3L3TA

Human mesotrypsin complexed with amyloid precursor protein inhibitor variant (appir15k)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRSS3 protein
publication title Determinants of affinity and proteolytic stability in interactions of Kunitz family protease inhibitors with mesotrypsin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/cell adhesion
total genus 55
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3l3tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3l3tA02
1GMDG 1HCGA 1ANDA 1SGRE 1AKSA 2Z6BD 1XMNB 1BRCE 1BZXE 1K28D 2F9UA 2G51A 2ZI2H 4MPWA 3P92A 3JZ1B 1P10A 2B9LA 7KMEH 4CBNA 2STAE 1S82A 3R3GB 1YPLH 4YESB 1TNIA 1HAGE 1T8LA 5ESBA 1KY9A 4BTIB 2OC7A 2VIWA 1FN8A 3IG6B 1P03A 1UJ1A 4ZH8A 1O35A 1OWIA 3D23A 3C1KA 1WV7H 1OWHA 3BN9A 4IMZA 8GCHF 1WQVH 1O30A 5AVDA 1FI8A 1WYKA 4BTUB 4I33A 1QQ4A 1TBRH 1C2JA 6GCHG 1P2IA 1AUTC 3CS7A 1UVTH 3RXFA 1NTPA 4J1YA 2GP9B 1CGIE 5E0GA 4E7RG 3UY9A 2P95A 3V7TA 2SGAA 3P6ZB 1PYTD 4FVBA 5DO4H 3TH2H 1GJ8B 1DLEA 2WV4A 4D76A 4FU7A 1UCYE 1GVKB 1KSNA 4FU8A 2OTVA 1TGCA 1YLCA 1KLIH 2PWXA 1O3EA 3RXAA 6ESTA 4AORA 2J38A 4ASHA 1P05A 3ITIA 1HPGA 1NRSH 1YKTA 1GI1A 1UMAH 2FLBH 3P17H 2QCYA 3QK1A 1B5GH 1QIXB 2J4IA 1O5CB 2BLWA 5AHGH 2VWOA 2AIQA 3KQBA 2FS8A 2PHBA 1WQSA 1ZR0A 1BQYA 2FI4E 2GKVE 4CRCA 3GY5A 1NESE 1GDUA 5I25A 1OP2A 4I8JA 3AW0A 4I8KA 4AB8A 2BVXH 4BAKB 4JZIA 1ESBA 1FIZA 2BDCA 5A09A 5IDKA 3BEIB 1C5MD 5A2MH 1Z7KA 1GI3A 5EPNA 4OS4A 2ZFSA 5A0BA 3ZVDA 1PPZA 1CGHA 1VZQH 3MTYA 3RXIA 4GAWA 3M7QA 1AD8H 1HJAC 5GXPA 5A0CA 3MH5A 2BD7A 1Z1JA 3M3VA 1SGCA 2A7HA 2YNBA 4A1TA 3U69H 2P8OB 1W12U 2WPHS 3P8OA 5JBTA 2FODA 4NFFA 1TNGA 2ZFFH 3SJIA 1OWJA 4MLFB 1ZRKA 2PKAA 1BOQA 3BTHE 3KGPA 2XC4A 2SFAA 4YT7H 4YLQH 1C5YB 2ZU5A 2CJIA 1Z6JH 3MH7A 2GCTC 3E16B 4TPYA 1YLDA 5EOKA 1IAUA 3K9XB 2D2DA 2BDBA 3U8RH 1A1RA 4O03A 1UVOA 3R0FA 1TRYA 3KL6A 3PTBA 1XX9A 5DP9A 3RXHA 1EZXC 3SGBE 1P2JA 8ESTE 4U2WA 1EATA 4PROA 3LU9B 1GMDF 1ZHRA 1LQDB 5F6MA 2VU8E 5E0JA 3GCTF 1GJ7B 2BDHA 2GMTB 4TPIZ 1G30B 1ZGVA 3F6UH 1PPFE 3QZQA 3BTTE 1A61H 1O2GH 5CHAC 1W0YH 1A2CH 3U8OH 1BHXB 5EW2H 1SLWB 2D1JA 2HWLB 3M36A 1C2GA 3RXGA 2A7JA 5JPMH 2A1DB 1O3MA 2H6MA 1VGCB 4ZHLU 1D6RA 2V6NA 4MPVA 2C8WB 4AFZA 1GI2A 3MWIU 2A45B 3S0NA 3PROA 3A81A 5GCHG 3HGPA 1FY4A 3OX7U 3PMBB 4ABFA 5FAHA 3H7TA 1QRZA 1C1RA 1QB6A 4RKJB 3SJKA 3AAUA 3STJA 3FVFB 1Q2WA 3TJUA 4GSOA 1MTNB 2BDAA 4ZMAH 3A83A 3WY8A 1JOUB 2QA9E 1VCWA 2BXUH 4ZAEA 1GHXH 1O3IA 1O5EH 5EXMA 2R3YA 1EAXA 3DHKH 2FYQA 1TGNA 2BHGA 4MG3A 1K1LA 1VCPA 3A84A 2C8XB 1DVAH 3LONA 1BRBE 1C9TA 2ESTE 1DSTA 1P3CA 1RTKA 3M5MA 1O2TA 1FN6A 1GGDB 1D4PB 2BTCE 3HKIB 1G3CA 2OCVB 5LPEA 4Q2KA 4UFFH 3BG8A 1QB1A 2FOBA 3O8CA 2YNAA 3ELAH 2XNIA 1UK3A 2VWNA 3T25A 1UTNA 1GI8B 1EB1H 3H7OA 1C4U2 2B8OH 1ZTLA 2VH6A 4JYUH 1SR5C 3P95A 4KTCA 1WUNH 1XXDA 1UTKA 1H8IH 1EAIA 1O3BA 4XFQA 4CHAC 1O3DA 2PKSB 4GUXA 1AZ8A 2W7UA 1WTHD 2FOGA 2HRVA 5FXLA 4K8BA 2A32A 1B0FA 3RXCA 3ZZ7A 1AO5A 2ANYA 5JYIA 3HATH 1Z8IB 1YP9A 1Y5BT 3K6ZA 2H9TH 2BM2A 1KLJH 2AMPA 2EEKA 2TBSA 5BPEA 2BX3A 2DE8A 2BD5A 1GBFA 1O2IA 1P09A 3RXRA 3E91A 1HAPH 1FQ3A 2FTLE 2ZCKP 3W95A 2BVSH 2H1UA 2A2XH 3RXOA 1HJ9A 5EQQA 1NT1A 4VGCB 3QDZB 3VB4A 1VITF 3SU4A 1RFNA 5B6OA 1GL0E 4MNWA 2G5VA 3UWJH 4GVUA 1C2LA 1QTFA 1Y59T 2XBXA 1PPHE 4ISHH 5AFYH 1P0SH 2CV3A 3CP7A 2DUCA 1OYQA 1GJ5H 4E05H 1K22H 3BEUA 3RXSA 3QGNB 3SJ9A 1F5RA 5A8ZA 4K60A 1LQEA 1NU9A 4UFDH 4AOQA 1DWDH 1RTLA 2GZ8A 2ZQ1A 4J2YB 2VIVA 1BMLA 3MNSA 1QRWA 1HIAB 1PYTC 1QCPA 2ASUB 3T26A 3VPKA 3G01A 2ZFQH 1GJ9B 4Y8ZA 4DG4A 4KELA 4OS6A 1U6QA 4WF8A 2BVRH 3RC5A 1EB2A 1O36A 3ENSB 1D3TB 1YM0A 1CA0C 1FNIA 2F9BH 2F9NA 1QBNA 1SFQB 1C1WH 2ZGXH 4B1TA 2QYIA 5HGGA 1RIWC 1FPHH 2WYGA 2P93A 1WCZA 1Y3WA 1O3KA 1MCVA 1DUEA 6LPRA 1LHFH 2HALA 2WPLS 3BG4C 3MO6A 2AMQA 1PFXC 2ZTXA 3MNBA 3TGIE 1ZMNA 3MFJA 3SUEA 2WPKS 1GDNA 3RXMA 2BLVA 2G52A 2BD9A 2PSXA 1CVWH 1FPCH 1C5NH 2NU0E 4JZEH 4BTTB 1LMWB 4O3UA 4UFEH 2A4QA 2ZG0H 1Q3XA 1QURH 3SNEA 4ABGA 3PLKA 1YPHE 1ZHMA 3UPEA 1V2UT 1CHGA 1K1MA 1V2ST 1FY5A 1O2OA 2CHAB 4Z6AH 3QX5H 4X8SH 1NFYA 1ELAA 3SU5A 3T5FH 4KGAA 3RDZA 2QV1A 4GPGA 2PV9B 2BLOA 1O2JA 2XBWA 4ISLA 1SB1H 5EODA 5FX5A 2TRMA 1TALA 4TY6A 1DUAA 1MTVA 4K1EA 1MKWK 5T6FA 2VIDA 4GCHG 1J8AA 1NPMA 2NWNA 3GCHB 3VGCB 1AFQC 1BITA 1NM6A 3MHWU 4IN1A 4ZKSU 3PV4A 2G81E 2NU4E 1ZLRA 1E34B 4Y8XA 1O33A 1GHZA 2H5DA 1OWDA 3DFJA 5DP6A 5EPYA 3F68H 4D7FA 4DOQA 4X1PU 1BTWA 2XRCA 2XC5A 4IC6A 2HVXA 3LIWA 2FOCA 2A4GA 1P9SA 1P11E 1V2LT 1Z6EA 2VIOA 1AUJA 4A7IB 3NPSA 4DY7B 2JH5D 1G36A 1O2VA 1BCUH 4AB9A 1V2QT 2PUQH 2B5TB 1VJAU 1OWEA 3PO1C 1G3EA 1L1NA 2C8ZB 4KTUA 3D65E 1J15A 3P70B 1HXFH 2Q1JA 3F1SB 4NIWA 2FXRA 2BZAA 2A5AA 2O8MA 1XKAC 2ZHWH 1FZZA 1HIAA 2F83A 4Y11E 3UQVA 1SPJA 4I31A 3IITA 3KF2A 3TK9A 1G9IE 1L0ZA 1O3FA 1K1JA 1SLVB 1NFWA 2FYRA 1FAKH 3URDA 1ARBA 1O2UA 4E7NA 2ZGBH 3FP7E 1A5GH 3ZVCA 1HBTH 2PTCE 2R0KA 4FUBA 3QTVH 1W13U 3GISB 3GY3A 1KXDA 3OY6U 1NN6A 1SQTA 1A7SA 2BLQA 4ZROA 5EXNA 1W3CA 3MNXA 2QY0B 3ATLA 9LPRA 3V12A 3DD2H 1KYNA 2GGVB 1QJ1B 2A7CA 1C4Y2 4K69A 3OYPA 3QGJA 2P3TB 2SGEE 4Q7ZA 1GHAF 4I8GA 1GVZA 2ODYB 2GDEH 3KCGH 1GHYH 1BJUA 2TGAA 4Y8YA 3GY2A 3RC4A 1C1OA 4X2WA 1SG8B 3ZZ6A 1F0SA 1BMNH 1DM4B 3ATIA 1TAWA 1VITH 3LJJA 4BAOB 4YO9A 4Y0YE 2FOHA 1EX3A 2XYAA 4RN6A 2RG3A 2CXVA 1KTTB 4JK6A 3ODFA 1GBCA 1FJSA 1A0LA 1O2WA 1DS2E 2BY6X 1LHDH 1ZMLA 1O3PB 1QQUA 1GJDB 3RLYH 1IQHA 2WPJS 1P2QA 3LC3A 1A0JA 4OGXA 4X8VH 4MNXA 4K8YA 1O5FH 3TIUA 4AGJA 3E3TA 3SNDA 3M35A 1TA6A 1C4V2 5DG6A 1AWHB 2IJOB 1SGQE 1KIGH 5HM9A 2VVCA 3BTGE 4U32A 4Y10E 1ELVA 1MU8B 3NCLA 1CT4E 1SVPA 1NRNH 4MPXA 1F2SE 3PLBA 1OKXA 1O5GH 1SSXA 1D3QB 4XDEA 2BQ7B 2XTTB 2A4OA 3IWMA 1VCQA 3RXJA 2SGDE 2ZGHA 1K1IA 2Z9LA 2AGEX 1SL3A 2J9NA 3SV6A 4DGJA 1BRUP 4X6NA 1O2MA 2QAAA 3E0NB 4AN7A 4DW2U 2OC0A 1D3DB 5L30H 1EJMA 1SGIB 3LT3A 1ZMJA 4BANB 3V13A 2THFB 2BD3A 1LVYA 1EKBB 1C1VH 1N8OC 1O2SA 3GCTG 3PYHA 1SHHB 1AGJA 2ILNA 1SGFA 2BOHB 2CGAA 1GI5A 1XUFA 1DOJA 1SGYE 1PJPA 4ZKOU 2VIPA 1GHWH 2H9EH 1T4VH 2ZPRA 1AVGH 2HPQH 2V3HH 3B23B 3HKJB 4NA9H 2A5KA 4AFSA 1M9UA 3BIVH 4Y6DA 3PB1E 3FP6E 5EQRA 5C3NA 3TJOA 4NFEA 1CBWB 2RCEA 4IW4E 1GMHF 5DP7A 1PQ5A 3ATWA 1TE0A 4TY7A 1C2DA 1MTUA 1SGFG 3P8NA 1C5SA 2O8LA 4JZ1A 1JIMA 1CA8B 1S6HA 3MU5A 2ODPA 1CT2E 1IQLA 3RU4T 3SOSA 4FXGH 2EA3A 3BTWE 5JBCS 1THSH 4NWLA 4DVAU 1GBBA 1KDQB 1P06A 2JKHA 2OBQA 1V2WT 3RXQA 2FIRH 3PMAB 3TNTA 2F91A 1ETSH 3NUMA 3A8DA 1RRKA 1SLUB 2VWMA 2GMTC 5E0HA 3ZV9A 1C9PA 1EPTB 1LHGH 1O3OA 3GICB 1YCPM 2SGFE 3OU0A 3MOCA 1J16A 1KXFA 1ACBE 1TRMA 4INHA 3VEQB 4B74A 3T2NA 2V3OH 3SNAA 2OXSA 2EI7A 1C5OH 1OYTH 1AB9C 1G3BA 2OINA 4IS5A 3LOXA 5DKMA 3RU4E 3TGKE 1B7XB 1VGCC 2FOMB 1ESTA 2OLGA 5E8EH 4K5ZA 3GDUA 1Y3VA 4AX9H 1ZJDA 5EXLA 3PWBA 1HAZB 4WXIA 2LPRA 5T3HA 2ANWA 3TH4H 1ELBA 1GJBB 1A3EH 1BJVA 3F9GA 2VVUA 3ZYDA 4LZ1H 3Q3KA 1MAYA 1PPCE 5C20A 2PW8H 1EZSC 1Z8GA 2ALPA 3RXEA 2QXJA 1F5KU 4XE4A 4X6OA 5DGJA 1NRQH 1LPKB 2FMJA 2ZPQA 1S0QA 1OX1A 1V3XA 3MU0A 1SGDE 3UNRA 3TU7H 2G4UA 2JETC 1UVSH 1ZTJA 1GDQA 1YCPH 2FEQH 1K1NA 1VITG 1GBJA 1QFKH 1TX6A 4IGDA 2UUYA 1HAYB 3NK8A 4H6TA 1GBIA 4CH8B 2OBOA 3UR6A 3KHVA 3LH1A 1TB6H 3RXKA 3GCOA 1AU8A 1GBDA 1MTWA 2EI8A 4ESTE 2G4TA 1HUTH 1V2TT 2BB4A 1O3LA 1BA8B 3GY6A 1RTFB 1TLDA 2PGBB 3MH6A 4FUIA 2PKSC 4AZ2B 3KNXA 3RUOA 1K2I1 1UVPA 3M7TA 2AMDA 5CE1A 3ZZCA 1GHVH 2BDIA 1UO6A 1DT2A 2SGQE 3RXTA 2FP7B 3QO6A 1TNHA 1F92A 1DY9A 4A6LA 3S7KB 2B0FA 1O3JA 2HNTE 1OWKA 4B71A 2ZA5A 4OS1A 2CMYA 2Q6GA 3EA7A 1BBRH 3V3MA 1KDQA 3M5OA 1IHTH 2PR3A 5EG4A 1HJAB 2ZIQH 1UCYK 1UK2A 3M3TA 1T8OA 1W0ZU 2OC8A 4YZUA 1QR3E 2ZP0H 7LPRA 1W7XH 1MZAA 1N6XA 3I77A 4X1RU 4MTBA 3U8TH 1GJAB 6CHAB 4IBLH 1EPTA 1TPSA 4ABEA 1BUIA 1PPGE 1O2RA 4JMYA 3ZV8A 5GWZA 4H42U 1O2LA 5EGMA 3FAOA 2WPMS 5C5OA 3NWUA 1T8NA 2R0LA 2XWBI 2ZDLA 1C5ZB 1NRPH 2ZDAH 3P8GA 4RSPA 1O2PA 4ISIH 1TWXB 1TX8A 1C5XB 1HAHH 1YPKH 3N7OA 1B0EA 2GCTB 4X1NU 2XC0A 1HDTH 3BTDE 3FP8E 1O3AA 1MTSA 5AF9H 2AGGX 2GV7A 4OS5A 4INKA 5T6DA 3FANA 2PUXB 1NFUA 1ELTA 2G5NA 3M5NA 4B2AA 5ESTE 1HAVB 3DT0H 1NU7B 2P3FH 3ZZ8A 1V2OT 1W10U 1XKBC 3HGNA 1NS3A 4CREA 5J4SA 3PLPA 4UD9H 3SI4H 5CHAB 5A8XA 1IQNA 2FS9A 2UWOA 3SU0A 2C3SA 1FXYA 4ABAA 1CHOF 1P9UA 1XUJA 2W26A 4RKOB 1XUIA 2FESH 3FZDA 1HLTH 1OP0A 1JRTA 2FO9A 2FDAA 5EQSA 2W3KA 1MQ5A 1C1TA 2I6QA 1W14U 2ZPSA 2BY9X 5C1XA 3MO3A 4UEHH 1C5UA 3VXEH 5DK1A 1ESAA 1LPGB 2VGCB 4HTCH 1AIXH 4NGAH 3RMMH 1ZSJA 4I8LA 4NIXA 1BTPA 3VB5A 4FUDA 3RXLA 3LGVA 3RP2A 3ZVAA 1V2RT 5L2YH 1GBAA 1FDPA 1A46H 1OPHB 1BT7A 3SJOA 3A8CA 4BAMB 4LZ4B 1AMHA 2XXLA 4WY3A 1O2ZA 1SQOA 4AGKA 1TPAE 1IQFA 2RA3A 1TOCB 2PSYA 1AZZA 3L3TA 7ESTE 3RMLH 1C5QA 1RXPA 2HLCA 1YYY1 4XOJA 1BTXA 3SGQE 3BTKE 2GZ9A 1O39A 3LKWA 5HMAA 2SNWA 1HV7A 3LGWA 1GG6B 4BXSA 3MNCA 1C2HA 5T6GA 2ULLA 1W7GH 1IHSH 2PTNA 1C1SA 2Y7ZA 1SGEE 1ETTH 1VJ9U 4X0WU 1CO7E 2ZFPH 4Y7BA 1O5DH 4ABIA 2KAIB 5GDSH 1GHAG 1TX7A 1Y3UA 1A0HB 1AVXA 1ZZZA 1TMTH 1KXEA 1QHRB 2FOEA 1JBUH 1XVOA 1ABJH 3GCNA 1C5VA 1MD8A 3NKKA 2FOAA 1BBRE 3UFAA 4X8TH 1TNKA 4TWWA 1EOLA 1MMJN 2BXTH 3A8AA 3U1JB 2Z94A 2ZU3A 5C67A 4JZFH 1GWAA 1GBHA 3B9FH 5FPYA 3Q3XA 4MNVA 1PQ8A 1S84A 1DFPA 2D26C 1V2KT 3E1XB 2QXIA 2BDYA 3VB3A 4INLA 3A85A 1AE5A 1HAVA 1QJ7B 3M7UA 2TIOA 1D3PB 1ANBA 3QZRA 1H9IE 2ZQ2A 4F49A 2FM2A 5L2ZH 3SV2H 1DWBH 1TRNA 3ZVBA 2FX6A 1IQKA 4I7YH 3NZIA 2M5TA 4Y71A 1THPB 2XCFA 1SGTA 1EASA 3UR9A 1DDJA 3A82A 2GD4B 4FUFA 1FV9A 1O31A 4CRDA 3SNCA 1GCTC 3ZZAA 5G4BA 1J17T 1EQ9A 1C1UH 4MNYA 3SW2B 4CR9A 2HNTF 2QC2A 1JMOH 4JYVH 2GVFA 1OXGA 2J95A 1LKBA 4B75A 1X7AC 3TNSA 3U9AH 1CU1A 2DE9A 1XM1A 4DIHH 4Y7AA 2FOFA 4Y76A 5EU8A 3SBKA 1TBQH 3DUXH 3SUGA 1CA0B 1VR1H 2IN2A 4JZDH 1G32B 5HYOA 3KQCA 1D6WA 4HI3A 2XW9A 4LK4A 1HYLA 4NSVA 1RIWB 1AVWA 2XWAA 1EOJA 1KXBA 3SV8A 1GBEA 2GCHF 3KQDA 4NSYA 5BRRE 1T7CA 3BG4B 1AWFH 3SU1A 4YOGA 1MH0A 1L1GA 2C90B 1ZGIA 1DITH 4NZQA 3SHAH 1AE8H 1BTHH 1NROH 1SMFE 1LPZB 2Y7XA 1SGNE 4CRAA 1UTJA 3A7TA 1CSOE 1G2MA 5LPRA 2KAIA 1GMHG 4ZXXH 1P2KA 1HNEE 4TYDA 1FAXA 1MD7A 2BD4A 1BB0B 4KTSA 1UHBB 3SN8A 4I8HA 3D49H 9ESTA 3AASA 2QF3A 1ELEE 1ZSKA 5C5NA 3PMJA 1DXWA 1C2FA 2OQUA 1ZJKA 4Q7YA 3QWCH 4JCNA 4X2VA 3MU1A 5FX6A 2FX4A 1AFQB 1TMBH 2C8YB 3ESTA 5CMXH 1O5AB 3L33A 3GOVB 1GMCG 1JIRA 2ZCLP 4A5TS 4CRGA 1GI9B 2RDLA 2C93B 4YT6H 2H5CA 2ZECA 2Y80A 1F0UA 1UTMA 5DP5A 4U30A 3LGIA 1SC8U 1Z1IA 4NWKA 4BAQB 3PWCA 5DP8A 3AW1A 1Y5AT 3BIUH 3Q77A 2GDDA 1TYNA 3MU8A 1RJXB 3K65B 1TGSZ 3LGTA 1C5RA 1MZDA 7GCHG 1FMGA 1T4UH 1DXPA 1QL7A 1ZTKA 2J94A 3PO1B 2ANMH 3SU6A 4IC5A 1P2MA 1P2OA 1GI6A 1BMAA 3MU4A 2RA0A 2W3IA 3MI4A 1TOMH 1TQ7B 3LGUA 1L4DA 2EI6A 1IQMA 4AFUA 4K1TA 4X8UH 3GDSA 2BY8X 1S5SA 2HOBA 3HPTB 2Z9GA 3CS0A 4THNH 1THRH 3PM3A 4LXBH 1LVBA 5JB9S 1DANH 2ZDVH 3KIDU 1BTUA 4Y79A 3LGYA 3LC5A 3Q76A 1EP6A 4DT7B 4FUGA 4R0IA 1C5PA 3SORA 3S7HB 3SZNA 2Y5FA 1ANCA 3EA8A 4AG2A 3F9EA 1TIOA 3TK6A 4UDWH 1IQEA 4NG9H 2GT8A 1IQIA 2ZDKA 2A5IA 2R3UA 3GY8A 2BX4A 3GYLB 1MQ6A 1C5WB 2TGPZ 1KTSB 2FI5E 1FY8E 1SFIA 2TGTA 3I29A 4YOIA 1O2NA 4WMDA 3RM0H 3ATMA 2AEIH 4JYTA 3URCA 2VNTA 2FLRH 5TCAA 8LPRA 3K2UA 2OC1A 1Y3XA 3S9CA 1PPBH 1FY3A 1P3EA 1V2NT 2P8OC 4OGYA 3TPIZ 1YPEH 2WPIS 4ZKRU 4XBBA 3AAVA 3TJNA 2UUJB 1UHBA 1XUGA 1AQ7A 2WUBA 4IMQA 4NCYA 1GHBF 1L4ZA 2PGQB 1N6YA 1TNJA 5IYTA 5K0HA 2F3CE 3BSQA 3BTFE 3UREA 1CE5A 3EAJA 4GHQA 1S85A 2VWLA 1GL1A 1ZPZA 1RD3B 4ISOA 3O8DA 4AYVB 1FONA 1GI0A 3TLOA 5L6NH 2ZC9H 2ZHFH 3QTOH 3TH3H 4ABHA 4WH8A 5C2ZA 4ZHAA 3MYWA 5TJXA 1C2MA 1EZUC 1LKAA 2NU2E 3ATKA 2XCNA 3S9AA 1KLTA 2W7SA 2AGIX 1MBMA 3A80A 2ZDMA 1OSSA 1C5TA 1QA7A 1WU1A 3TJVA 1Z8RA 1GMCF 2EC9H 3Q3YA 2P3UB 1QGFA 1O2XA 2IPHA 2WV5A 4UFGH 2F9VA 1MAXA 2O8WA 1W11U 2BD8A 2R2WU 4GLYA 3UUZA 3RXUA 1N8OB 5GIBA 1QL8A 3HK3B 2Z3DA 2Z9KA 2F9PA 4U01A 2ZU1A 3TK5A 7GCHF 1MKXH 2HPPH 2ZU4A 1F7ZA 3A87A 5FCRA 1P8VC 1TABE 2FTMA 1F5LA 1IQGA 2ZKSA 4D9QA 1ZHPA 3RM2H 2GV6A 1LHCH 1DLKB 1FY1A 2G00A 1G3DA 4WVPE 1CHOG 3D62A 1ORFA 2P94A 5ABWA 1MTNC 3BTEE 3ZZDA 1MKWH 1MCTA 4NIYA 3BF6H 1LO6A 1H9LB 5GPIB 3UNSA 1SOTA 2WINI 1CQQA 3EGKH 4D8NA 5AFZH 1JWTA 1QJ6B 1C1QA 2UWPA 3F9HA 4JK5A 6CHAC 3UOUA 3A7WA 8KME2 1ID5H 1ZOMA 1JXPA 2F9OA 1LDTT 3A7YA 4HFPB 2UUKB 3LJOA 1EAWA 2O9QA 1Z71A 1GGDC 1O3CA 3LH3A 4ZHMU 3TITA 4DCDA 3E8LA 4LOYH 3RXPA 1GBTA 1T32A 2P16A 3MO9A 1DSUA 1CGJE 5A8YA 1PQ7A 1HAIH 3SUFA 3M61U 1T31A 2Y5HA 4TWYA 3B8JA 5TCCA 2BZ6H 5JB8S 3I78A 1ZPBA 3A7VA 3SUDA 4X6PA 1OOKB 5I46H 2NU3E 1H8DH 1SHYA 2OUAA 1K1OA 3H5CB 2VVVA 5F8XA 1OP8A 5FCKA 1YPGH 2VB0A 4O9VA 2QXGA 1J14A 3HK6B 2FZZA 2Z3EA 1ETRH 3A8BA 1ELFA 2BQWB 4ZKNU 3SU2A 1LVOA 2WUCA 3BEFB 1QY6A 4D7GA 4H4FA 1AB9B 1N1LA 3SI3H 1WTGH 3VFEA 1YPHC 2Z9JA 4XBDA 5K7RA 1ELGA 1HRTH 1A5HA 2ALVA 4XBCA 1SBWA 4KKDA 1NFXA 1H1BA 4WJG2 5H4IB 1O2YA 1NY22 1A4WH 1QBVH 3VB6A 6GCHF 1O3GA 2VGCC 2ZNKH 4VGCC 1C2EA 1RGQA 2AS9A 1TGTA 1SLXB 1Y5UT 1BTZA 3RU4D 1INCA 2R9PA 1MU6B 2QN5T 4WXVA 4KP0A 1TMUH 1ARCA 1P12E 2K1QA 1EJNA 1E36B 2JETB 3Q00A 1ELCA 1S0RA 4YLUA 3JZ2B 2J92A 4BXWA 1SGPE 1K1PA 1V2VT 1DWEH 1P57B 3LDXH 2A0QB 5E2PA 2FWWA 4IN2A 2P59A 5C1UA 1GG6C 3GYMA 1HAXB 3VXFH 2FI3E 4R8TB 2ANKH 4FVDA 1UTQA 4MDSA 3T62A 1GI4A 1TONA 3U98H 2ZGJA 2GX4A 2VIQA 5LGOA 1Y8TA 1QA0A 1Q31A 1GBKA 3BTME 4OS2A 3DFLA 2VJ1A 4CRBA 1C1MA 1OS8A 3U1IB 2BY5X 2AH4X 1HJ8A 3KN2A 3GY7A 3TVJB 5J4QA 3V0XA 2GZ7A 2ZF0H 1BMMH 3A7XA 2CF8H 2ZHDA 4B73A 1BIOA 2C4FH 1K9OE 4B76A 4YOJA 2VINA 4NA8A 2BDGA 5DJ7A 3A86A 2XBVA 4X2XA 1EZQA 1ABIH 1MBQA 2GCHG 3A7ZA 3SHCH 5JBBS 4AG1A 3OY5U 1GJ4H 2AIPA 5ETXA 2UWLA 4FUJA 2CN0H 2W5EA 4WMEA 2CHAC 2QXHA 3KEEA 3L6PA 4WWYA 3BV9B 3S9BA 2TPIZ 1H4WA 5SGAE 2J34A 2O8TA 4BAHB 4YM9A 1YC0A 3RXBA 2Z3CA 3ODDA 4ABDA 1DY8A 5PTPA 3RXVA 1G2LA 1KXAA 4K2YA 5DP3A 1GVLA 1T8MA 2STBE 2A4RA 3A89A 3S69A 1K21H 4AYYB 3SNBA 1DE7H 1HXEH 3VB7A 1TPPA 2Y82A 2Z9IA 4O97A 4BOHA 1G37A 4B2BA 1SOZA 1EXFA 1YF4A 3GCHC 3VGCC 1GBLA 1TFXA 1TNLA 1GJCB 1TGBA 2SNVA 1SI5H 2ZEBA 3M37A 1ZPCA 1GCDA 2VH0A 1TBZH 4HGCA 3RC6A 1CT0E 1HB0B 3RMNH 4CH2B 3PMHB 3EA9A 2AERH 2H9HA 3O8RA 1YPJH 2GTBA 4CHAB 1O2KA 4ZUHA 5GCHF 3MMGA 1TA2A 1EAUA 3ZZ5A 2V0BA 3ZYEA 1L1JA 3E0PB 2BQ6B 3PTNA 1FIWA 4FU9A 2NU1E 2I6SA 4CRFA 3ZVFA 2ODQA 4X6MA 3K6YA 2ZHQH 2IOTA 1V2PT 2ZFTA 1ZSLA 4BNRA 3ZZ4A 2G55A 2AYWA 1V2MT 1C2KA 2A31A 1QRXA 1O34A 1Y3YA 5FPSA 3E90B 3UOPA 1LVMA 5F8ZA 2QF0A 3UIRA 1RS0A 4GHTA 4Q7XA 1AFEH 1UTPA 5GJ4B 2QGRA 1LCYA 1LHEH 1PPEE 3ZZ3A 2SGPE 1UTLM 2ZU2A 3ZZ9A 4ABJA 2Q6FA 1GBMA 4K1SA 4DJZB 4FUCA 1ELDE 4UONA 1L2EA 1MUEB 1IOEA 1E38B 3C27B 3STIA 1UK4A 1V6DA 1O2HA 1MKXK 1WOFA 3T27A 1O37A 5JDUB 2A2QH 4HZHA 1NRRH 4Z0KA 5HXFA 1YPMH 1ZRBA 3GY4A 1AN1E 4MPUA 3T28A 1ANEA 2ZDNA 3QUMP 4I32A 3SQHE 5FBEA 1O5BB 1SQAA 2B7DH 4A1VA 1NC6A 3UQOA 1AY6H 3RLWH 1BDAA 4Q80A 2FPZA 1H9HE 4E06H 3SQEE 4X1QU 1E0FD 1XUHA 3TGJE 1GPZA 3QLPH 3A88A 4A1XA 3UWIA 1YCPK 2D8WA 1AI8H 4A92A 1O38A 4ABBA 1C1PA 3EDXB 1S83A 5C1YA 1P02A 2ZGCA 4MQAA 1QBOA 1Z8JB 2ZFRH 2BMGB 3O8BA 5F8TA 1DWCH 3UNQA 4Y0ZE 5FBIA 3ZVGA 3EYDA 1EJAA 1HGTH 1C1NA 1P2NA 2Q6DA 4NA7A 1O0DH 1DPOA 4CBOA 4H6SB 1UTOA 2ZZUH 3E6PH 4D9RA 1AKSB 1JRSA 2OQ5A 1WSSH 1O3HA 4WH6A 1GHBG 3SJ8A 4K3JA 3UTUH 1TPOA 4O3TA 2GT7A 2QIQA 5FPTA 1WBGB 4M7GA 3CENA 8GCHG 4DURA 1C5LH 3DA9B 4QT8C 3NXPA 1GJ6A 2TGDA 2R2MB 4CR5A 3AVZA 2BY7X 1XXFA 4UE7H 1BBRK 3LPRA 1XVMA 2HGTH 1D9IA 1DX5M 2OP9A 1W2KH 4SGBE 2ZWLH 3OSYA 4SGAE 4X1SU 3MH4A 5E2OA 2YOLA 1GCTB 2ZCHP 3SU3A 2V35A 1HAOH 1UCYH 1S81A 2XBYA 4X2YA 3SV9A 1BHXF 2ZHEH 4AFQA 5F03A 5EW1H 4NZLA 1O2QA 4YTAA 4OS7A 1DICA 1UVUH 4F4OC 2BOKA 3BTQE 4ISNA 4B2CA 1W8BH 2WYJA 1LTOA 4FUEA 3OTJE 1GI7B 1P04A 1YGCH 2O8UA 5DP4A 3F9FA 1P01A 3QN7A 3FZZA 3SGAE 4NIVA 2LNCA 2PFEA 1ZYOA 1AHTH 1CBWC 5FHTA 3RXDA 1O32A 1TQ0B 1O3NA 4ZXYH 1HFDA 2H2ZA 3ZVEA 2PLXA 2Y6TA 2Y5GA 3ZZBA 2ZO3H 1KXCA 1EP5A 2Z7FE 3T29A 1YBWA 4WMFA 1F0TA 3EE0B 2BD2A 1F0RA 4DIIH 1V2JT 2BYAX 1FUJA 2J2UA 1PQAA 5DPAA 4XSKU 2JH0D 3W94A 1E35B 2G8TA 1C2IA 1QNJA 3SO3A 5LPFA 2JH6D 1FLEE 2AFQB 1A3BH 1A5IA 2OD3B 3M3SA 3KQEA 1BTYA 2UUFB 1WAYB 4GCHF 1E37B 3M5LA 1BRAA 1J9CH 3RMOH 2ZTYA 4MVNA 3EQ0H 3GDVA 3FFGA 2Y81A 1EPTC 3SV7A 1EUFA 2ZTZA 1IQJA 4FUHA 5LH8A 2HNTC 1NO9H 1QL9A 1XUKA 5HM2A 2PKAB 1QB9A 1S6FA 5JBAS 2CF9H 1NZQH 3P8FA 5A0AE
chains in the Genus database with same CATH superfamily
1GMDG 1HCGA 1ANDA 1SGRE 1AKSA 2Z6BD 1XMNB 1BRCE 1BZXE 1K28D 2F9UA 2G51A 2ZI2H 4MPWA 3P92A 3JZ1B 1P10A 2B9LA 7KMEH 4CBNA 2STAE 1S82A 4F48B 3R3GB 1YPLH 4YESB 1TNIA 1YLNA 1HAGE 1T8LA 5ESBA 1KY9A 4BTIB 2OC7A 2VIWA 1FN8A 3IG6B 1P03A 1UJ1A 4ZH8A 1O35A 1OWIA 3D23A 3C1KA 1WV7H 1UW7A 1OWHA 3BN9A 4IMZA 8GCHF 1WQVH 1O30A 5AVDA 1FI8A 1WYKA 4BTUB 4I33A 1QQ4A 1TBRH 5HKKD 1C2JA 6GCHG 1P2IA 1AUTC 3CS7A 1UVTH 3RXFA 1NTPA 4J1YA 2GP9B 1CGIE 5E0GA 4E7RG 3UY9A 2IPQX 2P95A 3V7TA 2SGAA 3P6ZB 1PYTD 4FVBA 4ACBA 5DO4H 3TH2H 1GJ8B 3OEED 1DLEA 2WV4A 2XOKD 4D76A 4FU7A 1UCYE 1GVKB 1KSNA 4FU8A 2OTVA 1TGCA 4RT0A 1YLCA 1KLIH 2PWXA 1O3EA 3RXAA 6ESTA 4AORA 2J38A 4ASHA 1P05A 3ITIA 1HPGA 1NRSH 1YKTA 1GI1A 1UMAH 2FLBH 3P17H 2QCYA 3QK1A 1B5GH 1QIXB 2J4IA 1O5CB 2BLWA 5F53A 5AHGH 2VWOA 2AIQA 3KQBA 2FS8A 4Q4LA 2PHBA 1WQSA 1ZR0A 1BQYA 2FI4E 2GKVE 4CRCA 3GY5A 1NESE 1GDUA 5I25A 1OP2A 4I8JA 3AW0A 4I8KA 4AB8A 2BVXH 4BAKB 4JZIA 1ESBA 1FIZA 2BDCA 5A09A 5IDKA 1VKYA 3BEIB 1C5MD 5A2MH 1Z7KA 1GI3A 5EPNA 4OS4A 2ZFSA 5A0BA 3ZVDA 1PPZA 1CGHA 1VZQH 3MTYA 3RXIA 4GAWA 3M7QA 1AD8H 1HJAC 5GXPA 5A0CA 3MH5A 2BD7A 1Z1JA 3M3VA 1SGCA 2A7HA 2YNBA 4A1TA 3U69H 3F2HA 2P8OB 2IJD1 1W12U 2WPHS 3P8OA 5JBTA 2FODA 2KZ4A 4NFFA 1TNGA 2ZFFH 3SJIA 1OWJA 4MLFB 1ZRKA 2PKAA 1BOQA 3BTHE 3KGPA 2XC4A 2SFAA 4YT7H 4YLQH 1E79D 1C5YB 2ZU5A 2CJIA 1Z6JH 3MH7A 2GCTC 3E16B 4TPYA 1YLDA 5EOKA 1IAUA 3K9XB 2D2DA 2BDBA 3U8RH 1A1RA 4O03A 1UVOA 3R0FA 1TRYA 3KL6A 5B6LA 3PTBA 1XX9A 5DP9A 3RXHA 1EZXC 3SGBE 1P2JA 8ESTE 4U2WA 1EATA 4PROA 3LU9B 1GMDF 1ZHRA 1LQDB 5F6MA 2VU8E 5E0JA 3GCTF 1GJ7B 2BDHA 2GMTB 4TPIZ 1G30B 1ZGVA 3F6UH 1PPFE 3QZQA 5C94A 3BTTE 1A61H 1O2GH 2YMSD 5CHAC 1W0YH 1A2CH 3U8OH 1BHXB 5EW2H 1SLWB 2D1JA 2HWLB 3M36A 1C2GA 3RXGA 2A7JA 5JPMH 2A1DB 1O3MA 2H6MA 1VGCB 4ZHLU 1D6RA 2V6NA 1COWD 4MPVA 2C8WB 4AFZA 1GI2A 2LP6A 2A45B 3MWIU 3S0NA 3PROA 4M9FA 3A81A 5GCHG 3HGPA 1FY4A 3OX7U 3PMBB 4ABFA 5FAHA 3H7TA 1QRZA 1C1RA 1QB6A 4RKJB 3SJKA 3AAUA 3STJA 3FVFB 1Q2WA 3TJUA 4GSOA 1MTNB 2BDAA 4ZMAH 3A83A 3WY8A 1JOUB 4XRNA 2QA9E 1VCWA 2BXUH 4ZAEA 1GHXH 1O3IA 1O5EH 5EXMA 2R3YA 1EAXA 3DHKH 2FYQA 1TGNA 2BHGA 4MG3A 1K1LA 1VCPA 3A84A 2C8XB 1DVAH 2PP6A 3LONA 1BRBE 1C9TA 2ESTE 1DSTA 1P3CA 1RTKA 3M5MA 1O2TA 1FN6A 1GGDB 1D4PB 2BTCE 3HKIB 1G3CA 2OCVB 5LPEA 4Q2KA 4UFFH 3BG8A 1QB1A 2FOBA 3O8CA 2YNAA 3ELAH 2XNIA 1UK3A 2KCOA 2VWNA 3T25A 1UTNA 1GI8B 1EB1H 3H7OA 1C4U2 2B8OH 1ZTLA 2VH6A 4JYUH 1SR5C 3P95A 4KTCA 1WUNH 3OTPA 1XXDA 1UTKA 4HG6A 1H8IH 1EAIA 1O3BA 4XFQA 4CHAC 1O3DA 2PKSB 4GUXA 1AZ8A 2W7UA 1WTHD 2FOGA 5KEDA 2HRVA 2F43B 5FXLA 4K8BA 2A32A 1B0FA 3RXCA 3ZZ7A 1AO5A 2ANYA 5JYIA 3HATH 2F4LA 1Z8IB 1YP9A 1Y5BT 3K6ZA 2H9TH 2BM2A 1KLJH 2AMPA 2EEKA 2TBSA 3WW7A 5BPEA 2BX3A 2DE8A 2BD5A 1GBFA 1O2IA 1P09A 3RXRA 3E91A 1HAPH 1FQ3A 2FTLE 2ZCKP 3W95A 4B6EA 2BVSH 2H1UA 2A2XH 3RXOA 1HJ9A 5EQQA 1NT1A 4VGCB 3QDZB 3VB4A 1VITF 3SU4A 1RFNA 5B6OA 1GL0E 4MNWA 2G5VA 3UWJH 4GVUA 1C2LA 1QTFA 1Y59T 2XBXA 1PPHE 5EJZA 4ISHH 5AFYH 1P0SH 2CV3A 3CP7A 2DUCA 1OYQA 1GJ5H 2WZQA 4E05H 1K22H 3BEUA 3RXSA 3QGNB 3SJ9A 1F5RA 5A8ZA 4K60A 1LQEA 1NU9A 4UFDH 4AOQA 4OM9A 1DWDH 1RTLA 2GZ8A 2ZQ1A 4J2YB 2VIVA 1BMLA 3MNSA 1QRWA 2EY4C 1HIAB 1PYTC 1QCPA 2ASUB 3T26A 3VPKA 2RDEA 3G01A 2ZFQH 1GJ9B 4Y8ZA 4DG4A 4KELA 4OS6A 1U6QA 4WF8A 2BVRH 3RC5A 1EB2A 1O36A 3ENSB 1D3TB 1KMHB 1YM0A 1CA0C 1FNIA 2F9BH 2F9NA 1QBNA 1SFQB 1C1WH 2ZGXH 4B1TA 2QYIA 5HGGA 1RIWC 1FPHH 2WYGA 2P93A 1WCZA 1Y3WA 1O3KA 1MCVA 1DUEA 3OAAD 6LPRA 1LHFH 2HALA 2WPLS 3BG4C 3MO6A 2AMQA 1PFXC 2ZTXA 3MNBA 3TGIE 1ZMNA 3MFJA 3SUEA 2WPKS 1GDNA 3RXMA 2BLVA 2G52A 2BD9A 2PSXA 1CVWH 1FPCH 1C5NH 2NU0E 4JZEH 4BTTB 1LMWB 4O3UA 4UFEH 2A4QA 2ZG0H 1Q3XA 1QURH 3SNEA 4ABGA 3PLKA 1YPHE 1ZHMA 3UPEA 1V2UT 1CHGA 1K1MA 1V2ST 1FY5A 1O2OA 2CHAB 4Z6AH 3QX5H 4X8SH 1NFYA 1ELAA 3SU5A 3T5FH 4KGAA 3RDZA 2QV1A 4GPGA 2PV9B 2BLOA 1O2JA 2XBWA 4ISLA 1SB1H 5EODA 5FX5A 2TRMA 1OHHD 1TALA 4TY6A 1DUAA 1MTVA 4K1EA 1MKWK 5T6FA 2QF5A 2VIDA 4GCHG 1J8AA 1NPMA 2NWNA 3GCHB 3VGCB 1AFQC 1BITA 1NM6A 3MHWU 4IN1A 4ZKSU 3PV4A 2G81E 2NU4E 1ZLRA 1E34B 4Y8XA 1O33A 1GHZA 2H5DA 1OWDA 3DFJA 3PRDA 5DP6A 5EPYA 3F68H 4D7FA 4DOQA 4X1PU 1BTWA 3WWFA 2XRCA 2XC5A 4IC6A 2HVXA 3LIWA 2FOCA 2A4GA 1P9SA 1P11E 1V2LT 1Z6EA 2VIOA 1AUJA 4YXWD 4A7IB 3NPSA 4DY7B 2JH5D 1G36A 1O2VA 1BCUH 4AB9A 1V2QT 2PUQH 3PRBA 2B5TB 1VJAU 1OWEA 2L6OA 3PO1C 1G3EA 1L1NA 2C8ZB 4KTUA 3D65E 1J15A 3P70B 1HXFH 2Q1JA 3F1SB 4NIWA 2FXRA 2BZAA 2A5AA 2O8MA 1XKAC 2ZHWH 1FZZA 1HIAA 2F83A 3F0PA 4Y11E 3UQVA 1SPJA 4I31A 3IITA 3KF2A 3TK9A 3AK5A 1G9IE 1L0ZA 1O3FA 1K1JA 1SLVB 1NFWA 2FYRA 1FAKH 3URDA 1ARBA 1O2UA 4E7NA 2ZGBH 3FP7E 1A5GH 3ZVCA 1HBTH 2PTCE 2R0KA 5HIZA 4TT3D 4FUBA 3QTVH 1W13U 3GISB 3GY3A 1KXDA 3OY6U 1NN6A 1SQTA 1A7SA 2BLQA 4ZROA 5EXNA 1W3CA 3MNXA 2QY0B 3ATLA 9LPRA 3V12A 3DD2H 2L74A 1KYNA 2GGVB 1QJ1B 2A7CA 1C4Y2 4K69A 3OYPA 3QGJA 2P3TB 2SGEE 4Q7ZA 1GHAF 4I8GA 1GVZA 2ODYB 2GDEH 3KCGH 1GHYH 1BJUA 2TGAA 4Y8YA 3GY2A 5FL7D 3RC4A 1C1OA 4X2WA 1MABB 1SG8B 3ZZ6A 1F0SA 1BMNH 1DM4B 3ATIA 1TAWA 1VITH 3LJJA 4BAOB 4YO9A 4Y0YE 2FOHA 1EX3A 2XYAA 4RN6A 3KYFA 2RG3A 2CXVA 1KTTB 4JK6A 3ODFA 1GBCA 1FJSA 1A0LA 1O2WA 1NBME 1DS2E 2BY6X 1LHDH 1ZMLA 2W6JD 1O3PB 1QQUA 1GJDB 3RLYH 1IQHA 2WPJS 1P2QA 3LC3A 1A0JA 4OGXA 4X8VH 4MNXA 4K8YA 1O5FH 3TIUA 4AGJA 4Q63A 3E3TA 3SNDA 3M35A 1TA6A 1C4V2 5DG6A 1AWHB 2IJOB 1SGQE 1KIGH 5HM9A 2VVCA 3BTGE 4U32A 4Y10E 1ELVA 1MU8B 3NCLA 1CT4E 1SVPA 1NRNH 4MPXA 1F2SE 3PLBA 1OKXA 1O5GH 1SSXA 5GNDA 1D3QB 4XDEA 2BQ7B 2XTTB 2A4OA 3IWMA 1VCQA 3RXJA 2SGDE 2ZGHA 1K1IA 2Z9LA 2AGEX 1SL3A 2EQNA 2J9NA 3SV6A 4DGJA 1BRUP 4X6NA 1O2MA 2QAAA 3E0NB 4AN7A 4DW2U 2OC0A 1D3DB 5L30H 1EJMA 1SGIB 3UAIC 3UB0A 3LT3A 1ZMJA 4BANB 3V13A 2THFB 2BD3A 1LVYA 1EKBB 1C1VH 1N8OC 1O2SA 3GCTG 3PYHA 1SHHB 1AGJA 2ILNA 1SGFA 2BOHB 2CGAA 2HLDD 1GI5A 1XUFA 1DOJA 1SGYE 1PJPA 4ZKOU 2VIPA 1GHWH 2H9EH 1T4VH 2ZPRA 1AVGH 2HPQH 2V3HH 3B23B 3HKJB 4NA9H 2A5KA 4I86A 4AFSA 1M9UA 3BIVH 5T1VA 4Y6DA 3PB1E 3FP6E 5EQRA 5HIYA 5C3NA 3TJOA 4NFEA 1CBWB 2RCEA 2V7QD 4IW4E 4B6FA 1GMHF 5DP7A 1PQ5A 3ATWA 1TE0A 2JIZD 4TY7A 1C2DA 1MTUA 1SGFG 3P8NA 1C5SA 2O8LA 4JZ1A 1SQRA 3F2GA 3WWBA 1JIMA 1CA8B 1S6HA 3MU5A 2ODPA 1CT2E 1IQLA 3RU4T 3SOSA 4FXGH 2EA3A 3BTWE 5JBCS 1THSH 4NWLA 4DVAU 1GBBA 1KDQB 1P06A 2JKHA 2OBQA 1V2WT 3RXQA 2FIRH 3PMAB 3TNTA 3F0OA 2F91A 1ETSH 3NUMA 3W1EA 3A8DA 1RRKA 1SLUB 2VWMA 2GMTC 5E0HA 3ZV9A 1C9PA 1EPTB 1LHGH 1O3OA 3GICB 1YCPM 2SGFE 3OU0A 3MOCA 1J16A 1KXFA 1ACBE 1TRMA 4INHA 3VEQB 4B74A 3T2NA 2V3OH 3SNAA 2OXSA 2HVYB 2EI7A 1C5OH 1OYTH 1AB9C 1G3BA 2OINA 4IS5A 3LOXA 5DKMA 3RU4E 3TGKE 1B7XB 1VGCC 2FOMB 1ESTA 2OLGA 5E8EH 4K5ZA 3GDUA 1Y3VA 4AX9H 1ZJDA 2KX4A 5EXLA 3PWBA 1HAZB 4WXIA 2LPRA 5T3HA 2ANWA 3ZIAD 3TH4H 1ELBA 1GJBB 1A3EH 1BJVA 3F9GA 2VVUA 3ZYDA 4LZ1H 3Q3KA 1MAYA 1PPCE 5C20A 2PW8H 1EZSC 1Z8GA 1W0JD 2ALPA 3RXEA 1W0KD 2QXJA 1F5KU 4XE4A 4X6OA 5DGJA 2KCAA 1NRQH 1LPKB 2FMJA 2ZPQA 1S0QA 1OX1A 1V3XA 3MU0A 4P00A 1SGDE 3UNRA 3TU7H 2G4UA 2JETC 1UVSH 1ZTJA 1GDQA 1YCPH 2FEQH 2J97A 1H8ED 1K1NA 1VITG 1GBJA 1QFKH 1TX6A 4IGDA 2UUYA 1HAYB 1S6LA 2KM0A 1QZ8A 3NK8A 4H6TA 1GBIA 4CH8B 2OBOA 2W6ID 3UR6A 3KHVA 3LH1A 2QF4A 1TB6H 3RXKA 3GCOA 1AU8A 1GBDA 4AC9A 1MTWA 2EI8A 4ESTE 2G4TA 1HUTH 1V2TT 2BB4A 1O3LA 1BA8B 3GY6A 1RTFB 1TLDA 2PGBB 3MH6A 4FUIA 2PKSC 4AZ2B 3KNXA 3RUOA 2CK3D 1K2I1 1UVPA 3M7TA 2AMDA 5CE1A 3ZZCA 1GHVH 2BDIA 1UO6A 1DT2A 2SGQE 3RXTA 2FP7B 3QO6A 1TNHA 1F92A 1DY9A 4A6LA 1YY3A 3S7KB 2B0FA 1O3JA 2HNTE 1OWKA 4B71A 2ZA5A 4OS1A 2CMYA 2Q6GA 3EA7A 1BBRH 3V3MA 1KDQA 3M5OA 2KCYA 1IHTH 2PR3A 5EG4A 1HJAB 2WPDD 2ZIQH 1UCYK 1UK2A 3M3TA 1T8OA 1W0ZU 2OC8A 4YZUA 1QR3E 2ZP0H 7LPRA 1W7XH 1MZAA 1N6XA 3I77A 4X1RU 4MTBA 3U8TH 1GJAB 6CHAB 4IBLH 4ACAA 1EPTA 1TPSA 4ABEA 1BUIA 1PPGE 1O2RA 4JMYA 3ZV8A 5GWZA 4H42U 1O2LA 5EGMA 3FAOA 2WPMS 5C5OA 3NWUA 1T8NA 2R0LA 2XWBI 2ZDLA 1C5ZB 1NRPH 2ZDAH 3P8GA 4RSPA 1O2PA 1SKYE 4ISIH 1TWXB 1TX8A 1C5XB 1HAHH 1YPKH 3N7OA 1B0EA 2GCTB 4X1NU 2XC0A 1HDTH 3BTDE 3FP8E 1O3AA 1MTSA 5AF9H 2AGGX 2GV7A 4OS5A 4INKA 5T6DA 3FANA 2PUXB 2GJGA 1NFUA 1ELTA 2G5NA 3M5NA 4B2AA 5ESTE 1HAVB 3DT0H 1NU7B 2P3FH 3ZZ8A 1V2OT 1W10U 1XKBC 3HGNA 1NS3A 4CREA 5J4SA 3PLPA 4UD9H 3SI4H 5CHAB 5A8XA 1IQNA 2FS9A 2UWOA 3SU0A 2C3SA 1FXYA 4ABAA 1CHOF 1P9UA 1XUJA 2W26A 4RKOB 1XUIA 2FESH 3FZDA 1HLTH 1OP0A 2KR7A 1JRTA 2FO9A 2FDAA 5EQSA 2W3KA 1MQ5A 1C1TA 2I6QA 1W14U 2ZPSA 2BY9X 5C1XA 3MO3A 4UEHH 1C5UA 3VXEH 5DK1A 1ESAA 1LPGB 2VGCB 4HTCH 1AIXH 4NGAH 3RMMH 1ZSJA 4I8LA 4NIXA 1BTPA 3VB5A 4FUDA 3RXLA 3F3BA 3LGVA 3RP2A 3ZVAA 3SZEA 1V2RT 5L2YH 1GBAA 1FDPA 1A46H 4Z1MD 1OPHB 1BT7A 3SJOA 3A8CA 4BAMB 4LZ4B 5EJLA 1AMHA 2WSSD 2XXLA 4WY3A 1O2ZA 5C17A 1SQOA 4AGKA 1TPAE 1IQFA 2RA3A 1TOCB 3OE7D 2PSYA 1AZZA 3L3TA 7ESTE 3RMLH 1C5QA 1RXPA 2HLCA 1YYY1 4XOJA 1BTXA 3SGQE 3BTKE 2GZ9A 1O39A 3LKWA 5HMAA 2SNWA 1HV7A 3LGWA 1GG6B 4BXSA 3MNCA 1C2HA 5T6GA 2ULLA 1W7GH 1IHSH 2PTNA 1C1SA 2Y7ZA 1SGEE 1ETTH 1VJ9U 4X0WU 1CO7E 2ZFPH 4Y7BA 1O5DH 4ABIA 2KAIB 5GDSH 1GHAG 1TX7A 1Y3UA 1A0HB 1AVXA 1ZZZA 1TMTH 1KXEA 1QHRB 2FOEA 1JBUH 1XVOA 1ABJH 3GCNA 1C5VA 1MD8A 3NKKA 2FOAA 1BBRE 3UFAA 4X8TH 1TNKA 4TWWA 1EOLA 1MMJN 2BXTH 3A8AA 3GS9A 3U1JB 2Z94A 2ZU3A 5EJ1A 5C67A 4JZFH 1GWAA 1GBHA 3B9FH 5FPYA 3Q3XA 4MNVA 1PQ8A 1S84A 1DFPA 2D26C 1V2KT 3F2FA 3E1XB 4FOUC 2QXIA 2BDYA 3VB3A 4INLA 3A85A 1AE5A 1HAVA 1QJ7B 3M7UA 2TIOA 1D3PB 1EFRD 1ANBA 3QZRA 1H9IE 2ZQ2A 4F49A 2FM2A 5L2ZH 3SV2H 1DWBH 1TRNA 3ZVBA 2FX6A 1K0HA 1IQKA 4I7YH 3NZIA 2M5TA 4Y71A 1THPB 2XCFA 1SGTA 1EASA 3UR9A 1DDJA 3A82A 2GD4B 4FUFA 1FV9A 1O31A 4CRDA 3SNCA 1GCTC 3ZZAA 5G4BA 1J17T 1EQ9A 1C1UH 4MNYA 3SW2B 4CR9A 2HNTF 2QC2A 1JMOH 4JYVH 2GVFA 1OXGA 2J95A 1LKBA 4B75A 1X7AC 4ASUD 3TNSA 3U9AH 1CU1A 2DE9A 1XM1A 4DIHH 4Y7AA 2FOFA 4Y76A 1H8HD 5EU8A 1TBQH 3DUXH 3SBKA 3SUGA 1CA0B 1VR1H 2IN2A 4JZDH 1G32B 2JJ1D 5HYOA 3KQCA 1D6WA 4HI3A 2XW9A 4LK4A 1HYLA 4NSVA 1RIWB 1AVWA 2XWAA 1EOJA 1KXBA 3SV8A 1GBEA 2GCHF 3KQDA 4NSYA 5BRRE 1T7CA 3BG4B 1AWFH 3SU1A 4YOGA 1MH0A 1L1GA 2C90B 1ZGIA 3CNRA 1DITH 4NZQA 3SHAH 1AE8H 1BTHH 1NROH 1SMFE 1LPZB 2Y7XA 2OK5A 1SGNE 4CRAA 1UTJA 3A7TA 1CSOE 1G2MA 5LPRA 2KAIA 1GMHG 4ZXXH 1P2KA 1WXRA 1HNEE 4TYDA 1FAXA 4XD7D 1MD7A 2BD4A 1BB0B 4KTSA 1UHBB 3SN8A 4I8HA 3D49H 9ESTA 3AASA 5EIYA 2QF3A 1ELEE 1ZSKA 5C5NA 3PMJA 1DXWA 1C2FA 2OQUA 1ZJKA 4Q7YA 3QWCH 4JCNA 4X2VA 3MU1A 5FX6A 2FX4A 1AFQB 1TMBH 2C8YB 3ESTA 5CMXH 1O5AB 3L33A 3GOVB 1GMCG 1JIRA 2ZCLP 4A5TS 4CRGA 1GI9B 2RDLA 2C93B 4YT6H 2H5CA 2ZECA 2Y80A 1F0UA 1UTMA 2XNDD 5DP5A 5C0TA 2YMSB 3LGIA 1SC8U 1Z1IA 4NWKA 4U30A 4BAQB 3PWCA 5DP8A 3AW1A 1Y5AT 3BIUH 3Q77A 2GDDA 1TYNA 3MU8A 1RJXB 3K65B 1TGSZ 3LGTA 1C5RA 2VBCA 1MZDA 7GCHG 1FMGA 1T4UH 1DXPA 1QL7A 1ZTKA 2J94A 3PO1B 2ANMH 3SU6A 4IC5A 1P2MA 1P2OA 1GI6A 1BMAA 3MU4A 3DCLA 2RA0A 2W3IA 3MI4A 1TOMH 1TQ7B 3LGUA 1L4DA 2EI6A 1IQMA 4AFUA 4K1TA 4X8UH 3GDSA 2M2AA 2BY8X 1S5SA 2HOBA 3HPTB 2Z9GA 3CS0A 4THNH 1THRH 3PM3A 4LXBH 1LVBA 5JB9S 1DANH 2ZDVH 3KIDU 1BTUA 4Y79A 3LGYA 3LC5A 3Q76A 1EP6A 4DT7B 4FUGA 4R0IA 1C5PA 3SORA 3S7HB 3SZNA 2Y5FA 1ANCA 3FOAA 3EA8A 4AG2A 3F9EA 1TIOA 3TK6A 4UDWH 1IQEA 4NG9H 2GT8A 1IQIA 2RFKC 2ZDKA 2A5IA 2R3UA 3GY8A 2BX4A 3GYLB 1MQ6A 1C5WB 2TGPZ 1KTSB 2FI5E 1FY8E 1SFIA 2TGTA 3I29A 4YOIA 1O2NA 4WMDA 3RM0H 3ATMA 2AEIH 4JYTA 3URCA 2VNTA 2FLRH 5TCAA 8LPRA 3K2UA 2OC1A 1Y3XA 3S9CA 3KYGA 1PPBH 1FY3A 1P3EA 1V2NT 2P8OC 4OGYA 3TPIZ 1YPEH 5CHBA 2WPIS 4ZKRU 4XBBA 3AAVA 3TJNA 2UUJB 1UHBA 1XUGA 1AQ7A 2WUBA 4IMQA 4NCYA 1GHBF 1L4ZA 2PGQB 1N6YA 1TNJA 5IYTA 4ZCNA 5K0HA 2F3CE 3BSQA 3BTFE 3UREA 1CE5A 3EAJA 4GHQA 1S85A 2VWLA 1GL1A 1ZPZA 1RD3B 4ISOA 3O8DA 4AYVB 1FONA 1GI0A 3TLOA 5L6NH 2ZC9H 1FX0B 1NBMD 2ZHFH 3QTOH 3TH3H 4ABHA 4WH8A 5C2ZA 4ZHAA 3MYWA 5TJXA 1C2MA 1EZUC 1LKAA 2NU2E 3ATKA 2XCNA 2JJ2D 3S9AA 1KLTA 4TSFD 2K0QA 2W7SA 2AGIX 1MBMA 3A80A 2ZDMA 1OSSA 1C5TA 1QA7A 1WU1A 3TJVA 4RI0A 1Z8RA 1GMCF 2EC9H 3Q3YA 2P3UB 1QGFA 1O2XA 2IPHA 2WV5A 4UFGH 2F9VA 3PV2A 1MAXA 2O8WA 1W11U 2BD8A 2R2WU 4GLYA 3UUZA 3RXUA 1N8OB 5GIBA 1QL8A 3HK3B 2Z3DA 2Z9KA 2F9PA 4U01A 2ZU1A 3TK5A 7GCHF 1MKXH 2HPPH 2ZU4A 1F7ZA 3A87A 5FCRA 1P8VC 1TABE 2FTMA 1F5LA 1IQGA 2ZKSA 4D9QA 1ZHPA 3RM2H 2GV6A 4F55A 1LHCH 1DLKB 1FY1A 2G00A 1G3DA 4WVPE 1CHOG 3D62A 1ORFA 2P94A 5ABWA 1MTNC 3BTEE 3ZZDA 1MKWH 1MCTA 4NIYA 4DT4A 3BF6H 1LO6A 1H9LB 5GPIB 3OFND 3UNSA 2K8IA 1SOTA 2WINI 1CQQA 3EGKH 4D8NA 5AFZH 1JWTA 1QJ6B 1C1QA 2UWPA 3F9HA 4JK5A 6CHAC 3UOUA 3A7WA 8KME2 1ID5H 1ZOMA 1JXPA 2F9OA 1LDTT 3A7YA 4HFPB 2UUKB 3LJOA 1EAWA 2O9QA 1Z71A 1GGDC 1O3CA 3LH3A 4ZHMU 3TITA 4DCDA 2WHXA 3E8LA 4LOYH 3RXPA 1GBTA 1T32A 2P16A 3MO9A 1DSUA 1CGJE 5A8YA 1PQ7A 1HAIH 3SUFA 3M61U 1T31A 2Y5HA 4TWYA 3B8JA 5TCCA 2BZ6H 5JB8S 3I78A 1ZPBA 3A7VA 3SUDA 4X6PA 1OOKB 5I46H 2NU3E 1H8DH 1SHYA 2OUAA 1K1OA 3H5CB 2VVVA 5F8XA 1OP8A 5FCKA 1YPGH 2VB0A 4O9VA 2V3MA 2QXGA 1J14A 3HK6B 2FZZA 2Z3EA 1ETRH 4P02A 5KGOA 3A8BA 1ELFA 2BQWB 4ZKNU 3SU2A 1LVOA 2WUCA 3BEFB 1QY6A 4D7GA 4H4FA 1AB9B 1N1LA 3SI3H 1WTGH 3VFEA 1YPHC 2Z9JA 4XBDA 5K7RA 1ELGA 1HRTH 1A5HA 2ALVA 4XBCA 1SBWA 4KKDA 1NFXA 3DSGA 1H1BA 4WJG2 5H4IB 1O2YA 3EE7A 1NY22 1A4WH 1QBVH 3VB6A 6GCHF 1O3GA 2VGCC 2ZNKH 3PV5A 4VGCC 1C2EA 1RGQA 2AS9A 1TGTA 4RT1A 1SLXB 3VG8A 1Y5UT 1BTZA 3RU4D 1INCA 2R9PA 1MU6B 2QN5T 4WXVA 4KP0A 1TMUH 1ARCA 5DN6D 1P12E 2K1QA 1EJNA 1E36B 2JETB 3Q00A 3N99A 1ELCA 1S0RA 2J5UA 3JZ2B 2J92A 4YLUA 4BXWA 1SGPE 1K1PA 1V2VT 1DWEH 1P57B 3LDXH 2A0QB 5E2PA 2FWWA 4IN2A 3N7EA 2P59A 5C1UA 1GG6C 3GYMA 1HAXB 3VXFH 2FI3E 4R8TB 2ANKH 4FVDA 1UTQA 4MDSA 3T62A 1GI4A 1TONA 3U98H 2ZGJA 2GX4A 2VIQA 5LGOA 1Y8TA 1QA0A 1Q31A 1GBKA 3BTME 4OS2A 5IK2D 3DFLA 2VJ1A 4CRBA 1C1MA 1OS8A 5KECA 3U1IB 3SYJA 2BY5X 2AH4X 1HJ8A 3KN2A 3GY7A 3TVJB 5J4QA 3V0XA 2GZ7A 4FETA 2ZF0H 1BMMH 3A7XA 2CF8H 2ZHDA 4B73A 1BIOA 2C4FH 1K9OE 4B76A 4YOJA 2VINA 4NA8A 2BDGA 5DJ7A 3A86A 2XBVA 4X2XA 3FN8A 1EZQA 2J98B 1ABIH 1MBQA 2GCHG 3A7ZA 3SHCH 5JBBS 4AG1A 3OY5U 1GJ4H 2AIPA 5ETXA 2UWLA 4FUJA 2CN0H 2AHME 2W5EA 4WMEA 2CHAC 2QXHA 3KEEA 3L6PA 4WWYA 3BV9B 3S9BA 2TPIZ 1H4WA 5SGAE 2J34A 2O8TA 4BAHB 4YM9A 1YC0A 3RXBA 2Z3CA 3ODDA 5CDFE 4ABDA 1DY8A 5PTPA 3RXVA 1G2LA 1KXAA 4K2YA 5DP3A 1GVLA 1T8MA 2STBE 2A4RA 3A89A 3S69A 1K21H 4AYYB 3SNBA 1DE7H 1HXEH 3VB7A 1TPPA 2Y82A 2Z9IA 4O97A 4BOHA 1G37A 4B2BA 1SOZA 1EXFA 1YF4A 3GCHC 3VGCC 1GBLA 1TFXA 1TNLA 1GJCB 1TGBA 2SNVA 1SI5H 2JDID 2ZEBA 3M37A 1ZPCA 3DSPA 1GCDA 2VH0A 2KFWA 1TBZH 4HGCA 3RC6A 1CT0E 1HB0B 3RMNH 4CH2B 3PMHB 3EA9A 2AERH 2H9HA 3O8RA 1YPJH 2GTBA 4CHAB 1O2KA 4ZUHA 5GCHF 3MMGA 1TA2A 3KQ5A 1EAUA 3ZZ5A 2V0BA 3ZYEA 1L1JA 3E0PB 2BQ6B 3NRLA 3PTNA 1FIWA 4FU9A 2NU1E 2I6SA 4CRFA 3ZVFA 2ODQA 4X6MA 3K6YA 2ZHQH 2IOTA 1V2PT 2ZFTA 1ZSLA 4BNRA 3ZZ4A 2G55A 2AYWA 1V2MT 1C2KA 2A31A 1QRXA 1O34A 1Y3YA 5FPSA 3E90B 3UOPA 3MQKC 1LVMA 5F8ZA 2QF0A 3UIRA 1RS0A 4GHTA 4Q7XA 1AFEH 1UTPA 5GJ4B 2QGRA 1LCYA 1LHEH 1PPEE 3ZZ3A 2SGPE 1UTLM 2ZU2A 3ZZ9A 4ABJA 2Q6FA 1GBMA 2WV9A 4K1SA 4DJZB 4FUCA 1ELDE 4UONA 1L2EA 1MUEB 1IOEA 1E38B 3C27B 3STIA 1UK4A 1V6DA 1O2HA 1MKXK 1WOFA 3T27A 1O37A 5JDUB 2A2QH 4HZHA 1NRRH 4Z0KA 5HXFA 1YPMH 1ZRBA 3GY4A 1AN1E 4MPUA 3T28A 1ANEA 2ZDNA 3QUMP 4I32A 3SQHE 5FBEA 1O5BB 1SQAA 2B7DH 4A1VA 1NC6A 3UQOA 1AY6H 3RLWH 1BDAA 4Q80A 2FPZA 1H9HE 4E06H 2J98A 3SQEE 4X1QU 1E0FD 1XUHA 3TGJE 1GPZA 3QLPH 3A88A 4A1XA 3UWIA 1YCPK 2D8WA 1AI8H 4A92A 1O38A 5DSFA 4ABBA 1C1PA 3FKSD 3EDXB 1S83A 2YMSC 5C1YA 1P02A 2ZGCA 1E1QD 4MQAA 1QBOA 1Z8JB 2ZFRH 2BMGB 1E1RD 2LELA 3O8BA 5F8TA 1DWCH 3UNQA 4Y0ZE 5FBIA 3DSOA 3ZVGA 3EYDA 1EJAA 1HGTH 1C1NA 1P2NA 2Q6DA 4NA7A 1O0DH 1DPOA 4CBOA 4H6SB 1UTOA 2ZZUH 3E6PH 4D9RA 1AKSB 1BMFD 1JRSA 2OQ5A 1WSSH 1O3HA 4WH6A 1GHBG 3SJ8A 4K3JA 3UTUH 1TPOA 4O3TA 2GT7A 2QIQA 5FPTA 1WBGB 4M7GA 3CENA 8GCHG 4DURA 1C5LH 1WDIA 3N7DA 3DA9B 4QT8C 3NXPA 1GJ6A 2TGDA 2R2MB 4CR5A 3AVZA 2BY7X 1XXFA 4UE7H 1BBRK 3LPRA 1XVMA 2HGTH 1D9IA 1DX5M 2OP9A 1W2KH 4SGBE 2ZWLH 3OSYA 4SGAE 4X1SU 3MH4A 5E2OA 2YOLA 1GCTB 2ZCHP 3SU3A 2V35A 1HAOH 1UCYH 1S81A 2XBYA 4X2YA 5C0UA 3SV9A 1BHXF 2ZHEH 4AFQA 5F03A 5EW1H 4NZLA 1O2QA 2KCPA 3OEHD 4OS7A 4YTAA 1DICA 1UVUH 4F4OC 2BOKA 3H09A 3BTQE 4ISNA 4B2CA 1W8BH 2WYJA 1LTOA 4FUEA 3OTJE 1GI7B 1P04A 1YGCH 2O8UA 5DP4A 3F9FA 1P01A 3QN7A 3FZZA 3SGAE 4NIVA 2LNCA 2PFEA 1ZYOA 1AHTH 1CBWC 5FHTA 2QE7D 3RXDA 1O32A 1TQ0B 1O3NA 4ZXYH 1HFDA 2H2ZA 3ZVEA 2PLXA 2Y6TA 2Y5GA 3ZZBA 3FO8D 2ZO3H 1KXCA 1EP5A 2Z7FE 3T29A 1YBWA 4WMFA 1F0TA 3EE0B 2BD2A 1F0RA 4DIIH 1V2JT 2BYAX 1FUJA 2J2UA 1PQAA 5DPAA 4XSKU 2JH0D 3W94A 1E35B 3U28C 2G8TA 1C2IA 1QNJA 3SO3A 5LPFA 2JH6D 1FLEE 2AFQB 1A3BH 1A5IA 2OD3B 3M3SA 3KQEA 1BTYA 2UUFB 1WAYB 4GCHF 1E37B 3M5LA 1BRAA 1J9CH 3RMOH 1YWUA 2ZTYA 4MVNA 3EQ0H 3GDVA 3FFGA 2Y81A 1EPTC 3SV7A 1EUFA 2ZTZA 1IQJA 4FUHA 5LH8A 2HNTC 1NO9H 1QL9A 1XUKA 5HM2A 2PKAB 1QB9A 1S6FA 5JBAS 2CF9H 1NZQH 3P8FA 5A0AE
chains in the Genus database with same CATH topology
1GMDG 1HCGA 1ANDA 1SGRE 1AKSA 2Z6BD 1XMNB 1BRCE 1BZXE 1K28D 2F9UA 2G51A 2ZI2H 4MPWA 3P92A 3JZ1B 1P10A 2B9LA 7KMEH 4CBNA 2STAE 1S82A 3R3GB 1YPLH 4YESB 1TNIA 1HAGE 1T8LA 5ESBA 1KY9A 4BTIB 2OC7A 2VIWA 1FN8A 3IG6B 1P03A 1UJ1A 4ZH8A 1O35A 1OWIA 3D23A 3C1KA 1WV7H 1OWHA 3BN9A 4IMZA 8GCHF 1WQVH 1O30A 5AVDA 1FI8A 1WYKA 4BTUB 4I33A 1QQ4A 1TBRH 1C2JA 6GCHG 1P2IA 1AUTC 3CS7A 1UVTH 3RXFA 1NTPA 4J1YA 2GP9B 1CGIE 5E0GA 4E7RG 3UY9A 2P95A 3V7TA 2SGAA 3P6ZB 1PYTD 4FVBA 5DO4H 3TH2H 1GJ8B 1DLEA 2WV4A 4D76A 4FU7A 1UCYE 1GVKB 1KSNA 4FU8A 2OTVA 1TGCA 1YLCA 1KLIH 2PWXA 1O3EA 3RXAA 6ESTA 4AORA 2J38A 4ASHA 1P05A 3ITIA 1HPGA 1NRSH 1YKTA 1GI1A 1UMAH 2FLBH 3P17H 2QCYA 3QK1A 1B5GH 1QIXB 2J4IA 1O5CB 2BLWA 5AHGH 2VWOA 2AIQA 3KQBA 2FS8A 2PHBA 1WQSA 1ZR0A 1BQYA 2FI4E 2GKVE 4CRCA 3GY5A 1NESE 1GDUA 5I25A 1OP2A 4I8JA 3AW0A 4I8KA 4AB8A 2BVXH 4BAKB 4JZIA 1ESBA 1FIZA 2BDCA 5A09A 5IDKA 3BEIB 1C5MD 5A2MH 1Z7KA 1GI3A 5EPNA 4OS4A 2ZFSA 5A0BA 3ZVDA 1PPZA 1CGHA 1VZQH 3MTYA 3RXIA 4GAWA 3M7QA 1AD8H 1HJAC 5GXPA 5A0CA 3MH5A 2BD7A 1Z1JA 3M3VA 1SGCA 2A7HA 2YNBA 4A1TA 3U69H 2P8OB 1W12U 2WPHS 3P8OA 5JBTA 2FODA 4NFFA 1TNGA 2ZFFH 3SJIA 1OWJA 4MLFB 1ZRKA 2PKAA 1BOQA 3BTHE 3KGPA 2XC4A 2SFAA 4YT7H 4YLQH 1C5YB 2ZU5A 2CJIA 1Z6JH 3MH7A 2GCTC 3E16B 4TPYA 1YLDA 5EOKA 1IAUA 3K9XB 2D2DA 2BDBA 3U8RH 1A1RA 4O03A 1UVOA 3R0FA 1TRYA 3KL6A 3PTBA 1XX9A 5DP9A 3RXHA 1EZXC 3SGBE 1P2JA 8ESTE 4U2WA 1EATA 4PROA 3LU9B 1GMDF 1ZHRA 1LQDB 5F6MA 2VU8E 5E0JA 3GCTF 1GJ7B 2BDHA 2GMTB 4TPIZ 1G30B 1ZGVA 3F6UH 1PPFE 3QZQA 3BTTE 1A61H 1O2GH 5CHAC 1W0YH 1A2CH 3U8OH 1BHXB 5EW2H 1SLWB 2D1JA 2HWLB 3M36A 1C2GA 3RXGA 2A7JA 5JPMH 2A1DB 1O3MA 2H6MA 1VGCB 4ZHLU 1D6RA 2V6NA 4MPVA 2C8WB 4AFZA 1GI2A 3MWIU 2A45B 3S0NA 3PROA 3A81A 5GCHG 3HGPA 1FY4A 3OX7U 3PMBB 4ABFA 5FAHA 3H7TA 1QRZA 1C1RA 1QB6A 4RKJB 3SJKA 3AAUA 3STJA 3FVFB 1Q2WA 3TJUA 4GSOA 1MTNB 2BDAA 4ZMAH 3A83A 3WY8A 1JOUB 2QA9E 1VCWA 2BXUH 4ZAEA 1GHXH 1O3IA 1O5EH 5EXMA 2R3YA 1EAXA 3DHKH 2FYQA 1TGNA 2BHGA 4MG3A 1K1LA 1VCPA 3A84A 2C8XB 1DVAH 3LONA 1BRBE 1C9TA 2ESTE 1DSTA 1P3CA 1RTKA 3M5MA 1O2TA 1FN6A 1GGDB 1D4PB 2BTCE 3HKIB 1G3CA 2OCVB 5LPEA 4Q2KA 4UFFH 3BG8A 1QB1A 2FOBA 3O8CA 2YNAA 3ELAH 2XNIA 1UK3A 2VWNA 3T25A 1UTNA 1GI8B 1EB1H 3H7OA 1C4U2 2B8OH 1ZTLA 2VH6A 4JYUH 1SR5C 3P95A 4KTCA 1WUNH 1XXDA 1UTKA 1H8IH 1EAIA 1O3BA 4XFQA 4CHAC 1O3DA 2PKSB 4GUXA 1AZ8A 2W7UA 1WTHD 2FOGA 2HRVA 5FXLA 4K8BA 2A32A 1B0FA 3RXCA 3ZZ7A 1AO5A 2ANYA 5JYIA 3HATH 1Z8IB 1YP9A 1Y5BT 3K6ZA 2H9TH 2BM2A 1KLJH 2AMPA 2EEKA 2TBSA 5BPEA 2BX3A 2DE8A 2BD5A 1GBFA 1O2IA 1P09A 3RXRA 3E91A 1HAPH 1FQ3A 2FTLE 2ZCKP 3W95A 2BVSH 2H1UA 2A2XH 3RXOA 1HJ9A 5EQQA 1NT1A 4VGCB 3QDZB 3VB4A 1VITF 3SU4A 1RFNA 5B6OA 1GL0E 4MNWA 2G5VA 3UWJH 4GVUA 1C2LA 1QTFA 1Y59T 2XBXA 1PPHE 4ISHH 5AFYH 1P0SH 2CV3A 3CP7A 2DUCA 1OYQA 1GJ5H 4E05H 1K22H 3BEUA 3RXSA 3QGNB 3SJ9A 1F5RA 5A8ZA 4K60A 1LQEA 1NU9A 4UFDH 4AOQA 1DWDH 1RTLA 2GZ8A 2ZQ1A 4J2YB 2VIVA 1BMLA 3MNSA 1QRWA 1HIAB 1PYTC 1QCPA 2ASUB 3T26A 3VPKA 3G01A 2ZFQH 1GJ9B 4Y8ZA 4DG4A 4KELA 4OS6A 1U6QA 4WF8A 2BVRH 3RC5A 1EB2A 1O36A 3ENSB 1D3TB 1YM0A 1CA0C 1FNIA 2F9BH 2F9NA 1QBNA 1SFQB 1C1WH 2ZGXH 4B1TA 2QYIA 5HGGA 1RIWC 1FPHH 2WYGA 2P93A 1WCZA 1Y3WA 1O3KA 1MCVA 1DUEA 6LPRA 1LHFH 2HALA 2WPLS 3BG4C 3MO6A 2AMQA 1PFXC 2ZTXA 3MNBA 3TGIE 1ZMNA 3MFJA 3SUEA 2WPKS 1GDNA 3RXMA 2BLVA 2G52A 2BD9A 2PSXA 1CVWH 1FPCH 1C5NH 2NU0E 4JZEH 4BTTB 1LMWB 4O3UA 4UFEH 2A4QA 2ZG0H 1Q3XA 1QURH 3SNEA 4ABGA 3PLKA 1YPHE 1ZHMA 3UPEA 1V2UT 1CHGA 1K1MA 1V2ST 1FY5A 1O2OA 2CHAB 4Z6AH 3QX5H 4X8SH 1NFYA 1ELAA 3SU5A 3T5FH 4KGAA 3RDZA 2QV1A 4GPGA 2PV9B 2BLOA 1O2JA 2XBWA 4ISLA 1SB1H 5EODA 5FX5A 2TRMA 1TALA 4TY6A 1DUAA 1MTVA 4K1EA 1MKWK 5T6FA 2VIDA 4GCHG 1J8AA 1NPMA 2NWNA 3GCHB 3VGCB 1AFQC 1BITA 1NM6A 3MHWU 4IN1A 4ZKSU 3PV4A 2G81E 2NU4E 1ZLRA 1E34B 4Y8XA 1O33A 1GHZA 2H5DA 1OWDA 3DFJA 5DP6A 5EPYA 3F68H 4D7FA 4DOQA 4X1PU 1BTWA 2XRCA 2XC5A 4IC6A 2HVXA 3LIWA 2FOCA 2A4GA 1P9SA 1P11E 1V2LT 1Z6EA 2VIOA 1AUJA 4A7IB 3NPSA 4DY7B 2JH5D 1G36A 1O2VA 1BCUH 4AB9A 1V2QT 2PUQH 2B5TB 1VJAU 1OWEA 3PO1C 1G3EA 1L1NA 2C8ZB 4KTUA 3D65E 1J15A 3P70B 1HXFH 2Q1JA 3F1SB 4NIWA 2FXRA 2BZAA 2A5AA 2O8MA 1XKAC 2ZHWH 1FZZA 1HIAA 2F83A 4Y11E 3UQVA 1SPJA 4I31A 3IITA 3KF2A 3TK9A 1G9IE 1L0ZA 1O3FA 1K1JA 1SLVB 1NFWA 2FYRA 1FAKH 3URDA 1ARBA 1O2UA 4E7NA 2ZGBH 3FP7E 1A5GH 3ZVCA 1HBTH 2PTCE 2R0KA 4FUBA 3QTVH 1W13U 3GISB 3GY3A 1KXDA 3OY6U 1NN6A 1SQTA 1A7SA 2BLQA 4ZROA 5EXNA 1W3CA 3MNXA 2QY0B 3ATLA 9LPRA 3V12A 3DD2H 1KYNA 2GGVB 1QJ1B 2A7CA 1C4Y2 4K69A 3OYPA 3QGJA 2P3TB 2SGEE 4Q7ZA 1GHAF 4I8GA 1GVZA 2ODYB 2GDEH 3KCGH 1GHYH 1BJUA 2TGAA 4Y8YA 3GY2A 3RC4A 1C1OA 4X2WA 1SG8B 3ZZ6A 1F0SA 1BMNH 1DM4B 3ATIA 1TAWA 1VITH 3LJJA 4BAOB 4YO9A 4Y0YE 2FOHA 1EX3A 2XYAA 4RN6A 2RG3A 2CXVA 1KTTB 4JK6A 3ODFA 1GBCA 1FJSA 1A0LA 1O2WA 1DS2E 2BY6X 1LHDH 1ZMLA 1O3PB 1QQUA 1GJDB 3RLYH 1IQHA 2WPJS 1P2QA 3LC3A 1A0JA 4OGXA 4X8VH 4MNXA 4K8YA 1O5FH 3TIUA 4AGJA 3E3TA 3SNDA 3M35A 1TA6A 1C4V2 5DG6A 1AWHB 2IJOB 1SGQE 1KIGH 5HM9A 2VVCA 3BTGE 4U32A 4Y10E 1ELVA 1MU8B 3NCLA 1CT4E 1SVPA 1NRNH 4MPXA 1F2SE 3PLBA 1OKXA 1O5GH 1SSXA 1D3QB 4XDEA 2BQ7B 2XTTB 2A4OA 3IWMA 1VCQA 3RXJA 2SGDE 2ZGHA 1K1IA 2Z9LA 2AGEX 1SL3A 2J9NA 3SV6A 4DGJA 1BRUP 4X6NA 1O2MA 2QAAA 3E0NB 4AN7A 4DW2U 2OC0A 1D3DB 5L30H 1EJMA 1SGIB 3LT3A 1ZMJA 4BANB 3V13A 2THFB 2BD3A 1LVYA 1EKBB 1C1VH 1N8OC 1O2SA 3GCTG 3PYHA 1SHHB 1AGJA 2ILNA 1SGFA 2BOHB 2CGAA 1GI5A 1XUFA 1DOJA 1SGYE 1PJPA 4ZKOU 2VIPA 1GHWH 2H9EH 1T4VH 2ZPRA 1AVGH 2HPQH 2V3HH 3B23B 3HKJB 4NA9H 2A5KA 4AFSA 1M9UA 3BIVH 4Y6DA 3PB1E 3FP6E 5EQRA 5C3NA 3TJOA 4NFEA 1CBWB 2RCEA 4IW4E 1GMHF 5DP7A 1PQ5A 3ATWA 1TE0A 4TY7A 1C2DA 1MTUA 1SGFG 3P8NA 1C5SA 2O8LA 4JZ1A 1JIMA 1CA8B 1S6HA 3MU5A 2ODPA 1CT2E 1IQLA 3RU4T 3SOSA 4FXGH 2EA3A 3BTWE 5JBCS 1THSH 4NWLA 4DVAU 1GBBA 1KDQB 1P06A 2JKHA 2OBQA 1V2WT 3RXQA 2FIRH 3PMAB 3TNTA 2F91A 1ETSH 3NUMA 3A8DA 1RRKA 1SLUB 2VWMA 2GMTC 5E0HA 3ZV9A 1C9PA 1EPTB 1LHGH 1O3OA 3GICB 1YCPM 2SGFE 3OU0A 3MOCA 1J16A 1KXFA 1ACBE 1TRMA 4INHA 3VEQB 4B74A 3T2NA 2V3OH 3SNAA 2OXSA 2EI7A 1C5OH 1OYTH 1AB9C 1G3BA 2OINA 4IS5A 3LOXA 5DKMA 3RU4E 3TGKE 1B7XB 1VGCC 2FOMB 1ESTA 2OLGA 5E8EH 4K5ZA 3GDUA 1Y3VA 4AX9H 1ZJDA 5EXLA 3PWBA 1HAZB 4WXIA 2LPRA 5T3HA 2ANWA 3TH4H 1ELBA 1GJBB 1A3EH 1BJVA 3F9GA 2VVUA 3ZYDA 4LZ1H 3Q3KA 1MAYA 1PPCE 5C20A 2PW8H 1EZSC 1Z8GA 2ALPA 3RXEA 2QXJA 1F5KU 4XE4A 4X6OA 5DGJA 1NRQH 1LPKB 2FMJA 2ZPQA 1S0QA 1OX1A 1V3XA 3MU0A 1SGDE 3UNRA 3TU7H 2G4UA 2JETC 1UVSH 1ZTJA 1GDQA 1YCPH 2FEQH 1K1NA 1VITG 1GBJA 1QFKH 1TX6A 4IGDA 2UUYA 1HAYB 3NK8A 4H6TA 1GBIA 4CH8B 2OBOA 3UR6A 3KHVA 3LH1A 1TB6H 3RXKA 3GCOA 1AU8A 1GBDA 1MTWA 2EI8A 4ESTE 2G4TA 1HUTH 1V2TT 2BB4A 1O3LA 1BA8B 3GY6A 1RTFB 1TLDA 2PGBB 3MH6A 4FUIA 2PKSC 4AZ2B 3KNXA 3RUOA 1K2I1 1UVPA 3M7TA 2AMDA 5CE1A 3ZZCA 1GHVH 2BDIA 1UO6A 1DT2A 2SGQE 3RXTA 2FP7B 3QO6A 1TNHA 1F92A 1DY9A 4A6LA 3S7KB 2B0FA 1O3JA 2HNTE 1OWKA 4B71A 2ZA5A 4OS1A 2CMYA 2Q6GA 3EA7A 1BBRH 3V3MA 1KDQA 3M5OA 1IHTH 2PR3A 5EG4A 1HJAB 2ZIQH 1UCYK 1UK2A 3M3TA 1T8OA 1W0ZU 2OC8A 4YZUA 1QR3E 2ZP0H 7LPRA 1W7XH 1MZAA 1N6XA 3I77A 4X1RU 4MTBA 3U8TH 1GJAB 6CHAB 4IBLH 1EPTA 1TPSA 4ABEA 1BUIA 1PPGE 1O2RA 4JMYA 3ZV8A 5GWZA 4H42U 1O2LA 5EGMA 3FAOA 2WPMS 5C5OA 3NWUA 1T8NA 2R0LA 2XWBI 2ZDLA 1C5ZB 1NRPH 2ZDAH 3P8GA 4RSPA 1O2PA 4ISIH 1TWXB 1TX8A 1C5XB 1HAHH 1YPKH 3N7OA 1B0EA 2GCTB 4X1NU 2XC0A 1HDTH 3BTDE 3FP8E 1O3AA 1MTSA 5AF9H 2AGGX 2GV7A 4OS5A 4INKA 5T6DA 3FANA 2PUXB 1NFUA 1ELTA 2G5NA 3M5NA 4B2AA 5ESTE 1HAVB 3DT0H 1NU7B 2P3FH 3ZZ8A 1V2OT 1W10U 1XKBC 3HGNA 1NS3A 4CREA 5J4SA 3PLPA 4UD9H 3SI4H 5CHAB 5A8XA 1IQNA 2FS9A 2UWOA 3SU0A 2C3SA 1FXYA 4ABAA 1CHOF 1P9UA 1XUJA 2W26A 4RKOB 1XUIA 2FESH 3FZDA 1HLTH 1OP0A 1JRTA 2FO9A 2FDAA 5EQSA 2W3KA 1MQ5A 1C1TA 2I6QA 1W14U 2ZPSA 2BY9X 5C1XA 3MO3A 4UEHH 1C5UA 3VXEH 5DK1A 1ESAA 1LPGB 2VGCB 4HTCH 1AIXH 4NGAH 3RMMH 1ZSJA 4I8LA 4NIXA 1BTPA 3VB5A 4FUDA 3RXLA 3LGVA 3RP2A 3ZVAA 1V2RT 5L2YH