3L3TA

Human mesotrypsin complexed with amyloid precursor protein inhibitor variant (appir15k)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRSS3 protein
publication title Determinants of affinity and proteolytic stability in interactions of Kunitz family protease inhibitors with mesotrypsin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/cell adhesion
total genus 55
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3l3tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3l3tA02
1JIMA 1AN1E 2SGEE 3MWIU 3EQ0H 2XC0A 4K69A 3SN8A 1Y59T 2J9NA 4IW4E 2H2ZA 5C1XA 1DWBH 2ZU2A 5IDKA 1EAIA 1HV7A 1ARCA 2BZAA 3U1IB 2D26C 2BTCE 2JKHA 3ITIA 1DDJA 5C3NA 1SGQE 3LGWA 4HZHA 2GZ7A 1O3OA 2BQ6B 5GWZA 3A8CA 3A81A 5DO4H 4DIHH 2XNIA 4NSYA 4ABAA 7LPRA 2GCTB 2BD4A 2WYJA 3U9AH 1UK4A 3AASA 4O97A 3GYMA 1GJAB 1ANBA 1BTXA 1TBQH 4JCNA 3T28A 8GCHF 1GHYH 1LKAA 1ORFA 1C9PA 2QXHA 3SU5A 1TB6H 3VGCB 1EX3A 3NUMA 5E8EH 6ESTA 1QB9A 4U2WA 2NU4E 3KL6A 4MPVA 1FY3A 2M5TA 2GCHG 3BG8A 1NESE 1DY9A 1A5IA 1MTUA 2ZTXA 1HIAB 2O8MA 1K1NA 4YLUA 4WH8A 4D7GA 1H4WA 4UFGH 4ZXYH 4DURA 1QR3E 1P06A 4BXWA 1TGCA 2Z9JA 3HKIB 5DP6A 2AMDA 1GL0E 1O5AB 4Q7ZA 3QX5H 3RXEA 2ZGJA 3E6PH 7GCHG 2WPIS 1GVLA 3D65E 1DWCH 2CN0H 1O3CA 4Y79A 1EPTA 1HFDA 5DK1A 4X6MA 4CRAA 1Y8TA 2ZU3A 2SGFE 4UEHH 3SV6A 5AFYH 1ZPBA 1BT7A 4R0IA 4A1TA 3DD2H 1YPHC 2WPMS 1SGPE 4KKDA 1S82A 1T8NA 4VGCC 2Y7XA 4JZEH 1ESTA 4UE7H 1F92A 3GOVB 3AVZA 1BHXB 2EEKA 4BTTB 5PTPA 4XBDA 3TNTA 5LPRA 1K1LA 1S0QA 5JBCS 1ZRKA 3UNQA 1C5LH 3UQVA 1SBWA 1FONA 1YCPM 1LVBA 1UTLM 1EAWA 3BEUA 2BLOA 3ATMA 1D3QB 1MTSA 3OTJE 1DSTA 1ELAA 1GDQA 1VGCB 1GBKA 1AWFH 2P8OC 2UUFB 4JK5A 4WXIA 5DP9A 1O2YA 5HMAA 1K1IA 8KME2 3C1KA 4ZHAA 4ZKRU 3PMHB 3LJOA 3VXEH 1ZMJA 4JYUH 3F6UH 2H5CA 1BQYA 1LO6A 1A46H 4GSOA 1VJAU 2Y5FA 4ZHLU 1QRZA 2FEQH 2W7SA 4AGKA 1C2DA 3SV7A 1U6QA 3RXLA 5I46H 4ZKNU 1V2LT 3FAOA 2GDEH 1BRBE 2G4TA 1AO5A 3GICB 4X6NA 3A7YA 4WMDA 3M7QA 1C5RA 3U8TH 1CA8B 4MPWA 5FAHA 1G30B 1L4ZA 1UTPA 2ZF0H 5EPNA 2VIVA 1HAVA 2PHBA 4MNWA 4NWKA 2A2QH 1FNIA 4O03A 2Z3EA 3M35A 4MPXA 3U98H 1TFXA 2ILNA 2P95A 5F8XA 1AY6H 2YNBA 3RLWH 2QY0B 5LH8A 4AGJA 1ELVA 4WVPE 5DJ7A 5CMXH 2ZC9H 3KQDA 4Y0YE 2BHGA 3GY4A 2BXUH 2OBOA 4E7RG 2ZGHA 1P2OA 2GD4B 2F83A 4X1PU 4YOJA 1SLUB 1QRXA 3Q3KA 2HRVA 1DICA 5EOKA 2R9PA 3KEEA 1C9TA 5E2OA 1GJ6A 1SFIA 5FPSA 1OWHA 4MLFB 2ZDVH 3F9EA 3H7OA 4DJZB 5A0CA 1VZQH 2JH5D 3VB5A 2Y6TA 1QJ1B 1ABIH 1SGFA 2VVUA 3LJJA 1P2MA 4FU7A 1K1JA 3ZVGA 3TNSA 1IQNA 1MCVA 1RIWB 2HGTH 1C2LA 4B75A 2XWAA 1O2SA 2V0BA 4AYVB 2FWWA 2ODYB 4AORA 1CGIE 2H9EH 5C1YA 3SNBA 3RXGA 3SJKA 2FI4E 1UK2A 4KTCA 1C5OH 2R2WU 1JIRA 1EXFA 3QGNB 1CHGA 3ZYDA 1HLTH 1SOZA 4IS5A 1EPTB 3AW0A 4YO9A 2G00A 4XSKU 2W26A 3RMOH 1KXDA 1SGEE 3UPEA 3KQCA 1TNKA 4A6LA 4CRGA 1NFYA 3SU4A 3KQBA 3MH5A 3ZV9A 5FX5A 2BVSH 4OS6A 2BLQA 1QFKH 1O32A 1YGCH 5ABWA 1WV7H 2WYGA 2VIQA 4FUFA 3U8RH 1O3AA 2UUYA 1BJUA 1F5LA 1F2SE 4I31A 3ATLA 4D9QA 3ZZCA 2AS9A 1GG6B 1XX9A 2BY6X 2AIQA 4YTAA 1WBGB 1GJCB 1CHOF 4K2YA 3UREA 1S5SA 2HWLB 3PTBA 4BANB 5HGGA 3TPIZ 3I78A 4D9RA 5L2YH 3SUEA 4GHTA 2ALPA 1DSUA 2FESH 2ZHDA 3MH4A 3RXDA 1TBRH 3BTHE 1GL1A 1V2QT 3U69H 1GPZA 3VB7A 4A1VA 2Z94A 4XBBA 4Y7AA 1TPPA 1KXCA 2ZKSA 2BY7X 1GJ4H 3MNCA 4AFSA 1OWEA 1G37A 1B5GH 2DE9A 4K8YA 1GI5A 1BTPA 2UWOA 1JBUH 1K28D 2BD7A 5FPYA 4LOYH 1G9IE 2C8ZB 3TITA 2CV3A 1A2CH 1SGIB 1FY5A 2VGCC 3TH2H 1FAKH 1G3BA 3E91A 1DITH 1HAVB 1W7GH 2BD2A 3V3MA 1BBRE 1AFEH 1P2QA 1SVPA 1KDQA 3DFLA 3K6ZA 1A0HB 5C2ZA 5EGMA 4X8VH 1V2RT 3Q00A 1GBHA 1Z7KA 3FP6E 2BDGA 3M5NA 1C1WH 1P3CA 4D76A 1DUAA 3OY6U 2QF3A 1NFUA 1N1LA 4X2YA 1AZ8A 3KGPA 3SJ8A 4IN2A 4ABDA 2HNTC 4FUGA 3D49H 2CHAB 3O8RA 2EI8A 1GCTB 3KF2A 4K1SA 1AMHA 2BOHB 3BEFB 3GCOA 2J4IA 1GBCA 1DLEA 1ETSH 4X6PA 3BTGE 5LGOA 3EA7A 1TPOA 1UCYE 1ZJKA 1YPLH 4ABEA 5F8TA 5J4SA 1ZGVA 2BYAX 4CBOA 2I6SA 3A7WA 1GBFA 3RU4E 2FXRA 2A1DB 3EYDA 2STBE 2F9BH 1THPB 1FI8A 1O3MA 1W11U 2ZZUH 1YKTA 1CGJE 1QTFA 2GT8A 2V6NA 1KTSB 1YPKH 1DFPA 1O2GH 3FZZA 2FX6A 1E34B 2ZTYA 1O30A 1OP2A 1YPGH 1HBTH 4BAHB 4Q2KA 4I33A 4AN7A 1HGTH 1CA0C 1WSSH 2H1UA 1YP9A 3SUGA 2IN2A 1L1GA 1UVPA 3RXKA 3E0PB 1BBRH 1TQ0B 3BTEE 1IOEA 1DX5M 2FOBA 4FUHA 4B1TA 1TAWA 1TABE 1DPOA 1ELGA 1LHDH 3S7KB 4XBCA 5EG4A 3V7TA 2PKAA 3LU9B 1YM0A 1KXAA 1ELEE 3QN7A 1AHTH 4FUDA 2Z9LA 1FXYA 3F9HA 4ZROA 2Q6GA 1C2IA 4OS1A 4X1QU 1GI1A 3SHCH 2WV5A 2ZI2H 3RM2H 3VB6A 3BF6H 1ZHMA 4FU9A 3GISB 2HPPH 1QRWA 1P11E 4ISNA 1E35B 2A5IA 2HOBA 2IJOB 1ANCA 3DA9B 2B8OH 1UCYH 2BX4A 3F9GA 1G3DA 1OPHB 4DCDA 3UNSA 4ABFA 1HXEH 6CHAB 2G4UA 2OQ5A 2OINA 1CVWH 1V2WT 5GDSH 2Z6BD 3MTYA 1JOUB 3VGCC 5L30H 1NM6A 4GPGA 1K1OA 3RXRA 1BRAA 2THFB 3SQHE 3RXAA 2J92A 3BTKE 3BG4C 1ZR0A 2W5EA 3LGYA 5FHTA 4YOGA 4NA9H 2AMPA 1F0SA 2UUKB 1W3CA 3PMBB 1G3EA 1RTKA 1XUFA 2BDIA 1WTGH 1HUTH 1A3EH 5GCHF 3PO1C 1IQJA 4ABHA 2FOEA 5A2MH 3MI4A 3EA9A 1GBJA 1A5GH 2EI6A 4XE4A 4NA8A 1SMFE 1TNJA 1Q31A 1ZPCA 4B2CA 4GHQA 2FTLE 2FI3E 4B71A 2XWBI 2K1QA 3KHVA 3OU0A 1QIXB 2ZFTA 1QQUA 4AB8A 2PW8H 2GMTB 2J2UA 3NPSA 4AG2A 2ZHQH 3ZYEA 2NU0E 3ZZ7A 1T32A 2AGEX 1Z8JB 2PFEA 2VIWA 3ATKA 2FMJA 2JH0D 3MHWU 4FUJA 2KAIA 3P8NA 3Q77A 2ZG0H 3ZZDA 2AEIH 5A0AE 5JPMH 1MZAA 1PPGE 1P9SA 1ZSKA 2XXLA 1OX1A 1OP0A 1YCPH 1O33A 1GI3A 4CH8B 2BB4A 1GI7B 1K2I1 1C5VA 4UDWH 3ZVBA 1N8OC 1HCGA 3H5CB 2H9TH 3I77A 2O9QA 4XOJA 2DE8A 1LPKB 3T26A 1NFXA 4ZKSU 4FVBA 2HLCA 4MTBA 2P93A 3TK6A 3SU0A 1O2LA 4INHA 1VR1H 1ABJH 2VNTA 1IQFA 1ESAA 2A0QB 3SHAH 1SB1H 4I8GA 3VEQB 1LKBA 2Z3DA 3LC3A 1P57B 2QXGA 1MUEB 3RXIA 5I25A 4HTCH 1MQ6A 2SGQE 5FCRA 4A7IB 5K7RA 1KXEA 1E36B 1C1UH 3SNDA 2C4FH 2OC8A 4B74A 5BPEA 1NTPA 1IHSH 1O38A 3URCA 1ELTA 1P2IA 4E7NA 1AVXA 2G8TA 1PPBH 1XUKA 3M3SA 2TGPZ 1Z1JA 2HNTF 4SGAE 2B5TB 4NIWA 1TGNA 1GHAF 3KIDU 4YOIA 1C5MD 5E0GA 5T6FA 1PJPA 1YYY1 5EQSA 2FTMA 3TJNA 2GV6A 3HK3B 3BTDE 2OTVA 3M37A 1GBEA 2G5NA 3T29A 1PFXC 1UVUH 1ESBA 4ISLA 5HM9A 3SW2B 3OY5U 4K1TA 4WMEA 1IQMA 3PTNA 5F8ZA 2OBQA 3MNBA 1TALA 4LXBH 1T8MA 1THRH 4Q7YA 2Q1JA 1YPEH 1BMMH 3UIRA 4H6SB 4CHAB 3A7VA 1B7XB 2BD9A 4UONA 2SGPE 1ZMNA 4MG3A 4Y10E 1CU1A 1L0ZA 1ZRBA 1ZPZA 5AF9H 2C3SA 4X2XA 1GJBB 1Y5AT 3RM0H 3SU1A 5DPAA 1W14U 1MTWA 4H42U 1GHWH 1LQEA 3A87A 3LPRA 3NZIA 1PYTC 1Y3UA 5E0HA 1NRQH 2G51A 3MH7A 1GVKB 1DWDH 1C1SA 1NN6A 1BTYA 1ELFA 1SQTA 4WH6A 1MTNC 1T7CA 1F0RA 1PQ7A 3GCTF 5T6DA 2AGIX 3OYPA 1IQKA 1EP6A 2GZ8A 4FVDA 2XTTB 4KTSA 3ZZ4A 3BN9A 2HPQH 4AZ2B 3W94A 1BRUP 1O2MA 2OP9A 1TGBA 1TGTA 2OXSA 3PMAB 1V2JT 5EQRA 1SGFG 4AX9H 1BITA 2STAE 5TJXA 4OGYA 3L33A 4GUXA 1DANH 3CENA 1P2KA 1GI8B 3W95A 2ANYA 3LKWA 2UWLA 2R0LA 1XUGA 1NFWA 4Q80A 1MQ5A 1O5FH 1RTFB 4X8SH 1CT2E 1Y3VA 1BDAA 2KAIB 1GI0A 3QTOH 1AFQB 2EA3A 2TGAA 3STJA 1EJAA 1KLTA 2QXIA 2UUJB 2EC9H 2PKSB 2PLXA 3E3TA 2ZFPH 3ZZ8A 2C8YB 2RCEA 5IYTA 5EW1H 1D3TB 1P10A 3MMGA 1AIXH 1P04A 1HJAC 1SGDE 1O2PA 2G52A 4X0WU 2PWXA 1Z8GA 3O8CA 2J38A 1O3EA 4U30A 3GCHC 4ABIA 4CRDA 4Z0KA 5GCHG 3RXQA 2Z9GA 1GDUA 4THNH 1ANDA 3UWIA 1GI4A 3TH4H 4ESTE 3AAUA 1C1TA 3S0NA 1TA2A 1Y3XA 1BJVA 4MDSA 1O2UA 1IAUA 1EB2A 3RLYH 3P70B 4AFUA 4HFPB 4F4OC 2R3YA 1C4Y2 4J2YB 1Y3YA 2BD8A 1GJ8B 2AIPA 1S6HA 1EQ9A 1Z8RA 2PV9B 3GY3A 3P95A 3BIUH 2BQWB 1XUHA 3GY5A 3NXPA 4K8BA 1KSNA 4JZIA 2CF9H 1P12E 1RS0A 4BTUB 1V2PT 1QB1A 2PGQB 3NWUA 1C5NH 2OC0A 1FY8E 4ISOA 1EUFA 1N6XA 4GLYA 1GBAA 4AG1A 3K6YA 1K9OE 3ZVAA 2D8WA 1T4UH 1W0ZU 1YPHE 3EE0B 1IQHA 4B73A 1C5ZB 1O37A 4JZ1A 1FIWA 3ATWA 2ZDAH 4FUEA 1C5PA 3QZRA 4U01A 1HJ9A 2P94A 3ZZAA 5TCCA 2XW9A 2F3CE 1O2TA 1TMUH 2BM2A 2GP9B 1WUNH 1CBWC 3ESTA 1KXBA 1E37B 3UTUH 5JBAS 2VU8E 1DS2E 1UTKA 3MU5A 2FOGA 1V6DA 3MOCA 1UTQA 2A7JA 4FUIA 2J34A 3A88A 1EASA 2ZIQH 3M36A 4KP0A 1E0FD 3E0NB 4CRBA 1OWDA 1AKSA 4JYTA 3SJ9A 2H9HA 1QL9A 1FUJA 2EI7A 4D8NA 3UWJH 5BRRE 1QL7A 4FUCA 3TGIE 3SGAE 1LVOA 2GVFA 3SU2A 3SBKA 2OD3B 2A45B 1AB9C 1PQ5A 3RXFA 1GI6A 3HATH 4BAQB 5HM2A 3V0XA 2P3FH 1JRSA 5GPIB 5DG6A 1O3GA 2FPZA 1UTJA 1SGTA 3SV8A 5JB8S 4A1XA 1UHBA 1GHAG 1L4DA 1SLXB 1TNIA 1WTHD 4VGCB 2GDDA 2BOKA 8GCHG 1V2VT 2Y5GA 1SC8U 2JETC 3VXFH 2TIOA 4WY3A 1BMNH 1VITF 2G81E 2GTBA 2FYQA 2NU1E 4INKA 3GDVA 1AUTC 4MQAA 3A7ZA 3RXVA 3S9BA 5ESTE 1FPHH 2ZU5A 4NWLA 1LPGB 4B2BA 1MKWH 2C8WB 1HAXB 2ZGCA 3F9FA 3L6PA 2WPHS 2ZU1A 2O8WA 3TGJE 1HAOH 2P8OB 1DWEH 3BTFE 1SHYA 3SNCA 1GGDC 1PPHE 1ACBE 1GMHF 5FXLA 1J16A 1G36A 3GY2A 1H9IE 2RDLA 9LPRA 2ZWLH 5DGJA 1H9LB 2RG3A 4RKOB 1J8AA 2ZTZA 3SQEE 2IOTA 1C5WB 1PYTD 1UMAH 1HJ8A 5CHAC 4JK6A 1FY4A 3AW1A 3U8OH 3QO6A 2ESTE 1AUJA 3T2NA 1C1VH 1YPJH 1T8LA 1C1MA 5EXMA 2QCYA 3F1SB 1BZXE 4Q7XA 4NZQA 3GCTG 4H4FA 2UWPA 1RD3B 1NRRH 2VWLA 3MU8A 2BY8X 3FANA 4OS7A 3A7XA 1NZQH 1C2KA 2ZFQH 4O3TA 3DHKH 4NGAH 2JH6D 4K5ZA 1QBVH 4DGJA 4UFDH 1GBTA 4RSPA 5FCKA 3MO9A 1WYKA 2BZ6H 4FXGH 2FLBH 2GGVB 2ZCHP 3MO3A 1H1BA 4CR5A 1GHXH 1PPFE 2V3OH 1V2OT 3M7UA 1D3PB 4GCHF 1AGJA 5LPFA 2QIQA 4HI3A 5FPTA 4X8TH 1VCWA 3L3TA 3TIUA 2P16A 1NO9H 2XBWA 4CRCA 2W3IA 5A8YA 3PYHA 1O3IA 2FOHA 1SOTA 2XC5A 5DP8A 5E2PA 1F5RA 4DIIH 5AVDA 1MTVA 3P8GA 1C4U2 5L6NH 1HPGA 4RN6A 1SL3A 1DY8A 3A89A 2SFAA 3UY9A 4WJG2 1AQ7A 3P8FA 1QCPA 4QT8C 4GAWA 2BMGB 1SSXA 1EKBB 3SNAA 1AVWA 1P01A 2CJIA 1V2MT 2A4QA 2BDHA 1DLKB 3LC5A 1UVOA 5SGAE 1HDTH 4NZLA 4SGBE 1XM1A 1NRSH 4MVNA 2P59A 3B8JA 3HGNA 1XKBC 4BOHA 1MBQA 3MNSA 3OSYA 4Y8YA 4DW2U 2R3UA 1O31A 2ZNKH 1AKSB 1TLDA 1Y5BT 1A0LA 3P92A 2AFQB 3PWCA 5J4QA 1KTTB 3GDSA 4X2WA 3KNXA 1TOCB 3A8DA 2TBSA 3PWBA 1MKXK 1GVZA 3E8LA 2GCHF 6GCHF 2B9LA 5FBIA 2BLVA 1TNLA 1O5GH 1C2HA 5JYIA 1UHBB 1K21H 2GX4A 1AU8A 4Y6DA 1F0UA 5CE1A 3FZDA 1XMNB 1NS3A 4Z6AH 3SGBE 2BDCA 2ZDNA 2O8LA 1QQ4A 1TNGA 1KXFA 4ZHMU 1A4WH 1CE5A 1W12U 2ZFRH 7GCHF 1ANEA 1L1JA 4NFFA 3LONA 3TU7H 1O2RA 1O2OA 4CR9A 2WINI 2FS9A 3FVFB 1SGYE 1EATA 1SQAA 1GBDA 1C1OA 1ZSJA 2A7HA 1C5UA 2PTCE 2GCTC 2GT7A 4I8KA 5FBEA 1C1RA 2NU2E 1TRMA 2W7UA 3MFJA 5C5NA 2HNTE 2FI5E 1V3XA 3SU3A 2TGTA 3DT0H 1G3CA 3BV9B 2XC4A 4PROA 1O35A 1BTHH 4BAMB 3RMLH 3RXHA 3RC6A 1JMOH 1NU7B 4ZXXH 2FODA 1EOJA 3A83A 5TCAA 1WAYB 4X1SU 2ASUB 3KQEA 2VGCB 4ABGA 1C1NA 1KDQB 2NWNA 3SUDA 1AI8H 1VITG 3RMMH 2F9UA 5DP3A 2A4RA 5HXFA 1FV9A 1K1PA 5EQQA 1QNJA 1W8BH 3B9FH 1OXGA 1O3HA 3RU4D 1EZXC 1RJXB 1XUIA 2LNCA 1Q3XA 2F9NA 1GHZA 1IQIA 1TYNA 1RTLA 1O3PB 1CHOG 3S9AA 6LPRA 1SR5C 4M7GA 3RXPA 2BY9X 1MZDA 1Y3WA 1GMHG 4TWYA 3CP7A 3T62A 3RXOA 2ZECA 1UO6A 5JB9S 2F9VA 1ZTKA 1VGCC 2P3UB 3ZVCA 1FZZA 2G5VA 1IQLA 1W7XH 1O3KA 1OS8A 4YT7H 3EAJA 3RXBA 1HAPH 4YT6H 1S81A 1PPCE 1W0YH 1FLEE 1HYLA 4E06H 1Z71A 2VJ1A 3DUXH 1YPMH 2TGDA 2Q6FA 1AD8H 1CQQA 1SPJA 1UJ1A 2F9PA 4Y8ZA 1TRYA 2ZP0H 1TE0A 3KCGH 5B6OA 2VH6A 4WMFA 1ZGIA 2TRMA 3TJUA 1HAYB 2B0FA 1K22H 2GZ9A 3R3GB 2CGAA 3A80A 3E1XB 4AFZA 3GDUA 3ENSB 2QV1A 3GY6A 1ZTJA 1LHCH 1CT4E 1MU6B 4BNRA 1GWAA 1QURH 1GMDF 2VH0A 1CA0B 3U1JB 3S69A 1BA8B 2SGAA 4GCHG 1RXPA 2WPLS 3UR6A 4I7YH 3ZV8A 2RA3A 5A09A 3VFEA 2ZFFH 2VIPA 1J17T 2ZGXH 1A5HA 2B7DH 1QY6A 2PKAB 1ZHPA 3RU4T 1LVMA 2J95A 2WUCA 3LGIA 1SQOA 3A86A 1L2EA 2SNVA 2F91A 1O39A 1GBIA 2ZQ2A 1QHRB 1SFQB 1TMBH 1LQDB 2ZCLP 2FYRA 2A2XH 4AYYB 1H9HE 2QAAA 2PTNA 1SLWB 4Y71A 4DVAU 1FY1A 2VIOA 5T3HA 2Y7ZA 3LIWA 3I29A 3M7TA 3IG6B 1G2MA 1QBOA 1TIOA 1TX7A 1TQ7B 1AE8H 2ZEBA 2V3HH 1ELCA 1V2ST 4I32A 1M9UA 3BTWE 2I6QA 1AVGH 4ABJA 1C2JA 1G32B 1RIWC 2FZZA 4I8HA 1GJDB 1C2EA 2WPJS 3BG4B 6GCHG 2XRCA 1B0FA 1QJ7B 2VVVA 4ZAEA 1FJSA 4IMQA 2C93B 3PROA 4YESB 3QLPH 4Y11E 4A5TS 4I8JA 1Q2WA 3M5MA 1TPAE 4IMZA 4BAOB 3M3TA 3RXJA 1TRNA 2BDYA 3F68H 1O2HA 3PO1B 5DP7A 5GJ4B 2ULLA 1MCTA 3M5OA 3LGVA 1EPTC 2BDBA 4KTUA 3QTVH 1F5KU 1UVSH 4WXVA 2FP7B 3EDXB 1CT0E 2BD3A 2FOAA 3Q3YA 4RKJB 5FX6A 2BVXH 2O8TA 3TH3H 4GVUA 2BVRH 5F6MA 1SI5H 1OWJA 1QBNA 2Z9IA 3MH6A 4ISHH 1DXWA 1GBMA 2XBVA 1H8DH 2A5KA 4IGDA 1C5SA 4IC5A 1E38B 1EB1H 2HALA 5EXNA 1MD8A 2SNWA 5C1UA 1SG8B 1BMLA 1GJ5H 3CS0A 1KLJH 2ZHWH 1DE7H 3HGPA 1GG6C 4HGCA 2BD5A 3MU4A 1EZQA 4O9VA 1P9UA 3ZZ3A 2D1JA 1LHFH 3E16B 1OYQA 3PLPA 1LVYA 4MNVA 1N8OB 1XXFA 5F03A 3PM3A 3QZQA 2QXJA 3SI4H 4A92A 1GBLA 1S84A 2FM2A 4ISIH 3QGJA 2ZCKP 1W13U 1H8IH 3D62A 3BIVH 1Z1IA 2BX3A 2ZDLA 2ZFSA 1HB0B 1O3DA 1C4V2 1BCUH 1L1NA 3MU0A 1Z8IB 4LZ1H 1OWIA 3RUOA 4X6OA 1WOFA 4Y7BA 1P0SH 3GY7A 4INLA 3UOPA 1KIGH 2DUCA 2Y5HA 1MBMA 1NROH 3UOUA 1LHGH 2ZU4A 1CGHA 4MPUA 2V35A 4FU8A 4ABBA 3MO6A 1GI2A 1LHEH 1O3LA 1C5XB 4MNYA 2FOMB 3V13A 3SJOA 1GI9B 5ETXA 2PUXB 1BHXF 1HNEE 3PB1E 3SUFA 4NIVA 2H6MA 3LT3A 4Y8XA 3FP8E 3ODFA 2CHAC 1V2NT 2PSYA 1GCTC 3DFJA 1ZHRA 4DT7B 2FS8A 3TJOA 1PPZA 5A8XA 4B76A 1MKWK 2QYIA 1S6FA 1Y5UT 3A8BA 3RXSA 1WU1A 1C1PA 1VITH 5DKMA 5E0JA 4WWYA 1BB0B 3AAVA 2PUQH 4TPYA 1HRTH 1KY9A 2ALVA 5C20A 4OS5A 1P2JA 2G55A 2R0KA 2YNAA 3EA8A 4BTIB 1D3DB 2FO9A 4AFQA 1F7ZA 1GMDG 3QUMP 4ZMAH 1PQAA 4TWWA 2Z9KA 1XVOA 3CS7A 1FN8A 3M5LA 4LK4A 1SGNE 2XCNA 1YLCA 1BTZA 4BAKB 4K60A 1F0TA 3S9CA 2VWNA 1INCA 2ANWA 5EPYA 3V12A 3A82A 3KN2A 1V2UT 2ZHEH 1QGFA 3TLOA 4TPIZ 3B23B 1C2MA 3QDZB 4KELA 1MTNB 4X8UH 4FUBA 4X1RU 1BIOA 2OC7A 1DOJA 1HAIH 3H7TA 1O3FA 1IQGA 1TGSZ 4WF8A 1GJ7B 1EJNA 4X1NU 1O5DH 1C2FA 1GHBF 1NU9A 2A5AA 3URDA 2Z7FE 4NA7A 1QA0A 1TA6A 3QK1A 3UNRA 1V2TT 1GCDA 3A7TA 1EZSC 1MH0A 1UK3A 1RGQA 1TNHA 1O5CB 1CSOE 1PQ8A 1FAXA 4AOQA 1O2ZA 1P03A 1ZSLA 3LH3A 5L2ZH 2GV7A 3P17H 4BXSA 2PSXA 1QB6A 1BMAA 3BTME 1VCPA 3IWMA 2PR3A 2OC1A 1NRNH 1O36A 1O2NA 4X2VA 1A0JA 3SI3H 3RDZA 1LDTT 1HXFH 4ZKOU 1K1MA 3TK9A 1JWTA 1NRPH 2ZDMA 4XFQA 4YLQH 2SGDE 1DXPA 1C5TA 1EJMA 2XBYA 3SOSA 6CHAC 1HJAB 1TMTH 2C8XB 1B0EA 1S85A 2FLRH 1SGCA 3GCHB 1FQ3A 3NK8A 4JZFH 1GDNA 1GMCF 1BRCE 5DP4A 2RA0A 1OSSA 3OX7U 3PLKA 1ZOMA 1O2JA 1S83A 3FP7E 2AGGX 1JRTA 2ZPQA 4NIXA 3BTQE 3RXTA 2OLGA 1J14A 4OS4A 1MAXA 1ZYOA 2VB0A 1TOMH 3BSQA 2CXVA 3JZ2B 1TONA 4Y76A 3FFGA 2OCVB 5EODA 1BBRK 1XKAC 4DY7B 1Z6EA 2VWMA 4MNXA 3ZVDA 2BLWA 2XBXA 1T4VH 5EW2H 3G01A 1RFNA 1BOQA 4R8TB 2H5DA 1EP5A 4LZ4B 1DUEA 3ZVEA 1IHTH 1O5EH 2Z3CA 1AZZA 2GMTC 3Q3XA 2AH4X 3GYLB 1DM4B 3S7HB 1LCYA 2VINA 5A8ZA 3HKJB 2ANKH 4IC6A 2YOLA 4XDEA 3VPKA 1HAHH 1N6YA 1UCYK 4NSVA 3TGKE 4O3UA 1O3BA 1EOLA 1SLVB 1OWKA 2J94A 3SO3A 1O3NA 1CBWB 2AERH 1GHVH 2TPIZ 1QA7A 4NCYA 2AYWA 2QGRA 1W10U 3UFAA 1D6WA 2CF8H 1TX6A 3SU6A 3VB3A 1OYTH 2R2MB 2Y80A 1TWXB 4JYVH 4CRFA 5AFZH 2QN5T 1PPEE 1D9IA 4JZDH 2AMQA 1SGRE 4UD9H 1P05A 1VCQA 1O2KA 3RXMA 1FIZA 3K9XB 1P2NA 1A7SA 1NPMA 2VVCA 1YF4A 1O2VA 2Y82A 3SZNA 1AB9B 1FDPA 1A3BH 1LTOA 4UFEH 2ZO3H 3ZZ5A 1GJ9B 5JBBS 3RC4A 1LMWB 4ASHA 5LPEA 1O34A 2F9OA 7KMEH 4TYDA 1KLIH 3RXCA 3RP2A 1O2IA 3HPTB 1THSH 4TY6A 3D23A 2D2DA 3R0FA 2WV4A 5C67A 4K1EA 1WCZA 3JZ1B 5JDUB 1ELBA 8ESTE 1YBWA 1OKXA 4I8LA 2JETB 3SV2H 2QC2A 4ZH8A 2BY5X 1DT2A 3SJIA 2Y81A 3LDXH 4CH2B 1A61H 2LPRA 4NIYA 1HAZB 5EU8A 3STIA 2FX4A 3HK6B 1AWHB 2P3TB 3T25A 1ZJDA 4YZUA 3TK5A 3K65B 1P3EA 1EAXA 2BDAA 3ODDA 3RXUA 1UTOA 1O2XA 1G2LA 4NFEA 1A1RA 5GIBA 3M3VA 2FOCA 2ZPRA 1C5YB 1GGDB 2GKVE 1ARBA 1BTUA 1J9CH 3WY8A 1O0DH 4DG4A 2ODQA 3K2UA 4UFFH 1OP8A 3ZZ9A 1P8VC 3C27B 1JXPA 1XUJA 1YCPK 1C5QA 2ZQ1A 5G4BA 1OOKB 1O3JA 3ZVFA 2A4OA 5CHAB 1O5BB 1MU8B 1WQVH 3UQOA 1XVMA 1FN6A 4B2AA 3LH1A 1HIAA 3A8AA 1V2KT 4U32A 4CHAC 1MAYA 2QF0A 1FMGA 1D4PB 2Q6DA 3PV4A 1ZMLA 4D7FA 3RC5A 2A31A 1NY22 2ZDKA 1YLDA 3P8OA 4IN1A 3MNXA 5GXPA 2XCFA 4YM9A 5K0HA 3SGQE 3UR9A 1MKXH 2A4GA 2A7CA 3Q76A 1CO7E 1P09A 3ELAH 1GHBG 1KYNA 2ZHFH 1T31A 1UTMA 2OUAA 4IBLH 4JMYA 4OS2A 3BTTE 3GY8A 1EZUC 3ZZ6A 5EXLA 5C5OA 2XYAA 1TX8A 1UTNA 3E90B 5JBTA 2FDAA 2QA9E 3NCLA 1BUIA 2ODPA 3T5FH 2ANMH 4AB9A 4J1YA 1TBZH 3TVJB 1LPZB 4F49A 1NC6A 1X7AC 4TY7A 5H4IB 3RMNH 1W2KH 1C1QA 1DVAH 1Z6JH 2NU3E 3M61U 4H6TA 3SV9A 8LPRA 1WQSA 1ZZZA 2A32A 3MYWA 1NT1A 4K3JA 2FOFA 1EAUA 1J15A 2OQUA 1O2QA 1QL8A 4OGXA 3O8BA 1MD7A 3EGKH 1S0RA 3GCNA 2BXTH 2FIRH 3SORA 4CBNA 1ETTH 1QJ6B 1ZTLA 3ZZBA 3NKKA 1BTWA 9ESTA 1AFQC 2WUBA 1IQEA 3TJVA 1ID5H 1GMCG 3PMJA 5ESBA 2PKSC 2W3KA 3IITA 1O2WA 3MU1A 1C2GA 1GBBA 3A84A 3ATIA 5AHGH 1SHHB 3N7OA 3LGTA 3BEIB 1P02A 2ZA5A 4E05H 5DP5A 5T6GA 1HAGE 1XXDA 2VWOA 2PGBB 2O8UA 3P6ZB 4CREA 2ZGBH 1RRKA 2WPKS 2IPHA 3SNEA 2C90B 1FPCH 3LGUA 5A0BA 1D6RA 3PLBA 3QWCH 1ZLRA 3UUZA 7ESTE 1YC0A 3LOXA 1TPSA 2VIDA 2CMYA 4KGAA 2HVXA 5HYOA 3O8DA 1T8OA 3VB4A 1ETRH 1ELDE 3A85A 4NG9H 4DOQA 1UVTH 3T27A 2ZPSA 1VJ9U 4ZUHA 1MMJN 1AE5A 2BQ7B 4Y0ZE
chains in the Genus database with same CATH superfamily
1JIMA 1AN1E 2SGEE 3MWIU 3EQ0H 2OK5A 2XC0A 4K69A 3SN8A 1Y59T 2J9NA 4IW4E 2H2ZA 5C1XA 1DWBH 2ZU2A 5IDKA 1EAIA 1HV7A 1ARCA 2BZAA 3GS9A 3U1IB 2D26C 2BTCE 2JKHA 3ITIA 1DDJA 5C3NA 1SGQE 3LGWA 4HZHA 2GZ7A 1O3OA 2BQ6B 5GWZA 3A8CA 3A81A 5DO4H 4DIHH 2XNIA 4NSYA 4ABAA 7LPRA 2GCTB 2BD4A 2WYJA 3U9AH 1UK4A 3AASA 3F0PA 4O97A 3GYMA 1GJAB 1ANBA 1BTXA 1TBQH 4JCNA 3T28A 8GCHF 1GHYH 1LKAA 1ORFA 5CDFE 1C9PA 2QXHA 3SU5A 1TB6H 3VGCB 1EX3A 3NUMA 5E8EH 6ESTA 1QB9A 4U2WA 2NU4E 3KL6A 4MPVA 1FY3A 2M5TA 2GCHG 3BG8A 1NESE 1DY9A 1A5IA 1MTUA 2ZTXA 1HIAB 2O8MA 1K1NA 4YLUA 4WH8A 4D7GA 1H4WA 4UFGH 4ZXYH 4DURA 1QR3E 1P06A 4BXWA 1TGCA 2Z9JA 3HKIB 5DP6A 2AMDA 1GL0E 1O5AB 4Q7ZA 5HIYA 3QX5H 3RXEA 2ZGJA 3E6PH 7GCHG 2WPIS 3VG8A 1GVLA 3D65E 1DWCH 2CN0H 1O3CA 4Y79A 1EPTA 2K0QA 1HFDA 5DK1A 4X6MA 4CRAA 1Y8TA 2ZU3A 2SGFE 5HKKD 4UEHH 3SV6A 5AFYH 1ZPBA 1BT7A 4R0IA 4A1TA 3DD2H 1YPHC 2WPMS 1SGPE 4KKDA 1S82A 1T8NA 4VGCC 2Y7XA 4JZEH 1ESTA 4UE7H 1F92A 3GOVB 3AVZA 1BHXB 2EEKA 4BTTB 5PTPA 4XBDA 3TNTA 5LPRA 1K1LA 1S0QA 5JBCS 1ZRKA 3UNQA 1C5LH 3UQVA 1SBWA 1FONA 1YCPM 1LVBA 1UTLM 1EAWA 3BEUA 2BLOA 3ATMA 1D3QB 1MTSA 3OTJE 1DSTA 1ELAA 1GDQA 1VGCB 1GBKA 1AWFH 2P8OC 2UUFB 4JK5A 4WXIA 5DP9A 1O2YA 5HMAA 1K1IA 8KME2 3C1KA 4ZHAA 4ZKRU 3PMHB 3LJOA 3VXEH 1ZMJA 5DSFA 4JYUH 3F6UH 2H5CA 1BQYA 1LO6A 1A46H 4GSOA 1VJAU 2KM0A 2Y5FA 4ZHLU 1QRZA 2FEQH 2W7SA 4AGKA 1C2DA 3SV7A 1U6QA 3RXLA 5I46H 4ZKNU 1V2LT 3FAOA 2GDEH 1BRBE 2G4TA 1AO5A 3GICB 4X6NA 3A7YA 4WMDA 3M7QA 5KECA 1C5RA 3U8TH 1CA8B 4ZCNA 5IK2D 4MPWA 5FAHA 1G30B 1L4ZA 1UTPA 2ZF0H 5EPNA 2VIVA 1HAVA 2PHBA 2WSSD 4MNWA 4NWKA 2A2QH 1FNIA 4O03A 2Z3EA 3M35A 4MPXA 3U98H 1TFXA 4RT1A 2ILNA 2P95A 5F8XA 1AY6H 2YNBA 3RLWH 2QY0B 5LH8A 4AGJA 1ELVA 4M9FA 4WVPE 5DJ7A 5CMXH 2ZC9H 3KQDA 4Y0YE 2BHGA 3GY4A 2BXUH 2OBOA 4E7RG 2ZGHA 1P2OA 2GD4B 2F83A 4X1PU 4YOJA 1SLUB 1QRXA 3Q3KA 2HRVA 1DICA 5EJLA 5EOKA 2R9PA 3KEEA 1C9TA 5E2OA 1GJ6A 1SFIA 5FPSA 1OWHA 4MLFB 2ZDVH 3F9EA 3H7OA 4DJZB 5A0CA 1VZQH 2JH5D 3VB5A 2Y6TA 2KCOA 5GNDA 1QJ1B 1ABIH 1SGFA 2VVUA 3F0OA 3LJJA 1P2MA 4FU7A 1K1JA 3ZVGA 3TNSA 1IQNA 1MCVA 1RIWB 2HGTH 1C2LA 4B75A 2XWAA 1O2SA 2V0BA 4AYVB 2FWWA 2ODYB 4AORA 1CGIE 2H9EH 1WDIA 5C1YA 3SNBA 3RXGA 3SJKA 2FI4E 1UK2A 4KTCA 1C5OH 2R2WU 1JIRA 1EXFA 3QGNB 1CHGA 3OEED 3ZYDA 1HLTH 1SOZA 3FN8A 4IS5A 1EPTB 3AW0A 4YO9A 2G00A 4XSKU 2W26A 3RMOH 1KXDA 1SGEE 3UPEA 3KQCA 1TNKA 4A6LA 4CRGA 1NFYA 3SU4A 3KQBA 3MH5A 3ZV9A 5FX5A 2BVSH 4OS6A 2BLQA 1QFKH 1O32A 1YGCH 5ABWA 1WV7H 2WYGA 2VIQA 4FUFA 3U8RH 1O3AA 2UUYA 1BJUA 1F5LA 1F2SE 4I31A 3ATLA 4D9QA 2J98A 3ZZCA 2AS9A 1GG6B 1XX9A 2BY6X 2AIQA 4YTAA 1WBGB 1GJCB 3OAAD 1CHOF 4K2YA 3UREA 5HIZA 1S5SA 2HWLB 3PTBA 4BANB 5HGGA 3TPIZ 3I78A 4D9RA 5L2YH 3SUEA 4GHTA 2ALPA 1DSUA 2FESH 2ZHDA 3MH4A 3RXDA 3EE7A 2W6JD 1TBRH 3BTHE 1GL1A 1V2QT 3U69H 1GPZA 3VB7A 4A1VA 2Z94A 4XBBA 4Y7AA 1TPPA 1KXCA 2ZKSA 2BY7X 1GJ4H 3MNCA 4AFSA 1OWEA 4F48B 1G37A 1B5GH 2DE9A 4K8YA 2KCYA 1GI5A 1BTPA 2UWOA 1JBUH 1K28D 2BD7A 5FPYA 4LOYH 1G9IE 2C8ZB 3TITA 2CV3A 1A2CH 1SGIB 4I86A 1FY5A 2VGCC 3TH2H 1FAKH 1G3BA 3E91A 1DITH 1HAVB 1W7GH 2BD2A 3V3MA 1BBRE 1AFEH 1P2QA 1SVPA 1KDQA 3DFLA 3K6ZA 1A0HB 5C2ZA 5EGMA 4X8VH 1V2RT 3Q00A 1GBHA 1Z7KA 3FP6E 2BDGA 3M5NA 1C1WH 1P3CA 4D76A 1DUAA 3OY6U 2QF3A 1NFUA 3OEHD 1N1LA 4X2YA 1AZ8A 3KGPA 3SJ8A 4IN2A 4ABDA 4AC9A 2HNTC 4FUGA 3D49H 1W0KD 2CHAB 3O8RA 2EI8A 1GCTB 3KF2A 4K1SA 2J5UA 1AMHA 2BOHB 3BEFB 3GCOA 2J4IA 1GBCA 1DLEA 1ETSH 4X6PA 3BTGE 5LGOA 3EA7A 1TPOA 1UCYE 1ZJKA 1YPLH 4ABEA 5F8TA 3F2GA 5J4SA 1ZGVA 2BYAX 4CBOA 2I6SA 3A7WA 1GBFA 3RU4E 2FXRA 2A1DB 3EYDA 2STBE 2F9BH 1THPB 1FI8A 1O3MA 1W11U 2ZZUH 1YKTA 1CGJE 1QTFA 2GT8A 2V6NA 1KTSB 1YPKH 1DFPA 1O2GH 3FZZA 2FX6A 1E34B 2ZTYA 1O30A 1OP2A 1YPGH 1HBTH 4BAHB 4Q2KA 4I33A 4AN7A 1HGTH 1CA0C 1WSSH 5EIYA 2H1UA 1YP9A 3SUGA 2IN2A 1L1GA 1UVPA 3RXKA 3E0PB 1BBRH 1TQ0B 3BTEE 1YY3A 1IOEA 3PRDA 1DX5M 2FOBA 4FUHA 4B1TA 1TAWA 1TABE 1DPOA 1ELGA 1LHDH 3S7KB 4XBCA 5EG4A 3V7TA 2PKAA 2AHME 3LU9B 1YM0A 1KXAA 1ELEE 3QN7A 1AHTH 4FUDA 2Z9LA 1FXYA 3F9HA 4ZROA 3SYJA 2Q6GA 1C2IA 4OS1A 4X1QU 1GI1A 3SHCH 2WV5A 2ZI2H 3RM2H 3VB6A 3BF6H 1ZHMA 4FU9A 3GISB 2HPPH 1QRWA 1P11E 4ISNA 1E35B 2A5IA 2HOBA 2IJOB 1ANCA 3DA9B 2B8OH 1UCYH 2BX4A 3F9GA 1G3DA 1OPHB 4DCDA 3UNSA 4ABFA 1HXEH 6CHAB 2G4UA 2OQ5A 2OINA 3MQKC 1CVWH 3N99A 1V2WT 5GDSH 2Z6BD 3MTYA 1JOUB 3VGCC 5L30H 1NM6A 4GPGA 1K1OA 3RXRA 1BRAA 2THFB 3SQHE 3RXAA 2J92A 5C17A 3BTKE 3BG4C 1ZR0A 2W5EA 3LGYA 5FHTA 4YOGA 4NA9H 2AMPA 3DSPA 1F0SA 2UUKB 2K8IA 1W3CA 3PMBB 1G3EA 1RTKA 1XUFA 2BDIA 1WTGH 1HUTH 1A3EH 5GCHF 3PO1C 1IQJA 4ABHA 2FOEA 5A2MH 3MI4A 3EA9A 3KYGA 1GBJA 1A5GH 2EI6A 4XE4A 4NA8A 1SMFE 1TNJA 1Q31A 1ZPCA 4B2CA 4GHQA 2FTLE 2FI3E 4B71A 2XWBI 2K1QA 3KHVA 3OU0A 1QIXB 2ZFTA 1QQUA 4AB8A 2PW8H 2GMTB 2J2UA 3NPSA 4AG2A 2ZHQH 3ZYEA 2NU0E 3ZZ7A 1T32A 2AGEX 1Z8JB 2PFEA 2VIWA 3ATKA 2FMJA 2JH0D 3MHWU 4FUJA 2L74A 2KAIA 4F55A 3P8NA 3Q77A 2ZG0H 3ZZDA 2AEIH 5A0AE 5JPMH 1MZAA 1PPGE 3SZEA 1P9SA 1ZSKA 2XXLA 1OX1A 1OP0A 1YCPH 1O33A 1GI3A 4CH8B 2BB4A 1GI7B 1K2I1 1C5VA 4UDWH 3ZVBA 1N8OC 1HCGA 3H5CB 2H9TH 3I77A 2O9QA 4XOJA 2DE8A 1LPKB 3T26A 1NFXA 4ZKSU 4FVBA 2HLCA 2JJ2D 4MTBA 2P93A 3TK6A 3SU0A 1O2LA 1FX0B 4INHA 1VR1H 1ABJH 2VNTA 1IQFA 1ESAA 3F3BA 2A0QB 4P00A 3SHAH 1SB1H 4I8GA 1MABB 4DT4A 3VEQB 1LKBA 2Z3DA 1VKYA 3F2HA 3H09A 3LC3A 1P57B 2QXGA 1MUEB 3RXIA 5I25A 4HTCH 1MQ6A 2SGQE 5FCRA 4A7IB 3N7EA 5K7RA 1KXEA 1E36B 1C1UH 2PP6A 3SNDA 2C4FH 2OC8A 4B74A 5BPEA 1NTPA 1IHSH 1O38A 3URCA 1ELTA 1P2IA 4E7NA 1AVXA 2G8TA 1PPBH 1XUKA 3M3SA 2TGPZ 1Z1JA 2HNTF 4SGAE 2B5TB 4NIWA 1H8ED 1TGNA 1GHAF 3KIDU 4YOIA 1C5MD 5E0GA 5T6FA 1PJPA 1YYY1 5EQSA 2FTMA 3TJNA 2GV6A 3HK3B 3BTDE 2OTVA 3M37A 1GBEA 3PV2A 2G5NA 3T29A 1PFXC 1UVUH 1ESBA 4ISLA 5HM9A 3SW2B 3OY5U 4K1TA 4WMEA 3OTPA 1IQMA 3PTNA 5F8ZA 2OBQA 3MNBA 1TALA 4LXBH 1T8MA 1THRH 4Q7YA 2Q1JA 1YPEH 1S6LA 1BMMH 3UIRA 4H6SB 4XRNA 4CHAB 3A7VA 1B7XB 2BD9A 4UONA 2SGPE 1ZMNA 4MG3A 3PRBA 4Y10E 1CU1A 1L0ZA 1ZRBA 1ZPZA 5AF9H 2C3SA 4X2XA 1GJBB 1Y5AT 2KX4A 3RM0H 3SU1A 5DPAA 1W14U 1MTWA 4H42U 1GHWH 1LQEA 3A87A 3LPRA 3NZIA 1PYTC 1Y3UA 5E0HA 1NRQH 2G51A 3MH7A 2WV9A 1GVKB 1DWDH 1C1SA 1NN6A 1BTYA 1ELFA 1SQTA 4WH6A 1MTNC 1T7CA 1F0RA 1PQ7A 3GCTF 5T6DA 1NBMD 2AGIX 3OYPA 1IQKA 1EP6A 2GZ8A 4FVDA 2XTTB 4KTSA 3ZZ4A 3BN9A 2HPQH 4AZ2B 3W94A 1BRUP 1O2MA 2OP9A 1TGBA 4FETA 1TGTA 2OXSA 3PMAB 1V2JT 5EQRA 1SGFG 4AX9H 1BITA 2STAE 5TJXA 4OGYA 3L33A 4GUXA 3UB0A 1DANH 3CENA 1P2KA 1GI8B 3W95A 2ANYA 3LKWA 2UWLA 2R0LA 1XUGA 1NFWA 4Q80A 1MQ5A 1O5FH 1RTFB 4X8SH 1CT2E 1Y3VA 1BDAA 4OM9A 2KAIB 1GI0A 4RT0A 3QTOH 1AFQB 2EA3A 2TGAA 3STJA 1EJAA 1KLTA 2QXIA 2UUJB 2EC9H 2PKSB 2PLXA 3E3TA 2ZFPH 3ZZ8A 2C8YB 2RCEA 5IYTA 5EW1H 1D3TB 1P10A 3MMGA 1AIXH 1P04A 1HJAC 1SGDE 1KMHB 1O2PA 2G52A 4X0WU 2PWXA 1Z8GA 3O8CA 2J38A 1O3EA 4U30A 3GCHC 4ABIA 4CRDA 4Z0KA 5GCHG 3RXQA 2Z9GA 1GDUA 4THNH 1ANDA 3UWIA 1GI4A 3TH4H 4ESTE 3AAUA 1C1TA 3S0NA 1TA2A 1Y3XA 1BJVA 4MDSA 1O2UA 1IAUA 1SQRA 1EB2A 3RLYH 3P70B 3FKSD 3W1EA 4AFUA 4HFPB 4F4OC 2R3YA 1C4Y2 4J2YB 1Y3YA 2BD8A 1GJ8B 2AIPA 1S6HA 1EQ9A 1Z8RA 2PV9B 3GY3A 2KCAA 3P95A 3BIUH 2BQWB 1XUHA 3GY5A 3NXPA 4K8BA 1KSNA 4JZIA 2CF9H 1P12E 1RS0A 4BTUB 1V2PT 1QB1A 2PGQB 3NWUA 1C5NH 1FY8E 2OC0A 4ISOA 1EUFA 1N6XA 4GLYA 4ASUD 3KYFA 1GBAA 1EFRD 4AG1A 3K6YA 1K9OE 3ZVAA 2D8WA 1T4UH 1W0ZU 1YPHE 3EE0B 1IQHA 4B73A 1C5ZB 1O37A 4JZ1A 1FIWA 3ATWA 2ZDAH 4FUEA 1C5PA 3QZRA 4U01A 1HJ9A 2P94A 3ZZAA 5TCCA 2XW9A 2F3CE 1O2TA 1TMUH 2XOKD 2BM2A 2GP9B 1WUNH 1CBWC 3ESTA 1KXBA 1E37B 5C0TA 3UTUH 5JBAS 2VU8E 1DS2E 1UTKA 3MU5A 2FOGA 1V6DA 3MOCA 1UTQA 2A7JA 4FUIA 2J34A 3A88A 1EASA 2ZIQH 3M36A 4KP0A 1E0FD 3DSGA 3E0NB 4CRBA 1OWDA 1AKSA 4JYTA 3SJ9A 2H9HA 1QL9A 1FUJA 2EI7A 4D8NA 3UWJH 5BRRE 1QL7A 4FUCA 3TGIE 3SGAE 1LVOA 2GVFA 3SU2A 3SBKA 4B6FA 2OD3B 2A45B 1AB9C 1PQ5A 3RXFA 1GI6A 3HATH 4BAQB 5HM2A 3V0XA 2P3FH 1JRSA 5GPIB 5DG6A 1O3GA 2FPZA 1UTJA 1SGTA 3SV8A 5JB8S 4A1XA 1UHBA 1GHAG 1L4DA 1SLXB 1TNIA 1WTHD 4VGCB 2GDDA 2BOKA 8GCHG 1V2VT 2Y5GA 1SC8U 2JETC 3VXFH 2TIOA 4WY3A 1BMNH 1VITF 2G81E 2GTBA 2FYQA 2NU1E 4INKA 3GDVA 1AUTC 4MQAA 3A7ZA 3RXVA 3S9BA 5ESTE 1FPHH 2ZU5A 4NWLA 1LPGB 4B2BA 1MKWH 2C8WB 1HAXB 2ZGCA 3F9FA 3L6PA 2WPHS 2ZU1A 2O8WA 2RFKC 3TGJE 1HAOH 2KCPA 2P8OB 1DWEH 3BTFE 1SHYA 3SNCA 1GGDC 1PPHE 1ACBE 1GMHF 5FXLA 1J16A 1G36A 3GY2A 1H9IE 2RDLA 9LPRA 2ZWLH 5DGJA 1H9LB 2RG3A 4RKOB 1J8AA 2ZTZA 3SQEE 2IOTA 1C5WB 1PYTD 1UMAH 1HJ8A 5CHAC 4JK6A 1FY4A 3AW1A 3U8OH 3QO6A 2ESTE 1AUJA 3T2NA 1C1VH 1YPJH 1T8LA 1C1MA 5EXMA 2QCYA 3F1SB 1BZXE 4Q7XA 4NZQA 3GCTG 4H4FA 2UWPA 1RD3B 1NRRH 2VWLA 3MU8A 2BY8X 3FANA 4OS7A 3A7XA 1NZQH 1C2KA 2ZFQH 4O3TA 3DHKH 2F4LA 4NGAH 2JH6D 4K5ZA 1QBVH 4DGJA 4UFDH 1GBTA 5EJ1A 4RSPA 5FCKA 3MO9A 1WYKA 2BZ6H 4FXGH 2FLBH 2GGVB 2ZCHP 3MO3A 1H1BA 4CR5A 1GHXH 1PPFE 2V3OH 1V2OT 3M7UA 1D3PB 3N7DA 4GCHF 1AGJA 5LPFA 2QIQA 4HI3A 5FPTA 4X8TH 1VCWA 3L3TA 3TIUA 3AK5A 2P16A 1NO9H 2XBWA 4CRCA 2W3IA 5A8YA 3PYHA 1O3IA 3KQ5A 2FOHA 1SOTA 2XC5A 5DP8A 5E2PA 1F5RA 4DIIH 5AVDA 1MTVA 3P8GA 1C4U2 5L6NH 1HPGA 2YMSC 4RN6A 1SL3A 1DY8A 3A89A 2SFAA 3UY9A 4WJG2 1AQ7A 3P8FA 1QCPA 4QT8C 4GAWA 2BMGB 1SSXA 1EKBB 3SNAA 1AVWA 1P01A 2CJIA 1V2MT 2A4QA 2BDHA 1DLKB 3LC5A 1UVOA 5SGAE 1HDTH 2JJ1D 4NZLA 4SGBE 1XM1A 1NRSH 1E1QD 4MVNA 2P59A 3B8JA 3HGNA 1XKBC 4BOHA 1MBQA 3MNSA 3OSYA 4Y8YA 4DW2U 2R3UA 1O31A 2ZNKH 1AKSB 1TLDA 1Y5BT 1A0LA 3P92A 2AFQB 3PWCA 5J4QA 1KTTB 3GDSA 4X2WA 3KNXA 1TOCB 3A8DA 2TBSA 3PWBA 1MKXK 1GVZA 2WPDD 3E8LA 2GCHF 6GCHF 2B9LA 5FBIA 2BLVA 1TNLA 1O5GH 1C2HA 5JYIA 1UHBB 1K21H 2GX4A 1AU8A 4Y6DA 3PV5A 1F0UA 5CE1A 3FZDA 1XMNB 1NS3A 4Z6AH 3SGBE 2BDCA 2ZDNA 2O8LA 1QQ4A 1TNGA 1KXFA 4ZHMU 2XNDD 1A4WH 1CE5A 1W12U 2ZFRH 3WW7A 7GCHF 1ANEA 1L1JA 4NFFA 3LONA 3TU7H 1O2RA 2J98B 1O2OA 4CR9A 2WINI 2FS9A 3FVFB 1SGYE 1EATA 1SQAA 1GBDA 1C1OA 1ZSJA 2A7HA 2EQNA 1C5UA 2PTCE 2GCTC 2GT7A 4I8KA 5FBEA 1C1RA 2NU2E 1TRMA 2W7UA 3MFJA 5C5NA 2HNTE 2FI5E 1V3XA 3SU3A 2TGTA 3DT0H 1G3CA 3BV9B 2XC4A 4PROA 1O35A 1BTHH 4BAMB 3RMLH 3RXHA 4Z1MD 5DN6D 3RC6A 1JMOH 4ACBA 1NU7B 4ZXXH 2FODA 1EOJA 3A83A 5TCAA 1WAYB 4X1SU 2ASUB 3KQEA 2VGCB 4ABGA 1C1NA 1KDQB 2NWNA 3SUDA 1AI8H 1VITG 3RMMH 2F9UA 5DP3A 2A4RA 5HXFA 1FV9A 3DCLA 1K1PA 5EQQA 1QNJA 1W8BH 3B9FH 1OXGA 1O3HA 3RU4D 1EZXC 1RJXB 1XUIA 2LNCA 1Q3XA 2F9NA 1GHZA 1IQIA 1TYNA 1RTLA 1O3PB 1CHOG 3S9AA 3FOAA 6LPRA 1SR5C 4M7GA 3RXPA 2BY9X 1MZDA 1Y3WA 1GMHG 5KGOA 4TWYA 3CP7A 3T62A 3RXOA 2ZECA 1UO6A 5JB9S 2F9VA 1ZTKA 1VGCC 2P3UB 3ZVCA 1FZZA 2G5VA 1IQLA 1W7XH 4ACAA 1O3KA 1OS8A 4YT7H 3EAJA 3RXBA 1HAPH 4YT6H 1S81A 1PPCE 1W0YH 2J97A 1FLEE 1HYLA 4E06H 1Z71A 2VJ1A 3DUXH 1YPMH 2TGDA 2Q6FA 3DSOA 3WWBA 1AD8H 1CQQA 1SPJA 1UJ1A 2F9PA 4Y8ZA 1TRYA 2ZP0H 1TE0A 3KCGH 5B6OA 2VH6A 4WMFA 1ZGIA 2TRMA 3TJUA 1HAYB 2B0FA 1K22H 5B6LA 2GZ9A 3R3GB 2CGAA 3A80A 3E1XB 4AFZA 3GDUA 3ENSB 2QV1A 3GY6A 1ZTJA 4TSFD 1LHCH 1CT4E 1MU6B 2F43B 4BNRA 1GWAA 1QURH 1GMDF 2VH0A 1CA0B 3U1JB 3S69A 1BA8B 2SGAA 2IPQX 4GCHG 1RXPA 2WPLS 2V7QD 3UR6A 4I7YH 3ZV8A 2RA3A 5A09A 3VFEA 2ZFFH 2VIPA 1J17T 2ZGXH 1A5HA 2B7DH 1QY6A 2PKAB 1ZHPA 2YMSD 3RU4T 1LVMA 2J95A 2WUCA 3LGIA 1SQOA 3A86A 1L2EA 2SNVA 2F91A 1O39A 1GBIA 2ZQ2A 1QHRB 2KR7A 1SFQB 1TMBH 1LQDB 2ZCLP 2FYRA 2A2XH 4AYYB 1H9HE 2QAAA 2PTNA 1SLWB 4Y71A 4DVAU 1FY1A 2VIOA 5T3HA 2Y7ZA 3LIWA 3I29A 3M7TA 3IG6B 1G2MA 1QBOA 1TIOA 1TX7A 1TQ7B 1AE8H 2ZEBA 2V3HH 1ELCA 1V2ST 4I32A 1M9UA 3BTWE 3FO8D 2I6QA 5C94A 4P02A 1AVGH 4ABJA 1C2JA 1G32B 1RIWC 2FZZA 4I8HA 1GJDB 1C2EA 2WPJS 3BG4B 6GCHG 2XRCA 1B0FA 1QJ7B 2VVVA 2LELA 4ZAEA 1FJSA 4IMQA 2C93B 3PROA 4YESB 3QLPH 4Y11E 4A5TS 4I8JA 1Q2WA 3M5MA 1TPAE 4IMZA 1E79D 4BAOB 3M3TA 3RXJA 1TRNA 2BDYA 3F68H 1O2HA 3PO1B 5DP7A 5GJ4B 2ULLA 1MCTA 5KEDA 3M5OA 3LGVA 1EPTC 2BDBA 4KTUA 3QTVH 1F5KU 1UVSH 4HG6A 4WXVA 2FP7B 3EDXB 2KZ4A 1CT0E 2BD3A 2FOAA 3Q3YA 4RKJB 5FX6A 2BVXH 2O8TA 3TH3H 4GVUA 2BVRH 5F6MA 1SI5H 1OWJA 1QBNA 2Z9IA 3MH6A 4ISHH 1DXWA 1GBMA 2XBVA 1H8DH 2A5KA 1YLNA 4IGDA 1C5SA 4IC5A 1E38B 1EB1H 2HALA 5EXNA 1W0JD 1MD8A 2SNWA 5C1UA 1SG8B 1BMLA 1GJ5H 3CS0A 1KLJH 2ZHWH 1DE7H 3HGPA 1GG6C 4HGCA 2BD5A 3MU4A 1EZQA 4O9VA 1P9UA 2QE7D 3ZZ3A 2D1JA 2KFWA 1LHFH 3E16B 1OYQA 3PLPA 1LVYA 4MNVA 1N8OB 1XXFA 5F03A 3PM3A 3QZQA 2QXJA 3SI4H 4A92A 1GBLA 1S84A 2FM2A 2JIZD 3QGJA 2ZCKP 4ISIH 1W13U 1H8IH 3D62A 3BIVH 1Z1IA 2BX3A 2ZDLA 2ZFSA 1HB0B 1O3DA 1C4V2 1BCUH 1L1NA 3MU0A 1Z8IB 4LZ1H 1OWIA 2QF4A 3RUOA 4X6OA 1WOFA 4Y7BA 1P0SH 3GY7A 4INLA 3UOPA 1KIGH 2DUCA 2Y5HA 1MBMA 1NROH 3UOUA 1LHGH 2ZU4A 4XD7D 1CGHA 4MPUA 2V35A 4FU8A 4ABBA 3MO6A 1GI2A 1LHEH 1O3LA 1C5XB 4MNYA 5T1VA 2FOMB 3V13A 3SJOA 1GI9B 5ETXA 2PUXB 1BHXF 1HNEE 3PB1E 3SUFA 4NIVA 1OHHD 3UAIC 5CHBA 2H6MA 3LT3A 2GJGA 4Y8XA 3FP8E 3ODFA 2CHAC 1V2NT 4Q63A 2PSYA 1GCTC 3DFJA 1ZHRA 4DT7B 2FS8A 3TJOA 1PPZA 5A8XA 4B76A 1MKWK 2QYIA 1S6FA 1Y5UT 3A8BA 3RXSA 1WU1A 1C1PA 1VITH 5DKMA 5E0JA 4WWYA 1BB0B 1SKYE 3AAVA 2PUQH 4TPYA 1HRTH 1KY9A 2ALVA 5C20A 4OS5A 1P2JA 2G55A 2R0KA 2YNAA 3EA8A 4BTIB 1D3DB 2FO9A 4AFQA 1F7ZA 1GMDG 3QUMP 4ZMAH 1PQAA 4TWWA 2Z9KA 1XVOA 3CS7A 1FN8A 2JDID 3M5LA 4LK4A 1SGNE 2XCNA 1YLCA 1BTZA 4BAKB 4K60A 1F0TA 3S9CA 2VWNA 1INCA 2ANWA 5EPYA 3V12A 3A82A 2HLDD 3KN2A 1V2UT 2ZHEH 1QGFA 3TLOA 4TPIZ 3OFND 3B23B 1C2MA 3QDZB 4KELA 1MTNB 3F2FA 4X8UH 4FUBA 4TT3D 1BIOA 4X1RU 2OC7A 1DOJA 1HAIH 3H7TA 1O3FA 1IQGA 1TGSZ 4WF8A 1GJ7B 1EJNA 4X1NU 1O5DH 1C2FA 1GHBF 1NU9A 2A5AA 3URDA 2Z7FE 4NA7A 1QA0A 1TA6A 4RI0A 3QK1A 3UNRA 1V2TT 1GCDA 3A7TA 1EZSC 1MH0A 1UK3A 1RGQA 1TNHA 1O5CB 1CSOE 1PQ8A 1FAXA 4AOQA 1O2ZA 1P03A 1ZSLA 3LH3A 5L2ZH 2GV7A 2LP6A 3P17H 2PSXA 2QF5A 4BXSA 1QB6A 1BMAA 3BTME 1VCPA 3IWMA 2PR3A 2OC1A 1NRNH 1O36A 1O2NA 4X2VA 1A0JA 3SI3H 3RDZA 1LDTT 1HXFH 4ZKOU 1K1MA 3TK9A 1JWTA 1NRPH 2ZDMA 4XFQA 4YLQH 2SGDE 1DXPA 1C5TA 1EJMA 2XBYA 3SOSA 6CHAC 2L6OA 1HJAB 1TMTH 2C8XB 1WXRA 1B0EA 1S85A 2FLRH 1SGCA 3GCHB 1FQ3A 3NK8A 4JZFH 1GDNA 3U28C 1GMCF 1BRCE 5DP4A 2EY4C 2RA0A 1OSSA 3OX7U 3PLKA 1ZOMA 1O2JA 1S83A 3FP7E 2AGGX 1JRTA 2M2AA 2ZPQA 4NIXA 3BTQE 3RXTA 1BMFD 2OLGA 1J14A 4OS4A 1MAXA 1ZYOA 2VB0A 1TOMH 3BSQA 2CXVA 2W6ID 3JZ2B 1TONA 4Y76A 3FFGA 2OCVB 5EODA 1BBRK 1XKAC 4DY7B 1Z6EA 2VWMA 4MNXA 3ZVDA 2BLWA 2XBXA 1T4VH 5EW2H 3G01A 1RFNA 1BOQA 4R8TB 2H5DA 1EP5A 1E1RD 4LZ4B 1DUEA 3ZVEA 1IHTH 1O5EH 2RDEA 2Z3CA 1AZZA 4Q4LA 2GMTC 3Q3XA 2AH4X 3GYLB 4FOUC 3ZIAD 1DM4B 3S7HB 3WWFA 1LCYA 2VINA 5A8ZA 3HKJB 2ANKH 4IC6A 2YOLA 2WHXA 4XDEA 3VPKA 1HAHH 1N6YA 1UCYK 4NSVA 3TGKE 4O3UA 1O3BA 1EOLA 1SLVB 1OWKA 2J94A 3SO3A 1O3NA 1CBWB 2AERH 1GHVH 2TPIZ 1QA7A 4NCYA 4YXWD 2AYWA 2QGRA 1W10U 3UFAA 1D6WA 2CF8H 1TX6A 3SU6A 3VB3A 1OYTH 2R2MB 2Y80A 1TWXB 4JYVH 4CRFA 5AFZH 2QN5T 1PPEE 1D9IA 4JZDH 2AMQA 1SGRE 4UD9H 1P05A 1VCQA 1O2KA 3RXMA 1FIZA 3K9XB 1P2NA 1H8HD 1A7SA 1NPMA 2VVCA 5F53A 1YF4A 1O2VA 2Y82A 3SZNA 1AB9B 1FDPA 1A3BH 1LTOA 4UFEH 2ZO3H 3ZZ5A 1GJ9B 5JBBS 3RC4A 1LMWB 4ASHA 5LPEA 1O34A 2F9OA 7KMEH 4TYDA 1KLIH 3RXCA 3RP2A 1O2IA 3HPTB 1THSH 4TY6A 5FL7D 3D23A 2D2DA 3R0FA 2WV4A 5C67A 4K1EA 1WCZA 3JZ1B 5JDUB 1ELBA 8ESTE 1YBWA 1OKXA 2VBCA 4I8LA 2JETB 3SV2H 2QC2A 4ZH8A 2BY5X 1DT2A 3SJIA 2Y81A 3LDXH 4CH2B 1A61H 2LPRA 4NIYA 1HAZB 5EU8A 3STIA 2FX4A 3HK6B 1AWHB 2P3TB 3T25A 1ZJDA 4YZUA 3TK5A 3K65B 1P3EA 1EAXA 2BDAA 3ODDA 3RXUA 1UTOA 1O2XA 1G2LA 4NFEA 1A1RA 5GIBA 5EJZA 3M3VA 2FOCA 2ZPRA 1C5YB 1GGDB 2GKVE 1ARBA 1BTUA 1J9CH 3WY8A 1O0DH 4DG4A 2ODQA 3K2UA 4UFFH 1OP8A 3ZZ9A 1P8VC 3C27B 1JXPA 1XUJA 1YCPK 1C5QA 2ZQ1A 2HVYB 5G4BA 1OOKB 1O3JA 3ZVFA 2A4OA 5CHAB 1O5BB 1MU8B 1WQVH 3UQOA 1XVMA 1FN6A 4B2AA 3LH1A 1HIAA 3A8AA 1V2KT 4U32A 1YWUA 1MAYA 4CHAC 2QF0A 1FMGA 1D4PB 2Q6DA 3PV4A 1ZMLA 3NRLA 4D7FA 3RC5A 2A31A 1NY22 2ZDKA 1YLDA 3P8OA 4IN1A 3MNXA 5GXPA 2XCFA 1UW7A 1QZ8A 4YM9A 5K0HA 3SGQE 3UR9A 1MKXH 2A4GA 2A7CA 3Q76A 1CO7E 1P09A 3ELAH 1GHBG 1KYNA 2ZHFH 1T31A 4B6EA 1UTMA 2OUAA 4IBLH 4JMYA 4OS2A 3BTTE 3GY8A 1EZUC 3ZZ6A 2WZQA 5EXLA 5C5OA 2XYAA 1TX8A 1UTNA 3E90B 5JBTA 2FDAA 2QA9E 3NCLA 1BUIA 2ODPA 3T5FH 2ANMH 4AB9A 4J1YA 1TBZH 3TVJB 1LPZB 4F49A 1NC6A 1X7AC 4TY7A 5H4IB 3RMNH 1W2KH 1C1QA 1DVAH 1Z6JH 2NU3E 3M61U 4H6TA 3SV9A 8LPRA 1WQSA 1ZZZA 2A32A 3MYWA 1NT1A 4K3JA 2FOFA 1EAUA 1J15A 2OQUA 1O2QA 1QL8A 4OGXA 3O8BA 1MD7A 3EGKH 1S0RA 3GCNA 2BXTH 2FIRH 3SORA 4CBNA 1ETTH 2YMSB 1K0HA 1QJ6B 1ZTLA 3ZZBA 3NKKA 1BTWA 9ESTA 1AFQC 2WUBA 1IQEA 3TJVA 1ID5H 1GMCG 3PMJA 5ESBA 2PKSC 2W3KA 3IITA 1O2WA 3MU1A 1C2GA 1GBBA 1NBME 3A84A 3ATIA 5AHGH 1SHHB 3N7OA 3LGTA 3BEIB 1P02A 2ZA5A 4E05H 5DP5A 5T6GA 2V3MA 1HAGE 1XXDA 2VWOA 1COWD 2PGBB 2O8UA 3P6ZB 4CREA 2ZGBH 1RRKA 2WPKS 2IPHA 3SNEA 2C90B 1FPCH 3CNRA 3LGUA 5A0BA 1D6RA 5C0UA 3PLBA 3OE7D 3QWCH 1ZLRA 2CK3D 3UUZA 7ESTE 1YC0A 3LOXA 1TPSA 2VIDA 2CMYA 4KGAA 2HVXA 5HYOA 3O8DA 1T8OA 3VB4A 1ETRH 1ELDE 3A85A 4NG9H 4DOQA 1UVTH 3T27A 2ZPSA 1VJ9U 4ZUHA 2IJD1 1MMJN 1AE5A 2BQ7B 4Y0ZE
chains in the Genus database with same CATH topology
1JIMA 1AN1E 2SGEE 3MWIU 3EQ0H 2XC0A 4K69A 3SN8A 1Y59T 2J9NA 4IW4E 2H2ZA 5C1XA 1DWBH 2ZU2A 5IDKA 1EAIA 1HV7A 1ARCA 2BZAA 3U1IB 2D26C 2BTCE 2JKHA 3ITIA 1DDJA 5C3NA 1SGQE 3LGWA 4HZHA 2GZ7A 1O3OA 2BQ6B 5GWZA 3A8CA 3A81A 5DO4H 4DIHH 2XNIA 4NSYA 4ABAA 7LPRA 2GCTB 2BD4A 2WYJA 3U9AH 1UK4A 3AASA 4O97A 3GYMA 1GJAB 1ANBA 1BTXA 1TBQH 4JCNA 3T28A 8GCHF 1GHYH 1LKAA 1ORFA 1C9PA 2QXHA 3SU5A 1TB6H 3VGCB 1EX3A 3NUMA 5E8EH 6ESTA 1QB9A 4U2WA 2NU4E 3KL6A 4MPVA 1FY3A 2M5TA 2GCHG 3BG8A 1NESE 1DY9A 1A5IA 1MTUA 2ZTXA 1HIAB 2O8MA 1K1NA 4YLUA 4WH8A 4D7GA 1H4WA 4UFGH 4ZXYH 4DURA 1QR3E 1P06A 4BXWA 1TGCA 2Z9JA 3HKIB 5DP6A 2AMDA 1GL0E 1O5AB 4Q7ZA 3QX5H 3RXEA 2ZGJA 3E6PH 7GCHG 2WPIS 1GVLA 3D65E 1DWCH 2CN0H 1O3CA 4Y79A 1EPTA 1HFDA 5DK1A 4X6MA 4CRAA 1Y8TA 2ZU3A 2SGFE 4UEHH 3SV6A 5AFYH 1ZPBA 1BT7A 4R0IA 4A1TA 3DD2H 1YPHC 2WPMS 1SGPE 4KKDA 1S82A 1T8NA 4VGCC 2Y7XA 4JZEH 1ESTA 4UE7H 1F92A 3GOVB 3AVZA 1BHXB 2EEKA 4BTTB 5PTPA 4XBDA 3TNTA 5LPRA 1K1LA 1S0QA 5JBCS 1ZRKA 3UNQA 1C5LH 3UQVA 1SBWA 1FONA 1YCPM 1LVBA 1UTLM 1EAWA 3BEUA 2BLOA 3ATMA 1D3QB 1MTSA 3OTJE 1DSTA 1ELAA 1GDQA 1VGCB 1GBKA 1AWFH 2P8OC 2UUFB 4JK5A 4WXIA 5DP9A 1O2YA 5HMAA 1K1IA 8KME2 3C1KA 4ZHAA 4ZKRU 3PMHB 3LJOA 3VXEH 1ZMJA 4JYUH 3F6UH 2H5CA 1BQYA 1LO6A 1A46H 4GSOA 1VJAU 2Y5FA 4ZHLU 1QRZA 2FEQH 2W7SA 4AGKA 1C2DA 3SV7A 1U6QA 3RXLA 5I46H 4ZKNU 1V2LT 3FAOA 2GDEH 1BRBE 2G4TA 1AO5A 3GICB 4X6NA 3A7YA 4WMDA 3M7QA 1C5RA 3U8TH 1CA8B 4MPWA 5FAHA 1G30B 1L4ZA 1UTPA 2ZF0H 5EPNA 2VIVA 1HAVA 2PHBA 4MNWA 4NWKA 2A2QH 1FNIA 4O03A 2Z3EA 3M35A 4MPXA 3U98H 1TFXA 2ILNA 2P95A 5F8XA 1AY6H 2YNBA 3RLWH 2QY0B 5LH8A 4AGJA 1ELVA 4WVPE 5DJ7A 5CMXH 2ZC9H 3KQDA 4Y0YE 2BHGA 3GY4A 2BXUH 2OBOA 4E7RG 2ZGHA 1P2OA 2GD4B 2F83A 4X1PU 4YOJA 1SLUB 1QRXA 3Q3KA 2HRVA 1DICA 5EOKA 2R9PA 3KEEA 1C9TA 5E2OA 1GJ6A 1SFIA 5FPSA 1OWHA 4MLFB 2ZDVH 3F9EA 3H7OA 4DJZB 5A0CA 1VZQH 2JH5D 3VB5A 2Y6TA 1QJ1B 1ABIH 1SGFA 2VVUA 3LJJA 1P2MA 4FU7A 1K1JA 3ZVGA 3TNSA 1IQNA 1MCVA 1RIWB 2HGTH 1C2LA 4B75A 2XWAA 1O2SA 2V0BA 4AYVB 2FWWA 2ODYB 4AORA 1CGIE 2H9EH 5C1YA 3SNBA 3RXGA 3SJKA 2FI4E 1UK2A 4KTCA 1C5OH 2R2WU 1JIRA 1EXFA 3QGNB 1CHGA 3ZYDA 1HLTH 1SOZA 4IS5A 1EPTB 3AW0A 4YO9A 2G00A 4XSKU 2W26A 3RMOH 1KXDA 1SGEE 3UPEA 3KQCA 1TNKA 4A6LA 4CRGA 1NFYA 3SU4A 3KQBA 3MH5A 3ZV9A 5FX5A 2BVSH 4OS6A 2BLQA 1QFKH 1O32A 1YGCH 5ABWA 1WV7H 2WYGA 2VIQA 4FUFA 3U8RH 1O3AA 2UUYA 1BJUA 1F5LA 1F2SE 4I31A 3ATLA 4D9QA 3ZZCA 2AS9A 1GG6B 1XX9A 2BY6X 2AIQA 4YTAA 1WBGB 1GJCB 1CHOF 4K2YA 3UREA 1S5SA 2HWLB 3PTBA 4BANB 5HGGA 3TPIZ 3I78A 4D9RA 5L2YH 3SUEA 4GHTA 2ALPA 1DSUA 2FESH 2ZHDA 3MH4A 3RXDA 1TBRH 3BTHE 1GL1A 1V2QT 3U69H 1GPZA 3VB7A 4A1VA 2Z94A 4XBBA 4Y7AA 1TPPA 1KXCA 2ZKSA 2BY7X 1GJ4H 3MNCA 4AFSA 1OWEA 1G37A 1B5GH 2DE9A 4K8YA 1GI5A 1BTPA 2UWOA 1JBUH 1K28D 2BD7A 5FPYA 4LOYH 1G9IE 2C8ZB 3TITA 2CV3A 1A2CH 1SGIB 1FY5A 2VGCC 3TH2H 1FAKH 1G3BA 3E91A 1DITH 1HAVB 1W7GH 2BD2A 3V3MA 1BBRE 1AFEH 1P2QA 1SVPA 1KDQA 3DFLA 3K6ZA 1A0HB 5C2ZA 5EGMA 4X8VH 1V2RT 3Q00A 1GBHA 1Z7KA 3FP6E 2BDGA 3M5NA 1C1WH 1P3CA 4D76A 1DUAA 3OY6U 2QF3A 1NFUA 1N1LA 4X2YA 1AZ8A 3KGPA 3SJ8A 4IN2A 4ABDA 2HNTC 4FUGA 3D49H 2CHAB 3O8RA 2EI8A 1GCTB 3KF2A 4K1SA 1AMHA 2BOHB 3BEFB 3GCOA 2J4IA 1GBCA 1DLEA 1ETSH 4X6PA 3BTGE 5LGOA 3EA7A 1TPOA 1UCYE 1ZJKA 1YPLH 4ABEA 5F8TA 5J4SA 1ZGVA 2BYAX 4CBOA 2I6SA 3A7WA 1GBFA 3RU4E 2FXRA 2A1DB 3EYDA 2STBE 2F9BH 1THPB 1FI8A 1O3MA 1W11U 2ZZUH 1YKTA 1CGJE 1QTFA 2GT8A 2V6NA 1KTSB 1YPKH 1DFPA 1O2GH 3FZZA 2FX6A 1E34B 2ZTYA 1O30A 1OP2A 1YPGH 1HBTH 4BAHB 4Q2KA 4I33A 4AN7A 1HGTH 1CA0C 1WSSH 2H1UA 1YP9A 3SUGA 2IN2A 1L1GA 1UVPA 3RXKA 3E0PB 1BBRH 1TQ0B 3BTEE 1IOEA 1DX5M 2FOBA 4FUHA 4B1TA 1TAWA 1TABE 1DPOA 1ELGA 1LHDH 3S7KB 4XBCA 5EG4A 3V7TA 2PKAA 3LU9B 1YM0A 1KXAA 1ELEE 3QN7A 1AHTH 4FUDA 2Z9LA 1FXYA 3F9HA 4ZROA 2Q6GA 1C2IA 4OS1A 4X1QU 1GI1A 3SHCH 2WV5A 2ZI2H 3RM2H 3VB6A 3BF6H 1ZHMA 4FU9A 3GISB 2HPPH 1QRWA 1P11E 4ISNA 1E35B 2A5IA 2HOBA 2IJOB 1ANCA 3DA9B 2B8OH 1UCYH 2BX4A 3F9GA 1G3DA 1OPHB 4DCDA 3UNSA 4ABFA 1HXEH 6CHAB 2G4UA 2OQ5A 2OINA 1CVWH 1V2WT 5GDSH 2Z6BD 3MTYA 1JOUB 3VGCC 5L30H 1NM6A 4GPGA 1K1OA 3RXRA 1BRAA 2THFB 3SQHE 3RXAA 2J92A 3BTKE 3BG4C 1ZR0A 2W5EA 3LGYA 5FHTA 4YOGA 4NA9H 2AMPA 1F0SA 2UUKB 1W3CA 3PMBB 1G3EA 1RTKA 1XUFA 2BDIA 1WTGH 1HUTH 1A3EH 5GCHF 3PO1C 1IQJA 4ABHA 2FOEA 5A2MH 3MI4A 3EA9A 1GBJA 1A5GH 2EI6A 4XE4A 4NA8A 1SMFE 1TNJA 1Q31A 1ZPCA 4B2CA 4GHQA 2FTLE 2FI3E 4B71A 2XWBI 2K1QA 3KHVA 3OU0A 1QIXB 2ZFTA 1QQUA 4AB8A 2PW8H 2GMTB 2J2UA 3NPSA 4AG2A 2ZHQH 3ZYEA 2NU0E 3ZZ7A 1T32A 2AGEX 1Z8JB 2PFEA 2VIWA 3ATKA 2FMJA 2JH0D 3MHWU 4FUJA 2KAIA 3P8NA 3Q77A 2ZG0H 3ZZDA 2AEIH 5A0AE 5JPMH 1MZAA 1PPGE 1P9SA 1ZSKA 2XXLA 1OX1A 1OP0A 1YCPH 1O33A 1GI3A 4CH8B 2BB4A 1GI7B 1K2I1 1C5VA 4UDWH 3ZVBA 1N8OC 1HCGA 3H5CB 2H9TH 3I77A 2O9QA 4XOJA 2DE8A 1LPKB 3T26A 1NFXA 4ZKSU 4FVBA 2HLCA 4MTBA 2P93A 3TK6A 3SU0A 1O2LA 4INHA 1VR1H 1ABJH 2VNTA 1IQFA 1ESAA 2A0QB 3SHAH 1SB1H 4I8GA 3VEQB 1LKBA 2Z3DA 3LC3A 1P57B 2QXGA 1MUEB 3RXIA 5I25A 4HTCH 1MQ6A 2SGQE 5FCRA 4A7IB 5K7RA 1KXEA 1E36B 1C1UH 3SNDA 2C4FH 2OC8A 4B74A 5BPEA 1NTPA 1IHSH 1O38A 3URCA 1ELTA 1P2IA 4E7NA 1AVXA 2G8TA 1PPBH 1XUKA 3M3SA 2TGPZ 1Z1JA 2HNTF 4SGAE 2B5TB 4NIWA 1TGNA 1GHAF 3KIDU 4YOIA 1C5MD 5E0GA 5T6FA 1PJPA 1YYY1 5EQSA 2FTMA 3TJNA 2GV6A 3HK3B 3BTDE 2OTVA 3M37A 1GBEA 2G5NA 3T29A 1PFXC 1UVUH 1ESBA 4ISLA 5HM9A 3SW2B 3OY5U 4K1TA 4WMEA 1IQMA 3PTNA 5F8ZA 2OBQA 3MNBA 1TALA 4LXBH 1T8MA 1THRH 4Q7YA 2Q1JA 1YPEH 1BMMH 3UIRA 4H6SB 4CHAB 3A7VA 1B7XB 2BD9A 4UONA 2SGPE 1ZMNA 4MG3A 4Y10E 1CU1A 1L0ZA 1ZRBA 1ZPZA 5AF9H 2C3SA 4X2XA 1GJBB 1Y5AT 3RM0H 3SU1A 5DPAA 1W14U 1MTWA 4H42U 1GHWH 1LQEA 3A87A 3LPRA 3NZIA 1PYTC 1Y3UA 5E0HA 1NRQH 2G51A 3MH7A 1GVKB 1DWDH 1C1SA 1NN6A 1BTYA 1ELFA 1SQTA 4WH6A 1MTNC 1T7CA 1F0RA 1PQ7A 3GCTF 5T6DA 2AGIX 3OYPA 1IQKA 1EP6A 2GZ8A 4FVDA 2XTTB 4KTSA 3ZZ4A 3BN9A 2HPQH 4AZ2B 3W94A 1BRUP 1O2MA 2OP9A 1TGBA 1TGTA 2OXSA 3PMAB 1V2JT 5EQRA 1SGFG 4AX9H 1BITA 2STAE 5TJXA 4OGYA 3L33A 4GUXA 1DANH 3CENA 1P2KA 1GI8B 3W95A 2ANYA 3LKWA 2UWLA 2R0LA 1XUGA 1NFWA 4Q80A 1MQ5A 1O5FH 1RTFB 4X8SH 1CT2E 1Y3VA 1BDAA 2KAIB 1GI0A 3QTOH 1AFQB 2EA3A 2TGAA 3STJA 1EJAA 1KLTA 2QXIA 2UUJB 2EC9H 2PKSB 2PLXA 3E3TA 2ZFPH 3ZZ8A 2C8YB 2RCEA 5IYTA 5EW1H 1D3TB 1P10A 3MMGA 1AIXH 1P04A 1HJAC 1SGDE 1O2PA 2G52A 4X0WU 2PWXA 1Z8GA 3O8CA 2J38A 1O3EA 4U30A 3GCHC 4ABIA 4CRDA 4Z0KA 5GCHG 3RXQA 2Z9GA 1GDUA 4THNH 1ANDA 3UWIA 1GI4A 3TH4H 4ESTE 3AAUA 1C1TA 3S0NA 1TA2A 1Y3XA 1BJVA 4MDSA 1O2UA 1IAUA 1EB2A 3RLYH 3P70B 4AFUA 4HFPB 4F4OC 2R3YA 1C4Y2 4J2YB 1Y3YA 2BD8A 1GJ8B 2AIPA 1S6HA 1EQ9A 1Z8RA 2PV9B 3GY3A 3P95A 3BIUH 2BQWB 1XUHA 3GY5A 3NXPA 4K8BA 1KSNA 4JZIA 2CF9H 1P12E 1RS0A 4BTUB 1V2PT 1QB1A 2PGQB 3NWUA 1C5NH 2OC0A 1FY8E 4ISOA 1EUFA 1N6XA 4GLYA 1GBAA 4AG1A 3K6YA 1K9OE 3ZVAA 2D8WA 1T4UH 1W0ZU 1YPHE 3EE0B 1IQHA 4B73A 1C5ZB 1O37A 4JZ1A 1FIWA 3ATWA 2ZDAH 4FUEA 1C5PA 3QZRA 4U01A 1HJ9A 2P94A 3ZZAA 5TCCA 2XW9A 2F3CE 1O2TA 1TMUH 2BM2A 2GP9B 1WUNH 1CBWC 3ESTA 1KXBA 1E37B 3UTUH 5JBAS 2VU8E 1DS2E 1UTKA 3MU5A 2FOGA 1V6DA 3MOCA 1UTQA 2A7JA 4FUIA 2J34A 3A88A 1EASA 2ZIQH 3M36A 4KP0A 1E0FD 3E0NB 4CRBA 1OWDA 1AKSA 4JYTA 3SJ9A 2H9HA 1QL9A 1FUJA 2EI7A 4D8NA 3UWJH 5BRRE 1QL7A 4FUCA 3TGIE 3SGAE 1LVOA 2GVFA 3SU2A 3SBKA 2OD3B 2A45B 1AB9C 1PQ5A 3RXFA 1GI6A 3HATH 4BAQB 5HM2A 3V0XA 2P3FH 1JRSA 5GPIB 5DG6A 1O3GA 2FPZA 1UTJA 1SGTA 3SV8A 5JB8S 4A1XA 1UHBA 1GHAG 1L4DA 1SLXB 1TNIA 1WTHD 4VGCB 2GDDA 2BOKA 8GCHG 1V2VT 2Y5GA 1SC8U 2JETC 3VXFH 2TIOA 4WY3A 1BMNH 1VITF 2G81E 2GTBA 2FYQA 2NU1E 4INKA 3GDVA 1AUTC 4MQAA 3A7ZA 3RXVA 3S9BA 5ESTE 1FPHH 2ZU5A 4NWLA 1LPGB 4B2BA 1MKWH 2C8WB 1HAXB 2ZGCA 3F9FA 3L6PA 2WPHS 2ZU1A 2O8WA 3TGJE 1HAOH 2P8OB 1DWEH 3BTFE 1SHYA 3SNCA 1GGDC 1PPHE 1ACBE 1GMHF 5FXLA 1J16A 1G36A 3GY2A 1H9IE 2RDLA 9LPRA 2ZWLH 5DGJA 1H9LB 2RG3A 4RKOB 1J8AA 2ZTZA 3SQEE 2IOTA 1C5WB 1PYTD 1UMAH 1HJ8A 5CHAC 4JK6A 1FY4A 3AW1A 3U8OH 3QO6A 2ESTE 1AUJA 3T2NA 1C1VH 1YPJH 1T8LA