2FPZA

Human tryptase with 2-amino benzimidazole
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
243
structure length
243
Chain Sequence
b'IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase beta-2
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fpzA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fpzA01
4Y76A 4AGKA 4YO9A 2BZ6H 3SN8A 2VIQA 4AYYB 3PM3A 3PWCA 5A2MH 1EX3A 2PWXA 1K28D 4ISNA 2QCYA 2JH6D 5AFYH 2V0BA 5E0HA 1ESBA 2F9UA 5DP7A 4CRDA 6ESTA 1AZ8A 3LH1A 3Q3YA 4NGAH 1TPPA 5GPIB 3PB1E 3HGNA 1ZSKA 4AGJA 1WYKA 1Z6EA 1QRXA 1CE5A 1O2YA 3GCHC 1DY8A 1O3PB 3GCHB 3ITIA 4Z0KA 4FU8A 4A5TS 1VITH 2UUYA 6LPRA 2TBSA 2HRVA 3M7TA 4IBLH 1NT1A 1XVMA 2ESTE 2SFAA 1SBWA 3U69H 2XCFA 2ZECA 2HPPH 4MPUA 5TCAA 1C1SA 3TNSA 3FP7E 1S0RA 1MCVA 1DVAH 3AVZA 4E05H 3MNXA 1NPMA 2RG3A 2J4IA 1JMOH 2QAAA 2FODA 3TK9A 2O8MA 1YPLH 4B2AA 1QNJA 2OUAA 1YLCA 4SGAE 1GHBF 1YPGH 2C90B 4CR5A 5TCCA 3KNXA 4XE4A 1C5PA 1ZYOA 1LHCH 2DE8A 4A1TA 2AMQA 2D26C 1NRRH 2ZHQH 1O2SA 1O3IA 1C1WH 1O2GH 1TABE 3CENA 3RMLH 2HGTH 1MBQA 1GHZA 1J8AA 5DP9A 2YOLA 2BY7X 3UR6A 2ZDAH 1QQ4A 2FESH 3MH5A 1EUFA 3MNCA 1XKBC 3LOXA 3MWIU 2XBYA 2RA3A 1KDQB 3QGNB 1ZJKA 1NY22 2P93A 1KLTA 3F9HA 5DP6A 2OQ5A 2ZGXH 2PUQH 2ZF0H 3LU9B 1Z8RA 5LPEA 2B7DH 1QBVH 3DT0H 2XC4A 2FTLE 1DM4B 1W7XH 3RXRA 3VFEA 1JRTA 5AFZH 2G81E 1PPHE 1Z8GA 1HAYB 1HDTH 4DY7B 1O3KA 3RXGA 4D9QA 4X8TH 3SU2A 4X1QU 2FOBA 2GCTC 1ZSLA 3A87A 3RC5A 2A32A 1WSSH 2TGDA 1Z1JA 2AEIH 3I77A 3V3MA 3SUDA 4DJZB 1NFXA 5A0AE 4XBBA 3F6UH 5DJ7A 3STJA 4ZMAH 2ZU5A 1LPGB 3P8FA 1P9SA 2W5EA 3S7KB 1NS3A 1C9PA 1P2JA 4ISHH 3MHWU 5GCHF 4I8LA 2CV3A 2OC8A 1GL1A 2FI3E 3H5CB 1XUIA 1C5RA 3LKWA 1O3HA 1G2MA 2F9BH 2AS9A 1P06A 2OCVB 1TGCA 2EEKA 4DVAU 1JBUH 1P01A 2GV6A 3DFJA 1P12E 2A4OA 5T3HA 5ESBA 1UCYK 3GY8A 4JYTA 2SGFE 2VIVA 1ZOMA 2BD5A 2BVRH 1FAXA 2GCHG 4INHA 4AB9A 1TPSA 3A7XA 4O03A 1ARCA 2BZAA 4A7IB 2FPZA 3KHVA 4MG3A 4H6SB 2WPIS 1Y3VA 1LMWB 2IOTA 4YESB 4ABGA 4Y7BA 4IW4E 1BHXF 4TY7A 5LH8A 1A4WH 1NFUA 2BY6X 3BEIB 4B1TA 2ODPA 2XYAA 1XUKA 4KELA 1Z7KA 2ASUB 1DOJA 4MNYA 1THRH 2C8ZB 4Y10E 3NKKA 3SQHE 4I32A 1BCUH 2OC7A 1SGQE 4Y0YE 1FQ3A 1W12U 2ZGCA 3RXUA 5DP3A 4XOJA 2QN5T 1SHHB 3T28A 3RUOA 1GPZA 4ZKRU 1O5GH 4X8SH 2TGAA 3FZDA 1EZXC 3P70B 1GVKB 2BD3A 3SU0A 3PMBB 1A3EH 1GDNA 2CXVA 1C4Y2 3TGKE 1O2ZA 1V2KT 1G32B 1GMCG 3QZQA 2ZGHA 1Q3XA 2O9QA 1WQSA 4YM9A 4UEHH 5SGAE 1BUIA 3FP8E 1XXFA 3O8BA 1EP6A 1XM1A 4RSPA 1P04A 4ZKSU 2ZU2A 1DITH 4H6TA 3LGVA 1TFXA 2Y7ZA 1EAWA 1GI6A 3QLPH 1RJXB 1J17T 1FY3A 3T25A 2P94A 1GGDC 1IHSH 1L1JA 1GGDB 1BTZA 3QTVH 4ABDA 2I6QA 1Y3XA 1O38A 2ODQA 2PKSC 3GY5A 2PKSB 1T8OA 1IOEA 2P3TB 2Y81A 1TAWA 1V2RT 1SB1H 1ELCA 2Z94A 3UTUH 5FBIA 3MFJA 2QXHA 2ZFTA 1EAXA 2ZDMA 2THFB 1T8LA 1RFNA 3KN2A 1TMUH 5J4QA 2BDAA 4HFPB 5H4IB 3C27B 3TNTA 1CT0E 3MOCA 1QL9A 1UVOA 2ZNKH 1QL7A 2ZTZA 2H9EH 3ATWA 1DLEA 3BEUA 1HAPH 1V2QT 2GP9B 1TPOA 1GJ9B 2Y5GA 3ZZCA 4GAWA 1SLUB 3E3TA 4X6OA 3C1KA 4TYDA 3PLKA 3B9FH 2H5CA 4AYVB 3RMNH 2VIDA 2A5IA 1O3NA 2R9PA 4OS2A 3GY4A 4DGJA 1WTGH 1VGCC 3SU5A 1VGCB 1W14U 2SGEE 2BLWA 2BOKA 1K1PA 2ULLA 1HNEE 4Y79A 3BG8A 1TB6H 1BOQA 2CF8H 2W26A 2IPHA 4KTUA 1GJ4H 1W0ZU 4JCNA 5DPAA 5T6DA 1TRNA 3LPRA 3A7VA 1ANBA 2CF9H 1SSXA 1C5QA 3IG6B 3SU1A 4Y71A 2O8TA 1VITG 1GBKA 3M5NA 2AYWA 3SJIA 1K21H 4JK5A 1MBMA 2Q6FA 2HNTF 5A0BA 2ALVA 1KXBA 2ZWLH 1ZMJA 2FZZA 3PMAB 4JMYA 1T8MA 4CREA 4Y7AA 1LHFH 2BDYA 1A5GH 2FDAA 2FOFA 3GYMA 4ZKNU 5LPRA 1FUJA 4XBCA 1ZR0A 5FPSA 4INLA 1B0EA 3T2NA 1L1GA 2V3OH 2VU8E 3ODFA 2FLRH 2PV9B 2I6SA 1GJ7B 3P95A 3TH4H 3M7QA 2ZKSA 3LT3A 1H9LB 1N6YA 1DWBH 1TX6A 1T4UH 2A5AA 3BTGE 4MQAA 1MZAA 1E34B 1C2DA 2FIRH 3TVJB 3RXHA 1SHYA 2C8XB 1SFQB 8LPRA 1CT4E 3ZYEA 3RXQA 1LO6A 4U32A 2F91A 3UY9A 5C2ZA 4Y8ZA 1HFDA 3SNDA 4X1RU 1O5DH 2W7UA 1FIZA 1YCPM 1FV9A 1BTXA 1LVBA 1G36A 4X6NA 2YNBA 4X2VA 1JWTA 3Q76A 1C5TA 2ZQ1A 3U8RH 1Q31A 2FWWA 2ZCLP 3K65B 2Z3EA 1EB1H 4FUJA 1TX7A 1HRTH 2GTBA 2XW9A 3AAUA 1G30B 2ZFFH 4ZUHA 1UVUH 3TK5A 1MD7A 4JYUH 3SZNA 2H2ZA 1O3CA 1O3MA 1QBOA 1SMFE 1YCPH 3U1JB 1WV7H 1V2WT 2ZFQH 2A7JA 5L2YH 3ZV9A 3SNCA 3A82A 1GL0E 1ZGIA 4FU7A 1EPTA 1GI0A 2ZDNA 3UQOA 3G01A 1TYNA 1G9IE 5F03A 1OX1A 3F9FA 1P3EA 5DKMA 1LCYA 5DP4A 2BXUH 2BQWB 5K7RA 1SOTA 1QFKH 2ODYB 3BN9A 3SQEE 1P2KA 1O32A 1YC0A 1UTQA 2Q6DA 1C1NA 4CH8B 1GWAA 4OS1A 1CGHA 1W7GH 2C4FH 2VGCC 4M7GA 6GCHG 2VGCB 2ZPQA 2VWNA 3ZZAA 1HJ9A 2W3KA 4WMFA 1T32A 4VGCB 1TNGA 4NSYA 4A1XA 1HAHH 3SV8A 1PPFE 3RM0H 1MUEB 2P3UB 2BD7A 3TJVA 4NA9H 1HLTH 3BG4B 5L30H 1V2LT 2BD8A 1HJ8A 5LPFA 4NIVA 4BXSA 3VB5A 2XC0A 1Y59T 4K1EA 5HYOA 2Y5HA 2ZQ2A 1VJ9U 1W2KH 7GCHF 2ZZUH 3RXAA 1EAUA 2B5TB 4ABAA 2H6MA 2QXGA 4DIHH 3ZVEA 3E0NB 3M36A 1O3FA 3SUGA 4HGCA 4YLQH 2VIOA 1Z8JB 1O5FH 5T6GA 4ABFA 3L3TA 2A7CA 3A81A 4FXGH 4K5ZA 1JRSA 2SGQE 3SGQE 3LGYA 1TNIA 3URDA 1OWDA 5E0JA 3SUFA 1KXFA 5DK1A 5JB8S 1SLWB 1IQNA 2C8YB 3QN7A 4ZXXH 2EC9H 2Q1JA 4BTUB 2R3YA 4AFUA 3T26A 2ALPA 4A1VA 3E8LA 2J95A 2BLOA 3A83A 2SGAA 4X1NU 2AMDA 1KTTB 1F0RA 4Q7YA 5T6FA 4ESTE 1BMLA 4O3UA 1ANCA 1UHBB 4O97A 2EI8A 1UTPA 4ZH8A 2ZI2H 4J2YB 1CVWH 3KQDA 4THNH 1LHEH 2Z9GA 1AKSA 1BB0B 2QXJA 1QJ1B 2G8TA 4E06H 2AGEX 3SOSA 2WYGA 3FFGA 3SI4H 1MTUA 3BTDE 4OS6A 4YT7H 1AWHB 4DURA 1EZSC 3PYHA 4MNXA 4F4OC 1IQGA 1HGTH 2WPLS 1HXFH 1V2NT 1AFEH 3PV4A 1AKSB 1QB6A 1KXAA 7LPRA 4IC6A 1O2TA 3A8BA 3P8NA 2XTTB 4MPVA 4DOQA 1CHOG 3RXIA 3U8OH 1YP9A 1BRCE 4D7FA 2PKAB 4GCHG 1RTFB 1DDJA 1UTKA 1PPEE 5F8XA 1W3CA 3SU3A 1AO5A 3ZZ9A 1O2LA 1SGIB 3AW1A 2TGTA 3GCOA 8KME2 4JZIA 1TALA 2O8UA 4ABBA 3RXEA 1LPKB 3LGTA 4NZLA 1OS8A 2ANWA 1YKTA 3GDVA 1V2TT 3SGAE 1O2HA 1BBRE 3VB3A 1YPHC 2LPRA 1CT2E 3T5FH 1QCPA 1GI1A 1P3CA 3TK6A 2R2WU 2BHGA 1SLVB 1YGCH 3PLPA 1SGDE 3UNRA 3BTKE 1ORFA 2BTCE 1AVGH 1YF4A 1ZHMA 1IQEA 2QC2A 2UUKB 3TGJE 1YLDA 2Z7FE 1C2IA 1UVPA 4FUIA 3SI3H 2BD9A 5JDUB 1KYNA 3FP6E 1LVOA 3L33A 1BRBE 1FXYA 1YPHE 2ZTXA 3KF2A 2BDGA 2AIPA 3ZV8A 2JKHA 3SJOA 3QO6A 1K1OA 1NN6A 1H9IE 1AI8H 3T27A 1QA7A 2A31A 1HAVB 3BIUH 3PLBA 1T31A 4FVDA 1SQTA 2OXSA 3K2UA 1ZZZA 3ZZ8A 2ZTYA 1TBQH 2EI7A 2TIOA 3V7TA 3EYDA 5I25A 4JZEH 1AE5A 3E90B 3SW2B 4AFQA 4UE7H 1UTNA 1GVZA 1P10A 1F5LA 2FLBH 3ZVGA 4H4FA 1SFIA 1S85A 1KDQA 2J92A 3MNSA 1WAYB 5DP5A 2VINA 1N1LA 1F7ZA 1GI2A 1DWCH 3HKIB 1O2NA 4OGYA 1MKXH 2FOMB 3SHAH 2AIQA 4OS7A 4X1SU 3UQVA 2GZ8A 2Y80A 3GCTG 4JZ1A 1AWFH 2A4QA 3M3SA 3M3TA 1AY6H 2BLQA 8ESTE 5HGGA 5IYTA 4FUCA 3TJUA 4IGDA 3KL6A 1TBZH 2PTNA 1TNHA 2XC5A 1MKWH 1UTOA 1ZRKA 2F9VA 1ABIH 3PMHB 1PQ5A 2OINA 1FY1A 3RLWH 4FUBA 2FI4E 5EXLA 1FI8A 1O2KA 1CA0C 3EE0B 1CA0B 3UOUA 1GJDB 1TA2A 3U9AH 1FPHH 1J9CH 3MU1A 2AERH 5JBCS 1K1MA 2R0KA 3D62A 2FI5E 1GHVH 2BOHB 1AZZA 1DLKB 1GBCA 4TY6A 2QXIA 4OGXA 4CRAA 1DT2A 1QB9A 1AVXA 3TGIE 3TJOA 4BAMB 2QGRA 2B8OH 1GBTA 1QQUA 2AH4X 1E35B 1Y5BT 1QJ6B 4CBOA 1IQFA 2ZDKA 1IQJA 9ESTA 3PO1B 1W8BH 1RTKA 1EOLA 2SGPE 4H42U 2ZDVH 3GY6A 3P17H 5E2PA 3E6PH 1FZZA 3QK1A 3ZVCA 1S83A 2TGPZ 1C1RA 1YM0A 1BJVA 1GG6C 1LTOA 1GG6B 1T7CA 2ZP0H 1LHDH 1KLIH 1AHTH 5EW2H 1NESE 3RC6A 2Z3DA 1O3OA 3HATH 2P8OC 1TX8A 2KAIB 2P8OB 4OS5A 1ELVA 3GY7A 1GHAF 5FXLA 4ZROA 1GJBB 1TE0A 2NU0E 3EA8A 3IITA 1QHRB 1EOJA 1DS2E 1O2UA 1ZPZA 1W0YH 3D23A 1IQMA 2J2UA 3GOVB 4QT8C 1ZTJA 1CQQA 2Y6TA 1CO7E 1TMBH 4JZFH 1A46H 1THPB 1D3DB 5C1UA 2WPMS 5FCKA 1S6HA 1BMNH 3U98H 3ATIA 3FVFB 1Y3WA 1ETRH 1VJAU 2ZIQH 2JH5D 2WPKS 3RU4E 1DWEH 3A86A 3BV9B 4X1PU 3OU0A 1KSNA 3MU4A 1VCPA 3H7TA 3KQCA 4LK4A 1O0DH 3WY8A 4CBNA 5JYIA 1E38B 3TITA 1ZLRA 1DPOA 3GY2A 1QJ7B 3UNSA 2C93B 3O8CA 4NFFA 2BYAX 2PW8H 3QTOH 2F3CE 2NU4E 4KGAA 2A0QB 4MTBA 3ATKA 3B23B 4MPXA 1J15A 2HPQH 1P2MA 3LIWA 2GGVB 4BANB 3SORA 3ELAH 2WPHS 1GBBA 3OY6U 4AN7A 4X2XA 4AFZA 4BTTB 1EJNA 2G5NA 1MTVA 1W11U 1SGYE 4A6LA 1C1TA 4K8BA 1HUTH 2XRCA 5BRRE 1NFYA 2BDBA 5C5OA 1HYLA 4E7NA 2BDHA 5F8ZA 4MNWA 3RM2H 4TPIZ 1AMHA 5JPMH 3BTME 1FY5A 2B9LA 2G4TA 2GX4A 1L4DA 4YTAA 3ZZDA 2VWMA 3TH2H 5C67A 1VITF 1SLXB 3STIA 3ZZ7A 1WCZA 2A4GA 3BF6H 2SNWA 5FBEA 1S81A 1K9OE 4MNVA 4UFFH 3BTQE 4JZDH 4K3JA 3MI4A 3S9CA 1BBRH 1CGJE 4DCDA 3SV7A 1O5CB 1BHXB 4FU9A 2H1UA 5K0HA 1OXGA 1C1MA 4WMEA 2EA3A 1K1NA 2VVCA 3PROA 1DE7H 5GJ4B 2BD4A 4GVUA 1C5WB 3HK3B 1NU9A 1EB2A 4Y6DA 3RXKA 1EJAA 2XBXA 4KTCA 1TQ0B 1P0SH 2GZ7A 5DGJA 3UR9A 3UNQA 1AUJA 2GT7A 1LPZB 3V0XA 1BITA 1OP2A 3B8JA 1P05A 2VJ1A 4ZXYH 1TONA 3TLOA 1S0QA 4J1YA 2D2DA 3SJKA 1O2QA 2G52A 2H5DA 1SGNE 4B75A 1KLJH 4ZKOU 3UWIA 3O8RA 3URCA 3RXMA 3E91A 2VIWA 3LGIA 1IHTH 2BMGB 5C5NA 2GKVE 2QYIA 2F83A 3I78A 4XBDA 1O2XA 4D76A 1O37A 1SOZA 1DFPA 1ZHPA 3VB6A 2SNVA 1GBDA 1ELAA 1DANH 3E16B 4BAHB 4RKOB 1SQAA 1MTSA 4Q7XA 4ZAEA 1D3TB 3Q3KA 5LGOA 5AF9H 5HMAA 1GBLA 5EODA 1YPEH 2UUJB 3RXJA 5A09A 2FYRA 2ZPSA 1A5HA 5EU8A 1PPGE 3DHKH 1OWEA 3GCNA 1XUGA 1LHGH 3A85A 1MH0A 4KP0A 1FMGA 1O2IA 5EXMA 4FVBA 3PWBA 3QWCH 4KTSA 1EZUC 1V6DA 2BD2A 2D1JA 2WYJA 3S9BA 1IQKA 1O3GA 3A7ZA 3F1SB 3MO3A 1KIGH 1A5IA 1XUFA 3SV9A 5HM2A 5C1YA 1JIRA 1GBMA 1L4ZA 3S9AA 4IS5A 1GI9B 1YCPK 2Z9IA 1CSOE 1SGRE 1HJAC 4U01A 1HJAB 1QURH 4FUFA 2BY8X 1O3DA 4BAQB 3D49H 1LKAA 4GHQA 4I8KA 1PYTC 4XFQA 1GMHF 2Z6BD 1ANEA 1FAKH 1HAIH 2BXTH 1C5UA 1XKAC 3A7TA 1EATA 4FUHA 1G37A 1GBHA 4B2BA 3AAVA 1C9TA 2BQ6B 1DUEA 1OP8A 3P8OA 4I31A 1SGPE 3K6ZA 4LZ1H 1GMDF 4AOQA 2A7HA 1TPAE 2FXRA 3A7YA 3NCLA 2QY0B 4GPGA 1A1RA 1NM6A 5CMXH 5FX5A 1C5MD 3VXEH 8GCHF 2UWPA 3SU4A 2F9OA 1BDAA 4CRBA 3MU8A 3QZRA 1GBJA 3NXPA 3OSYA 1EAIA 1H9HE 3ZZ4A 1T4VH 3LDXH 4U2WA 1BZXE 2CMYA 2WV4A 1LQEA 3ZZ5A 1VCQA 4X8VH 2CN0H 1AD8H 3R3GB 4NA7A 1TNJA 3TU7H 1QBNA 2F9PA 2AMPA 2STAE 3AW0A 4RN6A 5E8EH 2HALA 2HNTC 4UDWH 1AN1E 1PPCE 4WWYA 2W7SA 1EZQA 4B74A 2CHAC 2V6NA 2CHAB 3GICB 5JB9S 1XX9A 1O31A 3LONA 2SGDE 4R8TB 1C1VH 2JETC 3NK8A 3RP2A 1C5VA 2JETB 7KMEH 3HK6B 5C3NA 1KXDA 1OWJA 1KXEA 5CE1A 1O3LA 2HNTE 2ILNA 1LDTT 1P2IA 3JZ1B 4VGCC 5J4SA 3U1IB 1P9UA 1FDPA 1IQLA 1NRSH 4WF8A 1TOMH 1O36A 1A0HB 2HVXA 1CHOF 4CH2B 1ABJH 3A88A 3BG4C 5FAHA 1ELGA 3ZZBA 2O8WA 2XCNA 1C4U2 4LXBH 2P59A 3EA9A 3O8DA 3SNAA 5A8YA 4AFSA 1GI5A 2PGBB 3FANA 4Y11E 1XUHA 1UHBA 2GZ9A 4YOIA 4GLYA 5EQRA 3RXBA 1PQ8A 2BDIA 1GJ8B 3MYWA 1K1LA 1W13U 2VWOA 1D3QB 1C2LA 2GMTC 3TIUA 2GMTB 4YLUA 1Y8TA 4NIXA 1EJMA 4UFGH 1MZDA 3F9EA 1P09A 2AGGX 1OSSA 4Q2KA 2O8LA 4HTCH 3BIVH 2CGAA 1EKBB 2Z3CA 1AUTC 2BVXH 4WH6A 5F8TA 1OKXA 4AG1A 2BQ7B 2VWLA 1HB0B 1B0FA 1MU8B 2ZHWH 1V2ST 2HOBA 1G3EA 4I8GA 3GYLB 3UOPA 1HAGE 3MH6A 1MAYA 3A89A 3KIDU 4K69A 1GBEA 3CP7A 3AASA 1F5KU 1ZTLA 5AVDA 2OLGA 2PKAA 1VR1H 1NRQH 1ZPCA 1O5BB 2FS8A 2V35A 3D65E 2ZC9H 2ANYA 1C2MA 1UK2A 3GDSA 4ZHLU 3ZVFA 1UCYE 2Z9JA 4I33A 1FN6A 1TBRH 1O3BA 1W10U 1F5RA 4F49A 1NZQH 4BAOB 1TWXB 4IMQA 3DFLA 1BRAA 3RMMH 1P57B 2Q6GA 1RXPA 3RXPA 1F0SA 3MO9A 1UJ1A 1TGBA 1NC6A 1PPZA 1OYQA 1P2NA 4O9VA 5B6OA 1G2LA 1F0UA 1BJUA 4PROA 2AFQB 1DUAA 1OYTH 4BOHA 3UWJH 1ETSH 2C3SA 2WUCA 1DWDH 1HAZB 2R2MB 1UTLM 1AFQC 1J14A 1O30A 2FX6A 2G4UA 1HCGA 2ZPRA 1AFQB 2BX3A 1U6QA 4ISOA 3KQBA 2DUCA 3CS0A 1ZTKA 7GCHG 3E0PB 1SC8U 1C5YB 1HAVA 2IN2A 2A4RA 4ABHA 1OWKA 1YYY1 1ZHRA 3SV2H 3RXFA 1AE8H 1ELDE 4MLFB 2FS9A 2BDCA 1V2OT 1MU6B 1WU1A 2M5TA 4IMZA 2FX4A 1HPGA 1MKXK 2ZHFH 1S5SA 2OD3B 2XXLA 1BT7A 4MPWA 4YOJA 5GIBA 1V2MT 1NO9H 5G4BA 1V2VT 3V13A 3LJOA 1MKWK 2AGIX 2C8WB 3MH7A 3P8GA 3EAJA 1ZMNA 1KTSB 2FTMA 1C5OH 4NG9H 1P11E 1C2KA 1SQOA 3W94A 3RLYH 3SNEA 1OP0A 1ESTA 1PFXC 1UMAH 2NU1E 2TRMA 1JXPA 3NUMA 2DE9A 3HPTB 4B71A 2P95A 2PHBA 2FOEA 3OX7U 1ZSJA 2XWBI 3Q00A 1XXDA 2VB0A 1BRUP 5FCRA 4NZQA 1C2JA 4BXWA 3QUMP 4CRFA 2GD4B 3M35A 2OBOA 2Y7XA 3SHCH 4AB8A 3TPIZ 1B7XB 1GJ5H 2GCHF 3SU6A 3M5MA 4K8YA 1ELEE 4HI3A 1WQVH 5ABWA 1O2JA 3SBKA 1O2WA 1SL3A 1ZPBA 4YT6H 4Y8YA 2FOAA 4A92A 4CRCA 1L0ZA 1TA6A 1N6XA 3A8AA 3S0NA 2H9HA 1EASA 1NFWA 4K1SA 1FJSA 5E0GA 3T29A 4TWWA 1SPJA 3K6YA 3ZZ6A 5A8ZA 1C1QA 1O5AB 3BTHE 4DIIH 1O2PA 4HZHA 2UWLA 4CR9A 4RKJB 1QY6A 2J38A 3DD2H 4DW2U 6CHAC 5F6MA 5JBBS 6CHAB 1WOFA 2EI6A 2BB4A 1GJAB 1BTHH 1CGIE 1GHXH 5CHAC 3N7OA 2XBVA 1P8VC 5CHAB 5PTPA 5FPTA 3SJ8A 3LJJA 1Q2WA 2STBE 4E7RG 3RDZA 3RXSA 1UTMA 2IJOB 4NSVA 1O3EA 3NWUA 3RC4A 2KAIA 1GJ6A 3PO1C 2XNIA 1Y3YA 1C2FA 1ELTA 2GCTB 2JH0D 1D3PB 2A45B 4NIWA 1IAUA 1SGTA 3HGPA 1GMCF 1TGTA 2QIQA 3JZ2B 1INCA 5FHTA 3UUZA 1A61H 2F9NA 4IN1A 1NU7B 2WUBA 4Y8XA 2ZU1A 5EQSA 2QA9E 4YZUA 1AQ7A 1BTYA 4ZHMU 7ESTE 2FOGA 3M7UA 1CA8B 1BIOA 2FOHA 3R0FA 1GHBG 1BTPA 4B2CA 1ELFA 4TWYA 3OTJE 3A7WA 2ZFSA 3EGKH 5DG6A 2K1QA 1G3CA 1SVPA 2VH0A 3ZYDA 1QGFA 5L6NH 3S7HB 1LKBA 3TJNA 2RCEA 1O34A 1P03A 4D7GA 1GCTC 1L1NA 1SGCA 2GT8A 1F2SE 3RU4T 1GCTB 2ZFRH 3TH3H 1ARBA 2G51A 1FY8E 3KGPA 3LGUA 2GDEH 2OTVA 1C5NH 4UONA 1C5LH 5C1XA 4JK6A 5DP8A 3L6PA 4Q7ZA 2QV1A 5JBTA 2ZA5A 2BLVA 3VPKA 2BVSH 2RDLA 5A0CA 4Z6AH 1S6FA 3MU5A 2ZHDA 4BAKB 4KKDA 1GBIA 1V2UT 4X2WA 1GDQA 1BTUA 1ESAA 3NPSA 3UREA 4GHTA 1Y3UA 1SG8B 1FIWA 2ANMH 1MMJN 4I7YH 3BTEE 1BBRK 3BEFB 1E37B 2NU2E 4DT7B 1NTPA 2GVFA 2ZU3A 1EXFA 3A84A 1WBGB 2PSYA 2NWNA 3RU4D 3OY5U 1K22H 4O3TA 2FM2A 1P2OA 2UWOA 4XSKU 3T62A 1SGEE 3QX5H 3S69A 1BA8B 4R0IA 3QDZB 1UCYH 1D6RA 1GI8B 4UD9H 1C2GA 3GISB 2OC1A 1BMAA 1O39A 3MMGA 1C5SA 4MVNA 3SGBE 1V2JT 5GCHG 4GSOA 1C2HA 1O33A 3V12A 5HM9A 1TLDA 5EG4A 1PQAA 1EQ9A 3MH4A 1P2QA 1BQYA 3MU0A 1IQHA 1K1IA 3VB4A 3ZVDA 1V3XA 4X8UH 3VB7A 1D9IA 4FUDA 2PUXB 2BY9X 1DY9A 1A2CH 1BMMH 1ID5H 3M5LA 1KXCA 4WH8A 1MQ5A 1FY4A 1ETTH 4Q80A 3ZVBA 1GHAG 1TOCB 2PGQB 2ZGBH 2R0LA 2D8WA 1M9UA 1QR3E 2ZFPH 4WMDA 3GY3A 2OP9A 1C1OA 4TPYA 1YPKH 1UVSH 1B5GH 1PJPA 3ATMA 1GVLA 1FLEE 3SJ9A 2G5VA 4B73A 3DA9B 4K2YA 9LPRA 1F92A 2P3FH 2BX4A 1YBWA 2OC0A 4IN2A 1X7AC 1RRKA 1THSH 3UFAA 4NIYA 1UVTH 1Z6JH 1MQ6A 2W3IA 2A2XH 1AU8A 2CJIA 3DUXH 1TRMA 5IDKA 3LC5A 3SNBA 1OWHA 4NCYA 5E2OA 3M61U 3EQ0H 1L2EA 3SUEA 1KY9A 2XBWA 2VVUA 3RXTA 1FNIA 1O3JA 2UUFB 2VIPA 1HIAA 3FZZA 3KCGH 5BPEA 3PMJA 2Y82A 4FUEA 3FAOA 4GUXA 5FX6A 2J9NA 1QIXB 2PFEA 3IWMA 1TQ7B 1ZJDA 1IQIA 2QF3A 2VH6A 2PTCE 3VXFH 3W95A 4K60A 4ABJA 1FN8A 5EXNA 1SGFA 2BM2A 3LH3A 1MD8A 2YNAA 3BTFE 3SO3A 1TRYA 3ZZ3A 1S84A 1ACBE 2G55A 1HIAB 3MNBA 1GBFA 3SV6A 1NRNH 5GWZA 3EDXB 1H8IH 2FMJA 1ZRBA 1CBWC 1LVYA 2OBQA 1CBWB 2ZCHP 5FPYA 5A8XA 1GHWH 3GDUA 4ISIH 4XDEA 1XMNB 2RA0A 3EA7A 1N8OC 6GCHF 1N8OB 2B0FA 3UIRA 1SR5C 1FONA 5EPYA 1HBTH 1GJCB 1V2PT 1VZQH 1ZGVA 2A5KA 1ANDA 3NZIA 1EP5A 4AG2A 5I46H 1TMTH 4B76A 3RXVA 3PTBA 3ENSB 1XVOA 1PQ7A 1Y5UT 1SGFG 1AVWA 4DG4A 2FOCA 3ZVAA 4AZ2B 4K1TA 3BTWE 1BTWA 1O35A 2V3HH 1O2OA 1DX5M 1OOKB 4ABEA 2QF0A 4NWKA 3RMOH 2Z9LA 4I8JA 4NWLA 3K9XB 1YPMH 2ANKH 2BY5X 1QB1A 2WPJS 3P92A 1AIXH 3ESTA 5EW1H 1LQDB 2GV7A 1Z1IA 5ESTE 5EOKA 2ZCKP 1A3BH 1DSTA 4I8HA 1GI3A 3E1XB 1C4V2 1RGQA 2A2QH 1TNLA 1A0LA 2ZO3H 3MTYA 1C1PA 1O2MA 1D6WA 1E0FD 1JIMA 1PYTD 3RXDA 5TJXA 2VNTA 1RS0A 1LVMA 1NRPH 5EQQA 3MO6A 1UK3A 4ISLA 3BSQA 4WXIA 3PTNA 1ELBA 2Z9KA 5EPNA 3VEQB 1D4PB 1DXWA 1A7SA 1C5XB 4NFEA 4YOGA 1HV7A 3RXLA 5L2ZH 3BTTE 4BNRA 1GBAA 3CS7A 3LC3A 1MCTA 2PR3A 1JOUB 5DO4H 3M5OA 2R3UA 1J16A 1YPJH 2ZGJA 4CRGA 1C2EA 3OYPA 3KQEA 3U8TH 2FO9A 2PSXA 4ABIA 1WTHD 1C5ZB 1GI4A 2A1DB 1QA0A 4X6PA 5JBAS 1QL8A 1QTFA 4GCHF 4INKA 1EPTC 1UO6A 1EPTB 1T8NA 1TGNA 3KEEA 4X2YA 1XUJA 1GCDA 1UK4A 4CHAC 1Z8IB 4CHAB 1RTLA 4UFEH 3Q3XA 4ZHAA 4LZ4B 1A0JA 1C1UH 1AGJA 1GMHG 1Z71A 2HLCA 4NA8A 4WY3A 1AB9C 3VGCC 1AB9B 2FP7B 4SGBE 3VGCB 1E36B 2ZG0H 1CHGA 2FEQH 4WXVA 5GDSH 3H7OA 1ZMLA 2PLXA 2ZU4A 2LNCA 1RIWC 1GMDG 4AX9H 1RIWB 1DICA 1HAOH 2GDDA 4FUGA 8GCHG 4WJG2 3P6ZB 3RXOA 1RD3B 1GI7B 1CU1A 4IC5A 4D9RA 1MTNC 2H9TH 1Y5AT 1MTNB 3ODDA 1H1BA 5EGMA 1PPBH 3A80A 2ZDLA 1UTJA 1TGSZ 2ZHEH 4UFDH 3HKJB 5GXPA 3M3VA 1QRZA 2Y5FA 3RXCA 1TNKA 1HXEH 3LGWA 4MDSA 3UPEA 4ASHA 2TPIZ 3A8DA 1P02A 1SI5H 1VCWA 2XWAA 4D8NA 2NU3E 3F9GA 4X6MA 2VVVA 2ZEBA 3I29A 4U30A 3Q77A 1H4WA 4BTIB 1HAXB 1OWIA 2FYQA 5AHGH 4AORA 1O2RA 1G3BA 1O2VA 4X0WU 3M37A 5HXFA 1NROH 1K2I1 1S82A 5ETXA 4Y0ZE 1OPHB 2J94A 2HWLB 3A8CA 3F68H 1K1JA 1G3DA 2G00A 3QGJA 1GHYH 2J34A 4JYVH 4OS4A 1F0TA 2P16A 3GCTF 1WUNH 4LOYH 5C20A 1O3AA 1O5EH 2WINI 2OQUA 2WV5A 1MAXA 1MTWA 1DSUA 1H8DH 1TIOA 1GDUA 1FPCH 3ATLA 1DXPA 4WVPE 1QRWA
chains in the Genus database with same CATH superfamily
4Y76A 2RDEA 4AGKA 4YO9A 2BZ6H 1UW7A 3SN8A 2VIQA 4AYYB 3PM3A 3PWCA 2PP6A 5A2MH 1EX3A 2PWXA 1K28D 4ISNA 2QCYA 2JH6D 5AFYH 2V0BA 5E0HA 1ESBA 2F9UA 5DP7A 4CRDA 6ESTA 1AZ8A 3LH1A 3Q3YA 4NGAH 1TPPA 5GPIB 3PB1E 3HGNA 1E1RD 1ZSKA 5FL7D 4AGJA 1WYKA 1Z6EA 1QRXA 1CE5A 1O2YA 3GCHC 1DY8A 1O3PB 3GCHB 3ITIA 4Z0KA 4FU8A 4A5TS 1VITH 3PV2A 2UUYA 6LPRA 2TBSA 2HRVA 3M7TA 4IBLH 1NT1A 1XVMA 2ESTE 2SFAA 1SBWA 3U69H 2XCFA 2ZECA 2HPPH 4MPUA 5TCAA 1C1SA 3TNSA 3FP7E 1S0RA 1SKYE 1MCVA 1DVAH 3AVZA 4E05H 3MNXA 1NPMA 2RG3A 2QF5A 1H8HD 2J4IA 3DSOA 1JMOH 2QAAA 2FODA 3TK9A 2O8MA 1YPLH 4B2AA 1QNJA 2OUAA 1YLCA 4SGAE 1GHBF 1YPGH 3H09A 2C90B 4CR5A 5TCCA 3KNXA 4XE4A 1C5PA 1ZYOA 1LHCH 2DE8A 4A1TA 2AMQA 2D26C 1NRRH 2ZHQH 1O2SA 4B6FA 1O3IA 1C1WH 1O2GH 1TABE 3CENA 3RMLH 2HGTH 1MBQA 1GHZA 1J8AA 5DP9A 2YOLA 2BY7X 3UR6A 2ZDAH 1QQ4A 2FESH 3MH5A 1EUFA 3MNCA 1XKBC 3LOXA 3MWIU 2XBYA 2RA3A 1KDQB 3QGNB 1ZJKA 1NY22 2P93A 1KLTA 3F9HA 5DP6A 2OQ5A 2ZGXH 2PUQH 2ZF0H 3LU9B 1Z8RA 5LPEA 2B7DH 1QBVH 3DT0H 2XC4A 2FTLE 1DM4B 1W7XH 3RXRA 3VFEA 1JRTA 5AFZH 2G81E 1PPHE 1Z8GA 1HAYB 1HDTH 4DY7B 1O3KA 3RXGA 4D9QA 4X8TH 3SU2A 1W0JD 4X1QU 2FOBA 2GCTC 1ZSLA 3WW7A 3A87A 3RC5A 2A32A 1WSSH 2TGDA 1Z1JA 2AEIH 3I77A 3V3MA 3SUDA 4DJZB 1NFXA 5A0AE 4XBBA 3F6UH 5DJ7A 3STJA 4ZMAH 2ZU5A 1LPGB 3P8FA 1P9SA 2W5EA 3S7KB 1NS3A 1C9PA 1P2JA 4ISHH 3MHWU 5GCHF 2XOKD 4I8LA 2CV3A 3PRBA 2OC8A 1GL1A 2FI3E 1NBMD 3H5CB 1XUIA 1C5RA 3LKWA 1O3HA 1G2MA 2F9BH 2AS9A 1P06A 2OCVB 1TGCA 2EEKA 4DVAU 1JBUH 1P01A 2GV6A 3DFJA 1P12E 2A4OA 5T3HA 5ESBA 1UCYK 3GY8A 4JYTA 2SGFE 2VIVA 1ZOMA 2BD5A 2BVRH 1FAXA 2GCHG 4INHA 4AB9A 1TPSA 3A7XA 4O03A 2HVYB 1ARCA 2BZAA 5T1VA 4A7IB 4AC9A 5IK2D 2FPZA 3KHVA 4MG3A 4H6SB 2WPIS 1Y3VA 1LMWB 2IOTA 4YESB 4ABGA 4Y7BA 4IW4E 1BHXF 4TY7A 5LH8A 1A4WH 1NFUA 2BY6X 3BEIB 4B1TA 2ODPA 5HIZA 2XYAA 1XUKA 1WDIA 4KELA 1Z7KA 2ASUB 1DOJA 4MNYA 1THRH 2C8ZB 4Y10E 3NKKA 3FKSD 3UB0A 3SQHE 4I32A 1BCUH 2OC7A 1SGQE 4Y0YE 3FO8D 3OAAD 1FQ3A 1W12U 2ZGCA 3RXUA 5DP3A 4XOJA 2QN5T 1W0KD 1SHHB 3T28A 3RUOA 1COWD 1GPZA 4ZKRU 1O5GH 4X8SH 2TGAA 3FZDA 1EZXC 3P70B 1GVKB 2BD3A 2KZ4A 3SU0A 3WWFA 3PMBB 1A3EH 1GDNA 2CXVA 1C4Y2 3TGKE 1O2ZA 1V2KT 1G32B 1GMCG 3QZQA 2ZGHA 1Q3XA 2O9QA 1WQSA 4YM9A 4UEHH 5SGAE 1BUIA 3FP8E 1XXFA 3O8BA 1EP6A 1XM1A 4RSPA 1P04A 4ZKSU 2ZU2A 1DITH 4H6TA 3LGVA 1TFXA 2Y7ZA 1EAWA 1GI6A 3QLPH 1RJXB 1J17T 1FY3A 3T25A 2P94A 1GGDC 1IHSH 1L1JA 1GGDB 1BTZA 3QTVH 4ABDA 2I6QA 1Y3XA 1O38A 2ODQA 2PKSC 3GY5A 2PKSB 1T8OA 1IOEA 2P3TB 2Y81A 1TAWA 1V2RT 1SB1H 1ELCA 2Z94A 3UTUH 5FBIA 3MFJA 2QXHA 2ZFTA 1EAXA 2ZDMA 2THFB 1T8LA 1RFNA 3KN2A 1TMUH 5J4QA 2BDAA 4HFPB 5H4IB 3C27B 3TNTA 1CT0E 3MOCA 1QL9A 1UVOA 2ZNKH 1QL7A 2ZTZA 2H9EH 3ATWA 1DLEA 3BEUA 1HAPH 1V2QT 2GP9B 1TPOA 1GJ9B 2Y5GA 3ZZCA 4GAWA 1SLUB 3E3TA 4X6OA 3C1KA 1MABB 4TYDA 3PLKA 3B9FH 2H5CA 4AYVB 3RMNH 2VIDA 2A5IA 1O3NA 2AHME 2R9PA 4OS2A 1SQRA 3GY4A 4DGJA 1YY3A 1WTGH 1VGCC 3SU5A 1VGCB 1W14U 2SGEE 3F2GA 2BLWA 2BOKA 1K1PA 2ULLA 1HNEE 4Y79A 3BG8A 1TB6H 1BOQA 2CF8H 2W26A 2IPHA 4KTUA 1GJ4H 1W0ZU 4JCNA 5DPAA 5T6DA 1TRNA 2V3MA 3LPRA 3A7VA 1ANBA 2CF9H 1SSXA 1C5QA 3IG6B 3SU1A 4Y71A 2O8TA 1VITG 1GBKA 3M5NA 2AYWA 3SJIA 1K21H 4JK5A 1MBMA 1E1QD 2Q6FA 2HNTF 5A0BA 2ALVA 1KXBA 2ZWLH 3FOAA 1ZMJA 2FZZA 3PMAB 4JMYA 1T8MA 2EQNA 4Y7AA 4CREA 1LHFH 2BDYA 5EIYA 1A5GH 2FDAA 2FOFA 3GYMA 4ZKNU 5LPRA 1FUJA 4XBCA 1ZR0A 5FPSA 4INLA 1B0EA 3T2NA 1L1GA 2LELA 2V3OH 2VU8E 3ODFA 2FLRH 2KCPA 2PV9B 2I6SA 1GJ7B 5CHBA 3P95A 3TH4H 3M7QA 2ZKSA 3LT3A 1H9LB 1N6YA 1DWBH 1TX6A 1T4UH 2A5AA 3BTGE 4MQAA 1MZAA 1E34B 1C2DA 2FIRH 3TVJB 3RXHA 1SHYA 2C8XB 1SFQB 8LPRA 1CT4E 3ZYEA 3RXQA 1LO6A 4U32A 2F91A 3UY9A 5C2ZA 4Y8ZA 1HFDA 3SNDA 4X1RU 1O5DH 2W7UA 1FIZA 1YCPM 1FV9A 1BTXA 1LVBA 1G36A 4X6NA 2YNBA 2XNDD 4X2VA 1BMFD 1JWTA 3Q76A 1C5TA 2OK5A 2ZQ1A 3U8RH 1Q31A 2FWWA 2ZCLP 3K65B 2Z3EA 1EB1H 4FUJA 1TX7A 1HRTH 2GTBA 2XW9A 3AAUA 1G30B 2ZFFH 4ZUHA 1UVUH 3TK5A 1MD7A 4JYUH 3SZNA 2H2ZA 1O3CA 1O3MA 1QBOA 1SMFE 1YCPH 3U1JB 1WV7H 1V2WT 2ZFQH 2A7JA 5L2YH 3ZV9A 3SNCA 3A82A 1GL0E 1ZGIA 2IJD1 4FU7A 1EPTA 1GI0A 2ZDNA 3UQOA 3G01A 1TYNA 1G9IE 5F03A 1E79D 1OX1A 3F9FA 1P3EA 5DKMA 1LCYA 2WHXA 5DP4A 2BXUH 2BQWB 5K7RA 1SOTA 1QFKH 2ODYB 3BN9A 3SQEE 1P2KA 1O32A 1YC0A 1UTQA 2Q6DA 5DN6D 1C1NA 4CH8B 1GWAA 4OS1A 1CGHA 1W7GH 2C4FH 2VGCC 4M7GA 6GCHG 2VGCB 2ZPQA 2VWNA 3ZZAA 1HJ9A 2W3KA 4WMFA 1T32A 4VGCB 1TNGA 4NSYA 4A1XA 1HAHH 3SV8A 1PPFE 3RM0H 3F2HA 1MUEB 2P3UB 2KCYA 2BD7A 3TJVA 4NA9H 1HLTH 3BG4B 5L30H 1V2LT 2BD8A 1HJ8A 5LPFA 4NIVA 4BXSA 3VB5A 2XC0A 2W6JD 1Y59T 4K1EA 5HYOA 2Y5HA 2ZQ2A 1VJ9U 1W2KH 7GCHF 2ZZUH 3RXAA 1EAUA 2B5TB 4ABAA 2H6MA 2QXGA 4DIHH 3ZVEA 3E0NB 3M36A 1O3FA 3SUGA 4HGCA 4YLQH 2VIOA 1Z8JB 1O5FH 5T6GA 4ABFA 3L3TA 2A7CA 3A81A 4FXGH 4K5ZA 1JRSA 2SGQE 5HKKD 3SGQE 3LGYA 1TNIA 3URDA 1OWDA 5E0JA 3SUFA 1KXFA 5DK1A 5JB8S 1SLWB 1IQNA 2C8YB 3QN7A 4ZXXH 2EC9H 2Q1JA 4BTUB 2IPQX 2R3YA 4AFUA 3T26A 2ALPA 4A1VA 3E8LA 2J95A 2BLOA 3A83A 2SGAA 4X1NU 2AMDA 1KTTB 1F0RA 4Q7YA 5T6FA 4ESTE 1BMLA 4O3UA 1ANCA 1UHBB 4O97A 2EI8A 1UTPA 4ZH8A 2ZI2H 4J2YB 1CVWH 3KQDA 4THNH 1LHEH 2Z9GA 1AKSA 3SYJA 1BB0B 2QXJA 1QJ1B 2G8TA 4E06H 2AGEX 3SOSA 2WYGA 3FFGA 3SI4H 5EJ1A 1MTUA 3BTDE 4OS6A 4YT7H 1AWHB 4DURA 1EZSC 3PYHA 4MNXA 4F4OC 1IQGA 1HGTH 2WPLS 1HXFH 1V2NT 1AFEH 3PV4A 1AKSB 1QB6A 1KXAA 7LPRA 4IC6A 3DCLA 1O2TA 3A8BA 3P8NA 2XTTB 4MPVA 4M9FA 1CHOG 2YMSD 4DOQA 3RXIA 3U8OH 1YP9A 1BRCE 4D7FA 2PKAB 4GCHG 1RTFB 1DDJA 1UTKA 1PPEE 5F8XA 1W3CA 1VKYA 2HLDD 3SU3A 1AO5A 3ZZ9A 1O2LA 1SGIB 3AW1A 2TGTA 3GCOA 8KME2 4JZIA 1TALA 2O8UA 4ABBA 3RXEA 1LPKB 3LGTA 4NZLA 1OS8A 2ANWA 1YKTA 3GDVA 1V2TT 3SGAE 1O2HA 1BBRE 3VB3A 1YPHC 2LPRA 1CT2E 3T5FH 1QCPA 1GI1A 1P3CA 3TK6A 3NRLA 2R2WU 2BHGA 1SLVB 1YGCH 3PLPA 1SGDE 3UNRA 3BTKE 1ORFA 2BTCE 1AVGH 1YF4A 1ZHMA 1IQEA 2QC2A 2UUKB 3TGJE 1YLDA 2Z7FE 1C2IA 1UVPA 4FUIA 3SI3H 2BD9A 4ASUD 1KYNA 3FP6E 5JDUB 1LVOA 3L33A 1BRBE 1FXYA 1YPHE 2ZTXA 3KF2A 2BDGA 2AIPA 3ZV8A 2JKHA 3SJOA 3QO6A 1K1OA 1NN6A 1H9IE 1AI8H 3T27A 1QA7A 2A31A 1HAVB 3BIUH 3PLBA 1T31A 4FVDA 1SQTA 2OXSA 3K2UA 1ZZZA 3ZZ8A 2ZTYA 1TBQH 2EI7A 2TIOA 3V7TA 3EYDA 5I25A 4JZEH 3F2FA 1AE5A 3E90B 3SW2B 4AFQA 4UE7H 1UTNA 1GVZA 1P10A 1F5LA 2FLBH 3ZVGA 4H4FA 4F55A 1SFIA 1S85A 4Q63A 1KDQA 2J92A 3MNSA 1WAYB 5DP5A 3U28C 2VINA 1N1LA 1F7ZA 1GI2A 1DWCH 3HKIB 1O2NA 4OGYA 1MKXH 2FOMB 3SHAH 2AIQA 4OS7A 4X1SU 3UQVA 2GZ8A 2Y80A 3GCTG 4JZ1A 1AWFH 2A4QA 3M3SA 3M3TA 1AY6H 2BLQA 8ESTE 5HGGA 5IYTA 4FUCA 3TJUA 4IGDA 3KL6A 1TBZH 2PTNA 1TNHA 2XC5A 1MKWH 1UTOA 1ZRKA 2F9VA 1ABIH 3PMHB 1PQ5A 2OINA 1FY1A 3RLWH 4FUBA 2FI4E 5EXLA 1FI8A 1O2KA 1CA0C 3EE0B 1CA0B 3UOUA 1GJDB 1TA2A 3U9AH 1FPHH 1EFRD 1J9CH 3MU1A 2AERH 5JBCS 1K1MA 2R0KA 3D62A 2FI5E 1GHVH 2BOHB 1AZZA 1DLKB 1GBCA 4TY6A 2QXIA 4OGXA 4CRAA 1DT2A 1QB9A 3OE7D 1AVXA 3TGIE 3TJOA 4BAMB 2QGRA 2B8OH 1GBTA 1QQUA 2AH4X 1E35B 1Y5BT 1QJ6B 4CBOA 1IQFA 2ZDKA 1IQJA 9ESTA 3PO1B 1W8BH 1RTKA 2KCAA 1EOLA 2SGPE 4H42U 2ZDVH 3GY6A 3P17H 5E2PA 3E6PH 1FZZA 3QK1A 4ACBA 3ZVCA 1S83A 3N99A 2TGPZ 1WXRA 1C1RA 1YM0A 1BJVA 1GG6C 1LTOA 1GG6B 1T7CA 2ZP0H 1LHDH 1KLIH 1AHTH 5EW2H 1NESE 3RC6A 2Z3DA 1O3OA 3HATH 2P8OC 1TX8A 2KAIB 2P8OB 4OS5A 1ELVA 3GY7A 1GHAF 3FN8A 5FXLA 5C17A 4ZROA 1GJBB 1TE0A 2NU0E 3EA8A 3IITA 1QHRB 1EOJA 1DS2E 1O2UA 1ZPZA 1W0YH 3D23A 1IQMA 2J2UA 3GOVB 4QT8C 1ZTJA 1CQQA 2Y6TA 1CO7E 1TMBH 4JZFH 1A46H 1THPB 1D3DB 5C1UA 2WPMS 5FCKA 1S6HA 1BMNH 3U98H 3ATIA 3FVFB 1Y3WA 1ETRH 2JIZD 1VJAU 2ZIQH 2JH5D 2WPKS 3RU4E 1DWEH 3A86A 3BV9B 4X1PU 3OU0A 1KSNA 3MU4A 1VCPA 3H7TA 3KQCA 4LK4A 1O0DH 3WY8A 4CBNA 5JYIA 1E38B 3TITA 1ZLRA 1DPOA 3GY2A 1QJ7B 3UNSA 2C93B 3O8CA 4NFFA 2BYAX 2PW8H 3QTOH 2F3CE 2NU4E 4KGAA 2A0QB 4MTBA 3ATKA 3B23B 4MPXA 5DSFA 1J15A 2HPQH 1P2MA 3LIWA 2GGVB 4BANB 2J97A 3SORA 3ELAH 2WPHS 1GBBA 3OY6U 4AN7A 4X2XA 4AFZA 4BTTB 1EJNA 2KX4A 2G5NA 1MTVA 1W11U 1SGYE 4A6LA 1C1TA 4K8BA 1HUTH 2XRCA 5BRRE 1NFYA 2BDBA 5C5OA 1HYLA 4E7NA 2BDHA 5F8ZA 4MNWA 3RM2H 4TPIZ 1AMHA 3OEED 3BTME 1FY5A 2B9LA 2G4TA 2GX4A 2J98B 2JDID 4OM9A 5JPMH 1L4DA 4YTAA 3ZZDA 2VWMA 3TH2H 5C67A 1VITF 1SLXB 3STIA 3ZZ7A 1WCZA 2A4GA 3BF6H 2SNWA 5FBEA 1S81A 1K9OE 4MNVA 4UFFH 3BTQE 4JZDH 4K3JA 3MI4A 3S9CA 4YXWD 1BBRH 1CGJE 4DCDA 3SV7A 1O5CB 1BHXB 4FU9A 2H1UA 5K0HA 1OXGA 1C1MA 4WMEA 2EA3A 1K1NA 2VVCA 3PROA 1DE7H 3ZIAD 5GJ4B 2BD4A 4GVUA 1C5WB 5KEDA 3HK3B 1NU9A 1EB2A 4Y6DA 3RXKA 1EJAA 2XBXA 4KTCA 1TQ0B 1P0SH 2GZ7A 5DGJA 3UR9A 3UNQA 1K0HA 2J5UA 1AUJA 2GT7A 1LPZB 3V0XA 1BITA 1OP2A 3B8JA 2KCOA 1P05A 2VJ1A 4ZXYH 4ACAA 1TONA 2F4LA 1S0QA 4J1YA 3TLOA 2D2DA 5C0TA 3SJKA 1O2QA 2G52A 2H5DA 1SGNE 4B75A 1KLJH 4ZKOU 3UWIA 3O8RA 3URCA 3RXMA 4RI0A 3E91A 2VIWA 3LGIA 1IHTH 2BMGB 5C5NA 2GKVE 2QYIA 2F83A 3I78A 4XBDA 1O2XA 4D76A 1O37A 1SOZA 1DFPA 1ZHPA 3VB6A 2SNVA 1GBDA 1ELAA 1DANH 3E16B 4BAHB 3W1EA 4RKOB 1SQAA 1MTSA 4Q7XA 4ZAEA 1D3TB 3Q3KA 5LGOA 5AF9H 5HMAA 1GBLA 5EODA 1YPEH 2UUJB 3RXJA 5A09A 2FYRA 2ZPSA 1A5HA 5EU8A 1PPGE 3DHKH 1OWEA 3GCNA 2L74A 1XUGA 1LHGH 2JJ2D 1MH0A 3A85A 1FMGA 1O2IA 4KP0A 4FVBA 5EXMA 3PWBA 3QWCH 4KTSA 1EZUC 1V6DA 2BD2A 5EJZA 2D1JA 2WYJA 3S9BA 1IQKA 1O3GA 3A7ZA 3F1SB 3MO3A 1KIGH 3F3BA 1A5IA 1XUFA 1FX0B 5HM2A 5C1YA 3SV9A 1JIRA 1GBMA 1L4ZA 3S9AA 4IS5A 1GI9B 1YCPK 2Z9IA 1CSOE 1SGRE 1HJAC 4U01A 1HJAB 1QURH 2V7QD 4FUFA 2BY8X 1O3DA 5KECA 4BAQB 3D49H 1LKAA 4GHQA 4I8KA 1YWUA 1PYTC 4XFQA 1GMHF 2Z6BD 1ANEA 1FAKH 1HAIH 2BXTH 1C5UA 1XKAC 3A7TA 1EATA 4FUHA 1G37A 1GBHA 4B2BA 3AAVA 1C9TA 2BQ6B 1DUEA 1OP8A 3P8OA 4I31A 1SGPE 3K6ZA 4LZ1H 1GMDF 4AOQA 2A7HA 1TPAE 2FXRA 3A7YA 3NCLA 2QY0B 4GPGA 1A1RA 1NM6A 5CMXH 5FX5A 1C5MD 3VXEH 8GCHF 2UWPA 3SU4A 2F9OA 1BDAA 4CRBA 3MU8A 3QZRA 1GBJA 3NXPA 3OSYA 1EAIA 1H9HE 3ZZ4A 1T4VH 2GJGA 3LDXH 4U2WA 1BZXE 2CMYA 2WV4A 1LQEA 3ZZ5A 4B6EA 1VCQA 4X8VH 2CN0H 1AD8H 3R3GB 4NA7A 1TNJA 3TU7H 1QBNA 2F9PA 2AMPA 2STAE 3AW0A 4RN6A 5E8EH 2HALA 2HNTC 4UDWH 1AN1E 1PPCE 4WWYA 2W7SA 1EZQA 4B74A 2CHAC 2V6NA 2CHAB 3GICB 2K8IA 5JB9S 4DT4A 1XX9A 1O31A 3LONA 2SGDE 4R8TB 1C1VH 2JETC 3NK8A 3RP2A 1C5VA 2JETB 7KMEH 3HK6B 5C3NA 1KXDA 1OWJA 1KXEA 5CE1A 1O3LA 2HNTE 2ILNA 1LDTT 1P2IA 3JZ1B 4VGCC 3UAIC 5J4SA 3U1IB 1P9UA 1FDPA 1IQLA 1NRSH 4I86A 4WF8A 1TOMH 1O36A 1A0HB 2HVXA 3GS9A 1CHOF 4CH2B 1ABJH 3A88A 3BG4C 5FAHA 1ELGA 3ZZBA 2O8WA 2QE7D 3SZEA 2XCNA 1C4U2 4LXBH 3CNRA 2P59A 3EA9A 3O8DA 3SNAA 5A8YA 4AFSA 4ZCNA 1GI5A 2PGBB 3FANA 4Y11E 1XUHA 1UHBA 2GZ9A 4YOIA 4GLYA 5EQRA 3RXBA 1PQ8A 2BDIA 1GJ8B 3MYWA 1K1LA 1W13U 2VWOA 1D3QB 1C2LA 2GMTC 3TIUA 2GMTB 4YLUA 1Y8TA 4NIXA 1EJMA 4UFGH 1MZDA 3F9EA 1P09A 2AGGX 1OSSA 4Q2KA 2O8LA 4HTCH 3BIVH 2CGAA 1EKBB 2Z3CA 1AUTC 2BVXH 4WH6A 5F8TA 1OKXA 4AG1A 2BQ7B 2VWLA 1HB0B 1B0FA 1MU8B 2ZHWH 1V2ST 3PV5A 1OHHD 2HOBA 1G3EA 4I8GA 3GYLB 3UOPA 1HAGE 3MH6A 1MAYA 3A89A 3KIDU 2WPDD 4K69A 1GBEA 3CP7A 3AASA 1F5KU 1ZTLA 3N7EA 5AVDA 2OLGA 2PKAA 1VR1H 1NRQH 1ZPCA 1O5BB 2FS8A 5HIYA 2V35A 3D65E 2ZC9H 2ANYA 1C2MA 1UK2A 3GDSA 4ZHLU 3ZVFA 1UCYE 2Z9JA 4I33A 1FN6A 1TBRH 1O3BA 1W10U 1F5RA 4F49A 1NZQH 4BAOB 1TWXB 4IMQA 3DFLA 1BRAA 3RMMH 1P57B 2Q6GA 1RXPA 3EE7A 3RXPA 1F0SA 3WWBA 3MO9A 1UJ1A 1TGBA 1NC6A 1PPZA 1OYQA 1P2NA 4O9VA 5B6OA 1G2LA 1F0UA 1BJUA 4PROA 2AFQB 1DUAA 1OYTH 2KFWA 4BOHA 3UWJH 1ETSH 2C3SA 2WUCA 1DWDH 1HAZB 2R2MB 1UTLM 1AFQC 1J14A 1O30A 2FX6A 2G4UA 1HCGA 2ZPRA 1AFQB 3DSPA 2BX3A 3KYFA 1U6QA 4ISOA 3KQBA 2DUCA 3CS0A 1ZTKA 7GCHG 3E0PB 1SC8U 1C5YB 1HAVA 2VBCA 2IN2A 2A4RA 4ABHA 1OWKA 1YYY1 1ZHRA 3SV2H 3RXFA 4P00A 1AE8H 2WSSD 1ELDE 4MLFB 2FS9A 2BDCA 1V2OT 1MU6B 1WU1A 2M5TA 4IMZA 2FX4A 1HPGA 1MKXK 2ZHFH 1S5SA 2JJ1D 2OD3B 2XXLA 1BT7A 4MPWA 4YOJA 5GIBA 1V2MT 1NO9H 5G4BA 1V2VT 3V13A 3LJOA 1MKWK 2AGIX 2C8WB 3MH7A 3P8GA 3EAJA 1ZMNA 1KTSB 2FTMA 1C5OH 4NG9H 1P11E 1C2KA 1SQOA 3W94A 3RLYH 3SNEA 1OP0A 1ESTA 1PFXC 1UMAH 2NU1E 2TRMA 1JXPA 3NUMA 2DE9A 3HPTB 4B71A 2P95A 2PHBA 2FOEA 3OX7U 1ZSJA 2XWBI 3Q00A 1XXDA 2VB0A 4XD7D 1BRUP 5FCRA 4NZQA 1C2JA 4BXWA 3QUMP 4CRFA 2GD4B 3M35A 2OBOA 2Y7XA 3SHCH 4AB8A 3TPIZ 1B7XB 1GJ5H 2GCHF 2KM0A 3KYGA 3SU6A 3M5MA 4K8YA 1ELEE 5CDFE 4HI3A 1WQVH 5ABWA 1O2JA 3SBKA 1O2WA 1SL3A 1ZPBA 4YT6H 4Y8YA 2FOAA 4A92A 4CRCA 1L0ZA 1TA6A 1N6XA 3A8AA 3S0NA 2H9HA 1EASA 1NFWA 4K1SA 1FJSA 5E0GA 3T29A 4TWWA 1SPJA 3K6YA 3ZZ6A 5A8ZA 1C1QA 1O5AB 3BTHE 4DIIH 1O2PA 4HZHA 2UWLA 4CR9A 4RKJB 1QY6A 2J38A 3DD2H 4DW2U 6CHAC 5F6MA 5JBBS 6CHAB 1WOFA 2EI6A 4RT1A 5B6LA 2BB4A 1GJAB 1BTHH 1CGIE 1GHXH 5CHAC 3N7OA 2XBVA 1P8VC 5CHAB 5PTPA 5FPTA 3SJ8A 3LJJA 1Q2WA 2STBE 4E7RG 3RDZA 3RXSA 1UTMA 2IJOB 4NSVA 1O3EA 3NWUA 3RC4A 2KAIA 1GJ6A 3PO1C 2XNIA 1NBME 1Y3YA 1C2FA 1ELTA 2GCTB 2JH0D 1D3PB 2A45B 4NIWA 1IAUA 1SGTA 3HGPA 1GMCF 1TGTA 2QIQA 3JZ2B 1INCA 5FHTA 3UUZA 1A61H 2F9NA 4IN1A 1NU7B 2WUBA 4Y8XA 2ZU1A 5EQSA 2QA9E 4YZUA 1AQ7A 1BTYA 4ZHMU 7ESTE 2FOGA 3M7UA 1CA8B 1BIOA 2FOHA 3R0FA 1GHBG 1BTPA 4B2CA 4TT3D 1ELFA 4TWYA 2WV9A 3OTJE 3A7WA 2ZFSA 3EGKH 5DG6A 2K1QA 1G3CA 1SVPA 2VH0A 3ZYDA 1QGFA 5L6NH 3S7HB 1LKBA 3TJNA 2RCEA 1O34A 1P03A 4D7GA 1GCTC 4XRNA 1L1NA 1SGCA 2GT8A 1F2SE 3PRDA 1GCTB 2ZFRH 3RU4T 3TH3H 1ARBA 2G51A 1FY8E 3KGPA 3LGUA 2GDEH 2OTVA 1C5NH 4UONA 1C5LH 5C1XA 4JK6A 5DP8A 3L6PA 4Q7ZA 2QV1A 5JBTA 2ZA5A 2BLVA 3VPKA 2BVSH 2RDLA 5A0CA 4Z6AH 1S6FA 3MU5A 2ZHDA 4BAKB 4KKDA 1GBIA 4F48B 1V2UT 4X2WA 1GDQA 1BTUA 1ESAA 3NPSA 3UREA 4GHTA 1Y3UA 1SG8B 1FIWA 2ANMH 1MMJN 4I7YH 3BTEE 1BBRK 3BEFB 1E37B 2NU2E 4DT7B 1NTPA 2GVFA 2ZU3A 1EXFA 3A84A 1WBGB 2PSYA 2NWNA 2J98A 3RU4D 3OY5U 1K22H 4O3TA 2FM2A 1P2OA 2UWOA 4XSKU 3T62A 1SGEE 3QX5H 3S69A 1BA8B 4R0IA 3QDZB 1UCYH 1D6RA 1GI8B 4UD9H 1C2GA 3GISB 2OC1A 1BMAA 5F53A 1O39A 3MMGA 1C5SA 4MVNA 3SGBE 1V2JT 5GCHG 4GSOA 1C2HA 1O33A 3V12A 5HM9A 1TLDA 5EG4A 1PQAA 1EQ9A 2RFKC 3MH4A 1P2QA 1BQYA 3MU0A 1IQHA 1K1IA 3VB4A 3ZVDA 1V3XA 4X8UH 3VB7A 1D9IA 4FUDA 2PUXB 2QF4A 2BY9X 1DY9A 3AK5A 1A2CH 1BMMH 1ID5H 3M5LA 1KXCA 4WH8A 1MQ5A 1FY4A 1ETTH 4Q80A 3ZVBA 2KR7A 1GHAG 1TOCB 2PGQB 2ZGBH 2R0LA 2D8WA 1M9UA 1QR3E 2ZFPH 4WMDA 3GY3A 2OP9A 2EY4C 1C1OA 4TPYA 1YPKH 1UVSH 1B5GH 1PJPA 3ATMA 1GVLA 1FLEE 3SJ9A 2G5VA 4B73A 3DA9B 4K2YA 9LPRA 1F92A 2P3FH 2BX4A 1YBWA 2OC0A 4IN2A 1X7AC 1RRKA 1THSH 3UFAA 4NIYA 1UVTH 1Z6JH 1MQ6A 2W3IA 2A2XH 1AU8A 2CJIA 3DUXH 3MQKC 1TRMA 5IDKA 3LC5A 3SNBA 1OWHA 4NCYA 5E2OA 3M61U 3EQ0H 1L2EA 3SUEA 1KY9A 2XBWA 2VVUA 3RXTA 1FNIA 1O3JA 2UUFB 4Q4LA 2VIPA 1HIAA 3FZZA 3KCGH 5BPEA 3PMJA 5C94A 2Y82A 4FUEA 3FAOA 4GUXA 5FX6A 2J9NA 1QIXB 2PFEA 3IWMA 1TQ7B 1ZJDA 1IQIA 2QF3A 2VH6A 2PTCE 3VXFH 3W95A 4K60A 4ABJA 1FN8A 5EXNA 1SGFA 2BM2A 3LH3A 1MD8A 2YNAA 3BTFE 3SO3A 1TRYA 3ZZ3A 1S84A 1ACBE 2G55A 1HIAB 3MNBA 1GBFA 4FOUC 3SV6A 1NRNH 5GWZA 4RT0A 3EDXB 1H8IH 2FMJA 1ZRBA 1CBWC 1LVYA 2OBQA 1CBWB 2LP6A 2ZCHP 5FPYA 4Z1MD 5A8XA 1GHWH 3GDUA 4ISIH 4XDEA 1XMNB 2RA0A 3EA7A 1N8OC 1QZ8A 6GCHF 1N8OB 2B0FA 2CK3D 1S6LA 1SR5C 3UIRA 1FONA 5EPYA 1HBTH 1GJCB 1V2PT 1VZQH 1ZGVA 2A5KA 1ANDA 3NZIA 1EP5A 4AG2A 5I46H 1TMTH 4B76A 3RXVA 3PTBA 3ENSB 1XVOA 3N7DA 3OTPA 1H8ED 1PQ7A 1Y5UT 1SGFG 1AVWA 4DG4A 2FOCA 3ZVAA 4AZ2B 4K1TA 3KQ5A 3BTWE 1BTWA 2F43B 1YLNA 1O35A 2V3HH 3OEHD 1O2OA 1DX5M 1OOKB 4ABEA 2QF0A 4NWKA 3RMOH 2Z9LA 4I8JA 4TSFD 4NWLA 3K9XB 1YPMH 2ANKH 2BY5X 1QB1A 2WPJS 3P92A 1AIXH 3VG8A 3ESTA 5EW1H 1LQDB 2GV7A 1Z1IA 5ESTE 5EOKA 2ZCKP 1A3BH 1DSTA 4I8HA 1GI3A 3E1XB 1C4V2 1RGQA 2A2QH 1TNLA 1A0LA 2ZO3H 3MTYA 1C1PA 1O2MA 1D6WA 1E0FD 1JIMA 1PYTD 3RXDA 5GNDA 5TJXA 2VNTA 1RS0A 1LVMA 1NRPH 5EQQA 2W6ID 3MO6A 1UK3A 4ISLA 3BSQA 4WXIA 3PTNA 1ELBA 2Z9KA 5EPNA 3VEQB 1D4PB 3F0PA 1DXWA 1A7SA 1C5XB 4NFEA 4YOGA 1HV7A 3RXLA 5L2ZH 3BTTE 4BNRA 1GBAA 3CS7A 3LC3A 1MCTA 2PR3A 1JOUB 5DO4H 3M5OA 2R3UA 1J16A 1YPJH 2ZGJA 4CRGA 1C2EA 3OYPA 3KQEA 3U8TH 2FO9A 2PSXA 4ABIA 1WTHD 1C5ZB 5C0UA 1GI4A 2A1DB 1QA0A 4X6PA 5JBAS 1QL8A 3DSGA 5EJLA 1QTFA 4GCHF 4INKA 1EPTC 1UO6A 1EPTB 1T8NA 1TGNA 3KEEA 4X2YA 1XUJA 1GCDA 1UK4A 2M2AA 4CHAC 1Z8IB 4CHAB 1RTLA 4UFEH 3Q3XA 4ZHAA 4LZ4B 1A0JA 1C1UH 1AGJA 1GMHG 1Z71A 2HLCA 4NA8A 4WY3A 1AB9C 4FETA 5KGOA 3VGCC 1AB9B 2FP7B 4SGBE 3VGCB 1E36B 2ZG0H 1CHGA 2FEQH 4WXVA 5GDSH 3H7OA 1ZMLA 2PLXA 2ZU4A 2LNCA 1RIWC 1GMDG 4AX9H 1RIWB 1DICA 1HAOH 2GDDA 4FUGA 8GCHG 4WJG2 3P6ZB 3RXOA 1RD3B 1GI7B 4HG6A 1CU1A 4IC5A 4D9RA 1MTNC 2H9TH 1Y5AT 1MTNB 3ODDA 1H1BA 5EGMA 1PPBH 3A80A 2ZDLA 1UTJA 1TGSZ 2YMSC 2ZHEH 4P02A 4UFDH 3HKJB 2YMSB 5GXPA 3M3VA 1QRZA 2Y5FA 3RXCA 1TNKA 2L6OA 1HXEH 3LGWA 4MDSA 3UPEA 4ASHA 2TPIZ 3A8DA 1P02A 1SI5H 1VCWA 2XWAA 4D8NA 2NU3E 3F9GA 4X6MA 2VVVA 2ZEBA 3I29A 2K0QA 4U30A 3Q77A 1H4WA 1KMHB 4BTIB 1HAXB 1OWIA 2FYQA 5AHGH 4AORA 1O2RA 1G3BA 1O2VA 4X0WU 3M37A 5HXFA 1NROH 1K2I1 1S82A 5ETXA 4Y0ZE 1OPHB 2J94A 2HWLB 3A8CA 3F68H 1K1JA 3F0OA 1G3DA 2G00A 3QGJA 1GHYH 2J34A 4JYVH 4OS4A 3OFND 1F0TA 2P16A 3GCTF 1WUNH 4LOYH 5C20A 1O3AA 1O5EH 2WINI 2OQUA 2WV5A 1MAXA 1MTWA 1DSUA 1H8DH 1TIOA 1GDUA 1FPCH 3ATLA 1DXPA 4WVPE 2WZQA 1QRWA
chains in the Genus database with same CATH topology
4Y76A 4AGKA 4YO9A 2BZ6H 3SN8A 2VIQA 4AYYB 3PM3A 3PWCA 5A2MH 1EX3A 2PWXA 1K28D 4ISNA 2QCYA 2JH6D 5AFYH 2V0BA 5E0HA 1ESBA 2F9UA 5DP7A 4CRDA 6ESTA 1AZ8A 3LH1A 3Q3YA 4NGAH 1TPPA 5GPIB 3PB1E 3HGNA 1ZSKA 4AGJA 1WYKA 1Z6EA 1QRXA 1CE5A 1O2YA 3GCHC 1DY8A 1O3PB 3GCHB 3ITIA 4Z0KA 4FU8A 4A5TS 1VITH 2UUYA 6LPRA 2TBSA 2HRVA 3M7TA 4IBLH 1NT1A 1XVMA 2ESTE 2SFAA 1SBWA 3U69H 2XCFA 2ZECA 2HPPH 4MPUA 5TCAA 1C1SA 3TNSA 3FP7E 1S0RA 1MCVA 1DVAH 3AVZA 4E05H 3MNXA 1NPMA 2RG3A 2J4IA 1JMOH 2QAAA 2FODA 3TK9A 2O8MA 1YPLH 4B2AA 1QNJA 2OUAA 1YLCA 4SGAE 1GHBF 1YPGH 2C90B 4CR5A 5TCCA 3KNXA 4XE4A 1C5PA 1ZYOA 1LHCH 2DE8A 4A1TA 2AMQA 2D26C 1NRRH 2ZHQH 1O2SA 1O3IA 1C1WH 1O2GH 1TABE 3CENA 3RMLH 2HGTH 1MBQA 1GHZA 1J8AA 5DP9A 2YOLA 2BY7X 3UR6A 2ZDAH 1QQ4A 2FESH 3MH5A 1EUFA 3MNCA 1XKBC 3LOXA 3MWIU 2XBYA 2RA3A 1KDQB 3QGNB 1ZJKA 1NY22 2P93A 1KLTA 3F9HA 5DP6A 2OQ5A 2ZGXH 2PUQH 2ZF0H 3LU9B 1Z8RA 5LPEA 2B7DH 1QBVH 3DT0H 2XC4A 2FTLE 1DM4B 1W7XH 3RXRA 3VFEA 1JRTA 5AFZH 2G81E 1PPHE 1Z8GA 1HAYB 1HDTH 4DY7B 1O3KA 3RXGA 4D9QA 4X8TH 3SU2A 4X1QU 2FOBA 2GCTC 1ZSLA 3A87A 3RC5A 2A32A 1WSSH 2TGDA 1Z1JA 2AEIH 3I77A 3V3MA 3SUDA 4DJZB 1NFXA 5A0AE 4XBBA 3F6UH 5DJ7A 3STJA 4ZMAH 2ZU5A 1LPGB 3P8FA 1P9SA 2W5EA 3S7KB 1NS3A 1C9PA 1P2JA 4ISHH 3MHWU 5GCHF 4I8LA 2CV3A 2OC8A 1GL1A 2FI3E 3H5CB 1XUIA 1C5RA 3LKWA 1O3HA 1G2MA 2F9BH 2AS9A 1P06A 2OCVB 1TGCA 2EEKA 4DVAU 1JBUH 1P01A 2GV6A 3DFJA 1P12E 2A4OA 5T3HA 5ESBA 1UCYK 3GY8A 4JYTA 2SGFE 2VIVA 1ZOMA 2BD5A 2BVRH 1FAXA 2GCHG 4INHA 4AB9A 1TPSA 3A7XA 4O03A 1ARCA 2BZAA 4A7IB 2FPZA 3KHVA 4MG3A 4H6SB 2WPIS 1Y3VA 1LMWB 2IOTA 4YESB 4ABGA 4Y7BA 4IW4E 1BHXF 4TY7A 5LH8A 1A4WH 1NFUA 2BY6X 3BEIB 4B1TA 2ODPA 2XYAA 1XUKA 4KELA 1Z7KA 2ASUB 1DOJA 4MNYA 1THRH 2C8ZB 4Y10E 3NKKA 3SQHE 4I32A 1BCUH 2OC7A 1SGQE 4Y0YE 1FQ3A 1W12U 2ZGCA 3RXUA 5DP3A 4XOJA 2QN5T 1SHHB 3T28A 3RUOA 1GPZA 4ZKRU 1O5GH 4X8SH 2TGAA 3FZDA 1EZXC 3P70B 1GVKB 2BD3A 3SU0A 3PMBB 1A3EH 1GDNA 2CXVA 1C4Y2 3TGKE 1O2ZA 1V2KT 1G32B 1GMCG 3QZQA 2ZGHA 1Q3XA 2O9QA 1WQSA 4YM9A 4UEHH 5SGAE 1BUIA 3FP8E 1XXFA 3O8BA 1EP6A 1XM1A 4RSPA 1P04A 4ZKSU 2ZU2A 1DITH 4H6TA 3LGVA 1TFXA 2Y7ZA 1EAWA 1GI6A 3QLPH 1RJXB 1J17T 1FY3A 3T25A 2P94A 1GGDC 1IHSH 1L1JA 1GGDB 1BTZA 3QTVH 4ABDA 2I6QA 1Y3XA 1O38A 2ODQA 2PKSC 3GY5A 2PKSB 1T8OA 1IOEA 2P3TB 2Y81A 1TAWA 1V2RT 1SB1H 1ELCA 2Z94A 3UTUH 5FBIA 3MFJA 2QXHA 2ZFTA 1EAXA 2ZDMA 2THFB 1T8LA 1RFNA 3KN2A 1TMUH 5J4QA 2BDAA 4HFPB 5H4IB 3C27B 3TNTA 1CT0E 3MOCA 1QL9A 1UVOA 2ZNKH 1QL7A 2ZTZA 2H9EH 3ATWA 1DLEA 3BEUA 1HAPH 1V2QT 2GP9B 1TPOA 1GJ9B 2Y5GA 3ZZCA 4GAWA 1SLUB 3E3TA 4X6OA 3C1KA 4TYDA 3PLKA 3B9FH 2H5CA 4AYVB 3RMNH 2VIDA 2A5IA 1O3NA 2R9PA 4OS2A 3GY4A 4DGJA 1WTGH 1VGCC 3SU5A 1VGCB 1W14U 2SGEE 2BLWA 2BOKA 1K1PA 2ULLA 1HNEE 4Y79A 3BG8A 1TB6H 1BOQA 2CF8H 2W26A 2IPHA 4KTUA 1GJ4H 1W0ZU 4JCNA 5DPAA 5T6DA 1TRNA 3LPRA 3A7VA 1ANBA 2CF9H 1SSXA 1C5QA 3IG6B 3SU1A 4Y71A 2O8TA 1VITG 1GBKA 3M5NA 2AYWA 3SJIA 1K21H 4JK5A 1MBMA 2Q6FA 2HNTF 5A0BA 2ALVA 1KXBA 2ZWLH 1ZMJA 2FZZA 3PMAB 4JMYA 1T8MA 4CREA 4Y7AA 1LHFH 2BDYA 1A5GH 2FDAA 2FOFA 3GYMA 4ZKNU 5LPRA 1FUJA 4XBCA 1ZR0A 5FPSA 4INLA 1B0EA 3T2NA 1L1GA 2V3OH 2VU8E 3ODFA 2FLRH 2PV9B 2I6SA 1GJ7B 3P95A 3TH4H 3M7QA 2ZKSA 3LT3A 1H9LB 1N6YA 1DWBH 1TX6A 1T4UH 2A5AA 3BTGE 4MQAA 1MZAA 1E34B 1C2DA 2FIRH 3TVJB 3RXHA 1SHYA 2C8XB 1SFQB 8LPRA 1CT4E 3ZYEA 3RXQA 1LO6A 4U32A 2F91A 3UY9A 5C2ZA 4Y8ZA 1HFDA 3SNDA 4X1RU 1O5DH 2W7UA 1FIZA 1YCPM 1FV9A 1BTXA 1LVBA 1G36A 4X6NA 2YNBA 4X2VA 1JWTA 3Q76A 1C5TA 2ZQ1A 3U8RH 1Q31A 2FWWA 2ZCLP 3K65B 2Z3EA 1EB1H 4FUJA 1TX7A 1HRTH 2GTBA 2XW9A 3AAUA 1G30B 2ZFFH 4ZUHA 1UVUH 3TK5A 1MD7A 4JYUH 3SZNA 2H2ZA 1O3CA 1O3MA 1QBOA 1SMFE 1YCPH 3U1JB 1WV7H 1V2WT 2ZFQH 2A7JA 5L2YH 3ZV9A 3SNCA 3A82A 1GL0E 1ZGIA 4FU7A 1EPTA 1GI0A 2ZDNA 3UQOA 3G01A 1TYNA 1G9IE 5F03A 1OX1A 3F9FA 1P3EA 5DKMA 1LCYA 5DP4A 2BXUH 2BQWB 5K7RA 1SOTA 1QFKH 2ODYB 3BN9A 3SQEE 1P2KA 1O32A 1YC0A 1UTQA 2Q6DA 1C1NA 4CH8B 1GWAA 4OS1A 1CGHA 1W7GH 2C4FH 2VGCC 4M7GA 6GCHG 2VGCB 2ZPQA 2VWNA 3ZZAA 1HJ9A 2W3KA 4WMFA 1T32A 4VGCB 1TNGA 4NSYA 4A1XA 1HAHH 3SV8A 1PPFE 3RM0H 1MUEB 2P3UB 2BD7A 3TJVA 4NA9H 1HLTH 3BG4B 5L30H 1V2LT 2BD8A 1HJ8A 5LPFA 4NIVA 4BXSA 3VB5A 2XC0A 1Y59T 4K1EA 5HYOA 2Y5HA 2ZQ2A 1VJ9U 1W2KH 7GCHF 2ZZUH 3RXAA 1EAUA 2B5TB 4ABAA 2H6MA 2QXGA 4DIHH 3ZVEA 3E0NB 3M36A 1O3FA 3SUGA 4HGCA 4YLQH 2VIOA 1Z8JB 1O5FH 5T6GA 4ABFA 3L3TA 2A7CA 3A81A 4FXGH 4K5ZA 1JRSA 2SGQE 3SGQE 3LGYA 1TNIA 3URDA 1OWDA 5E0JA 3SUFA 1KXFA 5DK1A 5JB8S 1SLWB 1IQNA 2C8YB 3QN7A 4ZXXH 2EC9H 2Q1JA 4BTUB 2R3YA 4AFUA 3T26A 2ALPA 4A1VA 3E8LA 2J95A 2BLOA 3A83A 2SGAA 4X1NU 2AMDA 1KTTB 1F0RA 4Q7YA 5T6FA 4ESTE 1BMLA 4O3UA 1ANCA 1UHBB 4O97A 2EI8A 1UTPA 4ZH8A 2ZI2H 4J2YB 1CVWH 3KQDA 4THNH 1LHEH 2Z9GA 1AKSA 1BB0B 2QXJA 1QJ1B 2G8TA 4E06H 2AGEX 3SOSA 2WYGA 3FFGA 3SI4H 1MTUA 3BTDE 4OS6A 4YT7H 1AWHB 4DURA 1EZSC 3PYHA 4MNXA 4F4OC 1IQGA 1HGTH 2WPLS 1HXFH 1V2NT 1AFEH 3PV4A 1AKSB 1QB6A 1KXAA 7LPRA 4IC6A 1O2TA 3A8BA 3P8NA 2XTTB 4MPVA 4DOQA 1CHOG 3RXIA 3U8OH 1YP9A 1BRCE 4D7FA 2PKAB 4GCHG 1RTFB 1DDJA 1UTKA 1PPEE 5F8XA 1W3CA 3SU3A 1AO5A 3ZZ9A 1O2LA 1SGIB 3AW1A 2TGTA 3GCOA 8KME2 4JZIA 1TALA 2O8UA 4ABBA 3RXEA 1LPKB 3LGTA 4NZLA 1OS8A 2ANWA 1YKTA 3GDVA 1V2TT 3SGAE 1O2HA 1BBRE 3VB3A 1YPHC 2LPRA 1CT2E 3T5FH 1QCPA 1GI1A 1P3CA 3TK6A 2R2WU 2BHGA 1SLVB 1YGCH 3PLPA 1SGDE 3UNRA 3BTKE 1ORFA 2BTCE 1AVGH 1YF4A 1ZHMA 1IQEA 2QC2A 2UUKB 3TGJE 1YLDA 2Z7FE 1C2IA 1UVPA 4FUIA 3SI3H 2BD9A 5JDUB 1KYNA 3FP6E 1LVOA 3L33A 1BRBE 1FXYA 1YPHE 2ZTXA 3KF2A 2BDGA 2AIPA 3ZV8A 2JKHA 3SJOA 3QO6A 1K1OA 1NN6A 1H9IE 1AI8H 3T27A 1QA7A 2A31A 1HAVB 3BIUH 3PLBA 1T31A 4FVDA 1SQTA 2OXSA 3K2UA 1ZZZA 3ZZ8A 2ZTYA 1TBQH 2EI7A 2TIOA 3V7TA 3EYDA 5I25A 4JZEH 1AE5A 3E90B 3SW2B 4AFQA 4UE7H 1UTNA 1GVZA 1P10A 1F5LA 2FLBH 3ZVGA 4H4FA 1SFIA 1S85A 1KDQA 2J92A 3MNSA 1WAYB 5DP5A 2VINA 1N1LA 1F7ZA 1GI2A 1DWCH 3HKIB 1O2NA 4OGYA 1MKXH 2FOMB 3SHAH 2AIQA 4OS7A 4X1SU 3UQVA 2GZ8A 2Y80A 3GCTG 4JZ1A 1AWFH 2A4QA 3M3SA 3M3TA 1AY6H 2BLQA 8ESTE 5HGGA 5IYTA 4FUCA 3TJUA 4IGDA 3KL6A 1TBZH 2PTNA 1TNHA 2XC5A 1MKWH 1UTOA 1ZRKA 2F9VA 1ABIH 3PMHB 1PQ5A 2OINA 1FY1A 3RLWH 4FUBA 2FI4E 5EXLA 1FI8A 1O2KA 1CA0C 3EE0B 1CA0B 3UOUA 1GJDB 1TA2A 3U9AH 1FPHH 1J9CH 3MU1A 2AERH 5JBCS 1K1MA 2R0KA 3D62A 2FI5E 1GHVH 2BOHB 1AZZA 1DLKB 1GBCA 4TY6A 2QXIA 4OGXA 4CRAA 1DT2A 1QB9A 1AVXA 3TGIE 3TJOA 4BAMB 2QGRA 2B8OH 1GBTA 1QQUA 2AH4X 1E35B 1Y5BT 1QJ6B 4CBOA 1IQFA 2ZDKA 1IQJA 9ESTA 3PO1B 1W8BH 1RTKA 1EOLA 2SGPE 4H42U 2ZDVH 3GY6A 3P17H 5E2PA 3E6PH 1FZZA 3QK1A 3ZVCA 1S83A 2TGPZ 1C1RA 1YM0A 1BJVA 1GG6C 1LTOA 1GG6B 1T7CA 2ZP0H 1LHDH 1KLIH 1AHTH 5EW2H 1NESE 3RC6A 2Z3DA 1O3OA 3HATH 2P8OC 1TX8A 2KAIB 2P8OB 4OS5A 1ELVA 3GY7A 1GHAF 5FXLA 4ZROA 1GJBB 1TE0A 2NU0E 3EA8A 3IITA 1QHRB 1EOJA 1DS2E 1O2UA 1ZPZA 1W0YH 3D23A 1IQMA 2J2UA 3GOVB 4QT8C 1ZTJA 1CQQA 2Y6TA 1CO7E 1TMBH 4JZFH 1A46H 1THPB 1D3DB 5C1UA 2WPMS 5FCKA 1S6HA 1BMNH 3U98H 3ATIA 3FVFB 1Y3WA 1ETRH 1VJAU 2ZIQH 2JH5D 2WPKS 3RU4E 1DWEH 3A86A 3BV9B 4X1PU 3OU0A 1KSNA 3MU4A 1VCPA 3H7TA 3KQCA 4LK4A 1O0DH 3WY8A 4CBNA 5JYIA 1E38B 3TITA 1ZLRA 1DPOA 3GY2A 1QJ7B 3UNSA 2C93B 3O8CA 4NFFA 2BYAX 2PW8H 3QTOH 2F3CE 2NU4E 4KGAA 2A0QB 4MTBA 3ATKA 3B23B 4MPXA 1J15A 2HPQH 1P2MA 3LIWA 2GGVB 4BANB 3SORA 3ELAH 2WPHS 1GBBA 3OY6U 4AN7A 4X2XA 4AFZA 4BTTB 1EJNA 2G5NA 1MTVA 1W11U 1SGYE 4A6LA 1C1TA 4K8BA 1HUTH 2XRCA 5BRRE 1NFYA 2BDBA 5C5OA 1HYLA 4E7NA 2BDHA 5F8ZA 4MNWA 3RM2H 4TPIZ 1AMHA 5JPMH 3BTME 1FY5A 2B9LA 2G4TA 2GX4A 1L4DA 4YTAA 3ZZDA 2VWMA 3TH2H 5C67A 1VITF 1SLXB 3STIA 3ZZ7A 1WCZA 2A4GA 3BF6H 2SNWA 5FBEA 1S81A 1K9OE 4MNVA 4UFFH 3BTQE 4JZDH 4K3JA 3MI4A 3S9CA 1BBRH 1CGJE 4DCDA 3SV7A 1O5CB 1BHXB 4FU9A 2H1UA 5K0HA 1OXGA 1C1MA 4WMEA 2EA3A 1K1NA 2VVCA 3PROA 1DE7H 5GJ4B 2BD4A 4GVUA 1C5WB 3HK3B 1NU9A 1EB2A 4Y6DA 3RXKA 1EJAA 2XBXA 4KTCA 1TQ0B 1P0SH 2GZ7A 5DGJA 3UR9A 3UNQA 1AUJA 2GT7A 1LPZB 3V0XA 1BITA 1OP2A 3B8JA 1P05A 2VJ1A 4ZXYH 1TONA 3TLOA 1S0QA 4J1YA 2D2DA