2FZZA 1YLCA 3H09A 3MU5A 1GHVH 4YTAA 1W7XH 3SU6A 5A8XA 5JB8S 3SU3A 1V2MT 4JZFH 2UUJB 1OS8A 1K22H 1RXPA 2V35A 3I29A 2P8OC 1C2KA 4U2WA 1HAGE 1E36B 4DT4A 5EW1H 2A2QH 1UVUH 4B1TA 4YESB 1HYLA 1NRPH 3S9BA 1TGSZ 1TMTH 4YZUA 4FU7A 2BVRH 3OYPA 1F7ZA 4WH6A 2BLVA 3PRBA 1VR1H 3PV5A 1HXFH 2QGRA 1VITF 3BN9A 3OEED 5DP7A 2GT8A 1BBRK 3URCA 4O03A 2D8WA 3KIDU 3UREA 1IQHA 1MKXK 2ZDKA 2Y6TA 1GHBG 1BUIA 2PSYA 1F92A 4FVBA 2BY8X 3M5NA 3U98H 1EAUA 3F6UH 3TLOA 1P04A 3ZYDA 4NWLA 1TMBH 5EXNA 3TVJB 1DUEA 1S0QA 1GBLA 1O39A 1O2VA 1BQYA 1O5CB 1A7SA 4ZKRU 1DS2E 2QIQA 2GCHG 1F2SE 3F9HA 2QCYA 5C5NA 2JETB 1TPPA 4WF8A 2XBXA 4RT1A 5DN6D 4AB8A 2KCPA 5EODA 5FPYA 1SL3A 3QGJA 2EQNA 1CQQA 8GCHF 1WOFA 3SU0A 3MH4A 2BX3A 1NFYA 2Z3CA 3TJUA 1ELEE 1ANCA 4UE7H 1W14U 4MNVA 3BG4B 1P2NA 4IW4E 1ELVA 3AAVA 1FX0B 3DSGA 2HVXA 2NU4E 1MU6B 2BVSH 2BVXH 4PROA 4CH8B 7ESTE 1CBWB 2F9PA 2HNTC 3UOUA 1CHGA 2WINI 1AVWA 4FU9A 2WV5A 1OWJA 3BF6H 1WUNH 1KLTA 1VCQA 5TCCA 3MH6A 3N7EA 3SYJA 1YY3A 3MNBA 5LPRA 2ZPSA 1GI6A 1Z6EA 2QA9E 4NA7A 1MKWK 2P59A 2Q1JA 1Y5UT 3TPIZ 1FY8E 1XUHA 2WPLS 4OM9A 5L30H 1L1JA 1M9UA 4ABDA 2ZHFH 3MU0A 2FOBA 3LGVA 2SNVA 3VB4A 1H9LB 2P8OB 2O9QA 3QTVH 4F48B 4ZKSU 2GVFA 3HGNA 3ZVCA 4Y8YA 4Y0YE 3BIUH 2ASUB 2FOHA 4AB9A 1AN1E 3SO3A 2XWBI 3BEIB 3TK9A 1UVPA 1H9IE 3F2FA 3STJA 4AFZA 2A5KA 2XXLA 3ZV8A 5EW2H 1SFQB 2FMJA 4Y71A 1FZZA 1SGRE 2V0BA 1BRCE 2HRVA 4MQAA 1Y5AT 1BB0B 1B5GH 3OX7U 1J15A 5F8ZA 3UR9A 2PKAB 3RXDA 2A1DB 4ABJA 3V12A 1C2DA 2Z9LA 2WUCA 1E37B 4X2YA 4AN7A 1MABB 3BTQE 3SI3H 3ZVDA 3UNSA 1IQJA 4ZROA 1S84A 1RS0A 4JZEH 4F49A 1ETRH 3DFLA 1GJ5H 9LPRA 1C2GA 4AFQA 1EJAA 2A31A 1ZTKA 1T32A 3GYMA 1EAXA 1EB1H 1EB2A 5DO4H 2W3KA 4D76A 3P70B 2BZAA 1V2TT 3ATLA 1BBRE 2V3HH 2AERH 2QYIA 3CENA 3UWIA 4WMFA 1A5IA 1MBMA 3G01A 1FNIA 1C2FA 4ABFA 3PMHB 3U9AH 1W0ZU 2NU2E 1Z1IA 3L6PA 3MNSA 1YPJH 3BTHE 5J4QA 1T8OA 1E1QD 5C5OA 1IOEA 3RXQA 1MQ6A 2BY9X 1PQAA 2VH6A 1E38B 2ZZUH 2FI5E 1TAWA 1ANEA 1A46H 4I8KA 4X1NU 2TIOA 1QBOA 1UTNA 2I6SA 5JBTA 1SB1H 2OC0A 6LPRA 2OP9A 1SPJA 1UTMA 1UMAH 2L6OA 1A61H 3P8GA 5H4IB 2UUYA 1GBEA 1HRTH 2A4RA 1TX8A 3E8LA 1O2RA 2CV3A 3KQDA 3SQEE 3GCTF 3GDUA 1A0HB 1P2QA 4Q7XA 1Z8RA 2OXSA 2WSSD 4FUFA 1ANDA 1T8MA 1SGDE 2FXRA 1FLEE 3R0FA 3U8RH 1HB0B 5A0AE 4D8NA 3RU4E 3NWUA 4FXGH 2BXTH 4ZUHA 3U8OH 1D3PB 1P57B 3RMOH 1SSXA 3QLPH 2FX4A 3F0PA 1FDPA 5GDSH 4ZHAA 1ARBA 2KM0A 4X8TH 1JRSA 1CT0E 3I77A 1FN6A 3K2UA 1XKAC 3S69A 2AFQB 1IQIA 3Q3KA 2J95A 3E16B 2DE8A 5F6MA 3DFJA 2IJOB 1NFWA 1O2TA 1YCPK 1SGNE 3DCLA 1ZTLA 1C4Y2 2H9TH 2VVCA 1DSTA 3GY8A 1FIZA 3GY6A 1MTWA 1V2QT 1L2EA 2W6ID 1YPHE 1S85A 1BRAA 3SGAE 2OLGA 5ABWA 1WSSH 3RM0H 2VIVA 4B2AA 1G2MA 1O0DH 4X0WU 1HAIH 1OOKB 3PTBA 1BZXE 2GGVB 3ZZBA 2HWLB 2CMYA 3F9EA 1VJ9U 1PQ5A 3LGUA 3SGQE 1THPB 3VXEH 2I6QA 3SJOA 2EA3A 3UAIC 3F0OA 1NTPA 5DJ7A 3RXUA 4NZLA 4KKDA 1N6XA 5IK2D 1T31A 1TBQH 4K1TA 3EGKH 1LPZB 5JBCS 3VB3A 3ZZ5A 1A3EH 1GHXH 1YLNA 1P9SA 1TALA 4AYYB 2ODPA 1PJPA 4B76A 1J14A 5A09A 4HGCA 2H2ZA 1YC0A 8KME2 4XFQA 1LVYA 2WPIS 3KCGH 1SC8U 1DM4B 3RXLA 1Z71A 1W10U 2A4OA 4I8JA 5JPMH 3Q3YA 2ANWA 2GZ7A 1GMDG 3LH3A 3SHCH 4FUEA 4JMYA 2V6NA 4MNWA 2TBSA 1MU8B 2J2UA 3MO3A 3SOSA 4ABAA 1SLUB 3ZVAA 1O34A 1COWD 2FEQH 1P3CA 3RXBA 2ZPRA 3A81A 3PYHA 2ZU2A 4ZXXH 1P06A 4JZDH 4AGJA 1NY22 1BMMH 1K1LA 3RXIA 5CDFE 3FAOA 1TX7A 4MNYA 3RMLH 1RD3B 2LPRA 1SGYE 2NWNA 3SUDA 1KDQA 3DSPA 4ZH8A 2FIRH 1O2QA 3IG6B 3SUEA 2FLBH 1OHHD 3LC3A 5E0JA 1SHYA 5DP4A 3UPEA 3QZQA 3A8BA 2JH5D 3EE7A 2RG3A 3SU1A 4IS5A 1RTFB 3L3TA 1Z6JH 1E34B 1DWDH 2J34A 4ZKOU 3FANA 2YMSD 4DIHH 5ETXA 1C4V2 2C93B 3SN8A 3FO8D 4MLFB 3OAAD 2R3UA 1C5ZB 1O37A 3P92A 1C5NH 3VGCC 1MCTA 2GZ8A 1DANH 1GI1A 2ZDAH 2BDCA 3LH1A 1EAWA 3KQBA 1ZHRA 4ABIA 5C2ZA 4IC6A 1SQAA 1G3CA 1O2GH 1T8NA 3RXEA 5CMXH 4VGCC 3MI4A 7LPRA 3ZV9A 2L74A 3PLPA 2FOMB 2A5IA 1B7XB 1OWEA 3KQEA 2RFKC 1DX5M 1P0SH 3I78A 3A89A 1GBMA 1NBMD 1AB9C 2VU8E 3ITIA 8LPRA 1BA8B 4YM9A 3TNSA 2PSXA 1S6FA 3UIRA 1ELDE 4CRBA 3LT3A 1JOUB 4FUDA 2A32A 2C90B 1O2KA 3BTME 4OS1A 2AMQA 3KYFA 4Y10E 4UONA 2TGAA 2Z9KA 4UFEH 4I8HA 4INHA 1D4PB 1LVBA 2KAIB 2YMSC 4MNXA 3A8AA 1TE0A 1ZPCA 1AUTC 2NU0E 1GDQA 5DP3A 5EQSA 1L1NA 1K1NA 1H4WA 1SOZA 3GS9A 4MPVA 5T6DA 1ACBE 4IN1A 2ANMH 2ZDLA 3PB1E 1V2NT 3GY4A 4RKOB 4X8UH 1K21H 1OX1A 1F5LA 1PQ7A 1O3PB 1NROH 5C20A 5FBEA 2AYWA 2Z9GA 3RDZA 1ZJKA 1TOCB 5TJXA 2FX6A 4X6NA 1LHDH 2PUXB 1QB1A 4YLQH 3TH2H 1TRMA 3M5OA 3UQOA 3AASA 4BANB 2G4TA 3LONA 2FS8A 4Y76A 3SV7A 1ELGA 3BV9B 1FXYA 3OU0A 2Q6GA 1C5UA 1EASA 1JMOH 1QRZA 1TB6H 2ZP0H 1LMWB 1V2RT 5C1YA 4UFFH 4MVNA 1EJMA 5HYOA 4INKA 4HZHA 1T4VH 3A80A 2EY4C 3SNDA 3BTWE 4BTUB 5A0BA 2FS9A 2C8YB 3KHVA 4WXIA 1XMNB 4BOHA 4NZQA 1HBTH 2VVVA 2NU1E 1N1LA 1PPZA 3SJIA 4FUHA 1JXPA 1A5GH 3MYWA 1AD8H 2QXGA 1SHHB 1OSSA 2H6MA 2WPHS 2ZGXH 1Q3XA 1MD8A 3BIVH 1O3HA 3VGCB 1WQVH 3HKJB 3EA9A 3OY6U 3Q3XA 1E79D 1P03A 2C8WB 1ORFA 1AVXA 1D9IA 4WXVA 1LVOA 1PPHE 2H9EH 1MMJN 4NWKA 5DGJA 5F53A 1O2JA 1H8HD 2H5CA 1C5XB 2XBVA 1S82A 2G5VA 4KGAA 1H1BA 1K2I1 1GBBA 1A0JA 3A7XA 1BMFD 2UUFB 3A88A 1BCUH 5EJ1A 2AH4X 3V0XA 1A5HA 1QA0A 3K65B 1GI2A 1GL0E 3N7OA 1AQ7A 1UHBA 2ZNKH 3QTOH 5JBBS 1GVZA 1AB9B 5A8YA 2PV9B 1V2PT 4BAHB 2XOKD 1CHOG 1W0JD 2PTCE 2DE9A 1L4DA 3FOAA 4JYUH 2Z3DA 2PGBB 2A0QB 4DCDA 4D9QA 4R8TB 1K9OE 2JKHA 2PW8H 3GICB 2OBOA 2BDAA 3M3SA 3LKWA 3M7UA 1DY8A 2ZFTA 2D26C 2WV4A 2CF8H 1GCTC 1XUIA 2G81E 1L1GA 2BY6X 3LJOA 4GUXA 2R0KA 3M5LA 3QGNB 1AHTH 2YMSB 3A7VA 4K5ZA 3OEHD 4UEHH 4Y0ZE 1TNLA 4XD7D 2BOHB 4B2BA 1C1WH 4AFUA 4MG3A 1O5DH 5F03A 1KTSB 2BDGA 5IYTA 1QQ4A 3MO9A 2C8XB 1J16A 1IAUA 1RGQA 1GHAF 4FUJA 1C5WB 2VBCA 2VVUA 4DIIH 5E0HA 2YNBA 2XNDD 1WTGH 1NRQH 4A1VA 3ZZCA 5BPEA 1Z1JA 5FCKA 4GSOA 1WDIA 2PUQH 3C1KA 4SGBE 3T62A 2ZTYA 3BTFE 1O2MA 4O3UA 1BIOA 3SI4H 5L2YH 2FPZA 2UWLA 1YKTA 2CXVA 3SV6A 1D6RA 2TRMA 4AG1A 3M3VA 3WWFA 1O5BB 1ETTH 2IOTA 1IQMA 1DY9A 3ZZ4A 1FY1A 2THFB 3SNAA 5C0TA 4LZ1H 5EJZA 4NSYA 1C2EA 4LZ4B 1QL9A 6CHAC 5L6NH 2Z7FE 1C9TA 1ZZZA 3UOPA 3RU4T 3FN8A 2Y7XA 1GI7B 3MO6A 1GDUA 3PM3A 4ESTE 3N7DA 3RMNH 1O2UA 1C5MD 1S5SA 4FU8A 1L4ZA 1S6LA 3UB0A 5DP5A 3RXVA 1UTPA 1V3XA 4Q7ZA 1O3OA 1QRXA 5EGMA 1GJDB 3BTDE 2R9PA 1LVMA 1O2IA 3PMJA 1NS3A 1PPCE 1O3GA 1G30B 1P11E 2VIDA 5ESBA 1C1MA 1Y59T 4DT7B 2P95A 1EPTC 1BJVA 4AORA 3NXPA 2P94A 4J1YA 3SZEA 1O3EA 1N6YA 1G3EA 1UTJA 1O5AB 1IQLA 1C5SA 1SGCA 5A0CA 2OINA 2NU3E 3RXAA 1JRTA 1NRSH 1GMCG 1DE7H 1DITH 2FI3E 3PRDA 3JZ1B 1O30A 4ISOA 2R2WU 3RXTA 5GWZA 5F8TA 4YT6H 2BDYA 1MTSA 1O33A 3ZZ3A 1TRNA 1HIAA 1JIRA 1ZPBA 2BB4A 2W7SA 2A4GA 3ZVBA 4B6EA 3MU4A 4K60A 7GCHG 2VIWA 3TITA 2A7JA 2J98A 3FZZA 1W8BH 2SFAA 5KGOA 2BDHA 1Y5BT 5EQRA 4CRAA 1D6WA 1O2SA 1O3BA 1OWKA 1KTTB 2ODQA 2VINA 2QY0B 2W5EA 1QJ7B 4IC5A 4TY7A 1FN8A 5EJLA 3SNBA 3U28C 3RLYH 2ZFQH 1D3QB 1DVAH 4KP0A 2PKSC 1V2LT 2WPDD 1KXDA 1Z7KA 1SGFA 4BAOB 4X1PU 3P6ZB 1L0ZA 1A0LA 4TPIZ 4DW2U 3V3MA 3QK1A 1SMFE 1GBDA 2VB0A 3GDSA 1QIXB 2BD3A 2CJIA 3LGTA 5C0UA 1F0RA 2ZCKP 4ZHLU 5HM9A 4H6TA 1TQ0B 4ABHA 1EX3A 1KXAA 5A2MH 2GT7A 2ZGCA 2HLDD 6CHAB 3MH7A 1FAKH 2OUAA 2KCAA 4ASHA 2WYJA 3LDXH 1KXFA 4NG9H 5HM2A 1K1JA 1G37A 2CF9H 1JIMA 3FFGA 1GBTA 1UTQA 5AHGH 2GX4A 5B6OA 4QT8C 4WY3A 2FOGA 1V6DA 1C9PA 2GDDA 2M2AA 1WU1A 1F0UA 1FI8A 2ZPQA 1LCYA 2GP9B 1N8OC 3H7OA 2XRCA 3E0NB 4TWWA 2CN0H 1ESBA 1QBVH 2W3IA 1OP2A 3H7TA 4K1EA 4YOIA 1HNEE 1GJCB 1EPTB 1AKSB 1UJ1A 2ZCLP 4Y8XA 1GI3A 2Y5FA 1OYTH 4P00A 3P8FA 5KEDA 1GJ9B 1Y3WA 1QFKH 1HAXB 8ESTE 1NC6A 3EDXB 3W1EA 1TONA 2PTNA 4DJZB 2A7CA 3WY8A 3FZDA 3DSOA 1RIWC 4GCHF 2YNAA 3UNQA 3AK5A 2PGQB 2P3FH 4RT0A 3SV9A 5B6LA 2Q6DA 3E91A 2FOAA 5JYIA 1XUGA 1HUTH 1GCDA 1G2LA 1SLWB 1SGQE 1C5QA 3URDA 1V2WT 2ZKSA 2ZC9H 4CHAC 2VIQA 5EOKA 1GBIA 1ZHMA 1C2HA 3AVZA 3S7KB 2RCEA 4CRFA 5JB9S 1DXWA 2ZU3A 2OQ5A 2XC5A 4UFDH 1OXGA 2V7QD 1O5GH 4E7RG 1MTNC 1TA6A 2GTBA 1WYKA 3CS0A 2YOLA 3OTPA 3SV2H 2FTLE 1OYQA 3ZZ6A 2ZWLH 4OGXA 1BDAA 2PKSB 1HLTH 3T2NA 1F5KU 3EQ0H 1XX9A 3VFEA 3VEQB 2HNTF 4IMZA 4BAQB 2EC9H 3F2GA 5HGGA 1MAXA 3L33A 3M61U 2UWOA 1THRH 7KMEH 5GCHF 4GPGA 2H9HA 1O36A 3TU7H 4YT7H 1UTKA 1YYY1 3UY9A 3F3BA 2ODYB 1NRNH 1HJAC 1P2JA 1UCYK 5FAHA 1CVWH 1EATA 2JH0D 1B0FA 3RXKA 2CHAC 4Z6AH 3KNXA 4Y79A 3ZVGA 4X1RU 5F8XA 3ZZ8A 2FLRH 4TT3D 4E05H 4GLYA 2F83A 4Q4LA 4BXSA 1O2HA 2O8MA 4JK6A 1EOLA 2BD2A 4DGJA 2PFEA 5KECA 4TPYA 2P16A 1O32A 1O3MA 1EZQA 2PLXA 5EXLA 2W7UA 1N8OB 1UW7A 1FQ3A 2BLWA 3O8DA 1PPGE 5HIYA 1GMHG 4RN6A 1Y3YA 5HMAA 1HJ8A 1GHBF 3PLKA 1T7CA 3ATIA 2ZU4A 2OTVA 5C1XA 5LGOA 1EFRD 4NFFA 3EYDA 3HGPA 5GPIB 2PKAA 1H9HE 3M37A 2JIZD 3DD2H 1RIWB 1QA7A 1TFXA 5EQQA 1LDTT 4UDWH 1GI4A 1F5RA 1ABIH 3CP7A 1LHFH 2GCHF 5CHAC 1C1QA 1O35A 2QN5T 3N99A 1TABE 4X2WA 3MQKC 2BDIA 4ISIH 4CHAB 5PTPA 1C1VH 3GY3A 2SGEE 3KEEA 4DOQA 2XCNA 3GOVB 1V2JT 3LGIA 5IDKA 1C5PA 3EBNA 1O2PA 3QDZB 1EP6A 3S9CA 2O8TA 4NCYA 3P8NA 4FUBA 3MNXA 1C1PA 2QXJA 4U32A 1O2LA 5A8ZA 3TJVA 6GCHG 4OS5A 2ZF0H 3PLBA 1UTLM 1Y3VA 1O2WA 3U1JB 2HNTE 1GG6C 3M5MA 1GHYH 1OWHA 4YXWD 1P02A 4JZ1A 1NFXA 4WVPE 2J4IA 1TGBA 1FV9A 3RXMA 4D7GA 1MD7A 5DG6A 1DT2A 1HJAB 1HXEH 2QC2A 3S7HB 2RA3A 2FTMA 3RXCA 4FOUC 2B0FA 2BY5X 1DWCH 2CHAB 4WMEA 1ZJDA 2QF5A 2VWOA 1ZR0A 3OE7D 3A8CA 3C27B 4XOJA 1AZZA 2ZO3H 1O5FH 1GI8B 1C5LH 3W95A 2Z3EA 2XCFA 1QL7A 1KXCA 1NM6A 1RRKA 2F3CE 1O2YA 3E90B 1HAVB 1LTOA 2KCYA 3GY7A 3MH5A 5DKMA 1C1OA 1CGHA 1EKBB 4I31A 1Z8GA 1WXRA 2F9VA 1CGJE 3UWJH 3A87A 2RA0A 4NIWA 3QZRA 4OS4A 2GMTC 1O3CA 2J94A 1DICA 3S0NA 2J97A 2VIOA 1BT7A 1TQ7B 1W7GH 2FO9A 2ZFSA 3MU1A 1DXPA 2QXIA 1ELFA 1OP0A 2SNWA 1QB6A 4WJG2 4MPXA 3TIUA 1UCYE 2ZTZA 1ZMNA 4BTTB 3VG8A 4JYTA 1TGTA 3RXGA 1MAYA 3M36A 2WUBA 2FM2A 1MTUA 4X8SH 4A92A 1MH0A 3ODFA 4MPWA 5CHAB 1LPGB 1PPFE 2ZHQH 2IJD1 1EAIA 1AZ8A 2G52A 3KL6A 4J2YB 1C2LA 1LQDB 1E35B 2PHBA 3D49H 1HAOH 1BBRH 2ZI2H 2VGCC 4YOJA 1NU7B 1VITG 1LKAA 1MKXH 4LOYH 1AO5A 4K2YA 2FP7B 3LGYA 2A2XH 1UK3A 1O3NA 3A86A 2WYGA 2J9NA 3M3TA 1C2JA 2BYAX 4A1XA 3Q77A 2OC8A 1ELBA 5GJ4B 2G4UA 2ZGJA 3TGKE 2VJ1A 4B71A 4I86A 1EUFA 1GI0A 1O3AA 6ESTA 1ELCA 1TWXB 1GG6B 1NN6A 3AAUA 4YO9A 1C1TA 2Z9JA 1K0HA 1KXEA 2ZHWH 3ZZ7A 4U30A 4TYDA 1Y8TA 3KN2A 2ZQ2A 3OTJE 2W26A 5J4SA 2AGEX 2BLQA 3VB5A 1O3KA 4DURA 3SU4A 3DA9B 2ZA5A 3Q00A 1HPGA 4I8LA 5AF9H 2KCOA 3Q76A 3LIWA 3RXJA 4H6SB 2XTTB 4K3JA 1MUEB 2WV9A 5HKKD 1ESTA 1QY6A 3MWIU 2GJGA 1K28D 1ID5H 1GI5A 4GAWA 1DLEA 4XBCA 4OGYA 2BOKA 2ZGHA 3QN7A 1CSOE 1GGDC 2DUCA 3A7ZA 2VIPA 2SGQE 1KYNA 4XE4A 1Q31A 2VNTA 5DK1A 2P93A 2TGDA 2QV1A 1AI8H 5LH8A 3HK3B 1AFEH 1QNJA 1O5EH 4ISLA 5CHBA 1MKWH 4ISNA 1AMHA 1EQ9A 1SGEE 1K1PA 1TBZH 2OC1A 3FP8E 2ZTXA 1AY6H 1EZSC 2C4FH 5C1UA 3ZIAD 2ZGBH 4FETA 1A1RA 1H8IH 1MCVA 3BEFB 3EA8A 2ZDNA 2BTCE 2WZQA 2QF0A 3ZZ9A 3PMBB 2F4LA 3WW7A 3ATWA 2XBWA 1HGTH 2V3MA 1GVKB 1C5TA 3NZIA 1XXDA 1C5RA 5C17A 4DY7B 1BTWA 1HAHH 2SGFE 2VGCB 1GBCA 1ANBA 4VGCB 1OWIA 1GI9B 4CREA 4FUIA 1C1RA 4A5TS 4I33A 2WHXA 3MFJA 1IQEA 4UFGH 3ATMA 4GHTA 3FKSD 2BX4A 4AX9H 3M7QA 2F9OA 1SBWA 2QF3A 3E0PB 5CE1A 1DDJA 3AW0A 4X8VH 4B6FA 1PPBH 2SGAA 3KQ5A 2XC4A 3RC6A 2K8IA 1P2IA 3F9GA 1GL1A 2ZU1A 3GCOA 1FONA 1WBGB 3SJ9A 1ZMJA 4MTBA 1V2OT 2BXUH 5E2OA 4I32A 1AWHB 1O2OA 3H5CB 1QBNA 3SU5A 2OBQA 1E1RD 5L2ZH 3UQVA 1C5YB 2ZFPH 1DLKB 2AIPA 1OKXA 2J5UA 2ZHEH 5FPTA 1GMDF 3JZ2B 1UVTH 3GCNA 3MOCA 4K1SA 1GBJA 1C1SA 4OS6A 2G5NA 3RU4D 3RXFA 3ZVEA 3E3TA 4XSKU 1LKBA 2F91A 1G36A 2KAIA 1SQOA 1QJ6B 1OWDA 2LIZA 2Z94A 1JBUH 1K1OA 1KXBA 3TK5A 2HGTH 4HG6A 4ISHH 3A82A 1UK4A 3SJ8A 2FOEA 3DHKH 4BNRA 5EU8A 3EA7A 1BMNH 3BG4C 3STIA 1CGIE 2TGTA 3LU9B 1XXFA 2BLOA 1DFPA 3O8BA 1KMHB 1NESE 4NA8A 5JBAS 4FUCA 2A45B 1ETSH 2KR7A 1O2ZA 1CA8B 1G32B 4NIVA 2WPKS 1BMAA 1C5OH 3S9AA 1PQ8A 2AMDA 1BTHH 2BMGB 1P05A 3TGIE 1XKBC 1YP9A 3PWCA 1W11U 1GPZA 2G00A 3BEUA 3T26A 1TX6A 3GCTG 4JCNA 4X1SU 4ZHMU 3ZZAA 4Y7AA 5T1VA 4Y7BA 4A1TA 4E7NA 2WPMS 4CH2B 1THSH 3RC5A 1P2OA 1SG8B 3SJKA 4K8YA 1BTXA 5E2PA 3GISB 4Q63A 1ESAA 2A5AA 1QRWA 1V2VT 2ANYA 2VWMA 3A8DA 1NFUA 1OPHB 4XBBA 4NSVA 1D3TB 5AFYH 2LP6A 3P8OA 1V2ST 2EI8A 1EP5A 1GHWH 3SGBE 1A2CH 1W0YH 3BTEE 1P2MA 1TGNA 2STBE 4B74A 3V13A 2UWPA 4D9RA 4Z1MD 3AW1A 3LPRA 1MZAA 4LXBH 4NA9H 2KZ4A 1GCTB 1O3LA 3ENSB 1CO7E 1HAYB 2VH0A 1RTLA 3RM2H 1VZQH 1YCPH 1XUFA 1P12E 1XM1A 4O3TA 3VPKA 4WH8A 2FYQA 1J8AA 1Q2WA 1YPHC 9ESTA 1BOQA 3V7TA 3RLWH 4X6PA 1RJXB 3PWBA 3MU8A 1DWBH 4MDSA 1BRBE 1YCPM 2FOCA 1AU8A 2IPHA 5C3NA 2AHME 3NPSA 1UVSH 1ZLRA 1BRUP 1Z8IB 4I7YH 2QE7D 3A84A 4X2XA 5GIBA 2V3OH 3ODDA 2ZFFH 1MBQA 1GHZA 3OY5U 5K0HA 4X6MA 1NU9A 1ZTJA 3T28A 2QXHA 1QQUA 3E6PH 2QAAA 2XWAA 1ZMLA 1KSNA 5K7RA 2ZCHP 1RTKA 2KX4A 1C4U2 1T4UH 4HFPB 3QUMP 1O31A 4IN2A 4O97A 1GBHA 2IN2A 1TMUH 2P3UB 1T8LA 2ALPA 1NBME 3BTTE 1QR3E 3K9XB 4A7IB 1V2KT 2W6JD 3PV4A 3W94A 2JDID 1FUJA 2R2MB 4NIYA 5TCAA 4ZXYH 2A4QA 5SGAE 4DG4A 4X1QU 2HLCA 2TGPZ 1E0FD 4Z0KA 1A3BH 1ELTA 2OQUA 2XC0A 1S81A 1AIXH 3NUMA 2ZU5A 4OS7A 2QF4A 4FVDA 1GDNA 1ZRKA 5DSFA 3F9FA 1QB9A 4WWYA 1C1NA 2G55A 1P10A 3TJNA 4OS2A 3MHWU 3IITA 3CNRA 1EZXC 4DVAU 1DOJA 1ZGVA 1AFQC 3KGPA 5EPYA 1FAXA 2RDLA 1UK2A 1KLIH 3T29A 4NIXA 3VB6A 1QHRB 3TH3H 3O8RA 1YBWA 3FP6E 1O2XA 5E8EH 4LK4A 4ACAA 1YLDA 2FODA 1W13U 3BG8A 2OD3B 2D2DA 5G4BA 5JDUB 2K7XA 1BHXB 5DP9A 2BQ7B 2H5DA 1IHSH 5DP8A 5EG4A 1FMGA 1CHOF 1SGTA 2UUKB 4Y8ZA 4TY6A 1MTVA 1W2KH 1GJ6A 1WV7H 2XYAA 4ABGA 1BHXF 1UTOA 2HPPH 1TPOA 3SNEA 2GCTC 5FPSA 3LJJA 2J38A 3DT0H 4ABBA 3LGWA 1J17T 4X2VA 3VB7A 3F2HA 1MZDA 1FJSA 3HKIB 1HCGA 3GY5A 1ZGIA 2M5TA 3UNRA 5T6FA 4B75A 3UUZA 3SQHE 4IBLH 3U69H 3ZYEA 3A7TA 2K0QA 2ALVA 1YGCH 3UTUH 5FCRA 3WWBA 2P3TB 4INLA 1CU1A 1GBAA 1TNKA 1Y3XA 4B73A 2GKVE 3O8CA 2HALA 1TPSA 3B23B 1P09A 3RC4A 3T5FH 4RSPA 5HXFA 1EZUC 5LPEA 2ZG0H 1LHCH 1IQGA 2FOFA 1TPAE 2BHGA 1EOJA 1PPEE 3UR6A 2F9NA 2ZDVH 4ZAEA 3ZVFA 1HJ9A 5T6GA 2FWWA 3FVFB 3T25A 1ARCA 2BQWB 4HTCH 1ZSJA 1HDTH 1QGFA 1S0RA 1MQ5A 3ATKA 3SW2B 1G9IE 5I25A 2IPQX 3LOXA 1KDQB 3GDVA 1O38A 1F0TA 1GJ4H 1BITA 1WTHD 1HFDA 1AFQB 5ESTE 1W12U 1C1UH 1G3DA 2PR3A 2ILNA 1XUJA 4AGKA 5DPAA 1VCPA 1QURH 4XRNA 3PROA 1DSUA 5C94A 5FX5A 3B8JA 1FY5A 2AMPA 1SQRA 3PTNA 3NRLA 4E06H 1Y3UA 1DUAA 3D62A 1S83A 1EPTA 4CR9A 1AKSA 1RFNA 1VCWA 3F1SB 3R3GB 2ZIQH 1SFIA 5C67A 1GMCF 1VJAU 1W3CA 1YPMH 1UVOA 1YPLH 4D7FA 2KFWA 5HIZA 2GCTB 2HVYB 1BTUA 1YM0A 1IQFA 2FI4E 3QO6A 1OP8A 3B9FH 1MTNB 2Y82A 3VXFH 4AYVB 2G8TA 2BM2A 4AOQA 1WAYB 4AZ2B 3P17H 7GCHF 3A83A 5FX6A 4A6LA 2Y5HA 4K69A 1TIOA 1YPGH 2C3SA 1IQKA 5EPNA 2PP6A 3D23A 3A7WA 2F9BH 5AFZH 1XVMA 1AWFH 2EI7A 1QTFA 2PWXA 2JH6D 1LHGH 3BSQA 3E1XB 4BAKB 1XUKA 1A4WH 1EXFA 4Q2KA 1TBRH 3RXSA 4AG2A 4GHQA 2CK3D 3HATH 4X6OA 3U1IB 1X7AC 1O2NA 3BTKE 3GCHC 4ZKNU 1H8ED 3KYGA 3RUOA 1AGJA 1GBFA 1NRRH 1SGIB 2GDEH 5EXMA 1WQSA 4CBOA 2AGIX 1GJBB 3TH4H 2BDBA 4MPUA 3A85A 1AE8H 1BTYA 1VGCC 2ULLA 2CGAA 1H8DH 1O3IA 1G3BA 1SLVB 1SKYE 1SOTA 3EE0B 2R3YA 1GHAG 1VITH 3P95A 4THNH 4H42U 4ASUD 1GBKA 1K1MA 5LPFA 3RXHA 2STAE 2Y5GA 4GVUA 2EI6A 3UFAA 1SGFG 1TLDA 1BMLA 5FBIA 1NT1A 4CRDA 4F4OC 3ESTA 5AVDA 4BTIB 2BZ6H 2JJ1D 2Y81A 3OFND 1Z8JB 2BD5A 4RKJB 1EJNA 4TWYA 1CA0C 3PMAB 2FESH 2HOBA 3SORA 4M7GA 4M9FA 3M35A 2Q6FA 1FY3A 1UO6A 2C8ZB 2ZFRH 5EIYA 1GWAA 1ZOMA 1P01A 1BTPA 3ZZDA 2AGGX 1PYTD 1ZSLA 3TK6A 4BAMB 1YWUA 1V2UT 4KTCA 4NGAH 3SHAH 3OSYA 3MMGA 4B2CA 1NPMA 1P8VC 2OK5A 4SGAE 2BD4A 1CT2E 2O8UA 2H1UA 1KLJH 1YPKH 2BD8A 1W0KD 3MTYA 1UHBB 3GY2A 2ZHDA 1IHTH 1AUJA 1J9CH 1LPKB 3NKKA 1XVOA 2F9UA 4KTSA 3RMMH 2Y7ZA 3DUXH 1IQNA 4P02A 4UD9H 3EAJA 1O3JA 5GXPA 1SVPA 3GYLB 3RXRA 3SUFA 1LHEH 3M7TA 3CS7A 3SBKA 1O3FA 1KIGH 2SGPE 4ACBA 4JK5A 5FHTA 4I8GA 4Y6DA 2BD7A 1F0SA 2XBYA 4XDEA 1LO6A 3GCHB 4BXWA 3HPTB 2D1JA 8GCHG 2EEKA 1YF4A 2Z9IA 1P9UA 2J92A 1GVLA 2OC7A 2LNCA 2BQ6B 3T27A 3SZNA 2GD4B 1GJAB 1PYTC 2K1QA 2R0LA 3MNCA 1VGCB 1NZQH 2JJ2D 4RI0A 1ZHPA 1ZYOA 4U01A 1TNGA 1DWEH 4YOGA
chains in the Genus database with same CATH topology
2ZDMA 4O9VA 2AIQA 4ZMAH 4HI3A 1FPCH 1TGCA 2FYRA 4K8BA 2GV6A 3QX5H 4R0IA 1ZSKA 3SV8A 1TOMH 1CT4E 1HV7A 2GMTB 1CE5A 2OCVB 3K6YA 2BY7X 1SI5H 1PFXC 1HAVA 2B9LA 3D65E 3A7YA 1GMHF 2GZ9A 1SGPE 3PO1C 2ZQ1A 3SU2A 1GJ7B 3RP2A 1CA0B 5FXLA 4Q80A 4CRCA 1C2IA 4Q7YA 1BTZA 2XNIA 3IWMA 1TA2A 4XBDA 4FUGA 1S6HA 1C2MA 4JZIA 2ANKH 3U8TH 1DPOA 2TPIZ 1BJUA 1JWTA 2ZECA 3BTGE 3F68H 2SGDE 3RXOA 2HPQH 1KY9A 1NO9H 1ELAA 1TYNA 2AS9A 1C5VA 2XW9A 5E0GA 1QCPA 1TNHA 1TNIA 4Y11E 3SUGA 3ELAH 1AE5A 4CBNA 3TGJE 2A7HA 3KF2A 1ABJH 2ZEBA 3QWCH 4CRGA 2AEIH 5I46H 4WMDA 1WCZA 2VWLA 1D3DB 6GCHF 1LQEA 3HK6B 1FY4A 1QJ1B 4KTUA 3LC5A 5T3HA 3KQCA 4ABEA 4GCHG 1HIAB 1FIWA 1TRYA 1ZPZA 3RXPA 1SR5C 4CR5A 2B8OH 1K1IA 2FDAA 1U6QA 2GV7A 2ESTE 4YLUA 5BRRE 2JETC 4H4FA 3TJOA 2O8LA 2Z6BD 1HAPH 4KELA 4AFSA 2B7DH 1GJ8B 4NFEA 3TNTA 1GGDB 1FPHH 4JYVH 1SQTA 2BD9A 1P2KA 5DP6A 2B5TB 4IMQA 1SLXB 3SNCA 1YPEH 1B0EA 1ZRBA 1QL8A 1CBWC 1TNJA 1AVGH 1HAZB 3NCLA 3FP7E 3PO1B 1O3DA 1P3EA 2VWNA 2Y80A 5GCHG 2G51A 3K6ZA 2WPJS 4IGDA 2O8WA 3NK8A 1INCA 2FZZA 1UCYH 1YLCA 3MU5A 1GHVH 4YTAA 1W7XH 3SU6A 5A8XA 5JB8S 3SU3A 1V2MT 4JZFH 2UUJB 1OS8A 1K22H 1RXPA 2V35A 3I29A 2P8OC 1C2KA 4U2WA 1HAGE 1E36B 5EW1H 2A2QH 1UVUH 4B1TA 4YESB 1HYLA 1NRPH 3S9BA 1TGSZ 1TMTH 4YZUA 4FU7A 2BVRH 3OYPA 1F7ZA 4WH6A 2BLVA 1VR1H 1HXFH 2QGRA 1VITF 3BN9A 5DP7A 2GT8A 1BBRK 3URCA 4O03A 2D8WA 3KIDU 3UREA 1IQHA 1MKXK 2ZDKA 2Y6TA 1GHBG 1BUIA 2PSYA 1F92A 4FVBA 2BY8X 3M5NA 3U98H 1EAUA 3F6UH 3TLOA 1P04A 3ZYDA 4NWLA 1TMBH 5EXNA 3TVJB 1DUEA 1S0QA 1GBLA 1O39A 1O2VA 1BQYA 1O5CB 1A7SA 4ZKRU 1DS2E 2QIQA 2GCHG 1F2SE 3F9HA 2QCYA 5C5NA 2JETB 1TPPA 4WF8A 2XBXA 4AB8A 5EODA 5FPYA 1SL3A 3QGJA 1CQQA 8GCHF 1WOFA 3SU0A 3MH4A 2BX3A 1NFYA 2Z3CA 3TJUA 1ELEE 1ANCA 4UE7H 1W14U 4MNVA 3BG4B 1P2NA 4IW4E 1ELVA 3AAVA 2HVXA 2NU4E 1MU6B 2BVSH 2BVXH 4PROA 4CH8B 7ESTE 1CBWB 2F9PA 2HNTC 3UOUA 1CHGA 2WINI 1AVWA 4FU9A 2WV5A 1OWJA 3BF6H 1WUNH 1KLTA 1VCQA 5TCCA 3MH6A 3MNBA 5LPRA 2ZPSA 1GI6A 1Z6EA 2QA9E 4NA7A 1MKWK 2P59A 2Q1JA 1Y5UT 3TPIZ 1FY8E 1XUHA 2WPLS 5L30H 1L1JA 1M9UA 4ABDA 2ZHFH 3MU0A 2FOBA 3LGVA 2SNVA 3VB4A 1H9LB 2P8OB 2O9QA 3QTVH 4ZKSU 2GVFA 3HGNA 3ZVCA 4Y8YA 4Y0YE 3BIUH 2ASUB 2FOHA 4AB9A 1AN1E 3SO3A 2XWBI 3BEIB 3TK9A 1UVPA 1H9IE 3STJA 4AFZA 2A5KA 2XXLA 3ZV8A 5EW2H 1SFQB 2FMJA 4Y71A 1FZZA 1SGRE 2V0BA 1BRCE 2HRVA 4MQAA 1Y5AT 1BB0B 1B5GH 3OX7U 1J15A 5F8ZA 3UR9A 2PKAB 3RXDA 2A1DB 4ABJA 3V12A 1C2DA 2Z9LA 2WUCA 1E37B 4X2YA 4AN7A 3BTQE 3SI3H 3ZVDA 3UNSA 1IQJA 4ZROA 1S84A 1RS0A 4JZEH 4F49A 1ETRH 3DFLA 1GJ5H 9LPRA 1C2GA 4AFQA 1EJAA 2A31A 1ZTKA 1T32A 3GYMA 1EAXA 1EB1H 1EB2A 5DO4H 2W3KA 4D76A 3P70B 2BZAA 1V2TT 3ATLA 1BBRE 2V3HH 2AERH 2QYIA 3CENA 3UWIA 4WMFA 1A5IA 1MBMA 3G01A 1FNIA 1C2FA 4ABFA 3PMHB 3U9AH 1W0ZU 2NU2E 1Z1IA 3L6PA 3MNSA 1YPJH 3BTHE 5J4QA 1T8OA 5C5OA 1IOEA 3RXQA 1MQ6A 2BY9X 1PQAA 2VH6A 1E38B 2ZZUH 2FI5E 1TAWA 1ANEA 1A46H 4I8KA 4X1NU 2TIOA 1QBOA 1UTNA 2I6SA 5JBTA 1SB1H 2OC0A 6LPRA 2OP9A 1SPJA 1UTMA 1UMAH 1A61H 3P8GA 5H4IB 2UUYA 1GBEA 1HRTH 2A4RA 1TX8A 3E8LA 1O2RA 2CV3A 3KQDA 3SQEE 3GCTF 3GDUA 1A0HB 1P2QA 4Q7XA 1Z8RA 2OXSA 4FUFA 1ANDA 1T8MA 1SGDE 2FXRA 1FLEE 3R0FA 3U8RH 1HB0B 5A0AE 4D8NA 3RU4E 3NWUA 4FXGH 2BXTH 4ZUHA 3U8OH 1D3PB 1P57B 3RMOH 1SSXA 3QLPH 2FX4A 1FDPA 5GDSH 4ZHAA 1ARBA 4X8TH 1JRSA 1CT0E 3I77A 1FN6A 3K2UA 1XKAC 3S69A 2AFQB 1IQIA 3Q3KA 2J95A 3E16B 2DE8A 5F6MA 3DFJA 2IJOB 1NFWA 1O2TA 1YCPK 1SGNE 1ZTLA 1C4Y2 2H9TH 2VVCA 1DSTA 3GY8A 1FIZA 3GY6A 1MTWA 1V2QT 1L2EA 1YPHE 1S85A 1BRAA 3SGAE 2OLGA 5ABWA 1WSSH 3RM0H 2VIVA 4B2AA 1G2MA 1O0DH 4X0WU 1HAIH 1OOKB 3PTBA 1BZXE 2GGVB 3ZZBA 2HWLB 2CMYA 3F9EA 1VJ9U 1PQ5A 3LGUA 3SGQE 1THPB 3VXEH 2I6QA 3SJOA 2EA3A 1NTPA 5DJ7A 3RXUA 4NZLA 4KKDA 1N6XA 1T31A 1TBQH 4K1TA 3EGKH 1LPZB 5JBCS 3VB3A 3ZZ5A 1A3EH 1GHXH 1P9SA 1TALA 4AYYB 2ODPA 1PJPA 4B76A 1J14A 5A09A 4HGCA 2H2ZA 1YC0A 8KME2 4XFQA 1LVYA 2WPIS 3KCGH 1SC8U 1DM4B 3RXLA 1Z71A 1W10U 2A4OA 4I8JA 5JPMH 3Q3YA 2ANWA 2GZ7A 1GMDG 3LH3A 3SHCH 4FUEA 4JMYA 2V6NA 4MNWA 2TBSA 1MU8B 2J2UA 3MO3A 3SOSA 4ABAA 1SLUB 3ZVAA 1O34A 2FEQH 1P3CA 3RXBA 2ZPRA 3A81A 3PYHA 2ZU2A 4ZXXH 1P06A 4JZDH 4AGJA 1NY22 1BMMH 1K1LA 3RXIA 3FAOA 1TX7A 4MNYA 3RMLH 1RD3B 2LPRA 1SGYE 2NWNA 3SUDA 1KDQA 4ZH8A 2FIRH 1O2QA 3IG6B 3SUEA 2FLBH 3LC3A 5E0JA 1SHYA 5DP4A 3UPEA 3QZQA 3A8BA 2JH5D 2RG3A 3SU1A 4IS5A 1RTFB 3L3TA 1Z6JH 1E34B 1DWDH 2J34A 4ZKOU 3FANA 4DIHH 5ETXA 1C4V2 2C93B 3SN8A 4MLFB 2R3UA 1C5ZB 1O37A 3P92A 1C5NH 3VGCC 1MCTA 2GZ8A 1DANH 1GI1A 2ZDAH 2BDCA 3LH1A 1EAWA 3KQBA 1ZHRA 4ABIA 5C2ZA 4IC6A 1SQAA 1G3CA 1O2GH 1T8NA 3RXEA 5CMXH 4VGCC 3MI4A 7LPRA 3ZV9A 3PLPA 2FOMB 2A5IA 1B7XB 1OWEA 3KQEA 1DX5M 1P0SH 3I78A 3A89A 1GBMA 2VU8E 1AB9C 3ITIA 8LPRA 1BA8B 4YM9A 3TNSA 2PSXA 1S6FA 3UIRA 1ELDE 4CRBA 3LT3A 1JOUB 4FUDA 2A32A 2C90B 1O2KA 3BTME 4OS1A 2AMQA 4Y10E 4UONA 2TGAA 2Z9KA 4UFEH 4I8HA 4INHA 1D4PB 1LVBA 2KAIB 4MNXA 3A8AA 1TE0A 1ZPCA 1AUTC 2NU0E 1GDQA 5DP3A 5EQSA 1L1NA 1K1NA 1H4WA 1SOZA 4MPVA 5T6DA 1ACBE 4IN1A 2ANMH 2ZDLA 3PB1E 1V2NT 3GY4A 4RKOB 4X8UH 1K21H 1OX1A 1F5LA 1PQ7A 1O3PB 1NROH 5C20A 5FBEA 2AYWA 2Z9GA 3RDZA 1ZJKA 1TOCB 5TJXA 2FX6A 4X6NA 1LHDH 2PUXB 1QB1A 4YLQH 3TH2H 1TRMA 3M5OA 3UQOA 3AASA 4BANB 2G4TA 3LONA 2FS8A 4Y76A 3SV7A 1ELGA 3BV9B 1FXYA 3OU0A 2Q6GA 1C5UA 1EASA 1JMOH 1QRZA 1TB6H 2ZP0H 1LMWB 1V2RT 5C1YA 4UFFH 4MVNA 1EJMA 5HYOA 4INKA 4HZHA 1T4VH 3A80A 3SNDA 3BTWE 4BTUB 5A0BA 2FS9A 2C8YB 3KHVA 4WXIA 1XMNB 4BOHA 4NZQA 1HBTH 2VVVA 2NU1E 1N1LA 1PPZA 3SJIA 4FUHA 1JXPA 1A5GH 3MYWA 1AD8H 2QXGA 1SHHB 1OSSA 2H6MA 2WPHS 2ZGXH 1Q3XA 1MD8A 3BIVH 1O3HA 3VGCB 1WQVH 3HKJB 3EA9A 3OY6U 3Q3XA 1P03A 2C8WB 1ORFA 1AVXA 1D9IA 4WXVA 1LVOA 1PPHE 2H9EH 1MMJN 4NWKA 5DGJA 1O2JA 2H5CA 1C5XB 2XBVA 1S82A 2G5VA 4KGAA 1H1BA 1K2I1 1GBBA 1A0JA 3A7XA 2UUFB 3A88A 1BCUH 2AH4X 3V0XA 1A5HA 1QA0A 3K65B 1GI2A 1GL0E 3N7OA 1AQ7A 1UHBA 2ZNKH 3QTOH 5JBBS 1GVZA 1AB9B 5A8YA 2PV9B 1V2PT 4BAHB 1CHOG 2PTCE 2DE9A 1L4DA 4JYUH 2Z3DA 2PGBB 2A0QB 4DCDA 4D9QA 4R8TB 1K9OE 2JKHA 2PW8H 3GICB 2OBOA 2BDAA 3M3SA 3LKWA 3M7UA 1DY8A 2ZFTA 2D26C 2WV4A 2CF8H 1GCTC 1XUIA 2G81E 1L1GA 2BY6X 3LJOA 4GUXA 2R0KA 3M5LA 3QGNB 1AHTH 3A7VA 4K5ZA 4UEHH 4Y0ZE 1TNLA 2BOHB 4B2BA 1C1WH 4AFUA 4MG3A 1O5DH 5F03A 1KTSB 2BDGA 5IYTA 1QQ4A 3MO9A 2C8XB 1J16A 1IAUA 1RGQA 1GHAF 4FUJA 1C5WB 2VVUA 4DIIH 5E0HA 2YNBA 1WTGH 1NRQH 4A1VA 3ZZCA 5BPEA 1Z1JA 5FCKA 4GSOA 2PUQH 3C1KA 4SGBE 3T62A 2ZTYA 3BTFE 1O2MA 4O3UA 1BIOA 3SI4H 5L2YH 2FPZA 2UWLA 1YKTA 2CXVA 3SV6A 1D6RA 2TRMA 4AG1A 3M3VA 1O5BB 1ETTH 2IOTA 1IQMA 1DY9A 3ZZ4A 1FY1A 2THFB 3SNAA 4LZ1H 4NSYA 1C2EA 4LZ4B 1QL9A 6CHAC 5L6NH 2Z7FE 1C9TA 1ZZZA 3UOPA 3RU4T 3MO6A 2Y7XA 1GI7B 1GDUA 3PM3A 4ESTE 3RMNH 1O2UA 1C5MD 1S5SA 4FU8A 1L4ZA 5DP5A 3RXVA 1UTPA 1V3XA 4Q7ZA 1O3OA 1QRXA 5EGMA 1GJDB 3BTDE 2R9PA 1LVMA 1O2IA 3PMJA 1NS3A 1PPCE 1O3GA 1G30B 1P11E 2VIDA 5ESBA 1C1MA 1Y59T 4DT7B 2P95A 1EPTC 1BJVA 4AORA 3NXPA 2P94A 4J1YA 1O3EA 1N6YA 1G3EA 1UTJA 1O5AB 1IQLA 1C5SA 1SGCA 5A0CA 2OINA 2NU3E 3RXAA 1JRTA 1NRSH 1GMCG 1DE7H 1DITH 2FI3E 3JZ1B 1O30A 4ISOA 2R2WU 3RXTA 5GWZA 5F8TA 4YT6H 2BDYA 1MTSA 1O33A 3ZZ3A 1TRNA 1HIAA 1JIRA 1ZPBA 2BB4A 2W7SA 2A4GA 3ZVBA 3MU4A 4K60A 7GCHG 2VIWA 3TITA 2A7JA 3FZZA 1W8BH 2SFAA 2BDHA 1Y5BT 5EQRA 4CRAA 1D6WA 1O2SA 1O3BA 1OWKA 1KTTB 2ODQA 2VINA 2QY0B 2W5EA 1QJ7B 4IC5A 4TY7A 1FN8A 3SNBA 3RLYH 2ZFQH 1D3QB 1DVAH 4KP0A 2PKSC 1V2LT 1KXDA 1Z7KA 1SGFA 4BAOB 4X1PU 3P6ZB 1L0ZA 1A0LA 4TPIZ 4DW2U 3V3MA 3QK1A 1SMFE 1GBDA 2VB0A 3GDSA 1QIXB 2BD3A 2CJIA 3LGTA 1F0RA 2ZCKP 4ZHLU 5HM9A 4H6TA 1TQ0B 4ABHA 1EX3A 1KXAA 5A2MH 2GT7A 2ZGCA 6CHAB 3MH7A 1FAKH 2OUAA 4ASHA 2WYJA 3LDXH 1KXFA 4NG9H 5HM2A 1K1JA 1G37A 2CF9H 1JIMA 3FFGA 1GBTA 1UTQA 5AHGH 2GX4A 5B6OA 4QT8C 4WY3A 2FOGA 1V6DA 1C9PA 2GDDA 1WU1A 1F0UA 1FI8A 2ZPQA 1LCYA 2GP9B 1N8OC 3H7OA 2XRCA 3E0NB 4TWWA 2CN0H 1ESBA 1QBVH 2W3IA 1OP2A 3H7TA 4K1EA 4YOIA 1HNEE 1GJCB 1EPTB 1AKSB 1UJ1A 2ZCLP 4Y8XA 1GI3A 2Y5FA 1OYTH 3P8FA 1GJ9B 1Y3WA