2ZU5A

Complex structure of sars-cov 3cl protease with tg-0205486
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Inhibition Specificities of 3C and 3C-like Proteases by Zinc-coordinating and Peptidomimetic Compounds
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 87
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2zu5A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zu5A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zu5A02
3SV6A 3KQBA 3KIDU 3BTQE 3BG4C 2VB0A 3MWIU 4Y10E 5TCCA 1P3EA 3AAUA 3SU5A 1H8DH 3P8FA 4XBDA 1N6YA 1RTKA 4BNRA 1O3MA 3PYHA 2BQ6B 1PPHE 1UTLM 1MTSA 3SU2A 1AGJA 2CHAB 2HNTC 2M5TA 3S9AA 2VVCA 1GBDA 2J38A 2A4OA 2H9TH 1O2YA 1AKSB 1P05A 1QB1A 2WUBA 2ZDVH 4I32A 1BUIA 1A4WH 3E8LA 2V6NA 1D9IA 2ZA5A 2ZCLP 4X1RU 2XWBI 2GZ8A 1IQMA 5J4QA 1LO6A 4BTTB 4UDWH 1SVPA 1O2VA 1LVMA 1ZHPA 1IHTH 2V3HH 1QGFA 1VITG 5LPRA 1LTOA 1SI5H 2HRVA 2AMQA 1EX3A 2G00A 3A89A 2R0KA 6GCHG 3UNSA 1DWCH 3S9CA 1ZMLA 1Y5UT 1IQEA 2CXVA 3QGNB 1O2NA 2A2QH 1BQYA 5HYOA 3VXEH 1BTWA 2PUQH 2A7JA 4ZKNU 5IDKA 3H5CB 2QF3A 1OYTH 4Y0YE 4YLUA 4MLFB 2RA3A 2VIVA 1TMUH 2Y81A 3QK1A 1GJ4H 1EUFA 3LDXH 7LPRA 2FMJA 2FOBA 3MO3A 5A0CA 5C1YA 3MU0A 4X1PU 3RXVA 2J4IA 5I25A 1EATA 1CSOE 2GV6A 1P2QA 1KXFA 2XTTB 1MZAA 1GVKB 2CGAA 4MDSA 1FY5A 2VWMA 4BAQB 1ZPZA 2IN2A 5DP3A 1G32B 3B23B 2VIPA 3M5LA 5LPFA 1CBWB 4ZKSU 1MD7A 1C1MA 1NFWA 1C1WH 3ZZ9A 2WPKS 5BRRE 3K2UA 5C1UA 4BAHB 2VGCC 2H5DA 3HPTB 3LGWA 1Y8TA 2TGTA 1WSSH 3GCTF 1AZ8A 1DS2E 3SU1A 1OKXA 1UTPA 1G37A 1L0ZA 2WINI 1SL3A 1BCUH 4RN6A 2BDBA 2OQUA 1K1MA 1TPSA 3SV2H 4Q80A 1FJSA 1C9TA 2P93A 1V2TT 1AIXH 2ZKSA 1TGTA 1GJAB 3LGUA 5JB8S 1DWBH 2RA0A 4GHTA 3S0NA 5EODA 1GCTC 3OYPA 4X6MA 3MFJA 1SQAA 5DP7A 3NZIA 2QGRA 3E6PH 4MVNA 4YLQH 1HAYB 1SBWA 1MU6B 3BV9B 4ISOA 5CHAB 3KQDA 4MNVA 8ESTE 2STBE 2ZHDA 3AW0A 1LMWB 2BY8X 1THSH 2GCTB 4IW4E 4MNXA 3WY8A 2SNVA 2EI6A 3VB5A 2TIOA 3LH3A 1HUTH 1ELDE 2HALA 1ARCA 1NFXA 3R3GB 4ABDA 1S6HA 1MH0A 3MH7A 1LVYA 1OP8A 1V2MT 5C2ZA 3ZZBA 2TGDA 1SLXB 3H7OA 1O3GA 3PWBA 3F9FA 4HTCH 3GY6A 1QTFA 2SGPE 1BA8B 2LIZA 1KXCA 2PKSB 1OYQA 3RXIA 4X6OA 3TVJB 5A09A 2FOHA 4K69A 2OINA 1KDQA 4NFFA 2VH0A 2FX6A 1LHCH 1IQJA 3GY8A 1A0HB 1SGNE 1GHXH 1EZSC 1GDQA 2KAIA 1QBVH 1JRTA 1AZZA 1H9IE 4X6PA 3U8OH 1UO6A 2SFAA 1S83A 2C90B 1YPGH 1ZSKA 2AMDA 1DM4B 2B9LA 3BTWE 1KIGH 2D26C 5PTPA 4XBCA 1GI1A 1CA0B 3EAJA 2VGCB 1NROH 1HAIH 1TQ0B 1UK3A 1AO5A 2ZQ1A 2TRMA 2Z3EA 4TY7A 1HIAA 2AEIH 1FI8A 1OWJA 1HIAB 3P70B 4FXGH 2FLBH 1GI4A 3KGPA 1GBKA 4ZMAH 3BEUA 1J15A 3JZ2B 1UVTH 1A0LA 4OS6A 4CRFA 4AYVB 2DE8A 4BOHA 4YOIA 3RXBA 3EYDA 3KQEA 2A4RA 2FDAA 2HPQH 2VNTA 3S69A 1TWXB 2ZFRH 1LVOA 1LQEA 1C5WB 1BOQA 3Q3YA 5L6NH 3B9FH 3MO9A 1WTGH 3MYWA 1ELAA 3ZZ7A 4XBBA 2XWAA 1O2IA 1QFKH 2A0QB 2VIWA 2BX3A 1EPTB 1XMNB 1MAYA 2AIPA 1GBMA 1CHOF 1H9LB 1IQLA 4X1QU 4ABHA 1O2XA 2ZI2H 3M7QA 3SNBA 1ABIH 1OP0A 4AB9A 1LKBA 4LOYH 2H2ZA 1O3HA 1S85A 1CGJE 1O3BA 3SNDA 5JPMH 4U32A 3QUMP 4CH8B 1CT2E 2GT7A 1SGYE 2FOCA 9ESTA 1QA0A 2BVXH 2PUXB 2PW8H 3BSQA 4XFQA 1C2EA 2BDYA 1GHBG 5FX6A 5BPEA 3KNXA 4ISNA 1FN8A 2BD5A 5CMXH 5LPEA 4E05H 1SGQE 3DT0H 2ZGBH 3F9GA 1E0FD 2JKHA 4Y7BA 1P2OA 1DX5M 1SOTA 1VR1H 4I8JA 5DO4H 2O8MA 5EXLA 5AHGH 4HI3A 3EGKH 4WMDA 3A7ZA 3MMGA 2A5KA 2STAE 2VWLA 4IN1A 3BTGE 3CS0A 1FPCH 1SOZA 1SFIA 4XDEA 1AFEH 3LH1A 3ZVEA 3ZVFA 1MCVA 2XC4A 3TH3H 2BDIA 2O8LA 1JIMA 1IOEA 1P2JA 1HFDA 3V13A 4ESTE 3HK6B 1QQ4A 4KGAA 1Y3WA 3UWJH 3LJOA 2SGDE 3EA8A 1E37B 3TU7H 4MTBA 1C5QA 2W26A 3I77A 4E7NA 3TITA 1FAKH 2OC7A 4AFZA 1EZQA 3NPSA 5E0JA 1D3DB 1MKXK 3SUDA 3QZQA 2ANYA 3VPKA 1UK4A 4R8TB 3S9BA 1ZRKA 1GBHA 1GJ5H 4HZHA 4DCDA 4Y7AA 3BTHE 5JB9S 1TRYA 2FP7B 5FPTA 2V35A 1Z8IB 1YPKH 1GHBF 1TMTH 2PGQB 2R0LA 3QTOH 3GCTG 3RXPA 2VINA 1TAWA 1DLKB 4KTSA 2BDHA 4Y8XA 4OS7A 3QO6A 1IQNA 1NRPH 2CF8H 3ZVCA 1MCTA 2H5CA 1O39A 1ELTA 4X2WA 5LGOA 1SR5C 1ESTA 2W5EA 1H4WA 1HNEE 3GYMA 2ZDAH 4O3UA 3GCHB 1N6XA 1QJ1B 4D8NA 5F6MA 1UTMA 3MU1A 2NU1E 1JBUH 4Q7ZA 1QL9A 3FP7E 1D3TB 1ID5H 3U98H 1TBZH 2FM2A 5FXLA 1C2IA 1N8OC 2WYGA 2ZU1A 1C5SA 3RXKA 1BMNH 4FU7A 1AE8H 1O0DH 3SHAH 2OBQA 3EBNA 4NCYA 3ZVGA 1GBBA 1P3CA 3RU4T 3M5MA 3UNQA 2J2UA 1LHEH 1GCTB 3GICB 1TALA 1ZLRA 3RMLH 2TBSA 1GBLA 1C4U2 1GDUA 1CGIE 3K9XB 1FY3A 1T8LA 1DY9A 4ZHAA 1NRRH 7GCHG 4GSOA 1TYNA 1OWHA 4BTIB 3M3TA 3RU4E 4AFSA 3TGKE 2ZTYA 4KKDA 1O2TA 3T25A 2HWLB 1JWTA 2CJIA 1AWFH 1TPAE 3PO1C 1KSNA 4FUCA 3DFJA 1C9PA 1C5PA 4U2WA 1HDTH 1A5IA 5HM2A 1MBMA 1WTHD 1MZDA 3A86A 1TMBH 2FYRA 4AORA 4AG1A 3SO3A 1V2WT 3JZ1B 4ZXYH 4PROA 1YC0A 2GDEH 2G55A 1E36B 2J92A 2NU2E 3LGYA 3TPIZ 3ZZ4A 3DA9B 2TPIZ 1QBNA 1W7GH 1XUIA 2GTBA 4WH6A 2H9EH 1EOLA 3HKJB 4AX9H 5F8TA 4O97A 1ZJDA 2UUJB 2ZGJA 4OGXA 2ZU5A 1Y3UA 1YPLH 1DSTA 1QHRB 2W3KA 5A0BA 3GISB 3OTJE 1DPOA 1RTLA 1XUHA 1MAXA 1MD8A 2AYWA 4UE7H 2GX4A 1TNIA 3PB1E 1GBAA 3ELAH 3ODDA 4Y0ZE 3VGCB 1AVXA 4H4FA 1NC6A 3SW2B 1O33A 5DK1A 2G4TA 1B0FA 1NFUA 2JETC 1PYTD 1SB1H 4OS4A 1AFQB 3BTFE 3FP6E 1S0QA 3HKIB 3RM2H 2BYAX 3RXLA 6GCHF 6LPRA 1QIXB 2PTNA 2VVVA 1C1OA 2ZDMA 4D9QA 1LCYA 1QA7A 4NZLA 2Y7ZA 1TGCA 1AFQC 3RXDA 2ILNA 2O9QA 4JZIA 1O3EA 1HLTH 3A84A 2FOEA 1OOKB 1O2MA 3ZZ5A 3STJA 5C3NA 1U6QA 5J4SA 3UOUA 1NFYA 4LZ1H 2QXGA 1GHZA 1Q3XA 4Q2KA 5HGGA 1KTSB 3MTYA 1BBRE 2ZU2A 1BBRK 3QGJA 2VIOA 4X2VA 3TGIE 2BDGA 4UFDH 4WF8A 3RXMA 2FOMB 4CRAA 4GAWA 1ZOMA 2PKAB 1ANBA 2A31A 1QB9A 3MH6A 4F4OC 5A0AE 1FIWA 2BY7X 2NWNA 1YCPK 5EPNA 3LIWA 4JZDH 3QX5H 3I78A 2BY6X 5GDSH 2SGQE 4NIWA 1OWIA 2A2XH 2FYQA 5TJXA 2OC8A 4CH2B 1YPHE 1YKTA 2BLOA 1HRTH 1C2MA 1TFXA 2G8TA 1LHDH 2Q6DA 3C1KA 4FUEA 5AFZH 3TIUA 5FCKA 3SJIA 5DPAA 1EJAA 2QN5T 1TONA 1GPZA 1MMJN 1GJBB 5C20A 3F9HA 1NO9H 3IITA 2GZ9A 3HGNA 2W7SA 1ZPBA 2ZF0H 1HAHH 1C5MD 3W94A 1QL7A 2A7CA 1FY1A 1Y3VA 2Y80A 2GMTB 5DKMA 3CS7A 2C4FH 1P2NA 1K21H 1V2ST 2P16A 3BIUH 3RMOH 1BITA 1V2RT 3M37A 1VZQH 1ZGIA 1P2MA 2ZFSA 1PYTC 1TOCB 3CENA 3F9EA 1RIWC 3TK5A 2GP9B 2BZ6H 2ZEBA 8LPRA 4YT7H 1SLWB 1NU7B 3BTDE 5T6DA 4D9RA 1G3CA 1Z8RA 2FWWA 2VH6A 1J8AA 3LGVA 3BIVH 8GCHF 1P03A 2F9VA 2R2WU 1T8OA 2Q6GA 1ELVA 1S84A 1Y5BT 5FPYA 3U9AH 2ALPA 3PWCA 2ZQ2A 1BJVA 3VEQB 1BTUA 2BZAA 5G4BA 1QRZA 2R9PA 2EA3A 3TNTA 3T62A 3SV8A 2P94A 3P8NA 1EXFA 2OUAA 4AOQA 5JDUB 3VB6A 3SNCA 1C2JA 3CP7A 3TJVA 1PPFE 1DXPA 1A1RA 1V2UT 3IWMA 3TGJE 2OC1A 3V7TA 3E91A 1ELEE 4FUFA 1CQQA 3MNCA 1T31A 3MH5A 2Z9LA 3M3SA 1FXYA 1HJAB 1GCDA 2AFQB 5AFYH 7GCHF 3E0PB 2G5NA 2CN0H 1LHFH 2ANKH 4GUXA 4KTUA 5FBEA 2V3OH 4NG9H 5EU8A 3PTBA 4AN7A 4MG3A 1W2KH 3QZRA 4OS2A 2ASUB 3GOVB 3P92A 2ZGCA 3P8OA 3TH2H 1A46H 1WYKA 2B0FA 2PHBA 2GZ7A 4NWLA 2AH4X 3MNSA 1O3AA 4WWYA 2D2DA 2P95A 3SV9A 5LH8A 1O3JA 1QB6A 3DD2H 2UWPA 1YPEH 4IMZA 2D8WA 4HFPB 4GCHF 2Z7FE 2O8WA 1P11E 1TNHA 1J9CH 2R3YA 2CHAC 1O2JA 3L33A 1GHWH 1EJNA 1ELCA 2TGPZ 2NU4E 1GI7B 2VWNA 2WPJS 1GBEA 4UFGH 1BRAA 4LXBH 2ALVA 4AGJA 4UFFH 1VITF 1NPMA 1P0SH 1PQ7A 2FTLE 1SGPE 1XM1A 3NKKA 5C5OA 3Q77A 4DURA 1C5RA 1XUGA 2J94A 3GDVA 3ZYEA 2GMTC 2HLCA 2BD7A 4NSVA 1G3DA 1A7SA 1TNGA 3BTEE 1DLEA 3P95A 3LU9B 2ODYB 1MQ5A 5EG4A 2ZCKP 4B1TA 1E34B 1MKXH 5TCAA 2I6QA 3KQCA 4FUHA 1KXDA 1MBQA 3ZZ6A 2OTVA 3FZDA 1AY6H 2A7HA 4ABGA 1ANDA 4INKA 2G51A 4DIHH 1O2HA 1TGBA 1KXAA 2ZFQH 4J2YB 1UTOA 3S7HB 2YNBA 2ZPSA 5F03A 1CT0E 1YBWA 2ZZUH 3RXEA 1O30A 3A8BA 5I46H 5FAHA 1GJ6A 4MPVA 2W3IA 4WXIA 5K7RA 1GGDC 4JYUH 1TABE 3SJKA 4D76A 4RKJB 1PPBH 1C2DA 1ZSJA 2B8OH 1V2QT 1P10A 1O3DA 3GCOA 2FTMA 1ZTKA 4DY7B 3ZZAA 1SLUB 3UOPA 3A83A 1ZJKA 3LGTA 4I8GA 4WY3A 3MU8A 3QLPH 2BD4A 1ZRBA 3BF6H 2FXRA 1UJ1A 2FEQH 1GHVH 1O5CB 1HPGA 1FNIA 2Z6BD 5CE1A 2AERH 2QXJA 1CT4E 1C2KA 2FPZA 3UQOA 1ZMNA 5L2ZH 3QTVH 3VB4A 3FAOA 1G9IE 1C1TA 2LNCA 1SGEE 4ABAA 4FVBA 4KELA 4BAMB 1MTUA 1GBCA 1P04A 4ZKRU 4H6SB 1L4DA 1LKAA 1C5ZB 2BDCA 4FUBA 1P01A 4H6TA 1L2EA 1XUJA 3OX7U 3RXFA 4ABIA 2BXUH 5E8EH 2Y5HA 5L2YH 2F9UA 4CR9A 3ATLA 1GBIA 1SGRE 3BTME 5FX5A 2JH6D 1TE0A 3S7KB 3SJOA 5FCRA 2BTCE 1O2WA 3Q76A 1EAUA 1O3KA 3RU4D 5ESTE 3SN8A 6CHAB 1VJAU 3NUMA 4CHAB 4IMQA 1O2PA 1A3BH 1W0ZU 1K2I1 1SC8U 2JH0D 1G2MA 4MQAA 3NK8A 4E7RG 1MTNB 1HGTH 4CBNA 4K1SA 1DFPA 3GYLB 3UR9A 4YOGA 1C5NH 5AF9H 3Q3KA 1C5YB 1C1PA 3LPRA 3UQVA 3MHWU 3SUEA 5DP4A 1CA0C 2ZDKA 2LPRA 4Y76A 3D23A 1D6RA 1EAIA 1FLEE 1PPGE 4FUJA 4Q7XA 3N7OA 4CRGA 1DICA 1WAYB 4K3JA 4VGCC 1Y5AT 4D7GA 1O3LA 1YCPM 4TPYA 2EI7A 2ZFPH 3F6UH 2ULLA 3MNXA 2FX4A 5EW1H 4AZ2B 1TX7A 2FI5E 4K5ZA 3PMHB 1OXGA 2ZU4A 3U8RH 1XKBC 4ZXXH 2UUFB 3SU6A 4CRCA 1GWAA 2FIRH 1ETTH 1DSUA 1BT7A 4OS1A 2ZIQH 2K7XA 4BTUB 4JK6A 5A8XA 3ZZCA 1ARBA 1E38B 1F5KU 2AGIX 3LGIA 2VIQA 3NCLA 1NN6A 3PTNA 1BMAA 7KMEH 1NTPA 1O2LA 3RXQA 3AW1A 3PROA 1O36A 1DITH 3BEIB 3OY5U 1NU9A 3BN9A 3D65E 4ABJA 1XVMA 5EGMA 3RXRA 3STIA 2C8XB 1XUKA 1UTKA 2HNTF 1TNJA 3E1XB 1O2KA 1OS8A 3GDUA 3T26A 3U1JB 5DJ7A 3D62A 5JBCS 1O5EH 3B8JA 2PR3A 1C1UH 2G81E 1GBTA 2GCHG 3HATH 1TBRH 4ABEA 1K1NA 1EQ9A 1EB1H 2BX4A 2A32A 2OCVB 1HAGE 3A8CA 1UTQA 1BTZA 3RXUA 1IHSH 4O3TA 1ANEA 2CF9H 1FAXA 1THPB 3NXPA 2BD9A 1C5OH 1O2UA 2GDDA 1GJ7B 1O31A 1A0JA 1O37A 1TRMA 1GG6B 4IC5A 1NS3A 3PMJA 5A8ZA 2J34A 5ETXA 3O8RA 2BMGB 1O3PB 4BAOB 3PLBA 2QXIA 2THFB 3A81A 2NU3E 3O8BA 3NWUA 3ODFA 1DWDH 3KEEA 1G3BA 3LT3A 3LOXA 2B5TB 3RMNH 2QA9E 5ABWA 1XVOA 3E0NB 2IOTA 2XXLA 4AG2A 1BTPA 4FU8A 1ORFA 3OU0A 1HV7A 2UUYA 4AFUA 3MU5A 2Z9IA 2VWOA 5L30H 2BM2A 2R2MB 2ZHQH 1TPPA 1ACBE 2BLWA 1MU8B 3C27B 1V2NT 1MTVA 4DOQA 1C2GA 1ZR0A 3ZZDA 2HNTE 4YOJA 3SBKA 2PKAA 1EAXA 1GI6A 1GL1A 1P57B 1BBRH 2FOAA 4CBOA 1P06A 5HMAA 5JBTA 2ZPRA 4KP0A 1KYNA 2QC2A 1SQOA 1UCYH 2R3UA 4J1YA 4MPXA 4UD9H 3TK9A 3SZNA 5GIBA 5T3HA 1RJXB 4A92A 4JZFH 4YTAA 2FODA 4JCNA 3QN7A 5F8ZA 2Z9JA 5T6GA 3K65B 1C5TA 1TNKA 1GMHG 1C5LH 1YCPH 4Y8YA 3A82A 2ZGXH 4ISHH 4B2AA 1CBWC 1O5AB 2PV9B 3R0FA 1MTWA 1E35B 2RDLA 3RXTA 1YLCA 1RS0A 4CRBA 1L1NA 1SSXA 1P9SA 1V3XA 3MI4A 1BZXE 5EPYA 4B74A 2A4QA 8GCHG 1D3QB 4XOJA 1B5GH 1Y59T 4I8KA 3SUFA 1ETSH 2AS9A 4ABFA 1AB9B 3EQ0H 3L6PA 1W3CA 1NRSH 4FU9A 1S81A 2OC0A 4K2YA 1BRCE 2PSXA 1OSSA 2UUKB 1HAXB 1W11U 2JETB 3RXHA 1QJ7B 1J16A 1CGHA 1DWEH 2FZZA 3VFEA 4AFQA 1KTTB 1WCZA 3T27A 2V0BA 2ZDLA 3TJOA 3VB7A 2BOKA 4F49A 4ZROA 3ITIA 2HOBA 2FOFA 3T28A 1QNJA 4OGYA 4WMEA 4U30A 1YLDA 1PQ8A 1EJMA 3EA7A 1BHXF 1QY6A 4UONA 3P17H 1V2VT 3DUXH 1OWDA 1PQAA 3V3MA 1KLJH 1W0YH 1WQVH 1AUTC 2FI4E 1AB9C 1QRXA 5DP5A 1AN1E 1MKWK 1GI3A 4ZUHA 2OD3B 2SGAA 5GJ4B 2XC5A 1NRQH 1GJ9B 3SNAA 1O2QA 1YYY1 1K1JA 1VCQA 2XBWA 4U01A 1AKSA 2FO9A 1H9HE 6CHAC 2QV1A 4IS5A 3RMMH 1Q31A 2F3CE 1KDQB 4MPUA 3Q3XA 1EPTA 5FHTA 4UEHH 5A8YA 1GDNA 1W7XH 1VCWA 4JZEH 1YGCH 1OWKA 2O8UA 2XYAA 2PWXA 1ZHRA 2QXHA 5EQSA 2WV5A 2O8TA 3SGBE 3T2NA 3SU3A 2WPHS 2ANMH 1GBJA 1AI8H 3KN2A 2ODPA 1UK2A 2Y7XA 1G36A 2BHGA 3U69H 1KY9A 1HAVA 2ZTZA 3DHKH 4AB8A 2ZC9H 2PTCE 1ELGA 1P9UA 1NM6A 4TWYA 1C2LA 1D3PB 1Z8JB 4FUDA 3P6ZB 4NWKA 5GXPA 1NESE 2IPHA 4X8TH 3LJJA 1B7XB 2ZG0H 3TJUA 2SGEE 1W8BH 1BTXA 1QURH 1TGSZ 3LKWA 4Y6DA 5DP6A 2PKSC 1ETRH 2BXTH 4Y8ZA 1GI9B 1A3EH 4LK4A 1LPKB 1UHBA 2RCEA 1AHTH 3U1IB 2PGBB 5DP8A 1BTHH 2QYIA 1DUEA 6ESTA 1MQ6A 4O03A 4AGKA 5HXFA 1TNLA 1J17T 2BDAA 4NA7A 3SU0A 2F9BH 1BRUP 3BG4B 1FONA 1FPHH 3RM0H 5T6FA 1QBOA 4QT8C 1JMOH 1C4V2 1TOMH 3SQEE 2C3SA 1XUFA 5GCHG 1K9OE 2ZU3A 1G30B 1QJ6B 1RGQA 2B7DH 4BAKB 1CHOG 2ESTE 2ZP0H 1HAVB 4WMFA 4DIIH 1UMAH 3RXSA 1UTNA 3GDSA 2A5IA 1HB0B 3RC5A 2BQWB 2GD4B 4ISLA 1WBGB 4B2BA 1Y3YA 1C2HA 3M5OA 4INHA 4DT7B 1YP9A 1C2FA 1FQ3A 1P12E 3ZVDA 2OQ5A 2C8YB 3MH4A 1SG8B 3TNSA 2P3FH 1V2JT 1CO7E 1TGNA 3M5NA 2XCFA 1UHBB 1FV9A 4Y11E 1F0SA 1SGFA 3ATWA 1V2KT 1SPJA 1QL8A 1V2LT 1VGCC 3E90B 1WUNH 1ELFA 1PQ5A 5EW2H 1EZXC 3URDA 2DUCA 1V2PT 4CHAC 1F0TA 2ZPQA 1WV7H 2K1QA 1TQ7B 1TB6H 5H4IB 3A8AA 4FUIA 1UTJA 2Z9GA 4WVPE 3AVZA 4DGJA 1GMDG 1O3OA 1SFQB 1NY22 4JK5A 4NA8A 3FVFB 4BXSA 3ZZ3A 1HBTH 4CRDA 2SNWA 1J14A 4KTCA 2BLVA 1ZTLA 4JYVH 5C67A 1RFNA 4GLYA 3RC6A 2P3TB 3BTKE 4X8SH 2I6SA 5DGJA 4YT6H 1K28D 1CHGA 5GPIB 1TX8A 3SHCH 1CE5A 1C5UA 1QCPA 1GJ8B 1MUEB 1WOFA 3UR6A 4JZ1A 1CU1A 1BB0B 2Y82A 2FESH 5B6OA 4NZQA 1W14U 1O3CA 3K6YA 3T29A 2F9OA 4UFEH 2J9NA 3RC4A 1KXEA 1CVWH 3M35A 1GVLA 1UVUH 5EQRA 3PO1B 2P3UB 2FOGA 3OSYA 1EKBB 3SORA 3AAVA 1AE5A 1Y3XA 1O2OA 4X2YA 4X6NA 4SGAE 4K8YA 1RD3B 1A5HA 3D49H 4GCHG 4B73A 4DG4A 4CR5A 1T4UH 4B2CA 1BJUA 1TA6A 3A85A 1K1OA 1QR3E 3BG8A 1GMCG 4B75A 1EP6A 3DFLA 2BD3A 1ZYOA 1FDPA 1O35A 1ZSLA 1TA2A 2QAAA 1K1LA 2OBOA 1B0EA 3K6ZA 4WJG2 1O3IA 2G4UA 3VGCC 3A7WA 1RXPA 1F0RA 2GT8A 2VIDA 1GGDB 4WH8A 4I7YH 1F2SE 2XNIA 2G5VA 1FZZA 1PFXC 1AUJA 4FUGA 2Q6FA 1JRSA 4SGBE 1ABJH 1YPMH 3PLKA 1O5DH 1FIZA 4Y71A 3AASA 1UCYE 3GCHC 1BHXB 5EOKA 1YF4A 3P8GA 2AIQA 1NT1A 2G52A 1HAPH 3UTUH 5E2PA 2P8OC 1QRWA 1DVAH 4ZH8A 1N1LA 1YPJH 5DG6A 3PLPA 3UY9A 2PFEA 2ANWA 3A7YA 1YM0A 1GG6C 1MTNC 5ESBA 3ATMA 4IGDA 1EASA 1C1SA 4TY6A 1INCA 1P8VC 4ZKOU 3F68H 3TK6A 3U8TH 3GY4A 2OLGA 3O8CA 1UVSH 5E0HA 3FANA 1OX1A 3URCA 1KLTA 1T32A 1NZQH 3TH4H 1S5SA 1IQHA 1LPGB 1W13U 2CV3A 1S82A 2QF0A 1LDTT 2Y5GA 3PMAB 2BVRH 1H1BA 1ANCA 1P2IA 1BIOA 1O2RA 3RXAA 3UUZA 1XKAC 4Y79A 3HK3B 4NIXA 2F83A 3ESTA 1SHHB 4Q7YA 2WUCA 1X7AC 1OWEA 4GHQA 1TX6A 2WYJA 4MNWA 3TLOA 1SHYA 1AD8H 5DP9A 4TWWA 3UREA 9LPRA 1JIRA 3UFAA 1A5GH 4R0IA 1UCYK 3MU4A 1HCGA 2UWOA 1LPZB 4E06H 2Z3DA 1GJCB 1Z1IA 3T5FH 1D4PB 4Z0KA 1AU8A 1JOUB 3L3TA 4O9VA 1GL0E 1SGCA 1V6DA 1OP2A 3ZV8A 1KLIH 2PSYA 1WU1A 3RUOA 4A5TS 2TGAA 4OS5A 1BRBE 2C93B 1GMHF 2H9HA 1IQKA 1PPEE 2XBVA 3SUGA 1AQ7A 1BTYA 4NA9H 2P59A 4X8UH 1AVGH 2BB4A 5FBIA 1VITH 4IN2A 1IQFA 2A45B 5EXMA 1RTFB 1BMLA 4A1XA 5EXNA 1IAUA 1ZZZA 2VVUA 4D7FA 3BEFB 3F1SB 4K1EA 3UIRA 1XXDA 1F7ZA 2BQ7B 1ZMJA 1Z71A 3QWCH 1GHAF 1HXFH 1N8OB 1SGFG 4A7IB 1HJ9A 2Y5FA 4X8VH 3A7VA 2VJ1A 3KL6A 5C1XA 1D6WA 1GI5A 2GV7A 4H42U 3RLYH 2IJOB 3V0XA 1P2KA 4ZHLU 1T7CA 2BY5X 2XW9A 1C5VA 1O3NA 4K8BA 3SGAE 3ZYDA 3ZVAA 1T8NA 1FY8E 1BDAA 3MOCA 3RXJA 2D1JA 3M61U 3GCNA 5HM9A 4NIYA 2P8OB 3SQHE 2Z3CA 4X1SU 1ZPCA 1C1NA 5F8XA 3W95A 4A6LA 1W12U 1FUJA 5JYIA 1CA8B 1ZGVA 1MKWH 1O2GH 2XC0A 1ELBA 4ISIH 4ZHMU 1DY8A 4XSKU 2FS8A 3KHVA 4TPIZ 1GI8B 2Z94A 1SGIB 4NGAH 1SGTA 2A4GA 4RKOB 1PPCE 1HYLA 2F9NA 1FMGA 1C1QA 1O5BB 3IG6B 4JYTA 4DW2U 1IQIA 3LONA 1DT2A 2J95A 1IQGA 1EP5A 3PMBB 3QDZB 5IYTA 3RXCA 5EQQA 1O2ZA 4GPGA 3ZVBA 1ESAA 1T4VH 1BMMH 3ATKA 1ZHMA 2ZO3H 4DJZB 4YESB 1GHYH 3FP8E 2ZNKH 4I31A 4ABBA 5JBAS 4YO9A 1Z1JA 5E2OA 3OY6U 1LVBA 2JH5D 4MPWA 4INLA 2GCHF 1S0RA 3SU4A 3LC5A 2Y6TA 2OXSA 1EZUC 1C1RA 1SMFE 2GKVE 1L1JA 2XCNA 5CHAC 4Z6AH 1GBFA 3A8DA 1XX9A 7ESTE 1TBQH 1OPHB 1C4Y2 3SV7A 3KCGH 1UVPA 2EI8A 4JMYA 1DE7H 3SJ8A 1F92A 2VU8E 3SI3H 1WQSA 4WXVA 1EAWA 2FLRH 4DVAU 1H8IH 4NFEA 2ZWLH 1O5FH 2AGGX 3MNBA 2HGTH 1GMCF 1XXFA 3A7XA 4YM9A 2A1DB 1SQTA 1L4ZA 2CMYA 2WPIS 2RG3A 1SLVB 2BLQA 4A1TA 3G01A 1Z7KA 1DUAA 1F5RA 2KAIB 1GJDB 5AVDA 1GI2A 5K0HA 3SJ9A 3LC3A 2OP9A 1NRNH 1VJ9U 1RIWB 2HPPH 3RXOA 3RDZA 2PLXA 1Z8GA 1O5GH 1F5LA 2GVFA 2ZHWH 4X2XA 3UWIA 5GCHF 4HGCA 3RXGA 4A1VA 4AYYB 1AMHA 1W10U 1HAOH 5A2MH 2XBXA 3UNRA 2SGFE 3E16B 1DOJA 1Q2WA 3ZZ8A 1F0UA 1LHGH 1M9UA 2ZECA 2BOHB 2UWLA 1KXBA 1V2OT 3ATIA 2ZGHA 3EA9A 1O3FA 1O32A 1GI0A 2C8ZB 1TPOA 5FPSA 1DXWA 2Q1JA 4RSPA 2F9PA 1QQUA 3SOSA 4ASHA 4THNH 3O8DA 3UPEA 1G3EA 1K22H 1C1VH 1SGDE 4I33A 1S6FA 4X1NU 3A87A 1L1GA 1TRNA 2ZFFH 1K1IA 3ZV9A 2WV4A 1ESBA 8KME2 2BVSH 2ZFTA 4NIVA 3M7TA 5E0GA 1O34A 1DANH 1VCPA 2BD8A 3ENSB 3E3TA 2QY0B 3I29A 2ODQA 3PM3A 4XE4A 2BD2A 1DDJA 2ZDNA 3A7TA 1TLDA 3VXFH 4YZUA 4BXWA 1EB2A 2HVXA 2WPLS 2WPMS 1FN6A 1HJAC 1UVOA 4IBLH 4ZAEA 1AWHB 2ZHFH 4GVUA 3A80A 1P02A 3GY7A 3GY2A 3M36A 1O38A 4NSYA 1HXEH 1EPTC 1TIOA 4K60A 3Q00A 2H6MA 2GCTC 3RLWH 2NU0E 4I8HA 1GMDF 3KF2A 1EOJA 2QIQA 3GY5A 3FFGA 2W7UA 4MNYA 1PPZA 1O2SA 1ZTJA 2DE9A 1FY4A 2A5AA 1A2CH 4FVDA 3FZZA 2EEKA 3VB3A 2GGVB 1HAZB 3M7UA 2FS9A 4TYDA 1VGCB 4IC6A 1LQDB 5JBBS 3RP2A 3SGQE 2QCYA 2AGEX 1Z6JH 1GVZA 4K1TA 2XRCA 1JXPA 5SGAE 2F91A 2YOLA 2XBYA 2ZTXA 2BY9X 3SI4H 3EDXB 4M7GA 4B76A 2Z9KA 3BTTE 3V12A 2ZHEH 2FI3E 4B71A 3M3VA 1THRH 1P09A 1RRKA 4I8LA 5GWZA 1Z6EA 3PV4A 4LZ4B 4VGCB 1G2LA 2H1UA 3H7TA 1C5XB 1GHAG 4X0WU 3SNEA 1K1PA 3MO6A 2AMPA 5C5NA 3EE0B 2EC9H 3HGPA 2YNAA 1A61H 1HJ8A 1PJPA 3TJNA 3GY3A 2C8WB 3A88A 1AVWA 4BANB 1YPHC 1T8MA 4CREA 2ZCHP
chains in the Genus database with same CATH superfamily
3SV6A 3KQBA 3KIDU 3BTQE 3BG4C 2VB0A 3MWIU 4Y10E 5TCCA 1UW7A 1P3EA 3AAUA 3SU5A 1H8DH 3P8FA 4XBDA 1N6YA 1RTKA 2K0QA 4BNRA 1O3MA 3PYHA 2BQ6B 1PPHE 1VKYA 1UTLM 1MTSA 3SU2A 1AGJA 2CHAB 2HNTC 2M5TA 3S9AA 2VVCA 1GBDA 2J38A 2A4OA 3N7DA 2H9TH 1O2YA 1AKSB 1P05A 1QB1A 2WUBA 2ZDVH 4I32A 1BUIA 1A4WH 3E8LA 2V6NA 1D9IA 2ZA5A 2ZCLP 4X1RU 2KCAA 2XWBI 2GZ8A 1IQMA 5J4QA 1LO6A 4BTTB 4UDWH 1SVPA 1O2VA 1LVMA 1ZHPA 1IHTH 2V3HH 1QGFA 1VITG 5LPRA 1LTOA 1SI5H 2HRVA 2AMQA 1EX3A 2G00A 3A89A 2R0KA 6GCHG 3UNSA 1DWCH 3S9CA 1ZMLA 1Y5UT 1IQEA 2CXVA 3QGNB 1O2NA 2A2QH 1BQYA 5HYOA 3VXEH 1BTWA 2PUQH 2A7JA 4ZKNU 5IDKA 3H5CB 2QF3A 1OYTH 4Y0YE 4YLUA 4MLFB 2RA3A 2VIVA 1TMUH 2Y81A 3QK1A 1GJ4H 1EUFA 3LDXH 7LPRA 2FMJA 2FOBA 3MO3A 5A0CA 5C1YA 3MU0A 4X1PU 3RXVA 2J4IA 5I25A 1EATA 1CSOE 1H8ED 1P2QA 1KXFA 2GV6A 2XTTB 1MZAA 1GVKB 2CGAA 4MDSA 4ACAA 1FY5A 2VWMA 4BAQB 1ZPZA 2IN2A 5DP3A 1G32B 3B23B 2VIPA 3M5LA 5LPFA 1CBWB 3U28C 4ZKSU 1MD7A 1C1MA 1NFWA 1C1WH 2YMSC 3GS9A 3ZZ9A 2WPKS 5BRRE 3K2UA 5C1UA 4BAHB 4RT1A 2VGCC 2H5DA 3HPTB 3LGWA 1Y8TA 2TGTA 1WSSH 3GCTF 1AZ8A 1DS2E 3SU1A 1OKXA 1UTPA 1G37A 1L0ZA 3OAAD 2WINI 3F2FA 1SL3A 1BCUH 4RN6A 2BDBA 2OQUA 1K1MA 1TPSA 3SV2H 4Q80A 1FJSA 1C9TA 2P93A 1V2TT 1AIXH 2ZKSA 1TGTA 3F2HA 1GJAB 3LGUA 5JB8S 1DWBH 2RA0A 4GHTA 3S0NA 5EODA 1GCTC 3OYPA 4X6MA 3MFJA 1SQAA 5DP7A 3NZIA 2QGRA 2QF5A 3E6PH 4MVNA 1SKYE 4YLQH 1HAYB 1SBWA 1MU6B 3BV9B 4ISOA 5CHAB 3KQDA 4MNVA 8ESTE 2STBE 2ZHDA 3AW0A 1LMWB 2BY8X 1THSH 2GCTB 4IW4E 4MNXA 3WY8A 2SNVA 2EI6A 3VB5A 2TIOA 3LH3A 1HUTH 1ELDE 2HALA 1ARCA 1NFXA 3R3GB 4ABDA 1S6HA 1MH0A 3MH7A 1W0KD 1LVYA 1OP8A 1V2MT 5C2ZA 3ZZBA 2TGDA 1SLXB 3H7OA 1O3GA 3PWBA 3F9FA 4HTCH 3GY6A 1QTFA 2SGPE 1BA8B 2LIZA 1KXCA 2PKSB 1OYQA 3RXIA 4X6OA 3TVJB 5A09A 2KCYA 2FOHA 4K69A 2OINA 1KDQA 4NFFA 2VH0A 2FX6A 1LHCH 1IQJA 3GY8A 1A0HB 1SGNE 1GHXH 1EZSC 1GDQA 2KAIA 1QBVH 1JRTA 1AZZA 1H9IE 4X6PA 3U8OH 1UO6A 2SFAA 1S83A 2C90B 1YPGH 1ZSKA 2AMDA 1DM4B 2B9LA 3BTWE 1KIGH 2D26C 5PTPA 4XBCA 1GI1A 1CA0B 3EAJA 2VGCB 1NROH 1HAIH 1E1QD 1TQ0B 1UK3A 1AO5A 2ZQ1A 2TRMA 2Z3EA 4OM9A 4TY7A 1HIAA 2AEIH 1FI8A 1OWJA 1HIAB 3P70B 4FXGH 2FLBH 1GI4A 3KGPA 2J98B 1GBKA 4ZMAH 3BEUA 1J15A 3JZ2B 1UVTH 1A0LA 4OS6A 4CRFA 4AYVB 2DE8A 4ACBA 4YOIA 3RXBA 4BOHA 3EYDA 3KQEA 2A4RA 2FDAA 2HPQH 2VNTA 3S69A 1TWXB 2ZFRH 1LVOA 1LQEA 1C5WB 1BOQA 3Q3YA 5L6NH 3B9FH 3MO9A 1WTGH 3MYWA 1ELAA 3ZZ7A 4XBBA 2XWAA 1O2IA 1QFKH 3OFND 2A0QB 2VIWA 2BX3A 1EPTB 1XMNB 1E79D 1MAYA 2AIPA 1GBMA 1CHOF 1H9LB 1IQLA 4X1QU 4ABHA 1O2XA 2ZI2H 3M7QA 3SNBA 1ABIH 1OP0A 2W6JD 4AB9A 1LKBA 4LOYH 2H2ZA 1O3HA 1S85A 1CGJE 1O3BA 3SNDA 5JPMH 4U32A 3QUMP 4CH8B 1CT2E 2GT7A 1SGYE 2FOCA 9ESTA 1QA0A 2BVXH 2PUXB 2PW8H 3BSQA 4XFQA 1C2EA 2BDYA 1GHBG 5FX6A 5BPEA 3KNXA 4ISNA 1FN8A 2L74A 2BD5A 5CMXH 5LPEA 4E05H 1SGQE 3DT0H 2ZGBH 3F9GA 1E0FD 2JKHA 4Y7BA 1P2OA 1DX5M 1SOTA 1VR1H 2EQNA 4I8JA 5DO4H 2O8MA 5EXLA 3OE7D 5AHGH 4HI3A 3EGKH 4WMDA 3A7ZA 3DSGA 3MMGA 2A5KA 2STAE 2VWLA 4IN1A 3BTGE 3CS0A 1FPCH 1SOZA 1SFIA 4XDEA 1AFEH 3LH1A 3ZVEA 3ZVFA 1MCVA 2XC4A 3TH3H 2BDIA 2O8LA 1JIMA 1IOEA 1P2JA 1HFDA 3F3BA 3V13A 4ESTE 3HK6B 1QQ4A 4KGAA 1Y3WA 3UWJH 3LJOA 2SGDE 3EA8A 1E37B 3TU7H 4MTBA 1C5QA 2W26A 3I77A 4E7NA 3TITA 1FAKH 2OC7A 4AFZA 1EZQA 3NPSA 5E0JA 1D3DB 1MKXK 3SUDA 3QZQA 2ANYA 3VPKA 1UK4A 1MABB 4R8TB 3N99A 3S9BA 1ZRKA 1GBHA 1GJ5H 4HZHA 4DCDA 2W6ID 4Y7AA 4B6FA 3BTHE 5JB9S 1TRYA 2FP7B 5FPTA 2V35A 2JDID 1Z8IB 1YPKH 1GHBF 1TMTH 2PGQB 2R0LA 3QTOH 3GCTG 3RXPA 2VINA 1TAWA 1DLKB 4KTSA 2BDHA 4Y8XA 4OS7A 3QO6A 1IQNA 1NRPH 2CF8H 3ZVCA 1MCTA 2H5CA 1O39A 1ELTA 4X2WA 5LGOA 1SR5C 1ESTA 2W5EA 1H4WA 1HNEE 3GYMA 2ZDAH 4O3UA 3GCHB 1N6XA 1QJ1B 1NBMD 4D8NA 1YLNA 1UTMA 3MU1A 5F6MA 2NU1E 1JBUH 4Q7ZA 1QL9A 3FP7E 1D3TB 1ID5H 3U98H 1TBZH 2FM2A 5FXLA 1C2IA 1N8OC 2WYGA 2ZU1A 1C5SA 3RXKA 1BMNH 4FU7A 1AE8H 1O0DH 3SHAH 2OBQA 3EBNA 4NCYA 3ZVGA 1GBBA 1P3CA 3RU4T 3M5MA 3UNQA 2J2UA 1LHEH 1GCTB 3GICB 1TALA 1ZLRA 3RMLH 2TBSA 1GBLA 1C4U2 1GDUA 4F55A 1CGIE 3K9XB 1FY3A 1T8LA 1DY9A 4ZHAA 1NRRH 4RT0A 7GCHG 4GSOA 1TYNA 1OWHA 3DSOA 4BTIB 3M3TA 3RU4E 4AFSA 3TGKE 2ZTYA 4KKDA 1O2TA 3T25A 2HWLB 1JWTA 2CJIA 1AWFH 1TPAE 3PO1C 1KSNA 2V3MA 4FUCA 3DFJA 1C9PA 1C5PA 4U2WA 1HDTH 1A5IA 5HM2A 1MBMA 1WTHD 1MZDA 3A86A 1TMBH 2FYRA 4AORA 4AG1A 2AHME 3SO3A 1V2WT 3JZ1B 4ZXYH 4PROA 1YC0A 2GDEH 2G55A 1E36B 2J92A 2NU2E 3LGYA 3TPIZ 3ZZ4A 3DA9B 2TPIZ 1QBNA 1W7GH 1XUIA 2GTBA 4WH6A 4M9FA 2H9EH 1EOLA 3HKJB 4AX9H 5F8TA 4O97A 1ZJDA 2UUJB 2ZGJA 4OGXA 2ZU5A 1Y3UA 1YPLH 1DSTA 1QHRB 2W3KA 5A0BA 3GISB 3OTJE 1DPOA 1RTLA 1XUHA 1MAXA 1MD8A 2AYWA 4UE7H 2GX4A 1TNIA 1NBME 3PB1E 1GBAA 3ELAH 3ODDA 4Y0ZE 3VGCB 1AVXA 4H4FA 1NC6A 3SW2B 1O33A 5DK1A 2G4TA 1B0FA 1NFUA 2JETC 4Z1MD 1PYTD 1SB1H 4OS4A 1AFQB 3BTFE 3FP6E 1S0QA 3PRDA 3HKIB 3RM2H 2BYAX 2J98A 3RXLA 6GCHF 6LPRA 1QIXB 2PTNA 2VVVA 1C1OA 2ZDMA 4D9QA 1LCYA 1QA7A 4NZLA 2Y7ZA 1TGCA 1AFQC 3RXDA 2ILNA 2O9QA 4JZIA 1O3EA 1HLTH 3A84A 2FOEA 1OOKB 1O2MA 3ZZ5A 3STJA 5C3NA 1U6QA 5J4SA 3UOUA 1NFYA 4LZ1H 2QXGA 1GHZA 1Q3XA 4Q2KA 5HGGA 1KTSB 3MTYA 1BBRE 2ZU2A 1BBRK 3QGJA 2VIOA 4X2VA 3TGIE 2BDGA 4UFDH 4WF8A 3RXMA 2FOMB 4CRAA 4GAWA 5C17A 1ZOMA 2PKAB 1ANBA 2A31A 1QB9A 3MH6A 4F4OC 2KCPA 5A0AE 1FIWA 3PV5A 2BY7X 2NWNA 1YCPK 5EPNA 3LIWA 4JZDH 3QX5H 3I78A 2BY6X 5GDSH 2SGQE 4NIWA 1OWIA 1SQRA 2A2XH 2FYQA 5TJXA 2OC8A 4CH2B 1YPHE 1YKTA 2BLOA 1HRTH 1C2MA 1TFXA 2G8TA 1LHDH 2Q6DA 3C1KA 4FUEA 5T1VA 5AFZH 3TIUA 5DSFA 2CK3D 4DT4A 5FCKA 3SJIA 5DPAA 1EJAA 2QN5T 1TONA 1GPZA 1MMJN 1GJBB 5C20A 3F9HA 1NO9H 3IITA 2GZ9A 3HGNA 2W7SA 1ZPBA 2ZF0H 1HAHH 1C5MD 3W94A 1QL7A 2A7CA 1FY1A 1Y3VA 2Y80A 2GMTB 5DKMA 3CS7A 2C4FH 1P2NA 1K21H 1V2ST 2P16A 3BIUH 3SZEA 3RMOH 1BITA 1V2RT 3M37A 1VZQH 1ZGIA 1P2MA 2ZFSA 1PYTC 1TOCB 3CENA 3F9EA 2PP6A 1RIWC 3TK5A 2GP9B 2KZ4A 2BZ6H 2ZEBA 8LPRA 4YT7H 1SLWB 1NU7B 3BTDE 4B6EA 5T6DA 4D9RA 1G3CA 1Z8RA 2FWWA 2VH6A 4ZCNA 1J8AA 3LGVA 3BIVH 8GCHF 1P03A 2F9VA 2R2WU 1T8OA 2Q6GA 1ELVA 1S84A 1Y5BT 5FPYA 4ASUD 3U9AH 2ALPA 3PWCA 2ZQ2A 1BJVA 2JIZD 3VEQB 1BTUA 2BZAA 5G4BA 1QRZA 2R9PA 2EA3A 3TNTA 3T62A 3SV8A 2P94A 2IPQX 1EXFA 2OUAA 3P8NA 4AOQA 5JDUB 3VB6A 3SNCA 1C2JA 3CP7A 3TJVA 1PPFE 1DXPA 1A1RA 1V2UT 3IWMA 3TGJE 2OC1A 3V7TA 3E91A 1ELEE 4FUFA 1CQQA 3MNCA 1T31A 3MH5A 2Z9LA 3M3SA 1FXYA 1HJAB 1GCDA 2AFQB 5AFYH 7GCHF 3E0PB 2G5NA 2CN0H 1LHFH 2ANKH 4GUXA 4KTUA 5FBEA 2V3OH 4NG9H 5EU8A 3PTBA 4AN7A 4MG3A 1W2KH 3QZRA 2KFWA 2ASUB 4OS2A 3GOVB 3P92A 2ZGCA 3P8OA 3TH2H 1A46H 1WYKA 2B0FA 2PHBA 2GZ7A 4NWLA 2AH4X 3MNSA 1O3AA 4WWYA 2D2DA 2P95A 3SV9A 5LH8A 1O3JA 1QB6A 3DD2H 2UWPA 1YPEH 4IMZA 2D8WA 4HFPB 4TT3D 4GCHF 2Z7FE 2O8WA 1P11E 1TNHA 3F2GA 1J9CH 2R3YA 2CHAC 1O2JA 3L33A 1GHWH 1EJNA 1ELCA 2TGPZ 1BMFD 2NU4E 1GI7B 2VWNA 2WPJS 1GBEA 4UFGH 1BRAA 4LXBH 2ALVA 4AGJA 4UFFH 1VITF 1NPMA 1P0SH 1PQ7A 2FTLE 1SGPE 1XM1A 3NKKA 5C5OA 3Q77A 4DURA 1C5RA 1XUGA 2HLDD 2J94A 3GDVA 3ZYEA 2GMTC 2HLCA 2BD7A 4NSVA 1G3DA 1A7SA 1TNGA 5IK2D 3BTEE 1DLEA 3P95A 3LU9B 2KM0A 2ODYB 1MQ5A 5EG4A 2ZCKP 4B1TA 1E34B 1MKXH 5CHBA 5TCAA 2I6QA 3KQCA 4FUHA 1KXDA 1MBQA 3ZZ6A 2OTVA 4RI0A 3FZDA 1AY6H 2A7HA 4ABGA 1ANDA 4INKA 2G51A 4DIHH 1O2HA 1TGBA 1KXAA 2ZFQH 4J2YB 1UTOA 3S7HB 2YNBA 2ZPSA 5F03A 1CT0E 1YBWA 2ZZUH 3RXEA 1O30A 3A8BA 5I46H 5FAHA 1GJ6A 2EY4C 4MPVA 2W3IA 2YMSD 4WXIA 5K7RA 1GGDC 4JYUH 1TABE 3SJKA 4D76A 2XNDD 4RKJB 1PPBH 1C2DA 1ZSJA 2B8OH 1V2QT 1P10A 1O3DA 3GCOA 2FTMA 2YMSB 3OEHD 1ZTKA 4DY7B 3ZZAA 1SLUB 3UOPA 3A83A 1ZJKA 3LGTA 4I8GA 4WY3A 3MU8A 3QLPH 2BD4A 1ZRBA 3BF6H 2FXRA 1UJ1A 2FEQH 1GHVH 1O5CB 1HPGA 1FX0B 1FNIA 2Z6BD 5CE1A 1YWUA 2AERH 2QXJA 1CT4E 1C2KA 2FPZA 3UQOA 1ZMNA 5L2ZH 3H09A 5EIYA 3QTVH 3VB4A 3FAOA 1G9IE 3KQ5A 1C1TA 2LNCA 1SGEE 4ABAA 4FVBA 4KELA 4BAMB 1MTUA 1GBCA 1P04A 4ZKRU 4H6SB 1L4DA 1LKAA 1C5ZB 2BDCA 4FUBA 1P01A 4H6TA 1L2EA 1XUJA 3OX7U 3RXFA 4ABIA 4Q4LA 2BXUH 5E8EH 2Y5HA 5L2YH 2F9UA 4CR9A 3ATLA 1GBIA 1SGRE 3BTME 5FX5A 2JH6D 1TE0A 3S7KB 3OEED 3SJOA 5FCRA 2BTCE 1O2WA 3Q76A 1EAUA 1O3KA 3RU4D 5ESTE 3SN8A 6CHAB 1VJAU 3NUMA 4CHAB 1YY3A 3KYFA 4IMQA 1O2PA 1A3BH 1W0ZU 1K2I1 1SC8U 2JH0D 1G2MA 4MQAA 2IJD1 3NK8A 4E7RG 1MTNB 1HGTH 4CBNA 4K1SA 1DFPA 3GYLB 3UR9A 4YOGA 5KGOA 1C5NH 5AF9H 3Q3KA 1C5YB 1C1PA 3LPRA 2GJGA 3MHWU 3UQVA 3SUEA 5DP4A 1CA0C 2ZDKA 2LPRA 4Y76A 3D23A 1D6RA 1EAIA 1FLEE 1PPGE 4FUJA 4Q7XA 3N7OA 4CRGA 1DICA 1WAYB 4K3JA 4VGCC 1Y5AT 4D7GA 1O3LA 1YCPM 4TPYA 2EI7A 2ZFPH 3F6UH 2ULLA 2JJ1D 3MNXA 2FX4A 5EW1H 4AZ2B 1TX7A 2FI5E 4K5ZA 3CNRA 3PMHB 1OXGA 2ZU4A 3U8RH 1XKBC 4ZXXH 2UUFB 3SU6A 4CRCA 1GWAA 1S6LA 2FIRH 1ETTH 1DSUA 1BT7A 3WWFA 4OS1A 2ZIQH 2K7XA 4BTUB 4JK6A 5A8XA 3ZZCA 1ARBA 1E38B 1F5KU 2AGIX 3EE7A 3LGIA 2VIQA 3NCLA 1NN6A 3PTNA 1BMAA 1WDIA 7KMEH 2F4LA 1NTPA 1O2LA 3RXQA 3AW1A 3PROA 1O36A 1DITH 3BEIB 3OY5U 1NU9A 3BN9A 3D65E 4ABJA 1XVMA 5EGMA 3RXRA 3STIA 2C8XB 1XUKA 1UTKA 2HNTF 1TNJA 3E1XB 1O2KA 1OS8A 3GDUA 3T26A 3U1JB 5DJ7A 3D62A 5JBCS 1O5EH 4FETA 3B8JA 2PR3A 1C1UH 2G81E 4Q63A 1GBTA 2GCHG 3HATH 1TBRH 4ABEA 1K1NA 1EQ9A 1EB1H 2BX4A 2WPDD 2A32A 2OCVB 1HAGE 3A8CA 1UTQA 1BTZA 2L6OA 3RXUA 1IHSH 4O3TA 1ANEA 2CF9H 1FAXA 1THPB 3NXPA 2BD9A 1C5OH 1O2UA 2GDDA 1GJ7B 1O31A 1A0JA 1O37A 1TRMA 1GG6B 4IC5A 1NS3A 3PMJA 5A8ZA 2J34A 5B6LA 5ETXA 3O8RA 2BMGB 1O3PB 3F0PA 4BAOB 3PLBA 2QXIA 2THFB 3A81A 2NU3E 3O8BA 3NWUA 3ODFA 1DWDH 3KEEA 1G3BA 3LT3A 2LP6A 3LOXA 2B5TB 3RMNH 2QA9E 5ABWA 3F0OA 1XVOA 3E0NB 2IOTA 2XXLA 4AG2A 1BTPA 4FU8A 1ORFA 3OU0A 1HV7A 2UUYA 4AFUA 3MU5A 2Z9IA 2VWOA 5L30H 2BM2A 2R2MB 2ZHQH 1TPPA 2WZQA 1ACBE 2BLWA 1MU8B 3C27B 1V2NT 1MTVA 4DOQA 1C2GA 1ZR0A 3ZZDA 2HNTE 4YOJA 3SBKA 2PKAA 1EAXA 1GI6A 1GL1A 1P57B 1BBRH 2FOAA 4CBOA 1P06A 5HMAA 5JBTA 2ZPRA 4KP0A 1KYNA 2QC2A 1SQOA 1UCYH 2R3UA 4J1YA 4MPXA 4UD9H 3TK9A 3SZNA 5GIBA 5T3HA 1RJXB 4A92A 4JZFH 4YTAA 2FODA 4JCNA 3QN7A 5EJ1A 5F8ZA 5EJZA 2Z9JA 5T6GA 3K65B 1C5TA 1TNKA 1GMHG 1C5LH 1YCPH 4Y8YA 3A82A 2ZGXH 4ISHH 4B2AA 1CBWC 1O5AB 2PV9B 3R0FA 1MTWA 1E35B 2RDLA 3RXTA 1YLCA 1RS0A 4CRBA 3SYJA 1L1NA 1SSXA 1P9SA 4P00A 1V3XA 3MI4A 1BZXE 5EPYA 4B74A 2A4QA 8GCHG 1D3QB 4XOJA 1B5GH 1Y59T 4I8KA 3SUFA 1ETSH 2AS9A 4ABFA 1AB9B 3EQ0H 3L6PA 1W3CA 1NRSH 4FU9A 1S81A 2OC0A 4K2YA 1BRCE 2PSXA 1OSSA 2UUKB 1HAXB 1W11U 2JETB 3RXHA 1QJ7B 1J16A 1CGHA 1DWEH 2FZZA 3VFEA 4AFQA 5C0UA 1KTTB 1WCZA 3T27A 2V0BA 2ZDLA 3TJOA 3VB7A 2BOKA 4F49A 4ZROA 3ITIA 2HOBA 2FOFA 3T28A 1QNJA 4OGYA 4WMEA 4U30A 3N7EA 1YLDA 1PQ8A 1EJMA 3EA7A 1BHXF 1QY6A 4UONA 3P17H 1V2VT 3DUXH 1OWDA 1PQAA 3V3MA 1KLJH 1W0YH 1WQVH 1AUTC 2FI4E 2JJ2D 1AB9C 4F48B 1QRXA 5DP5A 1AN1E 1MKWK 1GI3A 4ZUHA 2OD3B 2SGAA 5GJ4B 2XC5A 1QZ8A 1NRQH 1GJ9B 3VG8A 3SNAA 1O2QA 1YYY1 1K1JA 1VCQA 2XBWA 4U01A 1AKSA 2FO9A 1H9HE 6CHAC 2QV1A 4IS5A 3RMMH 1Q31A 2F3CE 1KDQB 4MPUA 3Q3XA 1EPTA 5FHTA 4UEHH 5A8YA 1GDNA 1W7XH 1VCWA 4JZEH 1YGCH 1OWKA 2O8UA 2XYAA 2PWXA 1ZHRA 2QXHA 5EQSA 2WV5A 2O8TA 3SGBE 3T2NA 3SU3A 2WPHS 3ZIAD 2ANMH 1GBJA 1AI8H 3KN2A 2ODPA 1UK2A 2Y7XA 1G36A 2BHGA 3U69H 1KY9A 1HAVA 2ZTZA 3DHKH 4AB8A 2ZC9H 2PTCE 1ELGA 1P9UA 1NM6A 4TWYA 1C2LA 1D3PB 1Z8JB 4FUDA 3P6ZB 4NWKA 5GXPA 1NESE 2IPHA 4X8TH 3LJJA 1B7XB 2ZG0H 3TJUA 3OTPA 2SGEE 1W8BH 1BTXA 1QURH 1TGSZ 3LKWA 3KYGA 4Y6DA 5DP6A 2PKSC 1ETRH 2BXTH 4Y8ZA 1GI9B 1A3EH 4LK4A 1LPKB 1UHBA 2RCEA 1AHTH 3U1IB 2PGBB 5DP8A 1BTHH 2QYIA 1COWD 1DUEA 6ESTA 1MQ6A 4O03A 4AGKA 5HXFA 1TNLA 1J17T 2BDAA 4NA7A 3SU0A 2F9BH 1BRUP 3BG4B 1FONA 1FPHH 3RM0H 5T6FA 1QBOA 4QT8C 1JMOH 1C4V2 1TOMH 3SQEE 4XRNA 2C3SA 1XUFA 5GCHG 1K9OE 2ZU3A 1G30B 1QJ6B 1RGQA 5HIYA 2B7DH 4BAKB 1CHOG 2ESTE 2ZP0H 1HAVB 4WMFA 4DIIH 1UMAH 3RXSA 1UTNA 3GDSA 2A5IA 1HB0B 3RC5A 2BQWB 5CDFE 2GD4B 4ISLA 1WBGB 4TSFD 4B2BA 1Y3YA 1C2HA 3M5OA 4INHA 4DT7B 1YP9A 1C2FA 1FQ3A 1P12E 3ZVDA 2OQ5A 1EFRD 2C8YB 2K8IA 3MH4A 1SG8B 3TNSA 2P3FH 1V2JT 1CO7E 1TGNA 3M5NA 2XCFA 1UHBB 2KCOA 1FV9A 4Y11E 3WWBA 1F0SA 1SGFA 3ATWA 1V2KT 1SPJA 1QL8A 1V2LT 1VGCC 3E90B 1WUNH 1ELFA 1PQ5A 5EW2H 1EZXC 3URDA 2DUCA 2WSSD 1V2PT 4CHAC 2V7QD 1F0TA 2ZPQA 1WV7H 2K1QA 1TQ7B 1TB6H 5H4IB 3A8AA 4FUIA 1UTJA 2Z9GA 4WVPE 3AVZA 4DGJA 1GMDG 1O3OA 1SFQB 1NY22 4JK5A 4NA8A 3FVFB 4BXSA 3ZZ3A 1HBTH 4CRDA 2SNWA 1J14A 4KTCA 2BLVA 1ZTLA 4JYVH 5C67A 1RFNA 2LELA 4GLYA 3PRBA 2P3TB 3BTKE 4X8SH 3RC6A 2I6SA 5DGJA 2RFKC 4YT6H 1K28D 1CHGA 5GPIB 1TX8A 3SHCH 1CE5A 1C5UA 1QCPA 1GJ8B 1MUEB 1WOFA 3UR6A 4JZ1A 1CU1A 1BB0B 2Y82A 2FESH 5B6OA 4NZQA 1W14U 1O3CA 3K6YA 3T29A 2F9OA 4UFEH 2J9NA 3RC4A 1KXEA 1CVWH 3M35A 1GVLA 1UVUH 2VBCA 5EQRA 3PO1B 2P3UB 2FOGA 3OSYA 1EKBB 4P02A 3FKSD 3SORA 3AAVA 1AE5A 1Y3XA 1O2OA 4X2YA 4X6NA 4SGAE 4K8YA 1RD3B 1A5HA 3D49H 4GCHG 4B73A 4DG4A 4CR5A 1T4UH 4B2CA 1BJUA 1TA6A 3A85A 1K1OA 1QR3E 3BG8A 1GMCG 4B75A 1EP6A 3DFLA 2BD3A 1ZYOA 1FDPA 1O35A 1ZSLA 1TA2A 2QAAA 1K1LA 2OBOA 1B0EA 3K6ZA 4WJG2 1O3IA 2G4UA 3VGCC 3A7WA 1RXPA 2XOKD 1F0RA 2GT8A 2VIDA 1GGDB 4WH8A 4I7YH 1F2SE 1K0HA 2XNIA 2G5VA 1FZZA 1PFXC 1AUJA 5F53A 2OK5A 4FUGA 2Q6FA 1JRSA 4SGBE 1ABJH 1YPMH 3PLKA 1O5DH 1FIZA 4Y71A 3AASA 1UCYE 3GCHC 1BHXB 5EOKA 1YF4A 3P8GA 2AIQA 1NT1A 2G52A 1HAPH 3UTUH 5E2PA 2P8OC 1QRWA 1DVAH 4ZH8A 1N1LA 1YPJH 5DG6A 3PLPA 3DSPA 3UY9A 2PFEA 3UB0A 2ANWA 3A7YA 1YM0A 1GG6C 3FN8A 1MTNC 5ESBA 3ATMA 4IGDA 1EASA 5C0TA 1C1SA 4TY6A 1INCA 1P8VC 4ZKOU 3F68H 3TK6A 3U8TH 3GY4A 2OLGA 3O8CA 1UVSH 5E0HA 3FANA 1OX1A 5HKKD 3URCA 1KLTA 1T32A 1NZQH 3TH4H 1S5SA 1IQHA 1LPGB 1W13U 2CV3A 1S82A 2QF0A 3FO8D 2WV9A 1LDTT 2Y5GA 3PMAB 2BVRH 1H1BA 4HG6A 1ANCA 1P2IA 1BIOA 1O2RA 3RXAA 3UUZA 1XKAC 4Y79A 3HK3B 4NIXA 2F83A 3ESTA 1SHHB 4Q7YA 2WUCA 1X7AC 1OWEA 4GHQA 1TX6A 2WYJA 4MNWA 3TLOA 1SHYA 1KMHB 1AD8H 5DP9A 4TWWA 3UREA 9LPRA 1JIRA 3UFAA 1A5GH 4R0IA 1UCYK 3MU4A 1HCGA 2UWOA 1LPZB 4E06H 5FL7D 2Z3DA 1GJCB 1Z1IA 3T5FH 1D4PB 4Z0KA 1AU8A 1JOUB 3L3TA 4O9VA 1GL0E 1SGCA 1V6DA 3W1EA 1OP2A 3ZV8A 1KLIH 2PSYA 1WU1A 3RUOA 4A5TS 5HIZA 2TGAA 4OS5A 1BRBE 2C93B 1GMHF 2H9HA 1IQKA 1PPEE 2XBVA 3SUGA 1AQ7A 1BTYA 4NA9H 2P59A 4X8UH 1AVGH 2BB4A 5FBIA 1VITH 4IN2A 1IQFA 2A45B 5EXMA 1RTFB 1BMLA 4A1XA 5EXNA 1IAUA 4XD7D 1ZZZA 2VVUA 4D7FA 3BEFB 3F1SB 4K1EA 3UIRA 2KX4A 1XXDA 1F7ZA 2BQ7B 1ZMJA 1Z71A 3QWCH 1GHAF 2F43B 1HXFH 1N8OB 1SGFG 4A7IB 1HJ9A 2Y5FA 4X8VH 3A7VA 3DCLA 2VJ1A 3KL6A 5C1XA 1D6WA 1GI5A 2GV7A 4H42U 3RLYH 2IJOB 3V0XA 5C94A 1P2KA 4ZHLU 1T7CA 2BY5X 2XW9A 1C5VA 1O3NA 4K8BA 3SGAE 3ZYDA 3ZVAA 1T8NA 1FY8E 1BDAA 3MOCA 3RXJA 2D1JA 3M61U 3GCNA 5HM9A 4NIYA 2P8OB 3SQHE 2Z3CA 4X1SU 1ZPCA 1C1NA 5F8XA 3PV2A 3W95A 4A6LA 1W12U 1FUJA 5JYIA 1CA8B 1ZGVA 1MKWH 1O2GH 2XC0A 1ELBA 4ISIH 2QF4A 4ZHMU 1DY8A 4XSKU 2FS8A 3KHVA 4TPIZ 1GI8B 2Z94A 1SGIB 4NGAH 1SGTA 2A4GA 4RKOB 1PPCE 1HYLA 2F9NA 1FMGA 1C1QA 1O5BB 3IG6B 4JYTA 4DW2U 1IQIA 3LONA 1DT2A 3WW7A 2J95A 1IQGA 1EP5A 3PMBB 3QDZB 5IYTA 3RXCA 5EQQA 1O2ZA 4GPGA 3ZVBA 1ESAA 1T4VH 1BMMH 3ATKA 1ZHMA 2ZO3H 4DJZB 4YESB 1GHYH 3FP8E 2ZNKH 4I31A 4ABBA 5JBAS 4YO9A 1Z1JA 5E2OA 3OY6U 1LVBA 2JH5D 4MPWA 4INLA 3NRLA 2GCHF 1S0RA 3SU4A 3LC5A 2Y6TA 2OXSA 1EZUC 1C1RA 1SMFE 2GKVE 1L1JA 2XCNA 5CHAC 4Z6AH 1GBFA 3A8DA 1XX9A 7ESTE 1TBQH 2KR7A 1OPHB 1C4Y2 1OHHD 3SV7A 3KCGH 5KECA 1H8HD 1UVPA 2EI8A 4JMYA 1DE7H 3SJ8A 1F92A 2VU8E 3SI3H 1WQSA 4WXVA 1EAWA 2FLRH 4DVAU 1H8IH 4NFEA 2ZWLH 1O5FH 2AGGX 3MNBA 2HGTH 1GMCF 1XXFA 3A7XA 4YM9A 2J5UA 2A1DB 1SQTA 1L4ZA 2CMYA 2WPIS 2J97A 2RG3A 1SLVB 2BLQA 4A1TA 3G01A 1Z7KA 1DUAA 1F5RA 2KAIB 1GJDB 5AVDA 1GI2A 5K0HA 3SJ9A 1WXRA 3LC3A 2OP9A 1NRNH 1VJ9U 1RIWB 2HPPH 3MQKC 3RXOA 3RDZA 2PLXA 1Z8GA 4AC9A 1O5GH 1F5LA 2GVFA 2ZHWH 4X2XA 3UWIA 5GCHF 4HGCA 3RXGA 4A1VA 4AYYB 1AMHA 1W10U 4YXWD 1HAOH 5A2MH 2XBXA 3UNRA 2SGFE 3E16B 1DOJA 1Q2WA 3ZZ8A 1F0UA 1LHGH 1M9UA 2ZECA 2BOHB 2UWLA 4FOUC 1KXBA 1V2OT 2WHXA 3ATIA 2ZGHA 3EA9A 1O3FA 1O32A 1GI0A 2C8ZB 1TPOA 5FPSA 1DXWA 2Q1JA 4RSPA 1W0JD 2F9PA 1QQUA 3SOSA 4ASHA 4THNH 3O8DA 3UPEA 1G3EA 1K22H 1C1VH 1SGDE 4I33A 1S6FA 4X1NU 3A87A 1L1GA 1TRNA 2ZFFH 3FOAA 1K1IA 3ZV9A 4I86A 2WV4A 1ESBA 8KME2 2BVSH 2ZFTA 4NIVA 3M7TA 5E0GA 1O34A 1DANH 1VCPA 2BD8A 3ENSB 3E3TA 2QY0B 3I29A 2ODQA 3PM3A 1E1RD 4XE4A 2BD2A 1DDJA 3UAIC 2ZDNA 3A7TA 1TLDA 3VXFH 4YZUA 4BXWA 1EB2A 2HVXA 2WPLS 2WPMS 1FN6A 1HJAC 1UVOA 4IBLH 4ZAEA 1AWHB 2ZHFH 4GVUA 3A80A 1P02A 3GY7A 3GY2A 3M36A 5KEDA 1O38A 4NSYA 2RDEA 1HXEH 1EPTC 1TIOA 5EJLA 4K60A 3Q00A 2H6MA 2GCTC 3RLWH 2NU0E 4I8HA 1GMDF 3KF2A 1EOJA 2QIQA 3GY5A 3FFGA 3AK5A 2W7UA 4MNYA 1PPZA 1O2SA 1ZTJA 2DE9A 1FY4A 2A5AA 1A2CH 4FVDA 3FZZA 2EEKA 3VB3A 2GGVB 1HAZB 3M7UA 2FS9A 4TYDA 1VGCB 4IC6A 1LQDB 2QE7D 5JBBS 3RP2A 3SGQE 2QCYA 2AGEX 1Z6JH 1GVZA 4K1TA 2XRCA 1JXPA 5SGAE 2F91A 2YOLA 2XBYA 2ZTXA 2BY9X 3SI4H 3EDXB 4M7GA 4B76A 2Z9KA 3BTTE 3V12A 2ZHEH 2M2AA 2FI3E 4B71A 3M3VA 1THRH 1P09A 1RRKA 4I8LA 5GWZA 1Z6EA 3PV4A 4LZ4B 4VGCB 1G2LA 2H1UA 3H7TA 2HVYB 1C5XB 5DN6D 1GHAG 4X0WU 3SNEA 1K1PA 3MO6A 2AMPA 5C5NA 3EE0B 2EC9H 3HGPA 2YNAA 1A61H 1HJ8A 1PJPA 3TJNA 3GY3A 2C8WB 3A88A 1AVWA 5GNDA 4BANB 1YPHC 1T8MA 4CREA 2ZCHP
chains in the Genus database with same CATH topology
3SV6A 3KQBA 3KIDU 3BTQE 3BG4C 2VB0A 3MWIU 4Y10E 5TCCA 1P3EA 3AAUA 3SU5A 1H8DH 3P8FA 4XBDA 1N6YA 1RTKA 4BNRA 1O3MA 3PYHA 2BQ6B 1PPHE 1UTLM 1MTSA 3SU2A 1AGJA 2CHAB 2HNTC 2M5TA 3S9AA 2VVCA 1GBDA 2J38A 2A4OA 2H9TH 1O2YA 1AKSB 1P05A 1QB1A 2WUBA 2ZDVH 4I32A 1BUIA 1A4WH 3E8LA 2V6NA 1D9IA 2ZA5A 2ZCLP 4X1RU 2XWBI 2GZ8A 1IQMA 5J4QA 1LO6A 4BTTB 4UDWH 1SVPA 1O2VA 1LVMA 1ZHPA 1IHTH 2V3HH 1QGFA 1VITG 5LPRA 1LTOA 1SI5H 2HRVA 2AMQA 1EX3A 2G00A 3A89A 2R0KA 6GCHG 3UNSA 1DWCH 3S9CA 1ZMLA 1Y5UT 1IQEA 2CXVA 3QGNB 1O2NA 2A2QH 1BQYA 5HYOA 3VXEH 1BTWA 2PUQH 2A7JA 4ZKNU 5IDKA 3H5CB 2QF3A 1OYTH 4Y0YE 4YLUA 4MLFB 2RA3A 2VIVA 1TMUH 2Y81A 3QK1A 1GJ4H 1EUFA 3LDXH 7LPRA 2FMJA 2FOBA 3MO3A 5A0CA 5C1YA 3MU0A 4X1PU 3RXVA 2J4IA 5I25A 1EATA 1CSOE 2GV6A 1P2QA 1KXFA 2XTTB 1MZAA 1GVKB 2CGAA 4MDSA 1FY5A 2VWMA 4BAQB 1ZPZA 2IN2A 5DP3A 1G32B 3B23B 2VIPA 3M5LA 5LPFA 1CBWB 4ZKSU 1MD7A 1C1MA 1NFWA 1C1WH 3ZZ9A 2WPKS 5BRRE 3K2UA 5C1UA 4BAHB 2VGCC 2H5DA 3HPTB 3LGWA 1Y8TA 2TGTA 1WSSH 3GCTF 1AZ8A 1DS2E 3SU1A 1OKXA 1UTPA 1G37A 1L0ZA 2WINI 1SL3A 1BCUH 4RN6A 2BDBA 2OQUA 1K1MA 1TPSA 3SV2H 4Q80A 1FJSA 1C9TA 2P93A 1V2TT 1AIXH 2ZKSA 1TGTA 1GJAB 3LGUA 5JB8S 1DWBH 2RA0A 4GHTA 3S0NA 5EODA 1GCTC 3OYPA 4X6MA 3MFJA 1SQAA 5DP7A 3NZIA 2QGRA 3E6PH 4MVNA 4YLQH 1HAYB 1SBWA 1MU6B 3BV9B 4ISOA 5CHAB 3KQDA 4MNVA 8ESTE 2STBE 2ZHDA 3AW0A 1LMWB 2BY8X 1THSH 2GCTB 4IW4E 4MNXA 3WY8A 2SNVA 2EI6A 3VB5A 2TIOA 3LH3A 1HUTH 1ELDE 2HALA 1ARCA 1NFXA 3R3GB 4ABDA 1S6HA 1MH0A 3MH7A 1LVYA 1OP8A 1V2MT 5C2ZA 3ZZBA 2TGDA 1SLXB 3H7OA 1O3GA 3PWBA 3F9FA 4HTCH 3GY6A 1QTFA 2SGPE 1BA8B 2LIZA 1KXCA 2PKSB 1OYQA 3RXIA 4X6OA 3TVJB 5A09A 2FOHA 4K69A 2OINA 1KDQA 4NFFA 2VH0A 2FX6A 1LHCH 1IQJA 3GY8A 1A0HB 1SGNE 1GHXH 1EZSC 1GDQA 2KAIA 1QBVH 1JRTA 1AZZA 1H9IE 4X6PA 3U8OH 1UO6A 2SFAA 1S83A 2C90B 1YPGH 1ZSKA 2AMDA 1DM4B 2B9LA 3BTWE 1KIGH 2D26C 5PTPA 4XBCA 1GI1A 1CA0B 3EAJA 2VGCB 1NROH 1HAIH 1TQ0B 1UK3A 1AO5A 2ZQ1A 2TRMA 2Z3EA 4TY7A 1HIAA 2AEIH 1FI8A 1OWJA 1HIAB 3P70B 4FXGH 2FLBH 1GI4A 3KGPA 1GBKA 4ZMAH 3BEUA 1J15A 3JZ2B 1UVTH 1A0LA 4OS6A 4CRFA 4AYVB 2DE8A 4BOHA 4YOIA 3RXBA 3EYDA 3KQEA 2A4RA 2FDAA 2HPQH 2VNTA 3S69A 1TWXB 2ZFRH 1LVOA 1LQEA 1C5WB 1BOQA 3Q3YA 5L6NH 3B9FH 3MO9A 1WTGH 3MYWA 1ELAA 3ZZ7A 4XBBA 2XWAA 1O2IA 1QFKH 2A0QB 2VIWA 2BX3A 1EPTB 1XMNB 1MAYA 2AIPA 1GBMA 1CHOF 1H9LB 1IQLA 4X1QU 4ABHA 1O2XA 2ZI2H 3M7QA 3SNBA 1ABIH 1OP0A 4AB9A 1LKBA 4LOYH 2H2ZA 1O3HA 1S85A 1CGJE 1O3BA 3SNDA 5JPMH 4U32A 3QUMP 4CH8B 1CT2E 2GT7A 1SGYE 2FOCA 9ESTA 1QA0A 2BVXH 2PUXB 2PW8H 3BSQA 4XFQA 1C2EA 2BDYA 1GHBG 5FX6A 5BPEA 3KNXA 4ISNA 1FN8A 2BD5A 5CMXH 5LPEA 4E05H 1SGQE 3DT0H 2ZGBH 3F9GA 1E0FD 2JKHA 4Y7BA 1P2OA 1DX5M 1SOTA 1VR1H 4I8JA 5DO4H 2O8MA 5EXLA 5AHGH 4HI3A 3EGKH 4WMDA 3A7ZA 3MMGA 2A5KA 2STAE 2VWLA 4IN1A 3BTGE 3CS0A 1FPCH 1SOZA 1SFIA 4XDEA 1AFEH 3LH1A 3ZVEA 3ZVFA 1MCVA 2XC4A 3TH3H 2BDIA 2O8LA 1JIMA 1IOEA 1P2JA 1HFDA 3V13A 4ESTE 3HK6B 1QQ4A 4KGAA 1Y3WA 3UWJH 3LJOA 2SGDE 3EA8A 1E37B 3TU7H 4MTBA 1C5QA 2W26A 3I77A 4E7NA 3TITA 1FAKH 2OC7A 4AFZA 1EZQA 3NPSA 5E0JA 1D3DB 1MKXK 3SUDA 3QZQA 2ANYA 3VPKA 1UK4A 4R8TB 3S9BA 1ZRKA 1GBHA 1GJ5H 4HZHA 4DCDA 4Y7AA 3BTHE 5JB9S 1TRYA 2FP7B 5FPTA 2V35A 1Z8IB 1YPKH 1GHBF 1TMTH 2PGQB 2R0LA 3QTOH 3GCTG 3RXPA 2VINA 1TAWA 1DLKB 4KTSA 2BDHA 4Y8XA 4OS7A 3QO6A 1IQNA 1NRPH 2CF8H 3ZVCA 1MCTA 2H5CA 1O39A 1ELTA 4X2WA 5LGOA 1SR5C 1ESTA 2W5EA 1H4WA 1HNEE 3GYMA 2ZDAH 4O3UA 3GCHB 1N6XA 1QJ1B 4D8NA 5F6MA 1UTMA 3MU1A 2NU1E 1JBUH 4Q7ZA 1QL9A 3FP7E 1D3TB 1ID5H 3U98H 1TBZH 2FM2A 5FXLA 1C2IA 1N8OC 2WYGA 2ZU1A 1C5SA 3RXKA 1BMNH 4FU7A 1AE8H 1O0DH 3SHAH 2OBQA 3EBNA 4NCYA 3ZVGA 1GBBA 1P3CA 3RU4T 3M5MA 3UNQA 2J2UA 1LHEH 1GCTB 3GICB 1TALA 1ZLRA 3RMLH 2TBSA 1GBLA 1C4U2 1GDUA 1CGIE 3K9XB 1FY3A 1T8LA 1DY9A 4ZHAA 1NRRH 7GCHG 4GSOA 1TYNA 1OWHA 4BTIB 3M3TA 3RU4E 4AFSA 3TGKE 2ZTYA 4KKDA 1O2TA 3T25A 2HWLB 1JWTA 2CJIA 1AWFH 1TPAE 3PO1C 1KSNA 4FUCA 3DFJA 1C9PA 1C5PA 4U2WA 1HDTH 1A5IA 5HM2A 1MBMA 1WTHD 1MZDA 3A86A 1TMBH 2FYRA 4AORA 4AG1A 3SO3A 1V2WT 3JZ1B 4ZXYH 4PROA 1YC0A 2GDEH 2G55A 1E36B 2J92A 2NU2E 3LGYA 3TPIZ 3ZZ4A 3DA9B 2TPIZ 1QBNA 1W7GH 1XUIA 2GTBA 4WH6A 2H9EH 1EOLA 3HKJB 4AX9H 5F8TA 4O97A 1ZJDA 2UUJB 2ZGJA 4OGXA 2ZU5A 1Y3UA 1YPLH 1DSTA 1QHRB 2W3KA 5A0BA 3GISB 3OTJE 1DPOA 1RTLA 1XUHA 1MAXA 1MD8A 2AYWA 4UE7H 2GX4A 1TNIA 3PB1E 1GBAA 3ELAH 3ODDA 4Y0ZE 3VGCB 1AVXA 4H4FA 1NC6A 3SW2B 1O33A 5DK1A 2G4TA 1B0FA 1NFUA 2JETC 1PYTD 1SB1H 4OS4A 1AFQB 3BTFE 3FP6E 1S0QA 3HKIB 3RM2H 2BYAX 3RXLA 6GCHF 6LPRA 1QIXB 2PTNA 2VVVA 1C1OA 2ZDMA 4D9QA 1LCYA 1QA7A 4NZLA 2Y7ZA 1TGCA 1AFQC 3RXDA 2ILNA 2O9QA 4JZIA 1O3EA 1HLTH 3A84A 2FOEA 1OOKB 1O2MA 3ZZ5A 3STJA 5C3NA 1U6QA 5J4SA 3UOUA 1NFYA 4LZ1H 2QXGA 1GHZA 1Q3XA 4Q2KA 5HGGA 1KTSB 3MTYA 1BBRE 2ZU2A 1BBRK 3QGJA 2VIOA 4X2VA 3TGIE 2BDGA 4UFDH 4WF8A 3RXMA 2FOMB 4CRAA 4GAWA 1ZOMA 2PKAB 1ANBA 2A31A 1QB9A 3MH6A 4F4OC 5A0AE 1FIWA 2BY7X 2NWNA 1YCPK 5EPNA 3LIWA 4JZDH 3QX5H 3I78A 2BY6X 5GDSH 2SGQE 4NIWA 1OWIA 2A2XH 2FYQA 5TJXA 2OC8A 4CH2B 1YPHE 1YKTA 2BLOA 1HRTH 1C2MA 1TFXA 2G8TA 1LHDH 2Q6DA 3C1KA 4FUEA 5AFZH 3TIUA 5FCKA 3SJIA 5DPAA 1EJAA 2QN5T 1TONA 1GPZA 1MMJN 1GJBB 5C20A 3F9HA 1NO9H 3IITA 2GZ9A 3HGNA 2W7SA 1ZPBA 2ZF0H 1HAHH 1C5MD 3W94A 1QL7A 2A7CA 1FY1A 1Y3VA 2Y80A 2GMTB 5DKMA 3CS7A 2C4FH 1P2NA 1K21H 1V2ST 2P16A 3BIUH 3RMOH 1BITA 1V2RT 3M37A 1VZQH 1ZGIA 1P2MA 2ZFSA 1PYTC 1TOCB 3CENA 3F9EA 1RIWC 3TK5A 2GP9B 2BZ6H 2ZEBA 8LPRA 4YT7H 1SLWB 1NU7B 3BTDE 5T6DA 4D9RA 1G3CA 1Z8RA 2FWWA 2VH6A 1J8AA 3LGVA 3BIVH 8GCHF 1P03A 2F9VA 2R2WU 1T8OA 2Q6GA 1ELVA 1S84A 1Y5BT 5FPYA 3U9AH 2ALPA 3PWCA 2ZQ2A 1BJVA 3VEQB 1BTUA 2BZAA 5G4BA 1QRZA 2R9PA 2EA3A 3TNTA 3T62A 3SV8A 2P94A 3P8NA 1EXFA 2OUAA 4AOQA 5JDUB 3VB6A 3SNCA 1C2JA 3CP7A 3TJVA 1PPFE 1DXPA 1A1RA 1V2UT 3IWMA 3TGJE 2OC1A 3V7TA 3E91A 1ELEE 4FUFA 1CQQA 3MNCA 1T31A 3MH5A 2Z9LA 3M3SA 1FXYA 1HJAB 1GCDA 2AFQB 5AFYH 7GCHF 3E0PB 2G5NA 2CN0H 1LHFH 2ANKH 4GUXA 4KTUA 5FBEA 2V3OH 4NG9H 5EU8A 3PTBA 4AN7A 4MG3A 1W2KH 3QZRA 4OS2A 2ASUB 3GOVB 3P92A 2ZGCA 3P8OA 3TH2H 1A46H 1WYKA 2B0FA 2PHBA 2GZ7A 4NWLA 2AH4X 3MNSA 1O3AA 4WWYA 2D2DA 2P95A 3SV9A 5LH8A 1O3JA 1QB6A 3DD2H 2UWPA 1YPEH 4IMZA 2D8WA 4HFPB 4GCHF 2Z7FE 2O8WA 1P11E 1TNHA 1J9CH 2R3YA 2CHAC 1O2JA 3L33A 1GHWH 1EJNA 1ELCA 2TGPZ 2NU4E 1GI7B 2VWNA 2WPJS 1GBEA 4UFGH 1BRAA 4LXBH 2ALVA 4AGJA 4UFFH 1VITF 1NPMA 1P0SH 1PQ7A 2FTLE 1SGPE 1XM1A 3NKKA 5C5OA 3Q77A 4DURA 1C5RA 1XUGA 2J94A 3GDVA 3ZYEA 2GMTC 2HLCA 2BD7A 4NSVA 1G3DA 1A7SA 1TNGA 3BTEE 1DLEA 3P95A 3LU9B 2ODYB 1MQ5A 5EG4A 2ZCKP 4B1TA 1E34B 1MKXH 5TCAA 2I6QA 3KQCA 4FUHA 1KXDA 1MBQA 3ZZ6A 2OTVA 3FZDA 1AY6H 2A7HA 4ABGA 1ANDA 4INKA 2G51A 4DIHH 1O2HA 1TGBA 1KXAA 2ZFQH 4J2YB 1UTOA 3S7HB 2YNBA 2ZPSA 5F03A 1CT0E 1YBWA 2ZZUH 3RXEA 1O30A 3A8BA 5I46H 5FAHA 1GJ6A 4MPVA 2W3IA 4WXIA 5K7RA 1GGDC 4JYUH 1TABE 3SJKA 4D76A 4RKJB 1PPBH 1C2DA 1ZSJA 2B8OH 1V2QT 1P10A 1O3DA 3GCOA 2FTMA 1ZTKA 4DY7B 3ZZAA 1SLUB 3UOPA 3A83A 1ZJKA 3LGTA 4I8GA 4WY3A 3MU8A 3QLPH 2BD4A 1ZRBA 3BF6H 2FXRA 1UJ1A 2FEQH 1GHVH 1O5CB 1HPGA 1FNIA 2Z6BD 5CE1A 2AERH 2QXJA 1CT4E 1C2KA 2FPZA 3UQOA 1ZMNA 5L2ZH 3QTVH 3VB4A 3FAOA 1G9IE 1C1TA 2LNCA 1SGEE 4ABAA 4FVBA 4KELA 4BAMB 1MTUA 1GBCA 1P04A 4ZKRU 4H6SB 1L4DA 1LKAA 1C5ZB 2BDCA 4FUBA 1P01A 4H6TA 1L2EA 1XUJA 3OX7U 3RXFA 4ABIA 2BXUH 5E8EH 2Y5HA 5L2YH 2F9UA 4CR9A 3ATLA 1GBIA 1SGRE 3BTME 5FX5A 2JH6D 1TE0A 3S7KB 3SJOA 5FCRA 2BTCE 1O2WA 3Q76A 1EAUA 1O3KA 3RU4D 5ESTE 3SN8A 6CHAB 1VJAU 3NUMA 4CHAB 4IMQA 1O2PA 1A3BH 1W0ZU 1K2I1 1SC8U 2JH0D 1G2MA 4MQAA 3NK8A 4E7RG 1MTNB 1HGTH 4CBNA 4K1SA 1DFPA 3GYLB 3UR9A 4YOGA 1C5NH 5AF9H 3Q3KA 1C5YB 1C1PA 3LPRA 3UQVA 3MHWU 3SUEA 5DP4A 1CA0C 2ZDKA 2LPRA 4Y76A 3D23A 1D6RA 1EAIA 1FLEE 1PPGE 4FUJA 4Q7XA 3N7OA 4CRGA 1DICA 1WAYB 4K3JA 4VGCC 1Y5AT 4D7GA 1O3LA 1YCPM 4TPYA 2EI7A 2ZFPH 3F6UH 2ULLA 3MNXA 2FX4A 5EW1H 4AZ2B 1TX7A 2FI5E 4K5ZA 3PMHB 1OXGA 2ZU4A 3U8RH 1XKBC 4ZXXH 2UUFB 3SU6A 4CRCA 1GWAA 2FIRH 1ETTH