1GVKB

Porcine pancreatic elastase acyl enzyme at 0.95 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PEPTIDE INHIBITOR
publication title X-Ray Structure of a Serine Protease Acyl-Enzyme Complex at 0.95-A Resolution.
pubmed doi rcsb
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gvkB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gvkB01
1PFXC 1O30A 2OINA 4JK6A 4JMYA 1QIXB 3RXSA 2PGBB 1FPHH 1V2JT 1EQ9A 5HMAA 3F68H 4X2YA 4ZKSU 1N1LA 1UCYK 2UWOA 1QHRB 3BEIB 1C5YB 1KXCA 3TK9A 1MKXH 1W2KH 3T28A 1WBGB 1BBRH 2A4GA 3GY7A 1T4VH 3EYDA 1TNLA 3HKIB 1F92A 5FBIA 1K1OA 1LPKB 2VIQA 3LGUA 3QK1A 1TRMA 4FUJA 3RXKA 1YKTA 1ZTKA 3RU4D 2ZC9H 1BMLA 4RN6A 2BY6X 1ELAA 1G32B 1HPGA 2EC9H 3KQDA 1ZHPA 1EX3A 1GI2A 5TJXA 5CE1A 1XM1A 2EI8A 5CMXH 4HZHA 4AOQA 3VB3A 4TWYA 3A86A 1BOQA 3O8BA 4A6LA 1LO6A 1C1WH 1F2SE 1WOFA 3GDVA 2PTCE 1O2RA 2YNAA 5DP7A 2QY0B 1JIRA 4BOHA 4B73A 2J4IA 4I31A 1XX9A 2NU2E 1SLXB 2ZFQH 1EZQA 2VIDA 5FPSA 1C9TA 8GCHF 1MMJN 3BG8A 3LT3A 4ABFA 3Q3KA 4LOYH 4IN1A 1ARBA 3S7KB 1EJNA 3UQOA 1AVXA 1S85A 3MU0A 1MAXA 2C8ZB 1BQYA 1JOUB 1Y3VA 3K65B 2BZAA 2R2WU 3FVFB 4HGCA 1P09A 2F9NA 1T8OA 2UUKB 2STAE 1B7XB 4ZKNU 5G4BA 4AX9H 5GCHG 3SZNA 1NC6A 1RD3B 2A4RA 3D62A 1QB1A 4DY7B 1Z71A 2FX4A 2TBSA 3E8LA 1KDQB 1BDAA 1UK4A 2AMPA 4NWKA 1WSSH 2ZA5A 3SI3H 4I32A 1FLEE 1DPOA 3PLKA 5PTPA 3UR9A 4FU9A 3SJKA 3ZZCA 2JETC 2BM2A 3E1XB 4UFFH 2PUXB 1GWAA 1TGNA 1YM0A 2J95A 1SGEE 2G00A 1GBLA 1LHFH 1NRNH 3QO6A 3TGIE 5HM9A 1O38A 2PKAA 4FUGA 4AG1A 1HJAC 1SGIB 1GG6C 1N8OC 3BTFE 1VITG 2PKSC 2HVXA 4AFQA 1P2QA 4WXVA 4A1TA 4DVAU 4CR9A 4THNH 1CO7E 2D1JA 1BJVA 1C1NA 2RA0A 3F9FA 1GBIA 3NXPA 5JPMH 3E91A 4LZ4B 1BITA 3D65E 3VXEH 4WH8A 4ABEA 1O5EH 1EPTA 1CGHA 1GJ4H 1ABJH 4IC6A 1DS2E 2BY8X 3KGPA 1XUHA 1Z1JA 1BTZA 2P8OC 3NZIA 1C5MD 3E16B 2EI7A 1EXFA 1ZMNA 4ZHMU 4Q2KA 3HGPA 2ZFPH 1LVOA 4DT7B 2ZZUH 1UJ1A 1O3CA 1SGPE 5E0HA 1XVMA 4OS2A 2XBYA 2UUFB 2WYGA 1H4WA 1THPB 1YBWA 2VGCB 1RXPA 4ZKRU 3GICB 5JBAS 4CH2B 3K2UA 3FP7E 4Y8YA 4ISNA 3RXUA 3A7XA 2ALPA 1UK3A 1UVUH 2OC0A 3M7TA 3BTGE 3RM2H 5C67A 1GJBB 1E38B 1VR1H 4BXWA 2WINI 3UFAA 1NU7B 2BVRH 3BG4B 1G3BA 2FWWA 5HYOA 4D9QA 1AB9C 1BRCE 1W7XH 2FS9A 1HAPH 1F0RA 4ZXXH 1LHCH 2PLXA 1JXPA 1V2RT 4BAMB 3Q3XA 3Q77A 3PMHB 3SQHE 1GHXH 2ZIQH 1TNGA 3P70B 4A7IB 1GHYH 1K22H 2FOFA 3TK5A 1NRQH 1GI7B 2ZQ2A 1RIWB 1TMTH 5GXPA 2HPQH 1FY8E 1J17T 2BD5A 4WH6A 1C5LH 4K5ZA 3ZVAA 3TJVA 1Z6EA 4BXSA 2A5IA 1ELTA 1P3CA 2Z3EA 3QZRA 1EAIA 4Y6DA 1S0RA 1WTHD 1SSXA 2ESTE 1OX1A 4LXBH 4OS6A 4LZ1H 1H8DH 5DP6A 1O3DA 1GBMA 5I46H 2AERH 2BX4A 3MNBA 3A88A 1AY6H 3KQEA 1GVKB 1O2OA 1V2KT 5T6FA 5BRRE 3GCOA 1O3MA 1O2QA 1SLWB 1OSSA 2SGEE 1S0QA 5T3HA 1BUIA 1O2LA 1O2MA 3FZZA 2OP9A 2XWBI 2RG3A 4HI3A 3UOPA 2ZFRH 1WUNH 2AH4X 1MZDA 1CQQA 2GZ9A 3TGJE 1GJ8B 3SGQE 1W3CA 8GCHG 5EW2H 5IYTA 1DWCH 1KTSB 4IMZA 2BMGB 1ZMJA 1C5ZB 3BIVH 2J92A 1SQOA 1S84A 2C8YB 2OQUA 2SGPE 1EAUA 3DUXH 2PSXA 1HJ8A 1G3CA 2FM2A 1PQ8A 3GDUA 1DXWA 4O97A 3OYPA 1SPJA 1ESBA 4DW2U 1LQEA 1N6XA 1O2TA 1C2DA 1O5FH 3LC3A 3C27B 1BTPA 1FZZA 1ESAA 1TABE 2PSYA 3SU4A 4KGAA 1EAXA 4WWYA 2UWLA 1C5PA 5JDUB 3A8BA 2R3YA 4JYUH 1GBFA 1SGDE 1Z8IB 3TPIZ 1FUJA 2Y7XA 4TY6A 5E2OA 1P9SA 1ETTH 4NSYA 4TY7A 1MCVA 1AKSB 2XW9A 3RXRA 4OS4A 3ZZBA 2HOBA 4K8YA 3EAJA 1G9IE 1DANH 3ODFA 2ANMH 1HAXB 1GPZA 4INKA 2GGVB 3GYLB 2YNBA 3GY6A 1OP0A 1PPFE 1GCTB 3UREA 4X1QU 1OWDA 4CH8B 4UDWH 4SGAE 2BOHB 3SORA 2OCVB 2WPKS 1V3XA 1LDTT 1O5BB 1UVOA 1C1VH 2FXRA 1SQTA 4AG2A 2P3TB 3BF6H 1DSTA 1DM4B 3RMOH 2BVXH 5I25A 1G3EA 3M35A 2P59A 2GP9B 4UFEH 1ABIH 3A7VA 4GCHG 3OTJE 1YPMH 1C2HA 3D23A 1KXDA 3BTTE 5FX5A 4DGJA 1EB2A 1K1PA 2QYIA 2P95A 7ESTE 1WYKA 1G3DA 1K1LA 1C5OH 1PQAA 1HAVB 3ELAH 3EQ0H 3GCHC 3PO1C 3RXOA 1P3EA 4B75A 1UHBB 1BMNH 2Y7ZA 1F5RA 1EPTC 1Y5BT 1MQ5A 2A2QH 4JZEH 1BRAA 4YT7H 3SNCA 4Z0KA 3MH7A 4DIIH 3RXCA 3UY9A 2FESH 1RGQA 1AU8A 5GPIB 1V2QT 3DA9B 1Z6JH 1HRTH 1W0ZU 1ZTJA 4CRCA 3LH1A 1TQ0B 2GT8A 2BD4A 1AFQB 3PLPA 3PTBA 4K3JA 1ELFA 1DFPA 4OGYA 3TVJB 3I29A 3PV4A 2BDAA 1D6RA 2FODA 1VZQH 1QQUA 2ZDKA 3U8OH 2ZGHA 3NKKA 4H4FA 1M9UA 4ZAEA 1P2JA 4R0IA 3BG4C 3M61U 3RMNH 5EW1H 1A7SA 2GVFA 2QV1A 2G52A 2R0KA 1Y5UT 3BTQE 1XXFA 1AZZA 1IQJA 1MAYA 2YOLA 1HFDA 1TPPA 2I6QA 1C4Y2 3SU5A 1TQ7B 3MWIU 1LVYA 1Z8GA 2QGRA 4XE4A 3FZDA 3LGTA 1C2GA 1QA7A 1GMDF 1PQ5A 4YLQH 1RIWC 3GISB 1FXYA 2HPPH 1MTWA 2VVCA 2WPIS 3CP7A 3S0NA 2GCHF 1JRTA 4H6SB 5FAHA 1C2MA 3ZV8A 5FCKA 1XUKA 3VB4A 3Q3YA 2VWOA 4RSPA 4CRGA 2FOAA 1J9CH 2A4OA 4D7GA 2PGQB 1GGDB 5T6GA 1IHSH 4MPWA 2C93B 1PPZA 3Q00A 2WYJA 4MDSA 4MTBA 1YPHE 3P8OA 3QWCH 1TNKA 4YM9A 3MHWU 5F8XA 2GMTB 1C1QA 2G55A 1DX5M 1MQ6A 1FV9A 5FHTA 1CGIE 1YPHC 1GBAA 2B0FA 1L4DA 1LPZB 2ZGCA 5FX6A 3IITA 4YT6H 2Z9JA 1LTOA 2NU1E 2O9QA 5GIBA 2WUCA 4KP0A 4MPXA 4Y8XA 1GMHF 1SC8U 3TNSA 2BDBA 1P57B 1KXFA 2W26A 5DGJA 3IG6B 2VWMA 1B0EA 2STBE 5F03A 1B5GH 1BTWA 1FQ3A 1K21H 1V2MT 3S9AA 3U8TH 3V13A 1GL1A 4I7YH 1UK2A 1ANCA 3RXTA 5FBEA 3ZZ9A 1A4WH 1QRXA 2EEKA 1NM6A 2BD7A 1TMUH 1NS3A 3RC4A 3SNAA 1HAYB 2HALA 1L1GA 3KL6A 1IOEA 1C1PA 1O2ZA 1ZYOA 2ANKH 1GI1A 1HNEE 2FTLE 3SGAE 4H42U 4FXGH 1BJUA 1RTKA 2SGDE 4CREA 3H5CB 4NSVA 2FZZA 3BEFB 3BEUA 1NU9A 4X6PA 1P02A 1TFXA 4J2YB 3LGYA 1YP9A 1P0SH 3A7YA 4JZIA 2ZO3H 3MH4A 1BTYA 7LPRA 2WPJS 2G8TA 9ESTA 1TBZH 4RKJB 3ZVDA 1O3AA 2OQ5A 2JH0D 4XSKU 4B76A 3P6ZB 4FU7A 1CBWB 1E37B 3ZZ8A 3RXFA 2OTVA 1FY3A 2ZPQA 1QB6A 2ZF0H 2ZHDA 3V0XA 1LHGH 3ZYEA 2BZ6H 4MG3A 3T2NA 4E05H 2AGGX 4FUCA 2FEQH 1YPJH 1HLTH 1O2IA 4FUDA 2F83A 1NRRH 1INCA 1EOLA 1GCTC 2GCTB 1H8IH 1ZPZA 1O39A 3MNCA 4ABBA 1DOJA 2VU8E 1P04A 1N6YA 4XBCA 1DY9A 2BXUH 3UNRA 1GDNA 1TIOA 3NCLA 3MH6A 7KMEH 4HTCH 4X6OA 5LH8A 5J4SA 1MD8A 5GJ4B 3FP8E 1WTGH 3SU2A 2XRCA 1OWJA 4ZKOU 1QJ6B 4MNYA 3LKWA 4NZQA 4XBDA 1GBTA 4AFZA 1DWDH 3MU8A 1GBCA 2FI5E 2KAIB 4WJG2 5C1UA 1K9OE 1HDTH 1KYNA 3I78A 2BLOA 1ZJKA 3ATIA 2WPLS 1A0LA 3M3SA 3FAOA 1QFKH 5ESTE 1ELBA 4E7RG 3BIUH 2ILNA 3OU0A 4WMDA 1O3FA 1ZHRA 4PROA 1O3EA 1GI5A 5E2PA 1QQ4A 1SBWA 2XC0A 4FUIA 3SJOA 3ZZ6A 1DWBH 2Y80A 2FOCA 2I6SA 2XYAA 2ZG0H 2BLVA 1MKWK 1GHAG 3U69H 1YCPK 2Z6BD 3ATKA 1ELDE 1NROH 5L2ZH 3W95A 1O36A 2VIPA 3GCNA 3MO9A 1ACBE 2V0BA 2CN0H 1CE5A 1ZGVA 1UTJA 2A31A 5ESBA 1AFQC 1AI8H 3PWCA 3BTME 3QLPH 4VGCB 1FAKH 4NG9H 2ZNKH 1GBJA 2ZU5A 2BDIA 4U2WA 5DP4A 1GMDG 1KDQA 1MBMA 3RLYH 5DG6A 3RXAA 1QTFA 3URDA 3UWIA 3WY8A 2VWLA 4O03A 4NIXA 2ZDVH 4BANB 1O3HA 3A7ZA 3TGKE 2GCHG 4K2YA 5K0HA 4K1EA 4GAWA 5DP3A 5CHAC 3RP2A 5GWZA 1WAYB 4K69A 2H1UA 1CHOF 1XXDA 4ASHA 2PHBA 3BTWE 5E0JA 2PW8H 1C5SA 3A84A 4WMEA 1QNJA 1CA0B 1NO9H 4ZHLU 1QR3E 5EOKA 1Z8JB 1TNJA 2ZQ1A 3EA7A 4NA9H 1UCYH 5AVDA 3MH5A 1EZUC 2C90B 4DJZB 1A0HB 1V6DA 1AN1E 4U32A 5ETXA 1Z1IA 1ZSKA 5LPRA 1GMHG 1AE8H 3U1IB 3SU1A 6CHAB 1HB0B 1GGDC 3TITA 3MFJA 4D9RA 2Q6FA 1T8NA 2O8LA 1K1MA 5EXMA 1ID5H 1TALA 1UO6A 1W0YH 2GMTC 3RMLH 1UMAH 1AD8H 1PQ7A 3STJA 4TPIZ 3UUZA 1F5LA 1ZZZA 4GCHF 1FJSA 4MPUA 1OWHA 1A2CH 2LNCA 8ESTE 4B2AA 1FN6A 1UTNA 1O3NA 3UPEA 4IBLH 3LOXA 3MNXA 1RTLA 4I8HA 1C5XB 3KIDU 2XCFA 2G5VA 2ZEBA 1HUTH 1GI8B 3AVZA 4IMQA 1HJ9A 1GL0E 5EXLA 5EPYA 3GY2A 2VVVA 3SOSA 1O33A 2P16A 1SGFG 3A81A 1ANDA 1HYLA 3SNEA 4O3UA 1XUFA 4INHA 3RXIA 2SGFE 3V3MA 4X1PU 2XBVA 4YOGA 3MO3A 1MKWH 1KLIH 1O2NA 1YCPH 4D7FA 2OLGA 2O8UA 2BTCE 5DP9A 4B2CA 3OX7U 1F7ZA 2XBWA 2W7UA 5TCAA 1ZSLA 1VGCB 1WV7H 2VB0A 2Z9GA 4U01A 2BD9A 5HGGA 2VINA 2ASUB 1SGFA 4Y71A 1EP6A 1GBHA 1IAUA 3AAVA 1GI6A 4UFGH 1QBNA 1EJMA 1S6HA 1O3KA 1O34A 4NIYA 4I33A 1P2OA 4K1SA 4CRDA 2WV5A 1MD7A 1EP5A 2BYAX 1EKBB 5EODA 3ZZDA 1OWEA 3EA8A 3S7HB 4WY3A 3SQEE 1H9HE 1S6FA 3HPTB 1GMCF 2ANYA 1CT0E 2Z9LA 2EI6A 1TRNA 3UNSA 1DWEH 1KXEA 4UONA 1MTNB 1OKXA 1IQIA 3ATWA 3TJOA 5E0GA 2XC5A 1QJ7B 1PPEE 1J14A 1SGNE 1P2KA 2B7DH 3M5OA 1WQVH 4BAKB 1SGCA 1CHGA 2GT7A 2R9PA 1WQSA 4BAOB 1FIZA 1UTOA 4IC5A 1HV7A 4OS7A 3M5MA 4X2XA 3QZQA 1C2FA 1ELGA 3VGCB 3AASA 4XFQA 2Y81A 2J34A 2PFEA 3NUMA 2A45B 3MTYA 3ZYDA 5HM2A 1SOZA 1C1SA 1EAWA 3KQBA 1OXGA 4H6TA 1TRYA 1SI5H 2A5KA 2ODQA 4J1YA 1J16A 1TGBA 3UR6A 4A1XA 1V2ST 1NESE 2TGDA 1H1BA 4X2VA 1KY9A 2HRVA 4ABJA 4F49A 3HKJB 1LKAA 4Y0ZE 3GDSA 3BV9B 3ZZ7A 3RXEA 3CS0A 3ODDA 2GDDA 3UIRA 1O2PA 1ANEA 4Y76A 2SGQE 2ZKSA 2SFAA 1TONA 1C2IA 8LPRA 1YYY1 2GKVE 1QL7A 4Q7YA 1YPGH 3B8JA 2AGEX 1SGYE 1EJAA 1O37A 3SN8A 1ELVA 1THRH 4D76A 2B5TB 2O8WA 1O3JA 2BLQA 1Y3UA 1Y3WA 4X8UH 3PLBA 2ZU1A 3V7TA 4AORA 1PPBH 1C5QA 1ZGIA 1FMGA 1O2HA 1EZSC 1L2EA 2TRMA 5GDSH 1QGFA 3S9CA 1HAGE 1C5RA 2CF8H 5F8TA 4DCDA 4MNVA 1BMAA 1CHOG 1AKSA 1ETRH 3MU4A 3EA9A 4VGCC 1HCGA 1UTQA 4HFPB 1TPAE 3LJJA 3A8AA 2H5DA 5AFYH 4YTAA 1BHXB 4NA7A 1D3DB 6GCHF 2BDHA 2CHAB 3ESTA 4BAQB 3BN9A 1MU8B 1GJAB 1YC0A 4X6MA 5DJ7A 1P03A 1BIOA 1RTFB 2FMJA 2AEIH 2D2DA 2AIQA 4OS1A 1KIGH 2UUYA 3PMAB 4B2BA 1CA0C 3RXLA 2FDAA 3R0FA 3O8RA 1FDPA 1QB9A 2VIWA 1SLVB 3DFJA 2OUAA 2VH0A 3VXFH 2H5CA 2ZECA 1SHYA 3IWMA 1AWFH 5C5OA 4ZXYH 2A7HA 1MTUA 3B23B 2GX4A 3LH3A 2XCNA 1TBRH 4AN7A 3U8RH 1BMMH 1L0ZA 2IPHA 2QCYA 1W11U 1SGRE 1TLDA 1KTTB 1SFIA 2FP7B 3K6YA 4K8BA 1HAVA 1A46H 2H6MA 3GY3A 1UHBA 3RM0H 1Y5AT 5ABWA 3QGNB 3QTVH 3LGIA 1K1NA 3R3GB 2ODYB 2F9OA 1YLDA 2R0LA 3TH3H 3RXJA 5C1XA 3M3TA 1TOMH 1SVPA 4X1RU 2ZCKP 4YOJA 5AHGH 2OC7A 4GHTA 4KELA 3QDZB 4OS5A 1O5AB 3MYWA 5C3NA 1IQEA 1GI0A 1H9LB 2JH6D 2VGCC 3ZV9A 1JIMA 2TIOA 2J9NA 3DFLA 1E36B 1FY5A 4FUHA 2AS9A 2V6NA 4YLUA 1ZMLA 1W8BH 1Y8TA 1V2VT 1RRKA 1T4UH 1AO5A 2BQWB 4CRBA 1C5UA 3D49H 3P17H 4I8JA 1P11E 1ELEE 5EQQA 3NK8A 3JZ1B 4Y10E 1C1MA 3UNQA 1O35A 1HAZB 1S83A 3M36A 3RC6A 4ESTE 3F9HA 3SUFA 3SI4H 1GHAF 3AAUA 2QAAA 4X0WU 2BHGA 1GHZA 5EGMA 2K1QA 4AZ2B 3TNTA 3BTDE 2ZPRA 1VGCC 2ZHWH 1YPEH 2ZTZA 3L33A 1FI8A 2HLCA 3ZVEA 3KNXA 3RUOA 3M5NA 2F9BH 4CHAB 3A80A 1GMCG 2PWXA 4NA8A 1QL8A 1OOKB 4ABIA 1ANBA 3M7UA 2BOKA 5LGOA 3EGKH 1G37A 4FUBA 1PYTC 2ZU3A 5JBCS 1BBRE 2IJOB 3A85A 1O2WA 2WV4A 2A2XH 1MTVA 4JZDH 4ISLA 1DXPA 4DG4A 4ZH8A 2FX6A 5EXNA 4X1SU 4WVPE 1BT7A 1OPHB 3PWBA 3QTOH 3SNBA 3LDXH 1C2KA 3MI4A 3FFGA 2Q6GA 2G5NA 1CSOE 1GDQA 1GG6B 1CT4E 1MKXK 1ZSJA 2PKSB 3RDZA 1BBRK 4TPYA 1MTNC 4NFEA 4YZUA 1T8LA 3SU6A 2Y82A 1V2PT 1E34B 1UTPA 1SL3A 3ITIA 1LQDB 7GCHF 3LJOA 3TU7H 2G81E 2RA3A 1X7AC 4FUFA 3T5FH 1J15A 3RLWH 2BY7X 4MLFB 2IOTA 1C1OA 2QXIA 2ZPSA 4MNXA 3TH2H 3MNSA 3VGCC 1A0JA 4MNWA 2V35A 3VFEA 3PROA 1TBQH 5JYIA 2ZCHP 2AIPA 4UE7H 5A0AE 3E0NB 1EB1H 2VJ1A 1ARCA 2Y6TA 3KHVA 1A5GH 4Y8ZA 1OP8A 1BRUP 4B74A 4I8GA 2BB4A 1VITH 2JKHA 4K60A 2HGTH 3RXHA 2WUBA 4Y0YE 1P06A 1GBDA 1V2WT 1P9UA 1GHBG 3S69A 2GV7A 3ZZ3A 1QBVH 1CU1A 2BQ7B 1TA2A 2Z9KA 2ZFTA 3UQVA 2M5TA 3SUGA 1S82A 1XUGA 1BA8B 2CMYA 5E8EH 3L6PA 6GCHG 1OYTH 1VJ9U 3NPSA 4BTIB 1AB9B 4WXIA 1KXAA 1OWIA 1NPMA 2C4FH 2BLWA 2ZI2H 4I8KA 4YOIA 2V3OH 3LC5A 4OGXA 3MMGA 5H4IB 3ZZ4A 3OY5U 3P8NA 1UTMA 4AYVB 5JB9S 4UD9H 1ZHMA 3A8DA 1O3LA 1O2JA 5DK1A 1GI9B 3B9FH 1YPKH 2A7JA 3ENSB 2F9VA 3CENA 3ZZAA 1E0FD 3U1JB 4IGDA 4ZROA 2FPZA 2XTTB 5DKMA 5DP5A 1THSH 2R3UA 2J2UA 1XUIA 1SFQB 1O2GH 2PUQH 3O8CA 1W14U 2ZHFH 1SR5C 2NU4E 3F6UH 1TAWA 1LVMA 3FP6E 1TPOA 5EG4A 2FOGA 3OSYA 3S9BA 2F9PA 1GI4A 1EOJA 1MTSA 3VB7A 3W94A 3O8DA 3VB5A 1TGTA 1GCDA 3FANA 3SGBE 3MOCA 2FOMB 4E06H 4FUEA 4XBBA 1O3BA 3VPKA 1NY22 1SGTA 1C5TA 2XWAA 1TX8A 2KAIA 1ZOMA 5A8YA 1NFYA 3RXGA 1F0UA 1SMFE 1DLEA 3LGVA 4BNRA 1O5DH 1F0TA 2B9LA 2VNTA 1C1RA 2Y5FA 3SHCH 2FYQA 1IQNA 1P2MA 5T6DA 1LMWB 1RS0A 3K9XB 3L3TA 5IDKA 5L2YH 2FTMA 3T27A 4FU8A 2XBXA 4X8VH 3LIWA 4Y7BA 3TIUA 1TA6A 3P8FA 3E0PB 1DITH 1A3BH 2H9EH 1C4U2 2FOBA 5A8ZA 3TLOA 3BTHE 3TJUA 3VEQB 2QIQA 4SGBE 3UOUA 3LPRA 2RCEA 1AIXH 1UVSH 2A5AA 3GOVB 1DT2A 4A5TS 1XMNB 2OXSA 2P93A 3VB6A 1GJ5H 2FLBH 4B71A 1BTXA 3JZ2B 1LVBA 3SW2B 4IW4E 5L30H 2TGPZ 1GJ7B 1KLJH 3E90B 3RXPA 4BTTB 4CBOA 2FOHA 4CRFA 2QXGA 1FNIA 3SU3A 4M7GA 1OP2A 4ABGA 4ISIH 2ZGJA 2H9TH 1O2YA 1NZQH 1Z7KA 2ZP0H 2G4TA 4NCYA 1HBTH 3KQCA 1BHXF 1GJ9B 2BD2A 2G51A 1UTKA 1MZAA 1O31A 1AUJA 1XUJA 1F0SA 3P95A 1NTPA 2C8XB 4Y11E 1TGCA 1SLUB 4CHAC 4JK5A 2JH5D 2OBOA 1GJCB 2ANWA 1TOCB 4Q7XA 3P8GA 3SJ8A 1J8AA 1O3PB 1GHWH 3GY4A 1IQKA 2R2MB 4IN2A 3T26A 1G2LA 2HNTE 1A5HA 1C4V2 7GCHG 1IHTH 2TGTA 3LGWA 4YESB 1NN6A 2ALVA 3GY5A 4JYVH 3CS7A 9LPRA 2HNTC 2W3KA 2ZFSA 2ZWLH 5C20A 4ABDA 2PKAB 1QURH 5SGAE 1WU1A 2BY9X 1AQ7A 1ZPBA 1V2TT 2P3FH 4CR5A 4NFFA 2J38A 5AF9H 1W10U 1O5CB 1A61H 1Q31A 1O0DH 2BX3A 4UEHH 4TWWA 3BSQA 1C1TA 3RXDA 2C3SA 2ZTYA 5FPTA 3RXVA 2ZCLP 1EATA 3F9EA 1XVOA 3E3TA 3PM3A 1ESTA 3GCHB 1NFUA 3PO1B 1YF4A 1MH0A 1P05A 1QA0A 1EPTB 1ZLRA 1C5NH 2BXTH 3M37A 1IQHA 5A0CA 2Z3DA 1TNHA 2OD3B 4WMFA 3SU0A 4O3TA 1Y59T 4JCNA 3ATMA 5C1YA 5J4QA 1HXEH 2BDGA 1JWTA 1D3QB 1DSUA 3GCTG 1B0FA 1HGTH 1BRBE 2ZGBH 4NWLA 2GD4B 3RU4E 2RDLA 3SV7A 1G36A 2PR3A 5K7RA 4XDEA 2OBQA 1K28D 2DE8A 5C2ZA 1TB6H 2OC1A 1GVZA 2CF9H 2AYWA 1T7CA 4DURA 2Z7FE 1L4ZA 1O5GH 1K2I1 2G4UA 1TWXB 1GDUA 2CXVA 3UWJH 2PV9B 1TMBH 2FI3E 3GY8A 2HWLB 3STIA 5FCRA 1V2UT 1P2NA 1P8VC 1SG8B 2J94A 2CJIA 3M5LA 2D8WA 2FYRA 5FXLA 3PYHA 3RXBA 3SV2H 2GDEH 1P2IA 3DT0H 3MU1A 4JYTA 5F6MA 4Q80A 2AFQB 2WPHS 3LU9B 2ZFFH 4K1TA 2TGAA 1YCPM 2BDCA 1CBWC 1NT1A 3TK6A 5TCCA 4X6NA 1DDJA 4Q7ZA 1BB0B 2AMDA 2HNTF 1Q2WA 4ZMAH 2A32A 1C1UH 5L6NH 2ZDNA 1LHEH 1A5IA 4JZ1A 2Z9IA 2IN2A 1HIAB 2GCTC 1YLCA 2FLRH 4Y7AA 3U98H 4A92A 2D26C 1HIAA 3ZVFA 4AGKA 1ORFA 2P3UB 4KKDA 2NU3E 4NIVA 2A7CA 3KN2A 4AFSA 1BTUA 2BY5X 2GZ7A 1AHTH 2F91A 3QN7A 2C8WB 1ZJDA 4D8NA 3AW0A 1VCPA 1GJDB 5A2MH 2WPMS 4Z6AH 1FIWA 1NFXA 1RFNA 5DO4H 4Y79A 4U30A 1AZ8A 1FPCH 1QL9A 1VJAU 2LPRA 3M3VA 2ZDMA 5A0BA 1HAIH 1O2VA 1PJPA 2Y5GA 2BVSH 5EU8A 3A83A 2FO9A 2ULLA 4X2WA 2OC8A 1BZXE 1EUFA 3SJ9A 4A1VA 2XXLA 4GPGA 2UUJB 1C2JA 1PPCE 4NGAH 1IQFA 5C5NA 4I8LA 3SV9A 2F9UA 3H7OA 1DLKB 4E7NA 3RXMA 1W13U 2A1DB 1GVLA 6LPRA 1PPHE 4INLA 4RKOB 1ZTLA 4UFDH 4AB8A 2VIOA 3MO6A 1C5WB 2B8OH 4X8TH 4BAHB 5LPEA 3ATLA 1L1JA 2TPIZ 2A0QB 1TNIA 1OYQA 1PYTD 1D9IA 4X8SH 2Q1JA 1GHBF 2QN5T 2THFB 1KXBA 2QF3A 4YO9A 3P92A 1A1RA 5FPYA 3A82A 1SOTA 1T31A 3V12A 3BTEE 2ZDAH 3A8CA 1O3OA 5EQSA 1LKBA 3ZVGA 4TYDA 1K1JA 2BDYA 1FY1A 1QJ1B 3HK6B 1EASA 2QXJA 5AFZH 1E35B 5EQRA 1UTLM 1LPGB 3T25A 2UWPA 4AFUA 4KTUA 2QA9E 3QX5H 4LK4A 1DE7H 1LHDH 1G30B 2SNVA 3KCGH 1LCYA 3EDXB 2H2ZA 2PTNA 1QBOA 1AVWA 1P01A 2FIRH 4GHQA 2GZ8A 2EA3A 1Z8RA 6ESTA 1CA8B 1AMHA 1PPGE 6CHAC 1CT2E 1C5VA 4AB9A 4MVNA 1Y3XA 2ODPA 4GVUA 1JBUH 1DY8A 8KME2 3NWUA 1O3IA 1YPLH 3TJNA 1BCUH 3M7QA 4MPVA 1OWKA 2W7SA 3SJIA 3SHAH 5JBTA 1QRZA 1IQLA 3SUEA 2W3IA 3PMBB 1SQAA 3GYMA 3AW1A 4ZHAA 2XNIA 1VCWA 1DUAA 1QCPA 1NRPH 3MU5A 1SGQE 1GBBA 1XKAC 1T8MA 2QXHA 1S5SA 1MUEB 4GUXA 3OY6U 1BTHH 1IQGA 3K6ZA 2ZDLA 3SUDA 1FONA 2DE9A 1NRSH 1H9IE 1D3TB 1Q3XA 5DPAA 1GBEA 3E6PH 4GLYA 1TYNA 1L1NA 1F5KU 1O3GA 3F9GA 1C2LA 2AGIX 4B1TA 1FY4A 1FN8A 4FVDA 1NFWA 2BD3A 4ABAA 2CGAA 1G2MA 3Q76A 1MU6B 3G01A 2H9HA 2Z94A 3C1KA 2ZTXA 1AUTC 1HXFH 5HXFA 1KLTA 2FS8A 2BQ6B 1DICA 2W5EA 1UVTH 3T29A 1GI3A 1RJXB 4BTUB 1QRWA 1OS8A 1W7GH 1HAOH 1CVWH 1ZRBA 3EE0B 3TH4H 3ZVBA 3BTKE 1GHVH 3UTUH 2O8MA 5B6OA 2VIVA 4DIHH 2Z3CA 1V2LT 1WCZA 5EPNA 3RXQA 4R8TB 1AGJA 3URCA 1Y3YA 1AFEH 2F3CE 3HATH 4NIWA 2JETB 1YGCH 5A09A 3T62A 5CHAB 1P10A 1AVGH 1IQMA 5GCHF 3QGJA 1D3PB 1KSNA 1C2EA 2GV6A 1SB1H 5BPEA 1T32A 2AMQA 4O9VA 1O2XA 1U6QA 2XC4A 1HJAB 4NZLA 1N8OB 1TX7A 4IS5A 1AWHB 1ZR0A 3SV8A 1TPSA 1D6WA 2ZU4A 3ZZ5A 4JZFH 3H7TA 1O32A 3HGNA 1MCTA 4F4OC 1UVPA 3A89A 3DD2H 2ZU2A 1O2SA 1JRSA 1ZRKA 2VWNA 1P12E 2QF0A 1DUEA 4CRAA 3RMMH 3ZVCA 3A7WA 2VH6A 2O8TA 2P8OB 1VITF 1GBKA 4QT8C 1MBQA 2V3HH 2QC2A 3U9AH 4WF8A 4MQAA 1ETSH 1S81A 1HAHH 2FI4E 1C9PA 1VCQA 2A4QA 3QUMP 3SO3A 3HK3B 5JB8S 1A3EH 3N7OA 5LPFA 5JBBS 1D4PB 1JMOH 1K1IA 2ZHQH 1TX6A 2NWNA 2SNWA 4ZUHA 2SGAA 3KF2A 3GCTF 1O2KA 1V2OT 1W12U 1GJ6A 2Q6DA 3A87A 4AGJA 1FAXA 4ISHH 5A8XA 3RU4T 3SV6A 3SNDA 4FVBA 1EZXC 1AE5A 1V2NT 5DP8A 4AYYB 4GSOA 4ABHA 2VVUA 2ZHEH 3A7TA 4XOJA 4CBNA 3PMJA 3F1SB 3PB1E 1DVAH 2NU0E 1O2UA 4ISOA 5F8ZA 3DHKH 2FOEA 2GTBA 2P94A 3I77A 1ELCA 4X1NU 3KEEA 1TE0A 2BD8A 4KTSA 4DOQA 2Y5HA 3PTNA 2DUCA 4KTCA 1SHHB 2ZGXH 1TGSZ 1CGJE 3LONA 1XKBC 1QY6A 1ZPCA 2CV3A 1UCYE 2CHAC 3RC5A 3SBKA
chains in the Genus database with same CATH superfamily
1PFXC 1O30A 1KMHB 2OINA 4JK6A 4JMYA 1QIXB 3RXSA 2PGBB 2KFWA 1FPHH 1V2JT 1EQ9A 5HMAA 3F68H 4X2YA 4ZKSU 1N1LA 1UCYK 2UWOA 1QHRB 3BEIB 1C5YB 1KXCA 3TK9A 1MKXH 1W2KH 3T28A 1WBGB 1BBRH 2A4GA 3GY7A 1T4VH 3EYDA 1TNLA 3HKIB 1F92A 5FBIA 1K1OA 1LPKB 2VIQA 3LGUA 3QK1A 1TRMA 4FUJA 3RXKA 1YKTA 1ZTKA 3RU4D 2ZC9H 1BMLA 4RN6A 2BY6X 1ELAA 1G32B 1HPGA 2EC9H 3KQDA 1ZHPA 1EX3A 1GI2A 5TJXA 5CE1A 1XM1A 2EI8A 5CMXH 4HZHA 4AOQA 3VB3A 4TWYA 3A86A 1BOQA 3O8BA 4A6LA 1LO6A 1C1WH 1F2SE 1WOFA 3GDVA 2PTCE 1O2RA 2YNAA 5DP7A 2QY0B 1JIRA 4BOHA 4B73A 2J4IA 4I31A 1XX9A 2NU2E 1SLXB 2ZFQH 1EZQA 2VIDA 5FPSA 3F2FA 1C9TA 2WZQA 5DN6D 8GCHF 1MMJN 3BG8A 3LT3A 4ABFA 3Q3KA 4LOYH 4IN1A 1ARBA 1E1RD 3S7KB 1EJNA 5EJZA 1AVXA 1S85A 3UQOA 3MU0A 1MAXA 2C8ZB 1BQYA 1JOUB 1Y3VA 3OE7D 3K65B 2BZAA 2R2WU 3FVFB 4HGCA 1P09A 2F9NA 1T8OA 2UUKB 3DSOA 2STAE 5KGOA 1B7XB 4ZKNU 5G4BA 3ZIAD 4AX9H 5GCHG 3SZNA 1NC6A 1RD3B 2A4RA 3D62A 1QB1A 4DY7B 1Z71A 2FX4A 2TBSA 3E8LA 1KDQB 1BDAA 1UK4A 2AMPA 4NWKA 1WSSH 2ZA5A 3SI3H 4I32A 1FLEE 1DPOA 3PLKA 5PTPA 3UR9A 5CHBA 4FU9A 4B6EA 3SJKA 3ZZCA 2JETC 2BM2A 3E1XB 4UFFH 2PUXB 1GWAA 1TGNA 1YM0A 2J95A 1SGEE 2G00A 1GBLA 1LHFH 1NRNH 3QO6A 3TGIE 5HM9A 2L74A 1O38A 2PKAA 4FUGA 4AG1A 1HJAC 1SGIB 1GG6C 1N8OC 3BTFE 5IK2D 1VITG 2PKSC 2HVXA 4AFQA 1P2QA 4WXVA 4A1TA 4DVAU 4CR9A 4THNH 1CO7E 2D1JA 1UW7A 1BJVA 1C1NA 2RA0A 3F9FA 1GBIA 3NXPA 5JPMH 3E91A 4LZ4B 1BITA 3D65E 3VXEH 2HLDD 4WH8A 4ABEA 1O5EH 1EPTA 1CGHA 1GJ4H 1ABJH 4IC6A 1DS2E 2BY8X 3KGPA 1XUHA 1Z1JA 1BTZA 2P8OC 3NZIA 1C5MD 3E16B 2EI7A 1EXFA 1ZMNA 4XD7D 4ZHMU 4Q2KA 3HGPA 2ZFPH 1LVOA 3GS9A 4DT7B 2ZZUH 1UJ1A 1O3CA 1SGPE 5E0HA 1XVMA 4OS2A 2XBYA 2UUFB 2WYGA 1H4WA 1THPB 1YY3A 1YBWA 2VGCB 1RXPA 4ZKRU 3GICB 5JBAS 4CH2B 3K2UA 3FP7E 4Y8YA 4ISNA 1BMFD 3RXUA 3A7XA 2ALPA 1UK3A 1UVUH 2OC0A 3M7TA 3BTGE 3RM2H 5C67A 1GJBB 1E38B 1VR1H 4BXWA 2WINI 3UFAA 1NU7B 2BVRH 3BG4B 1G3BA 2FWWA 5HYOA 4D9QA 1AB9C 1BRCE 1W7XH 1YLNA 2FS9A 1HAPH 1F0RA 4ZXXH 1LHCH 2PLXA 1JXPA 1V2RT 4BAMB 3Q3XA 3Q77A 3PMHB 3SQHE 1GHXH 2ZIQH 1TNGA 3P70B 4A7IB 1GHYH 1K22H 2FOFA 3TK5A 1NRQH 1GI7B 2ZQ2A 3N99A 1RIWB 1TMTH 5GXPA 2HPQH 1FY8E 1J17T 2BD5A 4WH6A 1C5LH 4K5ZA 1WDIA 2KR7A 2L6OA 3ZVAA 3TJVA 1Z6EA 4BXSA 3FO8D 2A5IA 1ELTA 1P3CA 2YMSB 2Z3EA 3QZRA 1EAIA 4Y6DA 1S0RA 1WTHD 1SKYE 1SSXA 2ESTE 1OX1A 4LXBH 4OS6A 4YXWD 4LZ1H 1H8DH 5DP6A 1O3DA 1GBMA 5I46H 2AERH 2BX4A 3MNBA 3A88A 1AY6H 3KQEA 1GVKB 1O2OA 1V2KT 5T6FA 5BRRE 3GCOA 1O3MA 1O2QA 1SLWB 1OSSA 2SGEE 1S0QA 5T3HA 1BUIA 1O2LA 3KQ5A 1O2MA 3FZZA 2OP9A 2XWBI 2RG3A 4HI3A 3UOPA 2ZFRH 1WUNH 2AH4X 1MZDA 1CQQA 2GZ9A 3TGJE 1GJ8B 3SGQE 1W3CA 8GCHG 5EW2H 5IYTA 1DWCH 1KTSB 4IMZA 2BMGB 1ZMJA 1C5ZB 3BIVH 2J92A 1SQOA 1S84A 2C8YB 2OQUA 2SGPE 1EAUA 3DUXH 2AHME 2PSXA 3U28C 1HJ8A 1G3CA 2FM2A 1PQ8A 3GDUA 1DXWA 4O97A 3OYPA 1SPJA 1ESBA 4DW2U 1LQEA 1N6XA 1O2TA 1C2DA 1O5FH 2J5UA 3LC3A 3C27B 1BTPA 1FZZA 1ESAA 1TABE 2PSYA 3SU4A 4KGAA 1EAXA 4WWYA 2UWLA 1C5PA 5JDUB 3A8BA 2R3YA 4JYUH 1GBFA 1SGDE 1Z8IB 3TPIZ 1FUJA 2Y7XA 4TY6A 5E2OA 1P9SA 1ETTH 4NSYA 4TY7A 1MCVA 1AKSB 2XW9A 3RXRA 4OS4A 3ZZBA 2HOBA 4K8YA 3EAJA 1G9IE 1DANH 3ODFA 2ANMH 1HAXB 1GPZA 4INKA 2GGVB 3GYLB 4FETA 2YNBA 3GY6A 1OP0A 1PPFE 1GCTB 3UREA 4X1QU 1OWDA 4CH8B 4UDWH 4SGAE 2BOHB 3SORA 2OCVB 2WPKS 1V3XA 1LDTT 1O5BB 1UVOA 1C1VH 2FXRA 1SQTA 4B6FA 4AG2A 2P3TB 3BF6H 1DSTA 1DM4B 3RMOH 2BVXH 5I25A 1G3EA 3M35A 2P59A 2GP9B 4UFEH 1ABIH 3A7VA 4GCHG 3OTJE 1YPMH 1C2HA 3D23A 1KXDA 3BTTE 5FX5A 4DGJA 1EB2A 1K1PA 2QYIA 2P95A 7ESTE 1WYKA 1G3DA 1K1LA 1C5OH 1PQAA 1HAVB 3ELAH 3EQ0H 3GCHC 3PO1C 3RXOA 1P3EA 4B75A 1UHBB 1BMNH 2Y7ZA 1F5RA 1EPTC 1Y5BT 3PRBA 1MQ5A 2A2QH 4JZEH 2J98B 1BRAA 3F0OA 4YT7H 3SNCA 5KECA 4Z0KA 2XOKD 3MH7A 4DIIH 3RXCA 3UY9A 2FESH 1RGQA 1AU8A 2WSSD 5GPIB 1V2QT 3DA9B 1Z6JH 4TT3D 1HRTH 1W0ZU 1ZTJA 4CRCA 3LH1A 1TQ0B 2GT8A 2BD4A 1AFQB 3PLPA 3PTBA 4K3JA 1ELFA 1DFPA 4OGYA 3TVJB 3F3BA 3I29A 3PV4A 2BDAA 1D6RA 2FODA 1VZQH 3MQKC 1QQUA 2ZDKA 3U8OH 2WPDD 2ZGHA 3NKKA 4H4FA 1M9UA 4ZAEA 1P2JA 4R0IA 3BG4C 3M61U 3RMNH 5EW1H 1A7SA 2GVFA 2QV1A 2G52A 2R0KA 1Y5UT 3BTQE 1XXFA 1AZZA 1IQJA 1MAYA 2YOLA 1HFDA 1TPPA 2I6QA 2WHXA 1C4Y2 3SU5A 1TQ7B 3MWIU 1LVYA 1Z8GA 2QGRA 4XE4A 3FZDA 3LGTA 1C2GA 1QA7A 1GMDF 1PQ5A 4YLQH 1RIWC 3GISB 1FXYA 2HPPH 1MTWA 2VVCA 2WPIS 3CP7A 3S0NA 2GCHF 1JRTA 4H6SB 5FAHA 3DCLA 1C2MA 3ZV8A 5FCKA 1XUKA 3VB4A 3Q3YA 2VWOA 4RSPA 4CRGA 2FOAA 1J9CH 2A4OA 2IPQX 4D7GA 2PGQB 1GGDB 5T6GA 1IHSH 4MPWA 2C93B 1PPZA 3Q00A 2WYJA 4MDSA 4MTBA 1YPHE 3P8OA 2F4LA 3PV2A 3QWCH 1TNKA 4XRNA 4YM9A 3F0PA 3MHWU 5F8XA 2GMTB 1C1QA 2G55A 1DX5M 1MQ6A 1FV9A 5FHTA 1CGIE 1YPHC 1GBAA 2B0FA 1L4DA 1LPZB 2ZGCA 5FX6A 3IITA 4YT6H 2Z9JA 1LTOA 2NU1E 2O9QA 3SYJA 5GIBA 4RT1A 2WUCA 4KP0A 4MPXA 4Y8XA 3F2GA 1GMHF 1SC8U 3TNSA 2BDBA 1P57B 1KXFA 2W26A 5DGJA 3IG6B 2VWMA 1B0EA 2STBE 5F03A 1B5GH 1BTWA 1FQ3A 1K21H 1V2MT 3S9AA 3U8TH 3V13A 1GL1A 4I7YH 1UK2A 1ANCA 3RXTA 5FBEA 3ZZ9A 1A4WH 1QRXA 2EEKA 1NM6A 4ACAA 2BD7A 1TMUH 1NS3A 3RC4A 3SNAA 1HAYB 2HALA 1L1GA 3KL6A 1IOEA 1C1PA 1O2ZA 1ZYOA 2ANKH 1GI1A 1HNEE 2FTLE 3SGAE 4H42U 4FXGH 1BJUA 1RTKA 2SGDE 2V3MA 4CREA 3H5CB 4NSVA 2FZZA 3BEFB 3BEUA 2JJ1D 1NU9A 4X6PA 1P02A 1TFXA 3CNRA 4J2YB 5C94A 3LGYA 1YP9A 1P0SH 3A7YA 4JZIA 2ZO3H 3MH4A 1BTYA 7LPRA 2WPJS 2G8TA 9ESTA 1TBZH 4RKJB 3ZVDA 1O3AA 2JH0D 2OQ5A 4XSKU 4B76A 3P6ZB 4FU7A 1CBWB 1E37B 3ZZ8A 3RXFA 2OTVA 1FY3A 2ZPQA 1QB6A 2ZF0H 2ZHDA 3V0XA 1LHGH 3ZYEA 2BZ6H 4MG3A 3T2NA 4E05H 2AGGX 4FUCA 2FEQH 1YPJH 1HLTH 1O2IA 4FUDA 2F83A 1NRRH 1INCA 1EOLA 1GCTC 2GCTB 1H8IH 5EIYA 1ZPZA 1O39A 3MNCA 4ABBA 1DOJA 2VU8E 1P04A 1N6YA 3KYFA 2F43B 4XBCA 1DY9A 2BXUH 3UNRA 1GDNA 1TIOA 3NCLA 3MH6A 7KMEH 4HTCH 4X6OA 5LH8A 5J4SA 1MD8A 5GJ4B 3FP8E 1WTGH 3SU2A 2XRCA 1OWJA 4ZKOU 1QJ6B 4MNYA 3LKWA 4NZQA 4XBDA 1GBTA 4AFZA 1DWDH 3MU8A 1GBCA 2FI5E 4P00A 2KAIB 4WJG2 5C1UA 1K9OE 1HDTH 1KYNA 3I78A 2BLOA 1ZJKA 3ATIA 2WPLS 1A0LA 3M3SA 3FAOA 1QFKH 5ESTE 1ELBA 4E7RG 3BIUH 2ILNA 3OU0A 4WMDA 1O3FA 1ZHRA 4PROA 1O3EA 1GI5A 5E2PA 1QQ4A 1SBWA 2XC0A 4FUIA 3SJOA 3ZZ6A 1DWBH 2Y80A 2FOCA 2I6SA 2XYAA 2ZG0H 2BLVA 1MKWK 3UB0A 1GHAG 3U69H 1YCPK 2Z6BD 2QF4A 1ELDE 3ATKA 1NROH 2V7QD 5L2ZH 3W95A 1O36A 2VIPA 3GCNA 3MO9A 1ACBE 2V0BA 2CN0H 1CE5A 1COWD 1ZGVA 1UTJA 2A31A 5ESBA 1AFQC 1AI8H 3PWCA 3BTME 3QLPH 4VGCB 1FAKH 4NG9H 2ZNKH 1GBJA 2ZU5A 1W0KD 2BDIA 4U2WA 5DP4A 1GMDG 2XNDD 1KDQA 1MBMA 3RLYH 5DG6A 3RXAA 1QTFA 3URDA 3UWIA 2KCPA 3WY8A 2VWLA 4O03A 4NIXA 2ZDVH 4BANB 1O3HA 3A7ZA 3TGKE 2GCHG 4K2YA 5K0HA 4K1EA 4GAWA 3AK5A 2K8IA 5DP3A 2EQNA 5CHAC 3RP2A 1WAYB 5GWZA 4K69A 2H1UA 1CHOF 1XXDA 4ASHA 2RDEA 2PHBA 3BTWE 5E0JA 2PW8H 1C5SA 3A84A 4WMEA 1QNJA 1CA0B 1NO9H 3W1EA 3PRDA 4ZHLU 1QR3E 5EOKA 1Z8JB 1TNJA 2ZQ1A 3EA7A 4NA9H 1UCYH 5AVDA 3MH5A 1EZUC 2C90B 4DJZB 1A0HB 1V6DA 1AN1E 4U32A 5ETXA 1Z1IA 1ZSKA 5LPRA 1GMHG 1AE8H 3U1IB 3SU1A 6CHAB 1WXRA 1HB0B 1GGDC 2KM0A 3TITA 3MFJA 4D9RA 2Q6FA 1T8NA 2O8LA 1K1MA 5EXMA 1ID5H 1TALA 1UO6A 1W0YH 2GMTC 3RMLH 1UMAH 1AD8H 1PQ7A 3STJA 4TPIZ 3UUZA 1F5LA 1ZZZA 4GCHF 1FJSA 4MPUA 1OWHA 1A2CH 2LNCA 8ESTE 4B2AA 1FN6A 1UTNA 1O3NA 3UPEA 4IBLH 3LOXA 3MNXA 1RTLA 4ASUD 4I8HA 1C5XB 3KIDU 2XCFA 2G5VA 2ZEBA 1HUTH 1GI8B 3AVZA 4IMQA 1HJ9A 1GL0E 5EXLA 3KYGA 5EPYA 3GY2A 2VVVA 3SOSA 1O33A 2P16A 1SGFG 3A81A 1ANDA 1HYLA 3SNEA 4O3UA 1XUFA 4INHA 3RXIA 2SGFE 3V3MA 4X1PU 2XBVA 4YOGA 3MO3A 1MKWH 1KLIH 1O2NA 1YCPH 4D7FA 2OLGA 2O8UA 2BTCE 5DP9A 4B2CA 3OX7U 1F7ZA 2XBWA 2W7UA 5TCAA 1ZSLA 1VGCB 1WV7H 2VB0A 2Z9GA 4U01A 2BD9A 5HGGA 2QF5A 2VINA 2ASUB 1SGFA 4Y71A 1EP6A 1GBHA 1IAUA 3AAVA 1GI6A 4UFGH 2IJD1 1QBNA 1EJMA 1S6HA 1O3KA 1O34A 4NIYA 2KX4A 4I33A 3FKSD 3OTPA 1P2OA 4K1SA 4CRDA 2WV5A 1MD7A 1EP5A 2BYAX 1EKBB 5EODA 3ZZDA 1OWEA 3EA8A 3S7HB 4WY3A 3SQEE 1H9HE 1S6FA 3HPTB 1GMCF 2ANYA 1CT0E 2Z9LA 2EI6A 1TRNA 3UNSA 1DWEH 1KXEA 4UONA 1MTNB 1OKXA 1IQIA 3ATWA 3TJOA 5E0GA 2XC5A 1QJ7B 1PPEE 1J14A 1SGNE 1P2KA 2B7DH 3M5OA 1WQVH 4BAKB 1SGCA 1CHGA 2GT7A 2R9PA 1WQSA 4BAOB 1FIZA 3WW7A 1UTOA 4IC5A 1HV7A 4OS7A 3M5MA 4X2XA 3QZQA 1C2FA 1ELGA 3VGCB 3AASA 4XFQA 2Y81A 2J34A 2PFEA 3NUMA 2A45B 3MTYA 3ZYDA 5HM2A 1SOZA 2LELA 1C1SA 1EAWA 3KQBA 1OXGA 4H6TA 1TRYA 1SI5H 2A5KA 2ODQA 4J1YA 1J16A 1TGBA 3UR6A 4A1XA 1V2ST 1NESE 2TGDA 1H1BA 4X2VA 1KY9A 2EY4C 2HRVA 4ABJA 4TSFD 4F49A 5C0UA 3HKJB 1LKAA 4Y0ZE 3GDSA 3BV9B 3ZZ7A 3RXEA 3CS0A 3ODDA 2GDDA 3UIRA 1O2PA 1ANEA 4AC9A 4Y76A 2SGQE 2ZKSA 2SFAA 1TONA 1C2IA 8LPRA 1YYY1 2GKVE 1QL7A 4Q7YA 1YPGH 3B8JA 2AGEX 1SGYE 1EJAA 1O37A 3SN8A 1ELVA 1THRH 4D76A 2B5TB 2O8WA 1O3JA 2BLQA 1Y3UA 1Y3WA 4X8UH 3PLBA 2ZU1A 3V7TA 4AORA 1PPBH 1C5QA 1ZGIA 1FMGA 1O2HA 1EZSC 1L2EA 2TRMA 5GDSH 1QGFA 3S9CA 1HAGE 1C5RA 2CF8H 5F8TA 4DCDA 4MNVA 1BMAA 1CHOG 1AKSA 1ETRH 3MU4A 3EA9A 4VGCC 1HCGA 1UTQA 2PP6A 1TPAE 3LJJA 4HFPB 3A8AA 2H5DA 5AFYH 4YTAA 1BHXB 4NA7A 1D3DB 6GCHF 2BDHA 2CHAB 3ESTA 4BAQB 3BN9A 1MU8B 3DSPA 1GJAB 1YC0A 4X6MA 5DJ7A 1P03A 1BIOA 1RTFB 2FMJA 2AEIH 2D2DA 2AIQA 4OS1A 1NBMD 1KIGH 2UUYA 3PMAB 4B2BA 1CA0C 3RXLA 2FDAA 3R0FA 3O8RA 1FDPA 1QB9A 2VIWA 1SLVB 3DFJA 2OUAA 2VH0A 3VXFH 2H5CA 2ZECA 1SHYA 3IWMA 1AWFH 5C5OA 4ZXYH 3WWFA 2A7HA 1MTUA 3B23B 2GX4A 3LH3A 2XCNA 1TBRH 4AN7A 3U8RH 1BMMH 1L0ZA 2IPHA 2QCYA 1W11U 1SGRE 1TLDA 1KTTB 1SFIA 2FP7B 3K6YA 4K8BA 1HAVA 1A46H 2H6MA 3GY3A 1UHBA 3RM0H 1Y5AT 5ABWA 3QGNB 3QTVH 2J98A 3LGIA 1K1NA 3R3GB 2ODYB 2F9OA 1YLDA 1FX0B 2R0LA 3TH3H 3RXJA 5C1XA 3M3TA 1TOMH 1SVPA 4X1RU 2ZCKP 4YOJA 5AHGH 2OC7A 4GHTA 4KELA 3QDZB 4OS5A 3WWBA 1O5AB 3MYWA 5C3NA 1IQEA 1GI0A 1H9LB 2JH6D 2VGCC 3ZV9A 1JIMA 2TIOA 2J9NA 3DFLA 1E36B 1FY5A 4FUHA 2AS9A 2V6NA 4YLUA 1ZMLA 1W8BH 1Y8TA 1V2VT 1RRKA 1T4UH 1AO5A 2BQWB 4CRBA 1K0HA 2W6ID 1C5UA 3D49H 3P17H 4I8JA 1P11E 1ELEE 5EQQA 3NK8A 3JZ1B 4Y10E 1C1MA 3UNQA 1O35A 1HAZB 1S83A 3M36A 3RC6A 4ESTE 3F9HA 3SUFA 3SI4H 1GHAF 3AAUA 2QAAA 4X0WU 2BHGA 1GHZA 2JIZD 5EGMA 2K1QA 4AZ2B 3TNTA 3BTDE 2ZPRA 5HKKD 1VGCC 2ZHWH 1YPEH 2ZTZA 3L33A 1FI8A 2HLCA 3ZVEA 3KNXA 1SQRA 3RUOA 3M5NA 2F9BH 4CHAB 3A80A 1GMCG 3DSGA 2PWXA 4NA8A 1QL8A 1OOKB 4ABIA 1ANBA 3M7UA 2BOKA 5LGOA 3EGKH 1G37A 4FUBA 1PYTC 2ZU3A 5JBCS 1BBRE 2KCAA 2IJOB 3A85A 1O2WA 2WV4A 2A2XH 1MTVA 4JZDH 2YMSC 1DXPA 3FN8A 4ISLA 4DG4A 4ZH8A 2FX6A 5EXNA 4X1SU 4WVPE 4HG6A 1BT7A 1OPHB 3PWBA 3QTOH 3SNBA 3LDXH 1C2KA 3MI4A 3FFGA 2Q6GA 2G5NA 1CSOE 1GDQA 1GG6B 1CT4E 1MKXK 1ZSJA 2PKSB 3RDZA 1BBRK 4TPYA 1MTNC 4NFEA 4YZUA 1T8LA 3SU6A 2Y82A 1V2PT 1NBME 1E34B 1UTPA 1SL3A 3ITIA 1LQDB 1H8ED 7GCHF 3LJOA 3TU7H 2G81E 2RA3A 1X7AC 3F2HA 4FUFA 3T5FH 1J15A 3RLWH 2BY7X 4MLFB 2IOTA 1C1OA 2QXIA 2ZPSA 4MNXA 3TH2H 3MNSA 3VGCC 1A0JA 4MNWA 2RFKC 2V35A 3VFEA 3PROA 1TBQH 5JYIA 2ZCHP 2AIPA 4UE7H 5A0AE 3E0NB 1EB1H 2VJ1A 1ARCA 2Y6TA 3KHVA 1A5GH 4Y8ZA 1OP8A 1BRUP 4OM9A 2W6JD 4B74A 4I8GA 2BB4A 1VITH 2JKHA 4K60A 2HGTH 1EFRD 5KEDA 3RXHA 2WUBA 4Y0YE 1P06A 1GBDA 1V2WT 1P9UA 1GHBG 3S69A 2GV7A 3ZZ3A 1QBVH 1CU1A 2BQ7B 1TA2A 2Z9KA 2ZFTA 3UQVA 2M5TA 4ACBA 3SUGA 1S82A 4I86A 1XUGA 1BA8B 2CMYA 2J97A 5E8EH 3L6PA 6GCHG 1OYTH 1VJ9U 3NPSA 4BTIB 1AB9B 4WXIA 1KXAA 1OWIA 1NPMA 2C4FH 2BLWA 2ZI2H 4I8KA 4YOIA 2V3OH 3LC5A 4OGXA 2OK5A 3MMGA 5H4IB 3ZZ4A 3OY5U 3P8NA 1UTMA 4AYVB 5JB9S 5HIZA 4UD9H 1YWUA 1ZHMA 3A8DA 1O3LA 1O2JA 5DK1A 1GI9B 3B9FH 1YPKH 2A7JA 3ENSB 2F9VA 3CENA 3ZZAA 1E0FD 3U1JB 4IGDA 4M9FA 2FPZA 2XTTB 4ZROA 5DKMA 5DP5A 1THSH 2R3UA 2J2UA 5F53A 1XUIA 1SFQB 1O2GH 2PUQH 3O8CA 1W14U 2ZHFH 1SR5C 2NU4E 3F6UH 1TAWA 1LVMA 3FP6E 1TPOA 5EG4A 2FOGA 3OSYA 3S9BA 2F9PA 1GI4A 1EOJA 1MTSA 3VB7A 5EJ1A 4DT4A 3W94A 3O8DA 3VB5A 1TGTA 1GCDA 3FANA 3SGBE 3MOCA 1S6LA 2FOMB 4E06H 4FUEA 4XBBA 1O3BA 3VPKA 1NY22 1SGTA 1C5TA 2XWAA 1TX8A 2KAIA 1ZOMA 5A8YA 1NFYA 3RXGA 1F0UA 1SMFE 1DLEA 3LGVA 4BNRA 1O5DH 1F0TA 2B9LA 2VNTA 1C1RA 2Y5FA 5FL7D 3SHCH 2FYQA 1IQNA 1P2MA 5T6DA 1LMWB 2GJGA 4Z1MD 1RS0A 3K9XB 3L3TA 5IDKA 5L2YH 2FTMA 3OEED 3T27A 4FU8A 2XBXA 4X8VH 3LIWA 4Y7BA 3TIUA 1TA6A 3P8FA 3E0PB 2K0QA 1DITH 1A3BH 2H9EH 1C4U2 2FOBA 5A8ZA 3TLOA 3BTHE 3TJUA 3VEQB 2QIQA 4SGBE 3UOUA 3LPRA 2RCEA 1AIXH 1UVSH 2A5AA 3GOVB 1DT2A 4A5TS 1XMNB 2OXSA 2P93A 3VB6A 1GJ5H 2FLBH 4B71A 1BTXA 3JZ2B 1LVBA 3SW2B 4IW4E 5L30H 2TGPZ 1GJ7B 1KLJH 3N7EA 3E90B 3RXPA 4BTTB 4CBOA 2FOHA 4CRFA 2QXGA 1FNIA 3SU3A 4M7GA 2VBCA 1OP2A 4ABGA 4ISIH 2ZGJA 2H9TH 1O2YA 1NZQH 1Z7KA 2ZP0H 2G4TA 4NCYA 1HBTH 3KQCA 1BHXF 1GJ9B 2BD2A 2G51A 1UTKA 1MZAA 1O31A 1AUJA 1XUJA 1F0SA 3P95A 1NTPA 3OEHD 2C8XB 4Y11E 1TGCA 1SLUB 4CHAC 4JK5A 1E79D 2JH5D 2OBOA 1GJCB 2ANWA 1TOCB 4Q7XA 2QE7D 4FOUC 3P8GA 3SJ8A 1J8AA 1O3PB 1GHWH 3GY4A 1IQKA 2R2MB 4IN2A 3T26A 1G2LA 2HNTE 1A5HA 1C4V2 7GCHG 1IHTH 2TGTA 3LGWA 4YESB 1NN6A 3FOAA 2ALVA 3GY5A 4JYVH 3CS7A 9LPRA 2HNTC 2W3KA 2ZFSA 2ZWLH 5C20A 4ABDA 2PKAB 1QURH 5SGAE 1WU1A 2BY9X 1AQ7A 1ZPBA 1V2TT 2P3FH 4CR5A 4NFFA 2J38A 5AF9H 1W10U 1O5CB 1A61H 1Q31A 1O0DH 2BX3A 4UEHH 4TWWA 3BSQA 1C1TA 3RXDA 2C3SA 2ZTYA 5FPTA 3RXVA 2ZCLP 1EATA 3F9EA 1XVOA 3E3TA 3PM3A 1ESTA 3GCHB 1NFUA 3PO1B 1YF4A 1MH0A 1P05A 1QA0A 1EPTB 1ZLRA 1C5NH 2BXTH 2JDID 3M37A 1IQHA 5A0CA 2Z3DA 1TNHA 2OD3B 4WMFA 3SU0A 4O3TA 1Y59T 4JCNA 3ATMA 5C1YA 5J4QA 1HXEH 2BDGA 1JWTA 1D3QB 1DSUA 3GCTG 1B0FA 1HGTH 1BRBE 2ZGBH 4NWLA 2GD4B 3RU4E 2RDLA 3SV7A 1G36A 2PR3A 5K7RA 4XDEA 4P02A 2OBQA 1K28D 2DE8A 5C2ZA 1TB6H 2OC1A 1GVZA 2CF9H 2AYWA 1T7CA 4DURA 2Z7FE 1L4ZA 1O5GH 1K2I1 2G4UA 1TWXB 1GDUA 2CXVA 3UWJH 2PV9B 1TMBH 2FI3E 3GY8A 2HWLB 3STIA 5FCRA 1V2UT 1P2NA 1P8VC 1SG8B 2J94A 2CJIA 3M5LA 2D8WA 2FYRA 3OFND 3PYHA 5FXLA 3RXBA 3SV2H 2GDEH 1P2IA 3DT0H 3MU1A 4JYTA 5F6MA 4Q80A 2AFQB 2WPHS 3LU9B 2ZFFH 4K1TA 2KZ4A 2TGAA 1W0JD 1OHHD 1YCPM 2BDCA 1CBWC 1NT1A 4Q63A 1MABB 3TK6A 5TCCA 4X6NA 1DDJA 4Q7ZA 1BB0B 2AMDA 2HNTF 1Q2WA 4ZMAH 2A32A 1C1UH 5L6NH 2ZDNA 1LHEH 5DSFA 1A5IA 4JZ1A 2Z9IA 2IN2A 1HIAB 2GCTC 1YLCA 2FLRH 4Y7AA 3U98H 4A92A 2D26C 2JJ2D 1HIAA 3ZVFA 4AGKA 1ORFA 2P3UB 4KKDA 2NU3E 4NIVA 2A7CA 3KN2A 4AFSA 1BTUA 2BY5X 2GZ7A 1AHTH 2F91A 3QN7A 2C8WB 1ZJDA 1E1QD 4D8NA 3AW0A 1VCPA 1GJDB 5A2MH 2WPMS 4Z6AH 1FIWA 1NFXA 1RFNA 5DO4H 4Y79A 4U30A 1AZ8A 1FPCH 1QL9A 1VJAU 2LPRA 3M3VA 2ZDMA 5A0BA 1HAIH 3OAAD 1O2VA 1PJPA 2Y5GA 2LP6A 3NRLA 2BVSH 5EU8A 3A83A 2FO9A 2ULLA 4X2WA 2OC8A 1BZXE 4ZCNA 1EUFA 3SJ9A 4A1VA 2XXLA 4GPGA 2UUJB 1C2JA 2CK3D 1PPCE 4NGAH 3VG8A 1IQFA 5C5NA 4I8LA 3SV9A 2F9UA 3H7OA 1DLKB 4E7NA 3RXMA 1W13U 2A1DB 1GVLA 6LPRA 1PPHE 4INLA 4RKOB 1ZTLA 4UFDH 4AB8A 2VIOA 3MO6A 1C5WB 2B8OH 4X8TH 4BAHB 5LPEA 3ATLA 4RT0A 1L1JA 2TPIZ 2A0QB 1TNIA 1OYQA 1PYTD 1D9IA 4X8SH 2Q1JA 1GHBF 2QN5T 2THFB 1KXBA 2QF3A 4YO9A 3P92A 1A1RA 5FPYA 3A82A 1SOTA 1T31A 3V12A 2YMSD 3BTEE 2ZDAH 3A8CA 1O3OA 5T1VA 5EQSA 1LKBA 3ZVGA 4TYDA 1K1JA 2BDYA 1FY1A 1QJ1B 3HK6B 1EASA 2QXJA 5AFZH 1E35B 5EQRA 1UTLM 5EJLA 1LPGB 3SZEA 3T25A 2UWPA 4AFUA 4KTUA 2QA9E 3QX5H 4LK4A 1DE7H 1LHDH 1G30B 2SNVA 3KCGH 1LCYA 3EDXB 2H2ZA 2PTNA 1QBOA 1AVWA 1P01A 2FIRH 4GHQA 4Q4LA 2GZ8A 5C17A 2EA3A 1Z8RA 6ESTA 1CA8B 1AMHA 1PPGE 6CHAC 1CT2E 1C5VA 4AB9A 4MVNA 1Y3XA 2ODPA 4GVUA 1JBUH 1DY8A 8KME2 3NWUA 1O3IA 1YPLH 3TJNA 1BCUH 3M7QA 4MPVA 1OWKA 2W7SA 3SJIA 3SHAH 5JBTA 1QRZA 1IQLA 3SUEA 2W3IA 3PMBB 1SQAA 3GYMA 3AW1A 4ZHAA 2XNIA 1VCWA 1DUAA 1QCPA 3N7DA 1NRPH 3MU5A 1SGQE 1GBBA 1XKAC 1T8MA 2QXHA 1S5SA 1MUEB 4GUXA 3OY6U 1BTHH 1IQGA 3K6ZA 2ZDLA 3SUDA 1FONA 2DE9A 1NRSH 1H9IE 1D3TB 1Q3XA 5DPAA 1GBEA 3E6PH 4GLYA 4F48B 1TYNA 1L1NA 1F5KU 1O3GA 3F9GA 1C2LA 2AGIX 4B1TA 1FY4A 5B6LA 1FN8A 4FVDA 1NFWA 2BD3A 4ABAA 2CGAA 1G2MA 3Q76A 1MU6B 3G01A 2H9HA 2Z94A 3C1KA 2ZTXA 1AUTC 1HXFH 5HXFA 1KLTA 2FS8A 2BQ6B 1DICA 2W5EA 1UVTH 1VKYA 3T29A 1GI3A 1RJXB 4F55A 4BTUB 1QRWA 1OS8A 1W7GH 1HAOH 1CVWH 3UAIC 1ZRBA 3EE0B 3TH4H 3ZVBA 3BTKE 1GHVH 3UTUH 2O8MA 2KCOA 5B6OA 2VIVA 4DIHH 2Z3CA 1V2LT 1WCZA 5EPNA 3RXQA 4R8TB 1AGJA 3URCA 1Y3YA 1AFEH 2F3CE 3H09A 3HATH 4NIWA 2JETB 1YGCH 5A09A 3T62A 5CHAB 1P10A 1AVGH 1IQMA 5GCHF 3QGJA 1D3PB 1KSNA 1C2EA 2GV6A 1SB1H 5BPEA 1T32A 2AMQA 4O9VA 2HVYB 1O2XA 1U6QA 2XC4A 1HJAB 4NZLA 1N8OB 1TX7A 4IS5A 1AWHB 1ZR0A 3SV8A 1TPSA 1D6WA 2ZU4A 3ZZ5A 4JZFH 3H7TA 1O32A 3HGNA 1MCTA 4F4OC 1UVPA 1QZ8A 3A89A 3DD2H 2ZU2A 1O2SA 1JRSA 1ZRKA 2VWNA 1P12E 2QF0A 1DUEA 4CRAA 3RMMH 3ZVCA 3A7WA 1H8HD 2VH6A 2O8TA 2P8OB 1VITF 1GBKA 4QT8C 1MBQA 2V3HH 2QC2A 5HIYA 3U9AH 4WF8A 4MQAA 1ETSH 1S81A 1HAHH 2FI4E 1C9PA 1VCQA 2A4QA 3QUMP 3SO3A 5C0TA 3HK3B 5JB8S 1A3EH 3N7OA 5LPFA 5JBBS 1D4PB 3PV5A 1JMOH 1K1IA 2ZHQH 1TX6A 2NWNA 2SNWA 4ZUHA 2SGAA 3KF2A 3GCTF 1O2KA 1V2OT 1W12U 1GJ6A 2Q6DA 3A87A 4AGJA 1FAXA 4ISHH 5A8XA 3RU4T 3SV6A 3SNDA 4FVBA 1EZXC 5GNDA 1AE5A 1V2NT 5DP8A 4AYYB 4GSOA 4ABHA 2VVUA 2ZHEH 3A7TA 4XOJA 4CBNA 3PMJA 3F1SB 3PB1E 1DVAH 2NU0E 1O2UA 4ISOA 5F8ZA 3DHKH 2FOEA 2GTBA 2KCYA 2P94A 2WV9A 3I77A 1ELCA 4X1NU 3KEEA 1TE0A 2BD8A 4KTSA 4DOQA 2Y5HA 3PTNA 2DUCA 4KTCA 1SHHB 2ZGXH 1TGSZ 5CDFE 1CGJE 3LONA 1XKBC 4RI0A 1QY6A 1ZPCA 2M2AA 2CV3A 1UCYE 2CHAC 3EE7A 3RC5A 3SBKA
chains in the Genus database with same CATH topology
1PFXC 1O30A 2OINA 4JK6A 4JMYA 1QIXB 3RXSA 2PGBB 1FPHH 1V2JT 1EQ9A 5HMAA 3F68H 4X2YA 4ZKSU 1N1LA 1UCYK 2UWOA 1QHRB 3BEIB 1C5YB 1KXCA 3TK9A 1MKXH 1W2KH 3T28A 1WBGB 1BBRH 2A4GA 3GY7A 1T4VH 3EYDA 1TNLA 3HKIB 1F92A 5FBIA 1K1OA 1LPKB 2VIQA 3LGUA 3QK1A 1TRMA 4FUJA 3RXKA 1YKTA 1ZTKA 3RU4D 2ZC9H 1BMLA 4RN6A 2BY6X 1ELAA 1G32B 1HPGA 2EC9H 3KQDA 1ZHPA 1EX3A 1GI2A 5TJXA 5CE1A 1XM1A 2EI8A 5CMXH 4HZHA 4AOQA 3VB3A 4TWYA 3A86A 1BOQA 3O8BA 4A6LA 1LO6A 1C1WH 1F2SE 1WOFA 3GDVA 2PTCE 1O2RA 2YNAA 5DP7A 2QY0B 1JIRA 4BOHA 4B73A 2J4IA 4I31A 1XX9A 2NU2E 1SLXB 2ZFQH 1EZQA 2VIDA 5FPSA 1C9TA 8GCHF 1MMJN 3BG8A 3LT3A 4ABFA 3Q3KA 4LOYH 4IN1A 1ARBA 3S7KB 1EJNA 3UQOA 1AVXA 1S85A 3MU0A 1MAXA 2C8ZB 1BQYA 1JOUB 1Y3VA 3K65B 2BZAA 2R2WU 3FVFB 4HGCA 1P09A 2F9NA 1T8OA 2UUKB 2STAE 1B7XB 4ZKNU 5G4BA 4AX9H 5GCHG 3SZNA 1NC6A 1RD3B 2A4RA 3D62A 1QB1A 4DY7B 1Z71A 2FX4A 2TBSA 3E8LA 1KDQB 1BDAA 1UK4A 2AMPA 4NWKA 1WSSH 2ZA5A 3SI3H 4I32A 1FLEE 1DPOA 3PLKA 5PTPA 3UR9A 4FU9A 3SJKA 3ZZCA 2JETC 2BM2A 3E1XB 4UFFH 2PUXB 1GWAA 1TGNA 1YM0A 2J95A 1SGEE 2G00A 1GBLA 1LHFH 1NRNH 3QO6A 3TGIE 5HM9A 1O38A 2PKAA 4FUGA 4AG1A 1HJAC 1SGIB 1GG6C 1N8OC 3BTFE 1VITG 2PKSC 2HVXA 4AFQA 1P2QA 4WXVA 4A1TA 4DVAU 4CR9A 4THNH 1CO7E 2D1JA 1BJVA 1C1NA 2RA0A 3F9FA 1GBIA 3NXPA 5JPMH 3E91A 4LZ4B 1BITA 3D65E 3VXEH 4WH8A 4ABEA 1O5EH 1EPTA 1CGHA 1GJ4H 1ABJH 4IC6A 1DS2E 2BY8X 3KGPA 1XUHA 1Z1JA 1BTZA 2P8OC 3NZIA 1C5MD 3E16B 2EI7A 1EXFA 1ZMNA 4ZHMU 4Q2KA 3HGPA 2ZFPH 1LVOA 4DT7B 2ZZUH 1UJ1A 1O3CA 1SGPE 5E0HA 1XVMA 4OS2A 2XBYA 2UUFB 2WYGA 1H4WA 1THPB 1YBWA 2VGCB 1RXPA 4ZKRU 3GICB 5JBAS 4CH2B 3K2UA 3FP7E 4Y8YA 4ISNA 3RXUA 3A7XA 2ALPA 1UK3A 1UVUH 2OC0A 3M7TA 3BTGE 3RM2H 5C67A 1GJBB 1E38B 1VR1H 4BXWA 2WINI 3UFAA 1NU7B 2BVRH 3BG4B 1G3BA 2FWWA 5HYOA 4D9QA 1AB9C 1BRCE 1W7XH 2FS9A 1HAPH 1F0RA 4ZXXH 1LHCH 2PLXA 1JXPA 1V2RT 4BAMB 3Q3XA 3Q77A 3PMHB 3SQHE 1GHXH 2ZIQH 1TNGA 3P70B 4A7IB 1GHYH 1K22H 2FOFA 3TK5A 1NRQH 1GI7B 2ZQ2A 1RIWB 1TMTH 5GXPA 2HPQH 1FY8E 1J17T 2BD5A 4WH6A 1C5LH 4K5ZA 3ZVAA 3TJVA 1Z6EA 4BXSA 2A5IA 1ELTA 1P3CA 2Z3EA 3QZRA 1EAIA 4Y6DA 1S0RA 1WTHD 1SSXA 2ESTE 1OX1A 4LXBH 4OS6A 4LZ1H 1H8DH 5DP6A 1O3DA 1GBMA 5I46H 2AERH 2BX4A 3MNBA 3A88A 1AY6H 3KQEA 1GVKB 1O2OA 1V2KT 5T6FA 5BRRE 3GCOA 1O3MA 1O2QA 1SLWB 1OSSA 2SGEE 1S0QA 5T3HA 1BUIA 1O2LA 1O2MA 3FZZA 2OP9A 2XWBI 2RG3A 4HI3A 3UOPA 2ZFRH 1WUNH 2AH4X 1MZDA 1CQQA 2GZ9A 3TGJE 1GJ8B 3SGQE 1W3CA 8GCHG 5EW2H 5IYTA 1DWCH 1KTSB 4IMZA 2BMGB 1ZMJA 1C5ZB 3BIVH 2J92A 1SQOA 1S84A 2C8YB 2OQUA 2SGPE 1EAUA 3DUXH 2PSXA 1HJ8A 1G3CA 2FM2A 1PQ8A 3GDUA 1DXWA 4O97A 3OYPA 1SPJA 1ESBA 4DW2U 1LQEA 1N6XA 1O2TA 1C2DA 1O5FH 3LC3A 3C27B 1BTPA 1FZZA 1ESAA 1TABE 2PSYA 3SU4A 4KGAA 1EAXA 4WWYA 2UWLA 1C5PA 5JDUB 3A8BA 2R3YA 4JYUH 1GBFA 1SGDE 1Z8IB 3TPIZ 1FUJA 2Y7XA 4TY6A 5E2OA 1P9SA 1ETTH 4NSYA 4TY7A 1MCVA 1AKSB 2XW9A 3RXRA 4OS4A 3ZZBA 2HOBA 4K8YA 3EAJA 1G9IE 1DANH 3ODFA 2ANMH 1HAXB 1GPZA 4INKA 2GGVB 3GYLB 2YNBA 3GY6A 1OP0A 1PPFE 1GCTB 3UREA 4X1QU 1OWDA 4CH8B 4UDWH 4SGAE 2BOHB 3SORA 2OCVB 2WPKS 1V3XA 1LDTT 1O5BB 1UVOA 1C1VH 2FXRA 1SQTA 4AG2A 2P3TB 3BF6H 1DSTA 1DM4B 3RMOH 2BVXH 5I25A 1G3EA 3M35A 2P59A 2GP9B 4UFEH 1ABIH 3A7VA 4GCHG 3OTJE 1YPMH 1C2HA 3D23A 1KXDA 3BTTE 5FX5A 4DGJA 1EB2A 1K1PA 2QYIA 2P95A 7ESTE 1WYKA 1G3DA 1K1LA 1C5OH 1PQAA 1HAVB 3ELAH 3EQ0H 3GCHC 3PO1C 3RXOA 1P3EA 4B75A 1UHBB 1BMNH 2Y7ZA 1F5RA 1EPTC 1Y5BT 1MQ5A 2A2QH 4JZEH 1BRAA 4YT7H 3SNCA 4Z0KA 3MH7A 4DIIH 3RXCA 3UY9A 2FESH 1RGQA 1AU8A 5GPIB 1V2QT 3DA9B 1Z6JH 1HRTH 1W0ZU 1ZTJA 4CRCA 3LH1A 1TQ0B 2GT8A 2BD4A 1AFQB 3PLPA 3PTBA 4K3JA 1ELFA 1DFPA 4OGYA 3TVJB 3I29A 3PV4A 2BDAA 1D6RA 2FODA 1VZQH 1QQUA 2ZDKA 3U8OH 2ZGHA 3NKKA 4H4FA 1M9UA 4ZAEA 1P2JA 4R0IA 3BG4C 3M61U 3RMNH 5EW1H 1A7SA 2GVFA 2QV1A 2G52A 2R0KA 1Y5UT 3BTQE 1XXFA 1AZZA 1IQJA 1MAYA 2YOLA 1HFDA 1TPPA 2I6QA 1C4Y2 3SU5A 1TQ7B 3MWIU 1LVYA 1Z8GA 2QGRA 4XE4A 3FZDA 3LGTA 1C2GA 1QA7A 1GMDF 1PQ5A 4YLQH 1RIWC 3GISB 1FXYA 2HPPH 1MTWA 2VVCA 2WPIS 3CP7A 3S0NA 2GCHF 1JRTA 4H6SB 5FAHA 1C2MA 3ZV8A 5FCKA 1XUKA 3VB4A 3Q3YA 2VWOA 4RSPA 4CRGA 2FOAA 1J9CH 2A4OA 4D7GA 2PGQB 1GGDB 5T6GA 1IHSH 4MPWA 2C93B 1PPZA 3Q00A 2WYJA 4MDSA 4MTBA 1YPHE 3P8OA 3QWCH 1TNKA 4YM9A 3MHWU 5F8XA 2GMTB 1C1QA 2G55A 1DX5M 1MQ6A 1FV9A 5FHTA 1CGIE 1YPHC 1GBAA 2B0FA 1L4DA 1LPZB 2ZGCA 5FX6A 3IITA 4YT6H 2Z9JA 1LTOA 2NU1E 2O9QA 5GIBA 2WUCA 4KP0A 4MPXA 4Y8XA 1GMHF 1SC8U 3TNSA 2BDBA 1P57B 1KXFA 2W26A 5DGJA 3IG6B 2VWMA 1B0EA 2STBE 5F03A 1B5GH 1BTWA 1FQ3A 1K21H 1V2MT 3S9AA 3U8TH 3V13A 1GL1A 4I7YH 1UK2A 1ANCA 3RXTA 5FBEA 3ZZ9A 1A4WH 1QRXA 2EEKA 1NM6A 2BD7A 1TMUH 1NS3A 3RC4A 3SNAA 1HAYB 2HALA 1L1GA 3KL6A 1IOEA 1C1PA 1O2ZA 1ZYOA 2ANKH 1GI1A 1HNEE 2FTLE 3SGAE 4H42U 4FXGH 1BJUA 1RTKA 2SGDE 4CREA 3H5CB 4NSVA 2FZZA 3BEFB 3BEUA 1NU9A 4X6PA 1P02A 1TFXA 4J2YB 3LGYA 1YP9A 1P0SH 3A7YA 4JZIA 2ZO3H 3MH4A 1BTYA 7LPRA 2WPJS 2G8TA 9ESTA 1TBZH 4RKJB 3ZVDA 1O3AA 2OQ5A 2JH0D 4XSKU 4B76A 3P6ZB 4FU7A 1CBWB 1E37B 3ZZ8A 3RXFA 2OTVA 1FY3A 2ZPQA 1QB6A 2ZF0H 2ZHDA 3V0XA 1LHGH 3ZYEA 2BZ6H 4MG3A 3T2NA 4E05H 2AGGX 4FUCA 2FEQH 1YPJH 1HLTH 1O2IA 4FUDA 2F83A 1NRRH 1INCA 1EOLA 1GCTC 2GCTB 1H8IH 1ZPZA 1O39A 3MNCA 4ABBA 1DOJA 2VU8E 1P04A 1N6YA 4XBCA 1DY9A 2BXUH 3UNRA 1GDNA 1TIOA 3NCLA 3MH6A 7KMEH 4HTCH 4X6OA 5LH8A 5J4SA 1MD8A 5GJ4B 3FP8E 1WTGH 3SU2A 2XRCA 1OWJA 4ZKOU 1QJ6B 4MNYA 3LKWA 4NZQA 4XBDA 1GBTA 4AFZA 1DWDH 3MU8A 1GBCA 2FI5E 2KAIB 4WJG2 5C1UA 1K9OE 1HDTH 1KYNA 3I78A 2BLOA 1ZJKA 3ATIA 2WPLS 1A0LA 3M3SA 3FAOA 1QFKH 5ESTE 1ELBA 4E7RG 3BIUH 2ILNA 3OU0A 4WMDA 1O3FA 1ZHRA 4PROA 1O3EA 1GI5A 5E2PA 1QQ4A 1SBWA 2XC0A 4FUIA 3SJOA 3ZZ6A 1DWBH 2Y80A 2FOCA 2I6SA 2XYAA 2ZG0H 2BLVA 1MKWK 1GHAG 3U69H 1YCPK 2Z6BD 3ATKA 1ELDE 1NROH 5L2ZH 3W95A 1O36A 2VIPA 3GCNA 3MO9A 1ACBE 2V0BA 2CN0H 1CE5A 1ZGVA 1UTJA 2A31A 5ESBA 1AFQC 1AI8H 3PWCA 3BTME 3QLPH 4VGCB 1FAKH 4NG9H 2ZNKH 1GBJA 2ZU5A 2BDIA 4U2WA 5DP4A 1GMDG 1KDQA 1MBMA 3RLYH 5DG6A 3RXAA 1QTFA 3URDA 3UWIA 3WY8A 2VWLA 4O03A 4NIXA 2ZDVH 4BANB 1O3HA 3A7ZA 3TGKE 2GCHG 4K2YA 5K0HA 4K1EA 4GAWA 5DP3A 5CHAC 3RP2A 5GWZA 1WAYB 4K69A 2H1UA 1CHOF 1XXDA 4ASHA 2PHBA 3BTWE 5E0JA 2PW8H 1C5SA 3A84A 4WMEA 1QNJA 1CA0B 1NO9H 4ZHLU 1QR3E 5EOKA 1Z8JB 1TNJA 2ZQ1A 3EA7A 4NA9H 1UCYH 5AVDA 3MH5A 1EZUC 2C90B 4DJZB 1A0HB 1V6DA 1AN1E 4U32A 5ETXA 1Z1IA 1ZSKA 5LPRA 1GMHG 1AE8H 3U1IB 3SU1A 6CHAB 1HB0B 1GGDC 3TITA 3MFJA 4D9RA 2Q6FA 1T8NA 2O8LA 1K1MA 5EXMA 1ID5H 1TALA 1UO6A 1W0YH 2GMTC 3RMLH 1UMAH 1AD8H 1PQ7A 3STJA 4TPIZ 3UUZA 1F5LA 1ZZZA 4GCHF 1FJSA 4MPUA 1OWHA 1A2CH 2LNCA 8ESTE 4B2AA 1FN6A 1UTNA 1O3NA 3UPEA 4IBLH 3LOXA 3MNXA 1RTLA 4I8HA 1C5XB 3KIDU 2XCFA 2G5VA 2ZEBA 1HUTH 1GI8B 3AVZA 4IMQA 1HJ9A 1GL0E 5EXLA 5EPYA 3GY2A 2VVVA 3SOSA 1O33A 2P16A 1SGFG 3A81A 1ANDA 1HYLA 3SNEA 4O3UA 1XUFA 4INHA 3RXIA 2SGFE 3V3MA 4X1PU 2XBVA 4YOGA 3MO3A 1MKWH 1KLIH 1O2NA 1YCPH 4D7FA 2OLGA 2O8UA 2BTCE 5DP9A 4B2CA 3OX7U 1F7ZA 2XBWA 2W7UA 5TCAA 1ZSLA 1VGCB 1WV7H 2VB0A 2Z9GA 4U01A 2BD9A 5HGGA 2VINA 2ASUB 1SGFA 4Y71A 1EP6A 1GBHA 1IAUA 3AAVA 1GI6A 4UFGH 1QBNA 1EJMA 1S6HA 1O3KA 1O34A 4NIYA 4I33A 1P2OA 4K1SA 4CRDA 2WV5A 1MD7A 1EP5A 2BYAX 1EKBB 5EODA 3ZZDA 1OWEA 3EA8A 3S7HB 4WY3A 3SQEE 1H9HE 1S6FA 3HPTB 1GMCF 2ANYA 1CT0E 2Z9LA 2EI6A 1TRNA 3UNSA 1DWEH 1KXEA 4UONA 1MTNB 1OKXA 1IQIA 3ATWA 3TJOA 5E0GA 2XC5A 1QJ7B 1PPEE 1J14A 1SGNE 1P2KA 2B7DH 3M5OA 1WQVH 4BAKB 1SGCA 1CHGA 2GT7A 2R9PA 1WQSA 4BAOB 1FIZA 1UTOA 4IC5A 1HV7A 4OS7A 3M5MA 4X2XA 3QZQA 1C2FA 1ELGA 3VGCB 3AASA 4XFQA 2Y81A 2J34A 2PFEA 3NUMA 2A45B 3MTYA 3ZYDA 5HM2A 1SOZA 1C1SA 1EAWA 3KQBA 1OXGA 4H6TA 1TRYA 1SI5H 2A5KA 2ODQA 4J1YA 1J16A 1TGBA 3UR6A 4A1XA 1V2ST 1NESE 2TGDA 1H1BA 4X2VA 1KY9A 2HRVA 4ABJA 4F49A 3HKJB 1LKAA 4Y0ZE 3GDSA 3BV9B 3ZZ7A 3RXEA 3CS0A 3ODDA 2GDDA 3UIRA 1O2PA 1ANEA 4Y76A 2SGQE 2ZKSA 2SFAA 1TONA 1C2IA 8LPRA 1YYY1 2GKVE 1QL7A 4Q7YA 1YPGH 3B8JA 2AGEX 1SGYE 1EJAA 1O37A 3SN8A 1ELVA 1THRH 4D76A 2B5TB 2O8WA 1O3JA 2BLQA 1Y3UA 1Y3WA 4X8UH 3PLBA 2ZU1A 3V7TA 4AORA 1PPBH 1C5QA 1ZGIA 1FMGA