2FPZA

Human tryptase with 2-amino benzimidazole
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase beta-2
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fpzA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fpzA01
1NU9A 1C1PA 3QUMP 1HAOH 1O5FH 1PPZA 1SSXA 1W8BH 3A85A 1GI8B 2P3UB 4B75A 3EYDA 3KL6A 2PKAA 4YTAA 4XBBA 1F5LA 3A88A 1MQ6A 3GDUA 2DE9A 2PSXA 4Y76A 1O38A 1GG6C 5C2ZA 4NFFA 1QA0A 1UCYK 1O2IA 2GZ8A 2ZPQA 1WV7H 1K1LA 1HLTH 1TNGA 1FIZA 5FBEA 2BLQA 1RIWB 1NS3A 3DUXH 5IDKA 2W3IA 2HOBA 2V6NA 5EXNA 3AVZA 1O36A 2F9BH 1V2VT 1WAYB 3BTFE 2XXLA 1DX5M 4CHAB 4DIHH 4NFEA 1NO9H 1W10U 1P3CA 1E34B 1VCWA 3M3TA 1AN1E 4CH2B 3KCGH 1C5QA 3VB5A 2TGPZ 3BG4B 1LVMA 2UWPA 2G8TA 2BD8A 1LDTT 1ESTA 1NN6A 1O3NA 3VXEH 3SNDA 1K1OA 1IQMA 2HPPH 4B73A 3RXAA 1MTVA 2FTMA 2OINA 1HAGE 5FBIA 1FONA 2F9NA 4BXWA 2Y80A 1BCUH 2ZTYA 2QIQA 2WINI 1JIMA 1TRYA 2BQWB 3MI4A 1ESAA 1L4ZA 1GI9B 2VH6A 1HAPH 1ZMNA 1G2LA 2A1DB 2RA0A 1V6DA 5DP4A 1SHYA 5T6DA 1L1NA 1BRUP 4H6SB 4Y6DA 1B5GH 1P05A 1O3LA 3RU4T 2Y7ZA 3ITIA 2FIRH 2ZHQH 2GD4B 5DGJA 6CHAB 1QR3E 1DY8A 2I6SA 1OWHA 3B23B 1VJAU 1O2PA 1BA8B 1N6XA 1GBTA 1BMLA 1M9UA 3CS0A 2BY6X 1S83A 4NWLA 3M35A 1BDAA 5GXPA 1OX1A 2WPHS 3ZYDA 2C8XB 2A4OA 1TBRH 1GDQA 1XXDA 2H9HA 2OCVB 3BN9A 3RXVA 1Y3YA 2GX4A 1EUFA 1HAIH 2Y82A 2BY8X 3UTUH 2GT7A 1GBFA 1RJXB 1VITF 1GI4A 3OY5U 4Q7XA 4Q2KA 1C4Y2 1OYTH 5DP3A 1Z6JH 3EGKH 1O2QA 1MAXA 1W11U 1C5VA 8KME2 1T4UH 1RTLA 1QB1A 2G4UA 1NFUA 1IQIA 2LNCA 1Z6EA 1A3EH 3D49H 5HMAA 4OS2A 4Y11E 1SC8U 3SU2A 3U1IB 1YPEH 1OWIA 3ATMA 4UFEH 1QRWA 6GCHG 1K22H 1QBVH 3RLYH 1C5SA 1SQOA 1A0HB 3SHCH 4YO9A 1EOJA 1F5KU 3M3SA 1FY3A 1KYNA 1NU7B 1OS8A 2P59A 1TNKA 2ZI2H 3PM3A 2EC9H 3SU6A 1W12U 2P16A 1Q3XA 1AD8H 4DJZB 5DP6A 1ELVA 3LGWA 1QB9A 4XDEA 1TPPA 1SFIA 1IAUA 1YLDA 2W7UA 3PWBA 2C3SA 1D3PB 2BOHB 1VR1H 2ANKH 2VIOA 1W13U 4UFDH 1XKAC 4X6OA 1LQEA 5HM2A 3M5OA 4B71A 4D8NA 1H9LB 2VWLA 3UWJH 3MHWU 2ZGJA 4B2AA 1FN6A 2AGEX 2G55A 3QO6A 1XVOA 1CE5A 2FYQA 1VZQH 5A0BA 2ANMH 1EAWA 2WUBA 1V2LT 5EQQA 1IQGA 1GI6A 3SUEA 4RKOB 1PPHE 3HK3B 1C5PA 4GCHG 2AGGX 4A5TS 1Z7KA 4ZUHA 2AIQA 1BHXF 3MNSA 4K1SA 3P92A 2WUCA 1W7GH 1A61H 4CREA 4ABFA 4D7GA 5AHGH 3D23A 3IITA 5JBBS 2P3TB 1O2MA 1MTSA 3RXJA 3UNQA 2TGDA 1C4U2 1EJMA 1EZSC 1C1SA 1G3CA 3GYLB 4K3JA 3MU5A 7ESTE 2A32A 4A92A 2A7CA 2ANYA 4MPUA 5DK1A 2ANWA 3P8OA 2BX4A 4FXGH 2FZZA 2FOBA 3KF2A 2PUXB 1WOFA 1F0SA 1OP2A 4BAKB 3RM0H 3EDXB 3RXLA 1FI8A 1SGRE 3RXPA 1GBAA 3RMNH 1C4V2 1RIWC 1EB1H 1WUNH 1ZSJA 1KLJH 2GZ7A 1T8OA 2BLVA 4X2YA 1CGIE 2EEKA 3ZVDA 4BTIB 4X8TH 4DT7B 1PPGE 4X6PA 4CRGA 1MU6B 1AIXH 4MPXA 1F0TA 3ATWA 2W26A 3QDZB 4WWYA 2QGRA 1QL9A 3BG4C 3TGKE 1C5XB 1GHXH 3MU4A 2ZEBA 1EKBB 3T27A 1UVOA 1AUTC 2FI5E 1C5NH 1NM6A 2HPQH 1ZJKA 2FOHA 5T3HA 1ANCA 4B76A 2QYIA 3L6PA 4GSOA 4XBDA 1ACBE 1HGTH 3A84A 3VGCB 1BZXE 1MZDA 1G3BA 1Z71A 1O2TA 1GBBA 1YM0A 2VU8E 4LXBH 2VWNA 1O2JA 1P02A 1PQAA 1CT0E 2EI7A 3RXOA 3VXFH 1SLUB 3DFLA 1UO6A 1ELTA 5FPTA 1TMBH 1SR5C 1TGSZ 4FVBA 4A1TA 1AUJA 1XUIA 2NU3E 2GCHF 1YF4A 4O3TA 1ZSKA 1ELEE 1RTKA 4IW4E 2PSYA 3GISB 2VNTA 2FOFA 1C1OA 4XSKU 5C3NA 5JBAS 1ZPZA 3CS7A 3A80A 1Q2WA 1SPJA 5AF9H 1Y8TA 1PPCE 1MTWA 4THNH 3E0NB 1C2HA 1CHOF 2G52A 2ZF0H 4NA8A 3URDA 1O2RA 1QTFA 1UMAH 1ZTLA 1LPGB 1VITG 1MKWH 4TWYA 3SOSA 3RU4E 1P2NA 1GJAB 3PMAB 4B2CA 1TBQH 2BDIA 4A7IB 3SORA 2NU1E 3LH3A 3RXHA 1ETRH 1DWCH 2Z9IA 1FV9A 1YPGH 1YKTA 2AYWA 4A1VA 3A8BA 3HKJB 3M3VA 1V2JT 1A5IA 1LKBA 2QY0B 4I8LA 1YYY1 4DIIH 3C27B 1NROH 4X1NU 1PQ8A 1P2KA 4LZ1H 3GY8A 3QK1A 4VGCC 3JZ1B 1SOTA 1P04A 1TRMA 3MNXA 2SGDE 1OPHB 4ZROA 2GV6A 1QJ6B 4HI3A 5HGGA 1LVOA 1TX6A 5C67A 5ESTE 1A3BH 1GBDA 1SFQB 3M36A 4FU9A 5FX6A 1GI0A 1LHFH 4H6TA 1YC0A 8LPRA 2AH4X 4ESTE 2HALA 4CRFA 1SGYE 1VCPA 2CGAA 2J95A 4E06H 5DP8A 3HGNA 2CMYA 1OWJA 2GDEH 1DLKB 1OWEA 4X1QU 4INKA 4YOIA 1D3DB 5BPEA 4B2BA 1DPOA 1TIOA 3T2NA 4ABBA 2VVVA 2QV1A 2IOTA 1YP9A 1LHGH 3PLPA 3UUZA 2BVSH 4HGCA 2HLCA 2FX6A 2OLGA 1GBLA 3P8FA 1AU8A 4IC5A 3URCA 1DUEA 2QXIA 5JB8S 2ULLA 2XCNA 4Q80A 2OUAA 2WPKS 1ZHRA 2XCFA 4I31A 4X6MA 4AFQA 3A8CA 1O5BB 1J15A 1G9IE 3UIRA 2H5CA 1BMNH 3MH5A 3QWCH 3F6UH 1O2YA 2YOLA 5CMXH 3ZVEA 2F3CE 4NIWA 4RKJB 1EJNA 4Z0KA 2OQ5A 3AASA 1OOKB 4Y7AA 5FAHA 4ISIH 1RXPA 2ZDNA 1GHYH 1LPZB 2QF0A 1QNJA 4IN2A 5T6GA 1GI1A 2J2UA 1C5TA 1J16A 4JYUH 1BBRE 1BIOA 1EQ9A 1QRZA 1GJ8B 1K1JA 2PKSC 4J1YA 3K6YA 1ANBA 1IOEA 1S0RA 2ZG0H 1W0ZU 3S69A 3V7TA 1HAXB 5FCKA 1HIAB 1UK4A 2BY7X 3MOCA 4ASHA 1IQLA 1AMHA 3SQHE 3RXBA 3ZV9A 4AGKA 7KMEH 4X1SU 4JZFH 4MPVA 1CVWH 4XBCA 3RXGA 3SNCA 2ZFSA 5A2MH 4DCDA 1J14A 1N1LA 5HXFA 1J9CH 3FP6E 3TH2H 1ELGA 2ODYB 1CA8B 3VFEA 1FLEE 1Q31A 2Q6DA 3MFJA 1GL1A 4BAMB 8GCHF 1AZ8A 5A8ZA 3RXIA 1GMDF 1A5GH 3TIUA 2VWOA 1FNIA 4IGDA 1ABIH 1XUHA 1DDJA 2XWBI 3GCOA 2Y5FA 2V35A 1UTPA 1GHAG 4D9QA 5EGMA 1FY5A 3DD2H 2A2XH 5EXMA 1KTSB 2W3KA 1HAVB 1DXWA 2Y5GA 1GJ6A 3VGCC 2FMJA 2GCHG 1BRBE 4ISLA 1QJ1B 2GMTB 3GY7A 1SQAA 2Z6BD 5E2OA 3VB6A 1TAWA 1BTUA 1SGCA 4I8GA 3P8NA 1O3MA 1TABE 3ZZAA 4JZIA 4DW2U 2PUQH 2BDAA 1L1JA 5C1YA 1CHOG 1QURH 4MNXA 1TNJA 4YOGA 3PMJA 1QGFA 3BSQA 2Z3CA 2ZGBH 3VB7A 1GI2A 2FP7B 1C9PA 2ZU5A 3ZZ9A 2D26C 1FIWA 2A5IA 1LO6A 4ZKNU 1QA7A 2YNBA 1G37A 3RU4D 1GGDC 4NSYA 3H5CB 2ZGCA 1C2MA 1CSOE 1D6RA 2OQUA 4Y8XA 1GJ9B 1O3HA 3MO9A 1KSNA 1HRTH 4NIXA 4INLA 2ZU1A 1O5GH 2RCEA 4WXVA 4Y8YA 4X0WU 2WYGA 4ABAA 3MH4A 2OBQA 5DG6A 4NCYA 1O2NA 1ZOMA 2O8MA 3N7OA 1HJAC 3QLPH 2VVUA 2BD4A 1X7AC 2PV9B 3LJJA 1BUIA 5EOKA 2R0LA 2XC4A 1AVGH 1UVPA 5E0HA 5FX5A 2B7DH 1SOZA 1P9SA 5J4QA 1MCTA 1ZJDA 3OSYA 3LJOA 3OYPA 1SGFA 4ABIA 1DSTA 3LH1A 3NK8A 2Q6GA 3RMMH 4BAOB 3RLWH 1QCPA 3SV2H 1UK2A 4HFPB 1WU1A 2SGFE 2ZECA 3U98H 2ZP0H 2BYAX 2FOGA 5FCRA 1O3EA 1IQNA 3O8BA 4X8UH 3QZQA 1V3XA 4JYVH 1HAZB 3A83A 1ZYOA 1E0FD 1ANEA 4GPGA 5TJXA 4YZUA 3TGJE 2HNTE 4DVAU 1L1GA 1P03A 4FUGA 3DA9B 3O8CA 1DANH 1GBMA 1MU8B 1XXFA 1O34A 1QL7A 2CN0H 4AB9A 3GCTF 2BD2A 3EAJA 1C2KA 1W2KH 2FLRH 1AFQC 1H4WA 4Q7ZA 1BITA 3BTTE 1E36B 4I8HA 4NZLA 3BTGE 1C9TA 1UVUH 2B9LA 4IMZA 1OSSA 3FP8E 1A46H 1NRSH 1P8VC 2SGEE 4CRDA 3G01A 1ZZZA 4WXIA 1FUJA 4ZH8A 4BOHA 5GJ4B 3KQDA 2A2QH 1A0JA 1JRTA 4FUDA 3SJIA 1TGNA 2D1JA 1P09A 4NA7A 3ZVBA 1AGJA 2OC1A 2ZPRA 1KLIH 1SBWA 1ELDE 1TOMH 2HRVA 4ABHA 1SGDE 3BTKE 1EATA 3BTHE 2XBVA 3DFJA 1LHEH 1N8OC 1WQSA 2UWOA 3PB1E 2VIQA 3PLBA 1SLXB 4O3UA 2QN5T 1V2TT 2PHBA 3LIWA 4AFZA 1AE5A 1AVWA 3SU0A 4BTTB 1HIAA 3IG6B 1OXGA 1EJAA 1C5ZB 3LGUA 3EQ0H 2R2WU 2UUKB 1LQDB 2O9QA 1FDPA 3TK9A 4A1XA 1C5UA 3P95A 4SGAE 3RC4A 3LGYA 1AKSA 1DLEA 3UQOA 4FUHA 1YLCA 2AMDA 3SU3A 1TMUH 1EZXC 5GDSH 1KDQA 1W7XH 8GCHG 2LPRA 3A82A 5ABWA 1Z8GA 5PTPA 5L6NH 1GMDG 1O2ZA 1TA6A 1O32A 1DUAA 1PPBH 2FXRA 4VGCB 1H9IE 1T8MA 1BTXA 5L30H 1RTFB 2QA9E 1TWXB 5DP7A 3PMBB 1WQVH 2ESTE 2ZZUH 5G4BA 4NSVA 1AHTH 1F7ZA 1FY4A 3EA8A 1MUEB 2BZAA 2ZO3H 1GBHA 4YM9A 1S6HA 3SUFA 2C8YB 3SU5A 3I29A 4AB8A 3V0XA 1PYTD 3NKKA 2WPJS 1RGQA 5GWZA 2QXJA 2GKVE 1CHGA 3QGNB 1AFEH 3U8TH 1UK3A 4GHQA 3QN7A 2GMTC 2H6MA 2PR3A 1SGEE 1BTHH 2XTTB 1SI5H 3SV8A 2D8WA 1G32B 4X2VA 3UREA 4CRAA 2GZ9A 4U2WA 2QAAA 3ELAH 2ZGHA 3HKIB 4ISNA 1XUJA 3R3GB 2TGTA 2FEQH 1ZGVA 4TY6A 1DFPA 3UOPA 4JZ1A 2XWAA 5EU8A 4ZKOU 1CBWB 1IQKA 3A7TA 2BDHA 3B9FH 5EQRA 4K8BA 4UD9H 3ZZBA 1YPKH 1DOJA 3FFGA 2ALVA 3OY6U 2OD3B 2ZA5A 1V2RT 3RXDA 1QFKH 1QIXB 5A8YA 1EAIA 3FZDA 4H42U 1QBNA 1BRCE 1KXBA 3L33A 4ZKRU 2AMPA 7GCHF 3PMHB 4CBNA 4NIYA 4DURA 4ABGA 1DE7H 3TPIZ 1O2WA 3BF6H 1S81A 3K2UA 2BD5A 1DWEH 3VPKA 2P95A 4Z6AH 2ZFTA 4X2WA 1V2MT 2PKSB 1A1RA 5JBTA 1O3OA 1V2KT 1EAXA 4KTSA 3SO3A 1INCA 1A7SA 3MH7A 5CHAB 1TONA 2G4TA 2BD9A 1HYLA 3M5NA 4OS6A 3KQEA 4Y8ZA 1RS0A 2JH5D 2XW9A 3LGVA 3UNSA 3TH4H 2FDAA 4MVNA 1P01A 4XOJA 1IQHA 2BXTH 2VIVA 4YLQH 3EA9A 4E05H 2UUFB 1W3CA 2P93A 1MBQA 3GCTG 1LKAA 3VEQB 1JMOH 2G5NA 1S6FA 4Y71A 1ZPCA 2WV5A 2C93B 3M7TA 2ZDVH 2ZPSA 1W14U 1KXCA 4TPYA 4E7NA 4MTBA 3FP7E 5F8XA 3GY2A 3LC5A 1T8NA 1GCTC 2O8WA 1RFNA 3GY6A 3KGPA 1V2WT 1C2FA 4ZKSU 4NGAH 1C2LA 3SQEE 3BEFB 2JH6D 1TPSA 1SGIB 1BHXB 2ZQ1A 1MCVA 5E0JA 1Y59T 3SI4H 4BTUB 4ZHLU 4KKDA 2BVRH 1V2QT 3GDVA 4MG3A 1BB0B 3AW1A 1P2IA 1P3EA 3EE0B 3RXFA 2F9PA 1VGCC 3V3MA 1Z1JA 3KQCA 4CBOA 3ZZ7A 4WMDA 3Q3KA 1C2DA 2BHGA 2Y5HA 3T29A 3UFAA 1O3DA 1TALA 1EAUA 2EI8A 3TLOA 1AVXA 3BTDE 3FZZA 3FANA 1HUTH 5JYIA 2XRCA 4YESB 2H5DA 2YNAA 5DO4H 1TA2A 3S7KB 1O3FA 2ASUB 2BLWA 2JETC 3F9FA 1CA0C 1ELFA 3MO6A 2XYAA 3RMOH 4KTCA 1O3JA 1AI8H 1P2OA 1ESBA 2FOAA 1KY9A 1T8LA 1GGDB 1O3AA 3U8OH 1Y5BT 4CR5A 1DT2A 4TWWA 2ODQA 1O31A 2CF8H 2FOCA 1T32A 1NY22 2STBE 1UTQA 2GGVB 1O5EH 1GHBF 4J2YB 3NWUA 2WV4A 2ZCKP 1GHZA 6ESTA 1D3TB 1K2I1 4ABDA 1EPTC 1S5SA 1HJAB 1V2PT 5F6MA 3ATIA 2ZHEH 1ZTKA 1T4VH 1C2JA 1OWDA 4B74A 1C1RA 1F0UA 4UEHH 4Y79A 2BMGB 1YPMH 4UONA 3KIDU 1KXAA 2KAIB 1AQ7A 2DE8A 1DITH 1EZUC 3ZVAA 1PPEE 3SI3H 4O03A 3NXPA 5HYOA 2SFAA 5F8ZA 1TX8A 3HGPA 2TRMA 1WYKA 3ODDA 3RC6A 2C8WB 2PKAB 1QB6A 1AB9C 3D65E 2ZFRH 3OX7U 3BEIB 2ZFPH 1YPLH 5SGAE 1E35B 3WY8A 4AGJA 1S85A 2GT8A 3RUOA 2ZU3A 3ATKA 1BOQA 3NCLA 4IS5A 1ZTJA 2STAE 4Q7YA 1J17T 2V0BA 1AFQB 1NC6A 1YGCH 3A8DA 3BTQE 4ZXXH 3BTME 3MNBA 1MMJN 4FUIA 5TCCA 1T31A 2NWNA 3TK5A 4CH8B 3LOXA 3TGIE 1P9UA 4IC6A 1JXPA 1V2ST 2B5TB 4I8KA 3Q3XA 3HPTB 1F92A 3M37A 1JOUB 1GMCF 2BD3A 1Y3WA 3GCNA 4ISOA 3ZVFA 1P10A 4WJG2 4ABEA 1CBWC 7GCHG 4X8SH 4K2YA 4BNRA 1LVBA 2PTNA 4OS5A 3RXMA 4AOQA 1U6QA 4Y0YE 3AAUA 3PYHA 3S0NA 1GBEA 2JKHA 4BXSA 2O8LA 5EW2H 5JB9S 4MNWA 2D2DA 1UTJA 2QXHA 3SJOA 3ATLA 4AG1A 1P57B 1FY1A 1P0SH 1ZRBA 1N8OB 2PGQB 1K1NA 1UVSH 1QBOA 3PO1C 4JZDH 1EP6A 3ZZDA 3ZZ8A 2P3FH 3GY3A 1CGJE 4YLUA 5E2PA 2BM2A 1UTNA 5C1XA 1C5LH 1K9OE 2A4GA 3OTJE 2ZC9H 1GPZA 1THPB 1O3PB 1UHBB 5AVDA 1EZQA 1A2CH 1TX7A 1DS2E 5CHAC 2HNTF 1SL3A 3E8LA 4ABJA 1XUFA 1GHVH 1Y3XA 4JCNA 3T5FH 3LDXH 1L4DA 3H7TA 1G2MA 3O8RA 4NG9H 5DJ7A 1G36A 4FUFA 1NFXA 2ZKSA 4KTUA 3SU1A 1OP0A 4FUBA 2XC5A 4WF8A 2VIPA 5H4IB 2GVFA 1UJ1A 4SGBE 1B0FA 2J34A 3RDZA 4FU8A 2SNWA 3SNEA 3T28A 3TITA 1SGQE 1TGBA 5CE1A 2BXUH 3QGJA 1GCDA 2B0FA 4CR9A 1BBRK 1QQUA 3M5MA 1TYNA 3F9GA 2NU2E 1EASA 3A7ZA 3TJUA 3BG8A 4AYVB 1BMAA 1HAYB 1NT1A 3JZ2B 4ZHMU 3SGQE 1PQ5A 3PTNA 1Z8IB 4MQAA 2XNIA 3K65B 4TYDA 2ZCLP 4MPWA 1NRQH 3O8DA 1ANDA 3SN8A 2FO9A 1PPFE 2J4IA 5LGOA 1GHWH 2WPIS 2ZIQH 1KTTB 3FAOA 1UTMA 3LC3A 1YCPM 3P17H 4OS1A 2QXGA 2ZHFH 3TJVA 1BMMH 1GJBB 1ZMLA 4R8TB 3ZV8A 2FLBH 4MNVA 5A8XA 1Y5AT 1AZZA 1S0QA 1NRRH 1P11E 2AFQB 2VGCC 1GHBG 1MD8A 2H1UA 1HB0B 5F8TA 4FVDA 1HPGA 2A5AA 1ZGIA 3NUMA 1FJSA 1B7XB 1DM4B 1HDTH 2A4RA 2ALPA 1F2SE 1GJ4H 3SZNA 1KIGH 2FS8A 2THFB 2F91A 3V13A 3E6PH 2TPIZ 1FQ3A 5I46H 3E1XB 1VJ9U 1O37A 3STIA 1O2HA 2A0QB 2ZFQH 3M5LA 4OS4A 3S9AA 4D9RA 1P2QA 1W0YH 3GCHB 4KELA 1MD7A 2R2MB 1XUKA 2V3OH 1UCYE 2VWMA 2H9TH 2ZDAH 1ETTH 3AW0A 5A0CA 2F9UA 1QQ4A 1O39A 3TH3H 1G30B 1BTYA 2K1QA 3A7YA 1HJ9A 1AY6H 4OGXA 4LOYH 1K1IA 1KLTA 1P2JA 2UUYA 2EA3A 1Y5UT 4GCHF 9LPRA 4UFGH 2AGIX 4F49A 1WTHD 1L0ZA 2BVXH 3F1SB 7LPRA 4BANB 1UVTH 2GCTB 3LPRA 3LGTA 3ZZ5A 3RMLH 2NU0E 2OC7A 3SV9A 6LPRA 1E38B 5EXLA 3QTOH 1MKXK 3MYWA 1GBKA 3ESTA 1GCTB 3UR6A 2J92A 1DVAH 4DG4A 1GMCG 3PROA 1ZHPA 1DWBH 5LPRA 1GJCB 2FM2A 1RD3B 1V2NT 3MMGA 2R3YA 3IWMA 2HGTH 4ZAEA 5FXLA 3RC5A 2GDDA 1WBGB 3UQVA 1GVKB 1OP8A 1JWTA 4WMFA 1VGCB 3A89A 2AS9A 1KXEA 4FU7A 2UUJB 3ZZ3A 1WSSH 5EODA 2O8UA 1EB2A 1XUGA 5LPFA 1Y3VA 1IQEA 1TMTH 5I25A 3GYMA 1FXYA 4ZXYH 4ZHAA 4BAQB 5JBCS 4I32A 2TIOA 1ORFA 5A0AE 2TGAA 2TBSA 3RXUA 2V3HH 3P6ZB 4AG2A 1SHHB 4ZMAH 2RDLA 2JETB 1JBUH 3Q77A 3GICB 1IQFA 1CA0B 1PYTC 3I78A 1Z1IA 3S9CA 2FWWA 5ETXA 2PTCE 2J94A 2GP9B 4AORA 2WPLS 1LPKB 3B8JA 5C5OA 5AFZH 1NRPH 1WCZA 2FS9A 1THRH 1F5RA 3SGBE 3A86A 5TCAA 1HJ8A 1UHBA 4YT7H 2A7JA 4MLFB 1C1UH 1JRSA 1XMNB 3TNSA 2CHAB 3KNXA 1EPTB 4WY3A 4X8VH 1KXDA 1BRAA 3EA7A 4AFUA 3HATH 1FZZA 4FUEA 2BY9X 3UWIA 3UNRA 3F9HA 1SGNE 2FI3E 1AE8H 1O3BA 4JK5A 5BRRE 2BDYA 3SNBA 2G81E 4M7GA 1ZSLA 3NPSA 1C1VH 4AFSA 3SV6A 3C1KA 4JMYA 1NRNH 3UR9A 2VB0A 4AYYB 1K1MA 2P94A 1UTLM 3SJ8A 3BV9B 3LONA 2P8OB 1O35A 3S7HB 4D7FA 1C5OH 2CV3A 3KHVA 1EX3A 1GBJA 3LU9B 1VCQA 3LKWA 1EXFA 1YPHE 2FESH 2OC8A 5JPMH 3W94A 1MTUA 2Q1JA 1PJPA 1LHDH 1DICA 1FMGA 1DXPA 1AB9B 2Z3EA 4FUJA 3V12A 2BTCE 1C1QA 1O33A 3ODFA 5JDUB 2SGPE 3KEEA 3K9XB 1C5WB 1HAVA 1O2GH 2R3UA 3BIUH 1ZRKA 1FN8A 1N6YA 2Z9GA 1QHRB 4IBLH 1O3CA 2BQ6B 2BZ6H 1SG8B 1RRKA 2VH0A 4GHTA 1ZPBA 1O2XA 1O2KA 1ID5H 2OBOA 2GV7A 2G51A 4CRCA 2XBYA 1O5DH 1PQ7A 4FUCA 3CENA 1CGHA 2HNTC 3T62A 2AMQA 3ENSB 4U01A 4R0IA 1XX9A 4K8YA 5LH8A 5J4SA 8ESTE 4K1EA 2FOMB 1J8AA 4AN7A 1CU1A 1GWAA 2FODA 3ZZ4A 3KN2A 2HVXA 4H4FA 2SGQE 1P2MA 4KGAA 1CQQA 3T26A 1TPOA 4O97A 2W5EA 3MO3A 4INHA 3F68H 3Q76A 1O2VA 2GTBA 4NZQA 4BAHB 3BIVH 5EG4A 3A7VA 3PLKA 1HV7A 5E8EH 3QX5H 1MZAA 3PO1B 5FPYA 1MBMA 1SGTA 2PGBB 3GCHC 1GDNA 1EP5A 1IQJA 5EW1H 1C5RA 4WH6A 5FHTA 2RG3A 3W95A 3TJNA 2XC0A 1S82A 3BTEE 2FTLE 1IHTH 3RP2A 3M7UA 1QJ7B 2VINA 4E7RG 3D62A 2JH0D 2ILNA 1FAXA 3Q00A 3E16B 1VITH 4CRBA 1DSUA 2XBXA 5C20A 9ESTA 2CF9H 1GI5A 4F4OC 1LVYA 1IHSH 2Q6FA 4K5ZA 4YOJA 4Y0ZE 1OWKA 1GDUA 2FPZA 2SGAA 4PROA 2GCTC 3SV7A 5AFYH 2VVCA 3SHAH 1GJ7B 1LMWB 2IJOB 2QC2A 1ZR0A 2AIPA 2H9EH 3ZZ6A 1BT7A 2ZFFH 2ZHWH 2QCYA 3OU0A 4QT8C 3MU1A 4GUXA 3P70B 1Z8RA 4K60A 1LTOA 2ODPA 1XM1A 4I33A 1ABJH 4CHAC 2HWLB 4Y10E 2VJ1A 1LCYA 2M5TA 1YPHC 2J38A 4UDWH 3TVJB 1O3IA 2ZU2A 1PFXC 2BDCA 2XBWA 1C1MA 3UY9A 1MTNB 3SW2B 1ZLRA 3RXQA 1AWFH 3U8RH 3PTBA 1O5CB 1NFWA 3M61U 5GPIB 2Z9KA 3A81A 1D4PB 1GBIA 3MWIU 1V2OT 2W7SA 1TGCA 3CP7A 2VGCB 2R9PA 4HZHA 5B6OA 2ZNKH 1ELBA 1ZHMA 2B8OH 3QZRA 5GCHF 2CJIA 1H8DH 3RXRA 1SGPE 2QF3A 3RXKA 1TE0A 5HM9A 1GHAF 1C5MD 1SVPA 1GL0E 2A31A 4AZ2B 2ZDLA 1D6WA 1TOCB 1GI7B 1EPTA 2Y6TA 4JZEH 2OP9A 2CHAC 3GY4A 6CHAC 1UTKA 3PV4A 1NPMA 1A4WH 4WH8A 3TK6A 3I77A 3MU8A 1AWHB 5C1UA 3T25A 1T7CA 1O2OA 4X1PU 3STJA 3MH6A 1TNIA 3L3TA 1XKBC 2BQ7B 2ZTZA 5L2YH 1GMHF 2C8ZB 2R0KA 1HAHH 5DP9A 4XE4A 2A5KA 2ZDMA 1GJ5H 1P06A 3S9BA 1BTZA 3GY5A 5K0HA 1H1BA 3Q3YA 2P8OC 1C2IA 1OYQA 5FPSA 1AO5A 3E0PB 1C2GA 1UTOA 1K1PA 3RXEA 3HK6B 3E90B 3QTVH 4OS7A 1YCPH 3SU4A 4XFQA 2F83A 2A45B 2VIWA 3MNCA 1GG6B 1O30A 1HXEH 5C5NA 1C5YB 1O5AB 2AERH 3ZVCA 4TPIZ 1HCGA 4WVPE 5E0GA 3BEUA 4RN6A 1MAYA 1GJDB 4HTCH 1G3EA 3ZZCA 1BTWA 4KP0A 2FI4E 1C1TA 2ZQ2A 5DP5A 1SLVB 5EPYA 3RXCA 4B1TA 2NU4E 5K7RA 2WPMS 2EI6A 1V2UT 5ESBA 1NZQH 1BQYA 1Y3UA 3KQBA 2PWXA 1OKXA 3PWCA 4Y7BA 3UOUA 3BTWE 1HNEE 1S84A 4TY7A 1BJUA 2ZHDA 4U30A 4I7YH 4NIVA 1YPJH 1TNHA 2BOKA 1HBTH 2A7HA 1MKWK 2BX3A 2CXVA 3R0FA 3FVFB 3P8GA 2RA3A 1D3QB 2WYJA 3SJKA 4DGJA 3GDSA 1ARCA 1BBRH 3LT3A 5DPAA 5EQSA 2OXSA 1HXFH 4X6NA 2I6QA 3K6ZA 3U1JB 3A7WA 1YCPK 2Z94A 1O2LA 1O2SA 2AEIH 3F9EA 1HFDA 3TNTA 3RM2H 2C90B 1E37B 1TRNA 2ZU4A 1TNLA 2PW8H 3TU7H 4YT6H 4JK6A 3SUGA 2FOEA 1BTPA 1FY8E 1XVMA 4DY7B 5F03A 4DOQA 1JIRA 2ZWLH 4GAWA 3U9AH 1K28D 2PFEA 2SNVA 1GVLA 5DKMA 2IPHA 3RXTA 2IN2A 2F9VA 2C4FH 3LGIA 2F9OA 3E3TA 4O9VA 2H2ZA 1TFXA 2PLXA 5EPNA 3E91A 4RSPA 1H9HE 2A4QA 5LPEA 4LK4A 3SGAE 1SLWB 1WTGH 2VIDA 1O3KA 2J9NA 1MQ5A 2BDGA 1TLDA 4I8JA 3SBKA 1A0LA 3DHKH 4K1TA 4NA9H 1FAKH 1AKSB 1GVZA 1TBZH 1DWDH 2BLOA 1Z8JB 1ZMJA 1KDQB 2Z9JA 4X2XA 1O3GA 2BD7A 1GBCA 2Y81A 2ZGXH 1CT2E 4GVUA 2DUCA 2G00A 1NFYA 4MNYA 5IYTA 3ZVGA 1QRXA 1YBWA 2ZTXA 1BJVA 2BY5X 1QL8A 4UFFH 1A5HA 1FPHH 3A8AA 3MTYA 3MU0A 3SJ9A 2O8TA 4X1RU 1C1WH 1MTNC 1KXFA 4A6LA 3A87A 5GCHG 3VB4A 1G3DA 4K69A 3NZIA 3SUDA 4D76A 4GLYA 1H8IH 1L2EA 1SGFG 1TPAE 3UPEA 5T6FA 4JYTA 1ARBA 2OC0A 1ELAA 3U69H 2UWLA 1ELCA 3SNAA 6GCHF 1C1NA 3TJOA 1P12E 1F0RA 2OTVA 1O2UA 3DT0H 1DY9A 1SMFE 4WMEA 4NWKA 5L2ZH 1UCYH 1B0EA 1SB1H 1MKXH 1LHCH 2FYRA 2Z9LA 1TB6H 2ZDKA 1CT4E 4IN1A 3GOVB 4AX9H 1GI3A 1QY6A 3H7OA 1EOLA 1C2EA 4LZ4B 1GMHG 1TQ7B 3RXSA 2BDBA 4U32A 3AAVA 3ZYEA 1THSH 4UE7H 5A09A 1O0DH 1TQ0B 3A7XA 4IMQA 1NESE 2Z3DA 4OGYA 2FX4A 1MH0A 1D9IA 4ISHH 1TGTA 1FPCH 2BB4A 2Z7FE 1NTPA 2Y7XA 1K21H 1ETSH 2ZCHP 2KAIA 1CO7E 3VB3A 2G5VA 4MDSA 1SQTA 3M7QA 5GIBA
chains in the Genus database with same CATH superfamily
1NU9A 1C1PA 3FOAA 3QUMP 1HAOH 1O5FH 1PPZA 1SSXA 1W8BH 3A85A 1GI8B 2P3UB 4B75A 3EYDA 3KL6A 2PKAA 4YTAA 4XBBA 1F5LA 4Z1MD 3A88A 1MQ6A 3GDUA 2DE9A 2PSXA 4Y76A 1O38A 1GG6C 3DSPA 5C2ZA 4NFFA 1QA0A 1UCYK 1O2IA 4Q4LA 2GZ8A 2ZPQA 1WV7H 1K1LA 1HLTH 1TNGA 1FIZA 5FBEA 2BLQA 1RIWB 1NS3A 3DUXH 5IDKA 2W3IA 2HOBA 2V6NA 5EXNA 3AVZA 1O36A 3SYJA 2F9BH 1V2VT 1WAYB 3BTFE 2XXLA 1DX5M 4CHAB 4DIHH 4NFEA 1NO9H 1W10U 1P3CA 1E34B 1H8HD 1VCWA 3M3TA 1AN1E 4CH2B 3KCGH 1C5QA 3VB5A 2LELA 2TGPZ 3BG4B 1LVMA 2UWPA 2G8TA 2BD8A 1LDTT 1ESTA 1NN6A 1O3NA 3VXEH 3SNDA 1K1OA 1IQMA 2HPPH 4B73A 3RXAA 1MTVA 2FTMA 2OINA 1HAGE 5FBIA 1W0KD 1FONA 2F9NA 4BXWA 2Y80A 1BCUH 2ZTYA 2QIQA 2WINI 5FL7D 5EJLA 1JIMA 1TRYA 2BQWB 3MI4A 1ESAA 1L4ZA 3PRBA 1GI9B 2LP6A 2VH6A 1HAPH 1ZMNA 1G2LA 2A1DB 2RA0A 1V6DA 5DP4A 1SHYA 5T6DA 1L1NA 1BRUP 4H6SB 4Y6DA 1B5GH 1P05A 1O3LA 3RU4T 2Y7ZA 3ITIA 2FIRH 2ZHQH 2GD4B 5DGJA 6CHAB 1QR3E 1DY8A 2I6SA 1OWHA 3B23B 1VJAU 1O2PA 1BA8B 1N6XA 1GBTA 1BMLA 1M9UA 3CS0A 2BY6X 1S83A 4NWLA 3M35A 1BDAA 4OM9A 5GXPA 1OX1A 2WPHS 3ZYDA 2C8XB 2A4OA 2H9HA 1TBRH 1GDQA 1XXDA 2OCVB 3PRDA 3BN9A 3RXVA 1Y3YA 2GX4A 1EUFA 1HAIH 2Y82A 2BY8X 3UTUH 2GT7A 1GBFA 1RJXB 1VITF 1GI4A 3F2FA 3OY5U 4Q7XA 4Q2KA 1C4Y2 1OYTH 5DP3A 1Z6JH 3EGKH 1O2QA 1MAXA 1W11U 1C5VA 8KME2 1T4UH 1RTLA 1QB1A 2G4UA 1NFUA 1IQIA 2LNCA 1Z6EA 2JIZD 1A3EH 3D49H 5HMAA 4OS2A 4Y11E 1SC8U 3SU2A 3U1IB 1YPEH 1OWIA 3ATMA 4UFEH 1QRWA 6GCHG 1E1RD 1K22H 1QBVH 3RLYH 1C5SA 1SQOA 1A0HB 3SHCH 4YO9A 1EOJA 1F5KU 3M3SA 4RT1A 1FY3A 1KYNA 1NU7B 1OS8A 2M2AA 2P59A 1TNKA 2ZI2H 3PM3A 2EC9H 3SU6A 1W12U 4XRNA 2P16A 1Q3XA 1AD8H 4DJZB 5DP6A 1ELVA 3LGWA 1QB9A 4XDEA 1TPPA 1SFIA 1IAUA 1YLDA 2W7UA 3F2HA 3PWBA 2C3SA 1D3PB 3EE7A 2BOHB 1VR1H 2ANKH 2VIOA 1W13U 4UFDH 1XKAC 4X6OA 1LQEA 5HM2A 3M5OA 4B71A 4D8NA 1H9LB 2VWLA 3UWJH 3MHWU 2ZGJA 4B2AA 1FN6A 2AGEX 2G55A 3QO6A 1XVOA 1CE5A 2FYQA 1VZQH 5A0BA 2ANMH 1EAWA 2WUBA 1V2LT 5EQQA 1IQGA 1GI6A 3SUEA 4RKOB 1PPHE 3HK3B 1C5PA 4GCHG 2AGGX 4A5TS 1Z7KA 4ZUHA 2AIQA 1BHXF 3MNSA 4K1SA 3P92A 2WUCA 1W7GH 1A61H 3OEED 4CREA 4ABFA 4D7GA 2KCPA 5AHGH 3D23A 3IITA 5JBBS 1O2MA 2P3TB 1MTSA 3RXJA 3UNQA 2TGDA 1C4U2 1EJMA 1EZSC 1C1SA 1G3CA 3GYLB 4K3JA 3MU5A 7ESTE 2A32A 4A92A 2A7CA 2ANYA 4MPUA 5DK1A 2ANWA 3P8OA 2BX4A 4FXGH 2FZZA 2FOBA 3KF2A 2PUXB 1WOFA 1F0SA 1OP2A 4BAKB 3RM0H 3EDXB 3RXLA 1FI8A 1SGRE 3RXPA 1GBAA 3RMNH 1C4V2 1WXRA 1RIWC 1EB1H 1WUNH 1ZSJA 1KLJH 2GZ7A 2J98B 1T8OA 2BLVA 4X2YA 1CGIE 2EEKA 3ZVDA 4BTIB 4X8TH 4DT7B 1PPGE 4X6PA 4CRGA 1MU6B 1AIXH 4MPXA 1F0TA 3ATWA 2W26A 3QDZB 4WWYA 2QGRA 1QL9A 3BG4C 3TGKE 1C5XB 1GHXH 3MU4A 2ZEBA 1EKBB 3T27A 1UVOA 1AUTC 2FI5E 1C5NH 1NM6A 2HPQH 1ZJKA 2FOHA 5T3HA 1ANCA 4B76A 2QYIA 3L6PA 4GSOA 4XBDA 1ACBE 1HGTH 3A84A 3OTPA 2W6JD 3VGCB 1BZXE 1MZDA 1G3BA 1Z71A 1O2TA 1GBBA 1YM0A 2VU8E 4LXBH 2VWNA 1O2JA 1P02A 1PQAA 1CT0E 2EI7A 3RXOA 3VXFH 1SLUB 3DFLA 1UO6A 1ELTA 5FPTA 1TMBH 1SR5C 3MQKC 1TGSZ 4FVBA 4A1TA 1AUJA 1XUIA 2NU3E 5CHBA 2GCHF 1YF4A 4O3TA 1ZSKA 1ELEE 1RTKA 4IW4E 2PSYA 3GISB 2VNTA 2FOFA 1C1OA 4XSKU 5C3NA 5JBAS 1ZPZA 3CS7A 3A80A 2KZ4A 1Q2WA 1SPJA 5AF9H 1Y8TA 1PPCE 1MTWA 5HIYA 5T1VA 4THNH 3E0NB 1C2HA 2KFWA 1CHOF 2G52A 2ZF0H 4NA8A 3URDA 4Q63A 1O2RA 1QTFA 1UMAH 2KX4A 1ZTLA 1LPGB 1VITG 1MKWH 4TWYA 3SOSA 3RU4E 1P2NA 1GJAB 3PMAB 4B2CA 1TBQH 2BDIA 4A7IB 3SORA 2NU1E 3F2GA 3VG8A 3LH3A 3RXHA 1ETRH 1DWCH 2V7QD 2Z9IA 1FV9A 1YPGH 1YKTA 2AYWA 3U28C 4A1VA 2RFKC 3A8BA 3HKJB 2W6ID 3M3VA 1V2JT 1A5IA 1LKBA 2QY0B 4I8LA 1YYY1 4DIIH 3C27B 1NROH 4X1NU 1PQ8A 1P2KA 4LZ1H 3GY8A 3QK1A 4VGCC 3JZ1B 1SOTA 1P04A 1TRMA 3MNXA 2SGDE 1OPHB 4ZROA 2GV6A 1QJ6B 4HI3A 5HGGA 1LVOA 1TX6A 5C67A 5ESTE 1A3BH 1GBDA 1SFQB 2KCAA 3M36A 4FU9A 5FX6A 1GI0A 1LHFH 4H6TA 1YC0A 8LPRA 2AH4X 4ESTE 2HALA 4CRFA 1SGYE 1VCPA 2CGAA 2J95A 4E06H 5DP8A 3HGNA 4F55A 2CMYA 1OWJA 2GDEH 1DLKB 1OWEA 4X1QU 4INKA 4YOIA 1D3DB 5BPEA 4B2BA 1DPOA 1TIOA 3T2NA 4ABBA 2VVVA 2QV1A 2IOTA 4RI0A 1YP9A 1LHGH 3PLPA 3UUZA 2BVSH 4HGCA 2HLCA 2FX6A 2OLGA 1GBLA 3P8FA 1AU8A 4IC5A 3URCA 1DUEA 2QXIA 5JB8S 2ULLA 2XCNA 4Q80A 2OUAA 1NBME 2WPKS 1ZHRA 2XCFA 4I31A 4X6MA 4AFQA 3A8CA 1O5BB 1J15A 1G9IE 2JDID 3UIRA 2H5CA 1BMNH 3MH5A 3QWCH 3F6UH 1O2YA 2YOLA 5CMXH 3ZVEA 2F3CE 4NIWA 4RKJB 1EJNA 4Z0KA 2OQ5A 3AASA 1OOKB 4Y7AA 5FAHA 4ISIH 1RXPA 2ZDNA 1GHYH 1LPZB 2QF0A 1QNJA 4IN2A 5T6GA 1GI1A 2J2UA 1C5TA 5GNDA 1J16A 4JYUH 1BBRE 1BIOA 1EQ9A 1QRZA 1GJ8B 1K1JA 2PKSC 4J1YA 3K6YA 1ANBA 1IOEA 1S0RA 2ZG0H 1W0ZU 3S69A 3V7TA 1HAXB 5FCKA 1HIAB 2WV9A 1UK4A 2BY7X 3MOCA 4ASHA 1IQLA 1AMHA 3SQHE 3RXBA 3ZV9A 4AGKA 7KMEH 3ZIAD 4X1SU 4JZFH 4MPVA 1CVWH 4XBCA 3RXGA 3N7DA 2J98A 3SNCA 2ZFSA 5A2MH 4DCDA 1J14A 1N1LA 5HXFA 1J9CH 3FP6E 3TH2H 2WZQA 1ELGA 2ODYB 1CA8B 2J97A 3VFEA 1FLEE 1OHHD 1Q31A 2Q6DA 3MFJA 1GL1A 4BAMB 8GCHF 1AZ8A 5A8ZA 3RXIA 1GMDF 1A5GH 3TIUA 2VWOA 1FNIA 4IGDA 1ABIH 1XUHA 1DDJA 2XWBI 3GCOA 2Y5FA 2V35A 1UTPA 1GHAG 4D9QA 5EGMA 1FY5A 3DD2H 2A2XH 5EXMA 1KTSB 2W3KA 1HAVB 1DXWA 2Y5GA 1GJ6A 3VGCC 2FMJA 2GCHG 1BRBE 4ISLA 1QJ1B 2GMTB 3GY7A 1SQAA 2Z6BD 5E2OA 3VB6A 1TAWA 1BTUA 1SGCA 4I8GA 3P8NA 1O3MA 1TABE 3ZZAA 4JZIA 4DW2U 2PUQH 2BDAA 1L1JA 5C1YA 1CHOG 1QURH 4MNXA 3WWBA 1TNJA 4YOGA 3PMJA 1QGFA 3BSQA 2Z3CA 2ZGBH 3VB7A 1GI2A 2FP7B 1C9PA 2ZU5A 3ZZ9A 2D26C 1FIWA 2A5IA 1LO6A 4ZKNU 1QA7A 2YNBA 1G37A 4RT0A 3RU4D 1GGDC 4NSYA 3H5CB 2ZGCA 1C2MA 1CSOE 1D6RA 2OQUA 4Y8XA 1GJ9B 1O3HA 3MO9A 1KSNA 1HRTH 4NIXA 4INLA 2ZU1A 1O5GH 2RCEA 3UAIC 4WXVA 4Y8YA 4X0WU 2WYGA 4ABAA 3MH4A 2OBQA 5DG6A 4NCYA 1O2NA 1ZOMA 2O8MA 3N7OA 1HJAC 3QLPH 2VVUA 2BD4A 1X7AC 2PV9B 3LJJA 1BUIA 5EOKA 2R0LA 2XC4A 1AVGH 1UVPA 5E0HA 5FX5A 2B7DH 1SOZA 1P9SA 5J4QA 1MCTA 1ZJDA 3OSYA 3LJOA 3OYPA 1SGFA 4ABIA 1DSTA 3LH1A 3NK8A 2Q6GA 3RMMH 4BAOB 2F43B 3RLWH 1QCPA 3SV2H 1UK2A 4HFPB 1WU1A 2SGFE 2ZECA 3U98H 2ZP0H 2BYAX 2FOGA 5FCRA 1O3EA 1IQNA 3O8BA 4X8UH 5EJ1A 3QZQA 1V3XA 4JYVH 1HAZB 5IK2D 3A83A 1ZYOA 1E0FD 1ANEA 4GPGA 5TJXA 4YZUA 3TGJE 2HNTE 4DVAU 1L1GA 1P03A 4FUGA 3DA9B 3O8CA 1DANH 1GBMA 1MU8B 1XXFA 1O34A 4TSFD 1QL7A 2CN0H 4AB9A 3GCTF 2BD2A 3EAJA 1C2KA 1W2KH 2FLRH 1AFQC 1H4WA 4Q7ZA 1BITA 3BTTE 1E36B 4I8HA 4NZLA 3BTGE 1C9TA 1NBMD 1UVUH 2B9LA 4IMZA 1OSSA 3FP8E 1A46H 1NRSH 1P8VC 2SGEE 4CRDA 3GS9A 4FETA 3G01A 1ZZZA 4WXIA 1FUJA 4ZH8A 4BOHA 5GJ4B 3KQDA 2A2QH 1A0JA 1JRTA 4FUDA 3SJIA 1TGNA 2D1JA 1P09A 4NA7A 3ZVBA 1AGJA 2L74A 2OC1A 2ZPRA 1KLIH 1SBWA 1ELDE 1TOMH 2HRVA 4ABHA 3N99A 1SGDE 3BTKE 1EATA 3BTHE 2XBVA 3DFJA 1LHEH 1N8OC 1WQSA 2UWOA 3PB1E 2VIQA 3PLBA 1SLXB 2XNDD 4O3UA 2QN5T 1V2TT 2PHBA 3LIWA 4AFZA 1AE5A 1AVWA 3SU0A 4BTTB 4AC9A 1HIAA 3IG6B 1OXGA 1EJAA 1C5ZB 3LGUA 3EQ0H 2R2WU 2UUKB 1LQDB 2O9QA 1FDPA 3TK9A 4A1XA 1C5UA 3P95A 4SGAE 3RC4A 3LGYA 1AKSA 1DLEA 3UQOA 4FUHA 1YLCA 2AMDA 3SU3A 1TMUH 1EZXC 5GDSH 1KDQA 1W7XH 8GCHG 2LPRA 3A82A 5ABWA 1Z8GA 5PTPA 5L6NH 1GMDG 1O2ZA 1TA6A 1O32A 3WWFA 1DUAA 1PPBH 2FXRA 4VGCB 1H9IE 1T8MA 1BTXA 5L30H 3FN8A 1RTFB 2QA9E 1TWXB 5DP7A 3PMBB 1WQVH 2ESTE 2ZZUH 5G4BA 4NSVA 1AHTH 1F7ZA 1FY4A 3EA8A 1MUEB 2BZAA 2ZO3H 1GBHA 4YM9A 1S6HA 3SUFA 2C8YB 3SU5A 3I29A 4AB8A 3V0XA 1PYTD 3NKKA 2WPJS 1RGQA 5GWZA 2QXJA 2GKVE 1CHGA 3QGNB 1AFEH 3U8TH 1UK3A 4GHQA 3QN7A 2GMTC 2H6MA 2PR3A 1SGEE 1BTHH 4I86A 2XTTB 1SI5H 3SV8A 3AK5A 2D8WA 1G32B 2RDEA 4X2VA 2HLDD 3UREA 4CRAA 2GZ9A 4U2WA 2QAAA 3ELAH 2ZGHA 3HKIB 4ISNA 1XUJA 3R3GB 2TGTA 2FEQH 1ZGVA 4TY6A 1DFPA 3UOPA 3UB0A 4JZ1A 2XWAA 5EU8A 4ZKOU 1CBWB 1IQKA 3A7TA 2BDHA 3B9FH 5EQRA 4K8BA 1VKYA 2J5UA 4UD9H 3ZZBA 1YPKH 1DOJA 3FFGA 2ALVA 3OY6U 2OD3B 2ZA5A 1V2RT 3RXDA 1K0HA 1QFKH 1QIXB 5A8YA 1EAIA 3FZDA 4H42U 1QBNA 1BRCE 1KXBA 3L33A 4ZKRU 2AMPA 7GCHF 3PMHB 4CBNA 4NIYA 4DURA 4ABGA 1DE7H 3TPIZ 1O2WA 3BF6H 1S81A 3K2UA 2BD5A 1DWEH 3VPKA 2P95A 4Z6AH 2ZFTA 4X2WA 1V2MT 2PKSB 1A1RA 5JBTA 1O3OA 1V2KT 1EAXA 4KTSA 3SO3A 1INCA 1A7SA 3MH7A 5CHAB 1TONA 2AHME 2G4TA 2BD9A 1HYLA 3M5NA 4OS6A 3KQEA 4Y8ZA 1RS0A 2JH5D 2XW9A 3LGVA 3UNSA 3TH4H 2FDAA 4MVNA 1P01A 4XOJA 1IQHA 2BXTH 2VIVA 4YLQH 3EA9A 4E05H 2UUFB 1W3CA 2P93A 1MBQA 3GCTG 1LKAA 3VEQB 1JMOH 2G5NA 1S6FA 4Y71A 1ZPCA 2WV5A 2C93B 3M7TA 2ZDVH 2ZPSA 1W14U 1KXCA 4TPYA 4E7NA 4MTBA 3FP7E 5F8XA 3GY2A 3LC5A 1T8NA 1GCTC 2O8WA 2JJ1D 1RFNA 3GY6A 3KGPA 1V2WT 1C2FA 4ZKSU 4NGAH 1C2LA 3SQEE 3BEFB 2JH6D 1TPSA 1SGIB 1BHXB 2ZQ1A 1MCVA 5E0JA 1Y59T 3SI4H 4BTUB 4ZHLU 4KKDA 2BVRH 1V2QT 3GDVA 4MG3A 1BB0B 3AW1A 1P2IA 1P3EA 3EE0B 3RXFA 2F9PA 1VGCC 3V3MA 1Z1JA 3KQCA 4CBOA 3ZZ7A 4WMDA 3Q3KA 1C2DA 2BHGA 2Y5HA 3T29A 3UFAA 1O3DA 1TALA 3PV5A 1EAUA 3W1EA 2EI8A 3TLOA 1AVXA 3BTDE 3FZZA 3FANA 1HUTH 5JYIA 2XRCA 4YESB 2H5DA 2YNAA 5DO4H 3WW7A 1TA2A 3S7KB 1O3FA 2ASUB 2BLWA 2JETC 3SZEA 3F9FA 1CA0C 3OFND 1ELFA 2V3MA 3MO6A 2XYAA 1WDIA 3RMOH 4KTCA 1O3JA 4ACAA 1AI8H 1P2OA 1ESBA 2FOAA 1KY9A 1T8LA 1GGDB 1O3AA 3U8OH 1Y5BT 4CR5A 1DT2A 4TWWA 2ODQA 1O31A 2CF8H 3DSOA 2FOCA 1T32A 1NY22 2STBE 1UTQA 2GGVB 1O5EH 1GHBF 4J2YB 3NWUA 2WV4A 2ZCKP 1GHZA 6ESTA 1D3TB 1K2I1 4ABDA 1EPTC 1S5SA 5KECA 2CK3D 1HJAB 1V2PT 2QF4A 5F6MA 3ATIA 2ZHEH 1ZTKA 1T4VH 1C2JA 1OWDA 4B74A 1C1RA 1SKYE 1UW7A 1F0UA 4UEHH 4Y79A 2BMGB 1YPMH 4UONA 3KIDU 1KXAA 2KAIB 1YLNA 1AQ7A 2DE8A 1DITH 1EZUC 3ZVAA 1PPEE 3SI3H 4O03A 3NXPA 5HYOA 2SFAA 5F8ZA 1TX8A 3HGPA 2TRMA 1WYKA 3ODDA 3RC6A 2C8WB 2PKAB 1QB6A 1AB9C 3D65E 2ZFRH 3OX7U 3BEIB 2ZFPH 1YPLH 5SGAE 1E35B 3WY8A 4AGJA 5C94A 1S85A 2GT8A 3RUOA 2ZU3A 3ATKA 1BOQA 3NCLA 4IS5A 1ZTJA 2STAE 4Q7YA 1J17T 2V0BA 5B6LA 1AFQB 1NC6A 1YGCH 3A8DA 3BTQE 4ZXXH 3BTME 3MNBA 1MMJN 4FUIA 5TCCA 1T31A 2NWNA 3TK5A 2IPQX 4CH8B 3LOXA 3TGIE 1P9UA 4IC6A 1JXPA 1V2ST 2B5TB 4I8KA 3Q3XA 3HPTB 1F92A 2KM0A 3M37A 1JOUB 1GMCF 2BD3A 2YMSD 1Y3WA 3GCNA 4ISOA 3ZVFA 1P10A 4WJG2 4ABEA 1CBWC 7GCHG 4X8SH 4K2YA 4BNRA 1LVBA 2PTNA 4OS5A 3RXMA 4AOQA 1U6QA 4Y0YE 3AAUA 3PYHA 3S0NA 1GBEA 2JKHA 4BXSA 2O8LA 5EW2H 5JB9S 4MNWA 2D2DA 1UTJA 2QXHA 3SJOA 3ATLA 4AG1A 1P57B 1FY1A 1P0SH 1ZRBA 1N8OB 2PGQB 1K1NA 1UVSH 1QBOA 3PO1C 4JZDH 1EP6A 3ZZDA 3ZZ8A 2P3FH 3GY3A 1CGJE 4YLUA 4FOUC 5E2PA 1E79D 1UTNA 2BM2A 5F53A 5C1XA 1C5LH 1K9OE 2A4GA 3OTJE 2ZC9H 1GPZA 1THPB 1O3PB 1UHBB 5AVDA 1EZQA 1A2CH 1TX7A 1DS2E 5CHAC 2HNTF 1SL3A 3E8LA 4ABJA 1XUFA 1GHVH 1Y3XA 4JCNA 3T5FH 3LDXH 1L4DA 3H7TA 1G2MA 5DN6D 2F4LA 3O8RA 4NG9H 5DJ7A 1G36A 4FUFA 1NFXA 2ZKSA 4KTUA 3SU1A 1OP0A 4FUBA 2XC5A 4WF8A 2VIPA 5H4IB 2GVFA 1UJ1A 4SGBE 1B0FA 2J34A 3RDZA 4FU8A 2SNWA 3SNEA 3T28A 3TITA 1SGQE 1TGBA 5CE1A 2BXUH 2WPDD 1GCDA 2B0FA 3QGJA 4CR9A 1BBRK 1QQUA 3M5MA 1TYNA 3F9GA 2NU2E 1EASA 3A7ZA 3TJUA 3BG8A 4AYVB 1BMAA 1HAYB 1NT1A 3JZ2B 4ZHMU 3SGQE 1PQ5A 3PTNA 1Z8IB 4MQAA 2XNIA 3K65B 4TYDA 5DSFA 2ZCLP 4MPWA 1NRQH 3O8DA 1ANDA 3SN8A 2FO9A 1PPFE 2J4IA 5LGOA 1GHWH 2WPIS 2ZIQH 1KTTB 3FAOA 1UTMA 3LC3A 2GJGA 1YCPM 3P17H 4OS1A 2QXGA 2ZHFH 3TJVA 1BMMH 1GJBB 1ZMLA 4R8TB 3ZV8A 2FLBH 4MNVA 5A8XA 1Y5AT 1AZZA 1S0QA 1NRRH 1P11E 2AFQB 2VGCC 1GHBG 1MD8A 2H1UA 1HB0B 5F8TA 4FVDA 1HPGA 2A5AA 1ZGIA 3NUMA 1FJSA 1B7XB 1DM4B 1HDTH 2A4RA 2ALPA 1F2SE 1GJ4H 3SZNA 4P02A 1KIGH 2FS8A 1QZ8A 2THFB 2F91A 4TT3D 3V13A 3E6PH 2TPIZ 1FQ3A 5I46H 3E1XB 1VJ9U 1O37A 3STIA 1O2HA 2A0QB 3FO8D 2ZFQH 3M5LA 4OS4A 3S9AA 4D9RA 1COWD 1P2QA 1W0YH 2KR7A 3GCHB 4KELA 1MD7A 2R2MB 1XUKA 2V3OH 1UCYE 2VWMA 2H9TH 2ZDAH 1ETTH 3AW0A 5A0CA 2F9UA 1QQ4A 1O39A 3TH3H 1G30B 1BTYA 2K1QA 3A7YA 1HJ9A 1AY6H 3DSGA 4OGXA 4LOYH 1K1IA 1KLTA 4ASUD 1P2JA 2UUYA 1YY3A 2EA3A 1Y5UT 4GCHF 9LPRA 4UFGH 2AGIX 4F49A 1WTHD 1L0ZA 2BVXH 3F1SB 7LPRA 4BANB 1UVTH 2GCTB 2PP6A 3LPRA 3LGTA 3ZZ5A 3RMLH 2NU0E 2OC7A 3SV9A 6LPRA 1E38B 5EXLA 3QTOH 1MKXK 3MYWA 1GBKA 3ESTA 1GCTB 3UR6A 2J92A 1DVAH 4DG4A 1GMCG 3PROA 1ZHPA 1DWBH 5LPRA 1GJCB 2FM2A 1RD3B 1V2NT 3MMGA 2R3YA 3IWMA 2HGTH 4ZAEA 5FXLA 3RC5A 2GDDA 2WSSD 1WBGB 3UQVA 1GVKB 1OP8A 1JWTA 4WMFA 1VGCB 3A89A 4XD7D 2AS9A 1KXEA 4FU7A 2UUJB 3ZZ3A 1WSSH 5EODA 2EQNA 2O8UA 1EB2A 1XUGA 5LPFA 1Y3VA 1IQEA 1TMTH 2OK5A 5I25A 3GYMA 1FXYA 3KYGA 4ZXYH 4ZHAA 4BAQB 4I32A 5JBCS 2TIOA 1ORFA 5A0AE 2TGAA 2TBSA 3RXUA 2V3HH 3P6ZB 4AG2A 1SHHB 4ZMAH 2RDLA 2JETB 1JBUH 3Q77A 3GICB 1IQFA 1CA0B 1PYTC 2K8IA 1Z1IA 3I78A 3S9CA 2FWWA 5ETXA 2PTCE 2J94A 2GP9B 4AORA 2WPLS 1LPKB 1YWUA 3B8JA 5C5OA 5AFZH 1NRPH 1WCZA 2FS9A 1THRH 1F5RA 3SGBE 3A86A 5TCAA 1HJ8A 1UHBA 4YT7H 2A7JA 4MLFB 1C1UH 4HG6A 4M9FA 1JRSA 4ZCNA 1XMNB 3TNSA 2CHAB 3KNXA 2YMSB 1EPTB 4WY3A 4X8VH 1KXDA 1BRAA 3EA7A 4AFUA 3HATH 1FZZA 4FUEA 2BY9X 3UWIA 3UNRA 3F9HA 1SGNE 2FI3E 1AE8H 1O3BA 4JK5A 5BRRE 2BDYA 3SNBA 2G81E 4M7GA 1ZSLA 3NPSA 1C1VH 4AFSA 3SV6A 3C1KA 4JMYA 1NRNH 3UR9A 2VB0A 4AYYB 1K1MA 2P94A 1UTLM 3SJ8A 3BV9B 3LONA 2P8OB 1O35A 3S7HB 4D7FA 1C5OH 2CV3A 3KHVA 1EX3A 1GBJA 3LU9B 1VCQA 3LKWA 1EXFA 1YPHE 2FESH 2OC8A 5JPMH 3W94A 1MTUA 3PV2A 2Q1JA 1PJPA 1LHDH 1DICA 1FMGA 1DXPA 1AB9B 2Z3EA 4FUJA 3V12A 2BTCE 1C1QA 1O33A 3ODFA 5JDUB 2XOKD 2SGPE 3KEEA 3K9XB 1C5WB 1HAVA 1O2GH 2R3UA 3BIUH 2L6OA 1ZRKA 1FN8A 1N6YA 2Z9GA 1QHRB 3OEHD 4IBLH 1O3CA 2BQ6B 2BZ6H 1SG8B 1RRKA 2VH0A 4GHTA 1ZPBA 2VBCA 1O2XA 1O2KA 1ID5H 2GV7A 2OBOA 2G51A 4F48B 4CRCA 2XBYA 1O5DH 1PQ7A 4FUCA 3CENA 1CGHA 2HNTC 3T62A 2AMQA 3ENSB 4U01A 4R0IA 1XX9A 4K8YA 2K0QA 5LH8A 5J4SA 8ESTE 4K1EA 5C0UA 2FOMB 1J8AA 4AN7A 1CU1A 1W0JD 5HKKD 1GWAA 2FODA 4DT4A 3ZZ4A 3KN2A 2HVXA 4H4FA 2SGQE 1P2MA 4KGAA 1CQQA 3T26A 4P00A 1TPOA 4O97A 2W5EA 3MO3A 4INHA 3F68H 3Q76A 1O2VA 2GTBA 4NZQA 4BAHB 3BIVH 5EG4A 3A7VA 3PLKA 1HV7A 5E8EH 3QX5H 1MZAA 3PO1B 5FPYA 1MBMA 1SGTA 2PGBB 5EJZA 3GCHC 1GDNA 1EP5A 1IQJA 5EW1H 1C5RA 1H8ED 4WH6A 5FHTA 2RG3A 3W95A 3TJNA 2XC0A 1S82A 3BTEE 2FTLE 1IHTH 3RP2A 3M7UA 1QJ7B 2VINA 4E7RG 3D62A 2JH0D 2ILNA 3DCLA 3OAAD 1FAXA 5KEDA 3Q00A 3E16B 1VITH 4CRBA 1DSUA 1SQRA 2XBXA 5C20A 2IJD1 9ESTA 2CF9H 1GI5A 4F4OC 1LVYA 1IHSH 2Q6FA 4K5ZA 4YOJA 4Y0ZE 1OWKA 1GDUA 2FPZA 2SGAA 4PROA 2GCTC 3SV7A 5AFYH 2VVCA 3SHAH 1GJ7B 1LMWB 2IJOB 2QC2A 1ZR0A 2AIPA 2H9EH 3ZZ6A 1BT7A 1MABB 2ZFFH 1BMFD 2QCYA 2ZHWH 3OU0A 4QT8C 3MU1A 4GUXA 3P70B 1Z8RA 4K60A 1LTOA 2ODPA 1XM1A 4I33A 1ABJH 4CHAC 2HWLB 4Y10E 2VJ1A 1LCYA 2M5TA 1YPHC 2HVYB 5C0TA 2J38A 4UDWH 3TVJB 1O3IA 2ZU2A 1PFXC 3H09A 2BDCA 2XBWA 1C1MA 3UY9A 1MTNB 3SW2B 1ZLRA 3RXQA 1AWFH 3U8RH 3PTBA 1O5CB 1NFWA 3M61U 5GPIB 2Z9KA 3A81A 1D4PB 1GBIA 3MWIU 1V2OT 2W7SA 1TGCA 3CP7A 2VGCB 2R9PA 4HZHA 5B6OA 2ZNKH 1ELBA 1ZHMA 2B8OH 3QZRA 5GCHF 2CJIA 1H8DH 3RXRA 1SGPE 2QF3A 3RXKA 1TE0A 5HM9A 1GHAF 1C5MD 1SVPA 2WHXA 1GL0E 2A31A 4AZ2B 2ZDLA 1D6WA 1KMHB 1TOCB 1GI7B 1EPTA 2Y6TA 5CDFE 4JZEH 2OP9A 3N7EA 2CHAC 3GY4A 6CHAC 1UTKA 3PV4A 2YMSC 1NPMA 1A4WH 4WH8A 3TK6A 3I77A 3MU8A 1AWHB 5C1UA 3F0PA 3T25A 1T7CA 1O2OA 4X1PU 3STJA 3MH6A 1TNIA 3KYFA 3L3TA 1XKBC 2BQ7B 2ZTZA 5L2YH 1GMHF 2C8ZB 2R0KA 1HAHH 2KCOA 5DP9A 4XE4A 2A5KA 2ZDMA 1GJ5H 1P06A 3S9BA 1BTZA 3GY5A 5K0HA 1H1BA 3Q3YA 2P8OC 1C2IA 1OYQA 5FPSA 1AO5A 3E0PB 1C2GA 1UTOA 1K1PA 4ACBA 3RXEA 3HK6B 3E90B 3QTVH 4OS7A 1YCPH 3SU4A 4XFQA 2F83A 2A45B 5KGOA 2VIWA 3MNCA 1GG6B 1O30A 1HXEH 5C5NA 1C5YB 3OE7D 1O5AB 2AERH 3ZVCA 4TPIZ 1HCGA 4WVPE 5E0GA 3BEUA 4RN6A 1MAYA 1GJDB 4HTCH 1G3EA 3ZZCA 1BTWA 4KP0A 2FI4E 1C1TA 2ZQ2A 5DP5A 1FX0B 1SLVB 5EPYA 3RXCA 2NU4E 4B1TA 5K7RA 2WPMS 2EI6A 1V2UT 5ESBA 1NZQH 1BQYA 1Y3UA 3KQBA 2PWXA 1OKXA 3PWCA 4Y7BA 3F0OA 3UOUA 3BTWE 1HNEE 1S84A 4TY7A 5C17A 1BJUA 2QE7D 2ZHDA 4U30A 4I7YH 4NIVA 1YPJH 1TNHA 2BOKA 1HBTH 2A7HA 1MKWK 2BX3A 2CXVA 3R0FA 3FVFB 3P8GA 2RA3A 1D3QB 2WYJA 3SJKA 4DGJA 3GDSA 1ARCA 1S6LA 1BBRH 3LT3A 5DPAA 5EQSA 2OXSA 1HXFH 4X6NA 2I6QA 3K6ZA 3U1JB 3A7WA 1YCPK 2Z94A 1O2LA 1O2SA 2AEIH 3F9EA 1HFDA 3TNTA 3RM2H 2C90B 1E37B 1TRNA 2ZU4A 1TNLA 2PW8H 3TU7H 3KQ5A 4YT6H 3F3BA 4JK6A 3SUGA 2FOEA 1BTPA 2QF5A 1FY8E 1XVMA 4DY7B 5F03A 4DOQA 1JIRA 2ZWLH 4GAWA 3U9AH 1K28D 2PFEA 2SNVA 1GVLA 5DKMA 2IPHA 3RXTA 2IN2A 2F9VA 2C4FH 3LGIA 2F9OA 3E3TA 4O9VA 4B6FA 3CNRA 2H2ZA 1TFXA 1EFRD 2PLXA 5EPNA 3E91A 4RSPA 1H9HE 2A4QA 5LPEA 4LK4A 3SGAE 1SLWB 1WTGH 2VIDA 1O3KA 2J9NA 1MQ5A 2BDGA 5EIYA 1TLDA 4I8JA 3SBKA 1A0LA 3DHKH 4B6EA 4K1TA 4NA9H 1FAKH 1AKSB 2KCYA 4YXWD 1GVZA 1TBZH 1DWDH 2BLOA 5HIZA 1Z8JB 1ZMJA 1KDQB 2Z9JA 4X2XA 1O3GA 2BD7A 1E1QD 1GBCA 2Y81A 2ZGXH 1CT2E 4GVUA 2DUCA 2G00A 1NFYA 4MNYA 5IYTA 3ZVGA 1QRXA 1YBWA 2ZTXA 1BJVA 2BY5X 1QL8A 4UFFH 1A5HA 1FPHH 3A8AA 3MTYA 3MU0A 3SJ9A 2O8TA 4X1RU 1C1WH 1MTNC 1KXFA 2JJ2D 4A6LA 3A87A 5GCHG 3VB4A 1G3DA 4K69A 3NZIA 3SUDA 4D76A 4GLYA 1H8IH 1L2EA 1SGFG 1TPAE 3UPEA 5T6FA 4JYTA 1ARBA 2OC0A 1ELAA 3U69H 2UWLA 1ELCA 3SNAA 6GCHF 1C1NA 3TJOA 1P12E 3NRLA 1F0RA 2OTVA 1O2UA 3DT0H 1DY9A 1SMFE 4WMEA 4NWKA 5L2ZH 1UCYH 1B0EA 1SB1H 1MKXH 1LHCH 2FYRA 2Z9LA 3FKSD 1TB6H 2ZDKA 1CT4E 2EY4C 4IN1A 3GOVB 4AX9H 1GI3A 1QY6A 3H7OA 1EOLA 1C2EA 4LZ4B 1GMHG 1TQ7B 3RXSA 2BDBA 4U32A 3AAVA 3ZYEA 1THSH 4UE7H 5A09A 1O0DH 1TQ0B 3A7XA 4IMQA 1NESE 2Z3DA 4OGYA 2FX4A 1MH0A 1D9IA 4ISHH 1TGTA 1FPCH 2BB4A 2Z7FE 1NTPA 2Y7XA 1K21H 1ETSH 2ZCHP 2KAIA 1CO7E 3VB3A 2G5VA 4MDSA 1SQTA 3M7QA 5GIBA
chains in the Genus database with same CATH topology
1NU9A 1C1PA 3QUMP 1HAOH 1O5FH 1PPZA 1SSXA 1W8BH 3A85A 1GI8B 2P3UB 4B75A 3EYDA 3KL6A 2PKAA 4YTAA 4XBBA 1F5LA 3A88A 1MQ6A 3GDUA 2DE9A 2PSXA 4Y76A 1O38A 1GG6C 5C2ZA 4NFFA 1QA0A 1UCYK 1O2IA 2GZ8A 2ZPQA 1WV7H 1K1LA 1HLTH 1TNGA 1FIZA 5FBEA 2BLQA 1RIWB 1NS3A 3DUXH 5IDKA 2W3IA 2HOBA 2V6NA 5EXNA 3AVZA 1O36A 2F9BH 1V2VT 1WAYB 3BTFE 2XXLA 1DX5M 4CHAB 4DIHH 4NFEA 1NO9H 1W10U 1P3CA 1E34B 1VCWA 3M3TA 1AN1E 4CH2B 3KCGH 1C5QA 3VB5A 2TGPZ 3BG4B 1LVMA 2UWPA 2G8TA 2BD8A 1LDTT 1ESTA 1NN6A 1O3NA 3VXEH 3SNDA 1K1OA 1IQMA 2HPPH 4B73A 3RXAA 1MTVA 2FTMA 2OINA 1HAGE 5FBIA 1FONA 2F9NA 4BXWA 2Y80A 1BCUH 2ZTYA 2QIQA 2WINI 1JIMA 1TRYA 2BQWB 3MI4A 1ESAA 1L4ZA 1GI9B 2VH6A 1HAPH 1ZMNA 1G2LA 2A1DB 2RA0A 1V6DA 5DP4A 1SHYA 5T6DA 1L1NA 1BRUP 4H6SB 4Y6DA 1B5GH 1P05A 1O3LA 3RU4T 2Y7ZA 3ITIA 2FIRH 2ZHQH 2GD4B 5DGJA 6CHAB 1QR3E 1DY8A 2I6SA 1OWHA 3B23B 1VJAU 1O2PA 1BA8B 1N6XA 1GBTA 1BMLA 1M9UA 3CS0A 2BY6X 1S83A 4NWLA 3M35A 1BDAA 5GXPA 1OX1A 2WPHS 3ZYDA 2C8XB 2A4OA 1TBRH 1GDQA 1XXDA 2H9HA 2OCVB 3BN9A 3RXVA 1Y3YA 2GX4A 1EUFA 1HAIH 2Y82A 2BY8X 3UTUH 2GT7A 1GBFA 1RJXB 1VITF 1GI4A 3OY5U 4Q7XA 4Q2KA 1C4Y2 1OYTH 5DP3A 1Z6JH 3EGKH 1O2QA 1MAXA 1W11U 1C5VA 8KME2 1T4UH 1RTLA 1QB1A 2G4UA 1NFUA 1IQIA 2LNCA 1Z6EA 1A3EH 3D49H 5HMAA 4OS2A 4Y11E 1SC8U 3SU2A 3U1IB 1YPEH 1OWIA 3ATMA 4UFEH 1QRWA 6GCHG 1K22H 1QBVH 3RLYH 1C5SA 1SQOA 1A0HB 3SHCH 4YO9A 1EOJA 1F5KU 3M3SA 1FY3A 1KYNA 1NU7B 1OS8A 2P59A 1TNKA 2ZI2H 3PM3A 2EC9H 3SU6A 1W12U 2P16A 1Q3XA 1AD8H 4DJZB 5DP6A 1ELVA 3LGWA 1QB9A 4XDEA 1TPPA 1SFIA 1IAUA 1YLDA 2W7UA 3PWBA 2C3SA 1D3PB 2BOHB 1VR1H 2ANKH 2VIOA 1W13U 4UFDH 1XKAC 4X6OA 1LQEA 5HM2A 3M5OA 4B71A 4D8NA 1H9LB 2VWLA 3UWJH 3MHWU 2ZGJA 4B2AA 1FN6A 2AGEX 2G55A 3QO6A 1XVOA 1CE5A 2FYQA 1VZQH 5A0BA 2ANMH 1EAWA 2WUBA 1V2LT 5EQQA 1IQGA 1GI6A 3SUEA 4RKOB 1PPHE 3HK3B 1C5PA 4GCHG 2AGGX 4A5TS 1Z7KA 4ZUHA 2AIQA 1BHXF 3MNSA 4K1SA 3P92A 2WUCA 1W7GH 1A61H 4CREA 4ABFA 4D7GA 5AHGH 3D23A 3IITA 5JBBS 2P3TB 1O2MA 1MTSA 3RXJA 3UNQA 2TGDA 1C4U2 1EJMA 1EZSC 1C1SA 1G3CA 3GYLB 4K3JA 3MU5A 7ESTE 2A32A 4A92A 2A7CA 2ANYA 4MPUA 5DK1A 2ANWA 3P8OA 2BX4A 4FXGH 2FZZA 2FOBA 3KF2A 2PUXB 1WOFA 1F0SA 1OP2A 4BAKB 3RM0H 3EDXB 3RXLA 1FI8A 1SGRE 3RXPA 1GBAA 3RMNH 1C4V2 1RIWC 1EB1H 1WUNH 1ZSJA 1KLJH 2GZ7A 1T8OA 2BLVA 4X2YA 1CGIE 2EEKA 3ZVDA 4BTIB 4X8TH 4DT7B 1PPGE 4X6PA 4CRGA 1MU6B 1AIXH 4MPXA 1F0TA 3ATWA 2W26A 3QDZB 4WWYA 2QGRA 1QL9A 3BG4C 3TGKE 1C5XB 1GHXH 3MU4A 2ZEBA 1EKBB 3T27A 1UVOA 1AUTC 2FI5E 1C5NH 1NM6A 2HPQH 1ZJKA 2FOHA 5T3HA 1ANCA 4B76A 2QYIA 3L6PA 4GSOA 4XBDA 1ACBE 1HGTH 3A84A 3VGCB 1BZXE 1MZDA 1G3BA 1Z71A 1O2TA 1GBBA 1YM0A 2VU8E 4LXBH 2VWNA 1O2JA 1P02A 1PQAA 1CT0E 2EI7A 3RXOA 3VXFH 1SLUB 3DFLA 1UO6A 1ELTA 5FPTA 1TMBH 1SR5C 1TGSZ 4FVBA 4A1TA 1AUJA 1XUIA 2NU3E 2GCHF 1YF4A 4O3TA 1ZSKA 1ELEE 1RTKA 4IW4E 2PSYA 3GISB 2VNTA 2FOFA 1C1OA 4XSKU 5C3NA 5JBAS 1ZPZA 3CS7A 3A80A 1Q2WA 1SPJA 5AF9H 1Y8TA 1PPCE 1MTWA 4THNH 3E0NB 1C2HA 1CHOF 2G52A 2ZF0H 4NA8A 3URDA 1O2RA 1QTFA 1UMAH 1ZTLA 1LPGB 1VITG 1MKWH 4TWYA 3SOSA 3RU4E 1P2NA 1GJAB 3PMAB 4B2CA 1TBQH 2BDIA 4A7IB 3SORA 2NU1E 3LH3A 3RXHA 1ETRH 1DWCH 2Z9IA 1FV9A 1YPGH 1YKTA 2AYWA 4A1VA 3A8BA 3HKJB 3M3VA 1V2JT 1A5IA 1LKBA 2QY0B 4I8LA 1YYY1 4DIIH 3C27B 1NROH 4X1NU 1PQ8A 1P2KA 4LZ1H 3GY8A 3QK1A 4VGCC 3JZ1B 1SOTA 1P04A 1TRMA 3MNXA 2SGDE 1OPHB 4ZROA 2GV6A 1QJ6B 4HI3A 5HGGA 1LVOA 1TX6A 5C67A 5ESTE 1A3BH 1GBDA 1SFQB 3M36A 4FU9A 5FX6A 1GI0A 1LHFH 4H6TA 1YC0A 8LPRA 2AH4X 4ESTE 2HALA 4CRFA 1SGYE 1VCPA 2CGAA 2J95A 4E06H 5DP8A 3HGNA 2CMYA 1OWJA 2GDEH 1DLKB 1OWEA 4X1QU 4INKA 4YOIA 1D3DB 5BPEA 4B2BA 1DPOA 1TIOA 3T2NA 4ABBA 2VVVA 2QV1A 2IOTA 1YP9A 1LHGH 3PLPA 3UUZA 2BVSH 4HGCA 2HLCA 2FX6A 2OLGA 1GBLA 3P8FA 1AU8A 4IC5A 3URCA 1DUEA 2QXIA 5JB8S 2ULLA 2XCNA 4Q80A 2OUAA 2WPKS 1ZHRA 2XCFA 4I31A 4X6MA 4AFQA 3A8CA 1O5BB 1J15A 1G9IE 3UIRA 2H5CA 1BMNH 3MH5A 3QWCH 3F6UH 1O2YA 2YOLA 5CMXH 3ZVEA 2F3CE 4NIWA 4RKJB 1EJNA 4Z0KA 2OQ5A 3AASA 1OOKB 4Y7AA 5FAHA 4ISIH 1RXPA 2ZDNA 1GHYH 1LPZB 2QF0A 1QNJA 4IN2A 5T6GA 1GI1A 2J2UA 1C5TA 1J16A 4JYUH 1BBRE 1BIOA 1EQ9A 1QRZA 1GJ8B 1K1JA 2PKSC 4J1YA 3K6YA 1ANBA 1IOEA 1S0RA 2ZG0H 1W0ZU 3S69A 3V7TA 1HAXB 5FCKA 1HIAB 1UK4A 2BY7X 3MOCA 4ASHA 1IQLA 1AMHA 3SQHE 3RXBA 3ZV9A 4AGKA 7KMEH 4X1SU 4JZFH 4MPVA 1CVWH 4XBCA 3RXGA 3SNCA 2ZFSA 5A2MH 4DCDA 1J14A 1N1LA 5HXFA 1J9CH 3FP6E 3TH2H 1ELGA 2ODYB 1CA8B 3VFEA 1FLEE 1Q31A 2Q6DA 3MFJA 1GL1A 4BAMB 8GCHF 1AZ8A 5A8ZA 3RXIA 1GMDF 1A5GH 3TIUA 2VWOA 1FNIA 4IGDA 1ABIH 1XUHA 1DDJA 2XWBI 3GCOA 2Y5FA 2V35A 1UTPA 1GHAG 4D9QA 5EGMA 1FY5A 3DD2H 2A2XH 5EXMA 1KTSB 2W3KA 1HAVB 1DXWA 2Y5GA 1GJ6A 3VGCC 2FMJA 2GCHG 1BRBE 4ISLA 1QJ1B 2GMTB 3GY7A 1SQAA 2Z6BD 5E2OA 3VB6A 1TAWA 1BTUA 1SGCA 4I8GA 3P8NA 1O3MA 1TABE 3ZZAA 4JZIA 4DW2U 2PUQH 2BDAA 1L1JA 5C1YA 1CHOG 1QURH 4MNXA 1TNJA 4YOGA 3PMJA 1QGFA 3BSQA 2Z3CA 2ZGBH 3VB7A 1GI2A 2FP7B 1C9PA 2ZU5A 3ZZ9A 2D26C 1FIWA 2A5IA 1LO6A 4ZKNU 1QA7A 2YNBA 1G37A 3RU4D 1GGDC 4NSYA 3H5CB 2ZGCA 1C2MA 1CSOE 1D6RA 2OQUA 4Y8XA 1GJ9B 1O3HA 3MO9A 1KSNA 1HRTH 4NIXA 4INLA 2ZU1A 1O5GH 2RCEA 4WXVA 4Y8YA 4X0WU 2WYGA 4ABAA 3MH4A 2OBQA 5DG6A 4NCYA 1O2NA 1ZOMA 2O8MA 3N7OA 1HJAC 3QLPH 2VVUA 2BD4A 1X7AC 2PV9B 3LJJA 1BUIA 5EOKA 2R0LA 2XC4A 1AVGH 1UVPA 5E0HA 5FX5A 2B7DH 1SOZA 1P9SA 5J4QA 1MCTA 1ZJDA 3OSYA 3LJOA 3OYPA 1SGFA 4ABIA 1DSTA 3LH1A 3NK8A 2Q6GA 3RMMH 4BAOB 3RLWH 1QCPA 3SV2H 1UK2A 4HFPB 1WU1A 2SGFE 2ZECA 3U98H 2ZP0H 2BYAX 2FOGA 5FCRA 1O3EA 1IQNA 3O8BA 4X8UH 3QZQA 1V3XA 4JYVH 1HAZB 3A83A 1ZYOA 1E0FD 1ANEA 4GPGA 5TJXA 4YZUA 3TGJE 2HNTE 4DVAU 1L1GA 1P03A 4FUGA 3DA9B 3O8CA 1DANH 1GBMA 1MU8B 1XXFA 1O34A 1QL7A 2CN0H 4AB9A 3GCTF 2BD2A 3EAJA 1C2KA 1W2KH 2FLRH 1AFQC 1H4WA 4Q7ZA 1BITA 3BTTE 1E36B 4I8HA 4NZLA 3BTGE 1C9TA 1UVUH 2B9LA 4IMZA 1OSSA 3FP8E 1A46H 1NRSH 1P8VC 2SGEE 4CRDA 3G01A 1ZZZA 4WXIA 1FUJA 4ZH8A 4BOHA 5GJ4B 3KQDA 2A2QH 1A0JA 1JRTA 4FUDA 3SJIA 1TGNA 2D1JA 1P09A 4NA7A 3ZVBA 1AGJA 2OC1A 2ZPRA 1KLIH 1SBWA 1ELDE 1TOMH 2HRVA 4ABHA 1SGDE 3BTKE 1EATA 3BTHE 2XBVA 3DFJA 1LHEH 1N8OC 1WQSA 2UWOA 3PB1E 2VIQA 3PLBA 1SLXB 4O3UA 2QN5T 1V2TT 2PHBA 3LIWA 4AFZA 1AE5A 1AVWA 3SU0A 4BTTB 1HIAA 3IG6B 1OXGA 1EJAA 1C5ZB 3LGUA 3EQ0H 2R2WU 2UUKB 1LQDB 2O9QA 1FDPA 3TK9A 4A1XA 1C5UA 3P95A 4SGAE 3RC4A 3LGYA 1AKSA 1DLEA 3UQOA 4FUHA 1YLCA 2AMDA 3SU3A 1TMUH 1EZXC 5GDSH 1KDQA 1W7XH 8GCHG 2LPRA 3A82A 5ABWA 1Z8GA 5PTPA 5L6NH 1GMDG 1O2ZA 1TA6A 1O32A 1DUAA 1PPBH 2FXRA 4VGCB 1H9IE 1T8MA 1BTXA 5L30H 1RTFB 2QA9E 1TWXB 5DP7A 3PMBB 1WQVH 2ESTE 2ZZUH 5G4BA 4NSVA 1AHTH 1F7ZA 1FY4A 3EA8A 1MUEB 2BZAA 2ZO3H 1GBHA 4YM9A 1S6HA 3SUFA 2C8YB 3SU5A 3I29A 4AB8A 3V0XA 1PYTD 3NKKA 2WPJS 1RGQA 5GWZA 2QXJA 2GKVE 1CHGA 3QGNB 1AFEH 3U8TH 1UK3A 4GHQA 3QN7A 2GMTC 2H6MA 2PR3A 1SGEE 1BTHH 2XTTB 1SI5H 3SV8A 2D8WA 1G32B 4X2VA 3UREA 4CRAA 2GZ9A 4U2WA 2QAAA 3ELAH 2ZGHA 3HKIB 4ISNA 1XUJA 3R3GB 2TGTA 2FEQH 1ZGVA 4TY6A 1DFPA 3UOPA 4JZ1A 2XWAA 5EU8A 4ZKOU 1CBWB 1IQKA 3A7TA 2BDHA 3B9FH 5EQRA 4K8BA 4UD9H 3ZZBA 1YPKH 1DOJA 3FFGA 2ALVA 3OY6U 2OD3B 2ZA5A 1V2RT 3RXDA 1QFKH 1QIXB 5A8YA 1EAIA 3FZDA 4H42U 1QBNA 1BRCE 1KXBA 3L33A 4ZKRU 2AMPA 7GCHF 3PMHB 4CBNA 4NIYA 4DURA 4ABGA 1DE7H 3TPIZ 1O2WA 3BF6H 1S81A 3K2UA 2BD5A 1DWEH 3VPKA 2P95A 4Z6AH 2ZFTA 4X2WA 1V2MT 2PKSB 1A1RA 5JBTA 1O3OA 1V2KT 1EAXA 4KTSA 3SO3A 1INCA 1A7SA 3MH7A 5CHAB 1TONA 2G4TA 2BD9A 1HYLA 3M5NA 4OS6A 3KQEA 4Y8ZA 1RS0A 2JH5D 2XW9A 3LGVA 3UNSA 3TH4H 2FDAA 4MVNA 1P01A 4XOJA 1IQHA 2BXTH 2VIVA 4YLQH 3EA9A 4E05H 2UUFB 1W3CA 2P93A 1MBQA 3GCTG 1LKAA 3VEQB 1JMOH 2G5NA 1S6FA 4Y71A 1ZPCA 2WV5A 2C93B 3M7TA 2ZDVH 2ZPSA 1W14U 1KXCA 4TPYA 4E7NA 4MTBA 3FP7E 5F8XA 3GY2A 3LC5A 1T8NA 1GCTC 2O8WA 1RFNA 3GY6A 3KGPA 1V2WT 1C2FA 4ZKSU 4NGAH 1C2LA 3SQEE 3BEFB 2JH6D 1TPSA 1SGIB 1BHXB 2ZQ1A 1MCVA 5E0JA 1Y59T 3SI4H 4BTUB 4ZHLU 4KKDA 2BVRH 1V2QT 3GDVA 4MG3A 1BB0B 3AW1A 1P2IA 1P3EA 3EE0B 3RXFA 2F9PA 1VGCC 3V3MA 1Z1JA 3KQCA 4CBOA 3ZZ7A 4WMDA 3Q3KA 1C2DA 2BHGA 2Y5HA 3T29A 3UFAA 1O3DA 1TALA 1EAUA