1GVKB

Porcine pancreatic elastase acyl enzyme at 0.95 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDE INHIBITOR
publication title X-Ray Structure of a Serine Protease Acyl-Enzyme Complex at 0.95-A Resolution.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gvkB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gvkB01
7LPRA 2WUBA 1E34B 3K6YA 1CHOF 2H6MA 3LGVA 3U8RH 2WPIS 2XBVA 2P59A 1TOCB 4FUFA 3PWCA 3RC5A 1OYQA 1SVPA 1GBAA 1SLVB 3ZYDA 2F3CE 1C2MA 1Q3XA 3P8FA 1KXEA 2R9PA 2YNBA 1INCA 1OXGA 1AKSA 1GMDF 3O8BA 1EB1H 1P05A 1P3EA 3FP8E 1O2UA 1OP8A 2O8MA 2B9LA 1F5LA 5AF9H 2TGTA 1LPZB 4H6SB 3SGQE 1O5AB 4CR9A 5EXMA 4X1RU 3OY6U 5DK1A 3RXPA 4ABIA 1C5SA 1HAXB 2PV9B 2WV4A 2ZGXH 3M7UA 5GPIB 5C2ZA 1YYY1 3RXEA 1SSXA 1YPEH 5A0BA 4JZDH 7KMEH 1Q31A 1AVXA 3ITIA 1MTUA 1RFNA 1QA7A 3PWBA 1WQVH 1V2LT 3F9GA 1WOFA 4TPYA 2BD4A 5HGGA 3HGPA 2PR3A 3UR6A 1EZQA 4UDWH 4YT6H 1SLUB 1THPB 4D76A 3O8RA 4E7RG 3T5FH 2XWBI 1C1VH 1HAVA 2BX4A 1GCTB 3AVZA 2FOHA 4KTCA 3ZZ8A 1Z8JB 2A4GA 2J4IA 1G2MA 1Y3WA 1VCQA 1XXDA 3OY5U 3SO3A 1O2QA 1WU1A 1O3EA 3QTVH 1SFIA 5JBAS 3PMJA 4X6MA 2TPIZ 4Y11E 3PLBA 1SG8B 1BHXF 1Z7KA 1W2KH 1TFXA 3NZIA 3UWJH 6CHAB 4HTCH 2FESH 2QAAA 5L2YH 1SQOA 1C5PA 1ZSLA 3ESTA 1AFEH 2VIVA 1BOQA 1FQ3A 1DUAA 1MCVA 1O2GH 3QO6A 1SFQB 5FPTA 2ZEBA 1NO9H 3SU3A 1CE5A 1Z8GA 1N8OC 4RKOB 1ZOMA 5AFZH 1GBFA 1UTJA 2CF9H 4OS7A 1UK3A 5GJ4B 1DWBH 3FFGA 4OS6A 2Y5HA 3SJ9A 1NRNH 1C5VA 5FBEA 2R3YA 5FCKA 2H5DA 1PQ5A 5EOKA 5LGOA 1E36B 3URDA 1P2KA 2CHAC 5F03A 4BXWA 4MNWA 1OWEA 2BDBA 3LONA 4WWYA 4DJZB 1GI8B 3M7TA 2QA9E 5EG4A 5T6FA 8GCHG 1Y3UA 5FCRA 3UR9A 3VB4A 4F4OC 1QB6A 1GBTA 2AYWA 5ETXA 2AIPA 4ISLA 2D26C 1FDPA 2GDEH 4FU8A 3TH4H 5FPYA 2A1DB 3OU0A 2VH6A 3QWCH 1GMCG 1KXAA 3A82A 4MPVA 3BEUA 1EX3A 2D2DA 2A5KA 1NZQH 3UTUH 5BRRE 3VGCC 1BJUA 1SHHB 3EDXB 1Q2WA 1GMHG 3IITA 1A5HA 2AMPA 2BVSH 1AO5A 2FX4A 3ZYEA 8LPRA 1CT0E 1LDTT 1GG6B 1DWDH 1SGPE 4XSKU 1TLDA 2GGVB 3RU4T 5TCAA 1Y8TA 1FXYA 4JYVH 1SQAA 4BNRA 1ANDA 1AWFH 1Y5AT 2C90B 1H1BA 2FYRA 3AASA 4BTTB 2G55A 2D8WA 1SB1H 4H4FA 2A7HA 1UVPA 3QDZB 1ELVA 4Y76A 2P3UB 1ANEA 1AQ7A 1EAIA 5A09A 3BG8A 2PUXB 1J8AA 3UQVA 1N8OB 2AGIX 2J34A 1O38A 2XWAA 3GCOA 4Y8ZA 1HXFH 1JBUH 4AFUA 1QRZA 2EI7A 1C5NH 1TMUH 1RTKA 3NKKA 1YPHE 3KQDA 1TNGA 3E91A 3E90B 5FPSA 2KAIA 4IMZA 1ZMJA 3NK8A 1SBWA 4NZLA 2ANWA 1A61H 3M5OA 1EJAA 1LVMA 1TPOA 2ZFPH 1G3CA 3SNDA 3RM0H 3RMLH 3P8NA 1S5SA 1ELCA 1GL1A 4YZUA 4JZ1A 3PO1B 4B2CA 4FVDA 3RXKA 4KKDA 3UWIA 1P0SH 1SGNE 1EAUA 2F83A 2ZDAH 4NSVA 2FOBA 1NRPH 3BN9A 4X2VA 3VGCB 4BAKB 2OTVA 1G36A 4UD9H 1TOMH 4JK6A 2QCYA 1UTLM 5ESTE 1YPJH 1GBHA 2VGCB 1F5RA 3L33A 3MWIU 4QT8C 4LK4A 2Z94A 3SU6A 2FOCA 3SU5A 1BUIA 4D7FA 1P09A 1A3BH 2ANKH 4ZH8A 4B71A 1O5CB 3TLOA 4FUBA 6ESTA 1D3QB 1WBGB 1GPZA 4K3JA 1ZHPA 3A8BA 1C1PA 3NUMA 3O8CA 3KQEA 2SGDE 1HAOH 2ANYA 1KLJH 1WTHD 4O97A 2PGQB 4MPXA 1H4WA 3SI3H 3MH7A 4YOIA 1FONA 1BBRH 3S0NA 1WCZA 2R0LA 1V2MT 1L1NA 2ZU1A 4Y8XA 5DP4A 2SGPE 2GD4B 3SOSA 3P8GA 3SNBA 5LPEA 1IQKA 1C1NA 4Q2KA 1MTSA 1BMLA 3V3MA 5GCHF 2XBYA 2BDYA 3GY4A 1K1MA 2QN5T 2ZU3A 1G3BA 1KXDA 3F9EA 3R0FA 1C5RA 1ACBE 3E8LA 1QBOA 3ZZ7A 1O3LA 1P03A 2VJ1A 3FZZA 4B1TA 2PUQH 1GI6A 1MTNB 3VB7A 1FPHH 4LZ1H 2J2UA 2PWXA 4ABBA 1NU7B 3I78A 2OLGA 1BA8B 1P2JA 4JYTA 1O5FH 2ZU2A 3ZZ3A 1C2IA 1O5EH 2ZGCA 4FUDA 2PFEA 4D8NA 1IQHA 1HCGA 2FYQA 4X8TH 1VJAU 1NS3A 5L30H 1O0DH 1AUTC 1GI7B 2W5EA 2THFB 2ZDLA 1GJDB 1O3IA 1GJBB 1A5GH 1QJ1B 1SQTA 2OD3B 6GCHF 4GLYA 2ZPQA 5JB8S 1THRH 1KXBA 1C1WH 2OC0A 4Y10E 3S9CA 2BY5X 3M5LA 4MG3A 2FPZA 2A32A 2W3IA 3F68H 4PROA 2EEKA 1YPMH 1NROH 2XRCA 1D3TB 1F0TA 1V6DA 1O2LA 1GBBA 2STAE 1QJ7B 1J9CH 1H8DH 3S69A 4NIVA 3W95A 1QTFA 1NC6A 1SHYA 3A8DA 4E05H 1JIMA 1NTPA 1AFQC 3SGAE 2XNIA 2BVRH 1TIOA 2ALVA 1TBZH 3ZVDA 1UCYK 1KIGH 3P6ZB 2PKSC 2WUCA 3VXFH 1CBWC 1CSOE 3E1XB 1EP6A 1C2GA 2GTBA 5ABWA 2FS8A 4KTUA 1GJ7B 3H5CB 1N1LA 1O2XA 2BQ7B 3UOPA 1O30A 3RXDA 1GHBF 5GWZA 1C1SA 1P01A 1ANCA 3M37A 3V7TA 2ZF0H 1FNIA 3RXAA 1AI8H 1LVOA 1MKXH 1EOLA 4X1QU 1C5YB 2H9TH 2V3OH 5HM2A 1G37A 3DHKH 5J4QA 2SGQE 4NIYA 6GCHG 1TNJA 4AORA 1ANBA 4BXSA 4ABEA 1T8LA 3QLPH 2G51A 5DJ7A 3SUEA 4CH2B 2C8YB 4YOGA 1HXEH 3UNRA 4BTUB 1HAVB 3EYDA 3KIDU 3UOUA 1GBEA 1YBWA 2O9QA 5IDKA 5A0CA 2DUCA 3NWUA 1L4DA 4OGXA 2VWMA 1P2MA 2H2ZA 2P8OB 1DLEA 1O32A 1NU9A 1P2OA 1V2VT 2C8XB 1YLDA 2CF8H 1C5ZB 2ZWLH 1AY6H 5DP8A 4K5ZA 3RMOH 1XKBC 3K2UA 2AERH 2A7JA 1L2EA 4GCHG 2ZFSA 1GGDC 1ZMLA 2Y5GA 5JBTA 1S84A 1F0RA 3CP7A 4A6LA 1GI4A 3F9FA 4U2WA 1YPHC 2PTCE 3GCHB 2OC1A 1RTFB 1K2I1 1D6WA 4K60A 1HUTH 1EATA 3EGKH 2PKSB 2P94A 2A5IA 4CRBA 1GHBG 3MTYA 1C2DA 1CVWH 1SC8U 3M35A 4KP0A 1ESTA 1K1NA 1TX6A 2ZHDA 3LJOA 2Z9JA 5HYOA 2F91A 1N6XA 2RA0A 1GDUA 4I8KA 3UNSA 1UCYE 5A8XA 5EQQA 2BVXH 3PM3A 1ZHRA 3ATKA 1ETTH 2FOEA 1MKWH 1O2PA 1FIWA 4BTIB 3VXEH 3SI4H 1WQSA 5J4SA 4ABJA 1XKAC 3SJKA 1W7XH 2A45B 1V2RT 1MU8B 2VH0A 3MH5A 2JETB 5EW2H 1GBMA 1TYNA 3SV7A 5C1YA 4CRDA 1TA6A 5E8EH 1HAIH 2VVVA 4M7GA 4DIHH 3BTKE 1HJ8A 3P95A 4D9RA 4H42U 1TA2A 1LQDB 4MQAA 4CBNA 3LJJA 1GVKB 2K1QA 2H9HA 2Q6FA 1SR5C 5DP5A 1HDTH 3GY7A 4BOHA 3FZDA 1XUKA 2A7CA 2ZFQH 3MH6A 1A0JA 1Z6EA 1ZRBA 2B5TB 3M3VA 5L2ZH 3SHAH 1HAGE 1C1RA 1WTGH 2GMTC 3NCLA 3Q3XA 2PTNA 2G8TA 1O2RA 4ASHA 5LH8A 1GGDB 3A87A 3SUFA 1GCTC 2WPMS 3LGWA 1P57B 7GCHF 1NRRH 3ENSB 1LPKB 3P17H 1HAYB 1DXPA 1K1PA 2C4FH 2F9UA 4ABHA 2ODYB 4X8VH 2ZG0H 1AZZA 1GCDA 2ZCHP 4ZKRU 4E7NA 3E6PH 4CRAA 1EQ9A 1UTMA 4B73A 4B2AA 3AAVA 1V2WT 3EE0B 2PKAB 1E0FD 6CHAC 4LZ4B 2FLBH 3LPRA 1UTNA 4X6NA 5GIBA 2QF3A 1GWAA 4ZAEA 1JOUB 1C5TA 2KAIB 1FAKH 1JRTA 1ABJH 1C5OH 3SUGA 1P9UA 2FZZA 2ZHEH 1W13U 1ZZZA 3I77A 3JZ2B 4CH8B 1VITG 2Y82A 1BMNH 3L6PA 4NFFA 5DGJA 3SW2B 3A81A 3QGNB 2D1JA 3OX7U 3OTJE 1BHXB 3AW0A 3ATWA 1UTOA 1LKAA 2CMYA 4AFZA 2ZFFH 1FY1A 1UO6A 3LGTA 3MO3A 2CV3A 2HWLB 1HPGA 2Q6DA 3TNTA 2XTTB 1O5DH 5T6DA 2G4UA 3TITA 1C1MA 3K9XB 5AVDA 5I25A 1GHAF 2XBXA 1ZPZA 2BQ6B 2HRVA 3KHVA 5FX6A 5I46H 1A46H 1W7GH 2GMTB 1BRCE 2FI5E 1SGYE 1KXCA 3MU5A 1YLCA 2UWPA 1NESE 2ZGBH 1CHOG 1TB6H 1UHBA 3S9BA 5F8TA 2OC7A 5EW1H 2BDAA 1GG6C 1O3PB 5DP6A 1C9PA 1O3KA 1TBRH 4TY6A 5FAHA 3D49H 3UNQA 4NA8A 1BRAA 1FIZA 1GI1A 3BTTE 2XC0A 3MMGA 3BTEE 4INKA 2ZIQH 1CU1A 3GY5A 1GMDG 1TGBA 3KN2A 1DY8A 1TE0A 2W7UA 4MTBA 5GXPA 4ZHAA 1S83A 3ZVAA 1BT7A 1GJ9B 1DWEH 1DPOA 1Y59T 2O8WA 4FXGH 3Q00A 2O8TA 1L1JA 3FP6E 3RXFA 2FDAA 5SGAE 1K9OE 1H9IE 2J9NA 2ZECA 3MOCA 3GYLB 3GDVA 3ZZDA 5EXNA 1LHDH 2FOMB 1CT4E 3SNCA 3SV2H 1SL3A 1GJCB 2J95A 4SGAE 3VEQB 2P95A 2XYAA 1PPEE 1DY9A 4AFSA 4YT7H 2C93B 3TJOA 1KDQB 1MBMA 1YCPM 4CBOA 1CHGA 1HV7A 1NFYA 2Y81A 3T28A 3LDXH 3GOVB 1UK2A 2OQUA 4B76A 1AD8H 2BD8A 5EGMA 1T8NA 1TNKA 1ZSKA 1MTWA 4BAMB 3ELAH 2WPHS 2P3TB 3LC5A 1RGQA 1SLXB 3PO1C 1O2NA 3PMBB 4IC6A 2AIQA 1LKBA 2I6SA 2PSXA 1TGTA 1MQ5A 2EC9H 4MLFB 5B6OA 2ANMH 3P92A 1O2KA 4Y71A 1C4V2 4U01A 1JIRA 1FZZA 1GBKA 3LT3A 1OS8A 4GHTA 4MDSA 1WSSH 1TPSA 2BD3A 5C3NA 1GJ4H 2UWLA 4Y0YE 2EI8A 2WPKS 4FUIA 3UQOA 4A7IB 3LH1A 2VGCC 2J38A 3HATH 1P12E 3ZZAA 1PQ7A 2UUYA 1AUJA 2GX4A 1V3XA 1XMNB 3C1KA 1H8IH 1RRKA 1XM1A 1SI5H 2ZKSA 4ABAA 2ZHFH 3BSQA 3A7TA 4NWLA 2C3SA 2BZAA 1N6YA 3MH4A 1YPKH 3ZV8A 2FOAA 1JWTA 1TQ7B 1QFKH 4HFPB 4I8HA 3HK3B 4DW2U 1HJ9A 1THSH 2B0FA 2BB4A 4IC5A 2AGEX 2GDDA 1FUJA 1S6HA 1WUNH 1ABIH 3SU4A 1BTYA 5E2OA 3KL6A 4HGCA 3V12A 2CN0H 2PKAA 1IQJA 3W94A 3B9FH 1MTNC 1YM0A 4F49A 4UFEH 2Y7ZA 1ESBA 1AVWA 1SGQE 3RXBA 4BANB 2BMGB 3QGJA 3DT0H 3A7YA 2R0KA 3E3TA 3PROA 2O8UA 4X2WA 1C5MD 4NA7A 1H9HE 3TJUA 2VINA 2BD5A 1TONA 4HZHA 1UJ1A 4I32A 1BB0B 2Z6BD 1DXWA 4GHQA 2Y6TA 3MNSA 2OINA 4DG4A 4J2YB 1BTZA 1TX8A 3KF2A 4X8SH 5CHAC 4AOQA 1WYKA 2GT8A 4DVAU 3EA7A 1P10A 3TJVA 1EJNA 2JH5D 3IG6B 4H6TA 1K1LA 2F9PA 2XC4A 1B5GH 3SU1A 1KSNA 3ZZCA 4Y8YA 4O9VA 4A1XA 1O31A 1O2YA 4AB8A 1V2NT 1SGCA 1PPFE 4Q80A 2BY9X 5F6MA 3KQCA 2XC5A 1E37B 1NN6A 1EXFA 1S85A 5GDSH 2H5CA 4YO9A 5DPAA 1G3DA 3MI4A 3SORA 1MH0A 2OP9A 1GI3A 1QRXA 4A1TA 1TNIA 1SLWB 2JKHA 2GV7A 2ZU5A 1DX5M 3LGYA 4ZKSU 1EZSC 1C2LA 4FU7A 2DE8A 3A8CA 2NWNA 2RCEA 1DITH 3A86A 1QBVH 2FWWA 1OWHA 2GZ7A 4TPIZ 2BDGA 1OSSA 3U1JB 1P04A 7ESTE 1W11U 1QL8A 3BTDE 1QHRB 3TGJE 1FY5A 3U1IB 3QUMP 1K1JA 1P02A 4X0WU 2V35A 1K22H 3TGKE 1HAPH 3LGIA 1O2JA 1TRMA 2ZCKP 4ZROA 3RXLA 3BTGE 3QK1A 2UUJB 4X6OA 3ATLA 1QL7A 3UFAA 1ZPCA 1G30B 1O2WA 3QZRA 2NU3E 1NFXA 1V2QT 1LTOA 3U98H 5CHAB 4Q7XA 2ZDNA 2WYGA 1MTVA 2A5AA 1YPGH 5TJXA 1KDQA 1DSUA 1T32A 3ZV9A 1FMGA 3ZVGA 3TGIE 1DANH 2ZDKA 1J17T 1IQLA 3BTME 3KGPA 1H9LB 3CS7A 2ALPA 1LHGH 1TQ0B 3STJA 2P8OC 2A4OA 2Z7FE 2FOFA 4Y79A 8KME2 2QGRA 1BBRK 4Y6DA 3SNAA 3ZZBA 3K6ZA 2BX3A 3EA8A 4AYYB 1AIXH 3TH3H 1W8BH 2ZFRH 3TK6A 1CGHA 2ILNA 1TAWA 2Y80A 1PQ8A 1UVSH 2BZ6H 3BIUH 4ESTE 4XBBA 2XCFA 2BQWB 1C4Y2 1SMFE 1F92A 3GCHC 4Y7AA 5GCHG 1JRSA 1IQMA 2ZC9H 3BTWE 3RXOA 5IYTA 3NXPA 4WMFA 1DSTA 1CA8B 1LHFH 1TMBH 1DICA 1P9SA 1IOEA 1JXPA 1MZDA 3P8OA 1A7SA 4FUJA 1LHCH 1O3NA 1OP0A 1S82A 1IQEA 5AHGH 3DUXH 2F9VA 1ARCA 1KTTB 3A7ZA 1S81A 5G4BA 1K21H 3UY9A 5HMAA 1DVAH 1HJAC 3KCGH 1NM6A 4IN2A 4XOJA 3SU2A 4NGAH 4OS4A 2OBOA 1ETRH 3MYWA 1UVUH 1V2OT 1VZQH 2G5VA 1ZMNA 1MQ6A 3RMMH 2FP7B 2JH0D 2ZDVH 2FTMA 2V0BA 3SNEA 2UUKB 1QQ4A 4UEHH 3ZZ6A 2CXVA 5EPNA 3A80A 4I33A 3TIUA 1GJAB 2PHBA 2ZO3H 4NG9H 3WY8A 4AZ2B 4ZKNU 1O3MA 2JETC 3SQEE 3MU1A 1O34A 1UVOA 5T3HA 4YLUA 2BLQA 1UHBB 4THNH 3TJNA 1PFXC 3NPSA 1UTKA 3RXUA 3CS0A 4Q7ZA 2FODA 1T4UH 4FUCA 1C4U2 2PW8H 2FLRH 1Z1IA 2O8LA 3RP2A 1KLIH 1HNEE 4K1TA 1X7AC 2NU2E 1VR1H 1D3PB 1HIAB 4GVUA 1BTXA 1RIWB 1V2JT 3BTHE 3U9AH 1OWJA 5TCCA 3A8AA 3SQHE 1AZ8A 4DURA 1XUJA 4YLQH 3KQBA 3SV6A 2R3UA 1C5WB 1ZHMA 2BD7A 1E38B 4OS2A 1BBRE 3AW1A 4GPGA 2AMDA 1GBJA 2BDHA 1IAUA 4ZKOU 1GBCA 1A0HB 2TGDA 3TH2H 2VB0A 2ZTZA 4NIXA 4NCYA 5JPMH 3RC6A 4A92A 3GDSA 3M5MA 1DLKB 3U8OH 1HBTH 5EU8A 4NSYA 4IS5A 3B8JA 1QY6A 1O5BB 4ZMAH 3ATIA 3LIWA 1GL0E 3V13A 1HJAB 2HPPH 4XDEA 1ELDE 1SOZA 4O03A 4ZXXH 1LCYA 2TBSA 3LOXA 4WF8A 4K2YA 1PJPA 1O37A 1EPTC 4AB9A 1YCPH 4NZQA 1K1OA 5E0GA 1AE8H 5C5NA 4YOJA 4INHA 2DE9A 1CO7E 1GBLA 1TX7A 1UVTH 3M3SA 3SGBE 2NU1E 2F9OA 2I6QA 2VIDA 1GJ5H 9ESTA 5C1UA 2VIWA 5JB9S 5FHTA 1MU6B 1BMAA 5FX5A 3RLWH 2CJIA 1O39A 1Y3YA 5ESBA 4Z6AH 2AS9A 2ZHQH 4DOQA 4K1EA 1CGIE 1ZGIA 1GDNA 5E0JA 1IHSH 6LPRA 1C5UA 2ZGHA 1PYTD 5JYIA 4Z0KA 4NFEA 2GV6A 4OS1A 3CENA 4KELA 2YOLA 2XXLA 3PLKA 4UE7H 1EASA 1Z1JA 1O2ZA 2UUFB 4OGYA 4ABDA 2ULLA 4AG2A 1O5GH 1VCPA 5FBIA 2VIQA 1AGJA 1VITH 3SHCH 4UONA 3GY8A 1J16A 1VGCC 1CT2E 4IBLH 1Y3XA 3OYPA 2V6NA 2V3HH 3MNCA 1Y5BT 3UREA 3RMNH 1O33A 3GICB 4O3UA 3PYHA 3ATMA 4D9QA 1MKWK 3F9HA 1W10U 3MU0A 3OSYA 1UTPA 1DFPA 3HPTB 4MNXA 2BYAX 2R2WU 1KLTA 4VGCC 4ABGA 4E06H 1WV7H 2B8OH 1NPMA 2ZDMA 3GCTF 2XBWA 3C27B 2GP9B 2ZHWH 1EPTB 1NT1A 3T2NA 5F8ZA 2B7DH 3SJIA 3Q3YA 1VJ9U 5A8YA 3ZVEA 1GI9B 3RXJA 1C2FA 1C1TA 5EPYA 3GISB 1PPZA 2RG3A 4YM9A 2BY6X 2G00A 4I8GA 1OPHB 3P70B 1U6QA 5AFYH 2A0QB 1AB9C 2Y5FA 2HOBA 5JBBS 3RDZA 1IQFA 4MVNA 3LGUA 3TK5A 1F2SE 3STIA 2G52A 5PTPA 1GI0A 2GT7A 2F9NA 1S0QA 1SGIB 2BD9A 4NWKA 1PPBH 2ZFTA 3GY6A 1LMWB 4GSOA 3E16B 1BDAA 2A2XH 5CE1A 1C2JA 1ZLRA 5C67A 2BY8X 1DDJA 1C1QA 1O3AA 2ZZUH 1QB9A 4WVPE 1D6RA 3AAUA 2W26A 1K1IA 3GY2A 1O3HA 7GCHG 4GAWA 4I31A 3VFEA 1CGJE 1O36A 2IJOB 2P93A 3QN7A 4XBDA 2ODQA 2QIQA 1EOJA 4HI3A 1ELEE 1VGCB 3D65E 4RKJB 4I7YH 4BAHB 4B75A 2ASUB 3GCTG 1A2CH 4R8TB 2AEIH 2VIPA 1DUEA 1HIAA 2P16A 8GCHF 1C5QA 1S0RA 3BEIB 2QY0B 4VGCB 4B2BA 3MFJA 4DGJA 1W3CA 1O2OA 3MO9A 4K1SA 2A31A 1QBNA 4FUHA 4GUXA 1DS2E 1GMCF 2H9EH 1P11E 1UMAH 3RU4E 1BTUA 1FY4A 3SV9A 3RU4D 1ELAA 5EQRA 5DP7A 2W7SA 1GDQA 1GMHF 1FLEE 4YTAA 3DFJA 1O2VA 3O8DA 1OWIA 1O3GA 1F0SA 1SGEE 3M3TA 3TPIZ 3PMHB 1L4ZA 1EB2A 4JCNA 1AB9B 1SGFG 4U32A 2NU4E 1GHAG 2VWNA 1F0UA 2P3FH 2ZQ1A 3A7XA 2GZ8A 5EQSA 4DIIH 4UFFH 4AX9H 1XXFA 2HPQH 2F9BH 2GCTC 2FS9A 4TY7A 1YP9A 4A1VA 4X2XA 2QXIA 1UTQA 1GBDA 1IQGA 5A2MH 2WV5A 3RXSA 3SU0A 2IPHA 4CR5A 2SNVA 1HAZB 1XUGA 3MU4A 1FV9A 2TIOA 1EUFA 2GCHF 1B0EA 1GHZA 1AWHB 1QNJA 2UWOA 4CRGA 1NFUA 2SFAA 2ZTXA 4UFGH 1TBQH 4WXIA 2XCNA 1JMOH 4DCDA 1T8OA 3BG4C 1YPLH 1GVLA 3QZQA 1L0ZA 3UUZA 1CQQA 2YNAA 3FVFB 3S9AA 4WMDA 1HLTH 2A4QA 2HNTF 2FMJA 1MCTA 1SOTA 1V2TT 1ETSH 2OBQA 1BZXE 4ISHH 3SJ8A 1PPCE 4AGJA 3E0PB 1BITA 3KEEA 3RXHA 1A5IA 2HALA 1AMHA 3BTFE 1RS0A 1ZJKA 1NY22 2EA3A 5H4IB 2LPRA 2IN2A 3PMAB 4MPUA 1EAXA 1QURH 1BRUP 2FTLE 3A7VA 1LVYA 1O2HA 5HM9A 2PLXA 1GJ8B 1SGFA 1PYTC 5T6GA 1VCWA 2J92A 1SGTA 3T29A 1V2ST 3HGNA 3HKJB 4J1YA 4MPWA 1TRNA 1OYTH 2H1UA 1B7XB 4TWWA 1MUEB 1XVOA 1LO6A 4Y7BA 3RM2H 2BXTH 4CRCA 2ZP0H 1NRQH 3LH3A 3KNXA 1TGSZ 1GI2A 2GVFA 1OOKB 3A88A 3SZNA 2FX6A 3PTNA 4ZXYH 1BRBE 2A4RA 1G3EA 1P3CA 3VB3A 1ZYOA 1ZGVA 1V2UT 2BTCE 3PB1E 1GHWH 1ZSJA 3UPEA 1EPTA 1TPAE 1W0ZU 2GCHG 1FN6A 2GCTB 4WXVA 3PLPA 1ZR0A 3ODDA 5BPEA 1GHXH 1QJ6B 4MNVA 4B74A 4BAQB 1Z8IB 1SGRE 3ZZ4A 1Y5UT 1HAHH 3GY3A 1B0FA 3T26A 1G2LA 3QX5H 1TWXB 2FI4E 1RXPA 5EODA 1C5XB 2CHAB 1QIXB 2JH6D 2VU8E 1TALA 1G32B 1O2MA 2VIOA 3B23B 4MNYA 4R0IA 4ABFA 4CHAC 2BD2A 1ID5H 1MAXA 1DE7H 2IOTA 3BG4B 4WH6A 2ZA5A 1TNHA 3N7OA 2CGAA 1MZAA 2HGTH 3ODFA 3M36A 1QR3E 4FUEA 9LPRA 1IQNA 2VNTA 2FI3E 1D4PB 2G5NA 5C20A 2SGAA 2VVCA 2Z3DA 4JK5A 1V2KT 3EQ0H 5CMXH 2QYIA 2BDIA 1HRTH 1BTHH 3BV9B 2XW9A 3BEFB 1TABE 1O3JA 5C1XA 1TMTH 3RXIA 4K8BA 5L6NH 2OC8A 5DP3A 4DT7B 5JBCS 5FXLA 4IN1A 3RXMA 1UK4A 3VB6A 2FXRA 3LKWA 1P2IA 2Z3EA 4JZFH 1AU8A 3M61U 4JZEH 3U69H 1C1UH 2EI6A 1DT2A 3S7KB 2ZPRA 1F7ZA 5DG6A 1TGNA 5LPRA 1LVBA 4NA9H 2SNWA 4AN7A 1T7CA 4LXBH 1YF4A 2BLOA 2LNCA 2QV1A 4AFQA 1KXFA 3T27A 2ZCLP 3SJOA 4XBCA 1GVZA 4JMYA 4X1SU 1XUHA 2QXGA 5K7RA 1BJVA 3I29A 1KYNA 1FPCH 4IGDA 4ZHLU 1NFWA 3U8TH 1EJMA 3V0XA 1OWDA 1UCYH 1RJXB 2BY7X 3F6UH 4BAOB 1XUFA 3TU7H 4X1NU 1ZRKA 1ZJDA 1EP5A 1PQAA 4CHAB 2ZGJA 3TNSA 4ISNA 3RXRA 1T8MA 3FP7E 2TGPZ 3SV8A 2BOHB 3GDUA 2RDLA 1GI5A 1D3DB 1O2SA 3MU8A 2ZTYA 3PV4A 1KTSB 2HNTE 1AE5A 4YESB 2Q6GA 3EA9A 1HB0B 3D23A 1ELBA 3GYMA 4FU9A 4ZHMU 1O3OA 3T25A 2GKVE 1CA0C 2BDCA 2BLWA 1RIWC 2M5TA 3M5NA 4IW4E 4WH8A 2ZQ2A 4DY7B 4I8JA 3BF6H 1ARBA 1P8VC 2Z9LA 1TPPA 3LU9B 1TRYA 4ISOA 1M9UA 2QXJA 2ZNKH 1T31A 1DOJA 4D7GA 1TNLA 1J15A 4KTSA 1O2TA 1V2PT 3F1SB 1C9TA 2AFQB 5HXFA 1GHYH 3A83A 2NU0E 1IHTH 2Y7XA 4IMQA 1ZTKA 4ISIH 5DKMA 2ZPSA 1EKBB 1QRWA 4A5TS 1BMMH 3G01A 1XX9A 4XFQA 1AKSB 4WJG2 1C1OA 3Q77A 1MBQA 1P2QA 4O3TA 1YC0A 2SGEE 1BCUH 1MD8A 2OUAA 1O2IA 5A8ZA 2BXUH 4TWYA 1O35A 4GCHF 5E0HA 4LOYH 2R2MB 3ZZ5A 2Z9GA 1A4WH 5C5OA 2Z3CA 1A1RA 4X8UH 1SPJA 2G4TA 1ZPBA 1EAWA 5EXLA 3LC3A 1DWCH 1P2NA 3RXGA 2A2QH 1RD3B 1EZUC 1QA0A 2VVUA 3RUOA 2WINI 3IWMA 2HVXA 2PGBB 4JZIA 1F5KU 5A0AE 5F8XA 2SGFE 1YGCH 4X1PU 1T4VH 2HLCA 1ZTJA 1K28D 4JYUH 3RXTA 4FUGA 2ESTE 1QQUA 3JZ1B 1ELFA 1LQEA 1W12U 1IQIA 3H7TA 5E2PA 3ZVFA 1AHTH 2QXHA 3MHWU 4WMEA 2AH4X 1G9IE 3RLYH 4CREA 1OX1A 2OCVB 1CA0B 2PSYA 1GJ6A 1KY9A 3QTOH 1PPGE 1W14U 2Z9KA 1O3CA 3S7HB 1ZTLA 1QB1A 3VPKA 1FY3A 4INLA 2C8WB 1A0LA 2WPLS 3Q3KA 1SGDE 2BLVA 3Q76A 5DP9A 3TVJB 1Y3VA 3A7WA 1D9IA 1C5LH 1MAYA 2AMQA 3L3TA 3ZVBA 4AYVB 1WAYB 3BTQE 1MKXK 1W0YH 3DD2H 1ORFA 2Q1JA 4FVBA 4K69A 2VWOA 3HKIB 3RXVA 1C2HA 3SBKA 1YKTA 4WY3A 2ZI2H 2Z9IA 4CRFA 1AFQB 1FN8A 1NRSH 3H7OA 4RSPA 5JDUB 1MD7A 3T62A 3PTBA 2GZ9A 4U30A 3RC4A 3EAJA 1PPHE 2BOKA 2VWLA 4SGBE 3URCA 3SN8A 3DA9B 2OQ5A 1CBWB 4ZUHA 4RN6A 2FM2A 3TK9A 1MMJN 1QGFA 3HK6B 1O3DA 3D62A 3A89A 1AN1E 1BIOA 3MO6A 3GCNA 1C2KA 1FY8E 4OS5A 1BTPA 1Z6JH 1ELGA 1ELTA 5DO4H 1HFDA 1EZXC 1HYLA 1ESAA 2FO9A 3SUDA 3FAOA 1J14A 3A85A 1FJSA 2WPJS 3ZVCA 1TGCA 1FI8A 5K0HA 5LPFA 4UFDH 1E35B 1L1GA 4AG1A 2BM2A 2TGAA 1AVGH 2OXSA 4X2YA 1O3BA 4KGAA 3BIVH 3R3GB 1P06A 2TRMA 3M7QA 3MNBA 1GBIA 4XE4A 1O3FA 1XVMA 4K8YA 3MNXA 1VITF 2AGGX 3A84A 3E0NB 4TYDA 1LPGB 2W3KA 4Q7YA 3VB5A 4I8LA 3RXQA 3FANA 2FIRH 1OWKA 3UIRA 2J94A 4NIWA 2ODPA 1YCPK 1FAXA 1OP2A 1BQYA 1RTLA 2G81E 1BTWA 1Z71A 1C2EA 2FOGA 1DM4B 1QL9A 2RA3A 2BHGA 2C8ZB 1GHVH 3K65B 3ZZ9A 2QF0A 1A3EH 2FEQH 1XUIA 1S6FA 1QCPA 8ESTE 2QC2A 4AGKA 1HGTH 3DFLA 4Y0ZE 2ZU4A 2STBE 3RXCA 1OKXA 4X6PA 2WYJA 2HNTC 1LHEH 1Z8RA
chains in the Genus database with same CATH superfamily
7LPRA 2WUBA 1E34B 3K6YA 1CHOF 2H6MA 3LGVA 3U8RH 2WPIS 2XBVA 2P59A 1TOCB 4FUFA 3PWCA 4HG6A 3RC5A 4FOUC 1EFRD 1OYQA 1SVPA 1GBAA 1SLVB 3ZYDA 2F3CE 1C2MA 1Q3XA 3P8FA 1KXEA 2R9PA 2YNBA 2JIZD 1INCA 1E1RD 1OXGA 1AKSA 1WXRA 1GMDF 3O8BA 1EB1H 1P05A 1P3EA 3FP8E 1O2UA 1OP8A 2O8MA 2B9LA 1S6LA 1F5LA 5AF9H 2TGTA 2M2AA 1LPZB 4H6SB 1QZ8A 1O5AB 3SGQE 4CR9A 5EXMA 4X1RU 3OY6U 5DK1A 3RXPA 4ABIA 1C5SA 1HAXB 2PV9B 2WV4A 2ZGXH 3M7UA 5GPIB 5C2ZA 1YYY1 3RXEA 1SSXA 1YPEH 5A0BA 4JZDH 7KMEH 1Q31A 1AVXA 3ITIA 1MTUA 1RFNA 1QA7A 3PWBA 1WQVH 1V2LT 3F9GA 1WOFA 4TPYA 2BD4A 5HGGA 3HGPA 2PR3A 3UR6A 1EZQA 4UDWH 4YT6H 4ACBA 1SLUB 1THPB 4D76A 3O8RA 4E7RG 3T5FH 2XWBI 5C94A 1C1VH 2J5UA 1HAVA 2BX4A 1GCTB 3AVZA 2FOHA 4KTCA 3ZZ8A 1Z8JB 2A4GA 2J4IA 1G2MA 1Y3WA 1VCQA 1XXDA 3OY5U 3SO3A 1O2QA 1WU1A 1O3EA 3QTVH 1SFIA 5JBAS 3PMJA 4X6MA 2TPIZ 4Y11E 3PLBA 1SG8B 1BHXF 1Z7KA 1W2KH 1TFXA 3NZIA 3KQ5A 3UWJH 6CHAB 4HTCH 2FESH 2QAAA 5L2YH 1SQOA 1C5PA 1ZSLA 3ESTA 3F2FA 1AFEH 2VIVA 1BOQA 1FQ3A 1DUAA 1MCVA 1O2GH 3QO6A 1SFQB 5FPTA 2ZEBA 1NO9H 3SU3A 1CE5A 1Z8GA 1N8OC 4RKOB 1ZOMA 5AFZH 1GBFA 1UTJA 2CF9H 4OS7A 1UK3A 5GJ4B 1DWBH 3FFGA 4OS6A 2Y5HA 3SJ9A 1NRNH 1C5VA 5FBEA 2R3YA 5FCKA 2H5DA 1PQ5A 5EOKA 5LGOA 1E36B 3URDA 1P2KA 2CHAC 5F03A 4BXWA 4MNWA 1OWEA 2BDBA 3LONA 4WWYA 4DJZB 1GI8B 1COWD 3M7TA 2QA9E 5EG4A 5T6FA 8GCHG 1Y3UA 5FCRA 3UR9A 3VB4A 4F4OC 1QB6A 1GBTA 2AYWA 5ETXA 2AIPA 4ISLA 2D26C 1FDPA 2GDEH 4FU8A 3TH4H 5FPYA 2A1DB 3OU0A 2VH6A 3QWCH 1GMCG 1KXAA 3A82A 4MPVA 3BEUA 1EX3A 2D2DA 2A5KA 1NZQH 4TSFD 3UTUH 5BRRE 3VGCC 1BJUA 1SHHB 3EDXB 1Q2WA 1GMHG 3IITA 1A5HA 2AMPA 2BVSH 1AO5A 2FX4A 3ZYEA 8LPRA 1CT0E 1LDTT 1GG6B 5KEDA 1DWDH 1SGPE 4XSKU 1TLDA 2GGVB 3RU4T 5TCAA 1Y8TA 1FXYA 4JYVH 1SQAA 4BNRA 1ANDA 1AWFH 1Y5AT 2C90B 2RFKC 1H1BA 2FYRA 3AASA 4BTTB 2G55A 4ACAA 2D8WA 2YMSC 1SB1H 4H4FA 2A7HA 1UVPA 3QDZB 1ELVA 4Y76A 1YY3A 2P3UB 4XRNA 1ANEA 1AQ7A 1EAIA 5A09A 3BG8A 2PUXB 1J8AA 3UQVA 1N8OB 3SYJA 2AGIX 2J34A 1O38A 2XWAA 3GCOA 4Y8ZA 1HXFH 1JBUH 4AFUA 1QRZA 2EI7A 1C5NH 1TMUH 1RTKA 3NKKA 1YPHE 3KQDA 1TNGA 3E91A 3E90B 5FPSA 2KAIA 4IMZA 1ZMJA 3NK8A 1SBWA 2CK3D 4NZLA 2ANWA 1A61H 3M5OA 1EJAA 1LVMA 1TPOA 2ZFPH 1G3CA 3SNDA 3RM0H 3RMLH 3P8NA 1S5SA 4F55A 1ELCA 1GL1A 4YZUA 4JZ1A 3PO1B 4B2CA 4FVDA 3RXKA 3W1EA 4KKDA 3UWIA 1P0SH 1SGNE 1EAUA 2F83A 2ZDAH 5CHBA 4NSVA 2FOBA 1NRPH 3BN9A 4X2VA 3VGCB 4BAKB 2OTVA 1G36A 4UD9H 1TOMH 4JK6A 2KM0A 2QCYA 1UTLM 5ESTE 1YPJH 2IPQX 1GBHA 2VGCB 1F5RA 3L33A 3MWIU 4QT8C 4LK4A 2Z94A 3SU6A 2FOCA 3SU5A 1BUIA 4D7FA 1P09A 1A3BH 2ANKH 4ZH8A 4B71A 1O5CB 3TLOA 4FUBA 6ESTA 1D3QB 1WBGB 1GPZA 4K3JA 1ZHPA 3A8BA 1C1PA 3NUMA 3O8CA 3KQEA 2SGDE 1HAOH 2ANYA 1KLJH 1WTHD 4O97A 2PGQB 4MPXA 1H4WA 3SI3H 3MH7A 4YOIA 1FONA 1BBRH 3S0NA 1WCZA 2R0LA 1V2MT 1L1NA 2ZU1A 4Y8XA 5DP4A 2SGPE 2GD4B 3SOSA 3P8GA 3SNBA 5LPEA 1IQKA 1C1NA 1NBME 4Q2KA 1MTSA 1BMLA 3V3MA 5GCHF 2XBYA 2BDYA 3GY4A 1K1MA 2QN5T 2ZU3A 1G3BA 1FX0B 1KXDA 3F9EA 3R0FA 1C5RA 1ACBE 3E8LA 1QBOA 3ZZ7A 1O3LA 1P03A 2VJ1A 3FZZA 4B1TA 2PUQH 1GI6A 1MTNB 3VB7A 1FPHH 4LZ1H 2J2UA 2PWXA 4ABBA 1NU7B 3I78A 2OLGA 1BA8B 1P2JA 4JYTA 1O5FH 2ZU2A 3ZZ3A 1C2IA 4Q63A 1O5EH 2ZGCA 4FUDA 2PFEA 4D8NA 1IQHA 1HCGA 2FYQA 4X8TH 1VJAU 1NS3A 5L30H 1O0DH 1AUTC 1GI7B 2W5EA 2THFB 2ZDLA 4B6FA 1GJDB 1O3IA 1GJBB 1A5GH 1QJ1B 1SQTA 2OD3B 6GCHF 4GLYA 2ZPQA 5JB8S 3EE7A 1THRH 1KXBA 1C1WH 2OC0A 4Y10E 3S9CA 2BY5X 3M5LA 4MG3A 2FPZA 2A32A 2W3IA 3F68H 4PROA 2EEKA 1YPMH 1NROH 2XRCA 3KYGA 1D3TB 2AHME 1F0TA 1V6DA 1O2LA 1GBBA 2STAE 1QJ7B 1J9CH 1H8DH 3S69A 5DN6D 4NIVA 3W95A 1QTFA 1NC6A 1SHYA 3A8DA 4E05H 1JIMA 1NTPA 1AFQC 3SGAE 2XNIA 2BVRH 1TIOA 2ALVA 1TBZH 3ZVDA 1UCYK 1KIGH 3P6ZB 2PKSC 2WUCA 2WV9A 3VXFH 1CBWC 1CSOE 3E1XB 1EP6A 1C2GA 2GTBA 5ABWA 2FS8A 4KTUA 1GJ7B 3H5CB 1N1LA 1O2XA 2BQ7B 3UOPA 1O30A 3RXDA 1GHBF 5GWZA 1C1SA 1P01A 1ANCA 3M37A 3V7TA 2ZF0H 3DSOA 1FNIA 3RXAA 1AI8H 1LVOA 1MKXH 1EOLA 2F43B 4X1QU 1C5YB 2HLDD 2H9TH 2V3OH 5HM2A 1G37A 3DHKH 5J4QA 2SGQE 4NIYA 6GCHG 1TNJA 4AORA 5GNDA 3F2GA 1ANBA 4BXSA 4ABEA 1T8LA 3QLPH 2G51A 5DJ7A 3SUEA 4CH2B 2C8YB 4YOGA 1HXEH 3UNRA 3F0PA 4BTUB 1HAVB 3EYDA 3KIDU 1YLNA 3UOUA 1GBEA 1YBWA 2O9QA 5IDKA 5A0CA 2DUCA 3NWUA 1L4DA 4OGXA 2VWMA 1P2MA 2H2ZA 2P8OB 1DLEA 1O32A 1VKYA 1NU9A 1P2OA 1V2VT 2C8XB 1YLDA 2CF8H 1C5ZB 2WSSD 2ZWLH 1AY6H 5DP8A 4K5ZA 3RMOH 1XKBC 3FN8A 3K2UA 2AERH 2A7JA 1L2EA 4GCHG 2ZFSA 1GGDC 1ZMLA 2Y5GA 5JBTA 1S84A 1F0RA 3CP7A 4A6LA 1GI4A 3F9FA 4U2WA 1YPHC 2PTCE 3GCHB 2OC1A 1RTFB 1K2I1 1D6WA 4K60A 1BMFD 1HUTH 1EATA 3EGKH 2PKSB 2P94A 2A5IA 4CRBA 1GHBG 3MTYA 1C2DA 1CVWH 1SC8U 3M35A 4KP0A 1ESTA 1K1NA 1TX6A 2ZHDA 3LJOA 2Z9JA 5HYOA 2F91A 1N6XA 2RA0A 1GDUA 4I8KA 3UNSA 2KR7A 1UCYE 5A8XA 5EQQA 2BVXH 3PM3A 1ZHRA 3ATKA 1ETTH 2FOEA 3PRBA 1MKWH 1O2PA 1FIWA 4BTIB 3VXEH 3SI4H 1WQSA 5J4SA 4ABJA 1XKAC 3SJKA 1W7XH 2A45B 1V2RT 1MU8B 2VH0A 3MH5A 2JETB 5EW2H 1GBMA 1TYNA 3SV7A 5C1YA 4CRDA 1TA6A 2QF5A 1HAIH 5E8EH 2VVVA 5F53A 4M7GA 4DIHH 2PP6A 3BTKE 1HJ8A 3P95A 4D9RA 4H42U 1TA2A 1LQDB 4MQAA 4CBNA 3LJJA 1GVKB 2K1QA 2H9HA 2Q6FA 1SR5C 5DP5A 1HDTH 3GY7A 4BOHA 3FZDA 1XUKA 2VBCA 2A7CA 2ZFQH 3MH6A 1A0JA 1Z6EA 1ZRBA 2B5TB 3M3VA 5L2ZH 3SHAH 1HAGE 1C1RA 1WTGH 2GMTC 3NCLA 3Q3XA 2PTNA 3U28C 2G8TA 1O2RA 4ASHA 5LH8A 1GGDB 3A87A 3SUFA 1GCTC 2WPMS 3LGWA 1P57B 7GCHF 1NRRH 3ENSB 1LPKB 3P17H 1HAYB 1DXPA 1K1PA 2C4FH 2F9UA 4ABHA 2ODYB 4X8VH 2ZG0H 1AZZA 1GCDA 2ZCHP 4ZKRU 4E7NA 3E6PH 4CRAA 1EQ9A 1UTMA 4B73A 4B2AA 3AAVA 1V2WT 3EE0B 2PKAB 1E0FD 6CHAC 4LZ4B 3WW7A 2FLBH 3LPRA 1UTNA 4X6NA 5GIBA 2QF3A 1GWAA 4ZAEA 2KZ4A 1JOUB 1C5TA 2KAIB 1FAKH 1JRTA 1ABJH 1C5OH 3SUGA 1P9UA 2FZZA 2ZHEH 1W13U 1ZZZA 3I77A 3JZ2B 4CH8B 1VITG 2Y82A 1BMNH 3L6PA 4NFFA 5DGJA 3SW2B 3A81A 3UB0A 3QGNB 2D1JA 3OX7U 3OTJE 1BHXB 3AW0A 3ATWA 1UTOA 1LKAA 2CMYA 4AFZA 1E1QD 2ZFFH 1FY1A 1UO6A 3LGTA 3MO3A 2CV3A 2HWLB 1HPGA 2Q6DA 3TNTA 2XTTB 3N7EA 1O5DH 5T6DA 2G4UA 3TITA 1C1MA 3K9XB 5AVDA 5I25A 1GHAF 2XBXA 1ZPZA 2BQ6B 2HRVA 3KHVA 5FX6A 5I46H 1A46H 1W7GH 2GMTB 1BRCE 2FI5E 1SGYE 1KXCA 3MU5A 1YLCA 2UWPA 1NESE 2ZGBH 1CHOG 1TB6H 1UHBA 3S9BA 5F8TA 2OC7A 5EW1H 2BDAA 1GG6C 1O3PB 5DP6A 1C9PA 1O3KA 1TBRH 4TY6A 5FAHA 3D49H 3UNQA 3GS9A 4NA8A 1BRAA 1FIZA 1GI1A 3BTTE 2XC0A 3MMGA 3BTEE 4INKA 2ZIQH 1CU1A 3GY5A 1GMDG 1TGBA 3KN2A 1DY8A 1TE0A 2W7UA 4MTBA 5GXPA 4ZHAA 1S83A 3ZVAA 1BT7A 1GJ9B 1DWEH 1DPOA 1Y59T 2O8WA 4FXGH 3Q00A 2O8TA 1L1JA 3FP6E 3RXFA 2FDAA 5SGAE 1K9OE 1H9IE 2J9NA 2ZECA 4DT4A 3AK5A 2QF4A 3MOCA 3GYLB 3GDVA 3ZZDA 5EXNA 1LHDH 2FOMB 1CT4E 3SNCA 3SV2H 1SL3A 1GJCB 2J95A 5EIYA 4SGAE 2KX4A 4F48B 3VEQB 2P95A 2XYAA 1PPEE 1DY9A 4AFSA 4YT7H 2C93B 3TJOA 2F4LA 1KDQB 1MBMA 1YCPM 4CBOA 1CHGA 1HV7A 1NFYA 2Y81A 3T28A 3LDXH 3GOVB 1UK2A 2OQUA 4P00A 4B76A 1AD8H 2BD8A 5EGMA 1T8NA 1TNKA 1ZSKA 1MTWA 4BAMB 3ELAH 2WPHS 2P3TB 1WDIA 3LC5A 2HVYB 1RGQA 1SLXB 3PO1C 1O2NA 3PMBB 4IC6A 2AIQA 1LKBA 2I6SA 2PSXA 1TGTA 1MQ5A 3FOAA 2EC9H 4MLFB 5B6OA 2ANMH 1YWUA 1O2KA 3P92A 4Y71A 3H09A 2EQNA 1C4V2 4U01A 1JIRA 1FZZA 1GBKA 3LT3A 1OS8A 4GHTA 4MDSA 1WSSH 1TPSA 2BD3A 5C3NA 1GJ4H 2UWLA 4Y0YE 2EI8A 2WPKS 4FUIA 3UQOA 1E79D 4A7IB 3LH1A 2VGCC 2J38A 3HATH 1P12E 3ZZAA 1PQ7A 2UUYA 1AUJA 2GX4A 1V3XA 3PRDA 3WWFA 1XMNB 5T1VA 3C1KA 1H8IH 1RRKA 3PV5A 3VG8A 1XM1A 1SI5H 2ZKSA 5B6LA 4ABAA 2ZHFH 3BSQA 3A7TA 4NWLA 2C3SA 2BZAA 1N6YA 2XOKD 3MH4A 1YPKH 3ZV8A 2FOAA 1JWTA 1TQ7B 1QFKH 4HFPB 4I8HA 3HK3B 4DW2U 1HJ9A 1THSH 2B0FA 2BB4A 4IC5A 2AGEX 2GDDA 1FUJA 1S6HA 1WUNH 5HIZA 1ABIH 3SU4A 1BTYA 5E2OA 3KL6A 4HGCA 3V12A 2CN0H 2PKAA 1IQJA 3W94A 3B9FH 1MTNC 1YM0A 4F49A 4UFEH 2Y7ZA 1ESBA 1AVWA 1SGQE 3RXBA 4BANB 2BMGB 3QGJA 3DT0H 3A7YA 2R0KA 3E3TA 3PROA 2O8UA 4X2WA 1C5MD 4NA7A 1H9HE 3TJUA 2VINA 2BD5A 1TONA 4HZHA 1UJ1A 4I32A 1BB0B 2Z6BD 3F0OA 2LELA 1DXWA 4GHQA 2Y6TA 3MNSA 2OINA 4DG4A 4J2YB 1BTZA 1TX8A 3KF2A 4X8SH 5CHAC 4AOQA 1WYKA 2GT8A 4DVAU 3EA7A 1P10A 3TJVA 1EJNA 2JH5D 3IG6B 4H6TA 1K1LA 2F9PA 2XC4A 1B5GH 3SU1A 1KSNA 3ZZCA 4Y8YA 4O9VA 4A1XA 1O31A 1O2YA 4AB8A 1V2NT 1SGCA 1PPFE 4Q80A 2BY9X 5F6MA 3KQCA 2XC5A 1E37B 1NN6A 1EXFA 1S85A 5GDSH 2H5CA 4YO9A 5DPAA 1G3DA 3MI4A 3SORA 1MH0A 2OP9A 1GI3A 1QRXA 4RT0A 2V7QD 4A1TA 2WZQA 1TNIA 1SLWB 2JKHA 2GV7A 2ZU5A 1DX5M 3LGYA 4ZKSU 1EZSC 1C2LA 4FU7A 2DE8A 3A8CA 2NWNA 2RCEA 1DITH 3A86A 1QBVH 3DSGA 2FWWA 1OWHA 2GZ7A 4TPIZ 2BDGA 1H8HD 1OSSA 3U1JB 1P04A 7ESTE 1W11U 1QL8A 4YXWD 3BTDE 1QHRB 3TGJE 1FY5A 3U1IB 3QUMP 1K1JA 1P02A 4X0WU 2V35A 1K22H 3TGKE 1HAPH 3LGIA 1O2JA 1TRMA 2ZCKP 4ZROA 3RXLA 3BTGE 3QK1A 2UUJB 4X6OA 3ATLA 1QL7A 3UFAA 1ZPCA 1G30B 1O2WA 5HIYA 3QZRA 2NU3E 1NFXA 1V2QT 1LTOA 3U98H 1W0KD 5CHAB 4Q7XA 2ZDNA 2WYGA 1MTVA 2A5AA 1YPGH 5TJXA 1KDQA 1DSUA 1T32A 3ZV9A 1FMGA 3ZVGA 3TGIE 1DANH 2ZDKA 1J17T 1IQLA 3BTME 2L74A 1H9LB 3KGPA 3CS7A 2ALPA 1LHGH 1TQ0B 3STJA 2P8OC 2A4OA 2Z7FE 2FOFA 4Y79A 8KME2 2QGRA 1BBRK 4Y6DA 3SNAA 3ZZBA 3K6ZA 2BX3A 3EA8A 4AYYB 1AIXH 3TH3H 1W8BH 2ZFRH 3TK6A 1CGHA 2ILNA 1TAWA 2Y80A 1PQ8A 1UVSH 2BZ6H 3BIUH 4ESTE 4XBBA 2XCFA 2BQWB 1C4Y2 1SMFE 1F92A 3GCHC 4Y7AA 5GCHG 1JRSA 1IQMA 2ZC9H 3BTWE 3RXOA 5IYTA 3NXPA 4WMFA 1DSTA 1CA8B 1LHFH 1TMBH 1DICA 1P9SA 1IOEA 1JXPA 1MZDA 3P8OA 1A7SA 4FUJA 1LHCH 1O3NA 1OP0A 1S82A 1IQEA 5AHGH 3DUXH 2F9VA 1ARCA 1KTTB 3A7ZA 1S81A 5G4BA 1K21H 3UY9A 5HMAA 1DVAH 1HJAC 3KCGH 1NM6A 3N99A 4IN2A 4XOJA 3SU2A 3PV2A 5EJLA 4NGAH 4OS4A 2OBOA 1ETRH 3MYWA 1UVUH 1V2OT 1VZQH 2G5VA 1ZMNA 2KCAA 1MQ6A 3RMMH 2FP7B 2JH0D 2ZDVH 2FTMA 2V0BA 3SNEA 2UUKB 1QQ4A 4UEHH 3ZZ6A 2CXVA 5EPNA 3A80A 4I33A 3TIUA 1GJAB 2PHBA 2ZO3H 4NG9H 3WY8A 4AZ2B 4ZKNU 1O3MA 2JETC 3SQEE 3MU1A 1O34A 1UVOA 5T3HA 4YLUA 2BLQA 2JJ1D 1UHBB 4THNH 3TJNA 1PFXC 3NPSA 1UTKA 3RXUA 3CS0A 2KCPA 4Q7ZA 2FODA 1T4UH 4FUCA 1C4U2 2PW8H 2FLRH 1Z1IA 2O8LA 3RP2A 1KLIH 1HNEE 4K1TA 1X7AC 2NU2E 1VR1H 1D3PB 1HIAB 4GVUA 1BTXA 1RIWB 1V2JT 3BTHE 3NRLA 3U9AH 1OWJA 5TCCA 3A8AA 3SQHE 1AZ8A 4DURA 1XUJA 4YLQH 3KQBA 3SV6A 2R3UA 1C5WB 1ZHMA 2BD7A 1E38B 4OS2A 1BBRE 3AW1A 4GPGA 2AMDA 2L6OA 1GBJA 2BDHA 1IAUA 4ZKOU 1GBCA 1A0HB 2TGDA 3TH2H 2VB0A 2ZTZA 4NIXA 4NCYA 5JPMH 3RC6A 3OEED 4A92A 3GDSA 3M5MA 1DLKB 3U8OH 1HBTH 5EU8A 4NSYA 4IS5A 3B8JA 1QY6A 1O5BB 4ZMAH 3ATIA 3LIWA 1GL0E 3V13A 1SQRA 1HJAB 2HPPH 4XDEA 1ELDE 1SOZA 4O03A 4ZXXH 1LCYA 2TBSA 3LOXA 4WF8A 4K2YA 1PJPA 1O37A 1EPTC 4AB9A 1YCPH 4NZQA 1K1OA 5DSFA 1AE8H 5E0GA 5C5NA 4YOJA 4INHA 2DE9A 1CO7E 1GBLA 1TX7A 1UVTH 3M3SA 3SGBE 2NU1E 2F9OA 2I6QA 2VIDA 1GJ5H 9ESTA 5C1UA 2VIWA 5JB9S 5FHTA 1MU6B 1BMAA 5FX5A 3RLWH 2CJIA 1O39A 1Y3YA 5ESBA 4Z6AH 2AS9A 2ZHQH 4DOQA 4K1EA 1CGIE 3F2HA 4AC9A 1ZGIA 1GDNA 5E0JA 1IHSH 6LPRA 1C5UA 2ZGHA 1PYTD 5JYIA 4Z0KA 4NFEA 2GV6A 4OS1A 3FO8D 3CENA 4KELA 2YOLA 2XXLA 3PLKA 4UE7H 1EASA 1Z1JA 1O2ZA 2UUFB 4OGYA 4ABDA 2ULLA 4AG2A 1O5GH 1VCPA 2KCYA 5FBIA 2VIQA 1AGJA 1VITH 3SHCH 4I86A 4UONA 3GY8A 1J16A 1VGCC 4P02A 1CT2E 4IBLH 1Y3XA 3OYPA 2V6NA 2V3HH 3MNCA 1Y5BT 3UREA 3RMNH 1O33A 3GICB 4O3UA 3PYHA 3ATMA 4D9QA 1MKWK 3F9HA 1W10U 3OTPA 3MU0A 2K0QA 3OSYA 1UTPA 1DFPA 3HPTB 4MNXA 2BYAX 2R2WU 1KLTA 4VGCC 4ABGA 4E06H 1WV7H 2B8OH 1NPMA 2ZDMA 3GCTF 2XBWA 3C27B 2J97A 4FETA 2GP9B 2ZHWH 1EPTB 1NT1A 4OM9A 3T2NA 5F8ZA 2B7DH 3SJIA 3Q3YA 1VJ9U 2WHXA 5A8YA 3ZVEA 1GI9B 3RXJA 1C2FA 1C1TA 4M9FA 5EPYA 3GISB 1PPZA 2RG3A 4YM9A 2G00A 2BY6X 4I8GA 2W6JD 1OPHB 3P70B 1U6QA 5AFYH 2A0QB 1AB9C 2Y5FA 2HOBA 5JBBS 3RDZA 1IQFA 4MVNA 3LGUA 3TK5A 1F2SE 3STIA 2G52A 5PTPA 1GI0A 2GT7A 2F9NA 1S0QA 1SGIB 2BD9A 4NWKA 2KFWA 1PPBH 2ZFTA 3GY6A 1LMWB 4GSOA 3E16B 1BDAA 2A2XH 5CE1A 1C2JA 1ZLRA 5C67A 2BY8X 5KGOA 1DDJA 1C1QA 1O3AA 2ZZUH 1QB9A 4WVPE 1D6RA 3AAUA 2W26A 1K1IA 3GY2A 1O3HA 7GCHG 4GAWA 4I31A 3VFEA 1CGJE 1O36A 2IJOB 1OHHD 2P93A 3QN7A 4XBDA 2ODQA 2QIQA 1EOJA 5IK2D 4HI3A 1ELEE 1VGCB 3D65E 4RKJB 4I7YH 4BAHB 4B75A 3ZIAD 2ASUB 3GCTG 1A2CH 4R8TB 2AEIH 2VIPA 1DUEA 1HIAA 1H8ED 2P16A 8GCHF 1C5QA 1S0RA 3BEIB 2QY0B 4VGCB 4B2BA 3MFJA 4DGJA 1W3CA 1O2OA 3MO9A 4K1SA 2A31A 1QBNA 4FUHA 4GUXA 1DS2E 1GMCF 2H9EH 1P11E 1UMAH 3RU4E 1BTUA 1FY4A 3SV9A 3RU4D 1ELAA 5EQRA 5DP7A 2W7SA 1GDQA 1GMHF 1FLEE 4YTAA 3DFJA 1O2VA 3O8DA 1OWIA 1O3GA 1F0SA 5FL7D 1SGEE 3M3TA 3TPIZ 3PMHB 1L4ZA 1EB2A 4JCNA 1AB9B 1SGFG 4U32A 2NU4E 1GHAG 2VWNA 1F0UA 2P3FH 2ZQ1A 3A7XA 2GZ8A 5EQSA 4DIIH 4UFFH 4AX9H 1XXFA 2HPQH 2F9BH 2GCTC 2FS9A 4TY7A 1YP9A 4A1VA 4X2XA 2QXIA 1UTQA 1GBDA 1IQGA 5A2MH 2WV5A 3RXSA 3SU0A 2IPHA 4CR5A 2SNVA 1HAZB 1XUGA 3MU4A 1FV9A 2TIOA 1EUFA 2GCHF 1B0EA 1GHZA 1AWHB 2K8IA 1QNJA 2UWOA 4CRGA 1NFUA 2SFAA 2ZTXA 4UFGH 1TBQH 4WXIA 2XCNA 1JMOH 4DCDA 1T8OA 3BG4C 1YPLH 1GVLA 3QZQA 1L0ZA 3UUZA 4RT1A 1CQQA 2YNAA 3FVFB 3S9AA 4WMDA 1HLTH 2A4QA 2HNTF 2FMJA 4Q4LA 1MCTA 1SOTA 1V2TT 1ETSH 2OBQA 3DSPA 1BZXE 4ISHH 3SJ8A 1PPCE 4AGJA 3E0PB 1BITA 3KEEA 3RXHA 1A5IA 3FKSD 2HALA 1AMHA 2V3MA 3BTFE 1RS0A 1ZJKA 1NY22 2QE7D 2EA3A 5H4IB 2LPRA 2IN2A 3PMAB 4MPUA 1EAXA 1QURH 1BRUP 2FTLE 3A7VA 1LVYA 1O2HA 5HM9A 2PLXA 1GJ8B 5CDFE 1SGFA 1PYTC 5T6GA 1VCWA 2J92A 1SGTA 3T29A 1V2ST 3HGNA 3HKJB 4J1YA 4MPWA 1TRNA 1OYTH 2H1UA 1B7XB 4TWWA 1MUEB 1XVOA 1LO6A 4Y7BA 3RM2H 2BXTH 4CRCA 2ZP0H 4Z1MD 1NRQH 3LH3A 3KNXA 1TGSZ 1GI2A 2GVFA 1OOKB 3A88A 3SZNA 2FX6A 3PTNA 4ZXYH 1BRBE 2A4RA 2EY4C 1G3EA 1P3CA 3VB3A 1ZYOA 1ZGVA 1V2UT 2BTCE 3PB1E 1GHWH 1ZSJA 3UPEA 1EPTA 1TPAE 1W0ZU 2GCHG 1FN6A 2GCTB 4WXVA 3PLPA 1ZR0A 3ODDA 5BPEA 1GHXH 1QJ6B 4TT3D 3UAIC 4MNVA 4ASUD 4B74A 4BAQB 1Z8IB 1SGRE 3ZZ4A 1Y5UT 1HAHH 3GY3A 1B0FA 3T26A 1G2LA 3QX5H 1TWXB 2FI4E 1RXPA 5EODA 1C5XB 2CHAB 1QIXB 2JH6D 2VU8E 1TALA 1G32B 1O2MA 1UW7A 2VIOA 3B23B 4MNYA 4R0IA 4ABFA 4CHAC 3DCLA 2BD2A 1ID5H 1MAXA 1DE7H 2IOTA 3BG4B 4WH6A 2ZA5A 1TNHA 3N7OA 2CGAA 1MZAA 2HGTH 3ODFA 3M36A 1QR3E 4FUEA 9LPRA 1IQNA 2VNTA 2FI3E 1D4PB 2G5NA 5C20A 2SGAA 2VVCA 2Z3DA 4JK5A 1V2KT 3EQ0H 5CMXH 2QYIA 2BDIA 1HRTH 1BTHH 3BV9B 2XW9A 3BEFB 1TABE 5C0UA 1O3JA 5C1XA 2XNDD 1TMTH 3RXIA 4K8BA 5L6NH 2OC8A 5DP3A 4DT7B 5JBCS 5FXLA 4IN1A 2J98B 3RXMA 1UK4A 3VB6A 2FXRA 3LKWA 3F3BA 1P2IA 2Z3EA 2LP6A 4JZFH 1KMHB 1AU8A 3M61U 4JZEH 3U69H 1C1UH 2EI6A 1DT2A 3S7KB 2ZPRA 1F7ZA 2GJGA 1TGNA 2YMSB 1LVBA 5DG6A 5LPRA 4NA9H 2SNWA 4AN7A 1T7CA 4LXBH 1YF4A 2BLOA 2LNCA 2QV1A 4AFQA 2WPDD 1KXFA 3T27A 2ZCLP 1NBMD 3SJOA 1MABB 3MQKC 4XBCA 1GVZA 4JMYA 4X1SU 1XUHA 2QXGA 3WWBA 5K7RA 1BJVA 3I29A 1KYNA 1FPCH 4IGDA 4ZHLU 1NFWA 3U8TH 1EJMA 3V0XA 1OWDA 1UCYH 1RJXB 3KYFA 2BY7X 3F6UH 4BAOB 1XUFA 3TU7H 4X1NU 1ZRKA 1ZJDA 1EP5A 1PQAA 4CHAB 2ZGJA 2RDEA 3TNSA 4ISNA 3RXRA 1T8MA 3FP7E 2TGPZ 3SV8A 2BOHB 3GDUA 2RDLA 1GI5A 1D3DB 1O2SA 3MU8A 2ZTYA 1SKYE 1KTSB 2HNTE 1AE5A 3PV4A 4YESB 5C17A 2Q6GA 3EA9A 4RI0A 1HB0B 1K0HA 3D23A 1ELBA 3GYMA 4FU9A 4ZHMU 1O3OA 3T25A 2GKVE 1CA0C 2BDCA 2BLWA 1RIWC 3OAAD 2M5TA 3M5NA 4IW4E 4WH8A 2ZQ2A 4DY7B 4I8JA 3BF6H 1ARBA 1P8VC 2Z9LA 1TPPA 3LU9B 1TRYA 4ISOA 1M9UA 2QXJA 2ZNKH 1T31A 1DOJA 4D7GA 1TNLA 1J15A 4KTSA 1O2TA 1V2PT 2JJ2D 3F1SB 1C9TA 2AFQB 5HXFA 1GHYH 3A83A 2NU0E 1IHTH 3OFND 2Y7XA 4IMQA 1ZTKA 4ISIH 5DKMA 2ZPSA 1EKBB 1QRWA 4A5TS 1BMMH 3G01A 1XX9A 4XFQA 1AKSB 3OEHD 4WJG2 1C1OA 3Q77A 1MBQA 1P2QA 4O3TA 1YC0A 2SGEE 1BCUH 1MD8A 2OUAA 1O2IA 5A8ZA 2BXUH 4TWYA 1O35A 4GCHF 5E0HA 4LOYH 2R2MB 3ZZ5A 2Z9GA 4ZCNA 1A4WH 5C5OA 2Z3CA 1A1RA 4X8UH 1SPJA 2G4TA 1ZPBA 1EAWA 5EXLA 4B6EA 3LC3A 1DWCH 1P2NA 3RXGA 2A2QH 1RD3B 1EZUC 1QA0A 2VVUA 3RUOA 2WINI 3IWMA 2HVXA 2PGBB 4JZIA 1F5KU 5A0AE 5F8XA 5C0TA 2SGFE 1YGCH 4X1PU 1T4VH 2HLCA 1ZTJA 1K28D 4JYUH 3RXTA 4FUGA 2ESTE 1QQUA 3JZ1B 1ELFA 1LQEA 1W12U 1IQIA 3H7TA 5E2PA 3ZVFA 1AHTH 2QXHA 3MHWU 4WMEA 2AH4X 1G9IE 3RLYH 4CREA 1OX1A 2OCVB 5HKKD 1CA0B 2PSYA 1GJ6A 1KY9A 3QTOH 1PPGE 1W14U 2Z9KA 1O3CA 3S7HB 1ZTLA 1QB1A 2OK5A 3VPKA 1FY3A 4INLA 2C8WB 3OE7D 1A0LA 2WPLS 3Q3KA 1SGDE 2BLVA 3Q76A 5DP9A 3TVJB 1Y3VA 3A7WA 1D9IA 1C5LH 1MAYA 2AMQA 3L3TA 3ZVBA 4AYVB 1WAYB 3BTQE 1MKXK 1W0YH 3DD2H 1W0JD 1ORFA 2Q1JA 4FVBA 4K69A 2VWOA 3HKIB 3RXVA 1C2HA 5EJZA 1YKTA 3SBKA 4WY3A 2ZI2H 2KCOA 2Z9IA 4CRFA 1AFQB 1FN8A 1NRSH 3H7OA 4RSPA 5JDUB 1MD7A 3T62A 3PTBA 2GZ9A 4U30A 3RC4A 3EAJA 1PPHE 2BOKA 2VWLA 4SGBE 3URCA 3SN8A 3DA9B 2OQ5A 1CBWB 3N7DA 4ZUHA 4RN6A 2J98A 2FM2A 3TK9A 1MMJN 1QGFA 3HK6B 5EJ1A 1O3DA 3D62A 3A89A 1AN1E 1BIOA 3MO6A 3GCNA 1C2KA 1FY8E 4OS5A 1BTPA 1Z6JH 1ELGA 1ELTA 5DO4H 2W6ID 1HFDA 1EZXC 1HYLA 1ESAA 2FO9A 3SUDA 3FAOA 1J14A 5KECA 3A85A 1FJSA 2WPJS 3ZVCA 1TGCA 3CNRA 1FI8A 5K0HA 5LPFA 4UFDH 1E35B 1L1GA 4AG1A 2BM2A 2TGAA 1AVGH 2OXSA 4X2YA 1O3BA 4KGAA 3BIVH 3R3GB 1P06A 2TRMA 3M7QA 3MNBA 1GBIA 4XD7D 4XE4A 1O3FA 1XVMA 4K8YA 3MNXA 1VITF 2AGGX 2YMSD 3A84A 3E0NB 4TYDA 1LPGB 2W3KA 4Q7YA 3VB5A 2IJD1 4I8LA 3RXQA 3FANA 2FIRH 1OWKA 3UIRA 2J94A 4NIWA 3SZEA 2ODPA 1YCPK 1FAXA 1OP2A 1BQYA 1RTLA 2G81E 1BTWA 1Z71A 1C2EA 2FOGA 1DM4B 1QL9A 2RA3A 2BHGA 2C8ZB 1GHVH 3K65B 3ZZ9A 2QF0A 1A3EH 2FEQH 1XUIA 1S6FA 1QCPA 8ESTE 2QC2A 4AGKA 1HGTH 2JDID 3DFLA 4Y0ZE 2ZU4A 2STBE 3RXCA 1OKXA 4X6PA 2WYJA 2HNTC 1LHEH 1Z8RA
chains in the Genus database with same CATH topology
7LPRA 2WUBA 1E34B 3K6YA 1CHOF 2H6MA 3LGVA 3U8RH 2WPIS 2XBVA 2P59A 1TOCB 4FUFA 3PWCA 3RC5A 1OYQA 1SVPA 1GBAA 1SLVB 3ZYDA 2F3CE 1C2MA 1Q3XA 3P8FA 1KXEA 2R9PA 2YNBA 1INCA 1OXGA 1AKSA 1GMDF 3O8BA 1EB1H 1P05A 1P3EA 3FP8E 1O2UA 1OP8A 2O8MA 2B9LA 1F5LA 5AF9H 2TGTA 1LPZB 4H6SB 3SGQE 1O5AB 4CR9A 5EXMA 4X1RU 3OY6U 5DK1A 3RXPA 4ABIA 1C5SA 1HAXB 2PV9B 2WV4A 2ZGXH 3M7UA 5GPIB 5C2ZA 1YYY1 3RXEA 1SSXA 1YPEH 5A0BA 4JZDH 7KMEH 1Q31A 1AVXA 3ITIA 1MTUA 1RFNA 1QA7A 3PWBA 1WQVH 1V2LT 3F9GA 1WOFA 4TPYA 2BD4A 5HGGA 3HGPA 2PR3A 3UR6A 1EZQA 4UDWH 4YT6H 1SLUB 1THPB 4D76A 3O8RA 4E7RG 3T5FH 2XWBI 1C1VH 1HAVA 2BX4A 1GCTB 3AVZA 2FOHA 4KTCA 3ZZ8A 1Z8JB 2A4GA 2J4IA 1G2MA 1Y3WA 1VCQA 1XXDA 3OY5U 3SO3A 1O2QA 1WU1A 1O3EA 3QTVH 1SFIA 5JBAS 3PMJA 4X6MA 2TPIZ 4Y11E 3PLBA 1SG8B 1BHXF 1Z7KA 1W2KH 1TFXA 3NZIA 3UWJH 6CHAB 4HTCH 2FESH 2QAAA 5L2YH 1SQOA 1C5PA 1ZSLA 3ESTA 1AFEH 2VIVA 1BOQA 1FQ3A 1DUAA 1MCVA 1O2GH 3QO6A 1SFQB 5FPTA 2ZEBA 1NO9H 3SU3A 1CE5A 1Z8GA 1N8OC 4RKOB 1ZOMA 5AFZH 1GBFA 1UTJA 2CF9H 4OS7A 1UK3A 5GJ4B 1DWBH 3FFGA 4OS6A 2Y5HA 3SJ9A 1NRNH 1C5VA 5FBEA 2R3YA 5FCKA 2H5DA 1PQ5A 5EOKA 5LGOA 1E36B 3URDA 1P2KA 2CHAC 5F03A 4BXWA 4MNWA 1OWEA 2BDBA 3LONA 4WWYA 4DJZB 1GI8B 3M7TA 2QA9E 5EG4A 5T6FA 8GCHG 1Y3UA 5FCRA 3UR9A 3VB4A 4F4OC 1QB6A 1GBTA 2AYWA 5ETXA 2AIPA 4ISLA 2D26C 1FDPA 2GDEH 4FU8A 3TH4H 5FPYA 2A1DB 3OU0A 2VH6A 3QWCH 1GMCG 1KXAA 3A82A 4MPVA 3BEUA 1EX3A 2D2DA 2A5KA 1NZQH 3UTUH 5BRRE 3VGCC 1BJUA 1SHHB 3EDXB 1Q2WA 1GMHG 3IITA 1A5HA 2AMPA 2BVSH 1AO5A 2FX4A 3ZYEA 8LPRA 1CT0E 1LDTT 1GG6B 1DWDH 1SGPE 4XSKU 1TLDA 2GGVB 3RU4T 5TCAA 1Y8TA 1FXYA 4JYVH 1SQAA 4BNRA 1ANDA 1AWFH 1Y5AT 2C90B 1H1BA 2FYRA 3AASA 4BTTB 2G55A 2D8WA 1SB1H 4H4FA 2A7HA 1UVPA 3QDZB 1ELVA 4Y76A 2P3UB 1ANEA 1AQ7A 1EAIA 5A09A 3BG8A 2PUXB 1J8AA 3UQVA 1N8OB 2AGIX 2J34A 1O38A 2XWAA 3GCOA 4Y8ZA 1HXFH 1JBUH 4AFUA 1QRZA 2EI7A 1C5NH 1TMUH 1RTKA 3NKKA 1YPHE 3KQDA 1TNGA 3E91A 3E90B 5FPSA 2KAIA 4IMZA 1ZMJA 3NK8A 1SBWA 4NZLA 2ANWA 1A61H 3M5OA 1EJAA 1LVMA 1TPOA 2ZFPH 1G3CA 3SNDA 3RM0H 3RMLH 3P8NA 1S5SA 1ELCA 1GL1A 4YZUA 4JZ1A 3PO1B 4B2CA 4FVDA 3RXKA 4KKDA 3UWIA 1P0SH 1SGNE 1EAUA 2F83A 2ZDAH 4NSVA 2FOBA 1NRPH 3BN9A 4X2VA 3VGCB 4BAKB 2OTVA 1G36A 4UD9H 1TOMH 4JK6A 2QCYA 1UTLM 5ESTE 1YPJH 1GBHA 2VGCB 1F5RA 3L33A 3MWIU 4QT8C 4LK4A 2Z94A 3SU6A 2FOCA 3SU5A 1BUIA 4D7FA 1P09A 1A3BH 2ANKH 4ZH8A 4B71A 1O5CB 3TLOA 4FUBA 6ESTA 1D3QB 1WBGB 1GPZA 4K3JA 1ZHPA 3A8BA 1C1PA 3NUMA 3O8CA 3KQEA 2SGDE 1HAOH 2ANYA 1KLJH 1WTHD 4O97A 2PGQB 4MPXA 1H4WA 3SI3H 3MH7A 4YOIA 1FONA 1BBRH 3S0NA 1WCZA 2R0LA 1V2MT 1L1NA 2ZU1A 4Y8XA 5DP4A 2SGPE 2GD4B 3SOSA 3P8GA 3SNBA 5LPEA 1IQKA 1C1NA 4Q2KA 1MTSA 1BMLA 3V3MA 5GCHF 2XBYA 2BDYA 3GY4A 1K1MA 2QN5T 2ZU3A 1G3BA 1KXDA 3F9EA 3R0FA 1C5RA 1ACBE 3E8LA 1QBOA 3ZZ7A 1O3LA 1P03A 2VJ1A 3FZZA 4B1TA 2PUQH 1GI6A 1MTNB 3VB7A 1FPHH 4LZ1H 2J2UA 2PWXA 4ABBA 1NU7B 3I78A 2OLGA 1BA8B 1P2JA 4JYTA 1O5FH 2ZU2A 3ZZ3A 1C2IA 1O5EH 2ZGCA 4FUDA 2PFEA 4D8NA 1IQHA 1HCGA 2FYQA 4X8TH 1VJAU 1NS3A 5L30H 1O0DH 1AUTC 1GI7B 2W5EA 2THFB 2ZDLA 1GJDB 1O3IA 1GJBB 1A5GH 1QJ1B 1SQTA 2OD3B 6GCHF 4GLYA 2ZPQA 5JB8S 1THRH 1KXBA 1C1WH 2OC0A 4Y10E 3S9CA 2BY5X 3M5LA 4MG3A 2FPZA 2A32A 2W3IA 3F68H 4PROA 2EEKA 1YPMH 1NROH 2XRCA 1D3TB 1F0TA 1V6DA 1O2LA 1GBBA 2STAE 1QJ7B 1J9CH 1H8DH 3S69A 4NIVA 3W95A 1QTFA 1NC6A 1SHYA 3A8DA 4E05H 1JIMA 1NTPA 1AFQC 3SGAE 2XNIA 2BVRH 1TIOA 2ALVA 1TBZH 3ZVDA 1UCYK 1KIGH 3P6ZB 2PKSC 2WUCA 3VXFH 1CBWC 1CSOE 3E1XB 1EP6A 1C2GA 2GTBA 5ABWA 2FS8A 4KTUA 1GJ7B 3H5CB 1N1LA 1O2XA 2BQ7B 3UOPA 1O30A 3RXDA 1GHBF 5GWZA 1C1SA 1P01A 1ANCA 3M37A 3V7TA 2ZF0H 1FNIA 3RXAA 1AI8H 1LVOA 1MKXH 1EOLA 4X1QU 1C5YB 2H9TH 2V3OH 5HM2A 1G37A 3DHKH 5J4QA 2SGQE 4NIYA 6GCHG 1TNJA 4AORA 1ANBA 4BXSA 4ABEA 1T8LA 3QLPH 2G51A 5DJ7A 3SUEA 4CH2B 2C8YB 4YOGA 1HXEH 3UNRA 4BTUB 1HAVB 3EYDA 3KIDU 3UOUA 1GBEA 1YBWA 2O9QA 5IDKA 5A0CA 2DUCA 3NWUA 1L4DA 4OGXA 2VWMA 1P2MA 2H2ZA 2P8OB 1DLEA 1O32A 1NU9A 1P2OA 1V2VT 2C8XB 1YLDA 2CF8H 1C5ZB 2ZWLH 1AY6H 5DP8A 4K5ZA 3RMOH 1XKBC 3K2UA 2AERH 2A7JA 1L2EA 4GCHG 2ZFSA 1GGDC 1ZMLA 2Y5GA 5JBTA 1S84A 1F0RA 3CP7A 4A6LA 1GI4A 3F9FA 4U2WA 1YPHC 2PTCE 3GCHB 2OC1A 1RTFB 1K2I1 1D6WA 4K60A 1HUTH 1EATA 3EGKH 2PKSB 2P94A 2A5IA 4CRBA 1GHBG 3MTYA 1C2DA 1CVWH 1SC8U 3M35A 4KP0A 1ESTA 1K1NA 1TX6A 2ZHDA 3LJOA 2Z9JA 5HYOA 2F91A 1N6XA 2RA0A 1GDUA 4I8KA 3UNSA 1UCYE 5A8XA 5EQQA 2BVXH 3PM3A 1ZHRA 3ATKA 1ETTH 2FOEA 1MKWH 1O2PA 1FIWA 4BTIB 3VXEH 3SI4H 1WQSA 5J4SA 4ABJA 1XKAC 3SJKA 1W7XH 2A45B 1V2RT 1MU8B 2VH0A 3MH5A 2JETB 5EW2H 1GBMA 1TYNA 3SV7A 5C1YA 4CRDA 1TA6A 5E8EH 1HAIH 2VVVA 4M7GA 4DIHH 3BTKE 1HJ8A 3P95A 4D9RA 4H42U 1TA2A 1LQDB 4MQAA 4CBNA 3LJJA 1GVKB 2K1QA 2H9HA 2Q6FA 1SR5C 5DP5A 1HDTH 3GY7A 4BOHA 3FZDA 1XUKA 2A7CA 2ZFQH 3MH6A 1A0JA 1Z6EA 1ZRBA 2B5TB 3M3VA 5L2ZH 3SHAH 1HAGE 1C1RA 1WTGH 2GMTC 3NCLA 3Q3XA 2PTNA 2G8TA 1O2RA 4ASHA 5LH8A 1GGDB 3A87A 3SUFA 1GCTC 2WPMS 3LGWA 1P57B 7GCHF 1NRRH 3ENSB 1LPKB 3P17H 1HAYB 1DXPA 1K1PA 2C4FH 2F9UA 4ABHA 2ODYB 4X8VH 2ZG0H 1AZZA 1GCDA 2ZCHP 4ZKRU 4E7NA 3E6PH 4CRAA 1EQ9A 1UTMA 4B73A 4B2AA 3AAVA 1V2WT 3EE0B 2PKAB 1E0FD 6CHAC 4LZ4B 2FLBH 3LPRA 1UTNA 4X6NA 5GIBA 2QF3A 1GWAA 4ZAEA 1JOUB 1C5TA 2KAIB 1FAKH 1JRTA 1ABJH 1C5OH 3SUGA 1P9UA 2FZZA 2ZHEH 1W13U 1ZZZA 3I77A 3JZ2B 4CH8B 1VITG 2Y82A 1BMNH 3L6PA 4NFFA 5DGJA 3SW2B 3A81A 3QGNB 2D1JA 3OX7U 3OTJE 1BHXB 3AW0A 3ATWA 1UTOA 1LKAA 2CMYA 4AFZA 2ZFFH 1FY1A 1UO6A 3LGTA 3MO3A 2CV3A 2HWLB 1HPGA 2Q6DA 3TNTA 2XTTB 1O5DH 5T6DA 2G4UA 3TITA 1C1MA 3K9XB 5AVDA 5I25A 1GHAF 2XBXA 1ZPZA 2BQ6B 2HRVA 3KHVA 5FX6A 5I46H 1A46H 1W7GH 2GMTB 1BRCE 2FI5E 1SGYE 1KXCA 3MU5A 1YLCA 2UWPA 1NESE 2ZGBH 1CHOG 1TB6H 1UHBA 3S9BA 5F8TA 2OC7A 5EW1H 2BDAA 1GG6C 1O3PB 5DP6A 1C9PA 1O3KA 1TBRH 4TY6A 5FAHA 3D49H 3UNQA 4NA8A 1BRAA 1FIZA 1GI1A 3BTTE 2XC0A 3MMGA 3BTEE 4INKA 2ZIQH 1CU1A 3GY5A 1GMDG 1TGBA 3KN2A 1DY8A 1TE0A 2W7UA 4MTBA 5GXPA 4ZHAA 1S83A 3ZVAA 1BT7A 1GJ9B 1DWEH 1DPOA 1Y59T 2O8WA 4FXGH 3Q00A 2O8TA 1L1JA 3FP6E 3RXFA 2FDAA 5SGAE 1K9OE 1H9IE 2J9NA 2ZECA 3MOCA 3GYLB 3GDVA 3ZZDA 5EXNA 1LHDH 2FOMB 1CT4E 3SNCA 3SV2H 1SL3A 1GJCB 2J95A 4SGAE 3VEQB 2P95A 2XYAA 1PPEE 1DY9A 4AFSA 4YT7H 2C93B 3TJOA 1KDQB 1MBMA 1YCPM 4CBOA 1CHGA 1HV7A 1NFYA 2Y81A 3T28A 3LDXH 3GOVB 1UK2A 2OQUA 4B76A 1AD8H 2BD8A 5EGMA 1T8NA 1TNKA 1ZSKA 1MTWA 4BAMB 3ELAH 2WPHS 2P3TB 3LC5A 1RGQA 1SLXB 3PO1C 1O2NA 3PMBB 4IC6A 2AIQA 1LKBA 2I6SA 2PSXA 1TGTA 1MQ5A 2EC9H 4MLFB 5B6OA 2ANMH 3P92A 1O2KA 4Y71A 1C4V2 4U01A 1JIRA 1FZZA 1GBKA 3LT3A 1OS8A 4GHTA 4MDSA 1WSSH 1TPSA 2BD3A 5C3NA 1GJ4H 2UWLA 4Y0YE 2EI8A 2WPKS 4FUIA 3UQOA 4A7IB 3LH1A 2VGCC 2J38A 3HATH 1P12E 3ZZAA 1PQ7A 2UUYA 1AUJA 2GX4A 1V3XA 1XMNB 3C1KA 1H8IH 1RRKA 1XM1A 1SI5H 2ZKSA 4ABAA 2ZHFH 3BSQA 3A7TA 4NWLA 2C3SA 2BZAA 1N6YA 3MH4A 1YPKH 3ZV8A 2FOAA 1JWTA 1TQ7B 1QFKH 4HFPB 4I8HA 3HK3B 4DW2U 1HJ9A 1THSH 2B0FA 2BB4A 4IC5A 2AGEX 2GDDA 1FUJA 1S6HA 1WUNH 1ABIH 3SU4A 1BTYA 5E2OA 3KL6A 4HGCA 3V12A 2CN0H 2PKAA 1IQJA 3W94A 3B9FH 1MTNC 1YM0A 4F49A 4UFEH 2Y7ZA 1ESBA 1AVWA 1SGQE 3RXBA 4BANB 2BMGB 3QGJA 3DT0H 3A7YA 2R0KA 3E3TA 3PROA 2O8UA 4X2WA 1C5MD 4NA7A 1H9HE 3TJUA 2VINA 2BD5A 1TONA 4HZHA 1UJ1A 4I32A 1BB0B 2Z6BD 1DXWA 4GHQA 2Y6TA 3MNSA 2OINA 4DG4A 4J2YB 1BTZA 1TX8A 3KF2A 4X8SH 5CHAC 4AOQA 1WYKA 2GT8A 4DVAU 3EA7A 1P10A 3TJVA 1EJNA 2JH5D 3IG6B 4H6TA 1K1LA 2F9PA 2XC4A 1B5GH 3SU1A 1KSNA 3ZZCA 4Y8YA 4O9VA 4A1XA 1O31A 1O2YA 4AB8A 1V2NT 1SGCA 1PPFE 4Q80A 2BY9X 5F6MA 3KQCA 2XC5A 1E37B 1NN6A 1EXFA 1S85A 5GDSH 2H5CA 4YO9A 5DPAA 1G3DA 3MI4A 3SORA 1MH0A 2OP9A 1GI3A 1QRXA 4A1TA 1TNIA 1SLWB 2JKHA 2GV7A 2ZU5A 1DX5M 3LGYA 4ZKSU 1EZSC 1C2LA 4FU7A 2DE8A 3A8CA 2NWNA 2RCEA 1DITH 3A86A 1QBVH 2FWWA 1OWHA 2GZ7A 4TPIZ 2BDGA 1OSSA 3U1JB 1P04A 7ESTE 1W11U 1QL8A 3BTDE 1QHRB 3TGJE 1FY5A 3U1IB 3QUMP 1K1JA 1P02A 4X0WU 2V35A 1K22H 3TGKE 1HAPH 3LGIA 1O2JA 1TRMA 2ZCKP 4ZROA 3RXLA 3BTGE 3QK1A 2UUJB 4X6OA 3ATLA 1QL7A 3UFAA 1ZPCA 1G30B 1O2WA 3QZRA 2NU3E 1NFXA 1V2QT 1LTOA 3U98H 5CHAB 4Q7XA 2ZDNA