1QB9A

Bovine trypsin 7-[[2-[[1-(1-iminoethyl)piperidin-4-yl]oxy]-9h-carbozol-9-yl] methyl]naphthalene-2-carboximidamide (zk-806450) complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (TRYPSIN)
publication title Crystallographic analysis of potent and selective factor Xa inhibitors complexed to bovine trypsin.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qb9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qb9A02
1E0FD 2BVRH 1BA8B 3LC3A 1XUGA 1V3XA 3LGTA 1QQ4A 4MDSA 1YPGH 1K1OA 2W3KA 2OBQA 2H9HA 1ZRBA 2H5CA 2J95A 1RRKA 1ELEE 1ZHMA 3AW0A 3SNDA 1HAXB 2CMYA 1O2MA 3ZV9A 2FTMA 4CRBA 2BVSH 5C3NA 1G9IE 1OSSA 1QHRB 2UWOA 2ZDVH 3RU4D 1FI8A 2AIQA 4DVAU 1FNIA 4Q7XA 2AMDA 1ANDA 1NFXA 4Y71A 3ZVCA 5CE1A 1LPZB 2HOBA 4KTSA 4I8HA 4I8JA 3DFJA 1T8MA 6CHAB 1GI3A 4TWYA 2RDLA 1WTGH 3G01A 1P10A 2BQ6B 4MVNA 4AX9H 3RU4E 2BD3A 2ZNKH 2VIOA 4XE4A 2WPJS 5JDUB 4DURA 1GBAA 1ESBA 2F9UA 1ELGA 1W2KH 2P95A 1MD8A 3GYMA 1QRXA 1SMFE 4FU8A 4I7YH 3LPRA 2F91A 1GMCF 4IN1A 4Y8YA 2ODQA 1O2VA 3L3TA 2G55A 5C1UA 3NXPA 3M3VA 4HGCA 4WH8A 1C2GA 2BY8X 2XBYA 2VIWA 1LPKB 3GY3A 1VR1H 1CBWB 1OKXA 3SGAE 1ZYOA 2HRVA 1IQFA 4X8TH 5DP4A 1MTVA 5HM9A 4H4FA 4UE7H 2O9QA 3OTJE 1O2OA 3CS0A 5EW2H 4FUBA 1F5LA 1GDNA 2ZDNA 3U8OH 1GHYH 3UPEA 1B5GH 1NT1A 3KQCA 1V2KT 2FM2A 2Y5HA 3MTYA 4GHTA 5CMXH 1SGIB 1KTTB 1IQHA 1BITA 4BNRA 5TCCA 2FXRA 4Y11E 3RXLA 1GI9B 1O2YA 2GT8A 3GICB 2FWWA 2H9EH 2VGCC 3LGIA 1ANCA 1TQ0B 1V2RT 1GMCG 2Z3DA 3SU6A 3ZZ9A 1O2UA 3DHKH 1QBNA 2PW8H 4IC6A 2FDAA 3A8DA 5DG6A 2A7CA 2NU0E 5LGOA 1O3BA 4FUCA 1LMWB 1HIAA 1MTWA 1CU1A 1CGJE 1HAGE 3Q3KA 5G4BA 3P95A 1XUFA 1O39A 3H7TA 2VB0A 2FMJA 2O8MA 3BEIB 1SLVB 3HK3B 3HKJB 2AH4X 1FMGA 5H4IB 4FVBA 3TJNA 1C1OA 1ELBA 1C9TA 3RC5A 1TGBA 4INLA 4ISHH 9ESTA 2J9NA 1ID5H 1KXCA 5E0HA 2QYIA 5AF9H 5DKMA 3BTQE 3GOVB 2V6NA 3EA9A 1P2OA 1GI2A 1QFKH 1MUEB 1OP8A 1TX6A 1UMAH 2WV5A 1C2HA 3TJOA 1YCPH 1BRUP 3RU4T 3KNXA 2Z6BD 3MH6A 2VWNA 2NU2E 1TPPA 1ZSKA 4GUXA 1KXBA 1DICA 1V2TT 2VIQA 3HGNA 3R0FA 3VB4A 1Q31A 2BLWA 5JBCS 3RMLH 2JKHA 2UWPA 1RTKA 4TY6A 2BDCA 2FX4A 6CHAC 4BTIB 2ZFFH 2GVFA 1GG6B 1G3DA 3QK1A 3SJ9A 1L1NA 1GJ4H 4F4OC 3UOUA 2Y7XA 3P70B 4Y7AA 1OPHB 4HTCH 6ESTA 1YPJH 4ZKSU 4HFPB 1T8LA 3SW2B 1A5IA 2ZU5A 1ESAA 3MMGA 3VXFH 2GX4A 1AB9B 1HJ8A 3L6PA 3VFEA 4CREA 1GCTB 1QCPA 2NU3E 3T5FH 1W10U 1RTFB 2GDEH 4KELA 5FPTA 1BUIA 3TH4H 3A7YA 3V3MA 5ABWA 3SJ8A 2C8ZB 1ZPBA 4ISLA 3L33A 1HLTH 3QUMP 4Q2KA 1F92A 3F9HA 1BCUH 1PJPA 2JH6D 3V7TA 4K8BA 1ZGIA 3FVFB 1CBWC 3K2UA 3LGYA 3PWCA 1UVOA 1ZJKA 1SGNE 3RXDA 1MBMA 2SFAA 4UFEH 4XDEA 3F1SB 1P05A 4B2BA 4Z0KA 4THNH 1Z8GA 2EEKA 4ABFA 4VGCB 4R8TB 1IOEA 2W26A 1TIOA 1PPEE 4MNWA 3ZZ6A 1FUJA 4ZHMU 3SNEA 1T4UH 1P03A 1FIZA 2XBWA 1N8OB 2OC7A 1AGJA 3RDZA 4FUHA 3RUOA 1EKBB 1XM1A 2VU8E 2VJ1A 3E0PB 1E38B 3SJKA 1N6XA 3A7TA 4AG2A 1S82A 4ZUHA 4X6MA 4GCHF 1WCZA 4X1SU 1MKXH 1D9IA 3RMOH 1GL1A 1C2FA 2CHAC 5ESBA 1QB9A 2G5NA 1C9PA 1KLJH 3TJVA 1QQUA 2A0QB 1VJAU 1L2EA 2Q6DA 4O9VA 3BV9B 2BQWB 1Z7KA 1G3BA 3NZIA 5K7RA 1K21H 1O5DH 1SFIA 2AFQB 1Y3UA 1Y3WA 1TGSZ 2ZCLP 1VITH 2B0FA 5C5OA 1Z8JB 4YLQH 2KAIB 3TU7H 4BANB 1F0RA 4DT7B 1EZUC 1NRRH 2WYGA 1OP2A 4FUDA 2R3UA 2ZZUH 1S81A 2YNBA 3UNQA 1NO9H 3LOXA 4GHQA 2PV9B 1FY1A 2M5TA 1O3JA 2A5IA 2QN5T 1PPGE 5EXMA 3CENA 3RXIA 3RXPA 1AFEH 4ZAEA 3ZVGA 1O36A 5J4QA 2EI8A 3R3GB 4YOIA 2XXLA 1E37B 1GBJA 3VB6A 2DE8A 4DJZB 3MU4A 1WQSA 4B1TA 5A09A 3PMAB 3BTEE 1FPCH 1KXEA 4Z6AH 1WV7H 2P8OB 4ZKRU 3ZZ4A 4MNVA 2BX4A 4BAKB 4AB9A 1GMHG 3RXTA 4AYYB 1QY6A 5DP5A 3UWIA 1L4DA 2GCHF 4TYDA 1H1BA 1X7AC 4ABEA 2BD7A 3SI4H 1YLDA 3MOCA 4GCHG 4CBNA 7ESTE 2ZDKA 1ZHRA 1C2DA 4UD9H 4UEHH 1LVYA 1L4ZA 2G00A 4FUEA 4BAHB 3SGQE 1SLXB 3C27B 3PB1E 1V2MT 1A2CH 3SU0A 4BAQB 1C1PA 1CT0E 2GZ7A 5E0JA 1MD7A 1AY6H 1GG6C 3HKIB 2PSYA 1SSXA 1YC0A 1CO7E 1Z71A 4YTAA 4MNYA 4AORA 1K2I1 4K5ZA 3OY6U 2VINA 4X6PA 1TX7A 4D7FA 1DUAA 2FOBA 1ELTA 3UIRA 1AB9C 1K1MA 1W13U 1G30B 2ZU4A 3BF6H 1XXDA 4SGBE 3FP7E 1H9HE 1UK2A 2BZAA 1GJ5H 2FI4E 1TYNA 1LVBA 1SBWA 2GGVB 2Z9KA 2Z3EA 3BTWE 4NCYA 3PROA 2HVXA 1KYNA 2Q1JA 4NFFA 2P94A 1DM4B 1BQYA 2PKAB 4OS2A 3SNCA 3TVJB 1A0LA 1J16A 2OCVB 1C1MA 1SFQB 3MNSA 5AHGH 4BAOB 1B0EA 4ABAA 1G3EA 3MNCA 4LK4A 1DWDH 1TNJA 1BTYA 2GCHG 1ZTJA 5IYTA 2FOCA 4XOJA 3A80A 1V2OT 1G32B 1NRPH 3EAJA 4AZ2B 4AN7A 3T28A 1OWHA 1TMBH 2TBSA 1TNHA 1IHSH 3M36A 1AVGH 2FP7B 4VGCC 4ESTE 4K1EA 3E0NB 1O2HA 1KY9A 1C1NA 2SGEE 1ZMNA 4KTUA 1S85A 2Y6TA 3UQOA 4F49A 1QA0A 1C2IA 1CSOE 2NU4E 4ZMAH 3MNXA 2PKSB 1NFYA 1TWXB 3A8AA 2J38A 1E35B 3SZNA 4D9QA 5FX6A 3ZYDA 5T6DA 3PM3A 8ESTE 1O3PB 1TPAE 1TQ7B 1CHOF 2Z9GA 4MNXA 1SQOA 4YT6H 1BHXB 1WAYB 3A83A 3DFLA 1YGCH 4X1NU 5GCHG 3Q3XA 1CA8B 4MPVA 2HNTF 1THPB 2FX6A 1NFWA 1GMDF 1FY4A 8LPRA 1DWCH 2V35A 1DSTA 2A4GA 2THFB 1SGPE 1HDTH 2I6SA 4UDWH 5HM2A 3ATLA 2CGAA 7KMEH 1BIOA 1EQ9A 1FONA 1NRSH 4RKJB 3RC6A 1J8AA 3CP7A 1JWTA 3LC5A 2ZHEH 1MKWH 5JBBS 1LHEH 2FO9A 2C93B 2GT7A 1G36A 4X8UH 1FN8A 3UY9A 2J2UA 2F9OA 2F9VA 3SJIA 1KLIH 1MTNB 4FUGA 3GDUA 1TNLA 3SU4A 1KXAA 2FLRH 1HB0B 3RXOA 1P2MA 1KXDA 3TGJE 3NUMA 3HK6B 3LKWA 1DDJA 1O2RA 1Y5AT 2ZFTA 3M7QA 2P8OC 4HZHA 3KIDU 4O03A 5J4SA 1P09A 1TPOA 5L30H 1UVSH 4GSOA 1UTLM 5EPNA 1ZJDA 4X2XA 1CHOG 5FX5A 3P8OA 2BOHB 1Y3YA 1QBVH 2FPZA 4INKA 3BTDE 1IQIA 2P59A 3DT0H 3M35A 4IC5A 3K9XB 5E2OA 4D8NA 1GHZA 1QJ6B 2GP9B 2Z9IA 4XSKU 1RGQA 1HBTH 3ZZAA 4CRAA 2TGPZ 3TPIZ 4U30A 2OC8A 3MH7A 1T8NA 5EQSA 3UQVA 2IN2A 1YPHC 4ZHAA 3MYWA 3QX5H 1BMLA 1ZZZA 3FAOA 1AQ7A 1IQMA 3RXFA 1V6DA 5TCAA 1H8DH 4LZ4B 3F9FA 1SGRE 1H9IE 3PLBA 4WH6A 4NIXA 5EXNA 1D4PB 1K28D 3B23B 2VIPA 2W5EA 1OWKA 1GDUA 3RC4A 1F5RA 3W94A 2Y5GA 1HUTH 1BTWA 2FOEA 1E36B 4PROA 1P02A 1GHBF 1O3NA 1C5WB 2CF8H 3A84A 5HGGA 1T7CA 2RA3A 1W14U 3MH4A 3P17H 4WMEA 2C3SA 1U6QA 3U8RH 1ZMLA 2FEQH 5GWZA 4BTTB 4UONA 2VVVA 3SO3A 2B8OH 3KF2A 4JYTA 3PYHA 1QA7A 2BB4A 5A2MH 1ESTA 3S9CA 1FPHH 1ZPZA 3GY7A 2ZPSA 3ODDA 3MU0A 3FFGA 1DWBH 4NG9H 4CRGA 1TBQH 1AMHA 1SGDE 1JIMA 2PLXA 2D1JA 2UUFB 2PKSC 1UHBB 4ZKNU 1QB1A 1C4Y2 2H2ZA 1O2QA 1FZZA 3A82A 2R2MB 5TJXA 1O2NA 1FAXA 2O8TA 1IQKA 1O3DA 3O8BA 3LJJA 1NM6A 4XBBA 2ZHDA 3GCOA 4I33A 1P57B 1PFXC 4FUIA 1DXPA 2Z9JA 1AIXH 4OGYA 2JH5D 2ODYB 5JYIA 4SGAE 4H6TA 1YPLH 1KDQB 3AAUA 3F9EA 2CV3A 3BTTE 1V2VT 2PGBB 1GHBG 2BTCE 2UWLA 3VB3A 3RXMA 2ZFRH 3M5LA 2C90B 4R0IA 1YCPK 1TABE 1O5GH 4NIVA 3SUGA 1QJ7B 5C5NA 2GKVE 3RXCA 4RSPA 2FIRH 2RCEA 1EX3A 3FP8E 2VNTA 1D6WA 2XBXA 1HAVA 4GAWA 1HAPH 2IOTA 3LGWA 4JZDH 5DJ7A 2A7JA 1MQ5A 4E7RG 3P8FA 1LPGB 2ZCHP 1XVMA 1EPTC 2BDYA 4D76A 1YYY1 1ZPCA 1AI8H 2BD2A 1GBBA 2H5DA 3KGPA 1W7GH 3M7UA 3JZ1B 1O37A 2ANWA 1FY3A 3TLOA 5DP8A 1P2JA 1Y5BT 1O3IA 1QRWA 2KAIA 2ZA5A 4AOQA 1GBTA 1GGDB 5E8EH 1PQ5A 1WSSH 2J94A 1KIGH 2A7HA 5LPEA 1A0JA 1N6YA 1IQGA 4ABIA 1GI4A 2Y82A 4FU7A 2QXGA 3I29A 1HXFH 1ORFA 2FYQA 1PPHE 1MH0A 2QY0B 2QGRA 1Y5UT 4DY7B 1LQEA 2QXHA 2ZQ1A 1JRSA 5FCRA 3M37A 5I46H 4UFDH 1QL9A 1CHGA 2ZIQH 4E06H 2I6QA 1TE0A 5EQQA 3RXJA 1SG8B 1XUHA 2W7UA 1C2LA 1MZAA 2G4TA 2BXUH 1VCWA 1YPEH 1FIWA 1QRZA 1GHXH 4CBOA 5L6NH 1NY22 5EG4A 4K1TA 5C2ZA 1CT4E 2BLVA 2BZ6H 2F83A 1RTLA 3SQEE 1P8VC 2A2QH 5GDSH 2SNVA 1ETRH 1O2TA 3BIVH 2PTCE 3VGCB 4OS6A 1O5AB 1HJAB 2V0BA 1V2QT 3LDXH 3KEEA 1GVLA 3VXEH 1PPZA 2XNIA 2D26C 1A4WH 2Z9LA 1TGTA 4XBDA 5DP9A 8KME2 1GVZA 1EOLA 4XFQA 1BRCE 2TIOA 1MKXK 3ATWA 3PO1B 5GPIB 3A8CA 3QWCH 1VITF 3SV6A 1OYQA 2BD5A 1GI6A 1O3HA 3MU1A 1Z6JH 1TGNA 1VZQH 3OSYA 2ULLA 1GPZA 4FXGH 1S0RA 2PKAA 1EASA 3IG6B 1AFQB 1OWDA 5F8ZA 1JOUB 1EZSC 4INHA 2V3HH 4DW2U 3EA7A 2A4OA 9LPRA 5L2YH 3ZVEA 4NIYA 1NU7B 1A46H 2VH6A 3A8BA 4Y79A 3O8CA 3BEFB 3GY8A 2ILNA 5EODA 1HAHH 3LU9B 2HNTC 1A61H 3LGVA 5BPEA 1T4VH 2ZHQH 1EXFA 3ZZCA 3MU5A 1SI5H 3LH1A 1SGEE 1ELVA 1LKAA 1EJAA 5IDKA 1Y59T 3RM0H 3UR9A 1J9CH 1CVWH 2FODA 3BG4B 2CF9H 4X1PU 3STIA 1SGFA 1V2NT 1Z8IB 1DOJA 3PTNA 3C1KA 4GLYA 1CGHA 2WV4A 1IQLA 2GD4B 2B5TB 2B7DH 4DIIH 2OBOA 4YZUA 4K1SA 1ZLRA 3D62A 3O8RA 2R0LA 4Y6DA 4NWKA 1QIXB 1VITG 1ZMJA 3P8GA 4TPIZ 4LOYH 3RXKA 4K2YA 1G3CA 4AG1A 3S9AA 3GCTF 1QNJA 4NFEA 2OP9A 3RXRA 1C5UA 4Y10E 5LPFA 1FQ3A 2J4IA 1GJDB 2PHBA 4DGJA 1EP6A 2TRMA 3QTOH 1C2JA 2GCTB 4K3JA 2FS8A 3ENSB 1KTSB 2BMGB 4IN2A 3B9FH 1C1TA 1GHAF 2TGDA 1SOZA 2FS9A 4O3UA 1GHVH 3UOPA 1BHXF 1MU6B 1THRH 1PPFE 3ZZ3A 3EQ0H 1C5XB 2GV6A 3B8JA 1QBOA 1YBWA 1P2NA 4CRFA 1C1WH 1BBRE 2EA3A 1WOFA 4B76A 2AGIX 4D7GA 3T62A 2QCYA 3NPSA 1EPTA 2G51A 2A5AA 2A4RA 5FBEA 1NN6A 1OX1A 2K1QA 1EOJA 1BTZA 1XKAC 2ZTYA 5A0AE 1C5RA 1SLUB 4X0WU 1FJSA 1O3OA 1HAIH 3U98H 4WXIA 4BTUB 5I25A 1XUKA 4BOHA 1KXFA 2OUAA 2STAE 1JXPA 1EAWA 1TNGA 3MH5A 2ALPA 1YLCA 1FDPA 1AUJA 1W12U 3BG8A 1J17T 2ZHWH 1IQJA 3VGCC 4AB8A 1SB1H 2JETB 1HJAC 1T32A 4QT8C 2XC0A 1AVXA 3UR6A 4IW4E 5FPSA 4MPXA 1AVWA 4J2YB 1WTHD 1NROH 1SGFG 5PTPA 4ABJA 1C5OH 1H4WA 2Q6FA 4RN6A 3T2NA 1GJ7B 1DITH 2BDAA 2PWXA 2B9LA 3NKKA 2QA9E 2ESTE 1GI5A 3PO1C 3T29A 5F6MA 1Z8RA 1UCYE 1MQ6A 1FAKH 1A7SA 1B0FA 2XW9A 1YPMH 1MTSA 3SJOA 1H9LB 3V13A 1BTXA 2VWLA 5GIBA 1C5PA 2WYJA 1ETTH 1UK3A 2OLGA 2ZEBA 1QR3E 1O2JA 1VJ9U 2SNWA 5E0GA 1T31A 4YESB 1D3PB 1EB1H 2BD9A 1O2WA 2XWAA 4TY7A 3S0NA 1DX5M 1ZR0A 2IJOB 4FUFA 4WWYA 1NS3A 3M5NA 4A1VA 3Q77A 1MKWK 5JBTA 1ARBA 1TGCA 4M7GA 1GCTC 3EYDA 2BD8A 1OOKB 2SGDE 1SQAA 4CH8B 1GJ9B 1UVPA 2ANYA 1Q2WA 2SGQE 3OY5U 2BX3A 1F5KU 4GPGA 1AKSB 1UTMA 5FBIA 1QL7A 2R0KA 4NIWA 1Y3VA 2ZFPH 4JZ1A 4X8SH 1G2LA 1SL3A 1FLEE 5GXPA 1C1VH 1Z1IA 3A7ZA 4MPUA 1GBLA 3KQEA 5C1YA 1O3LA 1XUIA 3EGKH 2BXTH 1DT2A 1GJCB 1O0DH 3EE0B 3GY6A 3NCLA 4NSYA 3BTHE 2VVUA 4KGAA 4TWWA 1SGYE 3FP6E 3DD2H 3ZVBA 3ZZDA 2HWLB 2ZI2H 4ISIH 4X6OA 3SORA 5F8TA 1OXGA 1NRNH 4NZLA 5T6GA 1TALA 3GDSA 1UK4A 3I78A 1DE7H 1BDAA 1O2LA 1KDQA 5FAHA 3JZ2B 2EI6A 1EJNA 2AS9A 2W3IA 1N8OC 1QTFA 1YM0A 3KQBA 2Z7FE 2GCTC 2QXJA 3SQHE 1AD8H 1SGQE 1FY8E 1S84A 4CRCA 1TONA 2OC1A 1OWEA 1VGCB 4ASHA 2VIVA 1C5QA 1E34B 2BDGA 1JRTA 3SV7A 1P9UA 4H6SB 4BXWA 1NESE 3U8TH 1F2SE 5A8YA 1GI8B 2G52A 4YOGA 3A88A 4HI3A 1OWIA 4NWLA 1TB6H 2O8WA 1PYTD 1W0YH 5F8XA 6LPRA 1TMUH 5JBAS 2LNCA 2VWMA 3ODFA 4JYVH 1O34A 4U32A 5JPMH 1HXEH 5FXLA 1O3AA 1YCPM 1HCGA 1NFUA 3SUFA 4WY3A 4B73A 4YM9A 5GJ4B 4Q80A 1BOQA 3DA9B 2G4UA 2OINA 3UFAA 1GHWH 2XCFA 2ZP0H 1OS8A 1LVOA 2JETC 3ZZ5A 2O8UA 1BTUA 1ARCA 2ZGXH 3BTME 2UUKB 2Y5FA 3PMJA 1P12E 3ZZ8A 1D3DB 3U69H 1LHGH 1BTHH 2BLOA 1V2WT 1AUTC 3S9BA 1TFXA 3UTUH 1O3GA 3DUXH 3QLPH 3T27A 5A8ZA 4WF8A 2VH0A 1GJ6A 2GDDA 1GL0E 4NZQA 2FOHA 1Y3XA 1GMDG 2EI7A 4FUJA 4AFQA 4J1YA 4Y8XA 2ZGHA 5DPAA 2OQ5A 4NGAH 8GCHF 4WJG2 1VCQA 2OTVA 2QF3A 1NTPA 1UTKA 4Y0YE 1N1LA 1CQQA 2P3TB 1EAXA 1H8IH 1O2KA 2F9BH 2C8XB 1SOTA 3H7OA 2JH0D 1ZTKA 3BSQA 1O5BB 3QZRA 1AHTH 2PTNA 5FCKA 5C67A 1TRMA 1AZ8A 2HALA 2DUCA 3MWIU 1C2MA 1HYLA 2SGAA 1GBIA 2ZU3A 3U1IB 4KP0A 4MLFB 5EOKA 2A45B 2NU1E 4ZKOU 3RMMH 1UJ1A 4I8GA 1LVMA 2WPLS 3FZZA 4MQAA 1SC8U 3SU3A 1C1SA 2HGTH 1QGFA 2BLQA 1C1RA 2F3CE 3SHAH 2ZDMA 3KCGH 3AVZA 2Z3CA 1UTJA 2AERH 4X1RU 5DP3A 4CHAB 1PPBH 3KHVA 4AGJA 3SU2A 1JBUH 1BBRH 4CH2B 3LJOA 1NU9A 4Q7ZA 1HJ9A 3Q00A 4WMDA 3VEQB 1TPSA 2AEIH 1ZSLA 1LTOA 1Q3XA 3NWUA 1TBZH 5B6OA 2H1UA 4ISNA 3MNBA 3MHWU 8GCHG 2YOLA 1K1IA 3SV8A 1LCYA 3ZVAA 3Q76A 3MU8A 4OS5A 1C5VA 1O2ZA 4X2WA 1V2LT 1V2UT 2XRCA 1J15A 2PUXB 2FZZA 2QXIA 3SHCH 2R3YA 2AGGX 1GBHA 2ZGCA 3RXVA 4A5TS 3T25A 2GMTB 1A3EH 1KLTA 1VGCC 1YP9A 1MZDA 2RG3A 3N7OA 4X1QU 1HAYB 3ELAH 2ZGJA 1XMNB 1GBDA 2ZDLA 1YPHE 3SUDA 1SHYA 2BQ7B 1DWEH 1JIRA 1PQAA 1QL8A 5F03A 4NSVA 2UUJB 1MCVA 3BTFE 1TAWA 4AFUA 2WPIS 1ELDE 4JMYA 3SOSA 1DANH 2TGAA 3FZDA 2QF0A 1RS0A 3E91A 5ESTE 3ZVFA 1UCYH 4OGXA 1BJVA 4ZH8A 4I8KA 1P3EA 2BY5X 2FI5E 1D3TB 2PGQB 1TMTH 2A5KA 2AMQA 1ABJH 3TH2H 1MTNC 1C5TA 2C4FH 5L2ZH 3WY8A 3E6PH 3D65E 4JZIA 1TOCB 4Q7YA 3RXSA 1GBMA 1SLWB 5EW1H 1ELFA 1EZXC 3IITA 1LHCH 1O2PA 1UTQA 3VB7A 1O33A 2R2WU 2TPIZ 3BIUH 3P92A 1G2MA 4DCDA 1XVOA 3TH3H 5LPRA 3NK8A 2D2DA 1CA0B 1XX9A 3GYLB 5DP6A 2P3UB 3P8NA 3LONA 5DGJA 3ZVDA 2G81E 1WUNH 1GI7B 1GJAB 1XUJA 2PFEA 2FOFA 1P2KA 4MG3A 1AN1E 1EB2A 1O2SA 1HGTH 5T6FA 3K6YA 3U1JB 2A1DB 3RXGA 1EUFA 2CHAB 1UVTH 5T3HA 1RXPA 2WUCA 3E16B 5CHAB 1MMJN 1C4V2 2QV1A 2FOAA 4DG4A 4GVUA 4IBLH 1C4U2 1TBRH 1O35A 1P0SH 4X2YA 4U01A 2ZWLH 3UUZA 2XWBI 2WPHS 2OXSA 2G5VA 2FLBH 3RM2H 2P3FH 4O97A 3ZV8A 3A7VA 2D8WA 2ZTXA 3M7TA 3M3TA 1A3BH 4I31A 4OS4A 1K9OE 4B74A 1NPMA 1A1RA 1UTNA 3VB5A 3ZZ7A 4CHAC 1S6FA 2ZKSA 5A0CA 1A5HA 1W7XH 2BYAX 1FN6A 2HPPH 1DXWA 5C1XA 5JB8S 2XCNA 1K22H 5HYOA 1A5GH 3E8LA 4LXBH 2BOKA 1TNKA 1LKBA 3RMNH 3RXQA 4JCNA 3QN7A 1AKSA 1C1UH 1GCDA 3ZYEA 3URCA 3TGIE 1AU8A 1EP5A 5HMAA 2Y80A 3E90B 4K8YA 4XBCA 2BDIA 2ZG0H 2ZFSA 1F0SA 1GBCA 2ZPRA 4YO9A 1MTUA 1DFPA 5FHTA 2BY7X 1TRYA 4WVPE 5A8XA 4YOJA 2GMTC 1UVUH 3RXHA 5AFYH 1ZRKA 4AFZA 4JK6A 1O31A 3S69A 1SPJA 4JYUH 1F0UA 3LGUA 4NA8A 1UTOA 3QDZB 3ZZBA 3A7XA 3QTVH 3TGKE 1ANEA 2A4QA 3A89A 3PMBB 1GJBB 1A0HB 3LIWA 3UREA 1DUEA 1DPOA 1HNEE 3BTKE 1TA6A 1D3QB 1L1GA 4E7NA 3ESTA 3O8DA 5EXLA 3MO9A 1MAYA 3RXAA 1WBGB 1GWAA 3W95A 2STBE 2OQUA 2VWOA 2NWNA 1INCA 3EA8A 1DY9A 2BD4A 3SI3H 1F0TA 1S5SA 1LHDH 3BEUA 2QAAA 3E1XB 2DE9A 2WPMS 1ZHPA 3GY2A 1FXYA 1G37A 4FVDA 3MI4A 2OD3B 2ALVA 4AGKA 1EJMA 1HRTH 1TA2A 4ZXXH 2ANKH 3SUEA 4A92A 5LH8A 3PLPA 1GVKB 3ATIA 2XTTB 2HPQH 2ZGBH 3SU5A 4IS5A 2Z94A 4ABHA 5ETXA 2AGEX 3BTGE 1GGDC 4IMZA 3RXEA 1BTPA 1QURH 2QIQA 4Y8ZA 1WU1A 3TJUA 1XXFA 2BVXH 1V2JT 1CA0C 4K69A 3H5CB 3AW1A 4B75A 1L1JA 1LHFH 2PSXA 1GMHF 5EQRA 4CR9A 1PQ8A 2AMPA 1O3FA 3A85A 2CJIA 2ZU2A 5SGAE 1HAVB 5DP7A 4CR5A 2ZDAH 2HNTE 3SGBE 3VPKA 2P16A 2LPRA 1LQDB 3TITA 2GTBA 1O2XA 3TK9A 4A1TA 2GZ8A 2IPHA 5EGMA 3MFJA 1UO6A 5K0HA 2A31A 5CHAC 3A7WA 1IHTH 4IGDA 4I32A 1LO6A 2ZU1A 3AAVA 3S7KB 1ANBA 1O38A 1VCPA 3GY4A 1RJXB 3M61U 3TK6A 2H6MA 2ZECA 4TPYA 2ZTZA 1MU8B 3GCTG 3UNRA 1QJ1B 3PWBA 4DIHH 1RIWB 1C1QA 4B71A 3TNTA 3F6UH 3OU0A 3QO6A 1W0ZU 1F7ZA 3KN2A 4YT7H 1MAXA 4AFSA 2A2XH 1GHAG 2F9PA 4JK5A 4JZEH 3RXBA 5C20A 3KL6A 3MO3A 5AFZH 1S6HA 1AE8H 4A7IB 4Y7BA 1HV7A 1PPCE 4ABGA 1ABIH 2WPKS 1O3MA 3BN9A 5EPYA 4Y76A 1DLEA 1O5CB 1O30A 1O3EA 1GI0A 3SNAA 2TGTA 1FY5A 1W8BH 2FTLE 2J34A 1Y8TA 2ZO3H 1HIAB 1EATA 1C5LH 4K60A 7GCHF 2FI3E 3A87A 3OX7U 1SHHB 3K6ZA 1JMOH 1AFQC 1ACBE 1ELCA 2WINI 1BMMH 2CN0H 1V2ST 1MCTA 1O2IA 2WUBA 4UFGH 3IWMA 2VVCA 3A81A 2A32A 1O32A 6GCHF 1YKTA 3SV9A 1RFNA 2FOMB 4ZROA 1CT2E 3EDXB 3FANA 2YNAA 1OWJA 3M5OA 4UFFH 1DLKB 4Y0ZE 2BDBA 3F9GA 1B7XB 3V12A 1HAOH 3F68H 1C5ZB 1P06A 2Y7ZA 4U2WA 3URDA 2BY9X 3AASA 1GBFA 4DOQA 1T8OA 1K1LA 3BG4C 1UHBA 3T26A 1THSH 5GCHF 2Q6GA 2XC4A 1K1JA 1OP0A 1OYTH 2O8LA 3KQDA 3GDVA 3SNBA 3GCHB 1S0QA 2C8YB 1C5SA 1S83A 4AYVB 5DK1A 2XBVA 2Y81A 1NC6A 5EU8A 4NA9H 4ZXYH 2HLCA 2C8WB 3GISB 2SGPE 7LPRA 3RLYH 1DVAH 2ANMH 4BXSA 1PYTC 4LZ1H 1KSNA 4ABDA 3QZQA 2ZHFH 1YF4A 1AWHB 3STJA 1EAUA 7GCHG 1C2KA 1ETSH 5AVDA 4X2VA 2VIDA 3PMHB 2H9TH 3QGJA 2J92A 1P2IA 3HGPA 1O5EH 1TOMH 1DS2E 3GCNA 3ITIA 2AYWA 2PR3A 4OS7A 3P6ZB 3LH3A 4A6LA 1WYKA 3SN8A 1BMNH 1P9SA 6GCHG 2UUYA 3RP2A 1BB0B 2ZPQA 1GBKA 3ATMA 3D49H 1GJ8B 3Q3YA 3M5MA 4D9RA 2ASUB 3E3TA 3UWJH 1UTPA 1W3CA 1K1NA 1WQVH 1NRQH 1GI1A 2CXVA 1SR5C 2XC5A 1DSUA 3TNSA 3RXUA 4E05H 1CE5A 2BDHA 4H42U 4A1XA 4OS1A 1ZTLA 1YPKH 1BRBE 1AE5A 1P11E 1BJUA 1EZQA 4KKDA 3RLWH 3K65B 1P01A 3CS7A 2R9PA 3HATH 5HXFA 1BBRK 1FV9A 1O2GH 4I8LA 1C5MD 2V3OH 2ZCKP 1IQNA 2F9NA 1MBQA 2ODPA 1GBEA 3PLKA 1Z6EA 1SQTA 1C5YB 2BM2A 1TRNA 1BZXE 2FOGA 5BRRE 1ZSJA 1O3KA 1RD3B 3PV4A 1TNIA 1C2EA 3A86A 3GY5A 2ZC9H 3UNSA 1Z1JA 1W11U 1RIWC 4FU9A 4X8VH 1O3CA 1P2QA 4ISOA 3QGNB 4YLUA 3U9AH 1HAZB 5DO4H 1GDQA 1J14A 5E2PA 1IAUA 4BAMB 1DY8A 2FESH 2ZQ2A 1HPGA 4IMQA 2BY6X 4KTCA 1SVPA 1BMAA 1EPTB 3SBKA 2PUQH 1TX8A 1SGTA 1IQEA 2G8TA 4WXVA 1HFDA 3MO6A 1AZZA 2GV7A 1SGCA 3M3SA 2QC2A 1LDTT 1K1PA 1TLDA 4X6NA 1PQ7A 2OC0A 5A0BA 1ELAA 1O5FH 4MPWA 1BT7A 1AWFH 2ZF0H 2EC9H 5FPYA 2BHGA 2VGCB 1ZOMA 1UCYK 1V2PT 4RKOB 4CRDA 1QB6A 4ABBA 3SU1A 3SV2H 3PTBA 1XKBC 4NA7A 1M9UA 1NZQH 2RA0A 4O3TA 2GZ9A 1AO5A 1CGIE 3HPTB 1D6RA 3OYPA 3TIUA 2XYAA 1BRAA 2SGFE 2FYRA 4JZFH 3D23A 4WMFA 1L0ZA 3ATKA 2W7SA 5JB9S 3S7HB 1C5NH 1P3CA 4B2CA 1ZGVA 4ZHLU 3LT3A 3GCHC 4B2AA 2AIPA 1P04A 2P93A 3I77A 3V0XA 1EAIA 2ZFQH 4MTBA 3TK5A
chains in the Genus database with same CATH superfamily
1E0FD 2BVRH 1BA8B 3LC3A 1XUGA 1V3XA 4AC9A 3LGTA 1QQ4A 4MDSA 1YPGH 1K1OA 2W3KA 2OBQA 2H9HA 1ZRBA 2H5CA 2J95A 1RRKA 1ELEE 1ZHMA 3AW0A 3SNDA 1HAXB 2CMYA 1O2MA 3ZV9A 2FTMA 4CRBA 2BVSH 5C3NA 1G9IE 1OSSA 1QHRB 2UWOA 2ZDVH 3RU4D 1FI8A 2AIQA 4DVAU 1FNIA 4Q7XA 2AMDA 1ANDA 1NFXA 4Y71A 3ZVCA 5CE1A 1LPZB 2HOBA 4KTSA 4I8HA 4I8JA 3DFJA 1T8MA 6CHAB 1GI3A 4TWYA 2RDLA 1MABB 1WTGH 3G01A 1P10A 2BQ6B 4MVNA 4AX9H 3RU4E 1FX0B 2BD3A 2ZNKH 2VIOA 4XE4A 2WPJS 5JDUB 2F43B 4DURA 2K8IA 1GBAA 1ESBA 2F9UA 1ELGA 1W2KH 2P95A 1MD8A 3GYMA 1QRXA 1SMFE 4FU8A 4I7YH 3LPRA 2RDEA 2F91A 1GMCF 4IN1A 4Y8YA 2ODQA 1O2VA 3L3TA 2G55A 5C1UA 3NXPA 3M3VA 4HGCA 4WH8A 1C2GA 2BY8X 2XBYA 2VIWA 2L6OA 1LPKB 3GY3A 4OM9A 1VR1H 1CBWB 1OKXA 1H8HD 3SGAE 1ZYOA 2HRVA 1IQFA 4X8TH 5DP4A 1MTVA 5HM9A 4H4FA 4UE7H 2O9QA 3OTJE 1O2OA 3CS0A 5EW2H 4FUBA 1F5LA 1GDNA 2ZDNA 3U8OH 1GHYH 3UPEA 1B5GH 1NT1A 3KQCA 1V2KT 2FM2A 2Y5HA 3MTYA 4GHTA 2WSSD 2IPQX 5CMXH 1SGIB 1KTTB 1IQHA 1BITA 4BNRA 3OEED 5TCCA 2FXRA 4Y11E 5CHBA 3RXLA 1GI9B 1O2YA 2GT8A 3GICB 2FWWA 2H9EH 2VGCC 3LGIA 1ANCA 1TQ0B 1E79D 1V2RT 1GMCG 2Z3DA 3SU6A 3ZZ9A 1O2UA 3DHKH 1QBNA 3DSPA 2PW8H 4IC6A 2FDAA 3A8DA 5DG6A 2A7CA 2NU0E 5LGOA 1O3BA 4FUCA 1LMWB 1HIAA 1MTWA 1CU1A 1CGJE 1HAGE 3Q3KA 5G4BA 3P95A 1XUFA 1O39A 3H7TA 2VB0A 2FMJA 2O8MA 3BEIB 1SLVB 3HK3B 3HKJB 2AH4X 3WWFA 1FMGA 5H4IB 4FVBA 3TJNA 1C1OA 1ELBA 1C9TA 4DT4A 3RC5A 1TGBA 4INLA 4ISHH 9ESTA 2J9NA 1ID5H 1KXCA 2F4LA 3OEHD 2IJD1 5E0HA 2QYIA 5AF9H 5DKMA 3BTQE 3GOVB 2V6NA 3EA9A 1P2OA 1GI2A 1QFKH 1MUEB 1OP8A 1TX6A 1UMAH 2WV5A 1C2HA 3TJOA 1YCPH 1BRUP 3RU4T 3KNXA 2Z6BD 3MH6A 2VWNA 2NU2E 1TPPA 1ZSKA 4GUXA 1KXBA 1DICA 1V2TT 2VIQA 1NBMD 3HGNA 3R0FA 2YMSB 3VB4A 1Q31A 2BLWA 5JBCS 3RMLH 2JKHA 2UWPA 1RTKA 4TY6A 2BDCA 2FX4A 6CHAC 4BTIB 2ZFFH 2GVFA 5T1VA 1GG6B 1G3DA 3QK1A 3SJ9A 1L1NA 1GJ4H 1NBME 4F4OC 1E1RD 3UOUA 4B6EA 2Y7XA 3P70B 4Y7AA 1OPHB 4HTCH 6ESTA 1YPJH 4ZKSU 4HFPB 1T8LA 3SW2B 1A5IA 2ZU5A 1ESAA 3MMGA 3VXFH 2GX4A 1AB9B 4TT3D 1HJ8A 3L6PA 3VFEA 4CREA 1GCTB 1QCPA 2NU3E 3T5FH 4ACAA 1W10U 1RTFB 2GDEH 4KELA 5FPTA 1BUIA 3TH4H 3A7YA 3V3MA 5ABWA 3SJ8A 2C8ZB 1ZPBA 4ISLA 3L33A 1HLTH 3W1EA 3QUMP 4Q2KA 1F92A 3F9HA 1BCUH 1PJPA 2JH6D 3V7TA 4K8BA 1ZGIA 3FVFB 1CBWC 3K2UA 3LGYA 3PWCA 3EE7A 1UVOA 1ZJKA 1WDIA 1SGNE 3RXDA 1MBMA 2SFAA 4UFEH 4XDEA 3F1SB 1P05A 4B2BA 4Z0KA 4THNH 1Z8GA 2EEKA 4ABFA 4VGCB 4R8TB 1IOEA 2W26A 1TIOA 1PPEE 4MNWA 3ZZ6A 1FUJA 4ZHMU 3SNEA 1T4UH 1P03A 1FIZA 3PV5A 2XBWA 1N8OB 2OC7A 1AGJA 4TSFD 4FUHA 3RDZA 3RUOA 1EKBB 1XM1A 2VU8E 2VJ1A 3E0PB 1E38B 3SJKA 1N6XA 3A7TA 3N7DA 4AG2A 1S82A 4ZUHA 4X6MA 4GCHF 1WCZA 4X1SU 1MKXH 1D9IA 3RMOH 1GL1A 1C2FA 2CHAC 5ESBA 1QB9A 2G5NA 1C9PA 1KLJH 3TJVA 1QQUA 2A0QB 1VJAU 1L2EA 2Q6DA 4O9VA 3BV9B 2BQWB 1Z7KA 1G3BA 3N7EA 3NZIA 4XRNA 5K7RA 1K21H 1O5DH 1SFIA 2AFQB 3F3BA 1YY3A 1Y3UA 1Y3WA 1TGSZ 2ZCLP 1VITH 2B0FA 5C5OA 1Z8JB 4YLQH 2KAIB 3TU7H 4BANB 1F0RA 4DT7B 1EZUC 1NRRH 2WYGA 1OP2A 4FUDA 2R3UA 4Q63A 2ZZUH 1S81A 2YNBA 3UNQA 1NO9H 3LOXA 4GHQA 2PV9B 1FY1A 2M5TA 1O3JA 2A5IA 2QN5T 1PPGE 5EXMA 3CENA 3RXIA 3RXPA 1AFEH 4ZAEA 3ZVGA 1O36A 5J4QA 2EI8A 3R3GB 4YOIA 2XXLA 1E37B 1GBJA 3VB6A 2DE8A 4DJZB 3MU4A 1WQSA 4B1TA 5A09A 3PMAB 3BTEE 1FPCH 1KXEA 4Z6AH 1WV7H 2P8OB 4ZKRU 3ZZ4A 4MNVA 2BX4A 4BAKB 4AB9A 1GMHG 3RXTA 4AYYB 1QY6A 5DP5A 3UWIA 1L4DA 2GCHF 4TYDA 1H1BA 1X7AC 4ABEA 2BD7A 3SI4H 1COWD 1YLDA 3MOCA 4GCHG 1E1QD 2YMSC 4CBNA 7ESTE 2ZDKA 3KQ5A 1ZHRA 1C2DA 4UD9H 4UEHH 1LVYA 1L4ZA 2G00A 2HVYB 4FUEA 4BAHB 3SGQE 1SLXB 3C27B 3PB1E 1V2MT 1A2CH 5KGOA 3SU0A 4BAQB 1C1PA 1CT0E 2GZ7A 5E0JA 1MD7A 1AY6H 1GG6C 3HKIB 2XOKD 2PSYA 1SSXA 1YC0A 1CO7E 1Z71A 4YTAA 4MNYA 4AORA 1K2I1 4K5ZA 3OY6U 2VINA 4X6PA 1TX7A 4D7FA 1DUAA 2FOBA 1ELTA 3UIRA 1AB9C 1K1MA 3DCLA 1W13U 1G30B 2ZU4A 3BF6H 1XXDA 4SGBE 3FP7E 1H9HE 1UK2A 2BZAA 1GJ5H 2FI4E 1TYNA 1LVBA 1SBWA 2GGVB 2Z9KA 2Z3EA 3BTWE 4NCYA 3PROA 2HVXA 1KYNA 2Q1JA 4NFFA 2P94A 1DM4B 1BQYA 2PKAB 4OS2A 3SNCA 3TVJB 1A0LA 1J16A 2OCVB 1C1MA 1SFQB 3MNSA 5AHGH 4BAOB 1B0EA 4ABAA 1G3EA 3MNCA 4LK4A 1DWDH 1TNJA 1BTYA 2GCHG 1ZTJA 5IYTA 2FOCA 4ASUD 4XOJA 3A80A 1V2OT 1G32B 1NRPH 3EAJA 4AZ2B 4AN7A 3T28A 1OWHA 1TMBH 2TBSA 1TNHA 1IHSH 3M36A 1AVGH 2FP7B 4VGCC 4ESTE 4K1EA 3E0NB 1O2HA 4F48B 1KY9A 1C1NA 2SGEE 1ZMNA 4KTUA 1S85A 2Y6TA 3UQOA 4F49A 1QA0A 1C2IA 1CSOE 2AHME 2NU4E 4ZMAH 3MNXA 2PKSB 1NFYA 1TWXB 3A8AA 2J38A 1E35B 4M9FA 3SZNA 4D9QA 5FX6A 3ZYDA 5T6DA 3PM3A 8ESTE 1O3PB 1TPAE 1TQ7B 1CHOF 2Z9GA 4MNXA 1SQOA 4YT6H 1BHXB 1WAYB 3A83A 3DFLA 1YGCH 4X1NU 5GCHG 3Q3XA 1CA8B 4MPVA 2HNTF 1THPB 2FX6A 1NFWA 1GMDF 1FY4A 8LPRA 1DWCH 2V35A 2EY4C 1DSTA 2A4GA 2THFB 1SGPE 1HDTH 2I6SA 4UDWH 5HM2A 3F2HA 3ATLA 2CGAA 2LP6A 7KMEH 1BIOA 1EQ9A 1FONA 1NRSH 4RKJB 3RC6A 1J8AA 3CP7A 1JWTA 3LC5A 2ZHEH 1MKWH 5JBBS 1LHEH 2FO9A 2C93B 2GT7A 1G36A 4X8UH 1FN8A 3UY9A 2J2UA 2F9OA 2F9VA 3SJIA 1KLIH 1MTNB 4FUGA 3GDUA 1TNLA 3SU4A 1KXAA 2FLRH 1HB0B 3RXOA 1P2MA 1KXDA 3TGJE 3NUMA 3HK6B 3LKWA 1DDJA 1O2RA 1Y5AT 2ZFTA 3M7QA 2P8OC 4HZHA 3KIDU 4O03A 5J4SA 1P09A 1TPOA 5L30H 1UVSH 4GSOA 1UTLM 5EPNA 1ZJDA 4X2XA 1CHOG 5FX5A 3P8OA 2BOHB 1Y3YA 1QBVH 2FPZA 4INKA 3BTDE 1IQIA 2P59A 3DT0H 3M35A 4IC5A 3K9XB 5E2OA 4D8NA 1GHZA 1QJ6B 2GP9B 2Z9IA 4XSKU 1RGQA 1HBTH 3ZZAA 4CRAA 1OHHD 2TGPZ 3NRLA 3TPIZ 4U30A 2OC8A 3MH7A 1T8NA 5EQSA 3UQVA 2IN2A 1YPHC 4ZHAA 3MYWA 3QX5H 1BMLA 2QF4A 1ZZZA 3FAOA 4Q4LA 3SZEA 1AQ7A 1IQMA 1VKYA 3RXFA 1V6DA 5TCAA 1H8DH 4LZ4B 3F9FA 1SGRE 1H9IE 2QE7D 3PLBA 4WH6A 4NIXA 5EXNA 1D4PB 1K28D 3B23B 2VIPA 2W5EA 1OWKA 1GDUA 3RC4A 1F5RA 3W94A 2Y5GA 1HUTH 1BTWA 2FOEA 1E36B 4PROA 1P02A 1GHBF 1O3NA 1C5WB 2CF8H 3A84A 5HGGA 1T7CA 2RA3A 1W14U 3MH4A 3P17H 4WMEA 2KCPA 2C3SA 1U6QA 3U8RH 1ZMLA 2FEQH 5GWZA 4F55A 4BTTB 4UONA 2VVVA 3SO3A 2B8OH 3KF2A 3OFND 1YWUA 4JYTA 3PYHA 5EJZA 1QA7A 2BB4A 5A2MH 1ESTA 3S9CA 1FPHH 1ZPZA 1UW7A 3GY7A 2ZPSA 3ODDA 3MU0A 3FFGA 1DWBH 4NG9H 4CRGA 1TBQH 1AMHA 1SGDE 1JIMA 2PLXA 2D1JA 2UUFB 2PKSC 1UHBB 4ZKNU 1QB1A 3VG8A 1C4Y2 2H2ZA 1O2QA 3F2FA 1FZZA 3A82A 2R2MB 5TJXA 1O2NA 1FAXA 2O8TA 1IQKA 1O3DA 3O8BA 3LJJA 1NM6A 4XBBA 2ZHDA 3GCOA 4I33A 1P57B 1PFXC 4FUIA 1DXPA 2Z9JA 1AIXH 4OGYA 2JH5D 2ODYB 5JYIA 4SGAE 4H6TA 1YPLH 1KDQB 3AAUA 3F9EA 2CV3A 3BTTE 2J98A 2RFKC 1V2VT 2PGBB 1GHBG 2BTCE 2UWLA 3VB3A 3RXMA 2ZFRH 3M5LA 2C90B 4R0IA 1YCPK 1TABE 1O5GH 4NIVA 3SUGA 1QJ7B 5C5NA 2GKVE 3RXCA 4RSPA 3U28C 2FIRH 2RCEA 1EX3A 3FP8E 2VNTA 1D6WA 2XBXA 5C0TA 1HAVA 4GAWA 1HAPH 2IOTA 3LGWA 4JZDH 5DJ7A 2A7JA 1MQ5A 4E7RG 3P8FA 1LPGB 2ZCHP 1XVMA 1EPTC 5B6LA 2BDYA 4D76A 1YYY1 1ZPCA 1AI8H 2BD2A 1EFRD 1GBBA 2H5DA 3KGPA 1W7GH 3M7UA 3JZ1B 1O37A 2ANWA 1FY3A 3TLOA 5DP8A 1P2JA 1Y5BT 1O3IA 1QRWA 2KAIA 2ZA5A 4AOQA 1GBTA 1GGDB 5E8EH 1PQ5A 1WSSH 2J94A 1KIGH 2A7HA 5LPEA 1A0JA 1N6YA 1IQGA 4ABIA 1GI4A 2Y82A 4FU7A 2J5UA 2QXGA 3I29A 1HXFH 1ORFA 2FYQA 1PPHE 1MH0A 2QY0B 2QGRA 1Y5UT 4DY7B 1LQEA 2QXHA 2ZQ1A 1JRSA 5FCRA 2KZ4A 3M37A 5I46H 3PRDA 4UFDH 1QL9A 1CHGA 2ZIQH 4E06H 2I6QA 1TE0A 5EQQA 3RXJA 1SG8B 1XUHA 2W7UA 1C2LA 1MZAA 2G4TA 2BXUH 1VCWA 1YPEH 2PP6A 2KCOA 1FIWA 1QRZA 2V7QD 1GHXH 4CBOA 5L6NH 1NY22 5EG4A 4K1TA 5C2ZA 1CT4E 2BLVA 2BZ6H 2F83A 1RTLA 3SQEE 1P8VC 2A2QH 5GDSH 2SNVA 1ETRH 1O2TA 3BIVH 2PTCE 4XD7D 3VGCB 4OS6A 1O5AB 1HJAB 2KFWA 2V0BA 1V2QT 3LDXH 3KEEA 1GVLA 3VXEH 1PPZA 2V3MA 2XNIA 2D26C 1A4WH 2Z9LA 1TGTA 4XBDA 5DP9A 8KME2 1GVZA 1EOLA 4XFQA 1BRCE 2TIOA 1MKXK 3ATWA 3PO1B 5GPIB 3A8CA 3QWCH 2WHXA 1VITF 3SV6A 1OYQA 2BD5A 5F53A 1GI6A 1O3HA 3MU1A 1Z6JH 1TGNA 1VZQH 3OSYA 2JJ1D 2ULLA 1GPZA 4FXGH 5C0UA 1S0RA 2PKAA 1EASA 3IG6B 1AFQB 1OWDA 5F8ZA 1JOUB 1EZSC 4INHA 2L74A 2V3HH 4DW2U 3EA7A 2A4OA 9LPRA 5L2YH 3ZVEA 4NIYA 1NU7B 1A46H 2VH6A 3A8BA 4Y79A 3O8CA 3BEFB 3GY8A 2ILNA 5EODA 1HAHH 3LU9B 2HNTC 1A61H 3LGVA 5BPEA 2VBCA 1T4VH 2ZHQH 1EXFA 3ZZCA 3MU5A 1SI5H 3LH1A 1SGEE 1ELVA 1LKAA 1EJAA 5IDKA 1Y59T 4YXWD 3RM0H 3UR9A 1J9CH 1CVWH 2FODA 3BG4B 2CF9H 4X1PU 3STIA 1SGFA 1V2NT 1Z8IB 1DOJA 3PTNA 3C1KA 4GLYA 1CGHA 2WV4A 1IQLA 2GD4B 2B5TB 2B7DH 4DIIH 2OBOA 4YZUA 4K1SA 1ZLRA 3D62A 4Z1MD 3O8RA 2R0LA 4Y6DA 4NWKA 1QIXB 1VITG 1ZMJA 3P8GA 4TPIZ 4LOYH 3RXKA 4K2YA 1G3CA 4AG1A 3S9AA 3GCTF 1QNJA 2KX4A 4NFEA 2OP9A 3RXRA 1C5UA 4Y10E 5LPFA 1FQ3A 2J4IA 1GJDB 2PHBA 4DGJA 1EP6A 2TRMA 3QTOH 1C2JA 2GCTB 4K3JA 2FS8A 3ENSB 1KTSB 2BMGB 4IN2A 3B9FH 1C1TA 3GS9A 1GHAF 2TGDA 1SOZA 2FS9A 4O3UA 1GHVH 3UOPA 1BHXF 1MU6B 1THRH 1PPFE 3DSGA 3ZIAD 3ZZ3A 3EQ0H 1C5XB 2GV6A 5DSFA 3B8JA 1QBOA 1YBWA 1P2NA 4CRFA 1C1WH 1BBRE 2EA3A 1WOFA 4B76A 2AGIX 4D7GA 3T62A 2QCYA 3NPSA 4I86A 3FN8A 1EPTA 2G51A 2A5AA 2A4RA 5FBEA 1NN6A 1OX1A 2WV9A 2K1QA 4FETA 1EOJA 1BTZA 1XKAC 2ZTYA 3FO8D 5A0AE 1C5RA 1SLUB 4X0WU 1FJSA 1O3OA 1HAIH 3U98H 4WXIA 4BTUB 5I25A 1XUKA 4BOHA 1KXFA 2OUAA 2STAE 1JXPA 1EAWA 1TNGA 3MH5A 2ALPA 1YLCA 1FDPA 1AUJA 1W12U 3BG8A 1J17T 2ZHWH 1IQJA 3VGCC 4AB8A 1SB1H 2JETB 1HJAC 1T32A 4QT8C 2XC0A 5FL7D 1AVXA 3UR6A 4IW4E 5FPSA 5IK2D 5HIZA 4MPXA 1AVWA 4J2YB 1WTHD 1NROH 1SGFG 5PTPA 4ABJA 1C5OH 1H4WA 2Q6FA 4RN6A 3T2NA 1GJ7B 1DITH 2BDAA 2PWXA 2B9LA 3NKKA 2QA9E 2ESTE 1GI5A 3PO1C 3T29A 5F6MA 1Z8RA 1UCYE 1MQ6A 1FAKH 1A7SA 1B0FA 2XW9A 1YPMH 1MTSA 3SJOA 1H9LB 3V13A 1BTXA 2VWLA 5GIBA 1C5PA 2WYJA 1ETTH 1UK3A 2OLGA 2ZEBA 1K0HA 1QR3E 1O2JA 1VJ9U 2SNWA 5E0GA 1T31A 4YESB 1D3PB 1EB1H 2BD9A 1O2WA 2XWAA 4TY7A 3S0NA 1DX5M 1SQRA 1ZR0A 2IJOB 4FUFA 4WWYA 1NS3A 3M5NA 4A1VA 3Q77A 1MKWK 5JBTA 1ARBA 1TGCA 4M7GA 1GCTC 3EYDA 5KEDA 2BD8A 1OOKB 2SGDE 1SQAA 4CH8B 1GJ9B 1UVPA 2ANYA 1Q2WA 2SGQE 3OY5U 2BX3A 1F5KU 4GPGA 1AKSB 1UTMA 5FBIA 1QL7A 2R0KA 4NIWA 1Y3VA 2ZFPH 4JZ1A 4X8SH 1G2LA 1SL3A 1FLEE 5GXPA 3WWBA 1C1VH 2KCAA 1Z1IA 3A7ZA 4MPUA 1GBLA 3KQEA 5C1YA 1O3LA 1XUIA 3EGKH 2BXTH 1DT2A 1GJCB 1O0DH 3EE0B 3GY6A 3NCLA 4NSYA 3BTHE 2VVUA 4KGAA 4TWWA 1SGYE 3FP6E 3DD2H 3ZVBA 3ZZDA 2HWLB 2ZI2H 4ISIH 4X6OA 3SORA 5F8TA 3KYFA 1OXGA 1NRNH 4NZLA 5EIYA 5T6GA 1TALA 3GDSA 1UK4A 3I78A 1DE7H 1BDAA 1O2LA 1KDQA 5FAHA 3AK5A 3JZ2B 2EI6A 1EJNA 2AS9A 2W3IA 1N8OC 1QTFA 1YM0A 3KQBA 2Z7FE 2GCTC 2QXJA 3SQHE 1AD8H 1SGQE 1FY8E 1S84A 4CRCA 1TONA 2OC1A 1OWEA 1VGCB 4ASHA 2VIVA 1C5QA 1E34B 2BDGA 1JRTA 3FOAA 1P9UA 4H6SB 3SV7A 4BXWA 1NESE 3U8TH 1F2SE 5A8YA 1GI8B 2G52A 4YOGA 3A88A 4HI3A 1OWIA 4NWLA 1TB6H 2O8WA 1PYTD 1W0YH 5F8XA 6LPRA 1TMUH 1YLNA 5JBAS 2LNCA 2VWMA 3ODFA 4JYVH 1O34A 4U32A 5JPMH 1HXEH 5FXLA 1O3AA 1YCPM 1HCGA 1NFUA 3SUFA 4WY3A 4B73A 4YM9A 2M2AA 5GJ4B 4Q80A 1BOQA 3DA9B 2G4UA 2OINA 3UFAA 1GHWH 2XCFA 2ZP0H 1OS8A 1LVOA 2JETC 3ZZ5A 2O8UA 1BTUA 1ARCA 4B6FA 2ZGXH 3BTME 2UUKB 2Y5FA 5EJ1A 3PMJA 1P12E 3ZZ8A 1D3DB 3U69H 1LHGH 1BTHH 2BLOA 1V2WT 1AUTC 3S9BA 1TFXA 3UTUH 1O3GA 3DUXH 3QLPH 3T27A 5A8ZA 4WF8A 2VH0A 1GJ6A 2GDDA 1GL0E 4NZQA 2FOHA 1Y3XA 1GMDG 2EI7A 4FUJA 4AFQA 4J1YA 4Y8XA 2ZGHA 5DPAA 2OQ5A 4NGAH 8GCHF 4WJG2 1VCQA 2OTVA 2QF3A 1NTPA 1UTKA 4Y0YE 1N1LA 1CQQA 2P3TB 1EAXA 1H8IH 1O2KA 2F9BH 2C8XB 1SOTA 3H7OA 2JH0D 1ZTKA 3BSQA 1O5BB 3QZRA 1AHTH 2PTNA 5FCKA 5C67A 1TRMA 2W6JD 1AZ8A 2HALA 2DUCA 3MWIU 1C2MA 1HYLA 2SGAA 1GBIA 2ZU3A 3U1IB 4KP0A 4MLFB 5EOKA 2A45B 2NU1E 4ZKOU 3RMMH 1UJ1A 4I8GA 1LVMA 2WPLS 3FZZA 4MQAA 1SC8U 3SU3A 1C1SA 1S6LA 2HGTH 1QGFA 2BLQA 1C1RA 2F3CE 3SHAH 2ZDMA 4RI0A 3KCGH 3AVZA 2Z3CA 1UTJA 2AERH 4X1RU 5DP3A 4CHAB 2K0QA 1PPBH 3KHVA 4AGJA 3SU2A 1JBUH 1BBRH 4CH2B 3LJOA 1NU9A 4Q7ZA 1HJ9A 3Q00A 4WMDA 3VEQB 1TPSA 2AEIH 1ZSLA 1LTOA 1Q3XA 3NWUA 1TBZH 5B6OA 2H1UA 4ISNA 3MNBA 3MHWU 8GCHG 2YOLA 1K1IA 3SV8A 1LCYA 3ZVAA 3Q76A 3MU8A 4OS5A 1C5VA 1O2ZA 4X2WA 4ZCNA 1V2LT 1V2UT 2XRCA 1J15A 2PUXB 2FZZA 2QXIA 3SHCH 2R3YA 2AGGX 1GBHA 2ZGCA 3RXVA 4A5TS 3T25A 2GMTB 1A3EH 1KLTA 1VGCC 1YP9A 1MZDA 2RG3A 3N7OA 4X1QU 1HAYB 3ELAH 2ZGJA 1XMNB 1GBDA 2ZDLA 1YPHE 3SUDA 1SHYA 2CK3D 3SYJA 2BQ7B 1DWEH 1JIRA 1PQAA 1QL8A 5F03A 4NSVA 2UUJB 1MCVA 3BTFE 1TAWA 4AFUA 2WPIS 1ELDE 4JMYA 3SOSA 1DANH 2TGAA 3FZDA 2QF0A 1RS0A 3E91A 5ESTE 3ZVFA 1UCYH 4OGXA 1BJVA 4ZH8A 4I8KA 1P3EA 2BY5X 2FI5E 1D3TB 2PGQB 1TMTH 2A5KA 2AMQA 1ABJH 3TH2H 1MTNC 1C5TA 2C4FH 5L2ZH 3WY8A 3E6PH 3D65E 4JZIA 1TOCB 4Q7YA 3RXSA 1GBMA 1SLWB 5EW1H 1ELFA 1EZXC 3IITA 1LHCH 1O2PA 1UTQA 3VB7A 1H8ED 1O33A 2R2WU 2TPIZ 3BIUH 3F2GA 1G2MA 3P92A 4RT1A 4DCDA 4ACBA 2LELA 1XVOA 3TH3H 5LPRA 3NK8A 2D2DA 1CA0B 4FOUC 1XX9A 3GYLB 5DP6A 2P3UB 3P8NA 3LONA 3CNRA 5DGJA 2G81E 3ZVDA 1WUNH 1GI7B 1GJAB 1XUJA 2PFEA 2FOFA 1P2KA 4MG3A 1AN1E 1EB2A 1O2SA 1HGTH 5T6FA 3K6YA 3U1JB 2A1DB 3RXGA 1EUFA 1W0JD 2CHAB 1UVTH 5T3HA 1RXPA 2WUCA 3UAIC 3E16B 5CHAB 1MMJN 1C4V2 2QV1A 1W0KD 2FOAA 4DG4A 4GVUA 4IBLH 1C4U2 1TBRH 1O35A 1P0SH 4X2YA 4U01A 2ZWLH 3UUZA 2XWBI 2WPHS 2OXSA 2G5VA 2FLBH 3RM2H 2P3FH 2JJ2D 4O97A 3ZV8A 3A7VA 2D8WA 2ZTXA 3M7TA 3M3TA 1A3BH 4I31A 4OS4A 1K9OE 4B74A 1NPMA 1A1RA 2GJGA 1UTNA 3VB5A 3ZZ7A 4CHAC 1S6FA 2JDID 2ZKSA 5A0CA 1A5HA 1W7XH 2KCYA 2BYAX 1FN6A 2HPPH 1DXWA 5C1XA 5JB8S 2XCNA 1K22H 5HYOA 1A5GH 3MQKC 3E8LA 4LXBH 2BOKA 1TNKA 1LKBA 3RMNH 3RXQA 4JCNA 3QN7A 1AKSA 1C1UH 1GCDA 3ZYEA 3URCA 2HLDD 3TGIE 1AU8A 1EP5A 5HMAA 2Y80A 3E90B 4K8YA 4XBCA 2BDIA 2ZG0H 2ZFSA 5C17A 1F0SA 1GBCA 2ZPRA 4YO9A 1MTUA 1DFPA 5FHTA 2BY7X 1TRYA 4WVPE 3KYGA 5DN6D 5A8XA 4YOJA 2GMTC 1UVUH 3RXHA 5AFYH 1ZRKA 4AFZA 4JK6A 1O31A 3S69A 1SPJA 4JYUH 1F0UA 3DSOA 3LGUA 4NA8A 1UTOA 3QDZB 3ZZBA 3A7XA 3QTVH 3TGKE 1ANEA 2A4QA 3A89A 3PMBB 1GJBB 1A0HB 3LIWA 3UREA 1DUEA 1DPOA 1HNEE 3BTKE 1TA6A 1D3QB 1L1GA 4E7NA 4RT0A 3ESTA 3O8DA 5EXLA 3MO9A 1MAYA 3RXAA 1WBGB 1GWAA 3W95A 2STBE 3F0OA 2OQUA 2VWOA 2NWNA 2WZQA 5GNDA 1INCA 3EA8A 1DY9A 5CDFE 2BD4A 3SI3H 1F0TA 3OE7D 1S5SA 1LHDH 3BEUA 2QAAA 3E1XB 2DE9A 2WPMS 1ZHPA 2KR7A 3GY2A 1FXYA 1G37A 4FVDA 3MI4A 2OD3B 2ALVA 4AGKA 1EJMA 1HRTH 1TA2A 4ZXXH 2ANKH 3SUEA 4A92A 1KMHB 5LH8A 3PLPA 1GVKB 4P02A 3ATIA 2XTTB 2HPQH 2ZGBH 3SU5A 4IS5A 2Z94A 4ABHA 5ETXA 2AGEX 2KM0A 3BTGE 1GGDC 3H09A 4IMZA 3RXEA 1BTPA 1QURH 2J98B 2EQNA 1SKYE 2QIQA 1WU1A 4Y8ZA 3TJUA 1XXFA 2BVXH 1V2JT 1CA0C 4K69A 3H5CB 3AW1A 4B75A 1L1JA 1LHFH 2PSXA 1GMHF 5EQRA 4CR9A 1PQ8A 2AMPA 1O3FA 3A85A 2CJIA 2ZU2A 5SGAE 1HAVB 5DP7A 3OAAD 4CR5A 2ZDAH 2HNTE 3SGBE 3VPKA 2P16A 2LPRA 1LQDB 3TITA 2GTBA 1O2XA 3TK9A 4A1TA 2GZ8A 2IPHA 5EGMA 3MFJA 1UO6A 5K0HA 2A31A 5CHAC 3A7WA 1IHTH 4IGDA 4I32A 1LO6A 2ZU1A 3AAVA 3S7KB 1ANBA 1O38A 1VCPA 3GY4A 1RJXB 3M61U 3TK6A 2H6MA 2ZECA 4TPYA 2ZTZA 1MU8B 3GCTG 3UNRA 1QJ1B 3PWBA 4DIHH 1RIWB 1C1QA 4B71A 3TNTA 3F6UH 3OU0A 3QO6A 1W0ZU 1F7ZA 3KN2A 4YT7H 1MAXA 4AFSA 3WW7A 5EJLA 2A2XH 1GHAG 2F9PA 4JK5A 4JZEH 3RXBA 3PRBA 5C20A 3KL6A 3MO3A 5AFZH 1S6HA 1AE8H 2WPDD 4A7IB 4Y7BA 1HV7A 1PPCE 4ABGA 1ABIH 2WPKS 1O3MA 3BN9A 5EPYA 4Y76A 1DLEA 1O5CB 1O30A 1O3EA 1GI0A 3SNAA 2TGTA 1FY5A 1W8BH 2FTLE 2J34A 1Y8TA 2ZO3H 1HIAB 1EATA 1C5LH 4K60A 7GCHF 2FI3E 3A87A 3OX7U 1SHHB 3K6ZA 1JMOH 1AFQC 1ACBE 5KECA 2W6ID 1ELCA 2WINI 1BMMH 2CN0H 1V2ST 1MCTA 1O2IA 2WUBA 4UFGH 3IWMA 2VVCA 4HG6A 3A81A 2A32A 1O32A 6GCHF 1YKTA 3SV9A 1RFNA 2FOMB 4ZROA 1CT2E 3EDXB 3FANA 2YNAA 1OWJA 3M5OA 4UFFH 1DLKB 3F0PA 4Y0ZE 2BDBA 3F9GA 1QZ8A 1B7XB 3V12A 1HAOH 3F68H 1C5ZB 1P06A 2Y7ZA 4U2WA 3URDA 2BY9X 3AASA 1GBFA 4DOQA 1T8OA 1K1LA 3BG4C 1UHBA 3T26A 1THSH 4P00A 5GCHF 2Q6GA 2XC4A 2JIZD 1K1JA 1OP0A 1OYTH 2O8LA 3KQDA 3GDVA 3SNBA 3GCHB 1S0QA 2C8YB 3OTPA 1C5SA 1S83A 4AYVB 5DK1A 2XBVA 2Y81A 1NC6A 5EU8A 4NA9H 4ZXYH 2HLCA 2C8WB 2YMSD 3GISB 2SGPE 7LPRA 3RLYH 1DVAH 2ANMH 4BXSA 1PYTC 4LZ1H 1KSNA 4ABDA 3QZQA 2ZHFH 1YF4A 1AWHB 3STJA 1EAUA 7GCHG 1C2KA 1ETSH 5AVDA 4X2VA 2VIDA 3PMHB 2H9TH 3QGJA 2J92A 1P2IA 3HGPA 1O5EH 1TOMH 1DS2E 3GCNA 3ITIA 2J97A 2QF5A 2AYWA 2PR3A 4OS7A 3P6ZB 3LH3A 4A6LA 1WYKA 3SN8A 1BMNH 1P9SA 6GCHG 2UUYA 3RP2A 1BB0B 2ZPQA 1GBKA 3ATMA 3D49H 1GJ8B 3Q3YA 3M5MA 4D9RA 2ASUB 3E3TA 3UWJH 1UTPA 1W3CA 1K1NA 1WQVH 1NRQH 1GI1A 2CXVA 1SR5C 2XC5A 1DSUA 3TNSA 3RXUA 4E05H 1CE5A 2BDHA 4H42U 4A1XA 4OS1A 2OK5A 1ZTLA 1YPKH 1BRBE 1AE5A 1P11E 1BJUA 1EZQA 4KKDA 3RLWH 3K65B 1P01A 3CS7A 2R9PA 3HATH 5HXFA 1BBRK 1FV9A 1O2GH 4I8LA 1C5MD 2V3OH 2ZCKP 1IQNA 2F9NA 1MBQA 2ODPA 1GBEA 3PLKA 1Z6EA 1SQTA 1C5YB 2BM2A 1TRNA 1BZXE 2FOGA 5BRRE 1ZSJA 1O3KA 1RD3B 3PV4A 1TNIA 1C2EA 3A86A 3GY5A 2ZC9H 3UNSA 1Z1JA 5C94A 1W11U 1RIWC 4FU9A 4X8VH 1O3CA 1P2QA 4ISOA 3QGNB 4YLUA 3U9AH 1HAZB 5DO4H 1GDQA 1J14A 5E2PA 1IAUA 4BAMB 1DY8A 2FESH 1BMFD 2ZQ2A 1HPGA 4IMQA 2BY6X 4KTCA 1SVPA 2XNDD 1BMAA 1EPTB 3SBKA 2PUQH 1TX8A 1SGTA 1IQEA 2G8TA 4WXVA 1HFDA 3MO6A 1AZZA 2GV7A 1SGCA 3M3SA 3PV2A 2QC2A 1LDTT 1K1PA 1TLDA 3FKSD 4X6NA 1PQ7A 2OC0A 5A0BA 1ELAA 1O5FH 4MPWA 1BT7A 1AWFH 2ZF0H 1WXRA 2EC9H 5FPYA 2BHGA 2VGCB 1ZOMA 1UCYK 1V2PT 4RKOB 4CRDA 1QB6A 4ABBA 3SU1A 3SV2H 3PTBA 1XKBC 4NA7A 3UB0A 1M9UA 1NZQH 2RA0A 4O3TA 2GZ9A 1AO5A 1CGIE 3HPTB 1D6RA 3OYPA 3TIUA 2XYAA 3N99A 1BRAA 2SGFE 2FYRA 4JZFH 3D23A 5HIYA 4WMFA 1L0ZA 3ATKA 2W7SA 5JB9S 3S7HB 5HKKD 1C5NH 1P3CA 4B2CA 1ZGVA 4ZHLU 3LT3A 3GCHC 4B2AA 2AIPA 1P04A 2P93A 3I77A 3V0XA 1EAIA 2ZFQH 4MTBA 3TK5A
chains in the Genus database with same CATH topology
1E0FD 2BVRH 1BA8B 3LC3A 1XUGA 1V3XA 3LGTA 1QQ4A 4MDSA 1YPGH 1K1OA 2W3KA 2OBQA 2H9HA 1ZRBA 2H5CA 2J95A 1RRKA 1ELEE 1ZHMA 3AW0A 3SNDA 1HAXB 2CMYA 1O2MA 3ZV9A 2FTMA 4CRBA 2BVSH 5C3NA 1G9IE 1OSSA 1QHRB 2UWOA 2ZDVH 3RU4D 1FI8A 2AIQA 4DVAU 1FNIA 4Q7XA 2AMDA 1ANDA 1NFXA 4Y71A 3ZVCA 5CE1A 1LPZB 2HOBA 4KTSA 4I8HA 4I8JA 3DFJA 1T8MA 6CHAB 1GI3A 4TWYA 2RDLA 1WTGH 3G01A 1P10A 2BQ6B 4MVNA 4AX9H 3RU4E 2BD3A 2ZNKH 2VIOA 4XE4A 2WPJS 5JDUB 4DURA 1GBAA 1ESBA 2F9UA 1ELGA 1W2KH 2P95A 1MD8A 3GYMA 1QRXA 1SMFE 4FU8A 4I7YH 3LPRA 2F91A 1GMCF 4IN1A 4Y8YA 2ODQA 1O2VA 3L3TA 2G55A 5C1UA 3NXPA 3M3VA 4HGCA 4WH8A 1C2GA 2BY8X 2XBYA 2VIWA 1LPKB 3GY3A 1VR1H 1CBWB 1OKXA 3SGAE 1ZYOA 2HRVA 1IQFA 4X8TH 5DP4A 1MTVA 5HM9A 4H4FA 4UE7H 2O9QA 3OTJE 1O2OA 3CS0A 5EW2H 4FUBA 1F5LA 1GDNA 2ZDNA 3U8OH 1GHYH 3UPEA 1B5GH 1NT1A 3KQCA 1V2KT 2FM2A 2Y5HA 3MTYA 4GHTA 5CMXH 1SGIB 1KTTB 1IQHA 1BITA 4BNRA 5TCCA 2FXRA 4Y11E 3RXLA 1GI9B 1O2YA 2GT8A 3GICB 2FWWA 2H9EH 2VGCC 3LGIA 1ANCA 1TQ0B 1V2RT 1GMCG 2Z3DA 3SU6A 3ZZ9A 1O2UA 3DHKH 1QBNA 2PW8H 4IC6A 2FDAA 3A8DA 5DG6A 2A7CA 2NU0E 5LGOA 1O3BA 4FUCA 1LMWB 1HIAA 1MTWA 1CU1A 1CGJE 1HAGE 3Q3KA 5G4BA 3P95A 1XUFA 1O39A 3H7TA 2VB0A 2FMJA 2O8MA 3BEIB 1SLVB 3HK3B 3HKJB 2AH4X 1FMGA 5H4IB 4FVBA 3TJNA 1C1OA 1ELBA 1C9TA 3RC5A 1TGBA 4INLA 4ISHH 9ESTA 2J9NA 1ID5H 1KXCA 5E0HA 2QYIA 5AF9H 5DKMA 3BTQE 3GOVB 2V6NA 3EA9A 1P2OA 1GI2A 1QFKH 1MUEB 1OP8A 1TX6A 1UMAH 2WV5A 1C2HA 3TJOA 1YCPH 1BRUP 3RU4T 3KNXA 2Z6BD 3MH6A 2VWNA 2NU2E 1TPPA 1ZSKA 4GUXA 1KXBA 1DICA 1V2TT 2VIQA 3HGNA 3R0FA 3VB4A 1Q31A 2BLWA 5JBCS 3RMLH 2JKHA 2UWPA 1RTKA 4TY6A 2BDCA 2FX4A 6CHAC 4BTIB 2ZFFH 2GVFA 1GG6B 1G3DA 3QK1A 3SJ9A 1L1NA 1GJ4H 4F4OC 3UOUA 2Y7XA 3P70B 4Y7AA 1OPHB 4HTCH 6ESTA 1YPJH 4ZKSU 4HFPB 1T8LA 3SW2B 1A5IA 2ZU5A 1ESAA 3MMGA 3VXFH 2GX4A 1AB9B 1HJ8A 3L6PA 3VFEA 4CREA 1GCTB 1QCPA 2NU3E 3T5FH 1W10U 1RTFB 2GDEH 4KELA 5FPTA 1BUIA 3TH4H 3A7YA 3V3MA 5ABWA 3SJ8A 2C8ZB 1ZPBA 4ISLA 3L33A 1HLTH 3QUMP 4Q2KA 1F92A 3F9HA 1BCUH 1PJPA 2JH6D 3V7TA 4K8BA 1ZGIA 3FVFB 1CBWC 3K2UA 3LGYA 3PWCA 1UVOA 1ZJKA 1SGNE 3RXDA 1MBMA 2SFAA 4UFEH 4XDEA 3F1SB 1P05A 4B2BA 4Z0KA 4THNH 1Z8GA 2EEKA 4ABFA 4VGCB 4R8TB 1IOEA 2W26A 1TIOA 1PPEE 4MNWA 3ZZ6A 1FUJA 4ZHMU 3SNEA 1T4UH 1P03A 1FIZA 2XBWA 1N8OB 2OC7A 1AGJA 3RDZA 4FUHA 3RUOA 1EKBB 1XM1A 2VU8E 2VJ1A 3E0PB 1E38B 3SJKA 1N6XA 3A7TA 4AG2A 1S82A 4ZUHA 4X6MA 4GCHF 1WCZA 4X1SU 1MKXH 1D9IA 3RMOH 1GL1A 1C2FA 2CHAC 5ESBA 1QB9A 2G5NA 1C9PA 1KLJH 3TJVA 1QQUA 2A0QB 1VJAU 1L2EA 2Q6DA 4O9VA 3BV9B 2BQWB 1Z7KA 1G3BA 3NZIA 5K7RA 1K21H 1O5DH 1SFIA 2AFQB 1Y3UA 1Y3WA 1TGSZ 2ZCLP 1VITH 2B0FA 5C5OA 1Z8JB 4YLQH 2KAIB 3TU7H 4BANB 1F0RA 4DT7B 1EZUC 1NRRH 2WYGA 1OP2A 4FUDA 2R3UA 2ZZUH 1S81A 2YNBA 3UNQA 1NO9H 3LOXA 4GHQA 2PV9B 1FY1A 2M5TA 1O3JA 2A5IA 2QN5T 1PPGE 5EXMA 3CENA 3RXIA 3RXPA 1AFEH 4ZAEA 3ZVGA 1O36A 5J4QA 2EI8A 3R3GB 4YOIA 2XXLA 1E37B 1GBJA 3VB6A 2DE8A 4DJZB 3MU4A 1WQSA 4B1TA 5A09A 3PMAB 3BTEE 1FPCH 1KXEA 4Z6AH 1WV7H 2P8OB 4ZKRU 3ZZ4A 4MNVA 2BX4A 4BAKB 4AB9A 1GMHG 3RXTA 4AYYB 1QY6A 5DP5A 3UWIA 1L4DA 2GCHF 4TYDA 1H1BA 1X7AC 4ABEA 2BD7A 3SI4H 1YLDA 3MOCA 4GCHG 4CBNA 7ESTE 2ZDKA 1ZHRA 1C2DA 4UD9H 4UEHH 1LVYA 1L4ZA 2G00A 4FUEA 4BAHB 3SGQE 1SLXB 3C27B 3PB1E 1V2MT 1A2CH 3SU0A 4BAQB 1C1PA 1CT0E 2GZ7A 5E0JA 1MD7A 1AY6H 1GG6C 3HKIB 2PSYA 1SSXA 1YC0A 1CO7E 1Z71A 4YTAA 4MNYA 4AORA 1K2I1 4K5ZA 3OY6U 2VINA 4X6PA 1TX7A 4D7FA 1DUAA 2FOBA 1ELTA 3UIRA 1AB9C 1K1MA 1W13U 1G30B 2ZU4A 3BF6H 1XXDA 4SGBE 3FP7E 1H9HE 1UK2A 2BZAA 1GJ5H 2FI4E 1TYNA 1LVBA 1SBWA 2GGVB 2Z9KA 2Z3EA 3BTWE 4NCYA 3PROA 2HVXA 1KYNA 2Q1JA 4NFFA 2P94A 1DM4B 1BQYA 2PKAB 4OS2A 3SNCA 3TVJB 1A0LA 1J16A 2OCVB 1C1MA 1SFQB 3MNSA 5AHGH 4BAOB 1B0EA 4ABAA 1G3EA 3MNCA 4LK4A 1DWDH 1TNJA 1BTYA 2GCHG 1ZTJA 5IYTA 2FOCA 4XOJA 3A80A 1V2OT 1G32B 1NRPH 3EAJA 4AZ2B 4AN7A 3T28A 1OWHA 1TMBH 2TBSA 1TNHA 1IHSH 3M36A 1AVGH 2FP7B 4VGCC 4ESTE 4K1EA 3E0NB 1O2HA 1KY9A 1C1NA 2SGEE 1ZMNA 4KTUA 1S85A 2Y6TA 3UQOA 4F49A 1QA0A 1C2IA 1CSOE 2NU4E 4ZMAH 3MNXA 2PKSB 1NFYA 1TWXB 3A8AA 2J38A 1E35B 3SZNA 4D9QA 5FX6A 3ZYDA 5T6DA 3PM3A 8ESTE 1O3PB 1TPAE 1TQ7B 1CHOF 2Z9GA 4MNXA 1SQOA 4YT6H 1BHXB 1WAYB 3A83A 3DFLA 1YGCH 4X1NU 5GCHG 3Q3XA 1CA8B 4MPVA 2HNTF 1THPB 2FX6A 1NFWA 1GMDF 1FY4A 8LPRA 1DWCH 2V35A 1DSTA 2A4GA 2THFB 1SGPE 1HDTH 2I6SA 4UDWH 5HM2A 3ATLA 2CGAA 7KMEH 1BIOA 1EQ9A 1FONA 1NRSH 4RKJB 3RC6A 1J8AA 3CP7A 1JWTA 3LC5A 2ZHEH 1MKWH 5JBBS 1LHEH 2FO9A 2C93B 2GT7A 1G36A 4X8UH 1FN8A 3UY9A 2J2UA 2F9OA 2F9VA 3SJIA 1KLIH 1MTNB 4FUGA 3GDUA 1TNLA 3SU4A 1KXAA 2FLRH 1HB0B 3RXOA 1P2MA 1KXDA 3TGJE 3NUMA 3HK6B 3LKWA 1DDJA 1O2RA 1Y5AT 2ZFTA 3M7QA 2P8OC 4HZHA 3KIDU 4O03A 5J4SA 1P09A 1TPOA 5L30H 1UVSH 4GSOA 1UTLM 5EPNA 1ZJDA 4X2XA 1CHOG 5FX5A 3P8OA 2BOHB 1Y3YA 1QBVH 2FPZA 4INKA 3BTDE 1IQIA 2P59A 3DT0H 3M35A 4IC5A 3K9XB 5E2OA 4D8NA 1GHZA 1QJ6B 2GP9B 2Z9IA 4XSKU 1RGQA 1HBTH 3ZZAA 4CRAA 2TGPZ 3TPIZ 4U30A 2OC8A 3MH7A 1T8NA 5EQSA 3UQVA 2IN2A 1YPHC 4ZHAA 3MYWA 3QX5H 1BMLA 1ZZZA 3FAOA 1AQ7A 1IQMA 3RXFA 1V6DA 5TCAA 1H8DH 4LZ4B 3F9FA 1SGRE 1H9IE 3PLBA 4WH6A 4NIXA 5EXNA 1D4PB 1K28D 3B23B 2VIPA 2W5EA 1OWKA 1GDUA 3RC4A 1F5RA 3W94A 2Y5GA 1HUTH 1BTWA 2FOEA 1E36B 4PROA 1P02A 1GHBF 1O3NA 1C5WB 2CF8H 3A84A 5HGGA 1T7CA 2RA3A 1W14U 3MH4A 3P17H 4WMEA 2C3SA 1U6QA 3U8RH 1ZMLA 2FEQH 5GWZA 4BTTB 4UONA 2VVVA 3SO3A 2B8OH 3KF2A 4JYTA 3PYHA 1QA7A 2BB4A 5A2MH 1ESTA 3S9CA 1FPHH 1ZPZA 3GY7A 2ZPSA 3ODDA 3MU0A 3FFGA 1DWBH 4NG9H 4CRGA 1TBQH 1AMHA 1SGDE 1JIMA 2PLXA 2D1JA 2UUFB 2PKSC 1UHBB 4ZKNU 1QB1A 1C4Y2 2H2ZA 1O2QA 1FZZA 3A82A 2R2MB 5TJXA 1O2NA 1FAXA 2O8TA 1IQKA 1O3DA 3O8BA 3LJJA 1NM6A 4XBBA 2ZHDA 3GCOA 4I33A 1P57B 1PFXC 4FUIA 1DXPA 2Z9JA 1AIXH 4OGYA 2JH5D 2ODYB 5JYIA 4SGAE 4H6TA 1YPLH 1KDQB 3AAUA 3F9EA 2CV3A 3BTTE 1V2VT 2PGBB 1GHBG 2BTCE 2UWLA 3VB3A 3RXMA 2ZFRH 3M5LA 2C90B 4R0IA 1YCPK 1TABE 1O5GH 4NIVA 3SUGA 1QJ7B 5C5NA 2GKVE 3RXCA 4RSPA 2FIRH 2RCEA 1EX3A 3FP8E 2VNTA 1D6WA 2XBXA 1HAVA 4GAWA 1HAPH 2IOTA 3LGWA 4JZDH 5DJ7A 2A7JA 1MQ5A 4E7RG 3P8FA 1LPGB 2ZCHP 1XVMA 1EPTC 2BDYA 4D76A 1YYY1 1ZPCA 1AI8H 2BD2A 1GBBA 2H5DA 3KGPA 1W7GH 3M7UA 3JZ1B 1O37A 2ANWA 1FY3A 3TLOA 5DP8A 1P2JA 1Y5BT 1O3IA 1QRWA 2KAIA 2ZA5A 4AOQA 1GBTA 1GGDB 5E8EH 1PQ5A 1WSSH 2J94A 1KIGH 2A7HA 5LPEA 1A0JA 1N6YA 1IQGA 4ABIA 1GI4A 2Y82A 4FU7A 2QXGA 3I29A 1HXFH 1ORFA 2FYQA 1PPHE 1MH0A 2QY0B 2QGRA 1Y5UT 4DY7B 1LQEA 2QXHA 2ZQ1A 1JRSA 5FCRA 3M37A 5I46H 4UFDH 1QL9A 1CHGA 2ZIQH 4E06H 2I6QA 1TE0A 5EQQA 3RXJA 1SG8B 1XUHA 2W7UA 1C2LA 1MZAA 2G4TA 2BXUH 1VCWA 1YPEH 1FIWA 1QRZA 1GHXH 4CBOA 5L6NH 1NY22 5EG4A 4K1TA 5C2ZA 1CT4E 2BLVA 2BZ6H 2F83A 1RTLA 3SQEE 1P8VC 2A2QH 5GDSH 2SNVA 1ETRH 1O2TA 3BIVH 2PTCE 3VGCB 4OS6A 1O5AB 1HJAB 2V0BA 1V2QT 3LDXH 3KEEA 1GVLA 3VXEH 1PPZA 2XNIA 2D26C 1A4WH 2Z9LA 1TGTA 4XBDA 5DP9A 8KME2 1GVZA 1EOLA 4XFQA 1BRCE 2TIOA 1MKXK 3ATWA 3PO1B 5GPIB 3A8CA 3QWCH 1VITF 3SV6A 1OYQA 2BD5A 1GI6A 1O3HA 3MU1A 1Z6JH 1TGNA 1VZQH 3OSYA 2ULLA 1GPZA 4FXGH 1S0RA 2PKAA 1EASA 3IG6B 1AFQB 1OWDA 5F8ZA 1JOUB 1EZSC 4INHA 2V3HH 4DW2U 3EA7A 2A4OA 9LPRA 5L2YH 3ZVEA 4NIYA 1NU7B 1A46H 2VH6A 3A8BA 4Y79A 3O8CA 3BEFB 3GY8A 2ILNA 5EODA 1HAHH 3LU9B 2HNTC 1A61H 3LGVA 5BPEA 1T4VH 2ZHQH 1EXFA 3ZZCA 3MU5A 1SI5H 3LH1A 1SGEE 1ELVA 1LKAA 1EJAA 5IDKA 1Y59T 3RM0H 3UR9A 1J9CH 1CVWH 2FODA 3BG4B 2CF9H 4X1PU 3STIA 1SGFA 1V2NT 1Z8IB 1DOJA 3PTNA 3C1KA 4GLYA 1CGHA 2WV4A 1IQLA 2GD4B 2B5TB 2B7DH 4DIIH 2OBOA 4YZUA 4K1SA 1ZLRA 3D62A 3O8RA 2R0LA 4Y6DA 4NWKA 1QIXB 1VITG 1ZMJA 3P8GA 4TPIZ 4LOYH 3RXKA 4K2YA 1G3CA 4AG1A 3S9AA 3GCTF 1QNJA 4NFEA 2OP9A 3RXRA 1C5UA 4Y10E 5LPFA 1FQ3A 2J4IA 1GJDB 2PHBA 4DGJA 1EP6A 2TRMA 3QTOH 1C2JA 2GCTB 4K3JA 2FS8A 3ENSB 1KTSB 2BMGB 4IN2A 3B9FH 1C1TA 1GHAF 2TGDA 1SOZA 2FS9A 4O3UA 1GHVH 3UOPA 1BHXF 1MU6B 1THRH 1PPFE 3ZZ3A 3EQ0H 1C5XB 2GV6A 3B8JA 1QBOA 1YBWA 1P2NA 4CRFA 1C1WH 1BBRE 2EA3A 1WOFA 4B76A 2AGIX 4D7GA 3T62A 2QCYA 3NPSA 1EPTA 2G51A 2A5AA 2A4RA 5FBEA 1NN6A 1OX1A 2K1QA 1EOJA 1BTZA 1XKAC 2ZTYA 5A0AE 1C5RA 1SLUB 4X0WU<