2WV5A

Crystal structure of foot-and-mouth disease virus 3c protease in complex with a decameric peptide corresponding to the vp1-2a cleavage junction with a gln to glu substitution at p1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
200
structure length
200
Chain Sequence
DLQKMVMGNTKPVELILDGKTVAICCATGVFGTAYLVPRHLFAEKYDKIMLDGRAMTDSDYRVFEFEIKVKGQDMLSDAALMVLHRGNKVRDITKHFRDTARMKKGTPVVGVVNNADVGRLIFSGEALTYKDIVVLMDGDTMPGLFAYKAATRAGYAGGAVLAKDGADTFIVGTHSAGGNGVGYCSCVSRSMLQKMKAHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into Cleavage Specificity from the Crystal Structure of Foot-and-Mouth Disease Virus 3C Protease Complexed with a Peptide Substrate.
pubmed doi rcsb
source organism Foot-and-mouth disease virus
molecule tags Hydrolase/peptide
molecule keywords PICORNAIN 3C
total genus 43
structure length 200
sequence length 200
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wv5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2wv5A01
1HNEE 2ZU1A 1G2LA 1LHEH 1CGJE 7GCHG 3TU7H 3ZZ8A 1C1UH 4GLYA 3VGCB 1O3HA 2PLXA 1K1IA 1SHHB 1N8OC 5L6NH 4RSPA 3VB3A 1IQEA 2HGTH 2CGAA 3KQEA 2OC8A 1C1WH 1WQSA 3OSYA 3Q3YA 3A7TA 3BG8A 2BQ6B 4Y6DA 1HXEH 1FMGA 1T8NA 4D9RA 2VINA 3F6UH 1DICA 3R0FA 3LOXA 1J15A 1FN6A 5HGGA 1PQAA 3GYLB 2ESTE 3OTJE 4GHQA 1CA0C 1ZTJA 2ZO3H 1T4UH 4YLQH 3GY7A 1BTXA 2FI4E 4AFUA 5ETXA 4AFZA 1O2YA 1GL1A 2SGPE 1O3EA 4ISOA 1VITH 1OOKB 2H5DA 1V2JT 2ALPA 1UVOA 3ATIA 3PWCA 3EA9A 4HZHA 3GY6A 4BNRA 4IMQA 1VCWA 1X7AC 1EQ9A 1OP2A 4X1RU 2QCYA 3RU4D 1ORFA 9LPRA 1WSSH 4QT8C 1OYQA 3RM0H 3PMHB 3UQOA 4NIWA 3IITA 1LKAA 3GY5A 2BDGA 3PO1B 2ZFQH 3OY6U 1O5BB 5ABWA 1LTOA 3E1XB 3TGKE 1XKBC 2JKHA 2VWNA 1YYY1 4X2VA 1Q2WA 4Y79A 1A3EH 4X2WA 2BX3A 3MNCA 4KKDA 2SNVA 5A09A 1O39A 1S83A 1O37A 3ZV9A 3KF2A 2Z3CA 4GVUA 5E0GA 2R2WU 1TQ7B 1GBEA 2R9PA 3OYPA 2OBQA 3RXOA 1A1RA 4X6NA 4X8TH 4YT6H 3H7OA 1BJVA 3RUOA 3ODFA 2AMDA 2BD3A 1AB9B 1O5CB 2BOKA 2AGEX 2ZTYA 1RS0A 3P8FA 3FVFB 2FXRA 3I78A 1ZHMA 2GZ8A 3A7WA 1YGCH 1GVZA 3LT3A 5EODA 1TNGA 5A0BA 1RTLA 1C9TA 1ACBE 5AVDA 1GMHG 2A7JA 1FY4A 2D8WA 4ZKRU 1TRYA 3TNSA 1RTKA 2UUFB 3JZ1B 2HRVA 3RXTA 4E7NA 1PPHE 4TYDA 2P94A 7LPRA 1BTWA 2QY0B 1P2IA 3MH5A 3RXLA 1C5XB 4IN1A 1O2SA 2A1DB 3L33A 1C5SA 4ABFA 1GBKA 1V3XA 5F8ZA 1QL7A 1EOLA 1WTGH 3W95A 1BB0B 2BTCE 1KSNA 4CRCA 2GP9B 1KLJH 2WYJA 1TBZH 1ANDA 2G5VA 3ZZ9A 4FXGH 1BTYA 4K60A 2V0BA 1YPGH 1P9UA 1GI4A 3EA7A 2ZPRA 1G36A 2UWOA 1TMUH 3A89A 3RU4T 4ISNA 1TBQH 2XBYA 4NSYA 1ZYOA 1VITG 1NM6A 1O3AA 3RXCA 3PWBA 1NY22 1O5DH 2XC5A 3MHWU 4INHA 1P3EA 3SZNA 1KLIH 3BF6H 1NRRH 3VB6A 5LPEA 2BX4A 1NESE 1P2MA 1EOJA 1VJ9U 4XSKU 5FCRA 5DGJA 2AFQB 3A8BA 2GT8A 1A0JA 3MOCA 1EJAA 3VXFH 3KQDA 3T62A 1XXFA 3SU6A 4B73A 2AS9A 1TX6A 1OYTH 2TGTA 6LPRA 1FIZA 4MNVA 3E16B 2BY7X 3VGCC 4BAHB 4KP0A 4A1XA 1QFKH 2Z7FE 3LC5A 1Y8TA 2ZIQH 2OQUA 1YPHE 5HM2A 4FUJA 5LGOA 4YM9A 3BTGE 5DP9A 2ZGCA 3FAOA 5EQRA 1TNHA 1GJ4H 1P12E 2GV6A 1AN1E 3UTUH 2F9VA 1C5PA 4IC5A 1BTUA 4K2YA 3P8OA 1AO5A 3PTBA 1LPKB 3VB7A 2FX4A 3LDXH 5GJ4B 3A86A 1D3DB 2D1JA 4ABHA 2A0QB 4DCDA 2ZDNA 1ZR0A 3A8DA 3PROA 2FEQH 2G4TA 3D49H 1HAZB 1YKTA 1ZSKA 1GHZA 4AB9A 3BTQE 3I29A 1WAYB 2EI7A 3LJJA 2CF8H 3BIVH 1ZSJA 1DSUA 3H5CB 5EXNA 3TK5A 4CH2B 1VITF 2SGDE 2BD2A 3HATH 1IQMA 3M37A 3RMMH 5K7RA 3RXKA 1RGQA 1TIOA 1ETSH 1TOCB 4D76A 1NRSH 3MTYA 2CJIA 3GICB 1V2LT 3MH4A 3TJVA 3BG4B 1SGFG 3A80A 1GHAG 1NTPA 3M5LA 1C1OA 1Z1JA 4GSOA 2OQ5A 1EZQA 5J4SA 1YPHC 2FMJA 4BOHA 4ABIA 5A8XA 1DXWA 8KME2 1U6QA 3UOPA 4CRBA 1AZZA 1O5GH 3LH3A 1UVSH 2WPIS 2V3HH 3SJOA 2BY9X 1O2XA 2P16A 4A92A 2BQ7B 2VIPA 2OC1A 3CENA 1UHBB 1DOJA 1O3BA 1O2QA 1P05A 4O3TA 3SUGA 2J2UA 3FP8E 1FIWA 2IJOB 1LHFH 1YC0A 4JZFH 4DIIH 3RXGA 1G37A 5T6DA 4MQAA 1KLTA 2J94A 1GBCA 6CHAC 2ANWA 2UUJB 2F9BH 3EGKH 4BAMB 4OGYA 1BBRK 1D9IA 3RXPA 2RG3A 3TH3H 1TE0A 4JZEH 1INCA 1VZQH 1F5RA 1CT0E 2FLRH 4FVDA 1GHXH 2ZC9H 4GCHG 1GBTA 1FZZA 4K3JA 2GMTB 2JH0D 1SGIB 2D2DA 5EW1H 1H8IH 1O33A 1A5GH 2FP7B 4KELA 5CE1A 1A4WH 1AUTC 2JETC 2F9PA 1ELCA 2AERH 2FOAA 2PR3A 2ODPA 3F9EA 4BAOB 3A7VA 2FIRH 5JB8S 1EKBB 2GT7A 5FAHA 1JIRA 3W94A 1AD8H 1AU8A 1QQ4A 2G55A 3F9FA 1HAXB 2PV9B 3AAUA 3O8BA 5T6FA 1ZSLA 5EW2H 1P2QA 3IWMA 2Q6FA 2BD9A 4BXSA 2OC7A 1YPMH 1GI1A 4PROA 4BXWA 4BTUB 5E2PA 1SOTA 3GY8A 1DLEA 1V2MT 4OGXA 1H9IE 2XBVA 1AFQB 4XBBA 2ZHWH 4FUHA 1THPB 3RMOH 5C2ZA 5DKMA 1P8VC 1B0FA 3KL6A 2FOMB 2YOLA 4XFQA 4CRGA 2BYAX 2NU0E 3URCA 1EJMA 3HPTB 2ZHQH 1BTZA 5I46H 3K2UA 2A4OA 1CT2E 1XX9A 2Z94A 2CMYA 1SLVB 2AMPA 2PGBB 1C2KA 1YCPK 2PHBA 1W0YH 1TA2A 1ZPBA 1GJ5H 3BSQA 3UPEA 4YTAA 2ZCHP 1F7ZA 1DE7H 1UTOA 4A7IB 1SHYA 1G2MA 3TITA 1Y3VA 3NK8A 1GG6C 4NZQA 4X1SU 1RJXB 4O9VA 3DA9B 4GHTA 5E0HA 1GI8B 3BV9B 2J95A 3SHCH 2WPHS 1YLCA 3DFJA 3RC4A 3V12A 3VXEH 4K8BA 5DP5A 1PQ8A 3EA8A 3VPKA 4RKJB 3MYWA 1P04A 2ZWLH 1UVUH 3ZZ4A 4CR5A 1EATA 4AFSA 1O31A 2OUAA 1ZHRA 1UTJA 2ODQA 4LXBH 1QRXA 1O0DH 4Q7YA 1HXFH 1SFIA 1AI8H 3SQEE 3ZVFA 1K1PA 2FLBH 1RTFB 1T7CA 4ABDA 4ABAA 3GY3A 1L1NA 1C1MA 1ZTKA 1QCPA 4Y0ZE 4B75A 2BDAA 1ZRBA 4U32A 2XC0A 1V2NT 1ZRKA 1Y5UT 1Z8IB 1CHOF 3PMBB 2CHAB 5AHGH 1SSXA 1O3OA 4HFPB 5C5OA 1TALA 2GKVE 1KXCA 4A6LA 4CRDA 2O8WA 2GDEH 1SBWA 2OC0A 5HMAA 1AWHB 5GDSH 3C1KA 2QGRA 1SQOA 1O3DA 3Q3KA 2OINA 4I8LA 1ZPZA 1WQVH 1VGCC 1O35A 3RMNH 1LKBA 4CHAB 4I8GA 1LPGB 2AIPA 4XE4A 4NIVA 3ZZBA 4DOQA 1GJ7B 3UUZA 4FUCA 1FY3A 2PWXA 4NCYA 3HGNA 3RXIA 5HXFA 2FTMA 2ZDAH 3P95A 4UFGH 2ZTZA 2K1QA 3MNBA 3QGJA 1GBAA 1EAIA 2EC9H 1OXGA 4ZXYH 5A2MH 1ELGA 3ZVEA 1T4VH 4X8VH 2BZ6H 1GDQA 2M5TA 3SV6A 2HPQH 1IHTH 4GPGA 1TGNA 1UJ1A 3BN9A 4NGAH 1IOEA 4Y7BA 1BCUH 1O3IA 4MNYA 4MPUA 3FZZA 2AGIX 3P70B 3F9HA 4K1SA 1SGPE 3RXJA 2QF0A 1YCPM 3T27A 3QWCH 3LPRA 4X0WU 1NFYA 1UTMA 5FPSA 3S9AA 1JRTA 1ZZZA 2GVFA 3F9GA 4LOYH 4CBNA 4TPIZ 3KCGH 2Z9JA 3ZZDA 3O8RA 1AKSB 1T32A 4UEHH 1EP5A 1TMTH 3HGPA 1QJ6B 2OLGA 4J2YB 5DP8A 1UCYE 3ZV8A 1YM0A 1BRUP 3S7KB 1OWJA 2VIOA 1HIAB 5F03A 2XCNA 4WXIA 1QJ7B 2SGAA 2Z3EA 3HKIB 2FO9A 1HGTH 1DFPA 4R0IA 1MQ6A 3MFJA 2BHGA 7ESTE 3GY2A 4GAWA 4ISIH 3FANA 3ZZ7A 2ZEBA 5DP6A 1QGFA 1CU1A 1CT4E 2QIQA 1K22H 3ZZ3A 3SO3A 1V2VT 3SU2A 4I7YH 1AIXH 5FPYA 2C93B 1NC6A 1OP8A 1WYKA 3LGVA 3ZZAA 1E37B 1TRMA 2ZNKH 3QZRA 3S0NA 1DVAH 2XWBI 3RMLH 2STAE 5C20A 1SGNE 1THRH 2FOGA 3AW1A 1GI7B 1W11U 2JETB 4LK4A 3VEQB 2GTBA 2FOFA 4VGCC 1LVMA 3SUEA 1GCTC 1QIXB 3B9FH 1QBVH 1W2KH 1CHGA 3BTEE 5DJ7A 1H1BA 4WMEA 3ODDA 3V0XA 1YP9A 1LVYA 4NA9H 3RC5A 3P6ZB 2GMTC 2BD7A 2H2ZA 3TK6A 4AORA 1AVWA 1SL3A 3PLBA 1LPZB 2Y82A 4KTUA 1ESTA 1GI0A 1BITA 4O3UA 1S82A 1TOMH 4Y71A 1ELVA 2TBSA 3SU3A 1HAVB 9ESTA 1DITH 2A7CA 6CHAB 1TNKA 1KXAA 4FUBA 5JDUB 3MH7A 1C5UA 1G32B 2J38A 1WOFA 3MI4A 4IW4E 1MBMA 1EXFA 1GHWH 1BRAA 1FPCH 4ZAEA 3SNEA 4E7RG 2P3FH 1ESBA 1TABE 1GPZA 4DW2U 3SUDA 2H6MA 2HOBA 1ZJKA 4FU9A 1FN8A 3M5OA 1HIAA 1ZLRA 2WUBA 2BLQA 4FUDA 7KMEH 2WPKS 1S84A 1HAGE 3SI4H 1MKXH 3OX7U 1C5VA 2FESH 1WTHD 1ZTLA 1C4U2 2A2QH 2IN2A 4X8UH 1BRCE 2A32A 2BB4A 1TB6H 2PTNA 1AMHA 2PUXB 4E05H 1AFEH 1SGYE 4Z6AH 3SNCA 2CXVA 3SUFA 3TH4H 1RRKA 3RLYH 4DJZB 1XUIA 3O8CA 2XW9A 1J14A 3RXDA 3UNQA 3BG4C 1NFWA 4CR9A 2TGPZ 1Z6EA 2VIDA 2FOEA 3RXVA 2AMQA 3NZIA 2R0KA 1EASA 1BMLA 1XUGA 5EQQA 1IQIA 1HAVA 2FWWA 2P93A 3QTOH 3SJKA 3KQBA 1O5AB 1UVPA 2CN0H 3FZDA 2G81E 2KAIB 4NA7A 2ZF0H 2C90B 1C5WB 1AUJA 4YOJA 4X6MA 2BDIA 2BY6X 4CRFA 1D3PB 1HAIH 1EAUA 1HYLA 3A7YA 5E0JA 4B2CA 1RIWB 1HB0B 3UWIA 4AZ2B 1UCYK 2C8YB 3TIUA 4ZHAA 4AB8A 5GWZA 3TGJE 1S6HA 1XM1A 4MG3A 1O2MA 3SI3H 1TWXB 4R8TB 2OTVA 1JXPA 1MAXA 3MNXA 1GMDF 5CHAB 2F9NA 3TJUA 3LKWA 4OS5A 3RU4E 2ZA5A 3SV8A 3U8OH 1LDTT 4D8NA 4HTCH 3MO9A 1C2LA 2PKSB 2O8MA 1FI8A 1O2TA 2F9OA 3BEFB 3IG6B 2XRCA 1Q3XA 4NFEA 2H1UA 4U30A 3B8JA 1F0SA 5C5NA 2BLVA 3SNAA 3MO3A 4RN6A 5H4IB 4K69A 1W7XH 1RFNA 3N7OA 5FPTA 1PQ5A 2ZHDA 1GJ9B 2Z6BD 3NCLA 5FX5A 2Q6GA 1P06A 3K6ZA 1LVBA 4THNH 3L3TA 1O2HA 1V6DA 2Y5GA 1PPGE 3E0PB 1MAYA 3QK1A 3SV9A 1C2IA 2QF3A 4DURA 2PTCE 2BXTH 2NWNA 3T28A 4SGAE 4NIYA 2G00A 1MU8B 2ZHFH 3GYMA 1J17T 5EGMA 1V2WT 4XBDA 1TPAE 1FAKH 4DVAU 2ULLA 1G3EA 1BHXF 2R3UA 2ZGHA 1CBWC 1T31A 2SFAA 2GCHF 2F91A 2PKAA 1FQ3A 4UONA 5TCCA 3P8NA 4I33A 2HNTC 1YCPH 3LC3A 2GDDA 2EEKA 2SGQE 1PPZA 1A7SA 1K1LA 3QTVH 1PPBH 3M3SA 1D6WA 1TFXA 5A0AE 1NFUA 2FX6A 5DPAA 3PMAB 1P09A 3E91A 4JCNA 1GJ6A 2BZAA 1O32A 3F1SB 1DLKB 3EQ0H 4UFFH 3SOSA 3LGYA 1L4ZA 3RP2A 2FDAA 3RLWH 1MD8A 4AGKA 2BM2A 2PSYA 1BT7A 4ABJA 1Z8GA 4FVBA 4UFDH 4DG4A 1C2GA 3EAJA 3BTDE 3SNDA 3ZVDA 2FOBA 2GV7A 2A4RA 1C4V2 3PLPA 2C3SA 1FLEE 1YF4A 1MTSA 2G4UA 3M3VA 2D26C 1BBRH 2UWLA 2ZU2A 4OS1A 2UWPA 1O3PB 2GCHG 1K28D 4I32A 4ABGA 1CHOG 1B7XB 5JBAS 2AGGX 1W3CA 1Y3WA 3SJIA 2OCVB 3SORA 3QDZB 1P2OA 2WPLS 2BDCA 2ZGJA 2A4QA 1C5MD 1PPEE 3PYHA 1T8MA 2ZPSA 1P2NA 4DIHH 3OY5U 3P92A 1MKWH 4UFEH 2XXLA 1FV9A 1CVWH 1ESAA 4FUIA 1B0EA 4Y8YA 3TNTA 2PGQB 2W5EA 4U2WA 3ESTA 3LGTA 1K2I1 4X1NU 1C1SA 3I77A 2FTLE 3RXFA 8GCHF 2XBXA 2C4FH 4X8SH 1TX7A 4IGDA 5DP7A 2ANYA 1CA0B 2P3TB 3STIA 1W8BH 4X2YA 1CQQA 1KDQA 3MU0A 1PYTD 2OBOA 3QO6A 3C27B 5PTPA 1GBIA 1UHBA 1IQJA 4O03A 4CH8B 3MU4A 3ZZ5A 5AF9H 3VB4A 1BBRE 4TY7A 4UD9H 1C1TA 1N8OB 2ANMH 3HK6B 5EOKA 2J9NA 5C67A 1P9SA 3MWIU 1V2OT 3Q77A 3GCTF 1OWIA 5GIBA 1ELFA 1AVXA 2FOHA 2VU8E 3E0NB 4ISLA 1K1JA 1MD7A 1VCQA 5GXPA 1XMNB 1YPLH 3RXQA 4ZROA 4Y7AA 1TAWA 1KDQB 2XCFA 1O2PA 1O3KA 1EPTC 5C1YA 5I25A 1BMAA 3SU1A 1QRZA 4JZIA 2AH4X 1P2KA 2VIWA 3KIDU 1UTKA 3SHAH 1O3LA 5DP3A 5IDKA 2BVRH 1ZOMA 3H7TA 1GBJA 1QRWA 2I6QA 3A83A 2FI3E 4CHAC 2AIQA 1GHBG 1SLUB 1O3MA 5E2OA 5HM9A 2GCTB 3UWJH 3BEUA 1THSH 7GCHF 1JIMA 1EAWA 1O2RA 2LPRA 1OWDA 1V2KT 3S9BA 3T29A 1LHCH 1HCGA 2UUYA 2F3CE 2ZCLP 2FS8A 1ID5H 4H42U 3UOUA 1HV7A 1DANH 2CHAC 1OSSA 3A8CA 1NFXA 3S69A 4AOQA 2ZPQA 3NUMA 1FAXA 4ESTE 1GCDA 4ABEA 1VJAU 3U98H 4YO9A 1GMDG 1OX1A 1O36A 1ZHPA 1N1LA 2GCTC 1NPMA 1FY1A 2QXJA 3TVJB 5A0CA 1UVTH 1GI6A 2ILNA 3MH6A 4UDWH 1XUHA 4ZKOU 5TJXA 1OWEA 4ZXXH 2VVUA 2W26A 1ETTH 4JZDH 2PSXA 1BZXE 2P8OC 4IS5A 3M36A 1SGTA 1EPTB 5JBCS 5E8EH 2O8LA 3KGPA 3AVZA 1TPSA 2C8ZB 4U01A 1HAOH 1V2QT 2Y6TA 1A61H 2ZI2H 3DD2H 1MCVA 1K1MA 2NU3E 3RM2H 3U8TH 3A88A 2R2MB 2XWAA 4XOJA 1L1JA 1P3CA 3DFLA 1C2DA 3ITIA 1SQAA 1SQTA 1GBBA 2BDYA 5EXMA 1FDPA 5F8TA 4ZHMU 1S5SA 1NRQH 3GCOA 5EQSA 3HKJB 3KQCA 2QV1A 1C5TA 1NU7B 1EP6A 1PQ7A 2KAIA 1GJ8B 1SG8B 2Z9GA 5C3NA 2B5TB 3AAVA 2BD5A 4BAKB 2G51A 1ZGIA 1FONA 3L6PA 3LIWA 3P8GA 2ZFSA 3HK3B 1SVPA 3KEEA 1LCYA 3QZQA 4MPWA 1FXYA 1AFQC 2Z9LA 1VR1H 1XVMA 1MTVA 1N6XA 5IYTA 1NO9H 1XXDA 1TGTA 3ELAH 2TRMA 1O2IA 1PFXC 1MKXK 4TPYA 1QB1A 3A87A 2ZFPH 4ZHLU 1H8DH 1CE5A 1XVOA 1FNIA 1C2JA 2H5CA 1B5GH 2TGDA 2V35A 1SLWB 2OD3B 1IHSH 3E3TA 1UK3A 1UTNA 2QXHA 2ZU3A 1IAUA 1F5LA 4ZUHA 3BTWE 5SGAE 4Q7ZA 4OS2A 4AYVB 2C8XB 3BTHE 3GCHB 2PW8H 1ELEE 4I8HA 5ESTE 3EE0B 2BXUH 2Y5HA 3TGIE 4JZ1A 1F2SE 5FXLA 4X2XA 5F8XA 3ENSB 1O2VA 3SBKA 1ETRH 2JH6D 1KY9A 4NA8A 4B76A 3EDXB 3BTME 2FI5E 1Y59T 1QHRB 3SU4A 3LU9B 1NT1A 3RXUA 2P59A 1BMMH 4AG2A 4NWLA 4B71A 4LZ4B 1O2UA 3E8LA 2VVCA 2V3OH 1QA7A 1TRNA 5EG4A 1C2FA 2FS9A 2WPJS 3K65B 1GJDB 1G9IE 1BIOA 1UCYH 4IBLH 3LJOA 2RDLA 3F68H 1MU6B 1HFDA 3MNSA 1Z1IA 1C5QA 2SGFE 2W7UA 3FFGA 1JRSA 1C2HA 2HNTE 1N6YA 2A45B 2FPZA 1BJUA 4IN2A 1E0FD 2BY8X 2ANKH 5DG6A 4Z0KA 1GWAA 2DE9A 4YESB 5DK1A 3U9AH 4K8YA 5AFYH 1GI9B 2B0FA 2HVXA 3A82A 1PYTC 1V2ST 3Q3XA 1KXDA 4X1PU 2CV3A 1DUEA 1QR3E 2Q1JA 4YOGA 2ZQ2A 5EPNA 1IQGA 2P8OB 1K21H 2Z9KA 1LO6A 3RXEA 1O3NA 4BAQB 5EU8A 3RXRA 5L30H 1T8OA 2SGEE 1NROH 1DM4B 1E36B 2ALVA 3ATMA 1QB9A 5EPYA 1XUFA 2RCEA 2FODA 1HRTH 2WUCA 1F5KU 4JYUH 1CO7E 1ELAA 2TGAA 1YPKH 3FP7E 1LQDB 4BTIB 3UNRA 2J92A 4RKOB 4ZKNU 3PM3A 1UTQA 2NU1E 2ZTXA 2B8OH 1MZAA 2HNTF 1HLTH 3JZ2B 1LMWB 1RD3B 2TPIZ 4YT7H 5CHAC 1MUEB 1DWCH 3SQHE 1F0UA 2BD8A 1ZMLA 5DO4H 1SGFA 2GGVB 4MTBA 4X6OA 1ZMNA 1SFQB 2NU2E 1HJAB 1DXPA 2BY5X 1IQFA 3NKKA 1RIWC 3DT0H 3SJ9A 2BMGB 1O5FH 1GI5A 4Y0YE 3TH2H 1S81A 1DT2A 1TMBH 1GJBB 2ZHEH 3ZZCA 1KTSB 1TGBA 1Y3UA 2WV4A 1F92A 2Z3DA 1Z71A 5B6OA 1KTTB 1TGCA 1TNLA 1XKAC 4CREA 4Q2KA 1EUFA 2BQWB 1EPTA 4NIXA 3VB5A 1NU9A 2IPHA 2C8WB 1BHXB 4YZUA 1DUAA 3M7TA 1ANCA 3PV4A 1HAHH 2BOHB 4OS4A 4ZKSU 1PPFE 1EJNA 2Y7ZA 1QY6A 1SPJA 3ATKA 1E34B 4MVNA 3CP7A 1SGDE 1GGDB 3RC6A 3SGAE 1WCZA 1Y3YA 1GHAF 1C5OH 1SOZA 3UR9A 1WU1A 4TY6A 1YPEH 1ELBA 1C5LH 1HJ9A 1MMJN 4AG1A 1UK4A 3P17H 4LZ1H 3G01A 4DY7B 1NN6A 1UO6A 1TPOA 1C1RA 1S0QA 1WUNH 4OS7A 3A85A 1HUTH 1JMOH 1GMCF 1P10A 2WPMS 1JWTA 4F4OC 3BTFE 3GDSA 4BANB 1Y3XA 1ZJDA 1V2TT 1GJAB 3ZVBA 1SC8U 3UR6A 1DWBH 4O97A 1QBOA 1GBFA 1GHBF 2Y80A 3M7QA 4WMDA 1AE5A 3UY9A 1C1PA 4K5ZA 1OWHA 1BUIA 4B2BA 2BD4A 2A5IA 1C5NH 1EB2A 2W3KA 3KNXA 3U69H 3TLOA 1TLDA 3UIRA 1P02A 3E6PH 5K0HA 1GBHA 1BMNH 2PFEA 3QLPH 4B2AA 1YLDA 2ZG0H 2J4IA 4AFQA 2P3UB 3GDUA 8ESTE 2VWMA 2A2XH 4B74A 3DUXH 3RXSA 1AQ7A 1QJ1B 4I31A 4KTSA 1KYNA 4GCHF 1LHGH 1O3FA 1O2ZA 1KXEA 5T3HA 2VH0A 2AYWA 3RXHA 4AN7A 1AB9C 1ANEA 2BVXH 2VNTA 2VB0A 1C1VH 1OS8A 3V7TA 2ZQ1A 4KTCA 3R3GB 1GDUA 1Z8RA 2H9HA 8GCHG 1DY9A 3T5FH 1C1QA 1C5YB 1QA0A 4IMZA 1EX3A 2FYQA 3RDZA 2HLCA 4ASHA 1S6FA 1SR5C 2RA0A 3LH1A 2G5NA 4I8JA 4AX9H 5LPRA 4DT7B 5ESBA 1TNJA 5LH8A 1ABIH 1MH0A 1QQUA 1ZMJA 3PO1C 1MKWK 1ABJH 1O3CA 4NZLA 2IOTA 3MO6A 1DS2E 5LPFA 1J16A 4JYVH 3TK9A 1UTLM 2DUCA 4NG9H 1Z6JH 4CRAA 3MU8A 1O34A 3LGUA 1QTFA 8LPRA 4XBCA 2O8UA 4WH8A 1AGJA 1CBWB 1T8LA 1EAXA 4JK6A 3MMGA 1K9OE 2H9EH 2QA9E 1GBMA 2DE8A 3VFEA 1VCPA 3MU5A 1FY5A 3D62A 2BVSH 3SNBA 4ZMAH 1MBQA 1A5HA 2ZFTA 2XYAA 2A4GA 2ZECA 3UREA 1A0LA 4WVPE 2VWLA 4FU7A 1TGSZ 4IC6A 1BOQA 2B7DH 2RA3A 3CS7A 3B23B 1CGIE 2SNWA 5JBTA 2BLOA 1CSOE 2PUQH 3Q00A 1TPPA 3GISB 1Z7KA 2ZU4A 3U1IB 1GGDC 1OP0A 3QGNB 2P95A 1H9HE 1QL8A 1SB1H 2BLWA 5C1UA 1TA6A 4Y10E 1FPHH 3BEIB 1O2LA 1F0TA 2PKSC 4MLFB 2AEIH 2ZCKP 3ZYDA 3D23A 4X1QU 3ZYEA 5FBEA 1D4PB 4JMYA 1C5ZB 3ZVCA 1GVKB 1P11E 1EB1H 3AW0A 3WY8A 3UFAA 1C9PA 3PTNA 1GMCG 1UK2A 3LONA 5GPIB 1A5IA 4TWYA 1O2NA 1MTNC 3U1JB 1MZDA 3TJNA 3T26A 1ELTA 3A8AA 4MPVA 4TWWA 5BPEA 1RXPA 3ZVGA 3BIUH 1IQHA 1IQKA 1G3BA 2ODYB 5GCHG 5BRRE 3M7UA 5C1XA 1VGCB 1A46H 1YPJH 5DP4A 3Q76A 3URDA 2ZFRH 3ZVAA 3UQVA 3KN2A 4INLA 1G30B 3SV7A 1W7GH 1TYNA 1GHVH 1H9LB 1HJAC 4M7GA 1Q31A 1ZPCA 5FCKA 1O5EH 2B9LA 1JOUB 1DX5M 1QNJA 6GCHF 2XBWA 1G3DA 3SV2H 3UNSA 1AE8H 1NRPH 1SGQE 6GCHG 1Y5AT 3RXAA 4D9QA 3E90B 3GOVB 4MNWA 1P57B 1SLXB 3NPSA 2VIVA 1ZGVA 2VGCC 5AFZH 2A7HA 1DDJA 1K1NA 1DWDH 2XNIA 3K6YA 3MU1A 1C2EA 4Y8XA 1UTPA 1A0HB 4ABBA 4Q7XA 1FY8E 1P0SH 1EZUC 2V6NA 3ATWA 1FJSA 1ARCA 1O2OA 3LGWA 5JPMH 1HDTH 2QC2A 3U8RH 2STBE 2A31A 2I6SA 1MTUA 4ISHH 4MDSA 4B1TA 1O2WA 5JBBS 1GVLA 2THFB 2XTTB 1O2GH 1PPCE 2O8TA 3V13A 1BTHH 2W7SA 1GG6B 1XUKA 4H6TA 3FP6E 1HAPH 4MNXA 3V3MA 3SW2B 1L4DA 3ATLA 1WBGB 1NRNH 3D65E 4NWKA 4X6PA 4D7GA 5T6GA 1J9CH 3SGBE 3STJA 2EI6A 1NS3A 1MTWA 2F9UA 3A84A 1AHTH 1ANBA 1C4Y2 1O30A 2FM2A 1HJ8A 1O2KA 1SI5H 5L2YH 2BDBA 3NXPA 2Q6DA 2W3IA 4ZH8A 4BTTB 1KIGH 2OP9A 2WINI 2FZZA 3SGQE 4K1TA 1O3JA 2ZP0H 1O2JA 4H4FA 4HGCA 1GCTB 4KGAA 4VGCB 1BA8B 1P01A 1K1OA 3S7HB 1OWKA 1W0ZU 2PKAB 3DHKH 1O3GA 1BQYA 2CF9H 3GCHC 5G4BA 1A3BH 1S85A 1TNIA 2EI8A 3M5MA 5A8YA 3O8DA 1V2PT 1OKXA 4H6SB 2VH6A 1Y5BT 1DSTA 1SGRE 3PLKA 2ASUB 1E35B 1W10U 1LVOA 3M35A 1GBDA 1FUJA 3TPIZ 4CBOA 2ZFFH 4SGBE 3GCNA 1BTPA 3A81A 3GCTG 1V2RT 1L0ZA 1HPGA 2ZDKA 4FU8A 1GHYH 1L1GA 2TIOA 4UE7H 1GI3A 3QUMP 3SU0A 1GMHF 1D6RA 3RXBA 2YNAA 3M61U 4Y11E 1W12U 4XDEA 1SGCA 1V2UT 3S9CA 1HBTH 1KXBA 4Q80A 5F6MA 1D3TB 1IQLA 2R0LA 1L2EA 2HALA 2ZDMA 5CMXH 1QB6A 2H9TH 1UMAH 2ZDVH 3M5NA 5TCAA 4AGJA 1PJPA 1O38A 2Y81A 1TX8A 1AY6H 2GZ7A 4INKA 1MQ5A 3BTTE 2ZGXH 1GI2A 2HWLB 1AWFH 4YLUA 3BTKE 1YBWA 4D7FA 1Z8JB 3EYDA 4K1EA 4Y76A 2FOCA 2VJ1A 4JK5A 1J8AA 1EZXC 6ESTA 1W14U 3A7XA 4A1TA 1NZQH 1BDAA 1IQNA 5L2ZH 5J4QA 1W13U 1A2CH 1QBNA 1WV7H 1BRBE 2QN5T 2ZZUH 1KXFA 2LNCA 4NFFA 3T25A 1D3QB 1CA8B 3M3TA 1ELDE 2Z9IA 3NWUA 5FHTA 5EXLA 1MCTA 2QYIA 5A8ZA 4WF8A 1G3CA 4WMFA 2A5KA 4WH6A 1SGEE 1HAYB 2ZU5A 2ZGBH 1JBUH 2ZKSA 3ZZ6A 2XC4A 1H4WA 1SMFE 2G52A 2J34A 4YOIA 4WXVA 2OXSA 1QL9A 2Y7XA 3OU0A 5GCHF 3SJ8A 1M9UA 5HYOA 2HPPH 1GBLA 1DPOA 4MPXA 3LGIA 3A7ZA 3TJOA 2Y5FA 3SN8A 1AZ8A 3CS0A 2ZDLA 1GL0E 5JB9S 2UUKB 2VIQA 1CGHA 4NSVA 2FYRA 2VVVA 1P03A 2WYGA 1TBRH 2VGCB 3PB1E 1QURH 2QXIA 4F49A 2VWOA 4JYTA 4AYYB 3QN7A 3RXMA 1DY8A 1AKSA 3K9XB 4FUEA 1EZSC 2GX4A 4WY3A 1AVGH 4FUFA 2GD4B 4WWYA 3QX5H 2O9QA 4A1VA 2G8TA 2JH5D 5JYIA 1LQEA 2QAAA 2GZ9A 2NU4E 4J1YA 3KHVA 4WJG2 5FX6A 1GJCB 1P2JA 4Y8ZA 1F0RA 3PMJA 5FBIA 1GDNA 1E38B 1MTNB 3GY4A 2QXGA 4DGJA 2WV5A 3GDVA 4FUGA 1XUJA 4E06H 2A5AA 2YNBA 4A5TS 4OS6A 1LHDH 3T2NA 1DWEH 1C1NA 1ARBA 4I8KA 3AASA 1S0RA 2F83A 4GUXA 2R3YA 1TQ0B 1OPHB 1C5RA 4HI3A 2EA3A 1TONA 1C2MA 2BDHA 3SU5A
chains in the Genus database with same CATH superfamily
1HNEE 2ZU1A 1G2LA 1LHEH 1CGJE 7GCHG 3TU7H 3ZZ8A 2KM0A 1C1UH 1BMFD 4GLYA 3VGCB 1O3HA 2PLXA 1K1IA 1SHHB 1N8OC 5L6NH 4RSPA 3VB3A 1IQEA 2HGTH 2CGAA 3KQEA 2OC8A 1C1WH 1WQSA 3OSYA 3Q3YA 3A7TA 3BG8A 2BQ6B 4Y6DA 1HXEH 1FMGA 1T8NA 4D9RA 2VINA 3F6UH 1DICA 3R0FA 3LOXA 1J15A 1FN6A 5KECA 5HGGA 1PQAA 3GYLB 2ESTE 3OTJE 4GHQA 1CA0C 1ZTJA 2ZO3H 1T4UH 4YLQH 3GY7A 1BTXA 2FI4E 4AFUA 5ETXA 4AFZA 1O2YA 1GL1A 2SGPE 1O3EA 4ISOA 1VITH 1OOKB 2H5DA 1V2JT 2ALPA 1UVOA 3ATIA 3PWCA 2J97A 3EA9A 4HZHA 3GY6A 4BNRA 4IMQA 1VCWA 1H8ED 1X7AC 1EQ9A 1OP2A 4X1RU 2QCYA 3RU4D 1ORFA 4B6FA 9LPRA 1WSSH 4QT8C 1OYQA 2L74A 3RM0H 3PMHB 3UQOA 2IJD1 4NIWA 3IITA 1LKAA 3DSOA 3GY5A 2BDGA 3PO1B 2ZFQH 3OY6U 1O5BB 5ABWA 1LTOA 3E1XB 3TGKE 1XKBC 2JKHA 2VWNA 1YYY1 4X2VA 1Q2WA 4Y79A 1A3EH 4X2WA 2BX3A 3MNCA 4KKDA 2SNVA 5C17A 5A09A 1O39A 1S83A 1O37A 3ZV9A 3KF2A 2Z3CA 4GVUA 5E0GA 2R2WU 1TQ7B 1GBEA 2R9PA 3OYPA 2OBQA 3RXOA 1A1RA 4X6NA 4X8TH 4YT6H 3H7OA 1BJVA 3RUOA 3ODFA 2AMDA 2BD3A 1AB9B 1O5CB 2BOKA 2AGEX 2ZTYA 1RS0A 3P8FA 3FVFB 2FXRA 2M2AA 3I78A 1ZHMA 2GZ8A 3A7WA 1YGCH 1GVZA 2KZ4A 3LT3A 3FOAA 5EODA 1TNGA 4P00A 5A0BA 1RTLA 1C9TA 1ACBE 2YMSB 5AVDA 1GMHG 2A7JA 1FY4A 2D8WA 4ZKRU 1TRYA 3TNSA 1RTKA 2UUFB 3N7EA 3JZ1B 2HRVA 3RXTA 4E7NA 1PPHE 4TYDA 2P94A 7LPRA 1BTWA 2QY0B 1P2IA 3MH5A 3RXLA 1C5XB 4IN1A 1S6LA 1O2SA 2A1DB 3L33A 1C5SA 4ABFA 1GBKA 1V3XA 5F8ZA 1QL7A 1EOLA 1WTGH 2KFWA 3W95A 1BB0B 2BTCE 1KSNA 4CRCA 2GP9B 1KLJH 2WYJA 1TBZH 1ANDA 2W6ID 2G5VA 3ZZ9A 4FXGH 1BTYA 4K60A 2V0BA 1YPGH 1P9UA 1GI4A 3EA7A 2ZPRA 1G36A 2UWOA 1TMUH 3A89A 3RU4T 4ISNA 1TBQH 2XBYA 4NSYA 1ZYOA 1VITG 1NM6A 1O3AA 3RXCA 3PWBA 1NY22 1O5DH 2XC5A 3MHWU 4INHA 1P3EA 3SZNA 1KLIH 3BF6H 1NRRH 3VB6A 5LPEA 2BX4A 1NESE 1P2MA 1EOJA 1VJ9U 4XSKU 5FCRA 5DGJA 2AFQB 3A8BA 2GT8A 1A0JA 3MOCA 1EJAA 3VXFH 3KQDA 3T62A 1XXFA 3SU6A 4B73A 2AS9A 3FN8A 1TX6A 1OYTH 2TGTA 6LPRA 1FIZA 4MNVA 3E16B 2BY7X 3VGCC 4BAHB 4KP0A 4A1XA 1QFKH 2Z7FE 3LC5A 1Y8TA 2ZIQH 2OQUA 1YPHE 5HM2A 4FUJA 3GS9A 5LGOA 4YM9A 3BTGE 5DP9A 2ZGCA 3FAOA 5EQRA 1TNHA 1GJ4H 1P12E 2GV6A 1AN1E 3UTUH 2F9VA 1C5PA 2J98A 4IC5A 1BTUA 4K2YA 3P8OA 1AO5A 3PTBA 1LPKB 3VB7A 2FX4A 3LDXH 5GJ4B 3A86A 1D3DB 2D1JA 4ABHA 2A0QB 4DCDA 2ZDNA 1ZR0A 3A8DA 3PROA 2FEQH 2G4TA 3D49H 1HAZB 1YKTA 1ZSKA 1GHZA 4AB9A 3BTQE 3I29A 1WAYB 2EI7A 3LJJA 2CF8H 3BIVH 1ZSJA 1DSUA 3H5CB 5EXNA 3TK5A 4CH2B 1VITF 2SGDE 2BD2A 3HATH 1IQMA 3M37A 3RMMH 5K7RA 3RXKA 1RGQA 1TIOA 1WDIA 1ETSH 2OK5A 1TOCB 4D76A 1NRSH 3MTYA 2CJIA 3GICB 1V2LT 3MH4A 3TJVA 3BG4B 1SGFG 3A80A 1GHAG 1NTPA 3M5LA 1C1OA 2KCOA 1Z1JA 4GSOA 2OQ5A 1EZQA 5J4SA 1YPHC 2FMJA 4BOHA 3MQKC 1UW7A 4ABIA 5A8XA 1DXWA 8KME2 1U6QA 3UOPA 4CRBA 1AZZA 1O5GH 3LH3A 1UVSH 2WPIS 2V3HH 3SJOA 3WWFA 2BY9X 1O2XA 2P16A 4A92A 2BQ7B 2VIPA 2OC1A 3CENA 1UHBB 1DOJA 1O3BA 1O2QA 1P05A 4I86A 4O3TA 3SUGA 2J2UA 3FP8E 1FIWA 2IJOB 1LHFH 1YC0A 4JZFH 4DIIH 3RXGA 1G37A 5T6DA 4MQAA 1KLTA 2J94A 1GBCA 6CHAC 2ANWA 2UUJB 2F9BH 3EGKH 4BAMB 4OGYA 1BBRK 1D9IA 3RXPA 2RG3A 3TH3H 1TE0A 4JZEH 1INCA 5KEDA 1VZQH 1F5RA 1CT0E 2FLRH 4FVDA 1GHXH 2ZC9H 4GCHG 1GBTA 1FZZA 4K3JA 2GMTB 2JH0D 4XD7D 1SGIB 2D2DA 5EW1H 2YMSC 1H8IH 1O33A 1A5GH 2FP7B 2WV9A 4KELA 4ACAA 4YXWD 5CE1A 3SZEA 1A4WH 1AUTC 2JETC 2F9PA 1ELCA 2AERH 2GJGA 2FOAA 2PR3A 2ODPA 3F9EA 4BAOB 3FO8D 3A7VA 2FIRH 5JB8S 1EKBB 2GT7A 5FAHA 1JIRA 2WZQA 1AD8H 3W94A 1AU8A 1QQ4A 2G55A 3F9FA 1HAXB 2PV9B 3AAUA 3O8BA 5T6FA 1ZSLA 5EW2H 1P2QA 3IWMA 2Q6FA 2BD9A 5T1VA 2OC7A 1YPMH 4BXSA 1GI1A 4PROA 4BXWA 4BTUB 5E2PA 1SOTA 3GY8A 2HVYB 1DLEA 1V2MT 4OGXA 1H9IE 2XBVA 1AFQB 4XBBA 2ZHWH 4FUHA 1THPB 3RMOH 5C2ZA 5DKMA 1P8VC 1B0FA 3KL6A 2FOMB 2YOLA 4XFQA 4CRGA 2BYAX 2NU0E 3URCA 1EJMA 3HPTB 2ZHQH 1BTZA 5I46H 3K2UA 2A4OA 1CT2E 1XX9A 2Z94A 2CMYA 1SLVB 2AMPA 2PGBB 1C2KA 1YCPK 2PHBA 1W0YH 1TA2A 1ZPBA 1GJ5H 3BSQA 3UPEA 4YTAA 1E1RD 2ZCHP 1F7ZA 2W6JD 1DE7H 3VG8A 1UTOA 4A7IB 1SHYA 1G2MA 3TITA 1Y3VA 3NK8A 1GG6C 4NZQA 4X1SU 1RJXB 4O9VA 4RT1A 3DA9B 1COWD 4GHTA 5E0HA 1GI8B 3BV9B 2J95A 3SHCH 2WPHS 1YLCA 3CNRA 3DFJA 3RC4A 3V12A 3VXEH 2WHXA 4K8BA 5DP5A 1PQ8A 3EA8A 3VPKA 4RKJB 3MYWA 1P04A 2ZWLH 1UVUH 3ZZ4A 3SYJA 1EATA 4CR5A 4AFSA 1O31A 2OUAA 5C94A 1ZHRA 1UTJA 2ODQA 4LXBH 1QRXA 1O0DH 4Q7YA 1HXFH 1SFIA 1AI8H 3SQEE 3ZVFA 5HIYA 1K1PA 2FLBH 1RTFB 1T7CA 4ABDA 4ABAA 3GY3A 1L1NA 1C1MA 1ZTKA 1QCPA 4Y0ZE 4B75A 2BDAA 1ZRBA 4U32A 2XC0A 1V2NT 1ZRKA 1Y5UT 1Z8IB 1CHOF 3PMBB 2CHAB 5AHGH 1SSXA 1O3OA 4HFPB 2CK3D 1TALA 2GKVE 1KXCA 5C5OA 4A6LA 4CRDA 2O8WA 2GDEH 1SBWA 2OC0A 5HMAA 1AWHB 5GDSH 4ASUD 3C1KA 2QGRA 1SQOA 1O3DA 3Q3KA 2OINA 4I8LA 1ZPZA 1WQVH 1VGCC 1O35A 3RMNH 1LKBA 4CHAB 4I8GA 1LPGB 2AIPA 4XE4A 4NIVA 3ZZBA 4DOQA 1GJ7B 3UUZA 4FUCA 1FY3A 2PWXA 4NCYA 3HGNA 3RXIA 5HXFA 2FTMA 2ZDAH 3P95A 4UFGH 2ZTZA 2K1QA 3MNBA 3QGJA 4Z1MD 1GBAA 1EAIA 2EC9H 1OXGA 4ZXYH 5A2MH 1ELGA 3ZVEA 1T4VH 4X8VH 2BZ6H 1GDQA 2M5TA 3SV6A 2HPQH 1IHTH 4GPGA 1TGNA 1UJ1A 3BN9A 4NGAH 1IOEA 4Y7BA 1BCUH 1O3IA 3OE7D 4MNYA 3FZZA 4MPUA 2AGIX 3P70B 3F9HA 4K1SA 1SGPE 3RXJA 2QF0A 1YCPM 3T27A 3QWCH 3LPRA 4X0WU 1NFYA 1UTMA 5FPSA 3S9AA 1JRTA 1ZZZA 2GVFA 3F9GA 4LOYH 4CBNA 4TPIZ 3KCGH 2Z9JA 3ZZDA 3O8RA 1AKSB 1T32A 4UEHH 1EP5A 1TMTH 3HGPA 1QJ6B 2OLGA 4J2YB 5DP8A 1UCYE 3ZV8A 1YM0A 1BRUP 3S7KB 1OWJA 2VIOA 1HIAB 5F03A 2XCNA 4WXIA 1QJ7B 2SGAA 2Z3EA 3HKIB 2FO9A 3DSPA 1HGTH 1DFPA 4R0IA 1MQ6A 3MFJA 2BHGA 7ESTE 1E79D 3GY2A 4GAWA 4ISIH 3FANA 3ZZ7A 2ZEBA 5DP6A 1QGFA 1CU1A 1CT4E 2QIQA 1K22H 3ZZ3A 3SO3A 1V2VT 3SU2A 4I7YH 1AIXH 5FPYA 2C93B 1NC6A 1OP8A 1WYKA 3LGVA 3ZZAA 1E37B 1TRMA 2ZNKH 3QZRA 3S0NA 1DVAH 2XWBI 3RMLH 2STAE 5C20A 1SGNE 1THRH 2FOGA 3AW1A 1GI7B 1W11U 2JETB 4LK4A 3VEQB 2GTBA 2FOFA 4VGCC 1LVMA 3SUEA 1GCTC 1QIXB 3B9FH 1QBVH 1W2KH 1CHGA 3BTEE 5DJ7A 1H1BA 4WMEA 3ODDA 3V0XA 1YP9A 1LVYA 4NA9H 3RC5A 3P6ZB 2GMTC 2BD7A 2H2ZA 3TK6A 4AORA 1AVWA 1SL3A 3PLBA 1LPZB 2Y82A 4KTUA 1ESTA 1GI0A 1BITA 4O3UA 5FL7D 1S82A 1TOMH 4Y71A 1ELVA 2TBSA 3SU3A 1HAVB 9ESTA 1DITH 2KCYA 2A7CA 6CHAB 1TNKA 1KXAA 4FUBA 5JDUB 3MH7A 1C5UA 1G32B 2J38A 1WOFA 3MI4A 4IW4E 1MBMA 1EXFA 1GHWH 1BRAA 1FPCH 4ZAEA 3SNEA 4E7RG 2P3FH 1ESBA 1TABE 1GPZA 4DW2U 3SUDA 2H6MA 2HOBA 1ZJKA 2KX4A 4FU9A 1FN8A 3M5OA 1HIAA 1ZLRA 2WUBA 2BLQA 4FUDA 7KMEH 2WPKS 1S84A 1HAGE 3SI4H 1MKXH 1W0KD 5C0UA 3OX7U 1C5VA 2FESH 1WTHD 1ZTLA 1C4U2 2A2QH 2IN2A 4X8UH 1BRCE 2A32A 2BB4A 1TB6H 2PTNA 1AMHA 2PUXB 4E05H 2LP6A 1AFEH 1SGYE 4Z6AH 3SNCA 2CXVA 3SUFA 1YY3A 3TH4H 1RRKA 3RLYH 4DJZB 1XUIA 1YLNA 3O8CA 2XW9A 1J14A 3RXDA 1SKYE 3UNQA 3BG4C 1NFWA 4CR9A 2TGPZ 3PRDA 1Z6EA 2VIDA 2FOEA 3RXVA 2AMQA 3NZIA 2R0KA 1EASA 1BMLA 1XUGA 5EQQA 1IQIA 1HAVA 2FWWA 2P93A 3QTOH 3SJKA 3KQBA 1O5AB 1UVPA 2CN0H 3FZDA 2G81E 2KAIB 4NA7A 2ZF0H 2C90B 1C5WB 1SQRA 1AUJA 4YOJA 4X6MA 2BDIA 2BY6X 4CRFA 1D3PB 1HAIH 1EAUA 1HYLA 3A7YA 3N99A 5E0JA 4B2CA 4ZCNA 1RIWB 1HB0B 3UWIA 4AZ2B 1UCYK 2C8YB 3TIUA 4ZHAA 4AB8A 5GWZA 3TGJE 1S6HA 1XM1A 4MG3A 2XNDD 1O2MA 3SI3H 1TWXB 5IK2D 4R8TB 2OTVA 1JXPA 1MAXA 3MNXA 1GMDF 5CHAB 2F9NA 3TJUA 3LKWA 4OS5A 2JJ1D 3RU4E 2ZA5A 3SV8A 3U8OH 1LDTT 4D8NA 4HTCH 3MO9A 1C2LA 2PKSB 2O8MA 1FI8A 1O2TA 2F9OA 3BEFB 3IG6B 2XRCA 1KMHB 1Q3XA 4NFEA 2H1UA 4U30A 3B8JA 1F0SA 5C5NA 2BLVA 3SNAA 3MO3A 4RN6A 5H4IB 4K69A 1W7XH 1RFNA 3N7OA 5FPTA 1PQ5A 2ZHDA 1GJ9B 2Z6BD 3NCLA 5FX5A 2Q6GA 1P06A 3K6ZA 1LVBA 4THNH 3L3TA 1O2HA 1V6DA 2Y5GA 1PPGE 3E0PB 1MAYA 3QK1A 3SV9A 1C2IA 2QF3A 4DURA 2PTCE 2BXTH 5EJZA 2NWNA 3DSGA 4SGAE 3T28A 4NIYA 2G00A 1MU8B 2ZHFH 3GYMA 1J17T 5EGMA 1V2WT 4XBDA 3OFND 1TPAE 1FAKH 4DVAU 2ULLA 5F53A 1G3EA 1BHXF 2R3UA 2ZGHA 1CBWC 1T31A 2SFAA 2GCHF 2F91A 2PKAA 1FQ3A 4UONA 4XRNA 2JIZD 5TCCA 3P8NA 4I33A 2HNTC 1YCPH 3LC3A 2GDDA 2EEKA 2SGQE 4ACBA 1PPZA 1A7SA 1K1LA 3QTVH 1PPBH 3M3SA 1D6WA 1TFXA 5A0AE 1NFUA 2FX6A 5DPAA 3PMAB 1P09A 3E91A 4JCNA 1GJ6A 2BZAA 1O32A 3F1SB 5DSFA 1DLKB 3EQ0H 4UFFH 3SOSA 3LGYA 1L4ZA 3RP2A 4Q4LA 2FDAA 3RLWH 3UAIC 1MD8A 4AGKA 2BM2A 2PSYA 1BT7A 4ABJA 1Z8GA 4FVBA 4UFDH 4DG4A 1C2GA 3EAJA 3BTDE 3SNDA 3ZVDA 2FOBA 2GV7A 2A4RA 1C4V2 3PLPA 2C3SA 1FLEE 1YF4A 1MTSA 2G4UA 3M3VA 2D26C 1BBRH 2UWLA 2ZU2A 4OS1A 2UWPA 1O3PB 2GCHG 1K28D 4I32A 4ABGA 1CHOG 1B7XB 1YWUA 5JBAS 2AGGX 1W3CA 1Y3WA 3SJIA 2OCVB 3SORA 3QDZB 1P2OA 3ZIAD 2WPLS 2BDCA 2ZGJA 2A4QA 1C5MD 1PPEE 3PYHA 1T8MA 2ZPSA 1P2NA 5DN6D 4DIHH 3OEHD 3OY5U 3P92A 1MKWH 4UFEH 2XXLA 1FV9A 1CVWH 1ESAA 4FUIA 1K0HA 1B0EA 4Y8YA 3TNTA 2PGQB 2W5EA 4U2WA 3ESTA 3LGTA 1K2I1 4X1NU 1C1SA 3I77A 2FTLE 3RXFA 8GCHF 2XBXA 2C4FH 4X8SH 1TX7A 4IGDA 5DP7A 2ANYA 1CA0B 2P3TB 3STIA 1W8BH 3F0PA 4X2YA 1CQQA 1KDQA 3MU0A 1PYTD 2OBOA 3QO6A 3C27B 5PTPA 1GBIA 1UHBA 1IQJA 4O03A 4CH8B 3MU4A 3ZZ5A 5AF9H 3VB4A 1BBRE 4TY7A 4UD9H 1C1TA 1N8OB 2ANMH 3HK6B 5EOKA 2J9NA 5C67A 1P9SA 3MWIU 1V2OT 3Q77A 3GCTF 1WXRA 5C0TA 1OWIA 5GIBA 1ELFA 1AVXA 2FOHA 2VU8E 3E0NB 4ISLA 1K1JA 1MD7A 1VCQA 5GXPA 1XMNB 1YPLH 3RXQA 4ZROA 4Y7AA 1TAWA 3OTPA 1KDQB 2XCFA 1O2PA 1O3KA 1EPTC 3F2FA 5C1YA 5I25A 1BMAA 3SU1A 5HIZA 1QRZA 4JZIA 2AH4X 1P2KA 2VIWA 3KIDU 1UTKA 3SHAH 1O3LA 5DP3A 5IDKA 2BVRH 1ZOMA 3H7TA 1GBJA 2KCAA 1QRWA 2I6QA 3A83A 2FI3E 4CHAC 2AIQA 2JJ2D 1GHBG 1SLUB 1O3MA 5E2OA 5HM9A 2GCTB 3UWJH 3BEUA 1THSH 7GCHF 1JIMA 1EAWA 1O2RA 2LPRA 1OWDA 1V2KT 3S9BA 3T29A 1LHCH 1HCGA 2UUYA 2F3CE 2ZCLP 2FS8A 1ID5H 4H42U 3UOUA 1HV7A 1DANH 2CHAC 1OSSA 2L6OA 3A8CA 1NFXA 3S69A 4RI0A 2ZPQA 4AOQA 3NUMA 1FAXA 4ESTE 1GCDA 4ABEA 1VJAU 3U98H 4YO9A 1GMDG 1OX1A 1O36A 1ZHPA 1N1LA 2GCTC 4TT3D 1NPMA 1FY1A 2QXJA 3TVJB 5B6LA 5A0CA 1UVTH 1GI6A 2ILNA 3MH6A 4UDWH 1XUHA 4ZKOU 5TJXA 1OWEA 4ZXXH 2VVUA 2W26A 1ETTH 4JZDH 2PSXA 1BZXE 2P8OC 4IS5A 3M36A 1SGTA 1EPTB 5JBCS 5E8EH 2O8LA 3KGPA 3AVZA 1TPSA 2C8ZB 4U01A 1HAOH 1V2QT 2Y6TA 1A61H 3OEED 2ZI2H 3DD2H 1MCVA 1K1MA 2NU3E 3RM2H 3U8TH 3A88A 2R2MB 2XWAA 4XOJA 1L1JA 1P3CA 3DFLA 1C2DA 3ITIA 1SQAA 1NBMD 1SQTA 1GBBA 2BDYA 5EXMA 4F48B 1FDPA 5F8TA 4ZHMU 1S5SA 1NRQH 3GCOA 5EQSA 3HKJB 3KQCA 2XOKD 2QV1A 1C5TA 1NU7B 1EP6A 1PQ7A 2KAIA 1GJ8B 3PV2A 1SG8B 2Z9GA 5C3NA 2B5TB 3AAVA 2BD5A 4BAKB 2G51A 1ZGIA 1FONA 3L6PA 3LIWA 3P8GA 2ZFSA 3HK3B 1SVPA 3KEEA 1LCYA 3QZQA 4MPWA 1FXYA 1AFQC 2Z9LA 3FKSD 1VR1H 1XVMA 1MTVA 1N6XA 5IYTA 1NO9H 1XXDA 1TGTA 3ELAH 4RT0A 2TRMA 1O2IA 1PFXC 1MKXK 4TPYA 1QB1A 3A87A 2ZFPH 2JDID 4ZHLU 1H8DH 1CE5A 1XVOA 1FNIA 1C2JA 2H5CA 1B5GH 2TGDA 2V35A 1SLWB 2OD3B 4FOUC 1IHSH 3E3TA 1UK3A 1UTNA 2QXHA 2ZU3A 1IAUA 1F5LA 4ZUHA 3BTWE 5SGAE 4Q7ZA 4OS2A 4AYVB 2C8XB 3BTHE 3GCHB 2PW8H 1ELEE 4I8HA 5ESTE 3EE0B 3OAAD 2BXUH 2Y5HA 3TGIE 4JZ1A 1F2SE 5FXLA 4X2XA 5F8XA 3ENSB 1O2VA 3SBKA 1ETRH 2JH6D 1KY9A 2IPQX 4NA8A 4B76A 3EDXB 3BTME 2FI5E 1Y59T 1QHRB 3SU4A 3LU9B 1NT1A 3RXUA 2P59A 1BMMH 4AG2A 4NWLA 4B71A 4LZ4B 1O2UA 3E8LA 2VVCA 2V3OH 1QA7A 1TRNA 5EG4A 1C2FA 2FS9A 2WPJS 3K65B 1GJDB 1G9IE 1BIOA 1UCYH 4IBLH 3LJOA 2RDLA 3F68H 1MU6B 1HFDA 3W1EA 3MNSA 1Z1IA 1C5QA 2SGFE 2W7UA 3FFGA 1JRSA 2F4LA 1C2HA 2HNTE 1N6YA 2A45B 2FPZA 1BJUA 4IN2A 1E0FD 2BY8X 2ANKH 5DG6A 4Z0KA 5KGOA 1GWAA 2DE9A 4YESB 5DK1A 3U9AH 4K8YA 5AFYH 1GI9B 4TSFD 2B0FA 2HVXA 3A82A 2LELA 4Q63A 1PYTC 5EJ1A 1V2ST 3Q3XA 1KXDA 3WW7A 4X1PU 2CV3A 1DUEA 1QR3E 2Q1JA 4YOGA 2ZQ2A 5EPNA 1IQGA 2P8OB 1K21H 2Z9KA 1LO6A 3RXEA 1O3NA 2PP6A 2YMSD 4BAQB 5EU8A 3RXRA 5L30H 1T8OA 2SGEE 1E1QD 1NROH 2QF5A 1DM4B 1E36B 2ALVA 3ATMA 1QB9A 5EPYA 2K8IA 1XUFA 2RCEA 2FODA 1HRTH 1F5KU 2WUCA 4JYUH 1CO7E 1ELAA 2TGAA 1YPKH 3FP7E 1LQDB 3PV5A 4BTIB 3UNRA 2J92A 4RKOB 4ZKNU 3PM3A 1UTQA 2NU1E 2ZTXA 2B8OH 1W0JD 1MZAA 2HNTF 1H8HD 1OHHD 1HLTH 3JZ2B 1LMWB 1RD3B 2TPIZ 4YT7H 5CHAC 1MUEB 1DWCH 3H09A 3SQHE 1F0UA 2BD8A 1ZMLA 5DO4H 1SGFA 2GGVB 4MTBA 4X6OA 1ZMNA 1SFQB 2NU2E 1HJAB 1DXPA 2BY5X 1IQFA 3NKKA 1RIWC 3DT0H 3SJ9A 2BMGB 1NBME 1GI5A 1O5FH 4Y0YE 3TH2H 1S81A 1DT2A 1TMBH 1GJBB 2ZHEH 3ZZCA 1KTSB 1TGBA 1Y3UA 2WV4A 1F92A 2Z3DA 1Z71A 5B6OA 1KTTB 1TGCA 1TNLA 1XKAC 4CREA 4Q2KA 1EUFA 2BQWB 1EPTA 4NIXA 3VB5A 1NU9A 2IPHA 2C8WB 1BHXB 4YZUA 5HKKD 5CHBA 1DUAA 3M7TA 1ANCA 3PV4A 1HAHH 2BOHB 4OS4A 4ZKSU 1PPFE 1EJNA 2Y7ZA 1QY6A 1SPJA 3ATKA 1E34B 4MVNA 3CP7A 1SGDE 1GGDB 3RC6A 3SGAE 1WCZA 1Y3YA 1GHAF 1C5OH 1SOZA 3UR9A 1WU1A 4TY6A 1YPEH 4F55A 1ELBA 3KYGA 1C5LH 1HJ9A 1MMJN 4AG1A 4DT4A 1UK4A 3P17H 4LZ1H 3G01A 4DY7B 1NN6A 1UO6A 1TPOA 1C1RA 1S0QA 1WUNH 4OS7A 3A85A 1HUTH 2V3MA 1JMOH 1GMCF 1P10A 2WPMS 1JWTA 4F4OC 3BTFE 3GDSA 4BANB 1Y3XA 1ZJDA 1V2TT 1GJAB 3ZVBA 1SC8U 3UR6A 1DWBH 4O97A 4OM9A 1QBOA 1GBFA 1GHBF 2Y80A 3M7QA 4WMDA 1AE5A 3UY9A 1C1PA 4K5ZA 1OWHA 1BUIA 4B2BA 2BD4A 2A5IA 1C5NH 1EB2A 2W3KA 3KNXA 3U69H 3TLOA 1TLDA 3UIRA 1P02A 3E6PH 5K0HA 1GBHA 1BMNH 2PFEA 3QLPH 4B2AA 1YLDA 2ZG0H 2J4IA 4AFQA 2P3UB 3GDUA 8ESTE 2K0QA 2VWMA 2A2XH 4B74A 3DUXH 3RXSA 1AQ7A 1QJ1B 4I31A 4KTSA 1KYNA 4GCHF 1LHGH 1O3FA 1O2ZA 1KXEA 5T3HA 2VH0A 2AYWA 3RXHA 4AN7A 1AB9C 3F3BA 3KYFA 1ANEA 2BVXH 2VNTA 2VB0A 1C1VH 1OS8A 3V7TA 2ZQ1A 4KTCA 3R3GB 1GDUA 1Z8RA 2H9HA 8GCHG 1DY9A 3T5FH 1C1QA 2RDEA 1C5YB 1QA0A 4IMZA 1EX3A 2FYQA 3NRLA 3RDZA 2HLCA 4ASHA 1S6FA 1SR5C 2RA0A 3LH1A 2G5NA 4I8JA 4AX9H 5LPRA 4DT7B 5ESBA 1TNJA 5LH8A 1ABIH 1MH0A 1QQUA 1ZMJA 3PO1C 1MKWK 1ABJH 1O3CA 4NZLA 2IOTA 3MO6A 1DS2E 5LPFA 1J16A 4JYVH 3TK9A 1UTLM 2DUCA 4NG9H 1Z6JH 4CRAA 2HLDD 1O34A 3LGUA 3MU8A 2RFKC 1QTFA 8LPRA 4XBCA 2O8UA 4WH8A 1AGJA 1CBWB 2AHME 1T8LA 1EAXA 4FETA 4JK6A 3N7DA 3MMGA 1K9OE 2H9EH 2QA9E 1GBMA 2DE8A 3VFEA 1VCPA 3MU5A 1FY5A 3D62A 2BVSH 3SNBA 4ZMAH 1MBQA 1A5HA 2ZFTA 2XYAA 2A4GA 2ZECA 3UREA 1A0LA 4WVPE 2VWLA 4FU7A 1TGSZ 4IC6A 1BOQA 5EJLA 2B7DH 2RA3A 3CS7A 3B23B 1CGIE 2SNWA 5JBTA 2BLOA 1CSOE 2PUQH 3Q00A 1TPPA 3UB0A 3GISB 1Z7KA 2ZU4A 3F2HA 3F0OA 2KR7A 3U1IB 1GGDC 1OP0A 3QGNB 2P95A 1H9HE 1QL8A 1SB1H 2BLWA 5C1UA 1TA6A 4Y10E 1FPHH 3BEIB 1O2LA 1F0TA 2PKSC 4MLFB 2AEIH 2ZCKP 3ZYDA 3D23A 4X1QU 3ZYEA 5FBEA 1D4PB 4JMYA 1C5ZB 3ZVCA 1GVKB 1P11E 1EB1H 3AW0A 3WY8A 3UFAA 1C9PA 3PTNA 1GMCG 1UK2A 3LONA 1FX0B 5GPIB 1A5IA 4TWYA 1O2NA 1MTNC 3U1JB 1MZDA 3TJNA 3T26A 1ELTA 3A8AA 4MPVA 4TWWA 5BPEA 1RXPA 1EFRD 3ZVGA 3BIUH 1IQHA 1IQKA 1G3BA 2ODYB 5GCHG 5BRRE 3M7UA 5C1XA 1VGCB 1A46H 1YPJH 5DP4A 3Q76A 3URDA 2ZFRH 3ZVAA 3UQVA 3KN2A 4INLA 1G30B 3SV7A 1W7GH 1TYNA 1GHVH 1H9LB 1HJAC 4M7GA 1Q31A 1ZPCA 5FCKA 1O5EH 2B9LA 1JOUB 2QF4A 1DX5M 1QNJA 6GCHF 2XBWA 1G3DA 2QE7D 3SV2H 3UNSA 1AE8H 1NRPH 2EQNA 5GNDA 1SGQE 6GCHG 1Y5AT 3RXAA 4D9QA 3E90B 3GOVB 4MNWA 2V7QD 1P57B 1SLXB 3NPSA 2VIVA 1ZGVA 2VGCC 5AFZH 2A7HA 1DDJA 1K1NA 1DWDH 2XNIA 3K6YA 3MU1A 2WSSD 1C2EA 4Y8XA 1UTPA 1A0HB 4ABBA 4Q7XA 1FY8E 1P0SH 1EZUC 2V6NA 3ATWA 1FJSA 1ARCA 1O2OA 3LGWA 3DCLA 5JPMH 1HDTH 2QC2A 3U8RH 2STBE 2A31A 2I6SA 1MTUA 2J98B 4ISHH 4MDSA 4B1TA 1O2WA 2EY4C 5JBBS 1GVLA 2THFB 2XTTB 1O2GH 1PPCE 2O8TA 3V13A 1BTHH 2W7SA 3F2GA 1GG6B 1XUKA 2KCPA 4H6TA 3FP6E 1HAPH 4MNXA 1MABB 3V3MA 3SW2B 1L4DA 3ATLA 1WBGB 1NRNH 3D65E 4NWKA 4X6PA 4D7GA 5T6GA 1J9CH 3SGBE 3STJA 2EI6A 1QZ8A 1NS3A 1MTWA 4P02A 2F9UA 3A84A 1AHTH 1ANBA 1C4Y2 1O30A 2FM2A 1HJ8A 1O2KA 1SI5H 5L2YH 2BDBA 3NXPA 2Q6DA 2W3IA 4ZH8A 4BTTB 1KIGH 2OP9A 2WINI 4B6EA 2FZZA 3SGQE 4K1TA 1O3JA 2ZP0H 1O2JA 4H4FA 4HGCA 1GCTB 4KGAA 4VGCB 1BA8B 1P01A 1K1OA 3S7HB 1OWKA 1W0ZU 2PKAB 3DHKH 1O3GA 5EIYA 1BQYA 2CF9H 3GCHC 5G4BA 4AC9A 1A3BH 1S85A 1TNIA 2EI8A 3M5MA 5A8YA 3O8DA 1V2PT 1OKXA 4H6SB 2VH6A 1Y5BT 1DSTA 2VBCA 1SGRE 3PLKA 2ASUB 3AK5A 1E35B 1W10U 1LVOA 3M35A 1GBDA 1FUJA 3TPIZ 4CBOA 2ZFFH 4SGBE 3GCNA 1BTPA 3A81A 3GCTG 1V2RT 3PRBA 1L0ZA 1HPGA 2F43B 2J5UA 3EE7A 2ZDKA 4FU8A 1GHYH 1L1GA 3WWBA 2TIOA 4UE7H 1GI3A 3QUMP 3SU0A 1GMHF 1D6RA 3RXBA 2YNAA 3M61U 4Y11E 1W12U 4XDEA 1SGCA 1V2UT 3S9CA 1HBTH 1KXBA 4Q80A 5F6MA 1D3TB 1IQLA 2R0LA 1L2EA 2HALA 2ZDMA 5CMXH 1QB6A 2H9TH 1UMAH 2ZDVH 3M5NA 5TCAA 4AGJA 1PJPA 1O38A 2Y81A 1TX8A 1AY6H 3U28C 2GZ7A 4INKA 1MQ5A 3BTTE 2ZGXH 1GI2A 2HWLB 1AWFH 4YLUA 3BTKE 4M9FA 1YBWA 4D7FA 1Z8JB 3EYDA 4K1EA 4Y76A 2FOCA 2VJ1A 4JK5A 1J8AA 1EZXC 6ESTA 1W14U 3A7XA 4A1TA 1NZQH 1BDAA 1IQNA 5L2ZH 5J4QA 1W13U 1A2CH 1QBNA 1WV7H 1BRBE 2QN5T 2ZZUH 1KXFA 2LNCA 4NFFA 3T25A 1D3QB 1CA8B 3M3TA 1ELDE 2Z9IA 3NWUA 5FHTA 5EXLA 1MCTA 2QYIA 5A8ZA 4WF8A 1G3CA 4WMFA 2A5KA 4WH6A 1SGEE 1HAYB 2ZU5A 2ZGBH 1JBUH 2ZKSA 3ZZ6A 2XC4A 1H4WA 1SMFE 2G52A 2J34A 4YOIA 4WXVA 2OXSA 1QL9A 2Y7XA 3OU0A 5GCHF 3SJ8A 1M9UA 3KQ5A 5HYOA 2HPPH 1GBLA 1DPOA 4MPXA 3LGIA 3A7ZA 3TJOA 2Y5FA 3SN8A 1AZ8A 3CS0A 2ZDLA 1GL0E 5JB9S 2UUKB 2VIQA 1CGHA 4NSVA 2FYRA 2VVVA 1P03A 2WYGA 1TBRH 2VGCB 3PB1E 1QURH 2QXIA 4F49A 2VWOA 4JYTA 4AYYB 3QN7A 3RXMA 1DY8A 1VKYA 1AKSA 3K9XB 4FUEA 1EZSC 2GX4A 4WY3A 1AVGH 4FUFA 2GD4B 4WWYA 3QX5H 2O9QA 4A1VA 2G8TA 2JH5D 5JYIA 1LQEA 2QAAA 2GZ9A 2WPDD 2NU4E 4J1YA 3KHVA 4WJG2 5FX6A 1GJCB 1P2JA 4Y8ZA 1F0RA 3PMJA 5FBIA 1GDNA 1E38B 1MTNB 3GY4A 2QXGA 4DGJA 2WV5A 3GDVA 4FUGA 5CDFE 1XUJA 4E06H 2A5AA 2YNBA 4A5TS 4OS6A 1LHDH 3T2NA 1DWEH 1C1NA 1ARBA 4I8KA 3AASA 1S0RA 2F83A 4GUXA 4HG6A 2R3YA 1TQ0B 1OPHB 1C5RA 4HI3A 2EA3A 1TONA 1C2MA 2BDHA 3SU5A
chains in the Genus database with same CATH topology
1HNEE 2ZU1A 1G2LA 1LHEH 1CGJE 7GCHG 3TU7H 3ZZ8A 1C1UH 4GLYA 3VGCB 1O3HA 2PLXA 1K1IA 1SHHB 1N8OC 5L6NH 4RSPA 3VB3A 1IQEA 2HGTH 2CGAA 3KQEA 2OC8A 1C1WH 1WQSA 3OSYA 3Q3YA 3A7TA 3BG8A 2BQ6B 4Y6DA 1HXEH 1FMGA 1T8NA 4D9RA 2VINA 3F6UH 1DICA 3R0FA 3LOXA 1J15A 1FN6A 5HGGA 1PQAA 3GYLB 2ESTE 3OTJE 4GHQA 1CA0C 1ZTJA 2ZO3H 1T4UH 4YLQH 3GY7A 1BTXA 2FI4E 4AFUA 5ETXA 4AFZA 1O2YA 1GL1A 2SGPE 1O3EA 4ISOA 1VITH 1OOKB 2H5DA 1V2JT 2ALPA 1UVOA 3ATIA 3PWCA 3EA9A 4HZHA 3GY6A 4BNRA 4IMQA 1VCWA 1X7AC 1EQ9A 1OP2A 4X1RU 2QCYA 3RU4D 1ORFA 9LPRA 1WSSH 4QT8C 1OYQA 3RM0H 3PMHB 3UQOA 4NIWA 3IITA 1LKAA 3GY5A 2BDGA 3PO1B 2ZFQH 3OY6U 1O5BB 5ABWA 1LTOA 3E1XB 3TGKE 1XKBC 2JKHA 2VWNA 1YYY1 4X2VA 1Q2WA 4Y79A 1A3EH 4X2WA 2BX3A 3MNCA 4KKDA 2SNVA 5A09A 1O39A 1S83A 1O37A 3ZV9A 3KF2A 2Z3CA 4GVUA 5E0GA 2R2WU 1TQ7B 1GBEA 2R9PA 3OYPA 2OBQA 3RXOA 1A1RA 4X6NA 4X8TH 4YT6H 3H7OA 1BJVA 3RUOA 3ODFA 2AMDA 2BD3A 1AB9B 1O5CB 2BOKA 2AGEX 2ZTYA 1RS0A 3P8FA 3FVFB 2FXRA 3I78A 1ZHMA 2GZ8A 3A7WA 1YGCH 1GVZA 3LT3A 5EODA 1TNGA 5A0BA 1RTLA 1C9TA 1ACBE 5AVDA 1GMHG 2A7JA 1FY4A 2D8WA 4ZKRU 1TRYA 3TNSA 1RTKA 2UUFB 3JZ1B 2HRVA 3RXTA 4E7NA 1PPHE 4TYDA 2P94A 7LPRA 1BTWA 2QY0B 1P2IA 3MH5A 3RXLA 1C5XB 4IN1A 1O2SA 2A1DB 3L33A 1C5SA 4ABFA 1GBKA 1V3XA 5F8ZA 1QL7A 1EOLA 1WTGH 3W95A 1BB0B 2BTCE 1KSNA 4CRCA 2GP9B 1KLJH 2WYJA 1TBZH 1ANDA 2G5VA 3ZZ9A 4FXGH 1BTYA 4K60A 2V0BA 1YPGH 1P9UA 1GI4A 3EA7A 2ZPRA 1G36A 2UWOA 1TMUH 3A89A 3RU4T 4ISNA 1TBQH 2XBYA 4NSYA 1ZYOA 1VITG 1NM6A 1O3AA 3RXCA 3PWBA 1NY22 1O5DH 2XC5A 3MHWU 4INHA 1P3EA 3SZNA 1KLIH 3BF6H 1NRRH 3VB6A 5LPEA 2BX4A 1NESE 1P2MA 1EOJA 1VJ9U 4XSKU 5FCRA 5DGJA 2AFQB 3A8BA 2GT8A 1A0JA 3MOCA 1EJAA 3VXFH 3KQDA 3T62A 1XXFA 3SU6A 4B73A 2AS9A 1TX6A 1OYTH 2TGTA 6LPRA 1FIZA 4MNVA 3E16B 2BY7X 3VGCC 4BAHB 4KP0A 4A1XA 1QFKH 2Z7FE 3LC5A 1Y8TA 2ZIQH 2OQUA 1YPHE 5HM2A 4FUJA 5LGOA 4YM9A 3BTGE 5DP9A 2ZGCA 3FAOA 5EQRA 1TNHA 1GJ4H 1P12E 2GV6A 1AN1E 3UTUH 2F9VA 1C5PA 4IC5A 1BTUA 4K2YA 3P8OA 1AO5A 3PTBA 1LPKB 3VB7A 2FX4A 3LDXH 5GJ4B 3A86A 1D3DB 2D1JA 4ABHA 2A0QB 4DCDA 2ZDNA 1ZR0A 3A8DA 3PROA 2FEQH 2G4TA 3D49H 1HAZB 1YKTA 1ZSKA 1GHZA 4AB9A 3BTQE 3I29A 1WAYB 2EI7A 3LJJA 2CF8H 3BIVH 1ZSJA 1DSUA 3H5CB 5EXNA 3TK5A 4CH2B 1VITF 2SGDE 2BD2A 3HATH 1IQMA 3M37A 3RMMH 5K7RA 3RXKA 1RGQA 1TIOA 1ETSH 1TOCB 4D76A 1NRSH 3MTYA 2CJIA 3GICB 1V2LT 3MH4A 3TJVA 3BG4B 1SGFG 3A80A 1GHAG 1NTPA 3M5LA 1C1OA 1Z1JA 4GSOA 2OQ5A 1EZQA 5J4SA 1YPHC 2FMJA 4BOHA 4ABIA 5A8XA 1DXWA 8KME2 1U6QA 3UOPA 4CRBA 1AZZA 1O5GH 3LH3A 1UVSH 2WPIS 2V3HH 3SJOA 2BY9X 1O2XA 2P16A 4A92A 2BQ7B 2VIPA 2OC1A 3CENA 1UHBB 1DOJA 1O3BA 1O2QA 1P05A 4O3TA 3SUGA 2J2UA 3FP8E 1FIWA 2IJOB 1LHFH 1YC0A 4JZFH 4DIIH 3RXGA 1G37A 5T6DA 4MQAA 1KLTA 2J94A 1GBCA 6CHAC 2ANWA 2UUJB 2F9BH 3EGKH 4BAMB 4OGYA 1BBRK 1D9IA 3RXPA 2RG3A 3TH3H 1TE0A 4JZEH 1INCA 1VZQH 1F5RA 1CT0E 2FLRH 4FVDA 1GHXH 2ZC9H 4GCHG 1GBTA 1FZZA 4K3JA 2GMTB 2JH0D 1SGIB 2D2DA 5EW1H 1H8IH 1O33A 1A5GH 2FP7B 4KELA 5CE1A 1A4WH 1AUTC 2JETC 2F9PA 1ELCA 2AERH 2FOAA 2PR3A 2ODPA 3F9EA 4BAOB 3A7VA 2FIRH 5JB8S 1EKBB 2GT7A 5FAHA 1JIRA 3W94A 1AD8H 1AU8A 1QQ4A 2G55A 3F9FA 1HAXB 2PV9B 3AAUA 3O8BA 5T6FA 1ZSLA 5EW2H 1P2QA 3IWMA 2Q6FA 2BD9A 4BXSA 2OC7A 1YPMH 1GI1A 4PROA 4BXWA 4BTUB 5E2PA 1SOTA 3GY8A 1DLEA 1V2MT 4OGXA 1H9IE 2XBVA 1AFQB 4XBBA 2ZHWH 4FUHA 1THPB 3RMOH 5C2ZA 5DKMA 1P8VC 1B0FA 3KL6A 2FOMB 2YOLA 4XFQA 4CRGA 2BYAX 2NU0E 3URCA 1EJMA 3HPTB 2ZHQH 1BTZA 5I46H 3K2UA 2A4OA 1CT2E 1XX9A 2Z94A 2CMYA 1SLVB 2AMPA 2PGBB 1C2KA 1YCPK 2PHBA 1W0YH 1TA2A 1ZPBA 1GJ5H 3BSQA 3UPEA 4YTAA 2ZCHP 1F7ZA 1DE7H 1UTOA 4A7IB 1SHYA 1G2MA 3TITA 1Y3VA 3NK8A 1GG6C 4NZQA 4X1SU 1RJXB 4O9VA 3DA9B 4GHTA 5E0HA 1GI8B 3BV9B 2J95A 3SHCH 2WPHS 1YLCA 3DFJA 3RC4A 3V12A 3VXEH 4K8BA 5DP5A 1PQ8A 3EA8A 3VPKA 4RKJB 3MYWA 1P04A 2ZWLH 1UVUH 3ZZ4A 4CR5A 1EATA 4AFSA 1O31A 2OUAA 1ZHRA 1UTJA 2ODQA 4LXBH 1QRXA 1O0DH 4Q7YA 1HXFH 1SFIA 1AI8H 3SQEE 3ZVFA 1K1PA 2FLBH 1RTFB 1T7CA 4ABDA 4ABAA 3GY3A 1L1NA 1C1MA 1ZTKA 1QCPA 4Y0ZE 4B75A 2BDAA 1ZRBA 4U32A 2XC0A 1V2NT 1ZRKA 1Y5UT 1Z8IB 1CHOF 3PMBB 2CHAB 5AHGH 1SSXA 1O3OA 4HFPB 5C5OA 1TALA 2GKVE 1KXCA 4A6LA 4CRDA 2O8WA 2GDEH 1SBWA 2OC0A 5HMAA 1AWHB 5GDSH 3C1KA 2QGRA 1SQOA 1O3DA 3Q3KA 2OINA 4I8LA 1ZPZA 1WQVH 1VGCC 1O35A 3RMNH 1LKBA 4CHAB 4I8GA 1LPGB 2AIPA 4XE4A 4NIVA 3ZZBA 4DOQA 1GJ7B 3UUZA 4FUCA 1FY3A 2PWXA 4NCYA 3HGNA 3RXIA 5HXFA 2FTMA 2ZDAH 3P95A 4UFGH 2ZTZA 2K1QA 3MNBA 3QGJA 1GBAA 1EAIA 2EC9H 1OXGA 4ZXYH 5A2MH 1ELGA 3ZVEA 1T4VH 4X8VH 2BZ6H 1GDQA 2M5TA 3SV6A 2HPQH 1IHTH 4GPGA 1TGNA 1UJ1A 3BN9A 4NGAH 1IOEA 4Y7BA 1BCUH 1O3IA 4MNYA 4MPUA 3FZZA 2AGIX 3P70B 3F9HA 4K1SA 1SGPE 3RXJA 2QF0A 1YCPM 3T27A 3QWCH 3LPRA 4X0WU 1NFYA 1UTMA 5FPSA 3S9AA 1JRTA 1ZZZA 2GVFA 3F9GA 4LOYH 4CBNA 4TPIZ 3KCGH 2Z9JA 3ZZDA 3O8RA 1AKSB 1T32A 4UEHH 1EP5A 1TMTH 3HGPA 1QJ6B 2OLGA 4J2YB 5DP8A 1UCYE 3ZV8A 1YM0A 1BRUP 3S7KB 1OWJA 2VIOA 1HIAB 5F03A 2XCNA 4WXIA 1QJ7B 2SGAA 2Z3EA 3HKIB 2FO9A 1HGTH 1DFPA 4R0IA 1MQ6A 3MFJA 2BHGA 7ESTE 3GY2A 4GAWA 4ISIH 3FANA 3ZZ7A 2ZEBA 5DP6A 1QGFA 1CU1A 1CT4E 2QIQA 1K22H 3ZZ3A 3SO3A 1V2VT 3SU2A 4I7YH 1AIXH 5FPYA 2C93B 1NC6A 1OP8A 1WYKA 3LGVA 3ZZAA 1E37B 1TRMA 2ZNKH 3QZRA 3S0NA 1DVAH 2XWBI 3RMLH 2STAE 5C20A 1SGNE 1THRH 2FOGA 3AW1A 1GI7B 1W11U 2JETB 4LK4A 3VEQB 2GTBA 2FOFA 4VGCC 1LVMA 3SUEA 1GCTC 1QIXB 3B9FH 1QBVH 1W2KH 1CHGA 3BTEE 5DJ7A 1H1BA 4WMEA 3ODDA 3V0XA 1YP9A 1LVYA 4NA9H 3RC5A 3P6ZB 2GMTC 2BD7A 2H2ZA 3TK6A 4AORA 1AVWA 1SL3A 3PLBA 1LPZB 2Y82A 4KTUA 1ESTA 1GI0A 1BITA 4O3UA 1S82A 1TOMH 4Y71A 1ELVA 2TBSA 3SU3A 1HAVB 9ESTA 1DITH 2A7CA 6CHAB 1TNKA 1KXAA 4FUBA 5JDUB 3MH7A 1C5UA 1G32B 2J38A 1WOFA 3MI4A 4IW4E 1MBMA 1EXFA 1GHWH 1BRAA 1FPCH 4ZAEA 3SNEA 4E7RG 2P3FH 1ESBA 1TABE 1GPZA 4DW2U 3SUDA 2H6MA 2HOBA 1ZJKA 4FU9A 1FN8A 3M5OA 1HIAA 1ZLRA 2WUBA 2BLQA 4FUDA 7KMEH 2WPKS 1S84A 1HAGE 3SI4H 1MKXH 3OX7U 1C5VA 2FESH 1WTHD 1ZTLA 1C4U2 2A2QH 2IN2A 4X8UH 1BRCE 2A32A 2BB4A 1TB6H 2PTNA 1AMHA 2PUXB 4E05H 1AFEH 1SGYE 4Z6AH 3SNCA 2CXVA 3SUFA 3TH4H 1RRKA 3RLYH 4DJZB 1XUIA 3O8CA 2XW9A 1J14A 3RXDA 3UNQA 3BG4C 1NFWA 4CR9A 2TGPZ 1Z6EA 2VIDA 2FOEA 3RXVA 2AMQA 3NZIA 2R0KA 1EASA 1BMLA 1XUGA 5EQQA 1IQIA 1HAVA 2FWWA 2P93A 3QTOH 3SJKA 3KQBA 1O5AB 1UVPA 2CN0H 3FZDA 2G81E 2KAIB 4NA7A 2ZF0H 2C90B 1C5WB 1AUJA 4YOJA 4X6MA 2BDIA 2BY6X 4CRFA 1D3PB 1HAIH 1EAUA 1HYLA 3A7YA 5E0JA 4B2CA 1RIWB 1HB0B 3UWIA 4AZ2B 1UCYK 2C8YB 3TIUA 4ZHAA 4AB8A 5GWZA 3TGJE 1S6HA 1XM1A 4MG3A 1O2MA 3SI3H 1TWXB 4R8TB 2OTVA 1JXPA 1MAXA 3MNXA 1GMDF 5CHAB 2F9NA 3TJUA 3LKWA 4OS5A 3RU4E 2ZA5A 3SV8A 3U8OH 1LDTT 4D8NA 4HTCH 3MO9A 1C2LA 2PKSB 2O8MA 1FI8A 1O2TA 2F9OA 3BEFB 3IG6B 2XRCA 1Q3XA 4NFEA 2H1UA 4U30A 3B8JA 1F0SA 5C5NA 2BLVA 3SNAA 3MO3A 4RN6A 5H4IB 4K69A 1W7XH 1RFNA 3N7OA 5FPTA 1PQ5A 2ZHDA 1GJ9B 2Z6BD 3NCLA 5FX5A 2Q6GA 1P06A 3K6ZA 1LVBA 4THNH 3L3TA 1O2HA 1V6DA 2Y5GA 1PPGE 3E0PB 1MAYA 3QK1A 3SV9A 1C2IA 2QF3A 4DURA 2PTCE 2BXTH 2NWNA 3T28A 4SGAE 4NIYA 2G00A 1MU8B 2ZHFH 3GYMA 1J17T 5EGMA 1V2WT 4XBDA 1TPAE 1FAKH 4DVAU 2ULLA 1G3EA 1BHXF 2R3UA 2ZGHA 1CBWC 1T31A 2SFAA 2GCHF 2F91A 2PKAA 1FQ3A 4UONA 5TCCA 3P8NA 4I33A 2HNTC 1YCPH 3LC3A 2GDDA 2EEKA 2SGQE 1PPZA 1A7SA 1K1LA 3QTVH 1PPBH 3M3SA 1D6WA 1TFXA 5A0AE 1NFUA 2FX6A 5DPAA 3PMAB 1P09A 3E91A 4JCNA 1GJ6A 2BZAA 1O32A 3F1SB 1DLKB 3EQ0H 4UFFH 3SOSA 3LGYA 1L4ZA 3RP2A 2FDAA 3RLWH 1MD8A 4AGKA 2BM2A 2PSYA 1BT7A 4ABJA 1Z8GA 4FVBA 4UFDH 4DG4A 1C2GA 3EAJA 3BTDE 3SNDA 3ZVDA 2FOBA 2GV7A 2A4RA 1C4V2 3PLPA 2C3SA 1FLEE 1YF4A 1MTSA 2G4UA 3M3VA 2D26C 1BBRH 2UWLA 2ZU2A 4OS1A 2UWPA 1O3PB 2GCHG 1K28D 4I32A 4ABGA 1CHOG 1B7XB 5JBAS 2AGGX 1W3CA 1Y3WA 3SJIA 2OCVB 3SORA 3QDZB 1P2OA 2WPLS 2BDCA 2ZGJA 2A4QA 1C5MD 1PPEE 3PYHA 1T8MA 2ZPSA 1P2NA 4DIHH 3OY5U 3P92A 1MKWH 4UFEH 2XXLA 1FV9A 1CVWH 1ESAA 4FUIA 1B0EA 4Y8YA 3TNTA 2PGQB 2W5EA 4U2WA 3ESTA 3LGTA 1K2I1 4X1NU 1C1SA 3I77A 2FTLE 3RXFA 8GCHF 2XBXA 2C4FH 4X8SH 1TX7A 4IGDA 5DP7A 2ANYA 1CA0B 2P3TB 3STIA 1W8BH 4X2YA 1CQQA 1KDQA 3MU0