1GVKB

Porcine pancreatic elastase acyl enzyme at 0.95 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure of a Serine Protease Acyl-Enzyme Complex at 0.95-A Resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PEPTIDE INHIBITOR
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gvkB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gvkB01
2HRVA 3QX5H 1A4WH 3HATH 2GX4A 4AOQA 1MMJN 2EI7A 1TQ7B 3SUDA 3ZV9A 5T6FA 3TJNA 4DJZB 1GG6C 1BHXF 5ESBA 5A0AE 1JIMA 1ACBE 1HAVA 2B5TB 1FMGA 1KLTA 1KY9A 1SMFE 1W3CA 1O2TA 3URCA 5DP7A 2ZU2A 4KTUA 2R9PA 1G9IE 1TPSA 2BLWA 4J2YB 1WU1A 1QL7A 3UQOA 5A8YA 4ISHH 1LHDH 2OCVB 4DVAU 3RXRA 1QTFA 2VIOA 4FVBA 4R8TB 1S6FA 1HJ9A 1GDQA 2DUCA 1FAXA 2IN2A 3SJOA 3SUFA 1VCPA 1S85A 2CJIA 4XBDA 2PWXA 7KMEH 1JIRA 1GJ6A 1QBOA 4DOQA 5EU8A 2BY5X 3QN7A 3DFJA 3DA9B 3LH1A 3BTFE 1EASA 3QZRA 1A3BH 3U9AH 3BTDE 4H6TA 4BOHA 4NCYA 2QYIA 1SLWB 1UK4A 1ZTLA 3ZZDA 2CHAB 3MU4A 2LNCA 3DFLA 2Y6TA 4WXIA 4Y10E 3RXOA 3EA8A 1CA0C 4MPUA 2BD5A 1O36A 1AVGH 1VCWA 2VH6A 1FUJA 3NZIA 3LGWA 1P0SH 2TPIZ 4CH8B 2FZZA 1GVKB 3KQDA 1EJNA 2C90B 1Y5BT 1ZPBA 2FTLE 1FPCH 1QQUA 3H5CB 1VCQA 2BY6X 4AGKA 3EDXB 2ZGCA 1ZTKA 2PGBB 3M7TA 1S0RA 4AG2A 1BMMH 1NRNH 3ZZ6A 1OP2A 4VGCB 3ATKA 3LIWA 1TFXA 1KTSB 2BD9A 3UR6A 2WYJA 3RXLA 3KCGH 1ZYOA 1DUEA 1BIOA 1HNEE 1NS3A 5LH8A 1Z71A 3BEIB 1GBMA 4BAQB 2AFQB 3LGIA 1C5MD 4ISIH 1O3HA 4ABFA 2W3KA 3STIA 1YCPH 1S5SA 3JZ2B 1GBIA 5B6OA 1UTLM 1Z1JA 1BDAA 1AQ7A 4U30A 4BXWA 1RD3B 1EAWA 2BTCE 7ESTE 1GHWH 2XC4A 4BANB 1BTXA 1OKXA 2BDGA 2WYGA 1YPEH 1LQEA 1ELFA 6GCHG 1TPPA 1UTJA 5I25A 2ANWA 2Z9IA 2FOBA 3F9FA 1KLJH 4YT7H 1LHGH 3HPTB 2ZO3H 3SV2H 1RTFB 2KAIA 3MYWA 1TGCA 1AKSB 4AFZA 1XX9A 1EXFA 2CMYA 1BRUP 2BHGA 1ZJKA 2OC1A 1L0ZA 2A7CA 3EA9A 2R3YA 1D6RA 1U6QA 1W0YH 1X7AC 1GCDA 4X2WA 3TVJB 1TRYA 1J17T 3B9FH 2G5VA 1CO7E 3T5FH 2SGEE 1V2MT 2O8WA 1PPGE 2UUKB 4Q7YA 5DP8A 3PMBB 1CHOF 2QV1A 2XWAA 1YPLH 3MU8A 1GJCB 1HIAB 1TGSZ 1UHBA 2A5AA 2I6SA 1O3MA 2A5KA 3SHCH 1C4Y2 3I78A 4JZEH 1MD8A 3ZVBA 1GPZA 3SNCA 3PM3A 5C20A 1CSOE 1QA7A 1GWAA 1C1SA 2OC7A 4VGCC 4KKDA 2NU4E 1MKWK 3S69A 3AASA 3CS0A 1GCTC 3TK6A 3SV8A 3RXHA 1JOUB 5HGGA 2J94A 1W8BH 1GBCA 4TPYA 3MNBA 3PMJA 1P9SA 5EPNA 2BDAA 4GSOA 3RXBA 2W5EA 1UTOA 1KDQA 5FBEA 2ZDNA 4GPGA 2Z9LA 4JZ1A 1GHAG 2FXRA 3ZYEA 3T28A 2O8UA 1EZXC 1KXAA 2PSYA 5EQRA 4CREA 3VGCB 1AVWA 1FN8A 1AZZA 1GG6B 2GV6A 3BEFB 1ANDA 5FXLA 5HYOA 3P17H 3SNAA 1A5HA 2WV5A 3QWCH 2O9QA 1O3GA 4BAKB 5GDSH 1SB1H 2G55A 1IHSH 3FANA 5TCAA 2SFAA 1MD7A 2GKVE 3LGYA 3M35A 1SVPA 4UDWH 4A1VA 1O30A 1SGPE 1NRRH 1XMNB 1BRCE 4BTTB 1MUEB 1C2JA 3AAVA 3S9AA 1YLCA 2JH0D 4XFQA 2BDCA 2TBSA 2ZHQH 5FHTA 1ZJDA 2UWLA 5BPEA 3EYDA 5DJ7A 4ZXYH 4YOJA 2SGFE 3SZNA 1ANBA 2ZZUH 4Y8ZA 1WOFA 3U98H 3V0XA 1HUTH 2BY8X 4ZUHA 5E2OA 1XVOA 1GMDF 2ZFPH 3RC6A 1E37B 2ZPSA 2FODA 1ETRH 1M9UA 4DW2U 4ABDA 2TGTA 1IQHA 5C5NA 4ISNA 1RS0A 1G32B 1EKBB 1A5GH 1QL8A 1ESBA 1K28D 3PWBA 4KELA 3GCTF 4CRBA 2D2DA 2BY7X 2A4RA 3I29A 1BRBE 1SGRE 2AEIH 4O3UA 3PTNA 4YTAA 3RXTA 1P2KA 1ZHMA 4DURA 2H9EH 3GY8A 1TPOA 3OYPA 4HI3A 3UNRA 1Z8GA 3RXPA 5GXPA 3BTEE 5E2PA 3TNSA 4AN7A 3O8BA 1TX6A 1TOCB 5DKMA 1UTKA 1LKAA 2ZF0H 4JK6A 1CU1A 3MU5A 4NIYA 5I46H 2FEQH 2HALA 2Y5HA 4HZHA 1MU6B 2Z94A 2HVXA 4JZIA 4YOIA 1HV7A 1CT0E 5AF9H 3GCTG 3RU4D 2FOGA 3RXDA 3UFAA 3A80A 5T6GA 5DG6A 2CF8H 5DP3A 3TIUA 1GI0A 4B73A 5EG4A 3ZZ4A 1PFXC 3ZZ3A 3M3VA 1CT2E 4ZKNU 4CHAB 1VJAU 4AFSA 2ZP0H 3ATLA 4JYUH 1LVMA 3A7VA 1O3BA 1OOKB 1AD8H 1E38B 3SGQE 4B2AA 2FI3E 3MHWU 2H2ZA 2Z3DA 1NY22 1PJPA 1Y3VA 4E7NA 2G00A 2HNTC 3SGBE 4WY3A 2P3TB 1SGCA 4U2WA 2BLQA 3MO9A 3ZZ7A 3RXFA 3ELAH 2GZ8A 2VWOA 1FNIA 3O8DA 1PQAA 4RSPA 5K7RA 4IN1A 1FY3A 2BOKA 2XYAA 1DICA 4GCHG 4NIWA 1YM0A 3SW2B 4X1SU 1G3BA 1V2KT 2PW8H 3M5MA 3SV6A 1ZGVA 1ELTA 2WUCA 3SUGA 1IQKA 4ASHA 3P70B 1WQVH 3NK8A 4NG9H 4B76A 1P2NA 1IQFA 3DD2H 2VIWA 1OXGA 1GJ8B 1BBRH 2F9NA 1THPB 1KLIH 3GY6A 2O8MA 4BNRA 1FIWA 3AW0A 2F3CE 3HK3B 2GVFA 4FVDA 3ZVEA 1C2KA 1IQGA 4X0WU 1H8DH 4IC5A 2HNTE 3K9XB 2AIQA 2FPZA 1S82A 1IQMA 5DP5A 2A31A 2Y82A 4TY6A 3NKKA 3UOUA 1GBFA 3SO3A 1HAPH 1IQEA 1C5VA 1P2IA 4ZKOU 3L33A 4OGYA 3Q3YA 3SORA 3STJA 1NRSH 2JKHA 3LKWA 3P8GA 3U8TH 3TK9A 3UIRA 5T6DA 2ZDMA 2H9TH 1E35B 1P06A 5EGMA 2ODQA 1MCTA 1CE5A 4TYDA 5TJXA 2P3FH 1DE7H 3LC5A 3QO6A 4TPIZ 4E7RG 3U69H 2QXGA 3TH4H 1NPMA 1HAVB 1C1WH 1OX1A 4MPVA 1KIGH 1SGEE 3I77A 1BT7A 1RGQA 1WSSH 2UUYA 3BIUH 1GMHG 1V2OT 3T29A 1O32A 1TOMH 1T4VH 5DGJA 2H6MA 3RM0H 1QGFA 4AYVB 1EATA 1A61H 1P2QA 2WINI 4YLQH 3UQVA 2QC2A 5GIBA 1CGHA 3PO1C 1TA6A 4K3JA 1CA8B 3HGPA 1GHZA 4B74A 4B2CA 1OWHA 1F0UA 2FX4A 1UK3A 5JB8S 3S9BA 2DE9A 2AMPA 4Y8YA 1ZRBA 1MZDA 1P3EA 4Y6DA 1GJAB 1O5CB 2CHAC 1EJMA 2B0FA 3RXEA 1P09A 2P8OB 1RJXB 2CF9H 1YC0A 1C2LA 1HIAA 1UHBB 1HJAC 3A88A 1TE0A 1G36A 4X1PU 3LC3A 4GVUA 4Y0YE 4LZ1H 1C5RA 5DPAA 4LXBH 4UEHH 1Z6EA 4I8JA 2STBE 1ZSLA 8GCHF 1QHRB 1ZMNA 6ESTA 1Y59T 1ZHPA 4WH8A 4I31A 2FLBH 3LDXH 2IJOB 3SNBA 3HGNA 2ZU4A 1HAHH 1BJVA 2Q6FA 3UR9A 1G30B 1BB0B 3KN2A 1D3DB 4DIHH 2ZHFH 3BIVH 2Y5GA 1FY1A 1HAXB 1P3CA 3LH3A 2BX3A 3ATIA 3GCHB 3IITA 1A7SA 1ANCA 1IQLA 1QBNA 1A5IA 1QNJA 4HFPB 5EQSA 4BAMB 1A2CH 3U1JB 1DT2A 1OWDA 3C1KA 1DWEH 5HMAA 1YP9A 1QQ4A 2OBQA 4XSKU 2ZNKH 3RLYH 3NWUA 1YPGH 3NXPA 3A7XA 1FY4A 5C3NA 3C27B 4NIVA 3T62A 1P03A 4K8YA 2BVRH 2XNIA 1F2SE 3NUMA 1ZMLA 1HJ8A 4O9VA 1GI5A 3OTJE 1ESTA 1TQ0B 2A7JA 3V13A 1TB6H 2NU3E 3NPSA 5CHAC 1MKXH 3RMNH 5C1UA 2VNTA 2GCTC 2NU0E 1ZSJA 4I8KA 1NFYA 1A46H 1YPJH 2QCYA 1NZQH 1W12U 4WWYA 3A8CA 3TU7H 2BDHA 2ZTYA 1O2RA 3PV4A 4X6PA 3BTKE 1MZAA 4F49A 2ESTE 1O2IA 1MCVA 2VVUA 1SFIA 1ELGA 3W94A 1GBKA 3MWIU 2ULLA 5JBBS 3UWJH 1OYQA 4OS6A 4PROA 4AFUA 4XE4A 3VEQB 3ODDA 3A83A 1HRTH 3RXGA 1BMAA 1QFKH 1AIXH 3LOXA 2Q6GA 2XCFA 5IDKA 1UCYE 1KXFA 1D3TB 1O0DH 1WBGB 5L2YH 3ZVAA 2V6NA 1ELCA 3V12A 4K5ZA 1LHCH 1WYKA 5EPYA 1DDJA 1TGTA 1OS8A 3ZVFA 1RIWC 4ABAA 3MMGA 1H4WA 3S7KB 2ZGJA 1GHXH 2QN5T 4SGAE 1P57B 1T8OA 1ZGIA 1MAXA 1P11E 7GCHF 2C8WB 4JZDH 3E0PB 3QLPH 3AW1A 1F7ZA 1N1LA 1MTNB 2G4UA 1T32A 2J2UA 1KSNA 3BSQA 4FXGH 1ZRKA 3H7OA 2FESH 1CQQA 1ZPZA 5JDUB 2ZFTA 1AVXA 1O3AA 3MO6A 4AZ2B 1O2XA 4BTIB 1BTYA 2GT7A 2QXIA 2RA0A 4WH6A 2IPHA 3IWMA 1HBTH 2A32A 2ZFRH 3E1XB 3SJ8A 1AFQC 1EB1H 1SGYE 1SOZA 2BD7A 1C5UA 2ZIQH 1LVBA 1P2JA 4IS5A 1TPAE 1O3OA 2B8OH 4RKOB 1N8OC 3ATWA 5JYIA 4X1NU 1TIOA 1TABE 1EAUA 1MQ5A 4RN6A 3OSYA 2EI6A 3UNQA 1TNKA 2AMQA 1LPZB 2ODPA 1BCUH 2ALPA 5E0HA 1SSXA 3RU4T 4AGJA 5L6NH 3N7OA 1WAYB 1IQIA 1EP5A 2VVVA 3KHVA 3ZVDA 1BUIA 2P16A 3OU0A 3DHKH 3A89A 3LJJA 4OS5A 1TLDA 4X1RU 2QXHA 4CRFA 1THSH 2OUAA 1GJ9B 7GCHG 5HXFA 1S0QA 4MVNA 4OS4A 1SGQE 4A92A 1TONA 1INCA 3SN8A 1HLTH 2YNBA 3F6UH 3FZDA 4FU7A 1MBQA 4NGAH 4ABJA 1S6HA 1O2OA 4OS1A 2FP7B 2P93A 1QJ6B 4D7GA 3P8OA 1JMOH 1BA8B 1P12E 2H9HA 8ESTE 1V2QT 1SGTA 2J4IA 3RXSA 5LPFA 2ZTXA 4GHQA 2HGTH 1F5RA 1TNJA 1CBWC 2Y80A 2G4TA 3UY9A 2ZCKP 4Y76A 4X6NA 1LVYA 1N6YA 4NSYA 1SQOA 1AU8A 2BB4A 3UPEA 1ABIH 1MKWH 1DVAH 2PUQH 1T4UH 3VB5A 4CR9A 3SU2A 3GY7A 3LGVA 1RRKA 1TBRH 3KQEA 1O2VA 1Y5AT 5JB9S 3ITIA 5BRRE 1GL1A 2GZ9A 3A81A 1HDTH 4X6OA 1AB9C 4ZXXH 1YCPK 2ZGHA 3P8FA 3TJUA 3SV7A 4O97A 5EODA 1BTPA 1OPHB 3QTOH 4IMQA 4WJG2 1GHYH 3SBKA 1EZSC 1UTPA 2VIDA 1L4DA 9LPRA 4I8HA 4ZHLU 3AVZA 1SGIB 5C67A 4BAOB 1GBTA 1GDUA 4NFEA 4X2XA 1PPCE 4UFEH 1GI9B 1GI3A 3UREA 2ZPQA 1FZZA 4FUJA 2R0KA 1G3CA 3TLOA 1EX3A 2QY0B 1Q2WA 2FLRH 4K69A 3LJOA 4YT6H 4ZH8A 1FQ3A 2D1JA 3F9HA 4O03A 3BG4C 5JBTA 2ZDLA 1G37A 5JBCS 1TALA 1P2MA 1AE5A 1ANEA 2Z9KA 2F91A 3GDSA 4FUCA 2HOBA 2PLXA 3GDVA 4H4FA 1O2NA 4FUIA 4WF8A 2P59A 1C1RA 1EZUC 3Q00A 4K1SA 1CVWH 3PLKA 1BZXE 1AWHB 2GCHG 1VGCB 2VGCC 1O2MA 4MNXA 4AX9H 1GJ4H 1O3DA 1D6WA 2DE8A 2QXJA 1FY5A 3KNXA 1N6XA 1SQAA 2BVSH 1UCYH 4B2BA 1Q3XA 2WPKS 2ZEBA 4JCNA 9ESTA 1AUTC 2BDYA 3U8OH 3M5LA 1QCPA 1GBBA 2PTCE 1O3EA 1E36B 4Q7ZA 5A0BA 3A8BA 6CHAB 3EA7A 1BMNH 1C5PA 1GDNA 4GHTA 2EEKA 1PQ5A 1SPJA 1ABJH 1O39A 3GY5A 1ARBA 1DLKB 2SGAA 2XWBI 1FLEE 1PPEE 4ZHMU 1MTUA 4MPXA 1EPTA 1GJBB 2R2WU 3MH6A 4YO9A 2ZFFH 4DGJA 1EJAA 5F6MA 2GV7A 3MH7A 1RTKA 1NESE 3PROA 3MNSA 4Z6AH 1V3XA 3SJ9A 1SHYA 1G2MA 1ELBA 4X2YA 1V2WT 1MH0A 2CGAA 2FTMA 2NU1E 1O2SA 6LPRA 1ETSH 2D8WA 2Q6DA 3VB6A 2SGDE 2GMTC 2AYWA 3K6ZA 1GBEA 1GI1A 2G51A 2OLGA 1TWXB 3UOPA 3RC4A 5HM9A 2J34A 3KQCA 4ZAEA 4NFFA 8LPRA 3FFGA 3BTTE 3A84A 1O2QA 1F0TA 5FCRA 1NU9A 5FBIA 1IAUA 2O8TA 2B7DH 1JXPA 2W7UA 1G3DA 2HLCA 1BITA 2KAIB 2VGCB 4H42U 2Z3EA 1DSUA 1OP8A 2JETB 1BTHH 1AN1E 2BD3A 2FO9A 3ESTA 1FPHH 2AH4X 4JZFH 4K8BA 1F0SA 4YM9A 3D65E 1C2FA 3B23B 4UONA 1O34A 1TAWA 1GBLA 2BQ6B 2A4QA 2PKAB 2YNAA 1AMHA 1O2YA 3ODFA 4ZMAH 2BDIA 1V2LT 2ZDAH 2C8YB 5F8ZA 2OTVA 4YLUA 5A2MH 4XBCA 1C5SA 3F68H 1TX7A 3TGJE 5SGAE 1O5GH 1W11U 2THFB 4ZROA 5H4IB 3CENA 3A7ZA 5FAHA 2OINA 3L6PA 4WMFA 2RG3A 2ZHWH 3BTWE 5DP6A 4UE7H 3TJOA 3KF2A 1WCZA 1SL3A 1FIZA 8GCHG 1ZR0A 2VWMA 1BRAA 1AB9B 1WQSA 3A7YA 4O3TA 2FOAA 3JZ1B 1Y3UA 3QDZB 2OBOA 3SU3A 2R3UA 1QIXB 1DLEA 1J14A 1GJ5H 4NIXA 2FWWA 1KXCA 3ZZAA 2VIQA 1EZQA 2PSXA 1LHEH 4CBNA 5A8ZA 1HAZB 3SHAH 4GLYA 1LPGB 1C2HA 4Y7BA 1T7CA 3Q77A 1A0HB 4CRGA 1KXBA 1V2TT 2FIRH 3OY5U 4CRAA 1O5BB 1BBRE 3S7HB 4ZHAA 1PYTD 4OS7A 3RXKA 1LCYA 2OP9A 4CH2B 3TNTA 1ELVA 1NFUA 1LPKB 3PLPA 1V2JT 2VWNA 4X8SH 5J4SA 1W14U 4ZKRU 3MFJA 5IYTA 1EPTC 1K1JA 1LQDB 1XUGA 2QA9E 3IG6B 3E3TA 1K1NA 1CHGA 1DXPA 2BMGB 3SU1A 2CN0H 4FUEA 4MNVA 1CGJE 2TIOA 1DX5M 1A1RA 1TMBH 2GGVB 1GI2A 4X8VH 5J4QA 1AFEH 1B7XB 3KL6A 4YESB 3T25A 2FOFA 2K1QA 1WV7H 2BZ6H 2J38A 2QIQA 4IBLH 3F9EA 4K1TA 5FCKA 5DK1A 1O2UA 4AYYB 1ZHRA 3RMOH 1CHOG 6GCHF 1GI6A 5ESTE 1W0ZU 2BXTH 4Y79A 4X8TH 2VH0A 1NU7B 1MAYA 2I6QA 1S81A 4ABBA 1BTUA 2F9PA 5DP4A 3SNDA 3HK6B 1O2WA 2C4FH 3RXMA 3U8RH 4WMDA 2ZU5A 4NWKA 1O35A 3RXJA 1EB2A 1JRTA 3LU9B 1QRZA 4MG3A 3MNXA 2G5NA 1NFWA 2OQ5A 1O3IA 2GP9B 1C1MA 1SGDE 1PQ8A 1TNGA 4FUFA 1ZPCA 2Y81A 3QK1A 4IGDA 1BTZA 1F92A 2JH6D 3GCNA 1A0JA 1ZSKA 3ZV8A 1UTMA 1O5AB 2ANKH 4ABHA 1C2MA 4B75A 1DUAA 3E90B 1DSTA 1O5FH 1L1NA 1WTHD 2NU2E 1W2KH 4B1TA 1QURH 1YCPM 1YGCH 2C93B 1DITH 3Q3KA 4Z0KA 1C1OA 1FJSA 5GCHG 2QGRA 4D76A 4UD9H 1GI8B 3PWCA 1HYLA 1GMCF 1UMAH 2BVXH 3EE0B 1C1UH 2M5TA 4WMEA 3A8AA 1MQ6A 1SI5H 4K1EA 1K9OE 1OP0A 3CP7A 1D3QB 2BLOA 4MLFB 3M61U 3RXIA 1K2I1 1W13U 5FPSA 1GL0E 1SLXB 2V3HH 1XUHA 1UVSH 3TH3H 3LGUA 4NA7A 1F0RA 1O38A 1XUKA 2Y7ZA 3SUEA 4THNH 2AERH 3RP2A 3TJVA 4Q2KA 3MTYA 3MO3A 1OWEA 3SV9A 2PR3A 2H1UA 4FUBA 3VB7A 1T8LA 2ZDKA 1QJ1B 5GWZA 1HAGE 1Z8RA 1XKBC 1YPHC 2HPPH 1LKBA 3SGAE 4Y8XA 1DWDH 2OC8A 1C1VH 2FOCA 4A7IB 4BTUB 5C2ZA 2SGQE 1C9PA 1K1LA 1GMHF 1V6DA 4I33A 5EW2H 1SHHB 1TNIA 2V35A 4DIIH 3FP7E 1ETTH 1J8AA 2OC0A 3PYHA 4IW4E 1DS2E 1SLVB 3P6ZB 4KP0A 2A7HA 2XBWA 5EW1H 1FI8A 1TRMA 1ZMJA 2SNVA 3PMHB 1GGDC 1GJ7B 2P95A 4I32A 1C2EA 1DY9A 1B0FA 2AIPA 2PFEA 2PV9B 1QB1A 1C1TA 4ABEA 1EUFA 4F4OC 3ZZ8A 2A2QH 1LDTT 2PKSB 3K65B 1C5YB 4AB9A 1JWTA 1NRPH 3SI3H 1QJ7B 1HB0B 3E91A 2BD4A 2PKSC 1O2GH 4U01A 3D62A 5F8XA 3GY2A 2B9LA 1O2JA 1QY6A 4TWYA 4X8UH 3KGPA 4A5TS 1XUJA 1KXEA 1P05A 2PHBA 3MNCA 2A4OA 2GMTB 3RXQA 1GGDB 2BZAA 1OWKA 1LVOA 2XW9A 2ZHDA 2P94A 5L2ZH 1O37A 2C3SA 3BG4B 1KYNA 1IHTH 1TBZH 2FI5E 2Z7FE 3RUOA 1RTLA 1V2ST 1ELAA 1VITH 4DG4A 5GCHF 2ZFSA 1C5TA 1O3PB 1WTGH 4HTCH 1B5GH 4Q7XA 3A82A 2ZTZA 2GZ7A 3EAJA 5E0GA 3TGKE 1J16A 2Z9GA 3VXEH 2A5IA 5DP9A 1O2LA 2F9OA 1O3KA 3L3TA 4FUDA 1HJAB 2A2XH 1BBRK 1AHTH 2ZG0H 1FV9A 1J15A 5C1YA 1EAXA 1PPBH 3E8LA 3Q3XA 2J95A 1TBQH 2GCHF 1O3NA 2FYQA 2XXLA 1Z8JB 1VJ9U 1HGTH 2HNTF 3UNSA 2ZI2H 4JK5A 8KME2 2FX6A 5TCCA 1EP6A 1QRWA 4H6SB 1W10U 4UFGH 1AZ8A 3EGKH 1SFQB 2J92A 4OGXA 1CBWB 1J9CH 4LK4A 1C2GA 2W26A 3O8RA 1H9IE 3MOCA 2AS9A 1FAKH 5LGOA 3T27A 1UVUH 5CE1A 2CXVA 3RDZA 1XKAC 5ETXA 5LPEA 3SNEA 1SOTA 5PTPA 1AKSA 4KTSA 3MH5A 1THRH 4XDEA 1TMTH 1QR3E 2W7SA 3T26A 1L1JA 2VU8E 2GDEH 3SJKA 4JYVH 1O3FA 1NC6A 3ZZBA 1YKTA 2A45B 2O8LA 1D4PB 2BD2A 2FI4E 3PB1E 1H9LB 3M5OA 4ABGA 3V3MA 1GHBG 3BG8A 2BX4A 1BQYA 3VFEA 1ESAA 1MTVA 2EI8A 5F8TA 5FX6A 1ORFA 3RXAA 1XUFA 1C2IA 5LPRA 2FS8A 2UWOA 3GOVB 1DPOA 1DWCH 3S9CA 2ZQ1A 2ANYA 2ZHEH 1DOJA 1Z8IB 4E05H 1L1GA 4NWLA 4FUHA 2Z6BD 1DWBH 3FZZA 2GT8A 2ZA5A 2BQWB 4MQAA 5G4BA 4IN2A 3MU1A 1YF4A 2ZGXH 1AGJA 1NM6A 1Y3WA 2ZECA 1XUIA 1BTWA 3BTME 2XCNA 4I7YH 5A8XA 2SNWA 1C2DA 2AGGX 1K1PA 4MNWA 1O5DH 4RKJB 3S0NA 2BD8A 4ISOA 1UO6A 1A3EH 1OSSA 1K22H 5CMXH 5EOKA 3GY3A 3QZQA 1K21H 3A8DA 5EQQA 4NA9H 4UFDH 2SGPE 1Q31A 2Y7XA 1EPTB 4AG1A 3SI4H 1E34B 5L30H 1SLUB 1NO9H 2A0QB 5FX5A 3ZVCA 4CRCA 3MH4A 3R3GB 2WPHS 1PQ7A 5AFZH 3VPKA 1XXDA 1SR5C 2W3IA 3OX7U 1SGFG 1H9HE 1SQTA 4DY7B 2RDLA 1L4ZA 5AHGH 3RU4E 4INLA 1RIWB 5GJ4B 4QT8C 2VIPA 2R2MB 4BXSA 2ZFQH 4A1TA 3V7TA 2D26C 1MKXK 2FOHA 3KIDU 1TMUH 3FP6E 3G01A 1A0LA 4ESTE 2ZGBH 1XVMA 3K6YA 3M3TA 3QTVH 2FOMB 1N8OB 3ZZ5A 4LZ4B 2AGIX 4CHAC 1QRXA 1HFDA 2WPMS 2A4GA 1O31A 1T31A 3GICB 4XBBA 1TRNA 2PTNA 3RMLH 1Y8TA 3HKJB 3A85A 3SU4A 3DT0H 3GISB 2Y5FA 4Y11E 2RCEA 1B0EA 4D7FA 1V2RT 2PGQB 1D3PB 4K2YA 4A1XA 1MTNC 2ZU1A 3F1SB 1YLDA 2WPJS 2GCTB 4WXVA 2GTBA 3AAUA 3LT3A 1NROH 3SQEE 3QGNB 1GI4A 2VWLA 2WUBA 1IOEA 2J9NA 2ZPRA 3GYLB 2ZQ2A 1TA2A 2VVCA 4M7GA 4B71A 2G81E 2ALVA 3DUXH 4DCDA 1F5LA 4DT7B 1DANH 1EAIA 1ZTJA 2TGAA 1GHAF 3TK5A 3F9GA 5AFYH 4XOJA 4HGCA 2JETC 4NZQA 4X6MA 1TGBA 3P92A 5EXLA 4KTCA 1UTQA 1GI7B 1Y3XA 3CS7A 1TX8A 5K0HA 3LPRA 1HAIH 1P02A 1KDQB 2C8ZB 4E06H 1AE8H 4CR5A 1DXWA 3GCHC 1XXFA 1BMLA 3FVFB 1YBWA 1G2LA 1D9IA 1O3CA 1HAYB 1WUNH 4ZKSU 4NZLA 1C5WB 1T8MA 2TGDA 3VB3A 3BEUA 1QBVH 4TY7A 2BLVA 3BF6H 4CBOA 4NA8A 1K1OA 1P01A 2VIVA 1W7GH 1HAOH 1EOJA 1ELEE 2H5DA 1ELDE 3MI4A 5EXNA 1FY8E 2NWNA 1P2OA 5CHAB 1GBHA 1CT4E 5A09A 1BOQA 1NFXA 1SGFA 3SOSA 1CGIE 2CV3A 2TGPZ 5E0JA 1BHXB 1NT1A 3RMMH 1GMDG 1GVLA 6CHAC 2YOLA 4GAWA 1FXYA 4Q80A 1VR1H 4GCHF 2ODYB 3VGCC 1UJ1A 3EQ0H 1UCYK 1O33A 1AY6H 1C1PA 3UTUH 1T8NA 4U32A 1VGCC 1C5LH 2BM2A 3A7WA 3NCLA 1QB6A 1LHFH 1LMWB 1YPHE 3O8CA 3E16B 1UVOA 2QAAA 1O3JA 5DO4H 3RM2H 1C5ZB 2HWLB 3OY6U 1EQ9A 2F83A 1OYTH 4Y0ZE 2ZWLH 1MU8B 1GCTB 2OXSA 3BTGE 3PTBA 3E6PH 3TITA 2AMDA 4AORA 3GY4A 5C1XA 2FS9A 2XC0A 1GBAA 4INHA 1SGNE 2STAE 2ZU3A 1PPHE 2HPQH 2R0LA 3SQHE 4BAHB 1L2EA 2P8OC 3A7TA 1QL9A 1GVZA 1ARCA 1KXDA 1UTNA 2EC9H 1PPZA 4JMYA 1Z7KA 3SJIA 1TGNA 1ZZZA 1FDPA 2XRCA 4UFFH 5HM2A 4GUXA 1RFNA 1VITG 1DY8A 3GYMA 4J1YA 3M36A 1O3LA 1RXPA 4K60A 3M7QA 3WY8A 3PLBA 1C5QA 1C5NH 3ZZ9A 2TRMA 1HXEH 1XM1A 2XBXA 1NRQH 1ZOMA 3PO1B 4LOYH 1JRSA 5T3HA 1DM4B 4INKA 2ZCLP 2BYAX 3Q76A 3KQBA 2QF3A 3URDA 2EA3A 1W7XH 1MBMA 3H7TA 2PKAA 4FUGA 2XBVA 5C5OA 1S84A 1V2VT 1AWFH 3VXFH 3BTQE 1GMCG 1GHBF 2F9UA 4Y71A 3P8NA 3U1IB 4WVPE 4A6LA 2WPIS 1LTOA 1MTSA 2V3OH 3GDUA 1PYTC 4YZUA 4AB8A 7LPRA 1E0FD 4YOGA 1K1IA 5F03A 4X2VA 2BDBA 2WPLS 4MTBA 1H1BA 3SU0A 4TWWA 1FONA 1P10A 2Z3CA 1ZLRA 1O5EH 1YYY1 3W95A 1SG8B 4ABIA 2OD3B 2V0BA 3UUZA 2IOTA 2OQUA 3HKIB 1IQJA 3ZZCA 3ENSB 3MU0A 1ID5H 2JH5D 3ZVGA 2XTTB 3K2UA 2ZDVH 3ZYDA 1UVPA 3LONA 2VINA 2P3UB 3RXVA 3SU5A 1KTTB 4R0IA 3BN9A 1AUJA 3VB4A 2PUXB 3FAOA 5EXMA 1JBUH 1MTWA 1GJDB 1K1MA 2F9BH 1V2NT 3TPIZ 1UK2A 1AI8H 1C5XB 3BV9B 1TNHA 2H5CA 1C5OH 4IC6A 2GD4B 2UUJB 2G8TA 1P04A 1O2PA 3B8JA 1AO5A 1AFQB 1C1QA 1O2KA 2BOHB 5JPMH 3M3SA 1P9UA 3LGTA 1H8IH 4MNYA 1NN6A 2WV4A 2QF0A 2BY9X 4JYTA 4AFQA 1F5KU 1Y3YA 3E0NB 1HCGA 3QUMP 2UWPA 3P95A 1CA0B 2FDAA 1Z1IA 1C9TA 3RXUA 2LPRA 1GHVH 3A87A 1VZQH 1OWIA 3PMAB 1QB9A 1HPGA 4NSVA 3ATMA 1EOLA 4IMZA 1YPMH 3KEEA 1NTPA 3RC5A 2ZCHP 4X1QU 1PPFE 1TNLA 1VITF 4SGBE 1S83A 1V2UT 4OS2A 1OWJA 1P8VC 1GBDA 2Z9JA 1Z6JH 2ZKSA 2FOEA 2G52A 5GPIB 2ASUB 2FYRA 3UWIA 1C4U2 1SBWA 2FMJA 1V2PT 3A86A 4FU9A 3GCOA 2F9VA 5FPTA 5A0CA 4Y7AA 1QA0A 2RA3A 1SC8U 3M37A 3TH2H 5AVDA 4D9RA 5JBAS 1HXFH 2UUFB 3T2NA 4D9QA 3D23A 3TGIE 1O2HA 2BQ7B 2ZC9H 4I8LA 2A1DB 1FN6A 1C1NA 1IQNA 3BTHE 3D49H 2C8XB 4I8GA 5ABWA 3RLWH 1G3EA 1YPKH 3FP8E 2VB0A 3QGJA 4ISLA 1LO6A 2FM2A 4MPWA 3M7UA 4FU8A 2Q1JA 3R0FA 1TYNA 1GBJA 2ANMH 1BJUA 2XC5A 1DFPA 2GDDA 4MDSA 3SU6A 1Y5UT 3M5NA 1UVTH 2XBYA 1O2ZA 5E8EH 4CRDA 2ILNA 4KGAA 1C4V2 2AGEX 2BXUH 4D8NA 3RXCA 5FPYA 2VJ1A
chains in the Genus database with same CATH superfamily
2HRVA 3QX5H 1A4WH 3HATH 2GX4A 4AOQA 1MMJN 2EI7A 1TQ7B 3SUDA 3ZV9A 5T6FA 3TJNA 4DJZB 5IK2D 1GG6C 1BHXF 5ESBA 5A0AE 1JIMA 1ACBE 1HAVA 2B5TB 1FMGA 1KLTA 1KY9A 1SMFE 1W3CA 1O2TA 3URCA 5DP7A 2ZU2A 4KTUA 2R9PA 1G9IE 1TPSA 2BLWA 4J2YB 4Z1MD 1WU1A 1QL7A 3UQOA 5A8YA 4ISHH 5KECA 1LHDH 2OCVB 4DVAU 3RXRA 2V3MA 1QTFA 2VIOA 4FVBA 2JDID 4R8TB 1S6FA 1HJ9A 1GDQA 2DUCA 1FAXA 2IN2A 3SJOA 3SUFA 1VCPA 1S85A 2CJIA 4XBDA 2PWXA 2RDEA 7KMEH 1JIRA 1GJ6A 1QBOA 4DOQA 5EU8A 2BY5X 3QN7A 5C17A 3DFJA 3DA9B 3LH1A 3BTFE 1EASA 3QZRA 1A3BH 3U9AH 3BTDE 4H6TA 1UW7A 4BOHA 4NCYA 2QYIA 1SLWB 1UK4A 1ZTLA 3ZZDA 2CHAB 3MU4A 3WWFA 1WDIA 2LNCA 3DFLA 1FX0B 2Y6TA 4WXIA 4Y10E 3RXOA 3EA8A 1CA0C 4MPUA 2BD5A 1O36A 1AVGH 1VCWA 2VH6A 1FUJA 3NZIA 3MQKC 3LGWA 1P0SH 2TPIZ 4CH8B 2FZZA 1GVKB 3KQDA 1EJNA 2C90B 1Y5BT 1ZPBA 2FTLE 1FPCH 1QQUA 3H5CB 1VCQA 2BY6X 4AGKA 3EDXB 2ZGCA 1ZTKA 2PGBB 3M7TA 1S0RA 4AG2A 1BMMH 1NRNH 3ZZ6A 1OP2A 4VGCB 1QZ8A 3ATKA 3LIWA 1TFXA 1KTSB 2BD9A 3OEHD 3UR6A 2WYJA 3RXLA 3KCGH 1ZYOA 1DUEA 1BIOA 1HNEE 1NS3A 5LH8A 1Z71A 3BEIB 1GBMA 4BAQB 2AFQB 3LGIA 1C5MD 4ISIH 1O3HA 4ABFA 2W3KA 3STIA 1YCPH 1S5SA 2JIZD 3JZ2B 1GBIA 5B6OA 1UTLM 1Z1JA 1BDAA 1AQ7A 4U30A 4BXWA 1RD3B 1YWUA 1EAWA 2BTCE 7ESTE 1GHWH 2XC4A 1EFRD 1BTXA 1OKXA 4BANB 2V7QD 2BDGA 2WYGA 1YPEH 1LQEA 1ELFA 6GCHG 1TPPA 1UTJA 5I25A 2ANWA 2Z9IA 2FOBA 3F9FA 1KLJH 4YT7H 1LHGH 3HPTB 2ZO3H 3SV2H 1RTFB 2KAIA 3MYWA 1TGCA 1AKSB 4AFZA 1XX9A 1EXFA 3N7EA 2CMYA 1BRUP 2BHGA 1ZJKA 2OC1A 1L0ZA 2A7CA 2GJGA 3EA9A 2R3YA 1D6RA 1U6QA 1W0YH 1X7AC 1GCDA 4X2WA 3TVJB 1TRYA 1J17T 3B9FH 2G5VA 1CO7E 3T5FH 2SGEE 1V2MT 2O8WA 1PPGE 2UUKB 4Q7YA 5DP8A 3PMBB 1CHOF 2QV1A 2XWAA 1YPLH 3MU8A 1GJCB 1HIAB 1TGSZ 1UHBA 2A5AA 2I6SA 1O3MA 2A5KA 3SHCH 1C4Y2 3I78A 4JZEH 1MD8A 3ZVBA 1GPZA 3SNCA 3PM3A 5C20A 1CSOE 1QA7A 1GWAA 1C1SA 2OC7A 4VGCC 4KKDA 2NU4E 1MKWK 3S69A 3AASA 3CS0A 1GCTC 3TK6A 3SV8A 3RXHA 1JOUB 5HGGA 2J94A 1W8BH 3FKSD 1GBCA 4TPYA 3MNBA 3PMJA 3DSPA 1P9SA 5EPNA 2BDAA 4GSOA 3RXBA 2W5EA 1UTOA 1KDQA 5FBEA 2ZDNA 4GPGA 2Z9LA 3SYJA 4JZ1A 1GHAG 2FXRA 2LP6A 3ZYEA 3T28A 2O8UA 1EZXC 1KXAA 2PSYA 5EQRA 4CREA 3VGCB 1AVWA 1FN8A 4FOUC 2YMSD 1AZZA 1GG6B 2GV6A 3BEFB 1ANDA 5FXLA 5HYOA 3P17H 3SNAA 1A5HA 2WV5A 3QWCH 2O9QA 1O3GA 4BAKB 5GDSH 1SB1H 2G55A 1SKYE 1IHSH 3FANA 5TCAA 2SFAA 1MD7A 2GKVE 3LGYA 3M35A 1SVPA 4UDWH 4A1VA 1O30A 1SGPE 1NRRH 1XMNB 4B6FA 1BRCE 2EY4C 2RFKC 4BTTB 1MUEB 1C2JA 3AAVA 3S9AA 1YLCA 1MABB 2JH0D 4XFQA 2BDCA 2TBSA 2ZHQH 5FHTA 1ZJDA 2UWLA 5BPEA 2WSSD 3EYDA 5DJ7A 4ZXYH 4YOJA 2SGFE 3SZNA 1ANBA 2ZZUH 4Y8ZA 1WOFA 3U98H 3V0XA 1HUTH 2BY8X 4ZUHA 5E2OA 1XVOA 1GMDF 2ZFPH 3RC6A 1E37B 2ZPSA 2FODA 1ETRH 1M9UA 4DW2U 4ABDA 2TGTA 1IQHA 5C5NA 3AK5A 4ISNA 1RS0A 1G32B 1EKBB 1A5GH 1QL8A 1ESBA 1K28D 3PWBA 4KELA 3GCTF 4CRBA 2D2DA 2BY7X 2A4RA 3I29A 1BRBE 1SGRE 2AEIH 4O3UA 3PTNA 4YTAA 3RXTA 1P2KA 1ZHMA 2J98A 4DURA 2H9EH 3GY8A 1TPOA 3OYPA 4HI3A 3UNRA 1Z8GA 3RXPA 5GXPA 3BTEE 5E2PA 3TNSA 2KFWA 4AN7A 3O8BA 1TX6A 1TOCB 5DKMA 1UTKA 1LKAA 2ZF0H 4JK6A 1CU1A 3MU5A 4NIYA 5I46H 2FEQH 2HALA 2Y5HA 4HZHA 1MU6B 2Z94A 2HVXA 4JZIA 4YOIA 1HV7A 1CT0E 5AF9H 3GCTG 3RU4D 2FOGA 3RXDA 3UFAA 3A80A 5T6GA 5DG6A 2CF8H 5DP3A 3TIUA 1GI0A 4B73A 4Q63A 5EG4A 3ZZ4A 1PFXC 3ZZ3A 3M3VA 1CT2E 4ZKNU 4CHAB 1VJAU 4AFSA 2ZP0H 1SQRA 3ATLA 3VG8A 4JYUH 1LVMA 3A7VA 1O3BA 1OOKB 1AD8H 1E38B 3SGQE 4B2AA 2FI3E 3MHWU 2H2ZA 2Z3DA 1NY22 1PJPA 1Y3VA 4E7NA 2G00A 2HNTC 3SGBE 4WY3A 2P3TB 3OEED 1SGCA 4U2WA 2BLQA 3MO9A 3ZZ7A 3RXFA 3ELAH 2GZ8A 2VWOA 1FNIA 3O8DA 3PRDA 1PQAA 4RSPA 5K7RA 4IN1A 1FY3A 2BOKA 2XYAA 1DICA 5C0TA 4GCHG 4NIWA 1YM0A 3UB0A 3SW2B 4X1SU 1G3BA 1V2KT 2PW8H 3M5MA 3SV6A 1ZGVA 1ELTA 2WUCA 3SUGA 1IQKA 4ASHA 3P70B 1WQVH 5T1VA 3NK8A 4NG9H 4B76A 1P2NA 1IQFA 3DD2H 2VIWA 1OXGA 1GJ8B 1BBRH 2F9NA 1THPB 1KLIH 3GY6A 2O8MA 1YY3A 4BNRA 1FIWA 3AW0A 2F3CE 3HK3B 2GVFA 4FVDA 2YMSB 3ZVEA 1C2KA 1IQGA 4X0WU 1H8DH 4IC5A 2HNTE 4OM9A 3K9XB 2AIQA 2FPZA 1S82A 1IQMA 5DP5A 2A31A 2Y82A 4TY6A 3NKKA 3UOUA 1GBFA 3SO3A 1HAPH 1IQEA 1C5VA 1P2IA 4ZKOU 3L33A 4OGYA 3Q3YA 3SORA 3H09A 1NRSH 2JKHA 3LKWA 3STJA 3P8GA 3U8TH 3TK9A 3UIRA 5T6DA 2ZDMA 2H9TH 1E35B 1P06A 3KYFA 5EGMA 3ZIAD 2ODQA 1MCTA 2J97A 1CE5A 4TYDA 5TJXA 2P3FH 1DE7H 3LC5A 3QO6A 4TPIZ 4E7RG 3U69H 2QXGA 3TH4H 1NPMA 1HAVB 1C1WH 1OX1A 4MPVA 1KIGH 1SGEE 3I77A 1BT7A 3GS9A 1RGQA 1WSSH 2UUYA 2WHXA 3BIUH 1GMHG 1V2OT 3T29A 1O32A 1TOMH 1T4VH 5DGJA 2H6MA 3RM0H 1QGFA 4AYVB 1EATA 1A61H 1P2QA 2WINI 3U28C 4YLQH 3UQVA 2QC2A 5GIBA 1CGHA 3PO1C 1TA6A 4K3JA 2J5UA 1CA8B 3HGPA 1GHZA 3PV2A 4B74A 4B2CA 1OWHA 1F0UA 2FX4A 1UK3A 5JB8S 3S9BA 2DE9A 2AMPA 4Y8YA 1ZRBA 1MZDA 1P3EA 4Y6DA 1GJAB 1O5CB 2CHAC 1EJMA 2B0FA 3RXEA 1P09A 2P8OB 1RJXB 2CF9H 1YC0A 1C2LA 1HIAA 1UHBB 1HJAC 3A88A 1TE0A 1G36A 4X1PU 3LC3A 4GVUA 4Y0YE 4LZ1H 1C5RA 5DPAA 4ACBA 4LXBH 4UEHH 1Z6EA 4I8JA 2STBE 1ZSLA 8GCHF 1QHRB 1ZMNA 6ESTA 1Y59T 1ZHPA 4WH8A 4I31A 2FLBH 2XNDD 3LDXH 2IJOB 3SNBA 3HGNA 2ZU4A 1HAHH 1BJVA 2Q6FA 3UR9A 1G30B 1BB0B 3KN2A 1D3DB 4DIHH 2ZHFH 3BIVH 2Y5GA 1FY1A 1HAXB 1P3CA 3LH3A 2BX3A 3ATIA 1NBMD 3GCHB 3IITA 1A7SA 3OE7D 1ANCA 1IQLA 1QBNA 1A5IA 1QNJA 4HFPB 5EQSA 4BAMB 1A2CH 4TSFD 3U1JB 1DT2A 1OWDA 3C1KA 1DWEH 5HMAA 1YP9A 1QQ4A 2OBQA 4XSKU 2ZNKH 3RLYH 3NWUA 1YPGH 3NXPA 3A7XA 1FY4A 5C3NA 3C27B 4NIVA 3T62A 1P03A 4K8YA 2BVRH 2XNIA 1F2SE 3NUMA 1ZMLA 1HJ8A 4O9VA 2F4LA 1GI5A 3OTJE 1ESTA 1TQ0B 2A7JA 2OK5A 3V13A 1TB6H 2NU3E 3NPSA 5CHAC 1MKXH 3RMNH 5C1UA 2VNTA 2GCTC 2NU0E 1ZSJA 5DSFA 4I8KA 5FL7D 1NFYA 1A46H 3FN8A 1YPJH 2QCYA 1NZQH 1W12U 4WWYA 4RT0A 3A8CA 3TU7H 2BDHA 2F43B 1O2RA 2ZTYA 3PV4A 4X6PA 3BTKE 1MZAA 4F49A 2ESTE 1O2IA 1MCVA 2VVUA 1SFIA 1ELGA 3W94A 1GBKA 3MWIU 2ULLA 1H8ED 5JBBS 3UWJH 1OYQA 4OS6A 4PROA 4AFUA 4XE4A 3VEQB 3ODDA 3A83A 1HRTH 3RXGA 1BMAA 1QFKH 1AIXH 3LOXA 2Q6GA 2XCFA 5IDKA 1UCYE 1KXFA 1D3TB 1O0DH 1WBGB 5L2YH 3ZVAA 2V6NA 1ELCA 4HG6A 3V12A 4K5ZA 1LHCH 1WYKA 5EPYA 1DDJA 1TGTA 1OS8A 3ZVFA 1RIWC 4ABAA 3MMGA 1H4WA 3S7KB 2ZGJA 1GHXH 2QN5T 4SGAE 1P57B 1T8OA 1ZGIA 1MAXA 1P11E 7GCHF 2C8WB 4JZDH 3E0PB 3QLPH 4P00A 3AW1A 1F7ZA 1N1LA 1MTNB 2G4UA 1T32A 2J2UA 1KSNA 3BSQA 4FXGH 1ZRKA 3H7OA 5CHBA 2FESH 1CQQA 3F2FA 1ZPZA 5JDUB 2ZFTA 1AVXA 1O3AA 3MO6A 4AZ2B 1O2XA 4BTIB 1BTYA 2GT7A 2QXIA 2RA0A 4WH6A 2IPHA 3IWMA 1HBTH 4ASUD 2A32A 2ZFRH 3E1XB 3SJ8A 4ACAA 1AFQC 1EB1H 1SGYE 1SOZA 2BD7A 1C5UA 2ZIQH 1LVBA 1P2JA 4IS5A 1TPAE 1O3OA 2B8OH 4RKOB 1N8OC 3ATWA 5JYIA 4X1NU 1TIOA 1TABE 1EAUA 1MQ5A 4RN6A 3OSYA 2EI6A 3UNQA 1TNKA 2AMQA 1LPZB 2ODPA 1BCUH 2ALPA 5E0HA 1SSXA 3RU4T 4AGJA 5L6NH 3N7OA 1WAYB 1IQIA 1EP5A 2VVVA 3KHVA 3ZVDA 1OHHD 1BUIA 2P16A 3OU0A 3DHKH 3A89A 3LJJA 4OS5A 1TLDA 4X1RU 2QXHA 4CRFA 1THSH 2OUAA 1GJ9B 7GCHG 2J98B 5HXFA 1S0QA 4MVNA 4OS4A 1SGQE 4A92A 1TONA 1E1RD 1INCA 3SN8A 1HLTH 2YNBA 3F6UH 3FZDA 4FU7A 1MBQA 4NGAH 5C0UA 4ABJA 1S6HA 1O2OA 4OS1A 2FP7B 2P93A 1QJ6B 4D7GA 3P8OA 1JMOH 1BA8B 1P12E 2H9HA 8ESTE 1V2QT 1SGTA 2J4IA 3RXSA 5LPFA 2ZTXA 4GHQA 5C94A 2HGTH 1F5RA 1TNJA 1CBWC 2Y80A 2G4TA 3UY9A 2ZCKP 4Y76A 4X6NA 1LVYA 1N6YA 4NSYA 1SQOA 2KR7A 1AU8A 2BB4A 3UPEA 1ABIH 1MKWH 1DVAH 2PUQH 1T4UH 4M9FA 3VB5A 4CR9A 3SU2A 3GY7A 3LGVA 1RRKA 1TBRH 3KQEA 1O2VA 1Y5AT 5JB9S 3ITIA 5BRRE 1GL1A 2GZ9A 3A81A 1HDTH 4X6OA 1AB9C 4ZXXH 1YCPK 2ZGHA 3P8FA 3TJUA 3SV7A 4O97A 5EODA 1BTPA 1OPHB 3QTOH 4IMQA 4WJG2 1GHYH 3SBKA 1EZSC 1UTPA 2VIDA 1L4DA 9LPRA 4I8HA 4ZHLU 3AVZA 1SGIB 5C67A 4BAOB 1GBTA 1GDUA 4NFEA 4X2XA 1PPCE 4UFEH 1GI9B 1GI3A 3UREA 2ZPQA 1FZZA 4FUJA 2R0KA 1G3CA 3TLOA 1EX3A 2QY0B 1Q2WA 2FLRH 4K69A 3LJOA 4YT6H 4ZH8A 1FQ3A 2D1JA 3F9HA 4O03A 3BG4C 5JBTA 2ZDLA 1G37A 3N7DA 1TALA 5JBCS 1P2MA 1AE5A 2QE7D 1ANEA 2Z9KA 2F91A 3GDSA 4FUCA 2HOBA 2PLXA 3GDVA 4H4FA 1O2NA 4FUIA 4WF8A 2P59A 1C1RA 1EZUC 3Q00A 4K1SA 1CVWH 3PLKA 1BZXE 1AWHB 2GCHG 1VGCB 2VGCC 1O2MA 4MNXA 4AX9H 1GJ4H 1O3DA 1D6WA 2DE8A 2QXJA 1FY5A 1W0KD 3KNXA 1N6XA 1SQAA 2BVSH 1UCYH 1WXRA 4B2BA 1Q3XA 2WPKS 2ZEBA 4JCNA 3WW7A 9ESTA 1AUTC 2BDYA 3U8OH 3M5LA 1QCPA 1GBBA 2PTCE 1O3EA 1E36B 4Q7ZA 5A0BA 3A8BA 6CHAB 3EA7A 3CNRA 1BMNH 1C5PA 1GDNA 4GHTA 2EEKA 1PQ5A 1SPJA 1ABJH 1O39A 3GY5A 1ARBA 1DLKB 2SGAA 2XWBI 1FLEE 1PPEE 4ZHMU 1MTUA 4MPXA 1EPTA 1GJBB 2R2WU 3MH6A 4YO9A 2ZFFH 4DGJA 1EJAA 5F6MA 2GV7A 3MH7A 1RTKA 1NESE 3PROA 3MNSA 4Z6AH 1V3XA 3SJ9A 1SHYA 1G2MA 1ELBA 4X2YA 1V2WT 1MH0A 2CGAA 2FTMA 2NU1E 1O2SA 6LPRA 1ETSH 2D8WA 2Q6DA 3VB6A 3PV5A 2SGDE 2GMTC 2AYWA 3K6ZA 1GBEA 1GI1A 2G51A 2OLGA 1TWXB 3UOPA 3RC4A 5HM9A 2J34A 3KQCA 4ZAEA 4NFFA 4DT4A 8LPRA 3FFGA 3BTTE 3A84A 1O2QA 1F0TA 5FCRA 1NU9A 5FBIA 1IAUA 2O8TA 2B7DH 1JXPA 2W7UA 1G3DA 2HLCA 1BITA 2KAIB 2VGCB 4H42U 2Z3EA 1DSUA 1OP8A 2JETB 1BTHH 1AN1E 2BD3A 2FO9A 3ESTA 2L74A 1FPHH 2AH4X 4JZFH 4K8BA 1F0SA 4YM9A 3D65E 1C2FA 3B23B 4UONA 1O34A 1TAWA 1GBLA 2BQ6B 2A4QA 4P02A 2PKAB 2YNAA 1AMHA 1O2YA 3ODFA 4ZMAH 2BDIA 1V2LT 2ZDAH 2C8YB 5F8ZA 2OTVA 1W0JD 4YLUA 5A2MH 4XBCA 1C5SA 3F68H 1TX7A 3TGJE 5SGAE 1O5GH 1W11U 2THFB 4ZROA 5H4IB 3CENA 3A7ZA 5FAHA 2OINA 3L6PA 4WMFA 2RG3A 2ZHWH 3BTWE 5DP6A 4UE7H 3TJOA 3KF2A 1WCZA 1SL3A 1FIZA 3WWBA 8GCHG 1ZR0A 2VWMA 1BRAA 1AB9B 1WQSA 3A7YA 4O3TA 2FOAA 3JZ1B 1Y3UA 3QDZB 2OBOA 3SU3A 2R3UA 1QIXB 1DLEA 1J14A 1GJ5H 4NIXA 2FWWA 1KXCA 3ZZAA 2VIQA 1EZQA 2PSXA 1LHEH 4CBNA 4AC9A 1HAZB 5A8ZA 3SHAH 4GLYA 1LPGB 1C2HA 4Y7BA 1T7CA 3Q77A 1A0HB 3F0PA 2W6ID 4CRGA 1KXBA 1V2TT 2FIRH 3OY5U 4CRAA 1O5BB 1BBRE 3S7HB 4ZHAA 1PYTD 4OS7A 3RXKA 1LCYA 2OP9A 4TT3D 4CH2B 3TNTA 1ELVA 1NFUA 1LPKB 3PLPA 1V2JT 2VWNA 4X8SH 5J4SA 2HVYB 1W14U 4ZKRU 3MFJA 3F2HA 5IYTA 4YXWD 1EPTC 1K1JA 1LQDB 1XUGA 2QA9E 3IG6B 3E3TA 1K1NA 1CHGA 1DXPA 2BMGB 3SU1A 2CN0H 4FUEA 4MNVA 1CGJE 2TIOA 1DX5M 1A1RA 1TMBH 2GGVB 1GI2A 4X8VH 5J4QA 1AFEH 1B7XB 3KL6A 4YESB 3T25A 2FOFA 2K1QA 1WV7H 2BZ6H 2J38A 2QIQA 4IBLH 3F9EA 4K1TA 5FCKA 5DK1A 1O2UA 4AYYB 1ZHRA 3RMOH 1CHOG 6GCHF 1GI6A 5ESTE 1W0ZU 2BXTH 2KCOA 4Y79A 4X8TH 2VH0A 1NU7B 1MAYA 2I6QA 1S81A 4ABBA 1BTUA 2F9PA 5DP4A 3SNDA 3HK6B 1E1QD 1O2WA 2C4FH 3RXMA 3U8RH 4WMDA 2ZU5A 4NWKA 1O35A 3RXJA 1EB2A 1JRTA 3LU9B 1QRZA 3F3BA 4MG3A 3MNXA 2G5NA 1NFWA 2OQ5A 1O3IA 2GP9B 1C1MA 1SGDE 1PQ8A 1TNGA 4FUFA 1ZPCA 2Y81A 3QK1A 4IGDA 3DSOA 1BTZA 1F92A 2JH6D 3GCNA 1A0JA 1ZSKA 3ZV8A 1UTMA 1O5AB 2ANKH 4ABHA 1C2MA 4B75A 1DUAA 3E90B 1DSTA 1O5FH 1L1NA 1WTHD 2NU2E 1W2KH 4B1TA 1QURH 1YCPM 1YGCH 2C93B 1DITH 3Q3KA 4Z0KA 1C1OA 1FJSA 5GCHG 2QGRA 4D76A 4UD9H 1GI8B 3PWCA 1HYLA 1GMCF 1UMAH 2BVXH 3EE0B 1C1UH 2M5TA 4WMEA 3A8AA 1MQ6A 1SI5H 4K1EA 1K9OE 1OP0A 3CP7A 1D3QB 2BLOA 4MLFB 3M61U 3RXIA 1K2I1 1W13U 5FPSA 1GL0E 1SLXB 2V3HH 1XUHA 1UVSH 3TH3H 3LGUA 4NA7A 1F0RA 1O38A 1XUKA 2Y7ZA 3SUEA 4THNH 2AERH 3RP2A 3TJVA 4Q2KA 3MTYA 3MO3A 1OWEA 3SV9A 2PR3A 2H1UA 4FUBA 3VB7A 1T8LA 2ZDKA 1QJ1B 5GWZA 1HAGE 1Z8RA 2KCPA 1XKBC 1YPHC 2HPPH 1LKBA 3SGAE 4Y8XA 1DWDH 2OC8A 1C1VH 2FOCA 4A7IB 4BTUB 5C2ZA 2SGQE 1C9PA 1K1LA 1GMHF 1V6DA 4I33A 5EW2H 1SHHB 1TNIA 2V35A 4DIIH 3FP7E 1ETTH 1J8AA 2OC0A 3PYHA 4IW4E 1DS2E 1SLVB 3P6ZB 4KP0A 2A7HA 2XBWA 5EW1H 1FI8A 1TRMA 1ZMJA 4RT1A 2SNVA 3PMHB 1GGDC 1GJ7B 2P95A 4I32A 2AHME 1C2EA 1DY9A 1B0FA 2AIPA 2PFEA 2PV9B 1QB1A 1C1TA 4ABEA 1EUFA 4F4OC 3ZZ8A 2A2QH 1LDTT 2PKSB 3K65B 1C5YB 4AB9A 1JWTA 1NRPH 3SI3H 1QJ7B 1HB0B 3E91A 2BD4A 2PKSC 1O2GH 4U01A 3F0OA 3D62A 5F8XA 3GY2A 2B9LA 1O2JA 1QY6A 4TWYA 4X8UH 3KGPA 4A5TS 1XUJA 3EE7A 1KXEA 1P05A 2PHBA 3MNCA 2A4OA 2GMTB 3RXQA 1GGDB 2BZAA 1OWKA 1LVOA 2XW9A 2ZHDA 2P94A 3OFND 5L2ZH 1O37A 2C3SA 3BG4B 1KYNA 1IHTH 1TBZH 2FI5E 2Z7FE 3RUOA 1RTLA 1V2ST 1ELAA 1VITH 4FETA 4DG4A 2KZ4A 5GNDA 5EJZA 5GCHF 2JJ2D 2ZFSA 1C5TA 1O3PB 1WTGH 4HTCH 1B5GH 4Q7XA 3A82A 2ZTZA 2GZ7A 3EAJA 5E0GA 3TGKE 1J16A 2Z9GA 3VXEH 2A5IA 5DP9A 1O2LA 2F9OA 1O3KA 3L3TA 4FUDA 1HJAB 2A2XH 1BBRK 1AHTH 2ZG0H 1FV9A 1J15A 5C1YA 2KX4A 1EAXA 1PPBH 3E8LA 3Q3XA 2J95A 1TBQH 2GCHF 1O3NA 2FYQA 2XXLA 1Z8JB 1VJ9U 1HGTH 2HNTF 3UNSA 2ZI2H 4JK5A 8KME2 2FX6A 5TCCA 1EP6A 1QRWA 4H6SB 1W10U 1KMHB 4UFGH 1AZ8A 3EGKH 1SFQB 2J92A 4OGXA 1CBWB 1J9CH 4LK4A 1C2GA 2W26A 3O8RA 2KCAA 1H9IE 3MOCA 2AS9A 1FAKH 5LGOA 3T27A 1UVUH 5CE1A 1NBME 2CXVA 1XKAC 5ETXA 3RDZA 5LPEA 3SNEA 1SOTA 5PTPA 1AKSA 4KTSA 3MH5A 1THRH 2WPDD 2XOKD 4XDEA 1TMTH 3DCLA 1QR3E 1K0HA 2W7SA 3T26A 1L1JA 2VU8E 2GDEH 3SJKA 4JYVH 1O3FA 1NC6A 3ZZBA 1YKTA 2A45B 2O8LA 1D4PB 2BD2A 2FI4E 3PB1E 1H9LB 3M5OA 4ABGA 3V3MA 1GHBG 3BG8A 2BX4A 1BQYA 3VFEA 1ESAA 1MTVA 4I86A 2EI8A 5F8TA 5FX6A 1ORFA 3RXAA 1XUFA 1C2IA 5LPRA 2FS8A 2UWOA 3GOVB 5EJ1A 1DPOA 1DWCH 3S9CA 2ZQ1A 2ANYA 2ZHEH 3UAIC 1DOJA 3DSGA 1Z8IB 4E05H 2WZQA 1L1GA 4NWLA 4FUHA 2Z6BD 1DWBH 3FZZA 2GT8A 2ZA5A 2BQWB 4MQAA 5G4BA 4IN2A 3MU1A 1YF4A 2ZGXH 1AGJA 1NM6A 1Y3WA 2ZECA 1XUIA 1BTWA 3BTME 2XCNA 4I7YH 5A8XA 2SNWA 1C2DA 5CDFE 2AGGX 1K1PA 4MNWA 1O5DH 2M2AA 4RKJB 3S0NA 2BD8A 4ISOA 1UO6A 1A3EH 1OSSA 1K22H 2QF5A 5CMXH 5EOKA 3GY3A 3QZQA 1K21H 3A8DA 5EQQA 4NA9H 4UFDH 2SGPE 1Q31A 2Y7XA 1EPTB 4AG1A 3SI4H 1E34B 5L30H 1SLUB 1NO9H 2A0QB 5FX5A 3ZVCA 4CRCA 3MH4A 3R3GB 2WPHS 1PQ7A 5AFZH 3VPKA 1XXDA 1SR5C 4F48B 1COWD 2W3IA 3OX7U 1SGFG 1H9HE 1SQTA 4DY7B 5B6LA 2RDLA 1L4ZA 5AHGH 3RU4E 4INLA 1RIWB 5GJ4B 4QT8C 2VIPA 2R2MB 4BXSA 2ZFQH 4A1TA 3V7TA 2D26C 1MKXK 2FOHA 3KIDU 1TMUH 3FP6E 3G01A 1A0LA 4ESTE 2ZGBH 1XVMA 3K6YA 3M3TA 3QTVH 1BMFD 2FOMB 1N8OB 3ZZ5A 4LZ4B 2PP6A 2AGIX 4CHAC 1QRXA 1HFDA 2WPMS 2A4GA 1O31A 1T31A 1VKYA 3GICB 4XBBA 1TRNA 2PTNA 3RMLH 1Y8TA 3HKJB 3A85A 2VBCA 3SU4A 3NRLA 3DT0H 3GISB 2Y5FA 4Y11E 2RCEA 1B0EA 4D7FA 1V2RT 2PGQB 1D3PB 4K2YA 4A1XA 1MTNC 2ZU1A 3FO8D 3F1SB 1YLDA 2WPJS 2GCTB 4WXVA 2GTBA 3AAUA 3LT3A 1NROH 3SQEE 3QGNB 1GI4A 2VWLA 4B6EA 2WUBA 1IOEA 2J9NA 2QF4A 2ZPRA 3GYLB 2ZQ2A 1TA2A 2VVCA 4M7GA 4B71A 2G81E 2ALVA 3DUXH 4DCDA 1F5LA 4XD7D 4DT7B 1DANH 4Q4LA 1EAIA 1ZTJA 2TGAA 1GHAF 3TK5A 3F9GA 5AFYH 4XOJA 4HGCA 2JETC 4NZQA 4X6MA 1TGBA 3P92A 5EXLA 4KTCA 1UTQA 1GI7B 1Y3XA 3CS7A 1TX8A 5K0HA 3LPRA 1HAIH 1P02A 1KDQB 2C8ZB 4E06H 1AE8H 4CR5A 1DXWA 3GCHC 1XXFA 1BMLA 3FVFB 1YBWA 1G2LA 1D9IA 1O3CA 1HAYB 1WUNH 4ZKSU 3KQ5A 4NZLA 3OAAD 1C5WB 1T8MA 2TGDA 3VB3A 3BEUA 1QBVH 4TY7A 1YLNA 2BLVA 3BF6H 4CBOA 4NA8A 1K1OA 1P01A 2VIVA 1W7GH 2LELA 1HAOH 2HLDD 1EOJA 1ELEE 2H5DA 1ELDE 3MI4A 5EXNA 1FY8E 5DN6D 2NWNA 1P2OA 2IJD1 5CHAB 5KEDA 1GBHA 1CT4E 5A09A 3W1EA 1BOQA 1NFXA 1SGFA 3SOSA 1CGIE 2CV3A 2TGPZ 5E0JA 1BHXB 1NT1A 3RMMH 1GMDG 1GVLA 6CHAC 2YOLA 1H8HD 4GAWA 1FXYA 4Q80A 1VR1H 4GCHF 2ODYB 3VGCC 1UJ1A 3EQ0H 3SZEA 1UCYK 1O33A 1AY6H 1C1PA 3UTUH 1T8NA 4U32A 1VGCC 1C5LH 2BM2A 3A7WA 3NCLA 1QB6A 1LHFH 1LMWB 1YPHE 3O8CA 3E16B 1UVOA 2QAAA 1O3JA 2EQNA 5DO4H 3RM2H 1C5ZB 2HWLB 3OY6U 1EQ9A 2F83A 1OYTH 4Y0ZE 2ZWLH 1MU8B 1GCTB 2OXSA 3BTGE 3PTBA 3E6PH 3TITA 2AMDA 4AORA 3GY4A 5C1XA 2FS9A 2XC0A 1GBAA 4INHA 1SGNE 2STAE 2ZU3A 3FOAA 1PPHE 2HPQH 2R0LA 3SQHE 2IPQX 4BAHB 1L2EA 2P8OC 3A7TA 1QL9A 1GVZA 1ARCA 1KXDA 1UTNA 2EC9H 1PPZA 4JMYA 1Z7KA 3SJIA 1TGNA 1ZZZA 1FDPA 4ZCNA 2XRCA 4UFFH 5HM2A 4GUXA 1RFNA 1VITG 1DY8A 3GYMA 4J1YA 3M36A 1O3LA 1RXPA 4K60A 3M7QA 3WY8A 3PLBA 1C5QA 1C5NH 3ZZ9A 2TRMA 1HXEH 1XM1A 2XBXA 1NRQH 1ZOMA 3PO1B 4LOYH 3PRBA 1JRSA 5T3HA 1DM4B 4INKA 2ZCLP 4XRNA 2BYAX 3Q76A 3KQBA 2QF3A 3URDA 2EA3A 1W7XH 1MBMA 3H7TA 2PKAA 4FUGA 2XBVA 5C5OA 1S84A 1V2VT 1AWFH 3VXFH 3BTQE 1GMCG 1GHBF 2F9UA 4Y71A 3P8NA 3U1IB 4WVPE 1E79D 2WV9A 4A6LA 2WPIS 1LTOA 1MTSA 2V3OH 3GDUA 1PYTC 4YZUA 4AB8A 7LPRA 5HKKD 1E0FD 4YOGA 1K1IA 5F03A 4X2VA 2BDBA 2WPLS 4MTBA 1H1BA 3SU0A 4TWWA 1FONA 5EIYA 1P10A 2Z3CA 1ZLRA 1O5EH 1YYY1 3W95A 1SG8B 4ABIA 2OD3B 1S6LA 2V0BA 3UUZA 2IOTA 2OQUA 3HKIB 1IQJA 3ZZCA 3ENSB 3MU0A 1ID5H 2JH5D 3ZVGA 2KM0A 2XTTB 3K2UA 2ZDVH 3ZYDA 1UVPA 3LONA 2VINA 2P3UB 3RXVA 3SU5A 3F2GA 5HIYA 1KTTB 4R0IA 3BN9A 1AUJA 3VB4A 2PUXB 3FAOA 2YMSC 5EXMA 1JBUH 5HIZA 1MTWA 1GJDB 1K1MA 2F9BH 1V2NT 3TPIZ 1UK2A 1AI8H 2L6OA 1C5XB 3BV9B 1TNHA 2H5CA 1C5OH 4IC6A 2GD4B 2UUJB 2G8TA 1P04A 1O2PA 3B8JA 1AO5A 1AFQB 1C1QA 1O2KA 2BOHB 5JPMH 3M3SA 1P9UA 3LGTA 1H8IH 4MNYA 1NN6A 2WV4A 2QF0A 2BY9X 4JYTA 4AFQA 3KYGA 1F5KU 1Y3YA 3E0NB 1HCGA 3QUMP 2UWPA 2CK3D 3P95A 1CA0B 2FDAA 1Z1IA 1C9TA 3RXUA 2LPRA 1GHVH 3A87A 1VZQH 1OWIA 3PMAB 1QB9A 5KGOA 1HPGA 4NSVA 3ATMA 1EOLA 4IMZA 1YPMH 3KEEA 1NTPA 3RC5A 2ZCHP 4X1QU 1PPFE 1TNLA 1VITF 4SGBE 1S83A 5EJLA 1V2UT 4OS2A 1OWJA 1P8VC 1GBDA 2Z9JA 1Z6JH 2ZKSA 2FOEA 2G52A 5GPIB 2ASUB 2JJ1D 2FYRA 3UWIA 3N99A 1C4U2 1SBWA 4RI0A 2FMJA 1V2PT 3A86A 4FU9A 3GCOA 2F9VA 3OTPA 4F55A 5FPTA 5A0CA 2W6JD 4Y7AA 1QA0A 2RA3A 1SC8U 3M37A 3TH2H 5AVDA 4D9RA 5JBAS 1HXFH 2UUFB 3T2NA 4D9QA 3D23A 3TGIE 1O2HA 2BQ7B 2ZC9H 4I8LA 2A1DB 1FN6A 1C1NA 1IQNA 3BTHE 3D49H 2C8XB 4I8GA 5ABWA 3RLWH 2K0QA 1G3EA 1YPKH 3FP8E 2VB0A 3QGJA 4ISLA 1LO6A 2FM2A 4MPWA 3M7UA 4FU8A 2Q1JA 2KCYA 3R0FA 1TYNA 1GBJA 2ANMH 1BJUA 5F53A 2XC5A 1DFPA 2GDDA 2K8IA 4MDSA 3SU6A 1Y5UT 3M5NA 1UVTH 2XBYA 1O2ZA 5E8EH 4CRDA 2ILNA 4KGAA 1C4V2 2AGEX 2BXUH 4D8NA 3RXCA 5FPYA 2VJ1A
chains in the Genus database with same CATH topology
2HRVA 3QX5H 1A4WH 3HATH 2GX4A 4AOQA 1MMJN 2EI7A 1TQ7B 3SUDA 3ZV9A 5T6FA 3TJNA 4DJZB 1GG6C 1BHXF 5ESBA 5A0AE 1JIMA 1ACBE 1HAVA 2B5TB 1FMGA 1KLTA 1KY9A 1SMFE 1W3CA 1O2TA 3URCA 5DP7A 2ZU2A 4KTUA 2R9PA 1G9IE 1TPSA 2BLWA 4J2YB 1WU1A 1QL7A 3UQOA 5A8YA 4ISHH 1LHDH 2OCVB 4DVAU 3RXRA 1QTFA 2VIOA 4FVBA 4R8TB 1S6FA 1HJ9A 1GDQA 2DUCA 1FAXA 2IN2A 3SJOA 3SUFA 1VCPA 1S85A 2CJIA 4XBDA 2PWXA 7KMEH 1JIRA 1GJ6A 1QBOA 4DOQA 5EU8A 2BY5X 3QN7A 3DFJA 3DA9B 3LH1A 3BTFE 1EASA 3QZRA 1A3BH 3U9AH 3BTDE 4H6TA 4BOHA 4NCYA 2QYIA 1SLWB 1UK4A 1ZTLA 3ZZDA 2CHAB 3MU4A 2LNCA 3DFLA 2Y6TA 4WXIA 4Y10E 3RXOA 3EA8A 1CA0C 4MPUA 2BD5A 1O36A 1AVGH 1VCWA 2VH6A 1FUJA 3NZIA 3LGWA 1P0SH 2TPIZ 4CH8B 2FZZA 1GVKB 3KQDA 1EJNA 2C90B 1Y5BT 1ZPBA 2FTLE 1FPCH 1QQUA 3H5CB 1VCQA 2BY6X 4AGKA 3EDXB 2ZGCA 1ZTKA 2PGBB 3M7TA 1S0RA 4AG2A 1BMMH 1NRNH 3ZZ6A 1OP2A 4VGCB 3ATKA 3LIWA 1TFXA 1KTSB 2BD9A 3UR6A 2WYJA 3RXLA 3KCGH 1ZYOA 1DUEA 1BIOA 1HNEE 1NS3A 5LH8A 1Z71A 3BEIB 1GBMA 4BAQB 2AFQB 3LGIA 1C5MD 4ISIH 1O3HA 4ABFA 2W3KA 3STIA 1YCPH 1S5SA 3JZ2B 1GBIA 5B6OA 1UTLM 1Z1JA 1BDAA 1AQ7A 4U30A 4BXWA 1RD3B 1EAWA 2BTCE 7ESTE 1GHWH 2XC4A 4BANB 1BTXA 1OKXA 2BDGA 2WYGA 1YPEH 1LQEA 1ELFA 6GCHG 1TPPA 1UTJA 5I25A 2ANWA 2Z9IA 2FOBA 3F9FA 1KLJH 4YT7H 1LHGH 3HPTB 2ZO3H 3SV2H 1RTFB 2KAIA 3MYWA 1TGCA 1AKSB 4AFZA 1XX9A 1EXFA 2CMYA 1BRUP 2BHGA 1ZJKA 2OC1A 1L0ZA 2A7CA 3EA9A 2R3YA 1D6RA 1U6QA 1W0YH 1X7AC 1GCDA 4X2WA 3TVJB 1TRYA 1J17T 3B9FH 2G5VA 1CO7E 3T5FH 2SGEE 1V2MT 2O8WA 1PPGE 2UUKB 4Q7YA 5DP8A 3PMBB 1CHOF 2QV1A 2XWAA 1YPLH 3MU8A 1GJCB 1HIAB 1TGSZ 1UHBA 2A5AA 2I6SA 1O3MA 2A5KA 3SHCH 1C4Y2 3I78A 4JZEH 1MD8A 3ZVBA 1GPZA 3SNCA 3PM3A 5C20A 1CSOE 1QA7A 1GWAA 1C1SA 2OC7A 4VGCC 4KKDA 2NU4E 1MKWK 3S69A 3AASA 3CS0A 1GCTC 3TK6A 3SV8A 3RXHA 1JOUB 5HGGA 2J94A 1W8BH 1GBCA 4TPYA 3MNBA 3PMJA 1P9SA 5EPNA 2BDAA 4GSOA 3RXBA 2W5EA 1UTOA 1KDQA 5FBEA 2ZDNA 4GPGA 2Z9LA 4JZ1A 1GHAG 2FXRA 3ZYEA 3T28A 2O8UA 1EZXC 1KXAA 2PSYA 5EQRA 4CREA 3VGCB 1AVWA 1FN8A 1AZZA 1GG6B 2GV6A 3BEFB 1ANDA 5FXLA 5HYOA 3P17H 3SNAA 1A5HA 2WV5A 3QWCH 2O9QA 1O3GA 4BAKB 5GDSH 1SB1H 2G55A 1IHSH 3FANA 5TCAA 2SFAA 1MD7A 2GKVE 3LGYA 3M35A 1SVPA 4UDWH 4A1VA 1O30A 1SGPE 1NRRH 1XMNB 1BRCE 4BTTB 1MUEB 1C2JA 3AAVA 3S9AA 1YLCA 2JH0D 4XFQA 2BDCA 2TBSA 2ZHQH 5FHTA 1ZJDA 2UWLA 5BPEA 3EYDA 5DJ7A 4ZXYH 4YOJA 2SGFE 3SZNA 1ANBA 2ZZUH 4Y8ZA 1WOFA 3U98H 3V0XA 1HUTH 2BY8X 4ZUHA 5E2OA 1XVOA 1GMDF 2ZFPH 3RC6A 1E37B 2ZPSA 2FODA 1ETRH 1M9UA 4DW2U 4ABDA 2TGTA 1IQHA 5C5NA 4ISNA 1RS0A 1G32B 1EKBB 1A5GH 1QL8A 1ESBA 1K28D 3PWBA 4KELA 3GCTF 4CRBA 2D2DA 2BY7X 2A4RA 3I29A 1BRBE 1SGRE 2AEIH 4O3UA 3PTNA 4YTAA 3RXTA 1P2KA 1ZHMA 4DURA 2H9EH 3GY8A 1TPOA 3OYPA 4HI3A 3UNRA 1Z8GA 3RXPA 5GXPA 3BTEE 5E2PA 3TNSA 4AN7A 3O8BA 1TX6A 1TOCB 5DKMA 1UTKA 1LKAA 2ZF0H 4JK6A 1CU1A 3MU5A 4NIYA 5I46H 2FEQH 2HALA 2Y5HA 4HZHA 1MU6B 2Z94A 2HVXA 4JZIA 4YOIA 1HV7A 1CT0E 5AF9H 3GCTG 3RU4D 2FOGA 3RXDA 3UFAA 3A80A 5T6GA 5DG6A 2CF8H 5DP3A 3TIUA 1GI0A 4B73A 5EG4A 3ZZ4A 1PFXC 3ZZ3A 3M3VA 1CT2E 4ZKNU 4CHAB 1VJAU 4AFSA 2ZP0H 3ATLA 4JYUH 1LVMA 3A7VA 1O3BA 1OOKB 1AD8H 1E38B 3SGQE 4B2AA 2FI3E 3MHWU 2H2ZA 2Z3DA 1NY22 1PJPA 1Y3VA 4E7NA 2G00A 2HNTC 3SGBE 4WY3A 2P3TB 1SGCA 4U2WA 2BLQA 3MO9A 3ZZ7A 3RXFA 3ELAH 2GZ8A 2VWOA 1FNIA 3O8DA 1PQAA 4RSPA 5K7RA 4IN1A 1FY3A 2BOKA 2XYAA 1DICA 4GCHG 4NIWA 1YM0A 3SW2B 4X1SU 1G3BA 1V2KT 2PW8H 3M5MA 3SV6A 1ZGVA 1ELTA 2WUCA 3SUGA 1IQKA 4ASHA 3P70B 1WQVH 3NK8A 4NG9H 4B76A 1P2NA 1IQFA 3DD2H 2VIWA 1OXGA 1GJ8B 1BBRH 2F9NA 1THPB 1KLIH 3GY6A 2O8MA 4BNRA 1FIWA 3AW0A 2F3CE 3HK3B 2GVFA 4FVDA 3ZVEA 1C2KA 1IQGA 4X0WU 1H8DH 4IC5A 2HNTE 3K9XB 2AIQA 2FPZA 1S82A 1IQMA 5DP5A 2A31A 2Y82A 4TY6A 3NKKA 3UOUA 1GBFA 3SO3A 1HAPH 1IQEA 1C5VA 1P2IA 4ZKOU 3L33A 4OGYA 3Q3YA 3SORA 3STJA 1NRSH 2JKHA 3LKWA 3P8GA 3U8TH 3TK9A 3UIRA 5T6DA 2ZDMA 2H9TH 1E35B 1P06A 5EGMA 2ODQA 1MCTA 1CE5A 4TYDA 5TJXA 2P3FH 1DE7H 3LC5A 3QO6A 4TPIZ 4E7RG 3U69H 2QXGA 3TH4H 1NPMA 1HAVB 1C1WH 1OX1A 4MPVA 1KIGH 1SGEE 3I77A 1BT7A 1RGQA 1WSSH 2UUYA 3BIUH 1GMHG 1V2OT 3T29A 1O32A 1TOMH 1T4VH 5DGJA 2H6MA 3RM0H 1QGFA 4AYVB 1EATA 1A61H 1P2QA 2WINI 4YLQH 3UQVA 2QC2A 5GIBA 1CGHA 3PO1C 1TA6A 4K3JA 1CA8B 3HGPA 1GHZA 4B74A 4B2CA 1OWHA 1F0UA 2FX4A 1UK3A 5JB8S 3S9BA 2DE9A 2AMPA 4Y8YA 1ZRBA 1MZDA 1P3EA 4Y6DA 1GJAB 1O5CB 2CHAC 1EJMA 2B0FA 3RXEA 1P09A 2P8OB 1RJXB 2CF9H 1YC0A 1C2LA 1HIAA 1UHBB 1HJAC 3A88A 1TE0A 1G36A 4X1PU 3LC3A 4GVUA 4Y0YE 4LZ1H 1C5RA 5DPAA 4LXBH 4UEHH 1Z6EA 4I8JA 2STBE 1ZSLA 8GCHF 1QHRB 1ZMNA 6ESTA 1Y59T 1ZHPA 4WH8A 4I31A 2FLBH 3LDXH 2IJOB 3SNBA 3HGNA 2ZU4A 1HAHH 1BJVA 2Q6FA 3UR9A 1G30B 1BB0B 3KN2A 1D3DB 4DIHH 2ZHFH 3BIVH 2Y5GA 1FY1A 1HAXB 1P3CA 3LH3A 2BX3A 3ATIA 3GCHB 3IITA 1A7SA 1ANCA 1IQLA 1QBNA 1A5IA 1QNJA 4HFPB 5EQSA 4BAMB 1A2CH 3U1JB 1DT2A 1OWDA 3C1KA 1DWEH 5HMAA 1YP9A 1QQ4A 2OBQA 4XSKU 2ZNKH 3RLYH 3NWUA 1YPGH 3NXPA 3A7XA 1FY4A 5C3NA 3C27B 4NIVA 3T62A 1P03A 4K8YA 2BVRH 2XNIA 1F2SE 3NUMA 1ZMLA 1HJ8A 4O9VA 1GI5A 3OTJE 1ESTA 1TQ0B 2A7JA 3V13A 1TB6H 2NU3E 3NPSA 5CHAC 1MKXH 3RMNH 5C1UA 2VNTA 2GCTC 2NU0E 1ZSJA 4I8KA 1NFYA 1A46H 1YPJH 2QCYA 1NZQH 1W12U 4WWYA 3A8CA 3TU7H 2BDHA 2ZTYA 1O2RA 3PV4A 4X6PA 3BTKE 1MZAA 4F49A 2ESTE 1O2IA 1MCVA 2VVUA 1SFIA 1ELGA 3W94A 1GBKA 3MWIU 2ULLA 5JBBS 3UWJH 1OYQA 4OS6A 4PROA 4AFUA 4XE4A 3VEQB 3ODDA 3A83A 1HRTH 3RXGA 1BMAA 1QFKH 1AIXH 3LOXA 2Q6GA 2XCFA 5IDKA 1UCYE 1KXFA 1D3TB 1O0DH 1WBGB 5L2YH 3ZVAA 2V6NA 1ELCA 3V12A 4K5ZA 1LHCH 1WYKA 5EPYA 1DDJA 1TGTA 1OS8A 3ZVFA 1RIWC 4ABAA 3MMGA 1H4WA 3S7KB 2ZGJA 1GHXH 2QN5T 4SGAE 1P57B 1T8OA 1ZGIA 1MAXA 1P11E 7GCHF 2C8WB 4JZDH 3E0PB 3QLPH 3AW1A 1F7ZA 1N1LA 1MTNB 2G4UA 1T32A 2J2UA 1KSNA 3BSQA 4FXGH 1ZRKA 3H7OA 2FESH 1CQQA 1ZPZA 5JDUB 2ZFTA 1AVXA 1O3AA 3MO6A 4AZ2B 1O2XA 4BTIB 1BTYA 2GT7A 2QXIA 2RA0A 4WH6A 2IPHA 3IWMA 1HBTH 2A32A 2ZFRH 3E1XB 3SJ8A 1AFQC 1EB1H 1SGYE 1SOZA 2BD7A 1C5UA 2ZIQH 1LVBA 1P2JA 4IS5A 1TPAE 1O3OA 2B8OH 4RKOB 1N8OC 3ATWA 5JYIA 4X1NU 1TIOA 1TABE 1EAUA 1MQ5A 4RN6A 3OSYA 2EI6A 3UNQA 1TNKA 2AMQA 1LPZB 2ODPA 1BCUH 2ALPA 5E0HA 1SSXA 3RU4T 4AGJA 5L6NH 3N7OA 1WAYB 1IQIA 1EP5A 2VVVA 3KHVA 3ZVDA 1BUIA 2P16A 3OU0A 3DHKH 3A89A 3LJJA 4OS5A 1TLDA 4X1RU 2QXHA 4CRFA 1THSH 2OUAA 1GJ9B 7GCHG 5HXFA 1S0QA 4MVNA 4OS4A 1SGQE 4A92A 1TONA 1INCA 3SN8A 1HLTH 2YNBA 3F6UH 3FZDA 4FU7A 1MBQA 4NGAH 4ABJA 1S6HA 1O2OA 4OS1A 2FP7B 2P93A 1QJ6B 4D7GA 3P8OA 1JMOH 1BA8B 1P12E 2H9HA 8ESTE 1V2QT 1SGTA 2J4IA 3RXSA 5LPFA 2ZTXA 4GHQA 2HGTH 1F5RA 1TNJA 1CBWC 2Y80A 2G4TA 3UY9A 2ZCKP 4Y76A 4X6NA 1LVYA 1N6YA 4NSYA 1SQOA 1AU8A 2BB4A 3UPEA 1ABIH 1MKWH 1DVAH 2PUQH 1T4UH 3VB5A 4CR9A 3SU2A 3GY7A 3LGVA 1RRKA 1TBRH 3KQEA 1O2VA 1Y5AT 5JB9S 3ITIA 5BRRE 1GL1A 2GZ9A 3A81A 1HDTH 4X6OA 1AB9C 4ZXXH 1YCPK 2ZGHA 3P8FA 3TJUA 3SV7A 4O97A 5EODA 1BTPA 1OPHB 3QTOH 4IMQA 4WJG2 1GHYH 3SBKA 1EZSC 1UTPA 2VIDA 1L4DA 9LPRA 4I8HA 4ZHLU 3AVZA 1SGIB 5C67A 4BAOB 1GBTA 1GDUA 4NFEA 4X2XA 1PPCE 4UFEH 1GI9B 1GI3A 3UREA 2ZPQA 1FZZA 4FUJA 2R0KA 1G3CA 3TLOA 1EX3A 2QY0B 1Q2WA 2FLRH 4K69A 3LJOA 4YT6H 4ZH8A 1FQ3A 2D1JA 3F9HA 4O03A 3BG4C 5JBTA 2ZDLA 1G37A 5JBCS 1TALA 1P2MA 1AE5A 1ANEA 2Z9KA 2F91A 3GDSA 4FUCA 2HOBA 2PLXA 3GDVA 4H4FA 1O2NA 4FUIA 4WF8A 2P59A 1C1RA 1EZUC 3Q00A 4K1SA 1CVWH 3PLKA 1BZXE 1AWHB 2GCHG 1VGCB 2VGCC 1O2MA 4MNXA 4AX9H 1GJ4H 1O3DA 1D6WA 2DE8A 2QXJA 1FY5A 3KNXA 1N6XA 1SQAA 2BVSH 1UCYH 4B2BA 1Q3XA 2WPKS 2ZEBA 4JCNA 9ESTA 1AUTC 2BDYA 3U8OH 3M5LA 1QCPA 1GBBA 2PTCE 1O3EA 1E36B 4Q7ZA 5A0BA 3A8BA 6CHAB 3EA7A 1BMNH 1C5PA 1GDNA 4GHTA 2EEKA 1PQ5A 1SPJA 1ABJH 1O39A 3GY5A 1ARBA 1DLKB 2SGAA 2XWBI 1FLEE 1PPEE 4ZHMU 1MTUA 4MPXA 1EPTA 1GJBB 2R2WU 3MH6A 4YO9A 2ZFFH 4DGJA 1EJAA 5F6MA 2GV7A 3MH7A 1RTKA 1NESE 3PROA 3MNSA 4Z6AH 1V3XA 3SJ9A 1SHYA 1G2MA 1ELBA 4X2YA 1V2WT 1MH0A 2CGAA 2FTMA 2NU1E 1O2SA 6LPRA 1ETSH 2D8WA 2Q6DA 3VB6A 2SGDE 2GMTC 2AYWA 3K6ZA 1GBEA 1GI1A 2G51A 2OLGA 1TWXB 3UOPA 3RC4A 5HM9A 2J34A 3KQCA 4ZAEA 4NFFA 8LPRA 3FFGA 3BTTE 3A84A 1O2QA 1F0TA 5FCRA 1NU9A 5FBIA 1IAUA 2O8TA 2B7DH 1JXPA 2W7UA