3L3TA

Human mesotrypsin complexed with amyloid precursor protein inhibitor variant (appir15k)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/cell adhesion
molecule keywords PRSS3 protein
publication title Determinants of affinity and proteolytic stability in interactions of Kunitz family protease inhibitors with mesotrypsin.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3l3tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3l3tA02
3DD2H 1H9IE 1RFNA 1YP9A 1GPZA 3BTGE 1E38B 3VPKA 4ABAA 1LVMA 4MNYA 1PYTD 3ELAH 5FX5A 1HBTH 3UOUA 4X1SU 1EATA 3QUMP 1TRNA 3URDA 3QN7A 5A8XA 1PYTC 2B0FA 3ZVEA 4AG2A 3A84A 3OY5U 3A7ZA 4AYYB 1OXGA 2W5EA 1GJ8B 1S0RA 1T4UH 1TMUH 4JZIA 2FODA 4CHAB 5DO4H 5AVDA 1YCPH 3LIWA 5L30H 4Y0ZE 1M9UA 1Q2WA 1XMNB 7GCHF 2J2UA 1O2PA 1NFYA 1RTKA 2XRCA 1N8OB 1TQ7B 4O9VA 2NU0E 2FPZA 4X1PU 4AG1A 5DPAA 2ZU5A 1O2RA 4XBCA 1EPTC 5L6NH 1LVYA 1J8AA 4WJG2 1O2YA 1O32A 2BB4A 3SUFA 1ZLRA 1HLTH 1GI8B 2Y7ZA 3EAJA 3FVFB 4Y6DA 1P57B 3O8BA 1D6RA 1ANDA 2A5AA 2C8YB 4UD9H 2R3UA 7GCHG 5FBEA 1IQNA 3GY5A 1OYQA 1Y8TA 1NFUA 4WH6A 3K9XB 1DFPA 2ZDLA 3GY2A 1D6WA 1C1NA 3EYDA 5JBCS 1Z71A 5JDUB 1MQ5A 2H5DA 1EOLA 2J92A 1TB6H 3RXKA 1O36A 2QIQA 2QGRA 1V2OT 4Y71A 4WMDA 2SGPE 3D62A 1GBHA 2BHGA 5E0JA 3MTYA 4AGJA 1UVSH 4TPYA 1TMTH 1TA6A 3O8DA 3M61U 1K28D 2ZFFH 5JBAS 3AW0A 4JZ1A 3LC3A 1MBQA 5PTPA 1EXFA 3STIA 1S6HA 1NRNH 1SI5H 1W3CA 3CENA 1DY8A 3UOPA 4X6NA 1TGBA 1PQ5A 1O3EA 1Z8RA 2OD3B 1GMHF 1MH0A 1UMAH 1AB9C 4X6OA 3EA8A 3RU4E 1FI8A 3I77A 3MFJA 5DKMA 2PGQB 1IQFA 1UJ1A 2F83A 1B7XB 1VCPA 1HV7A 1OWJA 1RGQA 4AN7A 3RC4A 1AE5A 1V2LT 2R3YA 1T31A 3KEEA 1UTMA 2CJIA 2OP9A 2Q6DA 3B8JA 2XWAA 4AFUA 2IJOB 2PGBB 4ISIH 2FEQH 1BMLA 1YPLH 3BG4C 1ZPZA 2GV7A 2CMYA 3S7HB 1GBFA 5HM2A 4DT7B 3LC5A 2GZ7A 1XX9A 3SV8A 4CRGA 2PHBA 4X0WU 1BTXA 4WMFA 3SJ8A 3D23A 4K60A 3A7WA 1GHWH 1AVWA 1GBJA 1MZAA 2V6NA 2A4QA 3SBKA 4DG4A 1TE0A 4UDWH 1HRTH 4D76A 1KY9A 3GCHC 1QGFA 1TNIA 3ZYEA 2VGCC 2VIOA 4IGDA 2B7DH 1D9IA 2KAIB 3F9HA 1O37A 3FP7E 4NGAH 4BTUB 1YGCH 3ZZDA 1J15A 1OP8A 2AERH 4X8VH 3HK3B 2D2DA 3MOCA 5E8EH 5C67A 3SUEA 3SNBA 3MNXA 1GMDF 1OOKB 1Z6EA 3RXOA 4Q2KA 3T62A 1DVAH 1NC6A 1G3DA 3SW2B 1LHEH 3AAUA 3NZIA 4MPXA 1CVWH 1DWCH 4FUJA 1C2MA 4FU9A 2G51A 3PWCA 4VGCB 3T25A 5BPEA 5EXLA 1NN6A 3OU0A 1ELBA 1C1RA 2RA3A 4Q7YA 2VH0A 3SJOA 2P93A 1F92A 1ZHMA 1UK4A 1Z7KA 3P70B 3RM2H 1VGCC 2FOGA 8LPRA 3PTBA 2ZHWH 5A8YA 4LZ4B 3RMOH 1GHAG 3OX7U 3RXUA 2UUKB 3GCOA 1V2TT 2ZPSA 4I8HA 2HVXA 2V3OH 5I46H 3MU1A 5EOKA 3PMBB 1O3MA 2WPHS 3O8CA 1JWTA 1FPCH 1K1OA 1BMAA 6CHAC 3HPTB 1HAOH 4XBDA 1DS2E 1WTGH 1ZRBA 1ZMNA 2ZCLP 1MTNC 1LPGB 3P8NA 3RDZA 2ZO3H 4HGCA 3ZZ8A 1ELEE 5HYOA 3RXJA 3LONA 4CH2B 1W0YH 2W3KA 3SV2H 1AD8H 4YO9A 1ANEA 4E7RG 2R0LA 3LH3A 1P11E 1YCPK 1SOTA 2XC0A 1C2JA 2QXIA 3DHKH 3K2UA 1Y5BT 4I8LA 3GDVA 4I32A 3ZVAA 2TBSA 1ETSH 3DT0H 1E35B 1KYNA 3PMJA 1GJ5H 4MG3A 4J2YB 3I78A 4ZXXH 3A81A 1K1LA 3SU4A 1S6FA 3E91A 3Q3KA 1UK3A 1SL3A 2AIQA 3BG8A 1OS8A 4JYTA 1L4ZA 2EC9H 3ZYDA 1EP5A 1AY6H 1OP2A 3RXMA 4WY3A 4X8UH 1JMOH 1YF4A 1A0JA 2W26A 4FUCA 4ESTE 1EB2A 1DXPA 4BAMB 5C1UA 2K1QA 1V2VT 4FXGH 1EPTB 4NWLA 1MTWA 3MWIU 1AU8A 2C4FH 1F0TA 1THSH 1FLEE 1BQYA 2SNVA 2QY0B 1O3AA 2IPHA 2GVFA 2W3IA 1V2JT 2C3SA 3W94A 4B1TA 3EA7A 4K1EA 1SFQB 1FPHH 4LZ1H 1O34A 1ABJH 1L2EA 1TGTA 2R9PA 1K1NA 2GZ8A 1NY22 3RXAA 4NSYA 4NFFA 4YM9A 5LH8A 1A5HA 1IQEA 1HAVA 3JZ1B 4CRCA 3ATLA 4NA8A 5DG6A 3JZ2B 1XUGA 1PPCE 3BTEE 2O8UA 4ZROA 1FN6A 2UUJB 1FQ3A 3LJOA 5DP7A 2FS9A 1W11U 2BD8A 2NU4E 5C2ZA 3LGUA 2ZFPH 2XC5A 3SU5A 1FY4A 5CHAC 3UNSA 2FIRH 1C9PA 4FUEA 3U69H 2SGAA 4CRFA 1QJ1B 3T26A 2WPMS 1BT7A 1P3CA 5F8TA 2VNTA 2ULLA 1AB9B 1SHHB 1D3TB 2DUCA 1BHXB 5LPEA 2THFB 5IDKA 2ZHQH 1C5PA 2OCVB 2PW8H 4YT6H 2XYAA 4LK4A 1B0FA 1O2ZA 4K8YA 4Q7XA 3ZZBA 1W0ZU 3MH4A 3VB4A 2OQUA 3ZVFA 1E36B 1FXYA 3GDUA 4D8NA 1RS0A 1Z1IA 4SGAE 3TITA 2Z3DA 1C2LA 1K1JA 1UCYE 2BOKA 2H9EH 1WAYB 3FP8E 3BG4B 3SGQE 1K21H 4GCHG 3UY9A 3IG6B 5L2YH 1MAYA 1TPPA 5FX6A 4NSVA 5FPTA 2XBVA 3BF6H 2OLGA 3WY8A 1Y5AT 1GJAB 1RTFB 2AGIX 3QTOH 4FUIA 3RXQA 1H9LB 1SQAA 1FY8E 1ZTKA 2FZZA 3GCHB 2VGCB 4FVBA 1LVBA 1O3IA 1P8VC 2ZHEH 3A8AA 1LPKB 4F49A 1F2SE 3VXFH 1TNHA 1F5LA 3T5FH 1EASA 1O31A 2BVXH 2BDHA 1BOQA 1ESAA 2A4RA 2TGTA 4GSOA 2VB0A 4IC6A 3ATKA 3G01A 3SUDA 1VCWA 3BTQE 3L3TA 1CGIE 1XVMA 1NO9H 2ZP0H 1DSUA 2ZGCA 3NUMA 1ARBA 1ZPBA 4I8JA 1H9HE 3ZZ5A 1XUFA 2HPQH 3ENSB 1BBRE 1OWEA 1PPZA 1TX8A 2AYWA 1BRBE 4WH8A 4I8GA 3MH7A 2SGDE 4TYDA 2QXGA 1NESE 2FI5E 1XM1A 1CA0C 3QDZB 1FY3A 4X8TH 2XC4A 2Z3EA 4A1XA 1PPHE 3M7QA 1V2KT 3HKIB 2BX3A 1GBBA 2D8WA 1GL1A 1RIWC 2FOMB 3SU6A 3M5OA 1Q31A 3ATIA 3LGIA 1HAYB 3TJUA 4U2WA 1SGYE 2ANWA 1VGCB 2Z6BD 1MKXH 2A5KA 2CN0H 2Z9LA 1V2QT 1C1OA 1CA8B 5ETXA 2FM2A 1SGPE 4Y8YA 5DP3A 3U8OH 4A1TA 1TNGA 5AHGH 2JKHA 1QB6A 3S69A 1C2GA 3U98H 4Y10E 2F3CE 1GMCG 4K1SA 4IBLH 3CS7A 2PKAB 1LHDH 3A8BA 3P17H 4A6LA 5AF9H 1N1LA 6CHAB 1SHYA 3QZQA 2UWLA 1E37B 4K3JA 3OSYA 4NZQA 2ANKH 2BYAX 1C5ZB 1MTNB 2HNTE 1VJ9U 4BNRA 3S0NA 1IQJA 1O2SA 3RXBA 2C8XB 2F9UA 5C5NA 3GYMA 2FXRA 4JMYA 1WYKA 3UQOA 1C5RA 1P2KA 1F0UA 3D65E 1QR3E 1DUEA 1ELTA 3MI4A 1IOEA 1QJ7B 3MH5A 3BN9A 1EZUC 1HUTH 2OC1A 4WXIA 1BHXF 3QWCH 2ZDNA 3TK6A 1H4WA 2PR3A 1W2KH 2BD5A 3RXFA 3MO3A 1GDUA 1DWDH 1DITH 6GCHF 9ESTA 2BQWB 5F8XA 2ZCHP 2ZECA 4Y8XA 5DGJA 4D7GA 3KHVA 4H42U 1AFQC 4X6MA 2OINA 1HDTH 1MAXA 3P8OA 1FY1A 4ZUHA 3SQEE 6LPRA 1L1GA 2XNIA 2IN2A 5ESBA 3KN2A 3KCGH 2XTTB 1LPZB 2ZGJA 4AZ2B 1MU6B 1A1RA 2PSYA 4Y8ZA 3LOXA 2XCFA 6GCHG 2G5VA 3BIUH 1UVUH 2H9HA 7LPRA 4MNVA 4NWKA 1C5UA 3LGYA 1O2OA 2XBXA 3TJNA 2Z9JA 3E0PB 4MPUA 6ESTA 3ZZ7A 1H8DH 1WQSA 2CV3A 2AEIH 2V35A 3LGTA 1TFXA 1TAWA 2WUCA 5GDSH 1Y3YA 1ESTA 3V12A 2BXTH 4FU8A 1C2KA 1DOJA 3VB7A 4DOQA 5FCKA 2P59A 1KLTA 2AH4X 2PWXA 1GCTC 4ISHH 3RMNH 2QF0A 1GBTA 2P3FH 7KMEH 1O2XA 2ZC9H 2PLXA 3M5NA 5HMAA 3ATMA 5CHAB 1O2MA 1BDAA 1VCQA 3EE0B 4HI3A 2XBYA 2ZU4A 2Z9IA 2ZGXH 2ESTE 4Y7BA 1BZXE 5DP4A 1LTOA 1HJAC 1JXPA 1G3CA 3TK9A 1GBLA 1A2CH 3UWIA 2M5TA 1C5OH 2V3HH 1S83A 2TGPZ 1GHBF 1O2LA 1C4U2 3RXCA 1O3OA 2OC8A 3ATWA 3IITA 3RXSA 3SO3A 2UWPA 1GBCA 5BRRE 1T8OA 5EXMA 1KXBA 4OGXA 1IQHA 1CHOF 1GVKB 2BD7A 2QC2A 4YESB 2EI8A 1T8NA 1FIZA 1SFIA 2ANMH 2G5NA 3SNCA 1C5LH 4MDSA 1P04A 4BXSA 1GHBG 2A5IA 1V2NT 2NU1E 1GJ7B 2J34A 4E7NA 4ISLA 1RD3B 4U30A 1HAHH 3NWUA 1ELFA 5C20A 1G30B 4D7FA 1ELDE 1V3XA 2Y80A 4RSPA 3QLPH 2ZTYA 1SGTA 2GP9B 1CHOG 2Y82A 1TGNA 1P2JA 3I29A 2AMPA 1UVOA 1SB1H 2ZI2H 1HJ9A 1UCYH 1ZMJA 2FOHA 1A3BH 1QNJA 3UNQA 4O3UA 4HTCH 3RMLH 1XVOA 5J4SA 1O5DH 3U8RH 1GI4A 4ABEA 2Y5GA 2TIOA 2G55A 4B76A 1RRKA 3VGCC 1P05A 2BVSH 2Y5HA 5C5OA 2KAIA 4UFGH 2ODPA 1O2HA 1GI0A 3CS0A 1C1SA 1C5QA 1GBIA 1BUIA 1W12U 3KGPA 1EAUA 1ORFA 4LXBH 4KTSA 1ZJKA 3SHCH 2R2MB 1GI1A 1TNKA 3U8TH 5DK1A 2I6SA 1ETRH 1TYNA 3KQCA 3SN8A 4WWYA 1MKXK 1MTSA 1GJCB 1NS3A 3FFGA 4I31A 1CA0B 1SR5C 3LGWA 1DICA 2GTBA 1TLDA 2FTMA 4NIYA 4JZFH 1OPHB 1RIWB 1L1NA 3IWMA 3E8LA 1GBKA 1K1IA 1BBRH 1AO5A 4J1YA 1IHTH 4HZHA 1O2QA 1RJXB 3P6ZB 3TJVA 2ZHFH 4Y7AA 2ZTXA 1C5MD 1C2EA 1O3NA 3URCA 5GPIB 1C5SA 2BLWA 4GHTA 1SGEE 4DGJA 2BD4A 2TGAA 2ZDMA 2JH0D 1UHBB 1EZXC 2ZPRA 2QCYA 3GICB 5LGOA 1LHGH 3T27A 4GHQA 1QQUA 3GCTF 1NU7B 4KELA 3SGBE 2EI7A 1AKSB 1GHXH 2FMJA 5H4IB 2XBWA 1FAKH 3NK8A 2ZGHA 2P8OC 1TBZH 1FNIA 2WPJS 3BTWE 2A1DB 3V13A 4ZHAA 1FAXA 3MH6A 4K8BA 1O38A 2GZ9A 5F03A 2HWLB 4WXVA 1K22H 2FP7B 2HNTC 2A45B 1XKAC 4FUHA 2BDAA 1BIOA 1GDQA 3GCTG 5GIBA 1C9TA 2BOHB 2ZU3A 1SLUB 1N6XA 1AFQB 4GVUA 4O3TA 1D4PB 2O9QA 1QTFA 4JYVH 2VH6A 2BY8X 1NRRH 2BY7X 4JK5A 2P3UB 1SGRE 1O5GH 1YM0A 9LPRA 1EJMA 1ZZZA 1GHAF 4BXWA 4IN1A 1DLEA 1QJ6B 3Q3XA 4XDEA 2F9BH 1KXEA 4TPIZ 1QRXA 2D1JA 3B9FH 1TNJA 1EPTA 1IQLA 1XKBC 3F1SB 3CP7A 1MCVA 3KQDA 3ZVCA 3BTDE 3LJJA 3DFLA 1HNEE 1FZZA 1OWDA 5EQQA 3GY3A 2I6QA 1ANCA 1SLVB 2G8TA 2QA9E 3SORA 4DW2U 1INCA 1BTPA 1AFEH 3ZZ6A 2FX6A 3OTJE 2HALA 3RXIA 2GT8A 5TJXA 2ZQ2A 2J38A 2FLRH 1OSSA 3BEFB 1WOFA 4INLA 3RXDA 1UTQA 3HGPA 1YPKH 2F9PA 1SQOA 5A0CA 4RN6A 1OWKA 1GCTB 2ZFTA 3K6YA 2GKVE 2HLCA 3KQEA 3BIVH 1UTKA 1P02A 3UFAA 4CH8B 1EZQA 1ZTJA 1J14A 4MPVA 3SI4H 3EA9A 1P2MA 1ZMLA 4M7GA 5DP5A 2R2WU 2ZWLH 2WPKS 1CT0E 4TWWA 2OC0A 3HKJB 2AGEX 2G52A 2VWNA 1KLJH 1HAIH 3GOVB 5GWZA 3SU2A 1HJAB 2A0QB 5GCHF 1QIXB 5GXPA 1C1PA 1T4VH 1GWAA 3TVJB 5DP6A 2IOTA 2PTCE 3MMGA 1TGSZ 1XUJA 3A82A 3AASA 1ARCA 1GI6A 3QO6A 1AVGH 4ABFA 3BTME 4I33A 2P95A 3ZV9A 3F9GA 4X2YA 1C1VH 1DANH 2PV9B 2NWNA 1EOJA 4TWYA 4INHA 3PB1E 5GCHG 2STBE 4LOYH 1E34B 2VU8E 1WUNH 3LDXH 1DPOA 5IYTA 3RXHA 1UCYK 2Y5FA 1Z8IB 4NIWA 1FN8A 2BD3A 2FS8A 1Z8JB 2ZTZA 2LNCA 1GJDB 1BRUP 4KTCA 4GLYA 1QCPA 2TGDA 2BY9X 3E1XB 3P95A 1SGFA 1WCZA 5HM9A 1BMMH 1CBWC 1P9SA 2DE8A 3H7TA 3TGIE 1K1PA 3QGJA 2CF8H 4GPGA 3KF2A 5JB8S 4MQAA 3MNSA 1LQEA 5EU8A 1AWFH 1SVPA 4X2VA 2A4OA 1C1UH 2GV6A 3BTFE 2ZDAH 3M3TA 2W7UA 2PFEA 1ELGA 2FOFA 1VZQH 1V2UT 1V2PT 4O03A 5EW1H 3VGCB 4DCDA 1C4V2 3SZNA 2BLVA 1GBMA 1PQAA 3T28A 1FIWA 5FCRA 1S84A 1KLIH 1C2FA 4INKA 2H2ZA 4A92A 1AI8H 1BBRK 2FLBH 3L33A 3ESTA 4ZKOU 1TBQH 4IW4E 5F6MA 3M37A 5T6DA 3LGVA 1YC0A 2ZGBH 1MTVA 1TA2A 2C8ZB 1TNLA 3DUXH 2YOLA 4GCHF 1LDTT 4K1TA 1GJ9B 1ZGVA 2ALVA 1T32A 3T29A 4ZKRU 2FYQA 5HGGA 3BTHE 1XXDA 1JIMA 2VIPA 3GY8A 2G4UA 5FAHA 2A7CA 2ZDKA 1O2GH 1XXFA 1DWEH 4K5ZA 2AMDA 4F4OC 4ZMAH 3SGAE 2BZAA 4IMQA 3TNSA 3NXPA 2FOEA 1JIRA 1AGJA 1GL0E 3BEIB 1SMFE 1GHVH 1Y3WA 3FAOA 3A8CA 2PKAA 4H6TA 1BTZA 1YYY1 1GGDC 4O97A 5A2MH 2RA0A 5JBTA 3ODDA 1DY9A 1DX5M 5DP8A 1G32B 1MZDA 1GI3A 2AMQA 2P8OB 2Y81A 4YOGA 5FPSA 3QX5H 5EW2H 1D3PB 2C90B 2TPIZ 3BSQA 1C1MA 4FUBA 2ZG0H 3E0NB 5C1XA 2ZIQH 4FUGA 1IQMA 3PTNA 1PPFE 5E2PA 1O35A 1GBEA 3TH2H 1HAVB 2BX4A 2B5TB 5AFZH 1YKTA 3Q77A 1QQ4A 3TIUA 3GY7A 3P8GA 1BJVA 1YPJH 2PTNA 4DIHH 1T7CA 2AIPA 2BDBA 2F9VA 4XE4A 1Y3VA 3E3TA 2CGAA 1KDQB 3TGJE 3RLYH 3EGKH 1GI7B 1O39A 3QK1A 2BZ6H 5FPYA 1GJ4H 1NT1A 1KIGH 1GMCF 3V7TA 4KP0A 4NFEA 1O2UA 1ZOMA 4IC5A 1LCYA 4AFSA 3UR6A 4IN2A 5EXNA 2VVCA 3ZVDA 2WINI 2A7JA 2VVUA 1UTOA 1ELVA 1SGCA 1SQTA 1F7ZA 1VJAU 2Y6TA 5TCAA 1K1MA 2BQ6B 2EI6A 2FDAA 2FOCA 3HGNA 4NG9H 4AGKA 1KTSB 5T3HA 1C5TA 3MO6A 2FO9A 1ABIH 2AGGX 1O2IA 2LPRA 3RMMH 2BD9A 2VWLA 4ZHLU 4ISNA 3ITIA 2O8WA 2PSXA 1GDNA 3LH1A 3SI3H 3ZZ9A 4A7IB 1HAGE 1P12E 1YCPM 1TPAE 4RKOB 1QHRB 3LU9B 1AE8H 3F68H 1TONA 1Z6JH 2ALPA 2F91A 1ACBE 1C5YB 1XUIA 3TPIZ 1ELCA 5C3NA 2GT7A 3SOSA 2UUYA 1GJBB 4X2WA 2PKSC 1CHGA 2VIDA 4JCNA 3STJA 4HFPB 3MNBA 4CRAA 3DA9B 1O2KA 2Z9GA 1GVLA 1Y3UA 4ABHA 3E6PH 1ELAA 1GHYH 1MBMA 1A5IA 1TRMA 2ZDVH 1B0EA 3A7XA 3PMAB 2NU3E 1PQ8A 1ZPCA 3MO9A 1PPGE 2FESH 3SJ9A 1YPHC 1QURH 1FV9A 1HXEH 4GUXA 1BA8B 2OXSA 4X8SH 1Q3XA 1NROH 5T6GA 1NU9A 1DXWA 1P2OA 1KSNA 3C27B 2BD2A 2HRVA 2ZZUH 3R0FA 3ZZ4A 1O2VA 1WV7H 3GY6A 2HGTH 2Z7FE 1IHSH 1QBVH 4NA9H 2PUXB 1CBWB 1LO6A 2SNWA 4UE7H 3LKWA 4YLUA 1XUKA 3EDXB 1EKBB 2ANYA 2R0KA 1GBAA 1V2MT 2AFQB 2ZU2A 1QB9A 1OWHA 1C1TA 3HK6B 4Q80A 1D3QB 4I7YH 3AAVA 2HNTF 5EGMA 5FBIA 5J4QA 4YLQH 3MU8A 3U1IB 2QYIA 1SGIB 3AVZA 4FU7A 1P2QA 4U01A 1QRWA 1ZSLA 3TJOA 3O8RA 5LPFA 1G3EA 1YPGH 3U9AH 2CXVA 3F6UH 4X1QU 4BTTB 1V2RT 3F9FA 4DVAU 3PLBA 4Y0YE 4JYUH 3TLOA 3NPSA 2J4IA 1NFXA 1K9OE 3RXGA 1C4Y2 1O3CA 1T8MA 1GI9B 2XXLA 3UREA 3MU5A 2ODQA 1P03A 1A0HB 4K69A 4A1VA 2HPPH 2RG3A 2SGFE 1HIAB 4H6SB 4CRDA 1W10U 4ZHMU 3PO1C 1G36A 4ABJA 1NRSH 4YOIA 2ZPQA 1O0DH 1UVTH 2CF9H 5E0HA 2FYRA 1QL9A 2VIVA 3GYLB 3A88A 2XWBI 1AN1E 1Z1JA 1S81A 2BY5X 1HFDA 4TY7A 3RC6A 3SV6A 1A46H 2C93B 2VINA 4BTIB 4CBOA 1ZYOA 2J94A 3D49H 2BDYA 2ZHDA 3FP6E 7ESTE 1BMNH 2SGQE 1THRH 2ZQ1A 2WYJA 2VJ1A 1BB0B 1OKXA 4BAQB 1TABE 1P9UA 1SPJA 1KXCA 5EPYA 1C1WH 4BAKB 2YNBA 2ZFQH 1O3FA 1UHBA 4YTAA 4ABBA 1C5NH 3PMHB 1ZHRA 3VFEA 1GGDB 8KME2 5DP9A 3RXTA 2FI3E 1NFWA 4Y76A 1O3KA 1AKSA 3F9EA 4AYVB 2DE9A 1O3BA 1HGTH 2BDIA 1QBOA 3V3MA 1DM4B 1GCDA 5ABWA 1TBRH 2WYGA 1O30A 2EEKA 2OBQA 1V2ST 1AUJA 3RM0H 1VITH 5HXFA 4UONA 3VB6A 1TOMH 2F9NA 4FVDA 4U32A 4ZAEA 4X6PA 4D9RA 1P10A 3QZRA 1W13U 1VR1H 1GI5A 2VWMA 1LQDB 1P01A 1EJAA 4CREA 3GISB 3M5LA 3DFJA 1W14U 1EAWA 4YZUA 1CGJE 3S9CA 1PJPA 4ZKSU 2FI4E 1IQKA 1P2NA 4OS2A 1MUEB 1SGDE 1HPGA 1SSXA 2H6MA 2JETC 3RXEA 2WPIS 3M7TA 1DSTA 3C1KA 2V0BA 2VIQA 5I25A 4R8TB 1G37A 3M3SA 2FOAA 2GDEH 4FUDA 3ZV8A 5JBBS 3S9AA 1TMBH 1LMWB 2GCTC 2J9NA 1DUAA 1FJSA 3W95A 3ZVGA 2P94A 1DE7H 1G2MA 3A80A 4E05H 1QB1A 1GMHG 1MU8B 2H9TH 3K6ZA 1FONA 5K7RA 1E0FD 4MNWA 2HOBA 1SOZA 2QXHA 1IQGA 3OYPA 4XOJA 1H8IH 1JRSA 2A2XH 2CHAC 2OBOA 3N7OA 2PKSB 2QAAA 1WQVH 3KNXA 1O2TA 1FDPA 1N6YA 3LPRA 4XBBA 4Z6AH 4AB9A 1O5BB 3UIRA 3OY6U 1MKWH 4Z0KA 2O8MA 1BRAA 1HYLA 3K65B 4D9QA 1P0SH 1L4DA 1MMJN 1AZ8A 4Y11E 1ANBA 1MQ6A 3TK5A 1NZQH 3SV9A 1HXFH 4ASHA 1O5AB 1Y5UT 1S85A 2NU2E 1XUHA 3A7VA 4WVPE 5T6FA 4THNH 1UTLM 5JYIA 2GMTC 3UWJH 1KXFA 1CO7E 1TOCB 2YNAA 4CBNA 3A83A 2AS9A 3ZZAA 4B2AA 1BCUH 4TY6A 4Y79A 5EQRA 3M5MA 3RC5A 4AORA 1OX1A 5F8ZA 1QRZA 1YBWA 2BXUH 3MYWA 3PROA 1G2LA 4B2CA 1O3PB 1EP6A 2GX4A 1J9CH 4H4FA 5EODA 1GBDA 1ZSJA 4BAHB 1QA7A 3Q00A 2Q6GA 2OC7A 1GG6C 1GMDG 4DURA 3S9BA 3M35A 3Q3YA 4OS4A 1QL8A 5A0AE 1PQ7A 1A0LA 4E06H 1TRYA 2ZKSA 1C5XB 5EG4A 3P8FA 3RXPA 1NPMA 2ZFRH 1LHCH 1HAZB 3A8DA 3VXEH 5A09A 3UNRA 2H1UA 3GCNA 1YPHE 1O5CB 1SGQE 2BLQA 3SNEA 4CR5A 1AMHA 1PPEE 1WSSH 1A3EH 1GI2A 4DIIH 4OS1A 5AFYH 3VB5A 1FUJA 4GAWA 1GVZA 1D3DB 1LHFH 5TCCA 3PO1B 1YPEH 3S7KB 3A87A 3TGKE 2J95A 3SUGA 2FOBA 4OS6A 5A0BA 1O3GA 4NA7A 3SHAH 4AOQA 3KIDU 1ESBA 3KL6A 5SGAE 1H1BA 3A86A 3BTKE 1SBWA 1LKBA 1O5FH 1UO6A 3H5CB 1MCTA 5LPRA 2BDCA 1V6DA 1DLKB 1BTHH 1P06A 3SNDA 1SC8U 3A89A 1C5VA 1LVOA 1YLCA 3QGNB 3FANA 4KKDA 1TIOA 2GD4B 1QBNA 2JH6D 2VVVA 4R0IA 5C1YA 3ODFA 1L1JA 4XFQA 1AWHB 4UEHH 2W7SA 3LT3A 5GJ4B 1F0RA 4K2YA 3SU0A 1UVPA 1P09A 2GCHF 2A31A 4JK6A 5B6OA 1WTHD 3SJKA 1NTPA 1QL7A 1EUFA 2ZFSA 1O3DA 3PWBA 3TH4H 1J16A 4B73A 1SLWB 1A5GH 1G9IE 2JH5D 2ZEBA 2BLOA 2P16A 3HATH 1HAPH 1U6QA 1BTWA 3KQBA 4Q7ZA 2C8WB 4I8KA 1KTTB 8ESTE 1X7AC 1C2HA 4RKJB 1S0QA 4X1RU 2PUQH 1WU1A 4PROA 3PV4A 1DDJA 2GCHG 1BTYA 3V0XA 1MD8A 3UQVA 2G00A 1KDQA 1S5SA 5L2ZH 3GDSA 1NRPH 2OTVA 1AZZA 2Q6FA 2UUFB 2VWOA 3VEQB 3A7TA 1W7GH 1ZR0A 3M36A 4NCYA 2JETB 1ZGIA 4ZXYH 3SQHE 2BMGB 4DY7B 3M7UA 1JBUH 1BJUA 1AUTC 1S82A 3BEUA 3A7YA 1OWIA 4DJZB 1CSOE 3VB3A 1GHZA 3RU4D 2RDLA 2GCTB 1EJNA 1F5KU 5CMXH 2QV1A 5DJ7A 4CHAC 4ABIA 4B71A 2Z3CA 3RXRA 3P92A 2ILNA 2G81E 5EPNA 1UTNA 1TPSA 2BTCE 3U1JB 4KTUA 1TALA 3ZZ3A 1BTUA 4B75A 1MD7A 2QN5T 4XSKU 1N8OC 1MKWK 1IQIA 3RLWH 4AB8A 1A4WH 4NIXA 2STAE 1ZRKA 2CHAB 1O3LA 4AFQA 2A4GA 1HAXB 1UK2A 1AQ7A 1TWXB 2ZU1A 3RU4T 2A32A 1YLDA 2EA3A 2BVRH 3ZVBA 1UTJA 3PLPA 3SU1A 1P3EA 4YT7H 3FZDA 2BQ7B 2ZF0H 4BANB 1KXDA 1RTLA 3TNTA 3AW1A 1CQQA 1CGHA 2XW9A 3T2NA 1ZHPA 2VIWA 2BM2A 4QT8C 4CR9A 1OP0A 2B8OH 1HCGA 1NRQH 3MHWU 1ETTH 5JPMH 2SGEE 1C2DA 2O8TA 5CE1A 5E0GA 1C5WB 4ZKNU 3NKKA 2QXJA 1G3BA 1O3JA 1AHTH 1Y59T 4OS5A 1EQ9A 1NM6A 1TGCA 4BAOB 1ZJDA 2GMTB 3M3VA 3PLKA 8GCHF 3UUZA 3FZZA 2WPLS 4B2BA 3E16B 2ZNKH 5JB9S 4BOHA 3E90B 3Q76A 4MPWA 1O3HA 2G4TA 3EQ0H 2ZA5A 3TH3H 2FX4A 1ZSKA 1CT4E 4AFZA 4B74A 1BITA 8GCHG 2GDDA 4FUFA 1QFKH 1GG6B 1VITF 4JZEH 3B23B 1JOUB 2FWWA 1FY5A 4MLFB 1O33A 1P2IA 2A2QH 5ESTE 5FHTA 1SGNE 1B5GH 4ABGA 1TX7A 3RXLA 4OS7A 3SU3A 3RP2A 1AIXH 1GJ6A 3MU0A 3GY4A 3TU7H 4X1NU 4AX9H 4ISOA 2WUBA 1F0SA 1Y3XA 1IAUA 1EB1H 1O2JA 1O2NA 3SJIA 3ZZCA 1VITG 5A8ZA 1ID5H 2BY6X 1EX3A 4ZH8A 1HJ8A 1QY6A 4WMEA 4CRBA 2F9OA 1C2IA 4X2XA 1L0ZA 2P3TB 1UTPA 1RXPA 2ASUB 3BTTE 1DT2A 2TRMA 4NZLA 1FMGA 3SV7A 1YPMH 3NCLA 1HB0B 2H5CA 4IMZA 2Y7XA 1TPOA 1HIAA 5K0HA 1CE5A 2QF3A 2A7HA 3MU4A 2BDGA 2WV4A 2D26C 2RCEA 4OGYA 1BRCE 1TX6A 2XCNA 4YOJA 2O8LA 3RUOA 1O2WA 1C1QA 1MTUA 1J17T 3PM3A 1A61H 4ABDA 3UTUH 1F5RA 1K2I1 2OQ5A 2OUAA 1LKAA 3UR9A 4UFFH 1T8LA 1CU1A 1V2WT 4SGBE 2GGVB 5E2OA 1SLXB 5G4BA 1O5EH 1EAIA 1ZTLA 4UFEH 1PFXC 3MNCA 2WV5A 1EZSC 1DWBH 1EAXA 2Q1JA 3QTVH 2SFAA 3PYHA 1WBGB 4VGCC 4MNXA 5FXLA 4WF8A 1PPBH 2ZCKP 3RXVA 2B9LA 3H7OA 4MTBA 3UPEA 4A5TS 3A85A 1W7XH 4UFDH 2ODYB 4NIVA 1THPB 1QA0A 1W8BH 4MVNA 1SG8B 1CT2E 4JZDH 3L6PA 1Z8GA 3BV9B 2Z94A 1AVXA 1KXAA 1SGFG 2UWOA 1OYTH 3SNAA 2Z9KA 4KGAA 1TQ0B 2FTLE 1A7SA 5EQSA 1JRTA 3R3GB 4IS5A
chains in the Genus database with same CATH superfamily
2KFWA 3DD2H 1H9IE 1RFNA 1YP9A 2J98A 1GPZA 3BTGE 1E38B 3VPKA 4ABAA 1LVMA 4MNYA 1PYTD 3ELAH 5FX5A 1HBTH 3UOUA 4X1SU 5C0UA 1EATA 3QUMP 1TRNA 3URDA 3QN7A 5A8XA 1PYTC 2B0FA 2VBCA 3ZVEA 4AG2A 3A84A 3OY5U 3A7ZA 4AYYB 1OXGA 2W5EA 1GJ8B 1S0RA 1T4UH 1TMUH 4JZIA 2FODA 4CHAB 5DO4H 4RT0A 5AVDA 2KR7A 1YCPH 3LIWA 5L30H 4Y0ZE 1M9UA 1Q2WA 1XMNB 7GCHF 2J2UA 1O2PA 1NFYA 1RTKA 2XRCA 1N8OB 1TQ7B 4O9VA 2NU0E 2FPZA 4X1PU 4AG1A 5DPAA 2ZU5A 1O2RA 4XBCA 1EPTC 5L6NH 1LVYA 1J8AA 4WJG2 1O2YA 1O32A 2BB4A 3SUFA 1ZLRA 1HLTH 1GI8B 2Y7ZA 3EAJA 3FVFB 4Y6DA 1P57B 3O8BA 1D6RA 1ANDA 2A5AA 2C8YB 4UD9H 5KEDA 2R3UA 7GCHG 5FBEA 1IQNA 3GY5A 1OYQA 1Y8TA 1NFUA 4WH6A 3K9XB 1DFPA 2ZDLA 3GY2A 1D6WA 4ASUD 1C1NA 3EYDA 5JBCS 1Z71A 5JDUB 1MQ5A 2H5DA 1EOLA 2J92A 1TB6H 3RXKA 1O36A 2QIQA 2QGRA 1V2OT 4Y71A 4WMDA 2SGPE 3D62A 1GBHA 2BHGA 5E0JA 3MTYA 4AGJA 1UVSH 4TPYA 1TMTH 3PRDA 1TA6A 3O8DA 3M61U 1K28D 2ZFFH 5JBAS 3AW0A 4JZ1A 3LC3A 1MBQA 5PTPA 1EXFA 3STIA 1S6HA 1NRNH 1SI5H 1W3CA 3CENA 1DY8A 3UOPA 4X6NA 1TGBA 1PQ5A 1O3EA 1Z8RA 2OD3B 1GMHF 1MH0A 1UMAH 1AB9C 4X6OA 3EA8A 4RT1A 3RU4E 1UW7A 1FI8A 3I77A 3MFJA 5DKMA 2PGQB 1IQFA 2KCPA 2RDEA 1UJ1A 2F83A 1B7XB 5T1VA 1VCPA 1HV7A 1OWJA 1RGQA 4AN7A 3RC4A 4FETA 1AE5A 1V2LT 2R3YA 1T31A 3KEEA 1UTMA 2CJIA 2OP9A 2Q6DA 4Q63A 3B8JA 2XWAA 4AFUA 2IJOB 2PGBB 2WPDD 4ISIH 4P00A 2FEQH 1BMLA 1YPLH 3BG4C 1ZPZA 2GV7A 2CMYA 3S7HB 1GBFA 5HM2A 4DT7B 3LC5A 2GZ7A 1XX9A 3SV8A 4CRGA 2PHBA 4X0WU 1BTXA 4WMFA 3SJ8A 3D23A 4K60A 3A7WA 1GHWH 1AVWA 1GBJA 1MZAA 2V6NA 2A4QA 3SBKA 4DG4A 1TE0A 4UDWH 4DT4A 1HRTH 4D76A 1KY9A 3GCHC 1QGFA 1TNIA 3ZYEA 2VGCC 2VIOA 4IGDA 2B7DH 3ZIAD 1D9IA 2KAIB 3F9HA 1O37A 3FP7E 4NGAH 4BTUB 1YGCH 3ZZDA 1J15A 1OP8A 2AERH 4X8VH 3HK3B 2D2DA 3MOCA 5E8EH 5C67A 3SUEA 5KECA 3SNBA 3MNXA 1GMDF 1OOKB 1Z6EA 3RXOA 4Q2KA 3T62A 1DVAH 1NC6A 1G3DA 3SW2B 2YMSC 1LHEH 3AAUA 3NZIA 3SYJA 4MPXA 1CVWH 1DWCH 4FUJA 1C2MA 4FU9A 2G51A 3PWCA 4VGCB 3T25A 5BPEA 5EXLA 1NN6A 3OU0A 1ELBA 1C1RA 2RA3A 4Q7YA 4Q4LA 2VH0A 3SJOA 2P93A 2EY4C 1F92A 1ZHMA 1UK4A 1Z7KA 3P70B 3RM2H 1VGCC 2FOGA 5EJLA 8LPRA 3PTBA 2ZHWH 5A8YA 4LZ4B 3RMOH 1GHAG 3OX7U 3RXUA 2UUKB 3GCOA 1V2TT 2ZPSA 4I8HA 2HVXA 2V3OH 5I46H 1W0JD 3MU1A 5EOKA 3PMBB 1O3MA 2WPHS 3O8CA 1JWTA 1FPCH 1K1OA 1BMAA 5EJ1A 6CHAC 3HPTB 1HAOH 4XBDA 1DS2E 1WTGH 1ZRBA 1ZMNA 2ZCLP 1MTNC 1LPGB 3P8NA 3RDZA 2ZO3H 4HGCA 3ZZ8A 1ELEE 5HYOA 3RXJA 3LONA 4CH2B 1W0YH 2W3KA 3SV2H 1AD8H 4YO9A 1ANEA 4E7RG 2R0LA 3LH3A 1P11E 1YCPK 1SOTA 2XC0A 1C2JA 2QXIA 3DHKH 3K2UA 1Y5BT 4I8LA 3GDVA 4I32A 3ZVAA 2TBSA 1ETSH 2WHXA 1E35B 3DT0H 1KYNA 3PMJA 1GJ5H 3F2GA 4MG3A 5EJZA 4J2YB 3I78A 5B6LA 4ZXXH 3A81A 1K1LA 3SU4A 1S6FA 3E91A 3Q3KA 1UK3A 1SL3A 2AIQA 2IPQX 1E1RD 3BG8A 1OS8A 4JYTA 1L4ZA 2EC9H 3ZYDA 1EP5A 1AY6H 1OP2A 3RXMA 4WY3A 4X8UH 1JMOH 1YF4A 1A0JA 2W26A 4FUCA 4ESTE 1EB2A 1DXPA 4BAMB 5C1UA 2K1QA 1V2VT 4FXGH 1EPTB 4NWLA 1MTWA 3MWIU 1AU8A 2C4FH 1F0TA 1THSH 1FLEE 1BQYA 2SNVA 2QY0B 1O3AA 2IPHA 2GVFA 3F2HA 2AHME 2W3IA 1V2JT 2C3SA 3W94A 4B1TA 3EA7A 4K1EA 1SFQB 1FPHH 4LZ1H 1O34A 1ABJH 1L2EA 1TGTA 2R9PA 1K1NA 2GZ8A 1NY22 3RXAA 4NSYA 4NFFA 4YM9A 5LH8A 1A5HA 1IQEA 2F4LA 1HAVA 3UB0A 3JZ1B 4CRCA 3ATLA 4NA8A 5DG6A 3JZ2B 1XUGA 1PPCE 3BTEE 2O8UA 4ZROA 1FN6A 2UUJB 1FQ3A 3LJOA 5DP7A 2FS9A 1W11U 2BD8A 2NU4E 5C2ZA 3LGUA 2ZFPH 2XC5A 3SU5A 1FY4A 5CHAC 3UNSA 2FIRH 1C9PA 4FUEA 3U69H 2SGAA 4CRFA 1QJ1B 3T26A 2WPMS 1BT7A 1P3CA 5F8TA 2VNTA 2ULLA 1AB9B 1SHHB 4TT3D 1D3TB 2DUCA 1BHXB 5LPEA 2THFB 5IDKA 2ZHQH 1C5PA 2OCVB 2PW8H 4YT6H 2XYAA 3N99A 4LK4A 1B0FA 1O2ZA 4K8YA 4Q7XA 3ZZBA 1W0ZU 3MH4A 3VB4A 2J97A 2OQUA 3ZVFA 1E36B 3DSPA 1FXYA 3GDUA 4D8NA 1RS0A 1Z1IA 4SGAE 3TITA 2Z3DA 1C2LA 1K1JA 1UCYE 2BOKA 2H9EH 1WAYB 3FP8E 3BG4B 3SGQE 1K21H 1YLNA 4GCHG 3UY9A 3IG6B 5L2YH 1MAYA 1TPPA 5FX6A 4NSVA 5FPTA 5IK2D 2XBVA 3BF6H 2OLGA 3WY8A 1Y5AT 1GJAB 1RTFB 2AGIX 3QTOH 4FUIA 3RXQA 1H9LB 3DSOA 5CDFE 1SQAA 1FY8E 1ZTKA 2FZZA 3GCHB 2VGCB 4FVBA 1LVBA 4ACBA 1O3IA 1P8VC 2ZHEH 3A8AA 1LPKB 4F49A 1F2SE 3VXFH 1TNHA 1F5LA 3T5FH 1EASA 1O31A 2BVXH 2BDHA 1BOQA 1ESAA 2A4RA 2TGTA 4GSOA 2VB0A 4IC6A 2HVYB 3ATKA 3G01A 3SUDA 1VCWA 3BTQE 3L3TA 1CGIE 1XVMA 1NO9H 2ZP0H 1DSUA 2ZGCA 3NUMA 1ARBA 1ZPBA 1E79D 4I8JA 1H9HE 3ZZ5A 1XUFA 2HPQH 3ENSB 1BBRE 1OWEA 1PPZA 2YMSB 1TX8A 2AYWA 1BRBE 4WH8A 4I8GA 3MH7A 2SGDE 4TYDA 2QXGA 1NESE 2FI5E 1XM1A 1CA0C 3QDZB 1FY3A 4X8TH 2XC4A 2Z3EA 4A1XA 1PPHE 3M7QA 1V2KT 3HKIB 2BX3A 1GBBA 2D8WA 1GL1A 1RIWC 2FOMB 3SU6A 3M5OA 1Q31A 3ATIA 3LGIA 1HAYB 3TJUA 4U2WA 1SGYE 1W0KD 2ANWA 1VGCB 2Z6BD 1MKXH 2A5KA 2CN0H 2Z9LA 1V2QT 2XNDD 1C1OA 1CA8B 5ETXA 2FM2A 1SGPE 4Y8YA 5DP3A 3U8OH 4A1TA 1TNGA 5AHGH 2JKHA 1QB6A 3S69A 1C2GA 3U98H 4Y10E 2F3CE 1GMCG 4K1SA 4IBLH 3CS7A 2PKAB 1LHDH 3A8BA 3P17H 4A6LA 5AF9H 1N1LA 6CHAB 1SHYA 3QZQA 2UWLA 1E37B 4K3JA 3OSYA 4NZQA 2ANKH 2BYAX 1C5ZB 1MTNB 2HNTE 1VJ9U 2OK5A 4BNRA 3S0NA 1IQJA 1O2SA 3RXBA 2C8XB 2F9UA 5C5NA 3GYMA 2FXRA 4JMYA 1WYKA 3UQOA 1C5RA 1P2KA 1F0UA 3D65E 5HKKD 1QR3E 1DUEA 1ELTA 3MI4A 1IOEA 1QJ7B 3MH5A 3BN9A 1EZUC 1HUTH 2OC1A 4WXIA 1BHXF 3QWCH 2ZDNA 3TK6A 1H4WA 2PR3A 1W2KH 2BD5A 3RXFA 3MO3A 1GDUA 1DWDH 1DITH 6GCHF 9ESTA 2BQWB 5F8XA 2ZCHP 2ZECA 4Y8XA 5DGJA 4D7GA 3KHVA 4H42U 1AFQC 4X6MA 2OINA 1HDTH 1MAXA 3P8OA 1FY1A 4ZUHA 3SQEE 6LPRA 1L1GA 2XNIA 2IN2A 5ESBA 3KN2A 3KCGH 2XTTB 1LPZB 4RI0A 2ZGJA 4AZ2B 2F43B 1MU6B 1A1RA 2PSYA 4Y8ZA 3LOXA 2XCFA 6GCHG 2G5VA 3BIUH 1UVUH 2H9HA 7LPRA 4MNVA 4NWKA 1C5UA 3LGYA 1O2OA 2XBXA 3TJNA 2Z9JA 3E0PB 5EIYA 4MPUA 6ESTA 3ZZ7A 1COWD 1H8DH 1WQSA 2CV3A 2AEIH 2V35A 3LGTA 1TFXA 1TAWA 2WUCA 5GDSH 1Y3YA 1ESTA 3V12A 2BXTH 4FU8A 1C2KA 1DOJA 3VB7A 4DOQA 5FCKA 2P59A 1KLTA 2AH4X 2PWXA 1GCTC 4ISHH 3RMNH 2QF0A 1GBTA 2P3FH 7KMEH 1O2XA 2ZC9H 2PLXA 3M5NA 5HMAA 3ATMA 5CHAB 1O2MA 1BDAA 1VCQA 3EE0B 4HI3A 2XBYA 2ZU4A 2Z9IA 2ZGXH 5HIZA 2ESTE 3OFND 4Y7BA 1BZXE 5DP4A 1LTOA 1HJAC 1JXPA 1G3CA 3TK9A 1GBLA 1A2CH 3UWIA 2M5TA 1C5OH 2V3HH 1S83A 2TGPZ 1GHBF 1O2LA 1C4U2 3RXCA 1O3OA 2OC8A 3ATWA 3IITA 3RXSA 3SO3A 2UWPA 1GBCA 5BRRE 1T8OA 5EXMA 1KXBA 4OGXA 1IQHA 4HG6A 1CHOF 1GVKB 2BD7A 2QC2A 4YESB 2EI8A 1T8NA 1FIZA 1SFIA 2ANMH 2G5NA 3SNCA 1C5LH 4MDSA 1P04A 4BXSA 1GHBG 3W1EA 2A5IA 1V2NT 2L6OA 2NU1E 1GJ7B 2J34A 4E7NA 4ISLA 1RD3B 4U30A 1HAHH 3NWUA 1ELFA 5C20A 1G30B 2L74A 4D7FA 1ELDE 1V3XA 2Y80A 4RSPA 3QLPH 2ZTYA 1SGTA 2GP9B 1CHOG 2Y82A 1TGNA 1P2JA 3I29A 2AMPA 1UVOA 1SB1H 2ZI2H 1HJ9A 1UCYH 1ZMJA 1YY3A 2FOHA 1A3BH 1QNJA 3UNQA 4O3UA 4HTCH 3RMLH 1XVOA 5J4SA 1O5DH 3U8RH 1BMFD 1GI4A 4ABEA 2Y5GA 2TIOA 2G55A 4B76A 1RRKA 3VGCC 1P05A 2BVSH 2Y5HA 5C5OA 2KAIA 4UFGH 2ODPA 1O2HA 1GI0A 2KCAA 1H8ED 3CS0A 1C1SA 1C5QA 1GBIA 1BUIA 1W12U 3KGPA 1EAUA 1ORFA 4LXBH 2M2AA 4KTSA 1ZJKA 3SHCH 2R2MB 1GI1A 1TNKA 3U8TH 5DK1A 2I6SA 3N7DA 1ETRH 1TYNA 3KQCA 3SN8A 4WWYA 1MKXK 1MTSA 1GJCB 2QF5A 1NS3A 2J98B 3FFGA 4I31A 1CA0B 1SR5C 3LGWA 1DICA 2GTBA 1TLDA 2FTMA 4NIYA 4JZFH 1OPHB 1RIWB 1L1NA 3DCLA 3IWMA 3E8LA 1GBKA 1K1IA 1BBRH 1AO5A 4J1YA 1IHTH 4HZHA 1O2QA 1RJXB 3P6ZB 3TJVA 2ZHFH 4Y7AA 2ZTXA 1C5MD 1C2EA 4M9FA 1O3NA 3URCA 5GPIB 1C5SA 2KM0A 2BLWA 4GHTA 1SGEE 3OTPA 4DGJA 2BD4A 2TGAA 2ZDMA 2JH0D 1UHBB 1EZXC 4ACAA 2ZPRA 2QCYA 3GICB 5LGOA 1LHGH 3T27A 4GHQA 1QQUA 3GCTF 1NU7B 4KELA 3SGBE 2EI7A 1AKSB 1GHXH 2FMJA 5H4IB 2XBWA 1FAKH 3NK8A 2ZGHA 2P8OC 1TBZH 1FNIA 2W6JD 2WPJS 3BTWE 3CNRA 2A1DB 3V13A 4ZHAA 1FAXA 3MH6A 4K8BA 1O38A 2GZ9A 2EQNA 5F03A 2HWLB 4WXVA 1K22H 2FP7B 2HNTC 2A45B 1XKAC 4FUHA 2BDAA 1BIOA 1GDQA 3GCTG 5GIBA 1C9TA 2BOHB 2ZU3A 1SLUB 1N6XA 1AFQB 4GVUA 4O3TA 1D4PB 2O9QA 1QTFA 4JYVH 2VH6A 2BY8X 1NRRH 2BY7X 4JK5A 2P3UB 1SGRE 1O5GH 1YM0A 9LPRA 1EJMA 1ZZZA 1GHAF 4BXWA 4IN1A 1DLEA 1QJ6B 3Q3XA 4XDEA 2F9BH 1KXEA 4TPIZ 1QRXA 2D1JA 3FN8A 3B9FH 1TNJA 1EPTA 1IQLA 1XKBC 3F1SB 3CP7A 1MCVA 3KQDA 3ZVCA 3BTDE 3LJJA 3DFLA 1HNEE 1FZZA 1OWDA 5EQQA 3GY3A 2I6QA 1ANCA 1SLVB 2G8TA 2QA9E 3SORA 4AC9A 4DW2U 1INCA 1BTPA 1AFEH 3ZZ6A 2FX6A 3OTJE 2HALA 3RXIA 2GT8A 5TJXA 2ZQ2A 2J38A 2FLRH 1OSSA 3BEFB 1WOFA 4INLA 3RXDA 1UTQA 3HGPA 1YPKH 2F9PA 1SQOA 5A0CA 4RN6A 1OWKA 1GCTB 2ZFTA 3K6YA 2GKVE 2HLCA 3KQEA 3BIVH 1UTKA 2QF4A 4XD7D 1P02A 3UFAA 4CH8B 1EZQA 1ZTJA 3GS9A 1J14A 4MPVA 3SI4H 3EA9A 1P2MA 1ZMLA 4M7GA 5DP5A 2R2WU 2ZWLH 2WPKS 1CT0E 4TWWA 2OC0A 3HKJB 2AGEX 2G52A 2VWNA 1KLJH 1HAIH 3GOVB 2KCYA 5GWZA 3SU2A 1HJAB 2A0QB 5GCHF 1QIXB 5GXPA 1C1PA 1T4VH 1GWAA 3TVJB 5DP6A 2IOTA 2PTCE 3MMGA 1TGSZ 1XUJA 3A82A 3AASA 1ARCA 1GI6A 3QO6A 1AVGH 1OHHD 4ABFA 3BTME 4I33A 2P95A 3ZV9A 3F9GA 4X2YA 1C1VH 1DANH 2PV9B 2NWNA 1EOJA 4TWYA 4INHA 3PB1E 5GCHG 2STBE 2QE7D 4LOYH 3F3BA 1E34B 2VU8E 1WUNH 3LDXH 1DPOA 5IYTA 3RXHA 1UCYK 2Y5FA 1Z8IB 4NIWA 1FN8A 2BD3A 2FS8A 3PV2A 1Z8JB 2ZTZA 2LNCA 1GJDB 1BRUP 4KTCA 4GLYA 1QCPA 2TGDA 2BY9X 3E1XB 3P95A 1SGFA 1WCZA 5HM9A 1BMMH 1CBWC 1P9SA 2DE8A 3H7TA 3TGIE 3SZEA 1K1PA 3QGJA 2CF8H 4GPGA 3KF2A 5JB8S 4MQAA 3MNSA 1LQEA 5EU8A 1AWFH 1SVPA 4X2VA 2A4OA 1C1UH 2GV6A 3BTFE 2ZDAH 3M3TA 2W7UA 2PFEA 1ELGA 2FOFA 1VZQH 1V2UT 1V2PT 4O03A 5EW1H 1QZ8A 3VGCB 4DCDA 4Z1MD 3PRBA 1C4V2 3SZNA 2BLVA 1GBMA 1PQAA 3T28A 1FIWA 5FCRA 1S84A 1KLIH 1C2FA 4INKA 2H2ZA 4A92A 4B6EA 1AI8H 1BBRK 2FLBH 3L33A 3ESTA 4ZKOU 2IJD1 1TBQH 4IW4E 5CHBA 5F6MA 3M37A 5T6DA 3LGVA 1YC0A 2ZGBH 1MTVA 1TA2A 2C8ZB 1TNLA 3DUXH 2YOLA 4GCHF 1LDTT 4K1TA 1GJ9B 1ZGVA 2ALVA 1T32A 3T29A 4ZKRU 2FYQA 5HGGA 3BTHE 1XXDA 1JIMA 2VIPA 3GY8A 2G4UA 5FAHA 2A7CA 2ZDKA 1O2GH 1XXFA 1DWEH 4K5ZA 2AMDA 4F4OC 4ZMAH 3SGAE 2BZAA 4IMQA 3TNSA 3NXPA 2FOEA 1JIRA 1AGJA 1GL0E 3BEIB 1SMFE 1GHVH 1Y3WA 2WZQA 3FAOA 3A8CA 2PKAA 4H6TA 1BTZA 1YYY1 1GGDC 4O97A 5A2MH 2RA0A 5JBTA 3ODDA 1DY9A 1DX5M 5DP8A 1G32B 1MZDA 1GI3A 2AMQA 2P8OB 2Y81A 4YOGA 1EFRD 5FPSA 3QX5H 5EW2H 1D3PB 2C90B 2TPIZ 3BSQA 1C1MA 4FUBA 2ZG0H 3E0NB 5C1XA 2ZIQH 4FUGA 1IQMA 3PTNA 1PPFE 5E2PA 1O35A 1GBEA 3TH2H 2W6ID 5C94A 1HAVB 2K0QA 2BX4A 2B5TB 5AFZH 1YKTA 3Q77A 1E1QD 1QQ4A 3AK5A 3TIUA 3GY7A 3P8GA 1BJVA 1YPJH 2PTNA 4DIHH 1T7CA 2AIPA 2HLDD 2BDBA 2F9VA 3F0OA 4XE4A 1Y3VA 3E3TA 2CGAA 1KDQB 3TGJE 3RLYH 3EGKH 1GI7B 1O39A 3QK1A 2BZ6H 5FPYA 1GJ4H 1NT1A 1KIGH 1GMCF 3V7TA 4KP0A 4NFEA 1O2UA 1ZOMA 4IC5A 1LCYA 4YXWD 4AFSA 3UR6A 4IN2A 5EXNA 2VVCA 3ZVDA 2WINI 2A7JA 2VVUA 1UTOA 1ELVA 1SGCA 1SQTA 1F7ZA 1VJAU 2Y6TA 5TCAA 1K1MA 2BQ6B 2EI6A 2FDAA 2FOCA 3HGNA 3PV5A 4NG9H 4AGKA 1KTSB 5T3HA 1C5TA 3MO6A 2FO9A 1ABIH 2AGGX 1O2IA 2LPRA 3RMMH 2BD9A 2VWLA 4ZHLU 4ISNA 3ITIA 2O8WA 2PSXA 1GDNA 3LH1A 3SI3H 3ZZ9A 4A7IB 1HAGE 1P12E 1YCPM 1TPAE 4RKOB 3MQKC 1QHRB 3LU9B 3H09A 1WDIA 1AE8H 3F68H 1TONA 1Z6JH 2ALPA 2F91A 1ACBE 1C5YB 1XUIA 3TPIZ 1ELCA 5C3NA 2GT7A 3SOSA 2UUYA 1GJBB 4X2WA 2PKSC 1CHGA 2VIDA 4JCNA 3STJA 4HFPB 3MNBA 4CRAA 3DA9B 1O2KA 2GJGA 2Z9GA 1GVLA 1Y3UA 4ABHA 3E6PH 1ELAA 1GHYH 1MBMA 1A5IA 1TRMA 2ZDVH 1B0EA 3A7XA 3PMAB 2NU3E 1PQ8A 1ZPCA 3MO9A 1PPGE 2FESH 3SJ9A 1YPHC 1QURH 1FV9A 1HXEH 4GUXA 1BA8B 2OXSA 4X8SH 1Q3XA 4OM9A 1NROH 5T6GA 1YWUA 1NU9A 1DXWA 1P2OA 1KSNA 3C27B 2BD2A 2HRVA 2ZZUH 3R0FA 3ZZ4A 1O2VA 1WV7H 3GY6A 2HGTH 2Z7FE 1IHSH 1QBVH 4NA9H 3F0PA 2PUXB 1CBWB 1LO6A 2SNWA 4UE7H 3LKWA 4YLUA 1XUKA 3EDXB 1EKBB 2ANYA 2R0KA 3WW7A 1GBAA 1V2MT 2AFQB 4ZCNA 2ZU2A 1QB9A 1OWHA 1C1TA 3HK6B 4Q80A 1D3QB 4I7YH 3AAVA 2HNTF 5EGMA 5FBIA 5J4QA 4YLQH 1SQRA 2XOKD 3MU8A 3U1IB 2QYIA 1SGIB 3AVZA 4FU7A 1P2QA 2LELA 4U01A 1QRWA 1ZSLA 3TJOA 3O8RA 5LPFA 1G3EA 1YPGH 3U9AH 2CXVA 3F6UH 4X1QU 4BTTB 1V2RT 3F9FA 4DVAU 3PLBA 4Y0YE 4JYUH 3TLOA 2CK3D 3NPSA 2J4IA 1NFXA 1K9OE 3RXGA 1C4Y2 1O3CA 1T8MA 1GI9B 2XXLA 3UREA 3MU5A 2ODQA 1P03A 1A0HB 4K69A 4A1VA 2HPPH 2RG3A 2SGFE 1HIAB 3DSGA 4H6SB 4CRDA 1W10U 4ZHMU 3PO1C 1G36A 4ABJA 1NRSH 4YOIA 2ZPQA 1O0DH 1UVTH 2CF9H 5E0HA 2FYRA 1QL9A 2VIVA 3GYLB 3A88A 2XWBI 1AN1E 1Z1JA 1S81A 2BY5X 1HFDA 4TY7A 3RC6A 3SV6A 1A46H 2C93B 2VINA 4BTIB 4CBOA 1ZYOA 2J94A 3D49H 2BDYA 2ZHDA 3FP6E 7ESTE 1BMNH 2SGQE 1THRH 2ZQ1A 2WYJA 2VJ1A 1BB0B 1OKXA 3UAIC 4BAQB 1TABE 1P9UA 1SPJA 1KXCA 5EPYA 1C1WH 4BAKB 2YNBA 2ZFQH 1O3FA 1UHBA 4YTAA 4ABBA 1C5NH 3PMHB 1ZHRA 3VFEA 1GGDB 8KME2 5DP9A 3RXTA 2FI3E 1NFWA 3EE7A 4Y76A 1O3KA 3FO8D 1AKSA 3F9EA 4AYVB 2DE9A 1O3BA 1HGTH 2BDIA 1QBOA 3V3MA 1DM4B 1GCDA 5ABWA 1TBRH 2WYGA 1O30A 2EEKA 2OBQA 1V2ST 1AUJA 3RM0H 5FL7D 1WXRA 4XRNA 1VITH 5HXFA 2LP6A 4UONA 2V3MA 3VB6A 1TOMH 2F9NA 4FVDA 4U32A 2K8IA 4ZAEA 4X6PA 4D9RA 1P10A 3QZRA 1W13U 1VR1H 1GI5A 2VWMA 1LQDB 1P01A 1EJAA 4CREA 1VKYA 3GISB 3M5LA 1NBMD 3WWBA 3DFJA 1W14U 1EAWA 4YZUA 1CGJE 3S9CA 1PJPA 4ZKSU 2RFKC 2FI4E 1IQKA 1P2NA 4OS2A 4TSFD 2J5UA 1MUEB 1SGDE 1HPGA 1SSXA 2H6MA 5DSFA 2JETC 3RXEA 5F53A 2WPIS 3M7TA 1DSTA 3C1KA 2V0BA 2VIQA 5I25A 4R8TB 1G37A 3M3SA 2FOAA 2GDEH 4FUDA 3ZV8A 5JBBS 3S9AA 1TMBH 1LMWB 2GCTC 2J9NA 1DUAA 5DN6D 1FJSA 3W95A 3ZVGA 2P94A 1DE7H 1G2MA 3A80A 3FOAA 4E05H 1QB1A 1GMHG 1MU8B 2H9TH 3K6ZA 1FONA 5K7RA 1E0FD 4MNWA 2HOBA 1SOZA 2QXHA 1IQGA 3OYPA 4XOJA 1H8IH 1JRSA 2A2XH 2CHAC 2JIZD 2OBOA 3N7OA 2PKSB 2QAAA 1WQVH 3KNXA 1O2TA 1FDPA 1N6YA 3LPRA 4XBBA 4Z6AH 4AB9A 1O5BB 3UIRA 3OY6U 1MKWH 4Z0KA 2O8MA 1BRAA 1HYLA 3K65B 4D9QA 1P0SH 1L4DA 1MMJN 1AZ8A 4Y11E 1ANBA 1MQ6A 3TK5A 1NZQH 3SV9A 1HXFH 4ASHA 1O5AB 1Y5UT 1S85A 2NU2E 1XUHA 3A7VA 4WVPE 5T6FA 4THNH 2KZ4A 2YMSD 1UTLM 5JYIA 2GMTC 3UWJH 1KXFA 1CO7E 1TOCB 2YNAA 4CBNA 3A83A 2AS9A 3ZZAA 4B2AA 1BCUH 4TY6A 4Y79A 5EQRA 3M5MA 3RC5A 4AORA 1OX1A 5F8ZA 1QRZA 1YBWA 2BXUH 3MYWA 3PROA 1G2LA 4B2CA 1O3PB 1EP6A 2GX4A 1J9CH 4H4FA 5EODA 3OAAD 1GBDA 1ZSJA 4BAHB 1QA7A 3Q00A 2Q6GA 2OC7A 1GG6C 1GMDG 4DURA 5C17A 3S9BA 3M35A 3Q3YA 4OS4A 1QL8A 5A0AE 1PQ7A 1A0LA 4E06H 1TRYA 2ZKSA 1C5XB 5EG4A 3P8FA 3RXPA 1NPMA 2ZFRH 1LHCH 1HAZB 3A8DA 3VXEH 5A09A 3UNRA 2JJ1D 2H1UA 4P02A 3GCNA 1YPHE 1O5CB 5KGOA 1SGQE 2BLQA 3OE7D 3SNEA 4CR5A 1AMHA 1PPEE 1WSSH 1A3EH 1GI2A 4DIIH 4OS1A 5AFYH 3VB5A 1FUJA 4GAWA 1GVZA 1D3DB 1LHFH 5TCCA 3PO1B 1YPEH 3S7KB 3A87A 3TGKE 2J95A 2KX4A 3SUGA 2FOBA 4OS6A 5A0BA 1O3GA 4NA7A 3SHAH 4AOQA 3KIDU 1ESBA 3WWFA 3KL6A 5SGAE 1H1BA 3A86A 2KCOA 3BTKE 1SBWA 1LKBA 1O5FH 1UO6A 3H5CB 1MCTA 5LPRA 2BDCA 1V6DA 1DLKB 1BTHH 1P06A 3SNDA 1SC8U 3A89A 3U28C 1C5VA 1LVOA 1YLCA 3QGNB 3FANA 4KKDA 1TIOA 2GD4B 1QBNA 2JH6D 4FOUC 2VVVA 4R0IA 5C1YA 3ODFA 1L1JA 4XFQA 1AWHB 4UEHH 2W7SA 3LT3A 5GJ4B 1F0RA 4K2YA 3SU0A 1UVPA 1P09A 2GCHF 2A31A 4JK6A 5B6OA 1WTHD 3SJKA 1NTPA 1QL7A 1EUFA 2ZFSA 1O3DA 3PWBA 3TH4H 1J16A 4B73A 1SLWB 1A5GH 1G9IE 2JH5D 2ZEBA 2BLOA 2P16A 3HATH 1HAPH 1U6QA 1BTWA 3KQBA 4Q7ZA 2C8WB 4I8KA 1KTTB 8ESTE 1X7AC 1C2HA 4RKJB 1S0QA 4X1RU 2PUQH 1WU1A 4PROA 3PV4A 1DDJA 2GCHG 2JJ2D 1BTYA 1S6LA 3V0XA 1MD8A 2PP6A 2G00A 3UQVA 1KDQA 1S5SA 5L2ZH 1H8HD 3GDSA 1NRPH 2OTVA 1AZZA 2Q6FA 2UUFB 2VWOA 3OEED 3A7TA 3VEQB 1K0HA 1W7GH 1ZR0A 3M36A 4NCYA 2JETB 1ZGIA 4ZXYH 3SQHE 2BMGB 4DY7B 3M7UA 1JBUH 1BJUA 1AUTC 1S82A 3BEUA 3A7YA 1OWIA 4DJZB 1CSOE 5HIYA 3VB3A 1GHZA 3RU4D 2RDLA 2GCTB 1EJNA 1F5KU 5CMXH 2QV1A 5DJ7A 4CHAC 4ABIA 4B71A 2Z3CA 2JDID 3RXRA 3P92A 2ILNA 2G81E 5EPNA 1UTNA 1TPSA 2BTCE 4B6FA 3U1JB 4KTUA 1TALA 3ZZ3A 1BTUA 4B75A 1MD7A 2QN5T 4XSKU 1N8OC 1MKWK 1IQIA 3RLWH 4AB8A 1A4WH 4NIXA 2STAE 1ZRKA 2CHAB 1O3LA 4AFQA 2A4GA 1HAXB 1UK2A 1AQ7A 1TWXB 2ZU1A 3RU4T 2A32A 4F55A 3F2FA 1YLDA 2EA3A 2BVRH 3ZVBA 1UTJA 3PLPA 3SU1A 1P3EA 4YT7H 3FZDA 2BQ7B 2ZF0H 4BANB 1KXDA 1RTLA 3TNTA 3AW1A 1CQQA 1CGHA 2XW9A 3T2NA 1ZHPA 1NBME 2VIWA 2BM2A 4QT8C 4CR9A 1OP0A 2B8OH 1HCGA 1NRQH 3MHWU 1ETTH 5JPMH 2WV9A 2SGEE 1C2DA 2O8TA 5CE1A 5E0GA 1C5WB 4ZKNU 3NKKA 2QXJA 1G3BA 1O3JA 1AHTH 1Y59T 4OS5A 1EQ9A 1NM6A 1TGCA 4BAOB 1ZJDA 2GMTB 3M3VA 3PLKA 8GCHF 3UUZA 3FZZA 2WPLS 4B2BA 3FKSD 3E16B 2ZNKH 5JB9S 4BOHA 3E90B 3Q76A 4MPWA 1O3HA 2G4TA 3EQ0H 2ZA5A 3TH3H 2FX4A 1ZSKA 1CT4E 4AFZA 4B74A 1SKYE 1BITA 8GCHG 2GDDA 4FUFA 1QFKH 1GG6B 1VITF 4JZEH 3B23B 1JOUB 2FWWA 1FY5A 4MLFB 5C0TA 1O33A 1P2IA 1FX0B 2A2QH 5ESTE 5FHTA 1SGNE 1B5GH 4F48B 4ABGA 1TX7A 3RXLA 2V7QD 4OS7A 3SU3A 3RP2A 1AIXH 1GJ6A 3MU0A 3KYFA 3GY4A 3TU7H 4I86A 4X1NU 4ISOA 4AX9H 2WUBA 1F0SA 1Y3XA 1IAUA 3N7EA 1EB1H 1O2JA 1O2NA 5GNDA 3SJIA 3ZZCA 1VITG 5A8ZA 1ID5H 2BY6X 1EX3A 4ZH8A 1HJ8A 1QY6A 4WMEA 4CRBA 2F9OA 1C2IA 4X2XA 1L0ZA 1MABB 1KMHB 2P3TB 1UTPA 3KYGA 1RXPA 2ASUB 3BTTE 1DT2A 2TRMA 4NZLA 1FMGA 3SV7A 1YPMH 3NCLA 1HB0B 2H5CA 4IMZA 2Y7XA 1TPOA 1HIAA 5K0HA 1CE5A 2QF3A 2A7HA 3MU4A 2WSSD 2BDGA 2WV4A 2D26C 2RCEA 4OGYA 1BRCE 1TX6A 2XCNA 4YOJA 2O8LA 3RUOA 1O2WA 1C1QA 1MTUA 1J17T 3PM3A 1A61H 4ABDA 3UTUH 1F5RA 1K2I1 2OQ5A 2OUAA 1LKAA 3UR9A 4UFFH 1T8LA 1CU1A 1V2WT 3OEHD 4SGBE 2GGVB 5E2OA 1SLXB 5G4BA 1O5EH 1EAIA 1ZTLA 4UFEH 1PFXC 3MNCA 2WV5A 1EZSC 1DWBH 3KQ5A 3NRLA 1EAXA 2Q1JA 3QTVH 2SFAA 3PYHA 1WBGB 4VGCC 4MNXA 5FXLA 4WF8A 1PPBH 2ZCKP 3RXVA 2B9LA 3H7OA 4MTBA 3UPEA 4A5TS 3A85A 1W7XH 4UFDH 2ODYB 4NIVA 1THPB 1QA0A 1W8BH 4MVNA 1SG8B 1CT2E 4JZDH 3L6PA 1Z8GA 3BV9B 2Z94A 1AVXA 1KXAA 1SGFG 2UWOA 1OYTH 3SNAA 2Z9KA 4KGAA 1TQ0B 3VG8A 2FTLE 1A7SA 5EQSA 1JRTA 3R3GB 4IS5A
chains in the Genus database with same CATH topology
3DD2H 1H9IE 1RFNA 1YP9A 1GPZA 3BTGE 1E38B 3VPKA 4ABAA 1LVMA 4MNYA 1PYTD 3ELAH 5FX5A 1HBTH 3UOUA 4X1SU 1EATA 3QUMP 1TRNA 3URDA 3QN7A 5A8XA 1PYTC 2B0FA 3ZVEA 4AG2A 3A84A 3OY5U 3A7ZA 4AYYB 1OXGA 2W5EA 1GJ8B 1S0RA 1T4UH 1TMUH 4JZIA 2FODA 4CHAB 5DO4H 5AVDA 1YCPH 3LIWA 5L30H 4Y0ZE 1M9UA 1Q2WA 1XMNB 7GCHF 2J2UA 1O2PA 1NFYA 1RTKA 2XRCA 1N8OB 1TQ7B 4O9VA 2NU0E 2FPZA 4X1PU 4AG1A 5DPAA 2ZU5A 1O2RA 4XBCA 1EPTC 5L6NH 1LVYA 1J8AA 4WJG2 1O2YA 1O32A 2BB4A 3SUFA 1ZLRA 1HLTH 1GI8B 2Y7ZA 3EAJA 3FVFB 4Y6DA 1P57B 3O8BA 1D6RA 1ANDA 2A5AA 2C8YB 4UD9H 2R3UA 7GCHG 5FBEA 1IQNA 3GY5A 1OYQA 1Y8TA 1NFUA 4WH6A 3K9XB 1DFPA 2ZDLA 3GY2A 1D6WA 1C1NA 3EYDA 5JBCS 1Z71A 5JDUB 1MQ5A 2H5DA 1EOLA 2J92A 1TB6H 3RXKA 1O36A 2QIQA 2QGRA 1V2OT 4Y71A 4WMDA 2SGPE 3D62A 1GBHA 2BHGA 5E0JA 3MTYA 4AGJA 1UVSH 4TPYA 1TMTH 1TA6A 3O8DA 3M61U 1K28D 2ZFFH 5JBAS 3AW0A 4JZ1A 3LC3A 1MBQA 5PTPA 1EXFA 3STIA 1S6HA 1NRNH 1SI5H 1W3CA 3CENA 1DY8A 3UOPA 4X6NA 1TGBA 1PQ5A 1O3EA 1Z8RA 2OD3B 1GMHF 1MH0A 1UMAH 1AB9C 4X6OA 3EA8A 3RU4E 1FI8A 3I77A 3MFJA 5DKMA 2PGQB 1IQFA 1UJ1A 2F83A 1B7XB 1VCPA 1HV7A 1OWJA 1RGQA 4AN7A 3RC4A 1AE5A 1V2LT 2R3YA 1T31A 3KEEA 1UTMA 2CJIA 2OP9A 2Q6DA 3B8JA 2XWAA 4AFUA 2IJOB 2PGBB 4ISIH 2FEQH 1BMLA 1YPLH 3BG4C 1ZPZA 2GV7A 2CMYA 3S7HB 1GBFA 5HM2A 4DT7B 3LC5A 2GZ7A 1XX9A 3SV8A 4CRGA 2PHBA 4X0WU 1BTXA 4WMFA 3SJ8A 3D23A 4K60A 3A7WA 1GHWH 1AVWA 1GBJA 1MZAA 2V6NA 2A4QA 3SBKA 4DG4A 1TE0A 4UDWH 1HRTH 4D76A 1KY9A 3GCHC 1QGFA 1TNIA 3ZYEA 2VGCC 2VIOA 4IGDA 2B7DH 1D9IA 2KAIB 3F9HA 1O37A 3FP7E 4NGAH 4BTUB 1YGCH 3ZZDA 1J15A 1OP8A 2AERH 4X8VH 3HK3B 2D2DA 3MOCA 5E8EH 5C67A 3SUEA 3SNBA 3MNXA 1GMDF 1OOKB 1Z6EA 3RXOA 4Q2KA 3T62A 1DVAH 1NC6A 1G3DA 3SW2B 1LHEH 3AAUA 3NZIA 4MPXA 1CVWH 1DWCH 4FUJA 1C2MA 4FU9A 2G51A 3PWCA 4VGCB 3T25A 5BPEA 5EXLA 1NN6A 3OU0A 1ELBA 1C1RA 2RA3A 4Q7YA 2VH0A 3SJOA 2P93A 1F92A 1ZHMA 1UK4A 1Z7KA 3P70B 3RM2H 1VGCC 2FOGA 8LPRA 3PTBA 2ZHWH 5A8YA 4LZ4B 3RMOH 1GHAG 3OX7U 3RXUA 2UUKB 3GCOA 1V2TT 2ZPSA 4I8HA 2HVXA 2V3OH 5I46H 3MU1A 5EOKA 3PMBB 1O3MA 2WPHS 3O8CA 1JWTA 1FPCH 1K1OA 1BMAA 6CHAC 3HPTB 1HAOH 4XBDA 1DS2E 1WTGH 1ZRBA 1ZMNA 2ZCLP 1MTNC 1LPGB 3P8NA 3RDZA 2ZO3H 4HGCA 3ZZ8A 1ELEE 5HYOA 3RXJA 3LONA 4CH2B 1W0YH 2W3KA 3SV2H 1AD8H 4YO9A 1ANEA 4E7RG 2R0LA 3LH3A 1P11E 1YCPK 1SOTA 2XC0A 1C2JA 2QXIA 3DHKH 3K2UA 1Y5BT 4I8LA 3GDVA 4I32A 3ZVAA 2TBSA 1ETSH 3DT0H 1E35B 1KYNA 3PMJA 1GJ5H 4MG3A 4J2YB 3I78A 4ZXXH 3A81A 1K1LA 3SU4A 1S6FA 3E91A 3Q3KA 1UK3A 1SL3A 2AIQA 3BG8A 1OS8A 4JYTA 1L4ZA 2EC9H 3ZYDA 1EP5A 1AY6H 1OP2A 3RXMA 4WY3A 4X8UH 1JMOH 1YF4A 1A0JA 2W26A 4FUCA 4ESTE 1EB2A 1DXPA 4BAMB 5C1UA 2K1QA 1V2VT 4FXGH 1EPTB 4NWLA 1MTWA 3MWIU 1AU8A 2C4FH 1F0TA 1THSH 1FLEE 1BQYA 2SNVA 2QY0B 1O3AA 2IPHA 2GVFA 2W3IA 1V2JT 2C3SA 3W94A 4B1TA 3EA7A 4K1EA 1SFQB 1FPHH 4LZ1H 1O34A 1ABJH 1L2EA 1TGTA 2R9PA 1K1NA 2GZ8A 1NY22 3RXAA 4NSYA 4NFFA 4YM9A 5LH8A 1A5HA 1IQEA 1HAVA 3JZ1B 4CRCA 3ATLA 4NA8A 5DG6A 3JZ2B 1XUGA 1PPCE 3BTEE 2O8UA 4ZROA 1FN6A 2UUJB 1FQ3A 3LJOA 5DP7A 2FS9A 1W11U 2BD8A 2NU4E 5C2ZA 3LGUA 2ZFPH 2XC5A 3SU5A 1FY4A 5CHAC 3UNSA 2FIRH 1C9PA 4FUEA 3U69H 2SGAA 4CRFA 1QJ1B 3T26A 2WPMS 1BT7A 1P3CA 5F8TA 2VNTA 2ULLA 1AB9B 1SHHB 1D3TB 2DUCA 1BHXB 5LPEA 2THFB 5IDKA 2ZHQH 1C5PA 2OCVB 2PW8H 4YT6H 2XYAA 4LK4A 1B0FA 1O2ZA 4K8YA 4Q7XA 3ZZBA 1W0ZU 3MH4A 3VB4A 2OQUA 3ZVFA 1E36B 1FXYA 3GDUA 4D8NA 1RS0A 1Z1IA 4SGAE 3TITA 2Z3DA 1C2LA 1K1JA 1UCYE 2BOKA 2H9EH 1WAYB 3FP8E 3BG4B 3SGQE 1K21H 4GCHG 3UY9A 3IG6B 5L2YH 1MAYA 1TPPA 5FX6A 4NSVA 5FPTA 2XBVA 3BF6H 2OLGA 3WY8A 1Y5AT 1GJAB 1RTFB 2AGIX 3QTOH 4FUIA 3RXQA 1H9LB 1SQAA 1FY8E 1ZTKA 2FZZA 3GCHB 2VGCB 4FVBA 1LVBA 1O3IA 1P8VC 2ZHEH 3A8AA 1LPKB 4F49A 1F2SE 3VXFH 1TNHA 1F5LA 3T5FH 1EASA 1O31A 2BVXH 2BDHA 1BOQA 1ESAA 2A4RA 2TGTA 4GSOA 2VB0A 4IC6A 3ATKA 3G01A 3SUDA 1VCWA 3BTQE 3L3TA 1CGIE 1XVMA 1NO9H 2ZP0H 1DSUA 2ZGCA 3NUMA 1ARBA 1ZPBA 4I8JA 1H9HE 3ZZ5A 1XUFA 2HPQH 3ENSB 1BBRE 1OWEA 1PPZA 1TX8A 2AYWA 1BRBE 4WH8A 4I8GA 3MH7A 2SGDE 4TYDA 2QXGA 1NESE 2FI5E 1XM1A 1CA0C 3QDZB 1FY3A 4X8TH 2XC4A 2Z3EA 4A1XA 1PPHE 3M7QA 1V2KT 3HKIB 2BX3A 1GBBA 2D8WA 1GL1A 1RIWC 2FOMB 3SU6A 3M5OA 1Q31A 3ATIA 3LGIA 1HAYB 3TJUA 4U2WA 1SGYE 2ANWA 1VGCB 2Z6BD 1MKXH 2A5KA 2CN0H 2Z9LA 1V2QT 1C1OA 1CA8B 5ETXA 2FM2A 1SGPE 4Y8YA 5DP3A 3U8OH 4A1TA 1TNGA 5AHGH 2JKHA 1QB6A 3S69A 1C2GA 3U98H 4Y10E 2F3CE 1GMCG 4K1SA 4IBLH 3CS7A 2PKAB 1LHDH 3A8BA 3P17H 4A6LA 5AF9H 1N1LA 6CHAB 1SHYA 3QZQA 2UWLA 1E37B 4K3JA 3OSYA 4NZQA 2ANKH 2BYAX 1C5ZB 1MTNB 2HNTE 1VJ9U 4BNRA 3S0NA 1IQJA 1O2SA 3RXBA 2C8XB 2F9UA 5C5NA 3GYMA 2FXRA 4JMYA 1WYKA 3UQOA 1C5RA 1P2KA 1F0UA 3D65E 1QR3E 1DUEA 1ELTA 3MI4A 1IOEA 1QJ7B 3MH5A 3BN9A 1EZUC 1HUTH 2OC1A 4WXIA 1BHXF 3QWCH 2ZDNA 3TK6A 1H4WA 2PR3A 1W2KH 2BD5A 3RXFA 3MO3A 1GDUA 1DWDH 1DITH 6GCHF 9ESTA 2BQWB 5F8XA 2ZCHP 2ZECA 4Y8XA 5DGJA 4D7GA 3KHVA 4H42U 1AFQC 4X6MA 2OINA 1HDTH 1MAXA 3P8OA 1FY1A 4ZUHA 3SQEE 6LPRA 1L1GA 2XNIA 2IN2A 5ESBA 3KN2A 3KCGH 2XTTB 1LPZB 2ZGJA 4AZ2B 1MU6B 1A1RA 2PSYA 4Y8ZA 3LOXA 2XCFA 6GCHG 2G5VA 3BIUH 1UVUH 2H9HA 7LPRA 4MNVA 4NWKA 1C5UA 3LGYA 1O2OA 2XBXA 3TJNA 2Z9JA 3E0PB 4MPUA 6ESTA 3ZZ7A 1H8DH 1WQSA 2CV3A 2AEIH 2V35A 3LGTA 1TFXA 1TAWA 2WUCA 5GDSH 1Y3YA 1ESTA 3V12A 2BXTH 4FU8A 1C2KA 1DOJA 3VB7A 4DOQA 5FCKA 2P59A 1KLTA 2AH4X 2PWXA 1GCTC 4ISHH 3RMNH 2QF0A 1GBTA 2P3FH 7KMEH 1O2XA 2ZC9H 2PLXA 3M5NA 5HMAA 3ATMA 5CHAB 1O2MA 1BDAA 1VCQA 3EE0B 4HI3A 2XBYA 2ZU4A 2Z9IA 2ZGXH 2ESTE 4Y7BA 1BZXE 5DP4A 1LTOA 1HJAC 1JXPA 1G3CA 3TK9A 1GBLA 1A2CH 3UWIA 2M5TA 1C5OH 2V3HH 1S83A 2TGPZ 1GHBF 1O2LA 1C4U2 3RXCA 1O3OA 2OC8A 3ATWA 3IITA 3RXSA 3SO3A 2UWPA 1GBCA 5BRRE 1T8OA 5EXMA 1KXBA 4OGXA 1IQHA 1CHOF 1GVKB 2BD7A 2QC2A 4YESB 2EI8A 1T8NA 1FIZA 1SFIA 2ANMH 2G5NA 3SNCA 1C5LH 4MDSA 1P04A 4BXSA 1GHBG 2A5IA 1V2NT 2NU1E 1GJ7B 2J34A 4E7NA 4ISLA 1RD3B 4U30A 1HAHH 3NWUA 1ELFA 5C20A 1G30B 4D7FA 1ELDE 1V3XA 2Y80A 4RSPA 3QLPH 2ZTYA 1SGTA 2GP9B 1CHOG 2Y82A 1TGNA 1P2JA 3I29A 2AMPA 1UVOA 1SB1H 2ZI2H 1HJ9A 1UCYH 1ZMJA 2FOHA 1A3BH 1QNJA 3UNQA 4O3UA 4HTCH 3RMLH 1XVOA 5J4SA 1O5DH 3U8RH 1GI4A 4ABEA 2Y5GA 2TIOA 2G55A 4B76A 1RRKA 3VGCC 1P05A 2BVSH 2Y5HA 5C5OA 2KAIA 4UFGH 2ODPA 1O2HA 1GI0A 3CS0A 1C1SA 1C5QA 1GBIA 1BUIA 1W12U 3KGPA 1EAUA 1ORFA 4LXBH 4KTSA 1ZJKA 3SHCH 2R2MB 1GI1A 1TNKA 3U8TH 5DK1A 2I6SA 1ETRH 1TYNA 3KQCA 3SN8A 4WWYA 1MKXK 1MTSA 1GJCB 1NS3A 3FFGA 4I31A 1CA0B 1SR5C 3LGWA 1DICA 2GTBA 1TLDA 2FTMA 4NIYA 4JZFH 1OPHB 1RIWB 1L1NA 3IWMA 3E8LA 1GBKA 1K1IA 1BBRH 1AO5A 4J1YA 1IHTH 4HZHA 1O2QA 1RJXB 3P6ZB 3TJVA 2ZHFH 4Y7AA 2ZTXA 1C5MD 1C2EA 1O3NA 3URCA 5GPIB 1C5SA 2BLWA 4GHTA 1SGEE 4DGJA 2BD4A 2TGAA 2ZDMA 2JH0D 1UHBB 1EZXC 2ZPRA 2QCYA 3GICB 5LGOA 1LHGH 3T27A 4GHQA 1QQUA 3GCTF 1NU7B 4KELA 3SGBE 2EI7A 1AKSB 1GHXH 2FMJA 5H4IB 2XBWA 1FAKH 3NK8A 2ZGHA 2P8OC 1TBZH 1FNIA 2WPJS 3BTWE 2A1DB 3V13A 4ZHAA 1FAXA 3MH6A 4K8BA 1O38A 2GZ9A 5F03A 2HWLB 4WXVA 1K22H 2FP7B 2HNTC 2A45B 1XKAC 4FUHA 2BDAA 1BIOA 1GDQA 3GCTG 5GIBA 1C9TA 2BOHB 2ZU3A 1SLUB 1N6XA 1AFQB 4GVUA 4O3TA 1D4PB 2O9QA 1QTFA 4JYVH 2VH6A 2BY8X 1NRRH 2BY7X 4JK5A 2P3UB 1SGRE 1O5GH 1YM0A 9LPRA 1EJMA 1ZZZA 1GHAF 4BXWA 4IN1A 1DLEA 1QJ6B 3Q3XA 4XDEA 2F9BH 1KXEA 4TPIZ 1QRXA 2D1JA 3B9FH 1TNJA 1EPTA 1IQLA 1XKBC 3F1SB 3CP7A 1MCVA 3KQDA 3ZVCA 3BTDE 3LJJA 3DFLA 1HNEE 1FZZA 1OWDA 5EQQA 3GY3A 2I6QA 1ANCA 1SLVB 2G8TA 2QA9E 3SORA 4DW2U 1INCA 1BTPA 1AFEH 3ZZ6A 2FX6A 3OTJE 2HALA 3RXIA 2GT8A 5TJXA 2ZQ2A 2J38A 2FLRH 1OSSA 3BEFB 1WOFA 4INLA 3RXDA 1UTQA 3HGPA 1YPKH 2F9PA 1SQOA 5A0CA 4RN6A 1OWKA 1GCTB 2ZFTA 3K6YA 2GKVE 2HLCA 3KQEA 3BIVH 1UTKA 1P02A 3UFAA 4CH8B 1EZQA 1ZTJA 1J14A 4MPVA 3SI4H 3EA9A 1P2MA 1ZMLA 4M7GA 5DP5A 2R2WU 2ZWLH 2WPKS 1CT0E 4TWWA 2OC0A 3HKJB 2AGEX 2G52A 2VWNA 1KLJH 1HAIH 3GOVB 5GWZA 3SU2A 1HJAB 2A0QB 5GCHF 1QIXB 5GXPA 1C1PA 1T4VH 1GWAA 3TVJB 5DP6A 2IOTA 2PTCE 3MMGA 1TGSZ 1XUJA 3A82A 3AASA 1ARCA 1GI6A 3QO6A 1AVGH 4ABFA 3BTME 4I33A 2P95A 3ZV9A 3F9GA 4X2YA 1C1VH 1DANH 2PV9B 2NWNA 1EOJA 4TWYA