1GVKB

Porcine pancreatic elastase acyl enzyme at 0.95 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDE INHIBITOR
publication title X-Ray Structure of a Serine Protease Acyl-Enzyme Complex at 0.95-A Resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gvkB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gvkB01
2BM2A 4ZXXH 1WSSH 3B23B 3GY7A 2XW9A 4B2BA 2AGGX 3FP8E 5TCAA 1S84A 2OC7A 2RG3A 1O3IA 1X7AC 2OUAA 1V2UT 1S6FA 2UWOA 4CRGA 1C9PA 3PROA 1LVYA 3SNEA 1QJ7B 5GDSH 1O3LA 1OP0A 2PLXA 1UTLM 1C5LH 1ZTLA 2G4TA 1UVSH 4OS5A 1F0TA 1Q2WA 1O5GH 1ZHMA 1SGCA 5B6OA 2R2MB 1ELFA 4E7NA 1AE5A 1GGDB 1ZPZA 5DKMA 1MAXA 1EAWA 1GBCA 2A31A 3BEFB 3M35A 5EOKA 1HAZB 2F3CE 1GMDF 4Z6AH 1ELVA 3RC5A 1DE7H 5C67A 4IN2A 1RJXB 1WYKA 3RM0H 2M5TA 4B74A 2ZGBH 2ZU5A 1KXAA 1PPZA 1N8OB 4CRBA 4X6OA 1Q31A 1DS2E 2ZCHP 2ZQ2A 3ATLA 2ANMH 5DP8A 1QY6A 1T32A 4H4FA 4GCHG 5K0HA 1H8IH 3M3TA 3FZZA 1D6WA 3MTYA 2FI5E 2O8UA 1GJ7B 1BTPA 1C9TA 4DT7B 4XOJA 1CGHA 2ZTXA 2AMQA 1M9UA 1XUFA 2Y6TA 2ZI2H 3MH4A 4Y76A 1ZMLA 1ID5H 2BD9A 4DY7B 3QZQA 4AG2A 1THRH 4I8GA 8LPRA 2FLRH 2J4IA 1BTUA 2VWLA 1JWTA 2IN2A 3W95A 3TGJE 1C1VH 4K8BA 1YPHC 3SU5A 5F6MA 1AFQC 1K2I1 1PPGE 2RA3A 3A7XA 1UTQA 2KAIB 4Y0ZE 5JYIA 1OP8A 3V0XA 2XBYA 3D62A 5A0CA 2XXLA 1C2DA 3U9AH 3AW1A 2XTTB 1G3DA 4Y11E 3OU0A 2Z94A 4X1NU 1NFWA 3SUDA 2P93A 2F9UA 1AMHA 2H2ZA 5FPTA 1B7XB 1J9CH 3MU8A 3ZZ5A 4ZXYH 2H5DA 3B8JA 4A5TS 1C5MD 3A7TA 1EZUC 3MI4A 4RKJB 1KTTB 3TJNA 8GCHG 1KLJH 5JBAS 5E0GA 1A61H 5T6DA 2ZFPH 4CRDA 4NIYA 1FDPA 2CHAC 2Q6DA 5E0HA 1P9SA 1MAYA 2OC1A 1TRNA 2QV1A 1H9LB 1JRTA 1L0ZA 3ZZBA 1RFNA 2HNTE 3T2NA 1D3PB 2SGFE 4JK5A 1TNLA 1NT1A 2XC5A 3GY4A 4HGCA 4ZH8A 2WYJA 3U69H 4DIHH 1CQQA 5FPYA 2Z9GA 4Y8ZA 1HAVB 1TPSA 1UO6A 1OYTH 1G2MA 1GVZA 1W8BH 2FYQA 1GJ6A 3K6YA 5EW1H 4FUGA 2GMTC 1QBVH 1BMMH 5CMXH 4AFZA 1OWIA 4WY3A 4I8JA 4NZQA 2VU8E 4A7IB 5I46H 5T6FA 1SGQE 1RD3B 1PPCE 1EAXA 4ASHA 3HKIB 4CBOA 3Q3KA 4NWKA 4YM9A 1Y5AT 4X2VA 1HGTH 1N1LA 2ZQ1A 1FAXA 1C1SA 2ULLA 3T26A 3DA9B 4CRFA 1OKXA 3QGNB 1FONA 2PGQB 3ZV9A 2BLVA 3IG6B 4RKOB 1PYTC 1AU8A 4DJZB 1S85A 4DIIH 4E05H 2BLWA 4NG9H 4IW4E 4ABEA 3R0FA 2OINA 1O5FH 2LNCA 4ISLA 4AORA 4UONA 3RXVA 4YT7H 1O33A 1Y59T 4TYDA 1GMDG 5DP5A 5IYTA 1G32B 1SGIB 1O2LA 3LGYA 2H6MA 1LTOA 3MWIU 4I8LA 3ODDA 2P59A 1O2YA 1Z6JH 1Y3XA 3AAUA 5JBTA 1C2EA 4D76A 4JZ1A 3MO3A 1QBNA 3G01A 2JETB 2ZU1A 3ZZ6A 1W12U 2ODPA 3RXAA 1MKXK 3LIWA 2WPIS 3A86A 3ESTA 2BDIA 1G9IE 2D2DA 1TRMA 1HFDA 3MNSA 1TYNA 2BX3A 2TIOA 2W3KA 1O2KA 2J95A 5J4QA 2PKSB 1K28D 2VIOA 1A7SA 1AO5A 1V2MT 2JH0D 1GJ5H 2VB0A 4R8TB 3VB3A 3LGVA 4KKDA 1EOLA 2EA3A 1EPTC 1OOKB 3MH6A 4XDEA 2FESH 3BTWE 4FXGH 1LCYA 4BTTB 1GHAF 1TNJA 5ABWA 1YPJH 4BTIB 1GI2A 3TGIE 4NA7A 5HXFA 1E37B 1TMBH 1GJCB 1QRWA 3LKWA 1MTUA 4NA8A 2VIPA 1LVOA 3A8DA 1O3AA 1LVBA 2LPRA 2P3TB 3GCOA 1W0YH 5GXPA 1ZLRA 2JH5D 1C4V2 2FEQH 3GYLB 3SOSA 3ZVEA 3MU1A 1BCUH 1P3CA 2ZDKA 1F5RA 1TGSZ 2TBSA 3LU9B 2ZTZA 2B7DH 3E0PB 1K1OA 2FMJA 1A0JA 2G4UA 1AZZA 4DGJA 1LPKB 1O2SA 1SHYA 1KXFA 2UUKB 3WY8A 3CP7A 1P06A 1KIGH 1QBOA 1SOZA 5EPYA 3E0NB 5FX5A 2CHAB 1MBQA 1WTHD 3VXFH 2ZFFH 2ZDVH 3C27B 3UIRA 1PFXC 1QRZA 4FU7A 4ISIH 2Y7XA 1QQ4A 3EA7A 2ANYA 3B9FH 1IAUA 1YBWA 1QNJA 3GCNA 4TPYA 2VWOA 4Y8XA 1MQ5A 2P8OC 3T25A 1O34A 4BAMB 5AFYH 1C5XB 3BTHE 3UR9A 4CR9A 1LQDB 1F0RA 1ZGIA 1DVAH 4XBCA 1VITH 5CHAC 1DPOA 1QIXB 1WAYB 1FJSA 2TGDA 1GBHA 1UTPA 2ZDAH 3ZVCA 3RXFA 1MH0A 1F5KU 1P01A 2FDAA 2ZC9H 1QL7A 1TABE 3QWCH 2FI3E 1BQYA 1BTHH 2FLBH 3UQVA 2Z9LA 1DANH 3UTUH 3URCA 4B2CA 1C5OH 4MPXA 1YPMH 3RXMA 2ZPQA 2FOMB 3BTKE 1ABIH 3EDXB 2BVSH 2ZDLA 5DP4A 1C2FA 2GZ9A 3ZYDA 1QA0A 2ZDNA 1EJAA 1O2IA 5JPMH 5A2MH 1ELBA 1SQTA 1ACBE 3T27A 2SFAA 1BBRE 3STIA 1WQSA 4HZHA 1WU1A 1O3EA 2OC8A 4PROA 3KEEA 4NCYA 4ZUHA 1A2CH 4LOYH 3M37A 1YPKH 1GHBG 2BD7A 1FNIA 2AMDA 3ZZ4A 4Y6DA 1BJVA 2GDDA 3GDVA 4X2WA 3EE0B 3MH7A 3SQHE 2Y5FA 1GHYH 4FUHA 3VGCB 2Y80A 1IQIA 1KXBA 5IDKA 2SNWA 2F9NA 1Z1JA 2ZFSA 5A8XA 2EI8A 1O2UA 1KXEA 1CGJE 3RU4D 2J92A 2BD4A 1O36A 2BXTH 1LO6A 1NRSH 1O2TA 1O2MA 1P12E 2NU1E 2ODQA 2Z9JA 3VEQB 1ELGA 1NS3A 1Z71A 3PMJA 3AAVA 2A5AA 1Y5UT 4I7YH 4LK4A 2ZPRA 1UMAH 1UK2A 2P94A 3BTME 2EEKA 2FWWA 2BQ6B 3MHWU 4KTSA 2IPHA 2BDGA 3CS7A 1Z1IA 2TRMA 5F8XA 3PLBA 1UVTH 2ZGXH 5LPEA 1G2LA 3T28A 2FOCA 3SU3A 3TPIZ 4CH2B 1P3EA 4Y7AA 1JMOH 1V2NT 3ITIA 4IC5A 9ESTA 4WXIA 3A83A 3KQCA 1GBFA 4WXVA 1E38B 2TGAA 3UPEA 1IQLA 2UUFB 1GHAG 3D65E 1Y3UA 1ZTKA 2DE8A 3TK5A 1MZAA 5DK1A 1GBJA 1TGTA 1BJUA 1ELDE 1YGCH 4X8TH 1HJAB 2VINA 5E0JA 1GCTB 1HV7A 3PV4A 2NWNA 2WV4A 2KAIA 3A7ZA 4XBDA 2BY6X 2WUBA 2OCVB 2W3IA 1TFXA 1O38A 3PO1C 1DXPA 3QUMP 3JZ2B 1O32A 4AN7A 1DICA 1MKWK 1AE8H 2TGPZ 4BAKB 1A46H 5J4SA 4WMDA 5C1XA 1P02A 1B5GH 1TA2A 3SJ8A 5I25A 1O3JA 1C1OA 1PYTD 1W13U 4BNRA 2BY5X 2O8WA 1DWBH 1DX5M 2ZGCA 3L6PA 1D6RA 1MTNB 2ALVA 1YC0A 6GCHG 3O8RA 2G5NA 1PQAA 2NU0E 2QF3A 4R0IA 1O37A 4K69A 3LPRA 4FUIA 4ZHAA 3R3GB 1C2LA 3RU4T 4K3JA 1AZ8A 1XUKA 5EQQA 1RTKA 3T5FH 1KYNA 1H1BA 4GUXA 1OSSA 3V13A 2G51A 2GT8A 1DLEA 2Z7FE 2QF0A 5GJ4B 3UNRA 1EJMA 1IQJA 1AGJA 1HAVA 3S7KB 1A3EH 3QZRA 1O3NA 2GCTB 2WPJS 1NU9A 1SOTA 1V2KT 3BTDE 1DFPA 1CA0C 2Z9IA 3A7WA 3P92A 5AFZH 4UFGH 4CR5A 1TOCB 3M5OA 3SO3A 5CHAB 3RXHA 3A80A 1AB9C 5GIBA 1EZQA 2XBXA 1D3DB 1QB1A 2O8LA 5E2OA 5EPNA 4THNH 3RXLA 1KXCA 1O3HA 2ALPA 3FP7E 4JYTA 4O03A 4XSKU 3S9AA 1AUJA 4J2YB 4X8UH 5E2PA 5DGJA 3PYHA 3EAJA 4INKA 2ZNKH 1TX7A 4AB9A 3RU4E 2TPIZ 4O9VA 1ZJKA 2H9EH 2OC0A 1BMNH 3EGKH 2OTVA 1V2QT 3H7OA 1GJ4H 2YOLA 1SLVB 1RTFB 2PW8H 2QGRA 1TPAE 2FM2A 3EA8A 3MMGA 3V12A 2FOBA 2PHBA 1P2KA 5ESTE 3A8BA 4X6NA 3HKJB 5H4IB 2A5IA 1TBRH 2AERH 3SQEE 1TQ7B 2I6SA 1SGFA 3I78A 2FS9A 1L2EA 1HB0B 3E91A 2SGAA 1NRPH 2DE9A 3D49H 6CHAB 1O3KA 1P05A 2ZHFH 2D8WA 2GDEH 3PLPA 1HCGA 1AKSB 5FAHA 3BSQA 3A87A 4JMYA 4CHAC 3ATKA 1C4U2 1P8VC 2HWLB 2H9HA 4YOJA 1UCYE 1SR5C 1TB6H 2O9QA 3AVZA 3DHKH 4U01A 2HNTF 3ELAH 2D26C 4D9QA 1G30B 3NWUA 4UEHH 2CF8H 3F1SB 1XX9A 4Y71A 1Y3VA 1TBZH 2VIDA 1SGEE 1A5GH 1EXFA 1UTOA 2A7JA 4ABAA 5C5NA 1CBWB 2J38A 1O2XA 2YNAA 3MNCA 1SGDE 3RUOA 4DURA 4FUEA 4I31A 1UHBB 1VGCC 5DP7A 2Z3CA 7GCHG 2ZPSA 1ZOMA 2CJIA 3RMLH 2P16A 4XBBA 1HUTH 1G3BA 1JRSA 1PPFE 2FOAA 1D4PB 2ZECA 1DWCH 3F68H 1HXEH 1XUGA 1DUAA 4A92A 2VGCC 4DVAU 1VCPA 1GG6B 1K9OE 1XXFA 1OYQA 1O2RA 4Y7BA 1CT0E 1O39A 1PPEE 2I6QA 2Z3EA 3QLPH 4YO9A 2ZF0H 4IS5A 4X2YA 3A84A 2ZU3A 3KF2A 2RA0A 5FBEA 1IHTH 4UDWH 1DWEH 1DDJA 1GBBA 1ZMJA 4AG1A 4K1EA 1NTPA 2BD8A 3F9GA 1VCWA 2R0KA 4Q7XA 2A45B 3E3TA 1ESBA 4ZKSU 1E35B 1IHSH 1TOMH 3GCHC 1O3DA 3MO6A 1K1JA 1OX1A 1ANBA 1SVPA 1JIRA 3E6PH 4Y0YE 4Q7YA 1T7CA 2V6NA 4FVBA 3D23A 4BAQB 1K21H 1AIXH 1GI5A 3BEIB 1S0RA 1UTMA 1UCYK 2PSXA 2NU3E 2WPKS 3DUXH 4X1PU 1C5UA 1A0HB 3TU7H 1GI4A 3RXQA 3STJA 3T62A 1DY8A 5L2ZH 1P10A 1MBMA 1C1TA 1EAUA 3RLYH 1EB1H 2ODYB 1SB1H 2BVXH 4O97A 1VR1H 3TITA 3UUZA 1A5HA 1AVGH 1DT2A 1QA7A 2AIPA 2A5KA 2OXSA 2ZHDA 1EQ9A 4F49A 1K1NA 3SGBE 1BT7A 5L2YH 1GBIA 1AWFH 3T29A 3SUGA 1NC6A 2VH6A 2ZFTA 2ZHEH 1XUJA 4ABFA 3EA9A 1PQ8A 4BXSA 2BDYA 1UJ1A 3MFJA 1EB2A 4K8YA 4GPGA 1CT4E 1WV7H 1JIMA 1L4ZA 3RXJA 1FPHH 4H6TA 2XCNA 1LPZB 1GBAA 2J9NA 4WJG2 1MD7A 5FCRA 1C5QA 4MPVA 2H5CA 1SQOA 1SSXA 4RSPA 3ZV8A 1HAIH 4YLQH 3S7HB 3S9BA 1MTSA 1YPGH 2BZAA 2VVUA 1GI9B 3NXPA 1ESAA 3TJOA 2ANWA 2FTMA 5FPSA 1Y5BT 4OS2A 1GHBF 4O3TA 2SNVA 3ATIA 2SGEE 1SLWB 2BXUH 2BD3A 1P2QA 1ZHPA 5EQSA 1P0SH 4ZKRU 1T8NA 3BTQE 1NRQH 2OQUA 3U98H 2G5VA 1TRYA 5LH8A 4CREA 5A0BA 1S5SA 1ZSLA 2P95A 2A2XH 3P8OA 1GBTA 3VB5A 2XC0A 4GLYA 2IJOB 1C5YB 3RXIA 1J15A 1XKAC 3LH1A 4ISNA 3IITA 1RIWC 1SGTA 3QTOH 2BD5A 4A1XA 4WF8A 1AVXA 2FTLE 3JZ1B 1LPGB 3KN2A 4H42U 3VB7A 2CF9H 3S69A 1AFEH 1GHXH 4BOHA 2VGCB 3SNAA 1BTXA 4MDSA 1IQEA 3RXPA 1GJBB 4X8SH 1T8MA 3M5NA 4M7GA 1AHTH 1BUIA 1PJPA 2HNTC 1O2QA 2R9PA 2Y7ZA 1HAGE 5EODA 2OBQA 1P11E 1LHGH 1TBQH 1O3PB 1SC8U 1TQ0B 1AFQB 1G3EA 1QB9A 2XWAA 1J8AA 2PTCE 1MCTA 1GWAA 1QURH 5JDUB 1AY6H 1MD8A 3TH2H 1G37A 4BAHB 2ZDMA 1TLDA 2GTBA 1FY4A 3NUMA 2C90B 2ASUB 1GJAB 1S0QA 1PQ5A 1NZQH 1SFIA 3BIUH 3LJJA 3RP2A 3ZVAA 3A8CA 1DUEA 4GVUA 3VFEA 1XXDA 4K5ZA 3KL6A 2YNBA 1NY22 2FX6A 1AUTC 4RN6A 3SW2B 2J34A 3RMNH 4KELA 2OP9A 3F9HA 1V2WT 1EZSC 2ZTYA 3TNSA 1FZZA 2VNTA 2F83A 3BG4C 1QL8A 6GCHF 1GPZA 1MKXH 4NA9H 5HM9A 4VGCC 3TIUA 1BHXB 1TNGA 2DUCA 2CMYA 1TPOA 2XC4A 3Q77A 3K65B 1BMAA 1EP5A 4K60A 3RDZA 3PMHB 1BA8B 3FANA 1E34B 1Y3WA 1Z7KA 3M5MA 1J17T 1YP9A 3RXCA 1QJ1B 4J1YA 1O2GH 1C1RA 3BTGE 1O2HA 3GDUA 1HJ9A 2HPQH 1FPCH 5C1YA 3KCGH 1RS0A 1YCPM 2F9VA 3BTFE 4TPIZ 2XBWA 3OY5U 1J16A 2V0BA 1BB0B 3DT0H 1CHGA 2BTCE 3FVFB 1DLKB 2GMTB 1O0DH 2O8MA 1HRTH 4WMEA 4UFEH 1K1IA 3GY3A 2W7UA 3QX5H 1TONA 3UWJH 1ETRH 5HMAA 1GBLA 2QC2A 5EXLA 4BXWA 2QN5T 1NRNH 1Z8IB 3GYMA 1BRCE 2BX4A 1O2WA 1THPB 1ZR0A 2AFQB 3EQ0H 3SU6A 1HBTH 1EATA 1H9IE 1FMGA 1T8LA 3U8RH 3P17H 5DP6A 3LGIA 3RMOH 2EC9H 1CU1A 1ZJDA 3UNQA 4QT8C 3BTEE 2BVRH 1IQHA 1O2NA 4ABGA 3TVJB 4B2AA 1G36A 1FI8A 1KLTA 1P04A 4JZFH 1GI6A 1AKSA 1C5NH 2A7HA 1BMLA 1TAWA 4OGXA 1C1QA 1W3CA 2HPPH 2ZGHA 1ZPCA 1QRXA 1DSTA 2ZEBA 3RM2H 4KTUA 2NU2E 3GCTG 4ABJA 5T6GA 1ZGVA 3A7VA 1V2JT 2PKAB 5G4BA 5LPRA 1C1PA 1XMNB 1FY3A 1ZSJA 4D9RA 2A4RA 1A0LA 4IMZA 1SG8B 1KY9A 1EZXC 4ISHH 3PMBB 2ZGJA 4MNXA 4FU8A 1UK3A 1TX8A 1YYY1 5EU8A 3RLWH 3TLOA 4MPWA 4NGAH 2OQ5A 4Z0KA 3SJIA 1D3QB 1ELAA 3SV6A 1GL0E 1HJ8A 1UHBA 2C93B 2GZ8A 1CE5A 1PPHE 5C2ZA 1F5LA 3ZVBA 3E1XB 2IOTA 5ETXA 4E06H 1O3OA 4FUBA 4BAOB 1CSOE 1V2RT 1GGDC 4B71A 2F9PA 4D7FA 5A09A 1NFXA 1NU7B 1S82A 1O5CB 1ZPBA 2GZ7A 5L6NH 3SI4H 5SGAE 5L30H 4MNVA 3NZIA 4FVDA 4NIVA 4NSVA 1HIAB 1EPTB 5EW2H 1N8OC 2UWPA 1NFUA 1T31A 3BIVH 2Q6GA 3UNSA 3ZZCA 9LPRA 3S9CA 4UFFH 1XUIA 2AMPA 1LKBA 1OXGA 3OTJE 7GCHF 1W11U 1LMWB 3AW0A 1QFKH 1TNIA 3N7OA 1QQUA 1UTJA 4JCNA 2W5EA 1C2KA 4LZ1H 1GDUA 5TCCA 1H9HE 3HK6B 1BOQA 1ELEE 1H8DH 2FO9A 2FXRA 1SGNE 1TPPA 1WQVH 4ZMAH 1L1GA 3ZVGA 1DY9A 1ORFA 1W0ZU 3DD2H 2BHGA 2VWNA 1O30A 4JYUH 2A0QB 2Z6BD 4B75A 4FUCA 1MU6B 1GHWH 1MTVA 4I33A 2ZA5A 1KLIH 2BB4A 3ZZ9A 1N6XA 2O8TA 2SGDE 3M36A 3RMMH 2JKHA 2XNIA 4CBNA 4AOQA 1IQKA 3NCLA 1C5WB 1L1NA 1S81A 1EKBB 2GCHF 2D1JA 4BTUB 5F8TA 3SV2H 1YPLH 3QGJA 1MMJN 3Q76A 1CHOG 1ETSH 3QK1A 4JK6A 2VIVA 4A1TA 2AGIX 1AD8H 7KMEH 2BDBA 4K1SA 4TY6A 1DOJA 1O35A 3O8CA 3A82A 2F9BH 3SUEA 2K1QA 3UWIA 2P8OB 1SL3A 3P95A 1IQGA 3AASA 1OWDA 3PTNA 2ZWLH 1L4DA 4IBLH 1QCPA 2GKVE 5FX6A 3M7TA 3LH3A 5DP3A 1O3MA 1O2OA 1T4UH 1P09A 7ESTE 4Y10E 1UK4A 1P2MA 3RXBA 1YCPH 3ZZ3A 3SNBA 3SV9A 3F9EA 2BYAX 1YPHE 1V3XA 1BZXE 1BTWA 1RGQA 2GX4A 2ZFQH 1ELTA 1BBRH 1KDQB 1OWEA 4IMQA 3SI3H 3OYPA 1SGFG 1O2VA 1ZRBA 2ZCLP 1EUFA 4JZDH 1ARBA 2OD3B 4WH8A 4HI3A 3VB6A 1QR3E 1W14U 1ZYOA 1GI1A 1SMFE 2B8OH 1SHHB 3MU4A 3P8NA 3LONA 1MZDA 1TGBA 2V3HH 3VB4A 2ZU4A 3TK9A 3E8LA 2BDHA 5PTPA 3GY2A 3I29A 1C2HA 2ZP0H 1O2JA 2EI6A 5A8ZA 4NIWA 1BTZA 3BF6H 2B5TB 4KGAA 1FAKH 2FYRA 1BDAA 4GHTA 1JBUH 3SNCA 3LOXA 4TWYA 3TJUA 1SGPE 4DCDA 4ABDA 4JZIA 1TNKA 4NWLA 4WMFA 2GD4B 3E90B 1FUJA 1FN6A 1V6DA 2Z3DA 1K1LA 1QL9A 1JXPA 2C8WB 3GICB 4D8NA 4OGYA 4X2XA 5LGOA 5GCHF 1NFYA 1QGFA 1GJ8B 1DXWA 5EG4A 1EJNA 1GDQA 2PV9B 2A2QH 1HDTH 4SGBE 1TGCA 2WPLS 1P9UA 2G00A 1L1JA 3DFJA 1W7GH 1HNEE 2C8XB 1GI7B 2Y82A 1XUHA 1QHRB 4MG3A 4UE7H 3UQOA 3HK3B 1OPHB 2GVFA 2F9OA 3VXEH 3A89A 3CENA 1S83A 4ZHLU 1SPJA 4YZUA 3KIDU 2JETC 3TK6A 3QTVH 2BQ7B 3TH3H 3HGNA 1IOEA 3F6UH 2RCEA 4KP0A 4CH8B 2BDAA 1EX3A 4X1SU 4YESB 1AI8H 1WOFA 1V2OT 1CVWH 1FY8E 3PLKA 1FN8A 1C1UH 1GJDB 2PKSC 2VVCA 2HGTH 3PO1B 1YM0A 1FIZA 4MPUA 1VITF 4H6SB 2Q1JA 3SJKA 2G81E 3S0NA 3Q3YA 1O5AB 1N6YA 2FX4A 2ILNA 1SI5H 2FI4E 1GMCF 2ESTE 2ZHWH 4OS4A 1ELCA 3PWBA 2XBVA 2J94A 3M3VA 1HXFH 5FHTA 2R2WU 1Z8JB 3TNTA 2GCHG 1V2PT 3H7TA 1H4WA 1RRKA 1YF4A 4Q2KA 5A0AE 1VJAU 4OS1A 4IGDA 1LQEA 1Z8GA 4GSOA 1C2GA 5T3HA 4I8HA 1O5DH 3SV8A 4O3UA 1EASA 2BLQA 4I32A 1W7XH 5HGGA 2JH6D 4INLA 4A6LA 2Z9KA 3RXRA 2OBOA 1OWJA 4XFQA 1FV9A 3RXOA 2ZHQH 3P8FA 4YLUA 1A4WH 1DM4B 6ESTA 4X1QU 4U2WA 1GI3A 3OY6U 3GY5A 2Y5HA 1VJ9U 7LPRA 1CA0B 4LXBH 6LPRA 5DG6A 1SGRE 2G55A 2HRVA 4SGAE 1GMHG 3K6ZA 2V35A 2ZCKP 3MOCA 4U32A 3SGQE 1O5BB 2Y5GA 1TA6A 2QIQA 1B0FA 2ZU2A 1NN6A 1AB9B 3MNBA 2THFB 3GISB 2ZZUH 3UY9A 2VH0A 1WTGH 2V3OH 1ANEA 5A8YA 1ESTA 1D3TB 3ATWA 4ABIA 4AB8A 2GGVB 1AWHB 2CN0H 5GWZA 1O3CA 3L33A 4GHQA 4AFUA 4MLFB 1K1MA 4BANB 3OX7U 1UVOA 3NK8A 1ZHRA 2AYWA 5EXNA 3FZDA 1BTYA 1Q3XA 1GBEA 2Q6FA 4JZEH 4X8VH 1V2TT 5C3NA 1TMUH 1ZSKA 1ARCA 2QXJA 4ABHA 1MTWA 3UR6A 2WV5A 1IQMA 2ZKSA 2XYAA 2W26A 2AIQA 4FU9A 2PKAA 4B1TA 2HLCA 3UOPA 3SV7A 4TY7A 1CGIE 2SGPE 1CA8B 4LZ4B 2WPMS 3ATMA 3FP6E 1UCYH 1W2KH 2BY9X 2FIRH 4CHAB 3M5LA 1WCZA 1K1PA 5GCHG 4FUFA 1AQ7A 1MUEB 1XM1A 2BLOA 3SU2A 3LGWA 3V7TA 2ANKH 2C3SA 5C20A 1SBWA 3LT3A 2ZFRH 2QAAA 2H1UA 3VPKA 4X6MA 1IQNA 3GCTF 2CXVA 3M7QA 2FPZA 2OLGA 4B76A 3MYWA 5DJ7A 2VVVA 3VGCC 2FP7B 3TH4H 1NROH 4X1RU 2AEIH 1TNHA 3UFAA 1B0EA 1C2JA 1O3GA 2ZG0H 3SJ9A 3C1KA 3RXEA 2B0FA 2A1DB 1OS8A 3A85A 4YOIA 1C1NA 1THSH 1XKBC 3SU4A 1VGCB 1HIAA 3U1JB 3P70B 1EPTA 1HPGA 1SQAA 1SGYE 3KHVA 1GVKB 3PTBA 1VITG 1Z8RA 4TWWA 2VJ1A 1FIWA 5BRRE 4X0WU 2QA9E 3ENSB 2BZ6H 3BG8A 3M61U 3GY6A 1GMCG 1LHEH 1O2PA 4Y79A 1A1RA 1U6QA 2A32A 3O8BA 3M7UA 2FODA 4OS6A 1P2OA 3KQEA 1C5SA 1LDTT 3IWMA 2FOEA 1WUNH 4AYYB 1HAHH 1ZZZA 1FY1A 1W10U 2WPHS 3ZZ8A 3LDXH 2ZO3H 4ABBA 3UREA 1HJAC 1A3BH 1GCTC 1XVMA 1KXDA 1P2JA 2G8TA 5DO4H 1OWKA 4DG4A 4IC6A 3GCHB 8KME2 2GP9B 3TGKE 5C5OA 1JOUB 1YKTA 4YT6H 3TJVA 5FBIA 4ZROA 3RXTA 1UTNA 4IN1A 1O3BA 2QCYA 3GDSA 3FFGA 2XRCA 1C2IA 3RC6A 3CS0A 1HAXB 2C4FH 2RDLA 3MH5A 4AGJA 1F0SA 1NPMA 1ANCA 2UUJB 2A7CA 1MTNC 4NSYA 3MO9A 3SZNA 3ZVDA 5EXMA 1ZMNA 4E7RG 3SORA 4JYVH 4DW2U 2C8YB 1QB6A 1MU8B 3U8OH 5CE1A 3A8AA 2BQWB 2G52A 2W7SA 4K2YA 1C4Y2 2PUQH 2R0LA 3RC4A 4MNWA 1CHOF 3L3TA 1HAYB 4CRAA 4AZ2B 1LVMA 3BEUA 1LHDH 5E8EH 1DSUA 2A4OA 4NFFA 3ZZAA 3RXGA 2GCTC 1KDQA 1C5PA 2GT7A 4YTAA 5FXLA 1VCQA 3PM3A 1UVUH 2FZZA 4MQAA 3HATH 1P57B 3LC3A 4CRCA 4NIXA 5C1UA 3ZZ7A 4MVNA 3SUFA 5EGMA 2WINI 5EQRA 2BMGB 4MNYA 3SJOA 3M3SA 1LKAA 1BRUP 3RXUA 3U8TH 2AS9A 1QJ6B 4WH6A 2BD2A 4I8KA 2P3FH 4YOGA 1NRRH 4WVPE 4AX9H 1P2IA 1TX6A 4DOQA 3Q00A 1D9IA 5HYOA 1TMTH 4GAWA 2P3UB 3DFLA 4ZKOU 3F9FA 1FXYA 2PGBB 2UUYA 3MU0A 2QXIA 5F03A 4ISOA 2FS8A 3BV9B 1GBKA 3V3MA 1O2ZA 3SU0A 1P2NA 2NU4E 1UVPA 1GI0A 2AH4X 1LHFH 1YLCA 3SNDA 3BN9A 1LHCH 2PWXA 2R3UA 1FQ3A 2XWBI 3MU5A 2CGAA 1C5RA 3SN8A 3P6ZB 1J14A 4Q7ZA 6CHAC 1V2ST 5LPFA 1VZQH 3KGPA 3PMAB 3O8DA 2QY0B 8ESTE 1HAPH 2QYIA 1Y3YA 3EYDA 4KTCA 2GV6A 1EOJA 2HALA 4ESTE 1DITH 2STAE 2FOHA 1QTFA 1F2SE 1FLEE 4UD9H 2QXGA 3P8GA 1F0UA 1NESE 1GCDA 2SGQE 1RIWB 3K2UA 3ZYEA 1DWDH 2HVXA 3ZVFA 4A1VA 4X6PA 4F4OC 3LJOA 1YLDA 5BPEA 1INCA 1Z6EA 4NFEA 4U30A 3HGPA 3QO6A 3SGAE 1C2MA 1CBWC 1NO9H 4D7GA 1GBDA 1BRBE 4XE4A 1F7ZA 1NM6A 3BTTE 2PFEA 1O3FA 1O31A 1RXPA 4OS7A 1OP2A 1TE0A 2H9TH 1CT2E 1Y8TA 3GOVB 4UFDH 1O5EH 5AF9H 3SBKA 1YPEH 2BY8X 1AN1E 1MCVA 2PUXB 2VIQA 2Y81A 5JBCS 1GJ9B 2J2UA 3U1IB 3LGUA 2B9LA 1GDNA 3H5CB 3Q3XA 1TGNA 4GCHF 1GG6C 1IQFA 1SFQB 1E0FD 1GI8B 5AHGH 2AGEX 1T8OA 3URDA 1A5IA 1UTKA 1ZRKA 2STBE 3QDZB 1YCPK 2PTNA 1KTSB 3MNXA 3RXDA 1C5ZB 1OWHA 1ANDA 3PWCA 1BHXF 4ZHMU 1TALA 3A7YA 3LC5A 4FUDA 4AFSA 5JB8S 5DPAA 1BIOA 4ZAEA 2WUCA 3NKKA 1BBRK 3SHCH 1PQ7A 2BOHB 3A81A 4NZLA 1PPBH 3BG4B 1FY5A 1GL1A 1ETTH 1C1WH 2FOGA 4VGCB 2PSYA 1TIOA 3NPSA 1F92A 2XCFA 3RXKA 2TGTA 4Q80A 4K1TA 1XVOA 5ESBA 2WYGA 4AGKA 2CV3A 3A88A 3OSYA 4HTCH 1V2VT 4AFQA 3KNXA 4ZKNU 5AVDA 2VWMA 1MQ6A 1CO7E 4MTBA 1ABJH 1BRAA 2BDCA 5JBBS 3SHAH 3E16B 2ZIQH 2BOKA 3GY8A 5FCKA 2A4GA 5DP9A 3I77A 2A4QA 1GBMA 1HAOH 4AYVB 1K22H 2UWLA 2GV7A 1GHVH 2QXHA 8GCHF 1E36B 1GMHF 1TWXB 5GPIB 1P03A 1C5VA 1MKWH 5F8ZA 4INHA 3W94A 5JB9S 2EI7A 2VIWA 3KQBA 1C5TA 2R3YA 2PR3A 3RXSA 2C8ZB 3HPTB 1SLUB 4FUJA 1G3CA 3SU1A 1V2LT 2HOBA 4Y8YA 1WBGB 3UOUA 1C1MA 1T4VH 1HYLA 1AVWA 3K9XB 5K7RA 1GHZA 3LGTA 4HFPB 4WWYA 1EAIA 1GVLA 3ZZDA 3PB1E 1S6HA 3QN7A 1ZTJA 1BITA 3KQDA 1SLXB 1RTLA 3FAOA 1KSNA 1EP6A 5TJXA 1HLTH 4B73A 2F91A 5HM2A 2BY7X 2FOFA 3ODFA
chains in the Genus database with same CATH superfamily
2BM2A 4ZXXH 1WSSH 2J97A 3B23B 3GY7A 2XW9A 4RT1A 4B2BA 2AGGX 3FP8E 5TCAA 1S84A 2OC7A 2RG3A 1O3IA 1X7AC 2OUAA 1V2UT 1S6FA 2UWOA 4CRGA 1C9PA 3PROA 1LVYA 3SNEA 1QJ7B 5GDSH 1O3LA 4HG6A 1OP0A 2PLXA 1UTLM 1C5LH 1ZTLA 2G4TA 1UVSH 4OS5A 1F0TA 1Q2WA 1O5GH 1ZHMA 1KMHB 1SGCA 2JDID 5B6OA 2R2MB 1ELFA 4E7NA 1AE5A 1GGDB 1ZPZA 5DKMA 1MAXA 1EAWA 1GBCA 2A31A 3BEFB 3M35A 5EOKA 2CK3D 1HAZB 2F3CE 1GMDF 4Z6AH 1ELVA 2QF5A 3RC5A 1DE7H 5C67A 4IN2A 1RJXB 1WYKA 3RM0H 2M5TA 4B74A 2ZGBH 2ZU5A 1KXAA 1PPZA 1N8OB 4CRBA 4X6OA 1Q31A 1DS2E 2ZCHP 2ZQ2A 3ATLA 2ANMH 5DP8A 1QY6A 1T32A 4H4FA 4GCHG 5K0HA 1H8IH 1QZ8A 3M3TA 3FZZA 1D6WA 3MTYA 2FI5E 2O8UA 1GJ7B 3U28C 1BTPA 1C9TA 4DT7B 4XOJA 1CGHA 2ZTXA 2AMQA 1M9UA 1XUFA 2Y6TA 2ZI2H 3MH4A 4Y76A 1ZMLA 1ID5H 2BD9A 4DY7B 3QZQA 4AG2A 1THRH 4I8GA 8LPRA 2FLRH 2J4IA 5C94A 1BTUA 2VWLA 1JWTA 2IN2A 3WWFA 3W95A 3TGJE 1C1VH 4K8BA 1YPHC 3SU5A 5F6MA 1AFQC 1K2I1 1PPGE 2RA3A 3A7XA 1UTQA 2KAIB 4Y0ZE 5JYIA 1OP8A 3V0XA 2XBYA 3D62A 5A0CA 2XXLA 1C2DA 3U9AH 3AW1A 2XTTB 1G3DA 4Y11E 3OU0A 2Z94A 4X1NU 1NFWA 3SUDA 3CNRA 2P93A 2F9UA 1AMHA 2H2ZA 5FPTA 1B7XB 1J9CH 3MU8A 3ZZ5A 4ZXYH 2H5DA 3B8JA 4A5TS 1C5MD 3N7EA 3A7TA 1EZUC 1WDIA 3MI4A 1KTTB 4RKJB 3TJNA 8GCHG 1KLJH 5JBAS 5E0GA 1A61H 3OTPA 2ZFPH 5T6DA 4CRDA 3F0OA 4NIYA 1FDPA 2CHAC 2Q6DA 5E0HA 2YMSD 1P9SA 1MAYA 2OC1A 1TRNA 2QV1A 1H9LB 1JRTA 1L0ZA 3ZZBA 1RFNA 2HNTE 3T2NA 1D3PB 2SGFE 4JK5A 2JIZD 1TNLA 1NT1A 2XC5A 3GY4A 4HGCA 4ZH8A 2WYJA 3U69H 4DIHH 1CQQA 5FPYA 2Z9GA 4Y8ZA 1HAVB 1TPSA 1UO6A 1OYTH 1G2MA 1GVZA 1W8BH 2FYQA 2KCOA 1GJ6A 3K6YA 5EW1H 1SQRA 4FUGA 2GMTC 1QBVH 1BMMH 5CMXH 4AFZA 1OWIA 4WY3A 4I8JA 4NZQA 2VU8E 4A7IB 2KCPA 5I46H 5T6FA 1SGQE 1RD3B 1PPCE 1EAXA 5KEDA 4ASHA 3HKIB 4CBOA 3Q3KA 4NWKA 4YM9A 1Y5AT 4X2VA 1HGTH 1N1LA 2ZQ1A 2KFWA 1FAXA 1C1SA 2ULLA 3T26A 3DA9B 4CRFA 1OKXA 3QGNB 1FONA 2PGQB 3ZV9A 2BLVA 3IG6B 4RKOB 1PYTC 1AU8A 1UW7A 4DJZB 1S85A 4DIIH 4E05H 2BLWA 4NG9H 2HVYB 4IW4E 4ABEA 3R0FA 1O5FH 2LNCA 2OINA 3OAAD 4ISLA 4AORA 4UONA 3RXVA 4YT7H 1O33A 1Y59T 3VG8A 4TYDA 1GMDG 5DP5A 5IYTA 1G32B 1SGIB 1O2LA 3LGYA 2H6MA 1LTOA 3MWIU 4I8LA 3ODDA 2P59A 1O2YA 1Z6JH 1Y3XA 3AAUA 5JBTA 1C2EA 4D76A 4JZ1A 3MO3A 1QBNA 3G01A 2JETB 2ZU1A 3ZZ6A 1W12U 2ODPA 3RXAA 1MKXK 3LIWA 2WPIS 3A86A 3ESTA 2BDIA 1G9IE 2D2DA 1TRMA 1HFDA 3MNSA 1TYNA 2BX3A 2TIOA 2W3KA 1O2KA 2J95A 5J4QA 2PKSB 1K28D 2VIOA 2WZQA 1A7SA 1AO5A 1V2MT 2JH0D 1GJ5H 2VB0A 4R8TB 1H8HD 3VB3A 3LGVA 4KKDA 1EOLA 2EA3A 1EPTC 1OOKB 3MH6A 4XDEA 2FESH 3BTWE 4FXGH 1LCYA 4BTTB 3UAIC 1GHAF 1TNJA 5ABWA 1YPJH 4BTIB 4B6EA 1GI2A 3TGIE 4NA7A 5HXFA 1E37B 1TMBH 1GJCB 1QRWA 3LKWA 1MTUA 4NA8A 2VIPA 1LVOA 3A8DA 1O3AA 1LVBA 2LPRA 2P3TB 3GCOA 1W0YH 5GXPA 1ZLRA 2JH5D 1C4V2 4Q63A 2FEQH 3GYLB 1E1RD 3SOSA 3ZVEA 3MU1A 1BCUH 1P3CA 2ZDKA 1F5RA 1TGSZ 2TBSA 3LU9B 2ZTZA 2B7DH 3E0PB 1K1OA 2FMJA 1A0JA 2G4UA 1AZZA 4DGJA 1LPKB 1O2SA 1SHYA 1KXFA 2UUKB 3WY8A 3CP7A 1P06A 1KIGH 1QBOA 1SOZA 5EPYA 3E0NB 5FL7D 5FX5A 2CHAB 1MBQA 1WTHD 3VXFH 2WV9A 2ZFFH 2ZDVH 3C27B 3UIRA 1PFXC 1QRZA 4FU7A 4ISIH 2Y7XA 4Z1MD 1QQ4A 3EA7A 2ANYA 3B9FH 1IAUA 1YBWA 1QNJA 3GCNA 4TPYA 2VWOA 4Y8XA 1MQ5A 2P8OC 3T25A 1O34A 4BAMB 5AFYH 1C5XB 3BTHE 3UR9A 4CR9A 1LQDB 1F0RA 1ZGIA 1DVAH 4XBCA 1VITH 5CHAC 1DPOA 1QIXB 1WAYB 1FJSA 2TGDA 1GBHA 1UTPA 2ZDAH 3ZVCA 3RXFA 1MH0A 1F5KU 1P01A 2FDAA 2ZC9H 1QL7A 1TABE 3QWCH 2FI3E 1BQYA 1BTHH 2FLBH 3UQVA 2Z9LA 1DANH 3UTUH 3URCA 4B2CA 1S6LA 1C5OH 4MPXA 1YPMH 3RXMA 2ZPQA 2FOMB 3BTKE 1ABIH 3EDXB 2BVSH 2ZDLA 5DP4A 1C2FA 2GZ9A 3ZYDA 1QA0A 2ZDNA 5C0TA 1EJAA 3N99A 1O2IA 2J98B 5JPMH 5A2MH 1ELBA 1SQTA 1ACBE 3T27A 2SFAA 1BBRE 3STIA 1WQSA 4HZHA 1WU1A 1O3EA 2OC8A 4PROA 3KEEA 4NCYA 1OHHD 4ZUHA 1A2CH 4LOYH 3M37A 1YPKH 1GHBG 2BD7A 1FNIA 2IJD1 2AMDA 3ZZ4A 4Y6DA 1BJVA 2GDDA 3GDVA 4X2WA 2WPDD 3EE0B 3MH7A 3SQHE 2Y5FA 1GHYH 3PV2A 4FUHA 3VGCB 4F55A 2Y80A 1IQIA 1KXBA 5IDKA 2SNWA 2F9NA 1Z1JA 2ZFSA 5A8XA 2EI8A 1O2UA 1KXEA 1CGJE 3RU4D 2J92A 2BD4A 1O36A 2BXTH 1LO6A 1NRSH 1O2TA 1O2MA 1P12E 2NU1E 2ODQA 2Z9JA 3VEQB 1ELGA 1NS3A 1Z71A 3PMJA 3AAVA 2A5AA 1Y5UT 4I7YH 2YMSC 2ZPRA 4LK4A 1UMAH 1UK2A 2P94A 2XNDD 3BTME 2EEKA 2FWWA 2BQ6B 3MHWU 4KTSA 2IPHA 2BDGA 3CS7A 1Z1IA 2TRMA 5F8XA 3PLBA 1UVTH 2ZGXH 5LPEA 1G2LA 3T28A 2FOCA 3SU3A 3TPIZ 4CH2B 1P3EA 4Y7AA 1JMOH 1V2NT 3ITIA 4IC5A 3NRLA 9ESTA 4WXIA 3A83A 3KQCA 1GBFA 4WXVA 1E38B 5T1VA 2TGAA 4Q4LA 1IQLA 2UUFB 3UPEA 5DSFA 1GHAG 3D65E 1Y3UA 1ZTKA 2DE8A 3TK5A 1MZAA 5DK1A 1GBJA 1TGTA 1BJUA 1ELDE 1YGCH 4X8TH 1HJAB 2VINA 5E0JA 1GCTB 1HV7A 3PV4A 2NWNA 2WV4A 2KAIA 3A7ZA 4XBDA 2BY6X 2WUBA 2OCVB 2W3IA 1TFXA 1O38A 3PO1C 1DXPA 3QUMP 3JZ2B 1O32A 4AN7A 1DICA 1MKWK 1AE8H 2V7QD 3OEHD 2TGPZ 4BAKB 2PP6A 1A46H 5J4SA 4WMDA 5C1XA 1P02A 1B5GH 1TA2A 3SJ8A 5I25A 1O3JA 1C1OA 1PYTD 1W13U 4BNRA 2BY5X 2O8WA 1DWBH 1DX5M 2ZGCA 3L6PA 1D6RA 1MTNB 2ALVA 1YC0A 6GCHG 3O8RA 2EQNA 2G5NA 1PQAA 2NU0E 2QF3A 4R0IA 1O37A 4K69A 3LPRA 4FUIA 4ZHAA 3R3GB 1C2LA 3RU4T 4K3JA 1AZ8A 1XUKA 5EQQA 1RTKA 3T5FH 1KYNA 1H1BA 4GUXA 1OSSA 3V13A 2G51A 2GT8A 5IK2D 1DLEA 2Z7FE 2QF0A 5GJ4B 3UNRA 1EJMA 1IQJA 1AGJA 1HAVA 3S7KB 1A3EH 3QZRA 1O3NA 2GCTB 2WPJS 1NU9A 1SOTA 1V2KT 3BTDE 1DFPA 1CA0C 2Z9IA 3A7WA 3P92A 5AFZH 4UFGH 5KGOA 4CR5A 1TOCB 1BMFD 3M5OA 3SO3A 5CHAB 3RXHA 3A80A 1AB9C 5GIBA 1EZQA 2XBXA 1D3DB 1QB1A 2O8LA 5E2OA 5EPNA 4THNH 3RXLA 1KXCA 1O3HA 2ALPA 3FP7E 4JYTA 4O03A 4XSKU 3S9AA 1AUJA 4J2YB 4X8UH 5E2PA 5DGJA 3PYHA 3EAJA 3F2FA 4INKA 2ZNKH 1TX7A 4AB9A 3RU4E 2TPIZ 4O9VA 1ZJKA 2H9EH 2OC0A 1BMNH 3EGKH 2OTVA 1V2QT 3H7OA 1GJ4H 2YOLA 1SLVB 1RTFB 2PW8H 2QGRA 1TPAE 2FM2A 3EA8A 3MMGA 3V12A 2FOBA 2PHBA 1P2KA 5ESTE 3A8BA 4X6NA 3FN8A 3HKJB 5H4IB 2A5IA 1TBRH 2AERH 3SQEE 1TQ7B 2I6SA 1SGFA 3I78A 2FS9A 1L2EA 1HB0B 3E91A 2SGAA 1NRPH 2DE9A 3D49H 6CHAB 1O3KA 1P05A 2ZHFH 2D8WA 2GDEH 3PLPA 1HCGA 1AKSB 5FAHA 3BSQA 3A87A 4JMYA 4CHAC 3ATKA 1C4U2 1P8VC 2HWLB 2H9HA 4YOJA 1FX0B 1UCYE 1SR5C 1TB6H 2O9QA 3AVZA 3DHKH 4U01A 2HNTF 3ELAH 2D26C 4D9QA 1G30B 3NWUA 4UEHH 2CF8H 3F1SB 1XX9A 4Y71A 1Y3VA 1TBZH 2VIDA 1SGEE 1A5GH 1EXFA 1UTOA 2A7JA 4ABAA 5C5NA 1CBWB 2J38A 1O2XA 2YNAA 3MNCA 1SGDE 3RUOA 4DURA 4FUEA 4I31A 1UHBB 1VGCC 5DP7A 2Z3CA 7GCHG 2ZPSA 1ZOMA 2CJIA 3GS9A 3RMLH 2P16A 4XBBA 1HUTH 1G3BA 1JRSA 1PPFE 2FOAA 1D4PB 2ZECA 1DWCH 3F68H 1HXEH 1XUGA 1DUAA 2XOKD 4A92A 2VGCC 4DVAU 1VCPA 1GG6B 1K9OE 1XXFA 1OYQA 1O2RA 2VBCA 4Y7BA 5GNDA 1CT0E 1O39A 1PPEE 2I6QA 2Z3EA 3QLPH 4YO9A 2ZF0H 4IS5A 4X2YA 3A84A 2ZU3A 3KF2A 2RA0A 5FBEA 1IHTH 4UDWH 1DWEH 1DDJA 1GBBA 1ZMJA 3N7DA 4AG1A 4K1EA 1NTPA 2BD8A 5EJLA 3F9GA 1VCWA 4RI0A 2R0KA 4Q7XA 2A45B 3E3TA 1ESBA 4ZKSU 1E35B 1IHSH 1TOMH 3GCHC 1O3DA 3MO6A 1K1JA 1OX1A 1ANBA 1SVPA 1JIRA 5C0UA 3E6PH 4Y0YE 4Q7YA 1T7CA 2V6NA 4FVBA 3D23A 4BAQB 5CDFE 1K21H 1AIXH 1GI5A 3BEIB 1S0RA 2AHME 1UTMA 1UCYK 2PSXA 2NU3E 2WPKS 3DUXH 4X1PU 1C5UA 1A0HB 3TU7H 1GI4A 2QF4A 3RXQA 3STJA 3T62A 1DY8A 5L2ZH 1P10A 1MBMA 1C1TA 4YXWD 1EAUA 3RLYH 1EB1H 2ODYB 1SB1H 2BVXH 4O97A 1VR1H 3TITA 3UUZA 1A5HA 1AVGH 1DT2A 1QA7A 2AIPA 2A5KA 2OXSA 2ZHDA 1EQ9A 4F49A 1K1NA 3SGBE 1BT7A 1K0HA 5L2YH 1GBIA 1AWFH 2J98A 2J5UA 3T29A 3SUGA 1NC6A 2VH6A 2ZFTA 2ZHEH 1XUJA 2LP6A 4ABFA 3EA9A 1PQ8A 4BXSA 2BDYA 1UJ1A 3MFJA 1EB2A 4K8YA 4GPGA 1CT4E 1WV7H 1JIMA 1L4ZA 3RXJA 1FPHH 3FOAA 4H6TA 2XCNA 1LPZB 4ASUD 1GBAA 2J9NA 4WJG2 1MD7A 5FCRA 1C5QA 4MPVA 2H5CA 1SQOA 1SSXA 4RSPA 3ZV8A 1HAIH 4YLQH 3S7HB 3S9BA 1MTSA 1YPGH 2BZAA 2VVUA 3WW7A 1GI9B 3NXPA 1ESAA 3TJOA 2ANWA 2FTMA 5FPSA 1Y5BT 4OS2A 1GHBF 4O3TA 2SNVA 3ATIA 2SGEE 1SLWB 2BXUH 2BD3A 1P2QA 1ZHPA 5EQSA 1P0SH 4ZKRU 1T8NA 3KYGA 3BTQE 1NRQH 2OQUA 3U98H 2G5VA 1TRYA 5LH8A 4CREA 5A0BA 1S5SA 1ZSLA 2P95A 2A2XH 3P8OA 1GBTA 3VB5A 2XC0A 4GLYA 2IJOB 1C5YB 3RXIA 1J15A 1XKAC 3LH1A 4ISNA 3IITA 1RIWC 1SGTA 1E1QD 3QTOH 2BD5A 3OFND 4A1XA 4WF8A 1AVXA 2FTLE 3JZ1B 1LPGB 3KN2A 4H42U 3VB7A 2CF9H 3S69A 1AFEH 1GHXH 4BOHA 2VGCB 3SNAA 1BTXA 3DCLA 4MDSA 1IQEA 3RXPA 1EFRD 1GJBB 4X8SH 2EY4C 1T8MA 3M5NA 4M7GA 1AHTH 1BUIA 1PJPA 2HNTC 4TT3D 1O2QA 2R9PA 2Y7ZA 1HAGE 5EODA 2OBQA 1P11E 1LHGH 1TBQH 1O3PB 1SC8U 1TQ0B 1AFQB 1G3EA 1QB9A 2XWAA 1J8AA 2PTCE 1MCTA 1GWAA 1QURH 5JDUB 1AY6H 1MD8A 3TH2H 1G37A 4BAHB 2ZDMA 1TLDA 2GTBA 1FY4A 3NUMA 2C90B 2ASUB 5EIYA 1GJAB 1S0QA 1PQ5A 1NZQH 1SFIA 3BIUH 3LJJA 3RP2A 3ZVAA 3A8CA 1DUEA 4GVUA 3VFEA 1XXDA 4K5ZA 3KL6A 2YNBA 1NY22 2FX6A 1AUTC 4RN6A 3SW2B 2J34A 2JJ2D 3RMNH 4KELA 2OP9A 3F9HA 1V2WT 1EZSC 2ZTYA 5HIZA 3TNSA 1FZZA 2VNTA 2F83A 3BG4C 1QL8A 6GCHF 1GPZA 1MKXH 4I86A 4NA9H 4VGCC 3TIUA 5HM9A 1BHXB 1TNGA 2DUCA 2CMYA 1TPOA 2XC4A 3Q77A 3K65B 1BMAA 1EP5A 4K60A 3RDZA 2KR7A 3PMHB 1BA8B 3FANA 1E34B 1Y3WA 1Z7KA 3M5MA 1J17T 1YP9A 3RXCA 4ZCNA 1QJ1B 4J1YA 1O2GH 1C1RA 3BTGE 1O2HA 3GDUA 1HJ9A 2HPQH 1FPCH 5C1YA 3KCGH 1RS0A 1YCPM 1YY3A 2F9VA 3BTFE 4TPIZ 2XBWA 3OY5U 1J16A 2V0BA 1BB0B 3DT0H 1CHGA 2BTCE 3FVFB 1DLKB 2GMTB 1O0DH 2O8MA 1HRTH 4WMEA 4UFEH 2HLDD 1K1IA 5KECA 3GY3A 2W7UA 3QX5H 1TONA 3UWJH 1ETRH 5HMAA 1GBLA 2QC2A 1YLNA 5EXLA 4BXWA 2QN5T 1NRNH 1Z8IB 3GYMA 1BRCE 2BX4A 1O2WA 1THPB 1ZR0A 2AFQB 3EQ0H 3EE7A 2JJ1D 3SU6A 1HBTH 1EATA 1H9IE 1FMGA 1T8LA 3U8RH 3P17H 5DP6A 3LGIA 3RMOH 2EC9H 1CU1A 1ZJDA 3UNQA 4QT8C 3BTEE 2BVRH 1IQHA 1O2NA 4ABGA 3TVJB 4B2AA 1G36A 1FI8A 1KLTA 1P04A 4JZFH 1GI6A 1AKSA 1C5NH 2A7HA 1BMLA 1TAWA 4OGXA 1C1QA 1W3CA 2HPPH 1W0JD 2ZGHA 1ZPCA 1QRXA 2F4LA 1DSTA 2ZEBA 3RM2H 4KTUA 2NU2E 4P02A 3GCTG 4ABJA 5T6GA 1ZGVA 3A7VA 1V2JT 2PKAB 5G4BA 5LPRA 1C1PA 1XMNB 1FY3A 1ZSJA 4D9RA 2A4RA 1A0LA 4IMZA 1SG8B 1KY9A 1EZXC 4ISHH 3PMBB 2ZGJA 4MNXA 4FU8A 1UK3A 1TX8A 1YYY1 5EU8A 3RLWH 3TLOA 4MPWA 4NGAH 2OQ5A 3PRDA 4Z0KA 3W1EA 3SJIA 1D3QB 1ELAA 1H8ED 3SV6A 1GL0E 2K0QA 1HJ8A 1UHBA 2C93B 2GZ8A 1CE5A 1PPHE 5C2ZA 1F5LA 3ZVBA 3E1XB 2IOTA 5ETXA 4E06H 1O3OA 4FUBA 4BAOB 1CSOE 1V2RT 1GGDC 4B71A 2F9PA 4D7FA 5A09A 1NFXA 1NU7B 1S82A 1O5CB 1ZPBA 2GZ7A 5L6NH 3SI4H 5SGAE 5L30H 4MNVA 3NZIA 4FVDA 4NIVA 4NSVA 1HIAB 1EPTB 5EW2H 1N8OC 2UWPA 1NFUA 1T31A 3BIVH 2Q6GA 3UNSA 3ZZCA 9LPRA 3S9CA 4UFFH 1XUIA 2AMPA 1LKBA 1OXGA 3OTJE 7GCHF 1W11U 1LMWB 3AW0A 1QFKH 1TNIA 3N7OA 1QQUA 1UTJA 4JCNA 2W5EA 4ACBA 1C2KA 4LZ1H 1GDUA 5TCCA 1H9HE 3HK6B 1BOQA 1ELEE 1H8DH 2FO9A 2FXRA 1SGNE 1TPPA 1WQVH 4ZMAH 1L1GA 3ZVGA 1DY9A 1ORFA 2W6JD 1W0ZU 3DD2H 2BHGA 2VWNA 1O30A 4JYUH 2A0QB 2Z6BD 4B75A 4FUCA 1MU6B 1GHWH 1MTVA 4I33A 2ZA5A 1KLIH 2BB4A 3ZZ9A 1N6XA 1NBME 3OEED 2O8TA 2SGDE 3M36A 3OE7D 2JKHA 3RMMH 2XNIA 4CBNA 4AOQA 1IQKA 3NCLA 1C5WB 1L1NA 1S81A 4OM9A 1EKBB 2GCHF 2D1JA 4BTUB 5F8TA 3SV2H 1YPLH 3QGJA 1MMJN 3Q76A 1CHOG 1ETSH 3QK1A 4JK6A 2VIVA 4A1TA 2AGIX 1AD8H 7KMEH 2BDBA 4K1SA 4TY6A 1DOJA 1O35A 3O8CA 3A82A 2F9BH 3SUEA 2K1QA 3UWIA 2P8OB 1SL3A 3P95A 1IQGA 3AASA 1OWDA 1SKYE 3PTNA 2ZWLH 1L4DA 4IBLH 1QCPA 2GKVE 5FX6A 3M7TA 3LH3A 5DP3A 1O3MA 1O2OA 1T4UH 1P09A 7ESTE 4Y10E 1UK4A 1P2MA 3RXBA 1YCPH 3ZZ3A 3SNBA 3SV9A 3F9EA 2BYAX 1YPHE 1V3XA 1BZXE 2RDEA 1BTWA 1RGQA 2GX4A 2ZFQH 1ELTA 3F3BA 1BBRH 1KDQB 1OWEA 4IMQA 3SI3H 3OYPA 1SGFG 1O2VA 1ZRBA 2ZCLP 1EUFA 4JZDH 1ARBA 2OD3B 4WH8A 4HI3A 2KM0A 3VB6A 1QR3E 1W14U 1ZYOA 1GI1A 1SMFE 2B8OH 1SHHB 3MU4A 3P8NA 3LONA 1MZDA 1TGBA 2V3HH 2WSSD 3VB4A 2ZU4A 3TK9A 3E8LA 2BDHA 5PTPA 3GY2A 3I29A 1C2HA 2KZ4A 2ZP0H 1O2JA 2EI6A 5A8ZA 4NIWA 1BTZA 3BF6H 2B5TB 4KGAA 1FAKH 2FYRA 1BDAA 3PRBA 4GHTA 1JBUH 3SNCA 1YWUA 3LOXA 4TWYA 3TJUA 1SGPE 4DCDA 4ABDA 4JZIA 1TNKA 4NWLA 4WMFA 5C17A 2GD4B 3E90B 1FUJA 3UB0A 1FN6A 1V6DA 2Z3DA 4XRNA 2YMSB 1K1LA 1QL9A 1JXPA 2C8WB 3GICB 4D8NA 4OGYA 4X2XA 5LGOA 5GCHF 1NFYA 1QGFA 1GJ8B 1DXWA 5EG4A 1EJNA 1GDQA 2PV9B 2A2QH 1HDTH 4SGBE 1TGCA 2WPLS 1P9UA 4ACAA 2G00A 1L1JA 3DFJA 1W7GH 1HNEE 2C8XB 1GI7B 2Y82A 1XUHA 1QHRB 4MG3A 4UE7H 3UQOA 2WHXA 1OPHB 2GVFA 2F9OA 3HK3B 3VXEH 3A89A 3CENA 1S83A 3AK5A 4ZHLU 1SPJA 4YZUA 2KX4A 3KIDU 2JETC 3TK6A 3QTVH 2BQ7B 3TH3H 2L6OA 3HGNA 1IOEA 3F6UH 2RCEA 4KP0A 4CH8B 2BDAA 1EX3A 4X1SU 4YESB 1AI8H 1WOFA 1V2OT 1CVWH 1FY8E 3PLKA 1FN8A 1C1UH 1GJDB 2PKSC 2VVCA 2HGTH 3PO1B 1YM0A 1FIZA 4MPUA 1VITF 4H6SB 2F43B 2Q1JA 3SJKA 2G81E 3S0NA 3Q3YA 1O5AB 1N6YA 2FX4A 2ILNA 1SI5H 2FI4E 1GMCF 2ESTE 2ZHWH 4OS4A 1ELCA 3PWBA 2XBVA 2J94A 2KCYA 3M3VA 1HXFH 5FHTA 2R2WU 1Z8JB 3TNTA 2GCHG 1V2PT 3H7TA 1H4WA 1RRKA 1YF4A 4Q2KA 5A0AE 1VJAU 4OS1A 4IGDA 1LQEA 1Z8GA 4GSOA 1C2GA 5T3HA 4I8HA 1O5DH 3SV8A 4O3UA 1EASA 3SZEA 2BLQA 4I32A 1W7XH 5HGGA 2JH6D 4INLA 4A6LA 2Z9KA 3RXRA 2OBOA 1OWJA 3KYFA 4XFQA 1FV9A 3RXOA 2ZHQH 2IPQX 3P8FA 4YLUA 1A4WH 1DM4B 6ESTA 4X1QU 4U2WA 1GI3A 3OY6U 3GY5A 2Y5HA 1VJ9U 7LPRA 1CA0B 4LXBH 6LPRA 4FOUC 5DG6A 1SGRE 2G55A 2HRVA 4SGAE 1GMHG 3K6ZA 2V35A 2ZCKP 3MOCA 4U32A 3SGQE 1O5BB 2Y5GA 1TA6A 2QIQA 3F0PA 1B0FA 2ZU2A 1NN6A 1AB9B 3MNBA 2THFB 3GISB 2ZZUH 3UY9A 4DT4A 2VH0A 1WTGH 2V3OH 1MABB 1ANEA 5A8YA 4XD7D 1ESTA 1D3TB 3ATWA 4ABIA 4AB8A 2GGVB 1AWHB 2CN0H 5GWZA 1O3CA 3L33A 4GHQA 4AFUA 5HIYA 4MLFB 1K1MA 4BANB 3OX7U 1UVOA 3NK8A 1ZHRA 2AYWA 3PV5A 5EXNA 3FZDA 1BTYA 1Q3XA 1GBEA 2Q6FA 4JZEH 4X8VH 1V2TT 5C3NA 1TMUH 1ZSKA 1ARCA 2QXJA 4ABHA 1MTWA 3UR6A 1VKYA 1IQMA 2WV5A 2ZKSA 2XYAA 2W26A 2AIQA 4FU9A 2PKAA 4B1TA 2HLCA 1WXRA 3UOPA 3SV7A 4TY7A 1CGIE 3F2HA 2SGPE 1CA8B 4LZ4B 2WPMS 3ATMA 2L74A 3FP6E 1UCYH 1W2KH 2BY9X 2FIRH 4B6FA 3M5LA 1WCZA 1K1PA 4M9FA 4CHAB 5GCHG 4FUFA 1AQ7A 1MUEB 1XM1A 2BLOA 3SU2A 3LGWA 3V7TA 2ANKH 2C3SA 5C20A 1SBWA 3LT3A 2ZFRH 2QAAA 2H1UA 3VPKA 4X6MA 1IQNA 3GCTF 2CXVA 3M7QA 2FPZA 2OLGA 4B76A 1COWD 3MYWA 5DJ7A 2VVVA 3VGCC 2FP7B 3TH4H 1NROH 4X1RU 5EJZA 3ZIAD 2AEIH 1TNHA 3UFAA 1B0EA 1C2JA 1W0KD 1O3GA 2ZG0H 3SJ9A 3C1KA 3RXEA 2B0FA 2A1DB 3FO8D 1OS8A 2M2AA 3A85A 4YOIA 1C1NA 1THSH 1XKBC 3SU4A 1VGCB 1HIAA 3U1JB 3P70B 1EPTA 1HPGA 1SQAA 2QE7D 1SGYE 3KHVA 1GVKB 3PTBA 2K8IA 1VITG 1Z8RA 4TWWA 2VJ1A 1FIWA 5BRRE 4X0WU 5B6LA 2QA9E 1E79D 3ENSB 2BZ6H 3BG8A 3M61U 3GY6A 1GMCG 1LHEH 1O2PA 4Y79A 1A1RA 1U6QA 2A32A 3O8BA 3M7UA 4TSFD 2FODA 4OS6A 1P2OA 3KQEA 1C5SA 1LDTT 3IWMA 2FOEA 1WUNH 4AYYB 1HAHH 1ZZZA 1FY1A 1W10U 2WPHS 3ZZ8A 3LDXH 2ZO3H 4ABBA 3UREA 1HJAC 1A3BH 1GCTC 1XVMA 1KXDA 1P2JA 2G8TA 5DO4H 1OWKA 4DG4A 4IC6A 3GCHB 2RFKC 8KME2 2GP9B 3TGKE 5C5OA 1JOUB 1YKTA 4YT6H 3TJVA 5FBIA 4ZROA 3RXTA 1UTNA 4IN1A 1O3BA 2QCYA 3GDSA 3FFGA 2XRCA 1C2IA 3RC6A 3CS0A 1HAXB 2C4FH 2RDLA 3MH5A 4AGJA 1F0SA 1NPMA 1ANCA 2UUJB 2A7CA 1MTNC 4NSYA 3MO9A 3SZNA 3ZVDA 5EXMA 1ZMNA 4E7RG 3SORA 4JYVH 3DSOA 4DW2U 2C8YB 1QB6A 1MU8B 3U8OH 5CE1A 3A8AA 2BQWB 2G52A 2W7SA 4K2YA 1C4Y2 2PUQH 2R0LA 3RC4A 4MNWA 1CHOF 3L3TA 5CHBA 1HAYB 1NBMD 4CRAA 4AZ2B 1LVMA 3BEUA 1LHDH 5E8EH 1DSUA 3DSGA 2A4OA 4NFFA 3ZZAA 3RXGA 2GCTC 1KDQA 1C5PA 2GT7A 4YTAA 5FXLA 1VCQA 3PM3A 1UVUH 2FZZA 4MQAA 3HATH 1P57B 3LC3A 4CRCA 4NIXA 5C1UA 3ZZ7A 3H09A 4MVNA 3SUFA 5EGMA 2WINI 5EQRA 2BMGB 2W6ID 3F2GA 4MNYA 3SJOA 3M3SA 1LKAA 1BRUP 3RXUA 3U8TH 2AS9A 1QJ6B 4WH6A 2BD2A 4I8KA 2P3FH 4YOGA 1NRRH 5HKKD 4WVPE 4AX9H 1P2IA 1TX6A 4DOQA 3Q00A 1D9IA 5HYOA 1TMTH 4GAWA 2P3UB 3MQKC 3DFLA 4ZKOU 3F9FA 1FXYA 2PGBB 2UUYA 3MU0A 2QXIA 5F03A 4ISOA 2FS8A 3BV9B 1GBKA 3V3MA 1O2ZA 3SU0A 1P2NA 2NU4E 1UVPA 1GI0A 2AH4X 1LHFH 1YLCA 3SNDA 3BN9A 1LHCH 2PWXA 2R3UA 1FQ3A 2XWBI 3MU5A 2CGAA 1C5RA 3SN8A 3P6ZB 1J14A 4Q7ZA 6CHAC 1V2ST 5LPFA 1VZQH 3KGPA 3PMAB 4AC9A 3O8DA 2QY0B 8ESTE 1HAPH 2QYIA 1Y3YA 3EYDA 4KTCA 2GV6A 1EOJA 2HALA 4ESTE 1DITH 2STAE 5DN6D 2FOHA 1QTFA 1F2SE 1FLEE 4UD9H 2QXGA 3P8GA 1F0UA 1NESE 1GCDA 2SGQE 1RIWB 3K2UA 3WWBA 3ZYEA 1DWDH 2OK5A 4F48B 2HVXA 5EJ1A 3ZVFA 4A1VA 4X6PA 4F4OC 2GJGA 2V3MA 2LELA 3LJOA 1YLDA 5BPEA 3DSPA 1INCA 1Z6EA 2KCAA 4NFEA 4U30A 3HGPA 3QO6A 3SGAE 1C2MA 1CBWC 1NO9H 4D7GA 1GBDA 1BRBE 4XE4A 1F7ZA 1NM6A 3BTTE 4RT0A 2PFEA 1O3FA 1O31A 1RXPA 4OS7A 1OP2A 1TE0A 2H9TH 1CT2E 1Y8TA 3GOVB 4UFDH 1O5EH 5AF9H 3SBKA 1YPEH 2BY8X 1AN1E 1MCVA 2PUXB 2VIQA 2Y81A 5JBCS 1GJ9B 2J2UA 3U1IB 3LGUA 2B9LA 3SYJA 1GDNA 3H5CB 3Q3XA 1TGNA 4GCHF 1GG6C 1IQFA 1SFQB 1E0FD 1GI8B 5AHGH 2AGEX 1T8OA 3URDA 1A5IA 1UTKA 1ZRKA 2STBE 3QDZB 1YCPK 2PTNA 1KTSB 3MNXA 3RXDA 1C5ZB 1OWHA 1ANDA 3PWCA 1BHXF 4ZHMU 1TALA 3A7YA 3LC5A 4FUDA 4AFSA 5JB8S 5DPAA 1BIOA 4ZAEA 2WUCA 3NKKA 1BBRK 3SHCH 1PQ7A 2BOHB 3A81A 4NZLA 1PPBH 3BG4B 1FY5A 1GL1A 1ETTH 1C1WH 2FOGA 4VGCB 2PSYA 1TIOA 3NPSA 1F92A 2XCFA 4FETA 3RXKA 2TGTA 4Q80A 4K1TA 1XVOA 4P00A 5ESBA 2WYGA 4AGKA 2CV3A 3A88A 3OSYA 4HTCH 1V2VT 4AFQA 3KNXA 4ZKNU 5AVDA 2VWMA 1MQ6A 1CO7E 4MTBA 1ABJH 1BRAA 2BDCA 5JBBS 3SHAH 3KQ5A 3E16B 2ZIQH 2BOKA 3GY8A 5FCKA 2A4GA 5DP9A 3I77A 2A4QA 1GBMA 1HAOH 4AYVB 1K22H 2UWLA 2GV7A 1GHVH 2QXHA 8GCHF 1E36B 1GMHF 1TWXB 5GPIB 1P03A 1C5VA 1MKWH 5F8ZA 4INHA 3W94A 5JB9S 2EI7A 2VIWA 3KQBA 1C5TA 2R3YA 2PR3A 3FKSD 3RXSA 2C8ZB 3HPTB 1SLUB 4FUJA 1G3CA 3SU1A 1V2LT 2HOBA 4Y8YA 1WBGB 3UOUA 1C1MA 1T4VH 1HYLA 1AVWA 5F53A 3K9XB 5K7RA 1GHZA 3LGTA 4HFPB 4WWYA 1EAIA 1GVLA 3ZZDA 3PB1E 1S6HA 3QN7A 1ZTJA 1BITA 3KQDA 1SLXB 1RTLA 3FAOA 1KSNA 1EP6A 5TJXA 1HLTH 4B73A 2F91A 5HM2A 2BY7X 2FOFA 3ODFA
chains in the Genus database with same CATH topology
2BM2A 4ZXXH 1WSSH 3B23B 3GY7A 2XW9A 4B2BA 2AGGX 3FP8E 5TCAA 1S84A 2OC7A 2RG3A 1O3IA 1X7AC 2OUAA 1V2UT 1S6FA 2UWOA 4CRGA 1C9PA 3PROA 1LVYA 3SNEA 1QJ7B 5GDSH 1O3LA 1OP0A 2PLXA 1UTLM 1C5LH 1ZTLA 2G4TA 1UVSH 4OS5A 1F0TA 1Q2WA 1O5GH 1ZHMA 1SGCA 5B6OA 2R2MB 1ELFA 4E7NA 1AE5A 1GGDB 1ZPZA 5DKMA 1MAXA 1EAWA 1GBCA 2A31A 3BEFB 3M35A 5EOKA 1HAZB 2F3CE 1GMDF 4Z6AH 1ELVA 3RC5A 1DE7H 5C67A 4IN2A 1RJXB 1WYKA 3RM0H 2M5TA 4B74A 2ZGBH 2ZU5A 1KXAA 1PPZA 1N8OB 4CRBA 4X6OA 1Q31A 1DS2E 2ZCHP 2ZQ2A 3ATLA 2ANMH 5DP8A 1QY6A 1T32A 4H4FA 4GCHG 5K0HA 1H8IH 3M3TA 3FZZA 1D6WA 3MTYA 2FI5E 2O8UA 1GJ7B 1BTPA 1C9TA 4DT7B 4XOJA 1CGHA 2ZTXA 2AMQA 1M9UA 1XUFA 2Y6TA 2ZI2H 3MH4A 4Y76A 1ZMLA 1ID5H 2BD9A 4DY7B 3QZQA 4AG2A 1THRH 4I8GA 8LPRA 2FLRH 2J4IA 1BTUA 2VWLA 1JWTA 2IN2A 3W95A 3TGJE 1C1VH 4K8BA 1YPHC 3SU5A 5F6MA 1AFQC 1K2I1 1PPGE 2RA3A 3A7XA 1UTQA 2KAIB 4Y0ZE 5JYIA 1OP8A 3V0XA 2XBYA 3D62A 5A0CA 2XXLA 1C2DA 3U9AH 3AW1A 2XTTB 1G3DA 4Y11E 3OU0A 2Z94A 4X1NU 1NFWA 3SUDA 2P93A 2F9UA 1AMHA 2H2ZA 5FPTA 1B7XB 1J9CH 3MU8A 3ZZ5A 4ZXYH 2H5DA 3B8JA 4A5TS 1C5MD 3A7TA 1EZUC 3MI4A 4RKJB 1KTTB 3TJNA 8GCHG 1KLJH 5JBAS 5E0GA 1A61H 5T6DA 2ZFPH 4CRDA 4NIYA 1FDPA 2CHAC 2Q6DA 5E0HA 1P9SA 1MAYA 2OC1A 1TRNA 2QV1A 1H9LB 1JRTA 1L0ZA 3ZZBA 1RFNA 2HNTE 3T2NA 1D3PB 2SGFE 4JK5A 1TNLA 1NT1A 2XC5A 3GY4A 4HGCA 4ZH8A 2WYJA 3U69H 4DIHH 1CQQA 5FPYA 2Z9GA 4Y8ZA 1HAVB 1TPSA 1UO6A 1OYTH 1G2MA 1GVZA 1W8BH 2FYQA 1GJ6A 3K6YA 5EW1H 4FUGA 2GMTC 1QBVH 1BMMH 5CMXH 4AFZA 1OWIA 4WY3A 4I8JA 4NZQA 2VU8E 4A7IB 5I46H 5T6FA 1SGQE 1RD3B 1PPCE 1EAXA 4ASHA 3HKIB 4CBOA 3Q3KA 4NWKA 4YM9A 1Y5AT 4X2VA 1HGTH 1N1LA 2ZQ1A 1FAXA 1C1SA 2ULLA 3T26A 3DA9B 4CRFA 1OKXA 3QGNB 1FONA 2PGQB 3ZV9A 2BLVA 3IG6B 4RKOB 1PYTC 1AU8A 4DJZB 1S85A 4DIIH 4E05H 2BLWA 4NG9H 4IW4E 4ABEA 3R0FA 2OINA 1O5FH 2LNCA 4ISLA 4AORA 4UONA 3RXVA 4YT7H 1O33A 1Y59T 4TYDA 1GMDG 5DP5A 5IYTA 1G32B 1SGIB 1O2LA 3LGYA 2H6MA 1LTOA 3MWIU 4I8LA 3ODDA 2P59A 1O2YA 1Z6JH 1Y3XA 3AAUA 5JBTA 1C2EA 4D76A 4JZ1A 3MO3A 1QBNA 3G01A 2JETB 2ZU1A 3ZZ6A 1W12U 2ODPA 3RXAA 1MKXK 3LIWA 2WPIS 3A86A 3ESTA 2BDIA 1G9IE 2D2DA 1TRMA 1HFDA 3MNSA 1TYNA 2BX3A 2TIOA 2W3KA 1O2KA 2J95A 5J4QA 2PKSB 1K28D 2VIOA 1A7SA 1AO5A 1V2MT 2JH0D 1GJ5H 2VB0A 4R8TB 3VB3A 3LGVA 4KKDA 1EOLA 2EA3A 1EPTC 1OOKB 3MH6A 4XDEA 2FESH 3BTWE 4FXGH 1LCYA 4BTTB 1GHAF 1TNJA 5ABWA 1YPJH 4BTIB 1GI2A 3TGIE 4NA7A 5HXFA 1E37B 1TMBH 1GJCB 1QRWA 3LKWA 1MTUA 4NA8A 2VIPA 1LVOA 3A8DA 1O3AA 1LVBA 2LPRA 2P3TB 3GCOA 1W0YH 5GXPA 1ZLRA 2JH5D 1C4V2 2FEQH 3GYLB 3SOSA 3ZVEA 3MU1A 1BCUH 1P3CA 2ZDKA 1F5RA 1TGSZ 2TBSA 3LU9B 2ZTZA 2B7DH 3E0PB 1K1OA 2FMJA 1A0JA 2G4UA 1AZZA 4DGJA 1LPKB 1O2SA 1SHYA 1KXFA 2UUKB 3WY8A 3CP7A 1P06A 1KIGH 1QBOA 1SOZA 5EPYA 3E0NB 5FX5A 2CHAB 1MBQA 1WTHD 3VXFH 2ZFFH 2ZDVH 3C27B 3UIRA 1PFXC 1QRZA 4FU7A 4ISIH 2Y7XA 1QQ4A 3EA7A 2ANYA 3B9FH 1IAUA 1YBWA 1QNJA 3GCNA 4TPYA 2VWOA 4Y8XA 1MQ5A 2P8OC 3T25A 1O34A 4BAMB 5AFYH 1C5XB 3BTHE 3UR9A 4CR9A 1LQDB 1F0RA 1ZGIA 1DVAH 4XBCA 1VITH 5CHAC 1DPOA 1QIXB 1WAYB 1FJSA 2TGDA 1GBHA 1UTPA 2ZDAH 3ZVCA 3RXFA 1MH0A 1F5KU 1P01A 2FDAA 2ZC9H 1QL7A 1TABE 3QWCH 2FI3E 1BQYA 1BTHH 2FLBH 3UQVA 2Z9LA 1DANH 3UTUH 3URCA 4B2CA 1C5OH 4MPXA 1YPMH 3RXMA 2ZPQA 2FOMB 3BTKE 1ABIH 3EDXB 2BVSH 2ZDLA 5DP4A 1C2FA 2GZ9A 3ZYDA 1QA0A 2ZDNA 1EJAA 1O2IA 5JPMH 5A2MH 1ELBA 1SQTA 1ACBE 3T27A 2SFAA 1BBRE 3STIA 1WQSA 4HZHA 1WU1A 1O3EA 2OC8A 4PROA 3KEEA 4NCYA 4ZUHA 1A2CH 4LOYH 3M37A 1YPKH 1GHBG 2BD7A 1FNIA 2AMDA 3ZZ4A 4Y6DA 1BJVA 2GDDA 3GDVA 4X2WA 3EE0B 3MH7A 3SQHE 2Y5FA 1GHYH 4FUHA 3VGCB 2Y80A 1IQIA 1KXBA 5IDKA 2SNWA 2F9NA 1Z1JA 2ZFSA 5A8XA 2EI8A 1O2UA 1KXEA 1CGJE 3RU4D 2J92A 2BD4A 1O36A 2BXTH 1LO6A 1NRSH 1O2TA 1O2MA 1P12E 2NU1E 2ODQA 2Z9JA 3VEQB 1ELGA 1NS3A 1Z71A 3PMJA 3AAVA 2A5AA 1Y5UT 4I7YH 4LK4A 2ZPRA 1UMAH 1UK2A 2P94A 3BTME 2EEKA 2FWWA 2BQ6B 3MHWU 4KTSA 2IPHA 2BDGA 3CS7A 1Z1IA 2TRMA 5F8XA 3PLBA 1UVTH 2ZGXH 5LPEA 1G2LA 3T28A 2FOCA 3SU3A 3TPIZ 4CH2B 1P3EA 4Y7AA 1JMOH 1V2NT 3ITIA 4IC5A 9ESTA 4WXIA 3A83A 3KQCA 1GBFA 4WXVA 1E38B 2TGAA 3UPEA 1IQLA 2UUFB 1GHAG 3D65E 1Y3UA 1ZTKA 2DE8A 3TK5A 1MZAA 5DK1A 1GBJA 1TGTA 1BJUA 1ELDE 1YGCH 4X8TH 1HJAB 2VINA 5E0JA 1GCTB 1HV7A 3PV4A 2NWNA 2WV4A 2KAIA 3A7ZA 4XBDA 2BY6X 2WUBA 2OCVB 2W3IA 1TFXA 1O38A 3PO1C 1DXPA 3QUMP 3JZ2B 1O32A 4AN7A 1DICA 1MKWK 1AE8H 2TGPZ 4BAKB 1A46H 5J4SA 4WMDA 5C1XA 1P02A 1B5GH 1TA2A 3SJ8A 5I25A 1O3JA 1C1OA 1PYTD 1W13U 4BNRA 2BY5X 2O8WA 1DWBH 1DX5M 2ZGCA 3L6PA 1D6RA 1MTNB 2ALVA 1YC0A 6GCHG 3O8RA 2G5NA 1PQAA 2NU0E 2QF3A 4R0IA 1O37A 4K69A 3LPRA 4FUIA 4ZHAA 3R3GB 1C2LA 3RU4T 4K3JA 1AZ8A 1XUKA 5EQQA 1RTKA 3T5FH 1KYNA 1H1BA 4GUXA 1OSSA 3V13A 2G51A 2GT8A 1DLEA 2Z7FE 2QF0A 5GJ4B 3UNRA 1EJMA 1IQJA 1AGJA 1HAVA 3S7KB 1A3EH 3QZRA 1O3NA 2GCTB 2WPJS 1NU9A 1SOTA 1V2KT 3BTDE 1DFPA 1CA0C 2Z9IA 3A7WA 3P92A 5AFZH 4UFGH 4CR5A 1TOCB 3M5OA 3SO3A 5CHAB 3RXHA 3A80A 1AB9C 5GIBA 1EZQA 2XBXA 1D3DB 1QB1A 2O8LA 5E2OA 5EPNA 4THNH 3RXLA 1KXCA 1O3HA 2ALPA 3FP7E 4JYTA 4O03A 4XSKU 3S9AA 1AUJA 4J2YB 4X8UH 5E2PA 5DGJA 3PYHA 3EAJA 4INKA 2ZNKH 1TX7A 4AB9A 3RU4E 2TPIZ 4O9VA 1ZJKA 2H9EH 2OC0A 1BMNH 3EGKH 2OTVA 1V2QT 3H7OA 1GJ4H 2YOLA 1SLVB 1RTFB 2PW8H 2QGRA 1TPAE 2FM2A 3EA8A 3MMGA 3V12A 2FOBA 2PHBA 1P2KA 5ESTE 3A8BA 4X6NA 3HKJB 5H4IB 2A5IA 1TBRH 2AERH 3SQEE 1TQ7B 2I6SA 1SGFA 3I78A 2FS9A 1L2EA 1HB0B 3E91A 2SGAA 1NRPH 2DE9A 3D49H 6CHAB 1O3KA 1P05A 2ZHFH 2D8WA 2GDEH 3PLPA 1HCGA 1AKSB 5FAHA 3BSQA 3A87A 4JMYA 4CHAC 3ATKA 1C4U2 1P8VC 2HWLB 2H9HA 4YOJA 1UCYE 1SR5C 1TB6H 2O9QA 3AVZA 3DHKH 4U01A 2HNTF 3ELAH 2D26C 4D9QA 1G30B 3NWUA 4UEHH 2CF8H 3F1SB 1XX9A 4Y71A 1Y3VA 1TBZH 2VIDA 1SGEE 1A5GH 1EXFA 1UTOA 2A7JA 4ABAA 5C5NA 1CBWB 2J38A 1O2XA 2YNAA 3MNCA 1SGDE 3RUOA 4DURA 4FUEA 4I31A 1UHBB 1VGCC 5DP7A 2Z3CA 7GCHG 2ZPSA 1ZOMA 2CJIA 3RMLH 2P16A 4XBBA 1HUTH 1G3BA 1JRSA 1PPFE 2FOAA 1D4PB 2ZECA 1DWCH 3F68H 1HXEH 1XUGA 1DUAA 4A92A 2VGCC 4DVAU 1VCPA 1GG6B 1K9OE 1XXFA 1OYQA 1O2RA 4Y7BA 1CT0E 1O39A 1PPEE 2I6QA 2Z3EA 3QLPH 4YO9A 2ZF0H 4IS5A 4X2YA 3A84A 2ZU3A 3KF2A 2RA0A 5FBEA 1IHTH 4UDWH 1DWEH 1DDJA 1GBBA 1ZMJA 4AG1A 4K1EA 1NTPA 2BD8A 3F9GA 1VCWA 2R0KA 4Q7XA 2A45B 3E3TA 1ESBA 4ZKSU 1E35B 1IHSH 1TOMH 3GCHC 1O3DA 3MO6A 1K1JA 1OX1A 1ANBA 1SVPA 1JIRA 3E6PH 4Y0YE 4Q7YA 1T7CA 2V6NA 4FVBA 3D23A 4BAQB 1K21H 1AIXH 1GI5A 3BEIB 1S0RA 1UTMA 1UCYK 2PSXA 2NU3E 2WPKS 3DUXH 4X1PU 1C5UA 1A0HB 3TU7H 1GI4A 3RXQA 3STJA 3T62A 1DY8A 5L2ZH 1P10A 1MBMA 1C1TA 1EAUA 3RLYH 1EB1H 2ODYB 1SB1H 2BVXH 4O97A 1VR1H 3TITA 3UUZA 1A5HA 1AVGH 1DT2A 1QA7A 2AIPA 2A5KA 2OXSA 2ZHDA 1EQ9A 4F49A 1K1NA 3SGBE 1BT7A 5L2YH 1GBIA 1AWFH 3T29A 3SUGA 1NC6A 2VH6A 2ZFTA 2ZHEH 1XUJA 4ABFA 3EA9A 1PQ8A 4BXSA 2BDYA 1UJ1A 3MFJA 1EB2A 4K8YA 4GPGA 1CT4E 1WV7H 1JIMA 1L4ZA 3RXJA 1FPHH 4H6TA 2XCNA 1LPZB 1GBAA 2J9NA 4WJG2 1MD7A 5FCRA 1C5QA 4MPVA 2H5CA 1SQOA 1SSXA 4RSPA 3ZV8A 1HAIH 4YLQH 3S7HB 3S9BA 1MTSA 1YPGH 2BZAA 2VVUA 1GI9B 3NXPA 1ESAA 3TJOA 2ANWA 2FTMA 5FPSA 1Y5BT 4OS2A 1GHBF 4O3TA 2SNVA 3ATIA 2SGEE 1SLWB 2BXUH 2BD3A 1P2QA 1ZHPA 5EQSA 1P0SH 4ZKRU 1T8NA 3BTQE 1NRQH 2OQUA 3U98H 2G5VA 1TRYA 5LH8A 4CREA 5A0BA 1S5SA 1ZSLA 2P95A 2A2XH 3P8OA 1GBTA 3VB5A 2XC0A 4GLYA 2IJOB 1C5YB 3RXIA 1J15A 1XKAC 3LH1A 4ISNA 3IITA 1RIWC 1SGTA 3QTOH 2BD5A 4A1XA 4WF8A 1AVXA 2FTLE 3JZ1B 1LPGB 3KN2A 4H42U 3VB7A 2CF9H 3S69A 1AFEH 1GHXH 4BOHA 2VGCB 3SNAA 1BTXA 4MDSA 1IQEA 3RXPA 1GJBB 4X8SH 1T8MA 3M5NA 4M7GA 1AHTH 1BUIA 1PJPA 2HNTC 1O2QA 2R9PA 2Y7ZA 1HAGE 5EODA 2OBQA 1P11E 1LHGH 1TBQH 1O3PB 1SC8U 1TQ0B 1AFQB 1G3EA 1QB9A 2XWAA 1J8AA 2PTCE 1MCTA 1GWAA 1QURH 5JDUB 1AY6H 1MD8A 3TH2H 1G37A 4BAHB 2ZDMA 1TLDA 2GTBA 1FY4A 3NUMA 2C90B 2ASUB 1GJAB 1S0QA 1PQ5A 1NZQH 1SFIA 3BIUH 3LJJA 3RP2A 3ZVAA 3A8CA 1DUEA 4GVUA 3VFEA 1XXDA 4K5ZA 3KL6A 2YNBA 1NY22 2FX6A 1AUTC 4RN6A 3SW2B 2J34A 3RMNH 4KELA 2OP9A 3F9HA 1V2WT 1EZSC 2ZTYA 3TNSA 1FZZA 2VNTA 2F83A 3BG4C 1QL8A 6GCHF 1GPZA 1MKXH 4NA9H 5HM9A 4VGCC 3TIUA 1BHXB 1TNGA 2DUCA 2CMYA 1TPOA 2XC4A 3Q77A 3K65B 1BMAA 1EP5A 4K60A 3RDZA 3PMHB 1BA8B