3L3TA

Human mesotrypsin complexed with amyloid precursor protein inhibitor variant (appir15k)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
224
Chain Sequence
b'IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRSS3 protein
publication title Determinants of affinity and proteolytic stability in interactions of Kunitz family protease inhibitors with mesotrypsin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/cell adhesion
total genus 55
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3l3tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3l3tA02
1BBRE 1N1LA 1YYY1 4KTCA 2UUJB 1ELCA 1RIWC 5JDUB 4K60A 3RXSA 3V13A 1O2PA 3RXLA 4E7NA 4MPUA 2HWLB 4MQAA 1AE5A 1H9LB 1HAPH 2PLXA 4AFZA 1FIZA 5L30H 2ZDLA 3FP7E 5ETXA 2XBWA 3TH2H 5ESTE 2SFAA 3M3TA 2FS8A 2DE9A 1BA8B 1CT0E 1SL3A 1Y59T 1JIMA 3P6ZB 2HNTF 2Y6TA 1SR5C 2HNTE 2VIOA 1HXEH 1TONA 5HMAA 1HIAA 2JETC 1ID5H 1MAYA 1O3JA 4LZ4B 1O34A 4CBNA 4X2XA 3RU4E 3SJ8A 4X2YA 1UTOA 1YPMH 3KQCA 4JZEH 3MH4A 3TGIE 2P94A 3LU9B 5E2OA 1NRRH 3ZV8A 2Y5FA 3MO6A 5HXFA 4UE7H 1WTHD 4UFGH 1GI0A 2R0KA 1MKXH 1ZTLA 1F0RA 3OTJE 1TA2A 1FDPA 5J4SA 1ZSKA 4K69A 4BTIB 1FY1A 1YC0A 2F9BH 5C5OA 1S0QA 1GCTC 2BQWB 4UFDH 3VPKA 1ELDE 1C5OH 3M7QA 2HALA 3RXFA 3PO1B 1CA8B 3BEUA 1HUTH 1P12E 2YOLA 1SBWA 2ZF0H 1UO6A 4KELA 3LC5A 2WPHS 2XNIA 4WXIA 1QY6A 3KQEA 1SI5H 1KXDA 3IITA 3SJ9A 3M5MA 3GCHB 3PMBB 1IQKA 3ATIA 1CHOG 4BANB 1QJ1B 2FOMB 4MNWA 2ZCLP 3LGIA 3GDUA 1K1PA 2WV5A 1E0FD 2FDAA 2VVVA 1F0SA 2YNBA 3L6PA 1HAIH 1C1TA 1OYQA 3GY2A 3TNSA 2HPPH 2Y82A 4RKJB 3RXMA 1C5SA 1V2JT 3MH7A 5AF9H 1GJ8B 4E05H 1C1PA 2BM2A 2VIDA 2BY6X 3Q76A 2H9EH 4DW2U 1ZRKA 3U1IB 1GL0E 4D8NA 4KTUA 4MNXA 1GMHG 2RA0A 1GI3A 1JIRA 2ZHWH 3SNCA 5DP5A 1HAVB 4JZFH 2Z3DA 2FOHA 3E1XB 5E0GA 1O2HA 1Y3XA 4AN7A 3TK9A 1MQ6A 1EZUC 4B73A 1GG6C 5CHAB 3NCLA 3W94A 3QUMP 3LJJA 3H5CB 4NSVA 2O8WA 1GHZA 1U6QA 1P04A 2NU1E 4WMEA 3A7ZA 5LPEA 1C2MA 3GCNA 2EEKA 4DVAU 2ZHFH 5DO4H 1LKAA 3GICB 3LONA 4VGCB 4ZHLU 3DA9B 2I6QA 3BTHE 1BMAA 5H4IB 1GJBB 2G4UA 2QA9E 4YESB 1EOJA 1TX6A 5T3HA 1O3MA 4KTSA 1GBDA 1O5CB 2NU2E 1FLEE 1C2FA 1ZZZA 1D3QB 2OQUA 4CRBA 3MMGA 3F9EA 5JBAS 2YNAA 3SBKA 4AORA 9ESTA 1UHBA 2OUAA 4I8LA 1GJ7B 4CHAB 1MTWA 3ATLA 1SGFA 1EKBB 4B1TA 5TJXA 2VIPA 5I25A 1CBWB 3EA9A 1ZPZA 3SJIA 1AVXA 1FZZA 2GDDA 1SSXA 3ITIA 1C2IA 1V2LT 2BDIA 1SG8B 1BJVA 1ABJH 1Z8GA 3BEFB 1V6DA 5EW2H 4A1XA 1NROH 2TRMA 2KAIB 1JOUB 1D6WA 1SFIA 4K8YA 1NFWA 3TLOA 5EQRA 2BTCE 2FOEA 3UR9A 1WBGB 3LC3A 1WU1A 2BLWA 2ANKH 4CR9A 5A8ZA 2ILNA 8KME2 1TPOA 1XKBC 2FI5E 4ISNA 4B2CA 3EE0B 1GBEA 2TGPZ 5GXPA 3MH6A 2ZI2H 1SGDE 1LO6A 3UREA 3K6ZA 1YGCH 1C5LH 1XX9A 5FBIA 4INLA 1HYLA 1UTPA 4INKA 1ESBA 3TJNA 1GBFA 4YOGA 2AMPA 1VR1H 1TX7A 1OWIA 3ZVAA 2EC9H 4ZAEA 1TNGA 3ZYDA 5AVDA 5C3NA 1YCPK 3Q3KA 1GBTA 1ZR0A 5FAHA 1ELEE 1CVWH 3VB5A 1HPGA 1INCA 1Q2WA 5EPNA 2VWLA 1LCYA 1RXPA 1Y5UT 2ZPSA 4ZROA 4D9QA 4XBDA 1K1MA 4A6LA 3L3TA 1A5HA 1RRKA 4A5TS 1C1OA 1XUGA 1ZHRA 2C8YB 4FUFA 2FO9A 3K65B 5EQSA 1ETTH 2GDEH 1P57B 1RJXB 4O03A 3EA7A 2G5NA 1BOQA 1AB9C 1L1NA 2P16A 1F7ZA 3LJOA 1O2WA 1AY6H 3PO1C 3FAOA 4GCHF 4X6PA 1HFDA 4CREA 3GISB 2XC0A 1C5ZB 1T4VH 2BY7X 2GZ7A 1TX8A 4B76A 1OYTH 1PYTD 5F8XA 1GI7B 3I29A 3GCHC 2GT8A 1O3FA 2BZ6H 2ZDMA 1G2LA 1GVZA 1LHCH 1G2MA 4MPWA 1O2TA 2Y81A 1WTGH 3GDSA 8GCHF 2FM2A 1C5QA 1VCPA 3U69H 2G55A 2FS9A 2ZGHA 3M37A 4SGAE 3U98H 5L2YH 3UWJH 3T25A 3LT3A 4NCYA 1ZSJA 3PROA 2CHAB 1CSOE 3ZVBA 5IDKA 1GI9B 1BMNH 3E0PB 3RMLH 1PFXC 1TAWA 1VJ9U 1X7AC 2XXLA 3S7HB 1C5YB 5T6FA 1S0RA 1V3XA 4U01A 1VGCC 3RXKA 5EODA 4WJG2 1XXFA 3M35A 4O9VA 3SO3A 2JH0D 5ABWA 2GZ8A 1TMBH 1SGPE 1XUIA 5CHAC 4RN6A 1O3EA 2G00A 1TMUH 2ZKSA 1AGJA 1SLUB 1O3AA 5C5NA 3VFEA 1UTJA 3U8OH 1YLCA 4AB9A 1C2KA 3ZZ4A 1O5AB 3A8DA 1QR3E 5E8EH 3V7TA 2A0QB 1O39A 5T6DA 1SB1H 4O3TA 3E6PH 1FJSA 4VGCC 1IHSH 3V12A 3SV9A 2CN0H 4JZ1A 3SQHE 5LPRA 3SV2H 2THFB 3NPSA 4FUJA 1P8VC 1E37B 1FNIA 4NFFA 1K22H 4TYDA 4UONA 1RTKA 2V3OH 2WPKS 3TU7H 4ZXXH 1BUIA 1N8OB 1IQJA 1NU7B 4ESTE 1UTQA 1O3PB 1VITG 2PGQB 1ARCA 4FUGA 4CHAC 4ZKNU 2FEQH 1FY4A 2ZCHP 3LGUA 4WH6A 4K1EA 1CBWC 2WPMS 2GMTC 2P95A 1IAUA 2R2MB 2XBVA 2G5VA 1HAHH 3GY5A 1K1OA 4Y7BA 2AMDA 2OBQA 3A83A 1SGIB 1C2EA 3KF2A 4OS6A 1GMDF 6GCHF 4Q7XA 3PM3A 2VINA 3SN8A 3UQVA 2A32A 2B5TB 3MU5A 3MU8A 1O33A 1QB9A 3B23B 3UWIA 3LPRA 1UTMA 4IC6A 6ESTA 2WPIS 2SNVA 3MNBA 1KXEA 4X1QU 1SOZA 1ZTKA 1CE5A 1UTNA 2Q6DA 1O5DH 4I8KA 4GUXA 4BAMB 1WUNH 1FIWA 1QJ7B 1DWBH 1DITH 2PUQH 1RFNA 2P3UB 1SMFE 2NU4E 1Z7KA 5FBEA 2XC4A 1ZYOA 2C3SA 3ZVCA 1TPAE 2WPLS 2OC7A 1UCYK 2HOBA 4H4FA 1CGJE 1FQ3A 3MU0A 2D8WA 5A8XA 2ZZUH 3KL6A 2BX4A 2VB0A 2EI8A 2VH6A 1KIGH 2FODA 1B5GH 3ZZAA 3H7TA 3TH4H 4F49A 1P05A 1LDTT 1TBRH 1OOKB 1PPEE 2GGVB 2OBOA 3OSYA 3T2NA 3KCGH 1ANEA 1GI1A 1Q3XA 2O8MA 1Z1JA 1P9UA 3GCOA 3PMHB 3ZZ3A 2RA3A 3E8LA 2OXSA 1QTFA 1Z1IA 4IC5A 2H5DA 2FESH 5EQQA 1YPHE 4UFFH 1YF4A 2BOHB 2J94A 3VEQB 4TWYA 3SU0A 3UFAA 3VXFH 1S85A 2VWMA 3MNXA 3RXIA 3BV9B 2K1QA 2QXHA 2IPHA 1YKTA 1FONA 1OKXA 5DK1A 4XBCA 1S5SA 2TGDA 4UFEH 4K1TA 2BDYA 4GAWA 4OGXA 4RKOB 3FP8E 1W11U 4YOIA 1W0YH 4MDSA 4WH8A 3EAJA 1TQ0B 5GIBA 4A1TA 1TPPA 3RMMH 1V2PT 1N6YA 1T4UH 1GI8B 1P3CA 1JWTA 3UNSA 1P2QA 3BTFE 3GCTG 1IQMA 3M5NA 5GWZA 3W95A 1KLJH 3Q77A 3MOCA 1CHGA 4NIVA 1DWEH 4DOQA 1BTXA 1DM4B 1C1WH 1SFQB 1UVUH 1GL1A 3LH3A 1HAXB 1MTUA 2AGEX 3U8RH 1EXFA 1W14U 1O3OA 2RDLA 2CHAC 1HJAB 2BD5A 4BAKB 3TGKE 1GJ9B 1TQ7B 1OWDA 2QXJA 1EB1H 1Z6JH 4D76A 3OU0A 1HXFH 2ZU4A 1GPZA 3ZZCA 3A8AA 2ZO3H 2FOFA 1TNJA 2Z9IA 5DP9A 1TOCB 3BTTE 1A0LA 1FXYA 3SV6A 4YZUA 3QLPH 1GHAG 1TIOA 2FOCA 1ANDA 3QGJA 3QX5H 1T8LA 2HNTC 3WY8A 1LHDH 1AFQC 1G32B 4CRCA 2AYWA 2ZGCA 3O8RA 1WCZA 2TIOA 3SJKA 3BTWE 1HAVA 2GV7A 2CJIA 1LQEA 1FAKH 4LK4A 2TPIZ 5DPAA 2GKVE 1O2VA 1SGTA 4Y79A 2ANYA 3FFGA 3DFJA 5EG4A 3RLYH 2SGAA 1TNIA 1K1JA 1O3KA 2V0BA 3LGYA 1GBJA 2H6MA 5F6MA 1D3PB 1CO7E 3VGCB 3E16B 4CH8B 1N8OC 1ELAA 1QA0A 1O3GA 1Y5AT 1BRAA 4B2AA 1DS2E 3PTNA 1O2NA 1HNEE 4ZUHA 3E90B 3SU4A 3GY4A 1KY9A 5IYTA 2WUCA 4FUIA 1NTPA 3RXQA 1H4WA 3ZVGA 2BXTH 2Q1JA 1SC8U 1PYTC 1BZXE 1SHYA 1O2LA 3V3MA 2AERH 2H9TH 2PTCE 1NT1A 4FUCA 2NU3E 1GI5A 2SGEE 3PLKA 1S6HA 3FZZA 1FUJA 1YCPH 2ZG0H 1FI8A 2GVFA 5FPYA 2FTMA 2BOKA 1IQNA 1AB9B 1PQAA 4BXSA 2SGPE 2F9UA 1FPHH 1ZGVA 2VVCA 5GDSH 3A84A 1JMOH 1A5GH 1WQVH 5DP4A 4WWYA 1T8OA 3RXVA 1IQEA 1W0ZU 5A09A 4FVBA 2Z9LA 3HK6B 1ZSLA 1BBRK 1UK4A 2ZDVH 3KGPA 1AWFH 1Y8TA 4YM9A 2GCHF 2QY0B 3N7OA 1BTYA 2FP7B 2KAIA 4Q80A 3CENA 2ALPA 1KXBA 3E0NB 3M3VA 3KN2A 3SUEA 1EUFA 1GBMA 4AGKA 3F9FA 1WSSH 2F9VA 1SQOA 3RP2A 2ZTYA 3A87A 1ESTA 2FTLE 3UUZA 4LOYH 2XW9A 1XUHA 3P70B 4CRGA 1GBCA 5A0AE 1HV7A 1GCDA 4KP0A 1BMMH 3T29A 1T31A 2A2QH 3BG4C 1C5WB 2HPQH 1NS3A 2FYQA 4ABFA 5A0CA 2AIQA 2WYGA 2STBE 1MU8B 4Y11E 1LPZB 1MMJN 1TYNA 3EDXB 4OS7A 5AFYH 3PMJA 3ZVEA 1K21H 1EOLA 1KLTA 3S7KB 4J2YB 1VGCB 4Y10E 1PPZA 1UTKA 2Z3CA 2W7UA 4X8TH 3RU4T 5A0BA 3VB7A 4F4OC 4H6SB 2ZFTA 1IOEA 3A81A 2W7SA 5C20A 1V2UT 1J8AA 1SOTA 3AW1A 3VB6A 1ZHPA 4MTBA 5SGAE 3ODDA 3ODFA 2XC5A 4AYYB 1P2JA 2BDCA 3MFJA 1C5VA 3T5FH 3PLPA 1OWEA 3GY3A 4MNVA 1V2OT 2RG3A 1TGSZ 1XMNB 2BB4A 4J1YA 4JCNA 4X8SH 1LVOA 1BRUP 3V0XA 4X8UH 2ODPA 3A8BA 2VNTA 2ZQ1A 3MNSA 4JYVH 4A1VA 1C5TA 3SNAA 1CGHA 1HJAC 2ZFPH 1Y5BT 1S81A 1PPHE 3CS7A 1BTPA 1LPKB 3S69A 4QT8C 1GJ6A 1BIOA 2EA3A 2CGAA 2QF3A 4BTUB 3NKKA 4MPVA 2GMTB 1O38A 5EPYA 1EQ9A 4D7GA 1PPGE 3HGNA 2CF9H 2QYIA 1W7GH 3TVJB 3QN7A 3ZZ9A 3GYMA 1DSTA 2ZFQH 3CS0A 7GCHF 2OINA 2ZIQH 4Y6DA 4B74A 1NRNH 1TE0A 2BZAA 1Q31A 4ZMAH 2F3CE 1V2TT 1IQFA 2A1DB 3K2UA 1BITA 1TGTA 2Z6BD 1ACBE 1DLKB 5EXLA 2F9NA 1KDQA 1Z8RA 3QZQA 3QWCH 1UTLM 2GZ9A 1O3DA 2XTTB 1O36A 3U9AH 3UR6A 1BTWA 1HAOH 1ZJDA 3UOPA 1DFPA 4XOJA 1MTSA 1QBOA 1A46H 3VGCC 4MNYA 5CMXH 3LIWA 2BDHA 3VB4A 1AWHB 4I8HA 2WPJS 3R3GB 3UTUH 1C2DA 2G81E 1W12U 1MBMA 3QTVH 1F5LA 2G51A 3SGQE 1C2GA 1OWHA 1ZPBA 1O2YA 3SHAH 3SJOA 1DE7H 4BXWA 2G8TA 1V2QT 2FWWA 4A7IB 1C4V2 1PQ7A 1P10A 1TBZH 1UCYH 1AQ7A 1KTSB 1TABE 2BDAA 3STIA 1AFEH 1GMCF 1XVOA 2D26C 4AOQA 5DG6A 3MWIU 2F9PA 4WF8A 1NRQH 1LHEH 2ZFFH 4YTAA 3SU6A 2BLVA 3GOVB 2C4FH 3SV8A 1B7XB 2STAE 2P8OC 4ZHAA 5EOKA 1A4WH 4Y8ZA 4GCHG 1MUEB 4ZHMU 1VITH 1B0EA 3TK6A 3ZVFA 3VXEH 3RM2H 1O2SA 1OWKA 2Q6FA 5HYOA 3MTYA 2OCVB 1C2LA 1SLXB 2OC1A 4AFUA 2ZPRA 3TJVA 4CRFA 2PKAA 2ZWLH 4NIYA 1MD8A 2C93B 2VIQA 3FVFB 4I7YH 2NWNA 1A2CH 1HCGA 4OGYA 8GCHG 1EJMA 3SU3A 4K5ZA 4CR5A 4YT6H 3GYLB 2GD4B 1VCWA 1GVKB 3T27A 1Z71A 1GHBF 1T8NA 1TRNA 1TNLA 1TPSA 1G36A 1O2JA 1LVMA 3PMAB 3T62A 3BF6H 1XUKA 1RS0A 2LPRA 3C27B 3A82A 1BQYA 1YPEH 3LKWA 4TPIZ 4AFSA 4Z6AH 1GBKA 3UNRA 1ELBA 1BRBE 3ZZ8A 1NRSH 5JB8S 3E3TA 1K1LA 1OS8A 4X0WU 2ASUB 1ZTJA 1EZXC 1ZGIA 1AKSB 1KTTB 3SHCH 5EU8A 4MLFB 3PWBA 4NZLA 1GBIA 1H9IE 1AFQB 4ISHH 2TGAA 1V2MT 2JH6D 1E38B 1C5PA 5FX6A 1Z8IB 1T7CA 5FX5A 1XXDA 4R0IA 1RTFB 3ZZ7A 1V2WT 3BTQE 1ARBA 3B8JA 5GCHF 5C2ZA 1DWCH 3G01A 5AFZH 4IBLH 1OSSA 1J16A 4DURA 3AASA 2R2WU 2SGDE 2ZU3A 5DP6A 1NZQH 1O5FH 2GCTC 1S84A 1GJ5H 5L2ZH 4ISIH 1QB6A 2C8XB 2OP9A 1IHTH 4IS5A 3SV7A 5EW1H 1QQUA 3ZZ6A 1TLDA 4CRAA 4GVUA 1GHVH 2ODYB 2P59A 1ZMJA 2AGGX 1F0TA 2F83A 4XFQA 4FXGH 2BD4A 3I77A 4XE4A 1P02A 2A7HA 3TIUA 3NZIA 4BTTB 3AW0A 4D9RA 4DCDA 2W3KA 3S9AA 1O2MA 3KQDA 1GMDG 6GCHG 5FXLA 3ATMA 3P95A 5LH8A 1AIXH 3HKIB 1F0UA 3ZZ5A 4XSKU 1EAUA 1P9SA 4X1RU 1KYNA 1V2RT 4YO9A 1O37A 4FU7A 1BHXF 1F5KU 4B75A 2O8LA 2TBSA 1HAYB 3ATKA 1MKWK 4ZKOU 1DANH 1GDQA 1NRPH 1XM1A 3Q00A 1ELFA 2ZDKA 3P8OA 4Y8YA 1FAXA 1EX3A 1HDTH 1P3EA 4KKDA 4U30A 3ELAH 2SGFE 1QIXB 2ZDNA 1IQGA 1YPHC 2D1JA 1G9IE 1THSH 2B9LA 1TA6A 1HJ8A 1S83A 2UWPA 3QZRA 3UPEA 4CRDA 1OX1A 2GP9B 1PQ8A 5HGGA 4JZDH 4UDWH 1LQDB 1O3IA 1UVSH 1CU1A 3EGKH 3UQOA 1TMTH 1C5UA 1BBRH 3JZ1B 2QGRA 2BLOA 1MZAA 4DGJA 2V35A 1C2HA 7KMEH 1O5EH 3AAVA 1K1NA 1Z8JB 3LDXH 3PYHA 5DP3A 3RXTA 3BG4B 2O8UA 5DP7A 4BNRA 1C5MD 2QXGA 1Y3UA 1D9IA 4OS2A 1EATA 2CV3A 1AZ8A 1PQ5A 1O2GH 1SGCA 1SGRE 3GY8A 4THNH 4DY7B 3BSQA 5DKMA 2BD7A 1KLIH 4CH2B 1H8DH 4GLYA 1EASA 1TNKA 4Z0KA 2FOGA 2Z9GA 4X1PU 3QK1A 5JPMH 2QN5T 3SGBE 1H1BA 4IN1A 2Y7XA 1QL9A 1QHRB 3RXJA 4XDEA 5TCAA 1QGFA 4YOJA 2F91A 1A5IA 4O3UA 2ZDAH 1GI2A 2JH5D 2PR3A 4X2WA 4NSYA 2EI6A 1LTOA 1P2OA 2WINI 4ABGA 3MU1A 2SNWA 2Y7ZA 5K7RA 3MHWU 2ZHDA 2FOBA 1AN1E 2C8WB 1GBAA 1O32A 1TALA 1N6XA 1CQQA 1Y3VA 4A92A 1WOFA 2WYJA 3A7XA 4X2VA 2I6SA 3SW2B 2BD8A 4AG1A 1MD7A 2VWOA 3NUMA 1IQLA 2Z7FE 3KNXA 3SUDA 4JK6A 4NWKA 3RXEA 4ABBA 2ZNKH 3A80A 3RUOA 2PW8H 2H1UA 1HB0B 1ANCA 1YBWA 2OLGA 3BTME 3GY6A 1YPJH 3SU1A 1GDUA 3F6UH 2H5CA 3RXRA 4FUBA 2AS9A 5C1YA 3URCA 2WUBA 1SQAA 3UOUA 4ASHA 4I8JA 3SI3H 1C4U2 1O2OA 1O30A 3F9GA 1EP5A 1LHFH 3PTBA 4JYUH 2FOAA 1AI8H 2TGTA 2BVRH 2ZA5A 1O2ZA 2FIRH 4R8TB 4X6OA 1DLEA 4X8VH 3UIRA 4DJZB 1JRTA 2UWLA 3I78A 1DXPA 1G3DA 3SGAE 1O3CA 2BD2A 1THPB 3R0FA 3DT0H 4JMYA 2EI7A 1WAYB 1AVWA 1KXFA 1NO9H 1P2KA 1D6RA 3FZDA 2RCEA 1QNJA 1GGDC 3A89A 5FCKA 1YLDA 1ZHMA 2FI4E 2OC0A 3BN9A 1BTUA 1QL7A 1P06A 4ABDA 2ZU2A 2A2XH 1F2SE 1NN6A 3A7YA 5I46H 1NC6A 3F9HA 3S9BA 4BAQB 3EQ0H 2QXIA 1O2UA 3SI4H 3TH3H 1GI6A 1OP0A 3RXDA 3BTGE 1GJ4H 1QRZA 1WYKA 1QQ4A 2M5TA 1GDNA 2C90B 3ZYEA 3RXPA 1TRMA 3MO9A 2AH4X 1IQIA 2UWOA 1CA0B 4I33A 1GHXH 3CP7A 1RTLA 2W3IA 4YLUA 1HAGE 3SQEE 2P8OB 3P17H 2FZZA 1BRCE 3Q3YA 1WV7H 2GCHG 1O0DH 3P8FA 2B8OH 2PKSB 4X6NA 3ZVDA 1MQ5A 5A2MH 4Y0YE 3M3SA 2Q6GA 3RMOH 1PPCE 1C1NA 3RXBA 4BOHA 2Z9JA 2R9PA 2ZPQA 5L6NH 2A4GA 1HGTH 2ZGBH 1DT2A 1C5NH 1DDJA 4Y8XA 1O2QA 1C5XB 2BX3A 3QO6A 2AEIH 1XUFA 3F1SB 1EAIA 1HBTH 3U8TH 2XWBI 1QJ6B 1ESAA 1FY5A 1P0SH 3SU2A 1P11E 2Y5GA 4ZXYH 5JBTA 3OY5U 4YLQH 1D4PB 1MCVA 3SUFA 1K28D 4JK5A 5FHTA 1G3BA 1CHOF 1W8BH 1AD8H 3A7TA 3LGTA 3VB3A 1MU6B 1NFYA 3A7VA 1GBHA 3L33A 1UVOA 1DSUA 3TGJE 2J34A 2VVUA 6CHAC 4I32A 2HRVA 3HKJB 4DIIH 1C1VH 5E0JA 1UK3A 1OP8A 5BPEA 1O31A 2BY5X 1EPTB 5FPSA 4ABAA 3JZ2B 4BAOB 5TCCA 5CE1A 1CT2E 1GHWH 1MBQA 1AUTC 1F5RA 1O2XA 1MTNB 2PUXB 2QIQA 2J4IA 2BHGA 2J2UA 1O2IA 3UY9A 1GMHF 2BY9X 1ETSH 1TRYA 4MG3A 1FY8E 4IMQA 4Y71A 1QCPA 1FMGA 2J9NA 3BEIB 3MI4A 1QURH 2OD3B 2UUYA 1FN8A 2VGCB 3OX7U 1YPLH 3SNBA 2R3YA 1T8MA 1ELGA 5HM9A 3Q3XA 3SNDA 5T6GA 2BVSH 3KEEA 2A7JA 4IMZA 1EZSC 2QAAA 4K3JA 2GCTB 1BHXB 2DE8A 1C1RA 1C1MA 2XBYA 3S0NA 2GTBA 4INHA 3TJUA 5E0HA 2OTVA 3IG6B 1P2NA 1ZOMA 3RC4A 3LOXA 3RDZA 3DD2H 4TY6A 3C1KA 3MNCA 1YPKH 2FMJA 2ZP0H 1HIAB 1P09A 1TGCA 3A86A 2CXVA 1A1RA 1OXGA 1EB2A 1SVPA 2B7DH 4BAHB 3M36A 1F92A 4ISOA 3F68H 7GCHG 1OP2A 4GPGA 3BIUH 4WMFA 1O3NA 2A4QA 3GDVA 3RC6A 2W5EA 1ETRH 3SOSA 5C1XA 4H42U 4WVPE 1W10U 3SUGA 1UVTH 1DWDH 2AFQB 4I8GA 3NK8A 1EAWA 1E34B 1LPGB 3B9FH 3EYDA 2XCNA 4NA8A 2ZQ2A 2V3HH 1V2NT 2P3TB 2LNCA 1FPCH 2ZCKP 4TPYA 1J15A 1Y3WA 2OC8A 1QRWA 1XUJA 1AKSA 3MU4A 1AVGH 1DUAA 3D23A 1ANBA 1P2IA 3QGNB 4YT7H 1VZQH 9LPRA 5HM2A 3BTEE 1K2I1 1DY9A 2O8TA 1C9PA 5GJ4B 1SGNE 2ANMH 3BIVH 1MKWH 1GBLA 1THRH 3RLWH 3MO3A 3D62A 4NA9H 1L0ZA 1GJAB 4X1SU 4JZIA 1TBQH 3A85A 3BTDE 4M7GA 4LXBH 1BDAA 4FU8A 1D3TB 4NG9H 4U32A 2CMYA 1BTHH 4X6MA 1EP6A 1H9HE 2VU8E 3ATWA 3AAUA 1QBNA 2XCFA 2WV4A 3LH1A 3ZV9A 1O35A 1ELTA 1DXWA 5EXNA 3FANA 1C9TA 1HAZB 2C8ZB 3U1JB 1GMCG 1MAXA 2R0LA 1MKXK 1YM0A 1DICA 1A7SA 1PPFE 1FV9A 1L1JA 1CA0C 3BG8A 2J92A 1AU8A 4NIXA 5FPTA 2NU0E 3ENSB 3RU4D 3K9XB 4NIWA 1TB6H 3SZNA 4RSPA 1O3HA 1MH0A 1C4Y2 3AVZA 5E2PA 8LPRA 2PKSC 2P3FH 2VH0A 5JBCS 1SHHB 1YCPM 3E91A 2Y5HA 3D49H 1GVLA 4AX9H 1AZZA 2A4OA 2R3UA 1LVYA 1ZJKA 1EAXA 3MYWA 1KXAA 1AE8H 1XVMA 1ZRBA 4E7RG 4OS4A 3RM0H 1GHBG 1GJDB 8ESTE 3DHKH 2ZTZA 4HZHA 2GT7A 2XRCA 2PSYA 2Z3EA 3GY7A 4HGCA 3LGVA 1SQTA 3FP6E 1LMWB 1PPBH 4GSOA 3URDA 4FUHA 4JYTA 2ZFRH 1SGYE 1SGEE 5FCRA 2CF8H 2PTNA 1YP9A 4NA7A 2P93A 2G52A 3PLBA 1J14A 1UHBB 3M5OA 1C1QA 1ZMNA 3O8DA 1A0JA 4E06H 5F03A 1VJAU 3PV4A 2W26A 4KGAA 2J38A 2B0FA 3STJA 4WMDA 3A7WA 3D65E 1NFXA 1NY22 4ABJA 1D3DB 1A61H 4UEHH 1C1UH 4AG2A 5ESBA 2FXRA 2J95A 5C1UA 5LGOA 4Q7ZA 1A3EH 1EPTC 7ESTE 4FVDA 2QF0A 4AZ2B 2ZHEH 2BDBA 3O8BA 4MPXA 1DY8A 1MTNC 1TFXA 3RXUA 1V2ST 3LGWA 4PROA 4AYVB 4NGAH 4WXVA 4IN2A 3NXPA 4Q2KA 2Z9KA 1DUEA 4H6TA 2PSXA 1K1IA 1G3EA 3OYPA 1KDQB 1VCQA 2VGCC 1G37A 5GCHG 1BT7A 2A5IA 1AMHA 2PFEA 3RC5A 4B2BA 4ZH8A 4HTCH 3UNQA 1DX5M 5C67A 2BD3A 3A88A 4IW4E 3SNEA 5G4BA 3SORA 4Q7YA 5K0HA 4TWWA 1A0HB 2AGIX 3ZZBA 2BYAX 1RIWB 3SU5A 1TWXB 1ELVA 1C5RA 5JB9S 3RXAA 1GI4A 3T28A 1GGDB 1HJ9A 1MTVA 1NU9A 1UCYE 3QTOH 1E36B 1J17T 3IWMA 2PGBB 2GX4A 1NESE 1RD3B 3S9CA 4Y0ZE 1B0FA 2UUKB 3DUXH 1KXCA 4OS1A 3RXGA 2BDGA 2A5AA 1HLTH 4AB8A 1FN6A 2UUFB 2BQ6B 2PHBA 1MCTA 5A8YA 1MZDA 1RGQA 3NWUA 2FPZA 1HRTH 3M5LA 1TGBA 1G3CA 4DT7B 1VITF 1W13U 1QL8A 5AHGH 3HATH 2ZU5A 4DIHH 4X1NU 4WY3A 1L4ZA 3K6YA 1EZQA 1GHYH 2JETB 4XBBA 2IN2A 4MVNA 2A7CA 1LHGH 4AFQA 3O8CA 4ABHA 1NFUA 3M7TA 5B6OA 4GHQA 1BB0B 1CT4E 2GV6A 3RMNH 3P92A 5EGMA 2ESTE 1S82A 3KHVA 2PKAB 4UD9H 1G30B 1SLWB 2ALVA 1ZMLA 2ZTXA 2ZEBA 4CBOA 1ZPCA 2FX6A 1C1SA 3KIDU 5F8TA 1L2EA 1P01A 1XKAC 4GHTA 1CGIE 1O2RA 1NM6A 1GCTB 2HGTH 3EA8A 1QFKH 1UMAH 1Y3YA 4Y7AA 1TGNA 3MH5A 1K9OE 1C2JA 1PJPA 4OS5A 3TITA 1V2VT 2ZGJA 4ZKRU 5GPIB 2XWAA 1JBUH 4LZ1H 4SGBE 2O9QA 2IOTA 2ZGXH 5EXMA 3M7UA 1J9CH 2FLBH 1TOMH 4TY7A 3A8CA 4DG4A 1KSNA 2JKHA 2H2ZA 1O5GH 2IJOB 3H7OA 5JBBS 1O3LA 3OY6U 4FUDA 1OPHB 3PWCA 2PWXA 3QDZB 5F8ZA 3T26A 2Y80A 6CHAB 1ORFA 1T32A 4D7FA 1AO5A 1JRSA 1QRXA 1H8IH 2ULLA 2VJ1A 2FLRH 5J4QA 2XYAA 2XBXA 2FYRA 4NZQA 1O3BA 1FY3A 2D2DA 2SGQE 2BLQA 2HLCA 4NWLA 2VWNA 2AIPA 1DOJA 1SLVB 1DPOA 1EJNA 5DP8A 2ANWA 2A45B 1AUJA 2ODQA 4B71A 1GWAA 1Z6EA 3BTKE 4NFEA 2Z94A 1BMLA 1AHTH 5DJ7A 2H9HA 1W2KH 1S6FA 1QA7A 1GG6B 1W3CA 1EJAA 2ZC9H 4FU9A 2DUCA 1L4DA 3KQBA 1GBBA 2BQ7B 2A31A 3HPTB 2F9OA 3P8NA 2BXUH 2FX4A 2QCYA 2VIVA 1UK2A 4U2WA 1ZLRA 5PTPA 2BD9A 4ISLA 1JXPA 3TNTA 2ZHQH 1BTZA 3ESTA 4O97A 3M61U 1A3BH 3ZZDA 1YPGH 2G4TA 1O2KA 4IGDA 1GJCB 2QC2A 2AMQA 3GCTF 4ABEA 1LVBA 1V2KT 2BMGB 3RXCA 2OQ5A 2HVXA 1NPMA 4HI3A 5BRRE 5JYIA 4K2YA 4K8BA 1ABIH 4HFPB 2ZU1A 1P2MA 1DVAH 2PV9B 1UJ1A 4AGJA 1LKBA 1SGQE 6LPRA 1QBVH 5DGJA 1WQSA 1BJUA 1M9UA 2A4RA 3DFLA 3RXHA 3P8GA 3HGPA 3RXOA 2QV1A 4K1SA 1P03A 2BVXH 4I31A 3HK3B 7LPRA 2A5KA 1QB1A 1O5BB 1OWJA 1TNHA 2FI3E 1SPJA 2V6NA 1UVPA 4ZKSU 1SGFG 3TJOA 4Y76A 5LPFA 2BY8X 1L1GA 1EPTA 1IQHA 3TPIZ 2ZFSA 1GHAF 4FUEA 1BCUH 4ABIA 3PB1E 2VIWA 1E35B 2ZECA 1W7XH 3TK5A
chains in the Genus database with same CATH superfamily
1BBRE 1N1LA 1YYY1 4KTCA 2UUJB 1ELCA 1RIWC 5JDUB 4K60A 3RXSA 3V13A 1O2PA 3RXLA 4E7NA 4MPUA 2HWLB 4MQAA 1AE5A 1H9LB 1HAPH 2PLXA 4AFZA 1FIZA 5L30H 2ZDLA 3FP7E 5ETXA 2XBWA 3TH2H 5ESTE 2SFAA 1QZ8A 3M3TA 2FS8A 2DE9A 1BA8B 1CT0E 1SL3A 1Y59T 1JIMA 3P6ZB 2HNTF 2Y6TA 1SR5C 2HNTE 2VIOA 1HXEH 1TONA 5HMAA 1HIAA 2JETC 1ID5H 1MAYA 1O3JA 4LZ4B 1O34A 4CBNA 2J5UA 4X2XA 3RU4E 3SJ8A 4X2YA 1UTOA 1YPMH 3KQCA 4JZEH 3MH4A 3TGIE 2P94A 3LU9B 5E2OA 1NRRH 3ZV8A 2Y5FA 3MO6A 5HXFA 4UE7H 1WTHD 4UFGH 1GI0A 2R0KA 1MKXH 1ZTLA 1F0RA 3OTJE 3N7EA 1TA2A 1FDPA 5J4SA 1ZSKA 4K69A 4BTIB 1FY1A 1YC0A 2F9BH 5C5OA 1S0QA 1GCTC 2BQWB 4UFDH 3VPKA 1ELDE 1C5OH 3M7QA 2HALA 3RXFA 3PO1B 5C94A 1CA8B 3BEUA 3DCLA 1HUTH 1P12E 2YOLA 1SBWA 2ZF0H 1UO6A 4KELA 3LC5A 2WPHS 2XNIA 4WXIA 1QY6A 3KQEA 1SI5H 1KXDA 3IITA 3SJ9A 3OEED 3M5MA 3GCHB 3PMBB 1IQKA 3ATIA 1CHOG 5FL7D 4BANB 1QJ1B 2FOMB 4MNWA 2ZCLP 3LGIA 3GDUA 1K1PA 2WV5A 1E0FD 2FDAA 2VVVA 1F0SA 2YNBA 3L6PA 1HAIH 1C1TA 1OYQA 3GY2A 3TNSA 2HPPH 2Y82A 4RKJB 3RXMA 1C5SA 1V2JT 3MH7A 5AF9H 1GJ8B 4E05H 1C1PA 2BM2A 2VIDA 2BY6X 3Q76A 2H9EH 4DW2U 1ZRKA 3U1IB 1GL0E 4D8NA 4KTUA 4MNXA 1GMHG 2RA0A 1GI3A 1JIRA 2ZHWH 3FOAA 3SNCA 3PRBA 5DP5A 1HAVB 4JZFH 5KEDA 2Z3DA 2FOHA 3E1XB 3DSOA 5E0GA 1O2HA 1Y3XA 4AN7A 3TK9A 1MQ6A 1EZUC 4B73A 3WW7A 1E1RD 1GG6C 5CHAB 3NCLA 3W94A 3QUMP 3LJJA 3H5CB 4NSVA 2O8WA 1GHZA 1U6QA 1P04A 2NU1E 4WMEA 3A7ZA 5LPEA 1C2MA 3GCNA 2EEKA 4DVAU 2ZHFH 5DO4H 1LKAA 3GICB 3LONA 4VGCB 4ZHLU 3DA9B 2I6QA 3BTHE 1BMAA 5H4IB 1GJBB 2G4UA 2QA9E 4YESB 1EOJA 1TX6A 5T3HA 1O3MA 2KX4A 4KTSA 1GBDA 1O5CB 2NU2E 1FLEE 1C2FA 1ZZZA 1D3QB 2OQUA 3FO8D 4CRBA 3MMGA 3F9EA 5JBAS 2YNAA 3SBKA 4AORA 9ESTA 1UHBA 2OUAA 4I8LA 1GJ7B 4CHAB 1MTWA 3ATLA 4Q4LA 1SGFA 1EKBB 4B1TA 5TJXA 2VIPA 5I25A 1CBWB 3EA9A 1ZPZA 3SJIA 1AVXA 1FZZA 2GDDA 1SSXA 3ITIA 1C2IA 1V2LT 2BDIA 4ASUD 1SG8B 2WSSD 1BJVA 1ABJH 1Z8GA 3BEFB 1V6DA 5EW2H 4A1XA 1NROH 2TRMA 2KAIB 1JOUB 1D6WA 1SFIA 4K8YA 1NFWA 3TLOA 5EQRA 2BTCE 4B6FA 2FOEA 3UR9A 1WBGB 3LC3A 1WU1A 2BLWA 2ANKH 1W0JD 4CR9A 5A8ZA 2ILNA 8KME2 1TPOA 1XKBC 2FI5E 4ISNA 4B2CA 3EE0B 1GBEA 2TGPZ 5GXPA 3MH6A 2ZI2H 1SGDE 1LO6A 3N99A 3UREA 3K6ZA 1YGCH 1C5LH 1XX9A 5FBIA 4INLA 1HYLA 1UTPA 4INKA 1ESBA 3TJNA 1GBFA 4YOGA 3N7DA 2AMPA 1VR1H 1TX7A 1OWIA 3ZVAA 2EC9H 4ZAEA 1TNGA 3ZYDA 5AVDA 5C3NA 1YCPK 3Q3KA 1GBTA 1ZR0A 5FAHA 1ELEE 1CVWH 3VB5A 1HPGA 1INCA 3F3BA 1Q2WA 5EPNA 2VWLA 1LCYA 1RXPA 1Y5UT 2ZPSA 4ZROA 4D9QA 5B6LA 4XRNA 4XBDA 1K1MA 4A6LA 3L3TA 1A5HA 2F43B 1RRKA 4A5TS 1C1OA 1XUGA 1ZHRA 2C8YB 4FUFA 2FO9A 3K65B 5EQSA 1ETTH 2GDEH 1P57B 1RJXB 4O03A 3EA7A 2G5NA 1BOQA 1AB9C 1L1NA 2P16A 1F7ZA 3LJOA 5CHBA 1H8ED 1O2WA 1AY6H 3PO1C 3FAOA 4GCHF 5C0TA 4X6PA 1HFDA 4CREA 3GISB 2XC0A 1C5ZB 1T4VH 2BY7X 2GZ7A 1TX8A 4B76A 1OYTH 1PYTD 5F8XA 1GI7B 3I29A 3GCHC 2GT8A 1O3FA 2BZ6H 2ZDMA 1G2LA 1GVZA 3OAAD 1LHCH 1G2MA 4MPWA 3F2HA 1O2TA 2Y81A 1WTGH 2YMSB 2KM0A 3GDSA 8GCHF 2FM2A 1C5QA 1VCPA 2WZQA 3U69H 2G55A 2FS9A 2ZGHA 3M37A 5F53A 4SGAE 3U98H 5L2YH 3UWJH 3T25A 3LT3A 4NCYA 2WHXA 1ZSJA 3PROA 2CHAB 1CSOE 3ZVBA 5IDKA 1GI9B 1BMNH 3E0PB 3RMLH 1PFXC 1TAWA 2V7QD 1VJ9U 1X7AC 2XXLA 3S7HB 1C5YB 5T6FA 3WWBA 1S0RA 1V3XA 4U01A 1VGCC 3RXKA 5EODA 4WJG2 1XXFA 3M35A 4O9VA 3SO3A 2JH0D 5ABWA 2GZ8A 2K8IA 2IPQX 1TMBH 1SGPE 1XUIA 5CHAC 4RN6A 1O3EA 2KCPA 2G00A 1TMUH 2ZKSA 1AGJA 1SLUB 1O3AA 5C5NA 3VFEA 1UTJA 3U8OH 1YLCA 4AB9A 1C2KA 3ZZ4A 1O5AB 3A8DA 1QR3E 5E8EH 3V7TA 2A0QB 1O39A 5T6DA 1SB1H 4O3TA 3E6PH 1FJSA 4VGCC 1IHSH 3V12A 3SV9A 2CN0H 4JZ1A 3SQHE 5LPRA 3SV2H 2THFB 3NPSA 4FUJA 1P8VC 1E37B 1FNIA 4NFFA 1K22H 4TYDA 4UONA 1RTKA 2J98A 1YY3A 2V3OH 2WPKS 3TU7H 4ZXXH 2JJ1D 1BUIA 1N8OB 1IQJA 1NU7B 4ESTE 1UTQA 1O3PB 1VITG 2PGQB 1ARCA 4FUGA 3DSPA 4CHAC 4ZKNU 2FEQH 1FY4A 2ZCHP 3LGUA 4WH6A 4K1EA 1CBWC 2WPMS 2GMTC 3F0PA 2P95A 1IAUA 2R2MB 2XBVA 2G5VA 1HAHH 4ACBA 3GY5A 1K1OA 4Y7BA 2AMDA 4P00A 2OBQA 3A83A 1SGIB 1C2EA 3KF2A 4OS6A 1GMDF 6GCHF 3H09A 4Q7XA 3PM3A 2VINA 3SN8A 3UQVA 2A32A 2B5TB 3MU5A 3MU8A 1O33A 1QB9A 3B23B 3UWIA 3LPRA 1UTMA 4IC6A 6ESTA 2WPIS 2SNVA 3MNBA 1KXEA 4X1QU 1SOZA 1ZTKA 1CE5A 1UTNA 2Q6DA 1O5DH 4I8KA 4GUXA 4BAMB 1WUNH 1FIWA 1QJ7B 1DWBH 1DITH 2PUQH 1RFNA 2P3UB 1SMFE 2NU4E 1Z7KA 5FBEA 2XC4A 1ZYOA 2C3SA 3ZVCA 1TPAE 2WPLS 2OC7A 1UCYK 2HOBA 4H4FA 1CGJE 1FQ3A 3MU0A 2D8WA 5A8XA 2ZZUH 3KL6A 2BX4A 2VB0A 2EI8A 2VH6A 1KIGH 2FODA 1B5GH 2XOKD 3ZZAA 3H7TA 3TH4H 4ACAA 2JIZD 4F49A 1P05A 5EJZA 1LDTT 1TBRH 1OOKB 1PPEE 2GGVB 2OBOA 3OSYA 3T2NA 3KCGH 1ANEA 1GI1A 1Q3XA 2O8MA 1Z1JA 1P9UA 3GCOA 3PMHB 3ZZ3A 2RA3A 3E8LA 2OXSA 1QTFA 1Z1IA 4IC5A 2H5DA 2FESH 5EQQA 1YPHE 4UFFH 1YF4A 2BOHB 2J94A 3VEQB 4TWYA 3SU0A 3UFAA 3VXFH 2V3MA 1S85A 2VWMA 3MNXA 3RXIA 3BV9B 2K1QA 2QXHA 2IPHA 1YKTA 1FONA 1OKXA 5DK1A 4XBCA 1S5SA 2TGDA 4UFEH 4K1TA 2BDYA 4GAWA 4OGXA 4RKOB 3FP8E 1W11U 4YOIA 1W0YH 4MDSA 4WH8A 3EAJA 1TQ0B 5GIBA 3CNRA 4A1TA 1TPPA 3RMMH 1V2PT 1N6YA 1T4UH 1GI8B 2YMSC 1P3CA 1JWTA 3UNSA 1P2QA 3BTFE 3GCTG 1IQMA 3M5NA 5GWZA 3W95A 1KLJH 3Q77A 3MOCA 1CHGA 4NIVA 1DWEH 4DOQA 1BTXA 1DM4B 1C1WH 1SFQB 1UVUH 1GL1A 3LH3A 1HAXB 3MQKC 1MTUA 2AGEX 3U8RH 1EXFA 1W14U 3EE7A 1O3OA 2RDLA 2CHAC 1HJAB 2BD5A 4BAKB 3TGKE 1GJ9B 1TQ7B 1OWDA 2QXJA 1EB1H 1Z6JH 3F0OA 4D76A 3OU0A 1HXFH 2ZU4A 2QE7D 5HKKD 1GPZA 3ZZCA 3A8AA 2ZO3H 2FOFA 1TNJA 2Z9IA 5DP9A 1TOCB 3BTTE 1A0LA 1FXYA 3SV6A 4YZUA 3QLPH 1GHAG 1TIOA 2FOCA 1ANDA 3QGJA 3QX5H 1T8LA 2HNTC 4I86A 3WY8A 1LHDH 1AFQC 1G32B 4CRCA 2AYWA 3PV2A 2ZGCA 3O8RA 1WCZA 2TIOA 3SJKA 3BTWE 1HAVA 2GV7A 2CJIA 1LQEA 1FAKH 4LK4A 2TPIZ 5DPAA 2GKVE 1O2VA 1SGTA 4Y79A 2ANYA 3FFGA 3DFJA 5EG4A 3RLYH 2SGAA 1TNIA 1K1JA 1O3KA 2V0BA 3LGYA 1GBJA 2H6MA 5F6MA 1D3PB 1CO7E 3VGCB 3E16B 4CH8B 1N8OC 1ELAA 1QA0A 1O3GA 1Y5AT 1BRAA 4B2AA 1DS2E 3PTNA 1O2NA 1HNEE 4ZUHA 3E90B 3SU4A 3GY4A 1KY9A 5IYTA 2WUCA 4FUIA 1NTPA 3RXQA 1H4WA 3ZVGA 2BXTH 2Q1JA 1SC8U 1PYTC 1BZXE 1SHYA 1O2LA 3V3MA 2AERH 3OFND 2H9TH 2PTCE 1NT1A 4FUCA 2NU3E 1GI5A 2SGEE 3PLKA 2HVYB 1S6HA 3FZZA 1FUJA 1YCPH 2ZG0H 2L6OA 1FI8A 2GVFA 5FPYA 2FTMA 2BOKA 1IQNA 3GS9A 1AB9B 1PQAA 4BXSA 2SGPE 2F9UA 1FPHH 1ZGVA 2VVCA 5GDSH 3A84A 1JMOH 1A5GH 1WQVH 5DP4A 4WWYA 1T8OA 3RXVA 1IQEA 1W0ZU 5A09A 4FVBA 2Z9LA 3HK6B 1ZSLA 1BBRK 1UK4A 2ZDVH 3KGPA 1AWFH 1Y8TA 4YM9A 2GCHF 2QY0B 3N7OA 1BTYA 2FP7B 2KAIA 4Q80A 3CENA 2ALPA 1KXBA 3E0NB 3M3VA 3KN2A 3SUEA 1EUFA 1GBMA 4AGKA 3F9FA 1WSSH 2F9VA 1SQOA 2M2AA 3RP2A 2ZTYA 3A87A 1ESTA 2FTLE 3UUZA 4LOYH 2XW9A 1XUHA 3P70B 4CRGA 1GBCA 5A0AE 1HV7A 1GCDA 4KP0A 2IJD1 3UAIC 1BMMH 3T29A 1T31A 2A2QH 3BG4C 1C5WB 2HPQH 1NS3A 2FYQA 4ABFA 5A0CA 2AIQA 2WYGA 2STBE 1MU8B 4Y11E 1LPZB 1MMJN 1TYNA 3EDXB 4OS7A 5AFYH 3PMJA 3ZVEA 1K21H 1EOLA 1KLTA 3S7KB 4J2YB 4RT0A 1VGCB 4Y10E 1PPZA 1UTKA 2Z3CA 2W7UA 4X8TH 3RU4T 5A0BA 3VB7A 4F4OC 5DSFA 4H6SB 2ZFTA 1IOEA 3A81A 2W7SA 5C20A 1V2UT 1J8AA 1SOTA 3AW1A 3VB6A 1ZHPA 4MTBA 5SGAE 3ODDA 3ODFA 2XC5A 4AYYB 1P2JA 2BDCA 3MFJA 1C5VA 3T5FH 3PLPA 1OWEA 3GY3A 4MNVA 1V2OT 2RG3A 1TGSZ 1XMNB 2BB4A 4J1YA 4JCNA 4X8SH 1LVOA 1BRUP 3V0XA 4X8UH 2ODPA 3A8BA 2VNTA 2ZQ1A 3MNSA 4JYVH 4A1VA 1C5TA 3NRLA 3SNAA 1CGHA 1HJAC 2ZFPH 1Y5BT 1S81A 1PPHE 3CS7A 1BTPA 1LPKB 2WPDD 3S69A 4QT8C 1GJ6A 5KGOA 1BIOA 2EA3A 2CGAA 2QF3A 4BTUB 3NKKA 4MPVA 2GMTB 1O38A 5EPYA 1EQ9A 4D7GA 1PPGE 3HGNA 2CF9H 2QYIA 1W7GH 3TVJB 3QN7A 1BMFD 3ZZ9A 3GYMA 1DSTA 2ZFQH 3CS0A 7GCHF 2OINA 2ZIQH 4Y6DA 1W0KD 1NRNH 1TE0A 4B74A 2BZAA 1Q31A 4ZMAH 2F3CE 1V2TT 1IQFA 2A1DB 3K2UA 1BITA 1TGTA 2Z6BD 1ACBE 2KZ4A 1DLKB 5EXLA 2F9NA 1KDQA 1Z8RA 3QZQA 3QWCH 1UTLM 2GZ9A 1O3DA 2XTTB 1O36A 2F4LA 3U9AH 3UR6A 1BTWA 1HAOH 1ZJDA 3UOPA 1DFPA 4XOJA 1MTSA 1QBOA 1A46H 3VGCC 4MNYA 5CMXH 3LIWA 2BDHA 3VB4A 1AWHB 4I8HA 2WPJS 3R3GB 3UTUH 2L74A 1C2DA 5T1VA 2G81E 1W12U 1MBMA 3QTVH 1F5LA 2G51A 2K0QA 3SGQE 1C2GA 1OWHA 1ZPBA 1O2YA 3SHAH 5EIYA 5C17A 3SJOA 1DE7H 4BXWA 2G8TA 1V2QT 2FWWA 4A7IB 1C4V2 1PQ7A 1P10A 1TBZH 1UCYH 1AQ7A 1KTSB 1TABE 2BDAA 3STIA 5C0UA 1AFEH 1GMCF 1XVOA 2D26C 1K0HA 4AOQA 5DG6A 3MWIU 2F9PA 4WF8A 1NRQH 1LHEH 5HIZA 2ZFFH 4YTAA 3SU6A 2BLVA 3GOVB 2C4FH 3SV8A 1B7XB 2STAE 2P8OC 4ZHAA 5EOKA 1A4WH 4Y8ZA 4GCHG 1MUEB 4ZHMU 1VITH 2HLDD 1B0EA 3TK6A 3ZVFA 3VXEH 3RM2H 1O2SA 1OWKA 2Q6FA 5HYOA 3MTYA 2OCVB 1C2LA 1SLXB 2OC1A 4AFUA 2ZPRA 3TJVA 4CRFA 2PKAA 2ZWLH 2AHME 4NIYA 1MD8A 2C93B 2VIQA 3FVFB 4I7YH 2NWNA 1A2CH 1HCGA 4OGYA 1NBMD 1EJMA 3SU3A 8GCHG 4K5ZA 4CR5A 4YT6H 3GYLB 2GD4B 1VCWA 1GVKB 3T27A 1Z71A 3WWFA 4XD7D 1GHBF 1T8NA 1TRNA 1TNLA 1TPSA 1G36A 1O2JA 1LVMA 3PMAB 3T62A 3BF6H 1XUKA 1RS0A 2LPRA 3C27B 3A82A 1BQYA 1YPEH 3LKWA 4TPIZ 4AFSA 4Z6AH 3OE7D 1GBKA 3UNRA 1ELBA 1BRBE 3ZZ8A 1NRSH 4ZCNA 5JB8S 4Z1MD 3E3TA 1K1LA 4YXWD 1OS8A 4X0WU 2ASUB 1ZTJA 1EZXC 1ZGIA 1AKSB 1KTTB 3SHCH 5EU8A 4MLFB 3PWBA 4NZLA 2WV9A 1GBIA 1H9IE 1AFQB 4ISHH 2RFKC 2TGAA 1V2MT 2JH6D 1E38B 1C5PA 5FX6A 1Z8IB 1T7CA 5FX5A 1XXDA 4R0IA 1RTFB 3ZZ7A 1V2WT 4HG6A 3BTQE 1ARBA 3B8JA 3OTPA 5GCHF 5C2ZA 1DWCH 3G01A 5AFZH 4IBLH 1OSSA 1J16A 4DURA 3AASA 4OM9A 2R2WU 2SGDE 2ZU3A 5DP6A 1NZQH 1O5FH 2GCTC 1S84A 1GJ5H 5L2ZH 4ISIH 1QB6A 2C8XB 2OP9A 1IHTH 4IS5A 3SV7A 5EW1H 1QQUA 1H8HD 3ZZ6A 1TLDA 4CRAA 4GVUA 1YWUA 1GHVH 3W1EA 2ODYB 2P59A 1ZMJA 2AGGX 1F0TA 2F83A 4XFQA 4FXGH 2BD4A 3I77A 4XE4A 1P02A 2A7HA 3TIUA 3NZIA 4BTTB 3AW0A 4D9RA 4DCDA 2W3KA 3S9AA 1O2MA 3KQDA 1GMDG 6GCHG 5FXLA 2XNDD 3ATMA 3P95A 5LH8A 1AIXH 3FN8A 3HKIB 1F0UA 3ZZ5A 4XSKU 2KFWA 1EAUA 1P9SA 4X1RU 1KYNA 1V2RT 4YO9A 1O37A 4FU7A 1BHXF 1F5KU 4B75A 2O8LA 2TBSA 1HAYB 2LELA 3ATKA 1MKWK 3PRDA 4ZKOU 1DANH 1GDQA 1NRPH 1XM1A 3Q00A 1ELFA 2ZDKA 3P8OA 4Y8YA 1FAXA 1EX3A 1HDTH 1P3EA 2KCAA 4KKDA 4U30A 3ELAH 2SGFE 1QIXB 2ZDNA 1IQGA 3FKSD 1YPHC 2D1JA 1G9IE 3U28C 4F48B 1THSH 2B9LA 1TA6A 1HJ8A 1S83A 2UWPA 3QZRA 3UPEA 4CRDA 1OX1A 2GP9B 1PQ8A 5HGGA 4JZDH 4UDWH 1LQDB 1O3IA 1UVSH 1CU1A 3EGKH 3UQOA 1TMTH 1C5UA 1BBRH 3JZ1B 2QGRA 2BLOA 1MZAA 4DGJA 2V35A 1C2HA 7KMEH 3KQ5A 1O5EH 3AAVA 1K1NA 1Z8JB 3LDXH 3PYHA 5DP3A 3RXTA 3BG4B 2O8UA 5DP7A 4BNRA 1C5MD 2QXGA 1Y3UA 1D9IA 2QF5A 1EATA 2CV3A 1AZ8A 4OS2A 1PQ5A 1O2GH 1SGCA 1SGRE 3GY8A 4THNH 4DY7B 3BSQA 5DKMA 2BD7A 1KLIH 4CH2B 1H8DH 4GLYA 1EASA 5HIYA 1TNKA 4Z0KA 3SYJA 2FOGA 2Z9GA 4X1PU 3QK1A 5JPMH 2QN5T 3SGBE 1H1BA 4IN1A 2Y7XA 1QL9A 1QHRB 3RXJA 4XDEA 5TCAA 1QGFA 4YOJA 2F91A 3PV5A 1A5IA 4O3UA 2ZDAH 1GI2A 2JH5D 2PR3A 4X2WA 4NSYA 2EI6A 1LTOA 1P2OA 2WINI 3OEHD 4ABGA 3MU1A 2SNWA 2Y7ZA 5K7RA 3MHWU 2ZHDA 2FOBA 1UW7A 1AN1E 2C8WB 1GBAA 4TT3D 1O32A 1TALA 1N6XA 1CQQA 1Y3VA 4A92A 1WOFA 2WYJA 2J98B 3A7XA 4X2VA 2I6SA 3SW2B 2BD8A 4AG1A 1MD7A 2VWOA 3NUMA 1IQLA 2Z7FE 4Q63A 3KNXA 3SUDA 4JK6A 4NWKA 3RXEA 4ABBA 2ZNKH 3A80A 3RUOA 2PW8H 2H1UA 1HB0B 1ANCA 1YBWA 2OLGA 3BTME 3GY6A 1YPJH 3SU1A 1GDUA 3F6UH 2H5CA 3RXRA 4FUBA 2AS9A 5C1YA 3URCA 2WUBA 1SQAA 3UOUA 4ASHA 4I8JA 3SI3H 1C4U2 1O2OA 1O30A 3F9GA 1EP5A 1LHFH 3PTBA 4JYUH 2FOAA 1AI8H 2TGTA 2BVRH 2ZA5A 1O2ZA 2FIRH 4R8TB 4X6OA 2GJGA 1DLEA 4X8VH 3UIRA 3F2FA 4DJZB 1JRTA 2UWLA 3I78A 1DXPA 1G3DA 3SGAE 1O3CA 2BD2A 1THPB 3R0FA 3DT0H 4JMYA 2EI7A 1WAYB 1AVWA 1KXFA 1NO9H 1P2KA 1D6RA 3FZDA 2RCEA 2W6JD 1QNJA 1GGDC 3A89A 5FCKA 1YLDA 1ZHMA 2FI4E 2OC0A 3BN9A 1BTUA 1QL7A 1P06A 4ABDA 2ZU2A 2A2XH 1F2SE 1NN6A 3A7YA 5I46H 1NC6A 3F9HA 3S9BA 4BAQB 3EQ0H 2QXIA 1O2UA 3SI4H 3TH3H 1GI6A 1OP0A 3RXDA 4DT4A 3BTGE 1GJ4H 1QRZA 1WYKA 1QQ4A 2M5TA 1GDNA 2C90B 3ZYEA 3RXPA 1TRMA 3MO9A 2AH4X 1IQIA 1COWD 2UWOA 1CA0B 4I33A 1GHXH 3CP7A 1RTLA 2W3IA 4YLUA 1HAGE 3SQEE 2P8OB 3P17H 2FZZA 1BRCE 3Q3YA 1WV7H 2GCHG 4FETA 1O0DH 3P8FA 2B8OH 2PKSB 4X6NA 3ZVDA 1MQ5A 5A2MH 4Y0YE 3M3SA 2Q6GA 3RMOH 1PPCE 1C1NA 1OHHD 3RXBA 4BOHA 2Z9JA 2R9PA 2ZPQA 5L6NH 1NBME 2A4GA 1HGTH 2ZGBH 1DT2A 1C5NH 1DDJA 4Y8XA 1O2QA 1C5XB 2BX3A 3QO6A 2AEIH 1XUFA 3F1SB 1EAIA 1HBTH 3U8TH 2XWBI 1QJ6B 1ESAA 1FY5A 1P0SH 3SU2A 1P11E 2Y5GA 4ZXYH 5JBTA 3OY5U 4M9FA 4YLQH 1D4PB 1MCVA 3SUFA 1K28D 4JK5A 5FHTA 1G3BA 1CHOF 1W8BH 1AD8H 3A7TA 3LGTA 3VB3A 1MU6B 1NFYA 3A7VA 1GBHA 3L33A 1UVOA 1DSUA 3TGJE 2J34A 2VVUA 6CHAC 4I32A 2HRVA 3HKJB 4DIIH 1C1VH 5E0JA 1UK3A 1S6LA 1MABB 1OP8A 5BPEA 1O31A 2BY5X 1EPTB 5FPSA 4ABAA 3JZ2B 4BAOB 5TCCA 5GNDA 5CE1A 1CT2E 1GHWH 1MBQA 1AUTC 1F5RA 1O2XA 1MTNB 2PUXB 2QIQA 2J4IA 2BHGA 2J2UA 1O2IA 3UY9A 1GMHF 2BY9X 1ETSH 1TRYA 4MG3A 1FY8E 4IMQA 4Y71A 1QCPA 1FMGA 2J9NA 3BEIB 3MI4A 1QURH 2OD3B 2UUYA 1FN8A 2VGCB 3OX7U 1YPLH 3SNBA 2R3YA 5KECA 1T8MA 1ELGA 5HM9A 3Q3XA 3SNDA 5IK2D 5T6GA 2BVSH 3KEEA 2A7JA 4IMZA 1EZSC 2QAAA 4K3JA 2GCTB 1BHXB 2DE8A 1C1RA 1C1MA 2XBYA 3S0NA 2GTBA 4INHA 5EJLA 3TJUA 5E0HA 2OTVA 3IG6B 1P2NA 3KYFA 1ZOMA 3RC4A 2LP6A 3LOXA 3RDZA 3DD2H 4TY6A 3C1KA 3MNCA 1YPKH 2FMJA 2ZP0H 1HIAB 1P09A 1TGCA 3A86A 2CXVA 1A1RA 1OXGA 1EB2A 1SVPA 2B7DH 4BAHB 3M36A 3AK5A 1F92A 4ISOA 3F68H 7GCHG 1OP2A 4GPGA 3BIUH 4WMFA 1O3NA 2A4QA 3GDVA 3RC6A 2KCOA 2W5EA 1ETRH 3SOSA 5C1XA 4H42U 4WVPE 1W10U 3SUGA 1UVTH 1DWDH 2AFQB 4I8GA 3NK8A 2QF4A 4P02A 1EAWA 1E34B 1LPGB 3B9FH 3EYDA 2XCNA 4NA8A 2ZQ2A 2V3HH 1V2NT 2P3TB 2LNCA 1FPCH 2ZCKP 4TPYA 4TSFD 1J15A 1Y3WA 2YMSD 2OC8A 1QRWA 1XUJA 1AKSA 3MU4A 1AVGH 1DUAA 3D23A 1ANBA 1P2IA 3QGNB 4YT7H 1VZQH 9LPRA 5HM2A 3BTEE 1SQRA 1K2I1 1DY9A 2O8TA 3DSGA 1C9PA 5GJ4B 1SGNE 2ANMH 3BIVH 1EFRD 1MKWH 1GBLA 1THRH 2PP6A 3RLWH 3MO3A 3D62A 4NA9H 1L0ZA 1GJAB 4X1SU 4JZIA 1TBQH 3A85A 3BTDE 4M7GA 4LXBH 1BDAA 4FU8A 1D3TB 4NG9H 4U32A 2CMYA 1BTHH 4X6MA 1EP6A 1H9HE 2JJ2D 2VU8E 3ATWA 3AAUA 1QBNA 2XCFA 2WV4A 3LH1A 3ZV9A 1O35A 1ELTA 1DXWA 5EXNA 3FANA 1C9TA 1HAZB 1FX0B 2C8ZB 3U1JB 1GMCG 1MAXA 2R0LA 1MKXK 1YM0A 1DICA 1A7SA 2J97A 1PPFE 1FV9A 1L1JA 1CA0C 3BG8A 2J92A 1AU8A 4NIXA 5FPTA 2NU0E 3ENSB 3RU4D 3K9XB 4NIWA 1TB6H 3SZNA 4RSPA 1O3HA 1MH0A 2OK5A 1C4Y2 3AVZA 5E2PA 8LPRA 2PKSC 2P3FH 2VH0A 5JBCS 1SHHB 1YCPM 3E91A 2Y5HA 3D49H 1GVLA 1E79D 4AX9H 4F55A 1AZZA 2A4OA 2R3UA 1YLNA 1LVYA 1ZJKA 1EAXA 3MYWA 1KXAA 1AE8H 1XVMA 4RT1A 1ZRBA 4E7RG 4OS4A 3RM0H 1GHBG 1GJDB 8ESTE 3DHKH 2ZTZA 4HZHA 2GT7A 2XRCA 2PSYA 2Z3EA 3GY7A 4HGCA 3LGVA 1SQTA 3FP6E 1LMWB 1PPBH 4GSOA 3URDA 4FUHA 4JYTA 2ZFRH 1SGYE 1SGEE 5FCRA 2CF8H 2PTNA 1YP9A 4NA7A 2P93A 2G52A 3PLBA 1J14A 1UHBB 3M5OA 2JDID 1C1QA 1ZMNA 3O8DA 1A0JA 4E06H 5F03A 1VJAU 3PV4A 2W26A 4KGAA 2J38A 2B0FA 3STJA 1E1QD 4WMDA 3A7WA 3D65E 1NFXA 1NY22 4ABJA 1D3DB 1A61H 4UEHH 1C1UH 4AG2A 5ESBA 2FXRA 2J95A 5C1UA 5LGOA 4Q7ZA 1A3EH 1EPTC 7ESTE 4FVDA 2QF0A 4AZ2B 2ZHEH 2BDBA 3O8BA 4MPXA 1DY8A 1MTNC 1TFXA 3RXUA 1V2ST 3LGWA 4PROA 4AYVB 4NGAH 4WXVA 4IN2A 3NXPA 4Q2KA 2Z9KA 1DUEA 4H6TA 4AC9A 2PSXA 1K1IA 1G3EA 3OYPA 1KDQB 1VCQA 2VGCC 1G37A 5GCHG 1BT7A 2A5IA 1AMHA 2PFEA 3RC5A 4B2BA 4ZH8A 4HTCH 3UNQA 1DX5M 5C67A 2BD3A 1WDIA 3A88A 4IW4E 3SNEA 5G4BA 3SORA 4Q7YA 5K0HA 4TWWA 4RI0A 1A0HB 2KCYA 2AGIX 3ZZBA 2BYAX 1RIWB 3SU5A 1TWXB 1ELVA 1C5RA 5JB9S 3RXAA 1GI4A 3T28A 1GGDB 1HJ9A 1MTVA 1NU9A 1UCYE 3QTOH 1E36B 1J17T 3IWMA 2PGBB 2GX4A 1NESE 1RD3B 3S9CA 4Y0ZE 1B0FA 2UUKB 3DUXH 1KXCA 4OS1A 3RXGA 2BDGA 2A5AA 1HLTH 3UB0A 4AB8A 1FN6A 2UUFB 2BQ6B 2PHBA 1SKYE 1MCTA 5A8YA 1MZDA 1RGQA 3NWUA 2FPZA 1HRTH 3M5LA 1TGBA 1G3CA 4DT7B 1VITF 1W13U 5EJ1A 1QL8A 5AHGH 2CK3D 3HATH 2ZU5A 4DIHH 4X1NU 4WY3A 1L4ZA 3K6YA 1EZQA 1GHYH 2JETB 4XBBA 2IN2A 4MVNA 2A7CA 1LHGH 4AFQA 3O8CA 4ABHA 1NFUA 3M7TA 5B6OA 4GHQA 1BB0B 1CT4E 3SZEA 2GV6A 3RMNH 3P92A 5EGMA 2ESTE 1S82A 3KHVA 2PKAB 4UD9H 1G30B 1SLWB 2ALVA 1ZMLA 2ZTXA 5CDFE 2ZEBA 4CBOA 1ZPCA 2FX6A 1C1SA 3KIDU 5F8TA 1VKYA 1L2EA 1P01A 1XKAC 4GHTA 1CGIE 1O2RA 1NM6A 1GCTB 2HGTH 3EA8A 1QFKH 1UMAH 1Y3YA 4Y7AA 4FOUC 1TGNA 3MH5A 1K9OE 1C2JA 1PJPA 4OS5A 3TITA 1V2VT 2ZGJA 4ZKRU 5GPIB 2XWAA 1JBUH 4LZ1H 4SGBE 2O9QA 2IOTA 2ZGXH 5EXMA 3M7UA 1J9CH 2FLBH 1TOMH 4TY7A 3A8CA 4DG4A 1KSNA 2JKHA 2H2ZA 1O5GH 2IJOB 3H7OA 5JBBS 1O3LA 3OY6U 4FUDA 1OPHB 3PWCA 2PWXA 3QDZB 5F8ZA 3KYGA 3T26A 2Y80A 6CHAB 1ORFA 1T32A 4D7FA 1AO5A 1JRSA 1QRXA 1H8IH 2EQNA 2ULLA 2VJ1A 2FLRH 5J4QA 2XYAA 2XBXA 2FYRA 4NZQA 1O3BA 1FY3A 2D2DA 2SGQE 2BLQA 2HLCA 4NWLA 2VWNA 2AIPA 1DOJA 1SLVB 1DPOA 1EJNA 2EY4C 5DP8A 2ANWA 2A45B 1AUJA 2ODQA 4B71A 1GWAA 1Z6EA 3BTKE 3VG8A 4NFEA 2Z94A 1BMLA 1AHTH 5DJ7A 2H9HA 1W2KH 1S6FA 3F2GA 1QA7A 1GG6B 1W3CA 1KMHB 1EJAA 2ZC9H 4B6EA 4FU9A 2DUCA 1L4DA 3KQBA 1GBBA 2BQ7B 2A31A 3HPTB 2F9OA 3P8NA 2BXUH 2FX4A 2KR7A 2QCYA 2VIVA 1UK2A 4U2WA 1ZLRA 5PTPA 2BD9A 4ISLA 1JXPA 3TNTA 2ZHQH 1BTZA 3ESTA 4O97A 3M61U 1A3BH 3ZZDA 1YPGH 2G4TA 1O2KA 4IGDA 1GJCB 2QC2A 2AMQA 3GCTF 4ABEA 1LVBA 1V2KT 2BMGB 3RXCA 2OQ5A 2HVXA 1NPMA 4HI3A 5BRRE 5JYIA 2W6ID 4K2YA 4K8BA 1ABIH 4HFPB 2ZU1A 1P2MA 1DVAH 2PV9B 1UJ1A 4AGJA 1LKBA 1SGQE 6LPRA 1QBVH 5DGJA 1WQSA 1BJUA 1M9UA 3ZIAD 2A4RA 3DFLA 3RXHA 3P8GA 3HGPA 3RXOA 2QV1A 2RDEA 4K1SA 1P03A 2BVXH 5DN6D 4I31A 3HK3B 7LPRA 2A5KA 1QB1A 1O5BB 1OWJA 1TNHA 2FI3E 1SPJA 2V6NA 1UVPA 4ZKSU 1SGFG 3TJOA 4Y76A 5LPFA 1WXRA 2VBCA 2BY8X 1L1GA 1EPTA 1IQHA 3TPIZ 2ZFSA 1GHAF 4FUEA 1BCUH 4ABIA 3PB1E 2VIWA 1E35B 2ZECA 1W7XH 3TK5A
chains in the Genus database with same CATH topology
1BBRE 1N1LA 1YYY1 4KTCA 2UUJB 1ELCA 1RIWC 5JDUB 4K60A 3RXSA 3V13A 1O2PA 3RXLA 4E7NA 4MPUA 2HWLB 4MQAA 1AE5A 1H9LB 1HAPH 2PLXA 4AFZA 1FIZA 5L30H 2ZDLA 3FP7E 5ETXA 2XBWA 3TH2H 5ESTE 2SFAA 3M3TA 2FS8A 2DE9A 1BA8B 1CT0E 1SL3A 1Y59T 1JIMA 3P6ZB 2HNTF 2Y6TA 1SR5C 2HNTE 2VIOA 1HXEH 1TONA 5HMAA 1HIAA 2JETC 1ID5H 1MAYA 1O3JA 4LZ4B 1O34A 4CBNA 4X2XA 3RU4E 3SJ8A 4X2YA 1UTOA 1YPMH 3KQCA 4JZEH 3MH4A 3TGIE 2P94A 3LU9B 5E2OA 1NRRH 3ZV8A 2Y5FA 3MO6A 5HXFA 4UE7H 1WTHD 4UFGH 1GI0A 2R0KA 1MKXH 1ZTLA 1F0RA 3OTJE 1TA2A 1FDPA 5J4SA 1ZSKA 4K69A 4BTIB 1FY1A 1YC0A 2F9BH 5C5OA 1S0QA 1GCTC 2BQWB 4UFDH 3VPKA 1ELDE 1C5OH 3M7QA 2HALA 3RXFA 3PO1B 1CA8B 3BEUA 1HUTH 1P12E 2YOLA 1SBWA 2ZF0H 1UO6A 4KELA 3LC5A 2WPHS 2XNIA 4WXIA 1QY6A 3KQEA 1SI5H 1KXDA 3IITA 3SJ9A 3M5MA 3GCHB 3PMBB 1IQKA 3ATIA 1CHOG 4BANB 1QJ1B 2FOMB 4MNWA 2ZCLP 3LGIA 3GDUA 1K1PA 2WV5A 1E0FD 2FDAA 2VVVA 1F0SA 2YNBA 3L6PA 1HAIH 1C1TA 1OYQA 3GY2A 3TNSA 2HPPH 2Y82A 4RKJB 3RXMA 1C5SA 1V2JT 3MH7A 5AF9H 1GJ8B 4E05H 1C1PA 2BM2A 2VIDA 2BY6X 3Q76A 2H9EH 4DW2U 1ZRKA 3U1IB 1GL0E 4D8NA 4KTUA 4MNXA 1GMHG 2RA0A 1GI3A 1JIRA 2ZHWH 3SNCA 5DP5A 1HAVB 4JZFH 2Z3DA 2FOHA 3E1XB 5E0GA 1O2HA 1Y3XA 4AN7A 3TK9A 1MQ6A 1EZUC 4B73A 1GG6C 5CHAB 3NCLA 3W94A 3QUMP 3LJJA 3H5CB 4NSVA 2O8WA 1GHZA 1U6QA 1P04A 2NU1E 4WMEA 3A7ZA 5LPEA 1C2MA 3GCNA 2EEKA 4DVAU 2ZHFH 5DO4H 1LKAA 3GICB 3LONA 4VGCB 4ZHLU 3DA9B 2I6QA 3BTHE 1BMAA 5H4IB 1GJBB 2G4UA 2QA9E 4YESB 1EOJA 1TX6A 5T3HA 1O3MA 4KTSA 1GBDA 1O5CB 2NU2E 1FLEE 1C2FA 1ZZZA 1D3QB 2OQUA 4CRBA 3MMGA 3F9EA 5JBAS 2YNAA 3SBKA 4AORA 9ESTA 1UHBA 2OUAA 4I8LA 1GJ7B 4CHAB 1MTWA 3ATLA 1SGFA 1EKBB 4B1TA 5TJXA 2VIPA 5I25A 1CBWB 3EA9A 1ZPZA 3SJIA 1AVXA 1FZZA 2GDDA 1SSXA 3ITIA 1C2IA 1V2LT 2BDIA 1SG8B 1BJVA 1ABJH 1Z8GA 3BEFB 1V6DA 5EW2H 4A1XA 1NROH 2TRMA 2KAIB 1JOUB 1D6WA 1SFIA 4K8YA 1NFWA 3TLOA 5EQRA 2BTCE 2FOEA 3UR9A 1WBGB 3LC3A 1WU1A 2BLWA 2ANKH 4CR9A 5A8ZA 2ILNA 8KME2 1TPOA 1XKBC 2FI5E 4ISNA 4B2CA 3EE0B 1GBEA 2TGPZ 5GXPA 3MH6A 2ZI2H 1SGDE 1LO6A 3UREA 3K6ZA 1YGCH 1C5LH 1XX9A 5FBIA 4INLA 1HYLA 1UTPA 4INKA 1ESBA 3TJNA 1GBFA 4YOGA 2AMPA 1VR1H 1TX7A 1OWIA 3ZVAA 2EC9H 4ZAEA 1TNGA 3ZYDA 5AVDA 5C3NA 1YCPK 3Q3KA 1GBTA 1ZR0A 5FAHA 1ELEE 1CVWH 3VB5A 1HPGA 1INCA 1Q2WA 5EPNA 2VWLA 1LCYA 1RXPA 1Y5UT 2ZPSA 4ZROA 4D9QA 4XBDA 1K1MA 4A6LA 3L3TA 1A5HA 1RRKA 4A5TS 1C1OA 1XUGA 1ZHRA 2C8YB 4FUFA 2FO9A 3K65B 5EQSA 1ETTH 2GDEH 1P57B 1RJXB 4O03A 3EA7A 2G5NA 1BOQA 1AB9C 1L1NA 2P16A 1F7ZA 3LJOA 1O2WA 1AY6H 3PO1C 3FAOA 4GCHF 4X6PA 1HFDA 4CREA 3GISB 2XC0A 1C5ZB 1T4VH 2BY7X 2GZ7A 1TX8A 4B76A 1OYTH 1PYTD 5F8XA 1GI7B 3I29A 3GCHC 2GT8A 1O3FA 2BZ6H 2ZDMA 1G2LA 1GVZA 1LHCH 1G2MA 4MPWA 1O2TA 2Y81A 1WTGH 3GDSA 8GCHF 2FM2A 1C5QA 1VCPA 3U69H 2G55A 2FS9A 2ZGHA 3M37A 4SGAE 3U98H 5L2YH 3UWJH 3T25A 3LT3A 4NCYA 1ZSJA 3PROA 2CHAB 1CSOE 3ZVBA 5IDKA 1GI9B 1BMNH 3E0PB 3RMLH 1PFXC 1TAWA 1VJ9U 1X7AC 2XXLA 3S7HB 1C5YB 5T6FA 1S0RA 1V3XA 4U01A 1VGCC 3RXKA 5EODA 4WJG2 1XXFA 3M35A 4O9VA 3SO3A 2JH0D 5ABWA 2GZ8A 1TMBH 1SGPE 1XUIA 5CHAC 4RN6A 1O3EA 2G00A 1TMUH 2ZKSA 1AGJA 1SLUB 1O3AA 5C5NA 3VFEA 1UTJA 3U8OH 1YLCA 4AB9A 1C2KA 3ZZ4A 1O5AB 3A8DA 1QR3E 5E8EH 3V7TA 2A0QB 1O39A 5T6DA 1SB1H 4O3TA 3E6PH 1FJSA 4VGCC 1IHSH 3V12A 3SV9A 2CN0H 4JZ1A 3SQHE 5LPRA 3SV2H 2THFB 3NPSA 4FUJA 1P8VC 1E37B 1FNIA 4NFFA 1K22H 4TYDA 4UONA 1RTKA 2V3OH 2WPKS 3TU7H 4ZXXH 1BUIA 1N8OB 1IQJA 1NU7B 4ESTE 1UTQA 1O3PB 1VITG 2PGQB 1ARCA 4FUGA 4CHAC 4ZKNU 2FEQH 1FY4A 2ZCHP 3LGUA 4WH6A 4K1EA 1CBWC 2WPMS 2GMTC 2P95A 1IAUA 2R2MB 2XBVA 2G5VA 1HAHH 3GY5A 1K1OA 4Y7BA 2AMDA 2OBQA 3A83A 1SGIB 1C2EA 3KF2A 4OS6A 1GMDF 6GCHF 4Q7XA 3PM3A 2VINA 3SN8A 3UQVA 2A32A 2B5TB 3MU5A 3MU8A 1O33A 1QB9A 3B23B 3UWIA 3LPRA 1UTMA 4IC6A 6ESTA 2WPIS 2SNVA 3MNBA 1KXEA 4X1QU 1SOZA 1ZTKA 1CE5A 1UTNA 2Q6DA 1O5DH 4I8KA 4GUXA 4BAMB 1WUNH 1FIWA 1QJ7B 1DWBH 1DITH 2PUQH 1RFNA 2P3UB 1SMFE 2NU4E 1Z7KA 5FBEA 2XC4A 1ZYOA 2C3SA 3ZVCA 1TPAE 2WPLS 2OC7A 1UCYK 2HOBA 4H4FA 1CGJE 1FQ3A 3MU0A 2D8WA 5A8XA 2ZZUH 3KL6A 2BX4A 2VB0A 2EI8A 2VH6A 1KIGH 2FODA 1B5GH 3ZZAA 3H7TA 3TH4H 4F49A 1P05A 1LDTT 1TBRH 1OOKB 1PPEE 2GGVB 2OBOA 3OSYA 3T2NA 3KCGH 1ANEA 1GI1A 1Q3XA 2O8MA 1Z1JA 1P9UA 3GCOA 3PMHB 3ZZ3A 2RA3A 3E8LA 2OXSA 1QTFA 1Z1IA 4IC5A 2H5DA 2FESH 5EQQA 1YPHE 4UFFH 1YF4A 2BOHB 2J94A 3VEQB 4TWYA 3SU0A 3UFAA 3VXFH 1S85A 2VWMA 3MNXA 3RXIA 3BV9B 2K1QA 2QXHA 2IPHA 1YKTA 1FONA 1OKXA 5DK1A 4XBCA 1S5SA 2TGDA 4UFEH 4K1TA 2BDYA 4GAWA 4OGXA 4RKOB 3FP8E 1W11U 4YOIA 1W0YH 4MDSA 4WH8A 3EAJA 1TQ0B 5GIBA 4A1TA 1TPPA 3RMMH 1V2PT 1N6YA 1T4UH 1GI8B 1P3CA 1JWTA 3UNSA 1P2QA 3BTFE 3GCTG 1IQMA 3M5NA 5GWZA 3W95A 1KLJH 3Q77A 3MOCA 1CHGA 4NIVA 1DWEH 4DOQA 1BTXA 1DM4B 1C1WH 1SFQB 1UVUH 1GL1A 3LH3A 1HAXB 1MTUA 2AGEX 3U8RH 1EXFA 1W14U 1O3OA 2RDLA 2CHAC 1HJAB 2BD5A 4BAKB 3TGKE 1GJ9B 1TQ7B 1OWDA 2QXJA 1EB1H 1Z6JH 4D76A 3OU0A 1HXFH 2ZU4A 1GPZA 3ZZCA 3A8AA 2ZO3H 2FOFA 1TNJA 2Z9IA 5DP9A 1TOCB 3BTTE 1A0LA 1FXYA 3SV6A 4YZUA 3QLPH 1GHAG 1TIOA 2FOCA 1ANDA 3QGJA 3QX5H 1T8LA 2HNTC 3WY8A 1LHDH 1AFQC 1G32B 4CRCA 2AYWA 2ZGCA 3O8RA 1WCZA 2TIOA 3SJKA 3BTWE 1HAVA 2GV7A 2CJIA 1LQEA 1FAKH 4LK4A 2TPIZ 5DPAA 2GKVE 1O2VA 1SGTA 4Y79A 2ANYA 3FFGA 3DFJA 5EG4A 3RLYH 2SGAA 1TNIA 1K1JA 1O3KA 2V0BA 3LGYA 1GBJA 2H6MA 5F6MA 1D3PB 1CO7E 3VGCB 3E16B 4CH8B 1N8OC 1ELAA 1QA0A 1O3GA 1Y5AT 1BRAA 4B2AA 1DS2E 3PTNA 1O2NA 1HNEE 4ZUHA 3E90B 3SU4A 3GY4A 1KY9A 5IYTA 2WUCA 4FUIA 1NTPA 3RXQA 1H4WA 3ZVGA 2BXTH 2Q1JA 1SC8U 1PYTC 1BZXE 1SHYA 1O2LA 3V3MA 2AERH 2H9TH 2PTCE 1NT1A 4FUCA 2NU3E 1GI5A 2SGEE 3PLKA 1S6HA 3FZZA 1FUJA 1YCPH 2ZG0H 1FI8A 2GVFA 5FPYA 2FTMA 2BOKA 1IQNA 1AB9B 1PQAA 4BXSA 2SGPE 2F9UA 1FPHH 1ZGVA 2VVCA 5GDSH 3A84A 1JMOH 1A5GH 1WQVH 5DP4A 4WWYA 1T8OA 3RXVA 1IQEA 1W0ZU 5A09A 4FVBA 2Z9LA 3HK6B 1ZSLA 1BBRK 1UK4A 2ZDVH 3KGPA 1AWFH 1Y8TA 4YM9A 2GCHF 2QY0B 3N7OA 1BTYA 2FP7B 2KAIA 4Q80A 3CENA 2ALPA 1KXBA 3E0NB 3M3VA 3KN2A 3SUEA 1EUFA 1GBMA 4AGKA 3F9FA 1WSSH 2F9VA 1SQOA 3RP2A 2ZTYA 3A87A 1ESTA 2FTLE 3UUZA 4LOYH 2XW9A 1XUHA 3P70B 4CRGA 1GBCA 5A0AE 1HV7A 1GCDA 4KP0A 1BMMH 3T29A 1T31A 2A2QH 3BG4C 1C5WB 2HPQH 1NS3A 2FYQA 4ABFA 5A0CA 2AIQA 2WYGA 2STBE 1MU8B 4Y11E 1LPZB 1MMJN 1TYNA 3EDXB 4OS7A 5AFYH 3PMJA 3ZVEA 1K21H 1EOLA 1KLTA 3S7KB 4J2YB 1VGCB 4Y10E 1PPZA 1UTKA 2Z3CA 2W7UA 4X8TH 3RU4T 5A0BA 3VB7A 4F4OC 4H6SB 2ZFTA 1IOEA 3A81A 2W7SA 5C20A 1V2UT 1J8AA 1SOTA 3AW1A 3VB6A 1ZHPA 4MTBA 5SGAE 3ODDA 3ODFA 2XC5A 4AYYB 1P2JA 2BDCA 3MFJA 1C5VA 3T5FH 3PLPA 1OWEA 3GY3A 4MNVA 1V2OT 2RG3A 1TGSZ 1XMNB 2BB4A 4J1YA 4JCNA 4X8SH 1LVOA 1BRUP 3V0XA 4X8UH 2ODPA 3A8BA 2VNTA 2ZQ1A 3MNSA 4JYVH 4A1VA 1C5TA 3SNAA 1CGHA 1HJAC 2ZFPH 1Y5BT 1S81A 1PPHE 3CS7A 1BTPA 1LPKB 3S69A 4QT8C 1GJ6A 1BIOA 2EA3A 2CGAA 2QF3A 4BTUB 3NKKA 4MPVA 2GMTB 1O38A 5EPYA 1EQ9A 4D7GA 1PPGE 3HGNA 2CF9H 2QYIA 1W7GH 3TVJB 3QN7A 3ZZ9A 3GYMA 1DSTA 2ZFQH 3CS0A 7GCHF 2OINA 2ZIQH 4Y6DA 4B74A 1NRNH 1TE0A 2BZAA 1Q31A 4ZMAH 2F3CE 1V2TT 1IQFA 2A1DB 3K2UA 1BITA 1TGTA 2Z6BD 1ACBE 1DLKB 5EXLA 2F9NA 1KDQA 1Z8RA 3QZQA 3QWCH 1UTLM 2GZ9A 1O3DA 2XTTB 1O36A 3U9AH 3UR6A 1BTWA 1HAOH 1ZJDA 3UOPA 1DFPA 4XOJA 1MTSA 1QBOA 1A46H 3VGCC 4MNYA 5CMXH 3LIWA 2BDHA 3VB4A 1AWHB 4I8HA 2WPJS 3R3GB 3UTUH 1C2DA 2G81E 1W12U 1MBMA 3QTVH 1F5LA 2G51A 3SGQE 1C2GA 1OWHA 1ZPBA 1O2YA 3SHAH 3SJOA 1DE7H 4BXWA 2G8TA 1V2QT 2FWWA 4A7IB 1C4V2 1PQ7A 1P10A 1TBZH 1UCYH 1AQ7A 1KTSB 1TABE 2BDAA 3STIA 1AFEH 1GMCF 1XVOA 2D26C 4AOQA 5DG6A 3MWIU 2F9PA 4WF8A 1NRQH 1LHEH 2ZFFH 4YTAA 3SU6A 2BLVA 3GOVB 2C4FH 3SV8A 1B7XB 2STAE 2P8OC 4ZHAA 5EOKA 1A4WH 4Y8ZA 4GCHG 1MUEB 4ZHMU 1VITH 1B0EA 3TK6A 3ZVFA 3VXEH 3RM2H 1O2SA 1OWKA 2Q6FA 5HYOA 3MTYA 2OCVB 1C2LA 1SLXB 2OC1A 4AFUA 2ZPRA 3TJVA 4CRFA 2PKAA 2ZWLH 4NIYA 1MD8A 2C93B 2VIQA 3FVFB 4I7YH 2NWNA 1A2CH 1HCGA 4OGYA 8GCHG 1EJMA 3SU3A 4K5ZA 4CR5A 4YT6H 3GYLB 2GD4B 1VCWA 1GVKB 3T27A 1Z71A 1GHBF 1T8NA 1TRNA 1TNLA 1TPSA 1G36A 1O2JA 1LVMA 3PMAB 3T62A 3BF6H 1XUKA 1RS0A 2LPRA 3C27B 3A82A 1BQYA 1YPEH 3LKWA 4TPIZ 4AFSA