2PKAB

Refined 2 angstroms x-ray crystal structure of porcine pancreatic kallikrein a, a specific trypsin-like serine proteinase. crystallization, structure determination, crystallographic refinement, structure and its comparison with bovine trypsin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
152
structure length
152
Chain Sequence
ADGKDYSHDLMLLRLQSPAKITDAVKVLELPTQEPELGSTCEASGWGSIEPGPDDFEFPDEIQCVQLTLLQNTFCADAHPDKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWIDDTITENP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine proteinase
molecule keywords KALLIKREIN A
publication title Refined 2 A X-ray crystal structure of porcine pancreatic kallikrein A, a specific trypsin-like serine proteinase. Crystallization, structure determination, crystallographic refinement, structure and its comparison with bovine trypsin.
pubmed doi rcsb
source organism Sus scrofa
total genus 29
structure length 152
sequence length 152
chains with identical sequence Y
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 1984-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2pkaB00
3UQOA 1G3EA 3A82A 3A88A 1THSH 4X2YA 2BY7X 1CBWB 2C8YB 2AGIX 1TLDA 4CRDA 5DP5A 1TMUH 2SGAA 2ZDKA 1FDPA 5DP3A 1C5ZB 3P95A 3BIUH 1SGYE 1AVWA 3U8OH 3SQEE 2V3OH 4IGDA 4E7RG 1ABIH 4BTIB 3E90B 3MNCA 3MU8A 2BMGB 1O33A 3LC3A 3EA8A 1WCZA 1FLEE 3G01A 2BY5X 1XUJA 4CR9A 1BTYA 4ABIA 3RC6A 2GTBA 2TBSA 1QRZA 3M35A 1SGFA 3VXFH 1VZQH 3NWUA 5HM9A 4LXBH 2VU8E 3BTEE 4YOGA 3UUZA 4Z6AH 4LK4A 3E0NB 1QIXB 2FS9A 4D7FA 5C1UA 1QL8A 1CHGA 1LKAA 1MH0A 3HGNA 3LOXA 4FVBA 2FODA 4TWYA 2PTCE 1VCQA 3RC5A 1GMDG 5DP7A 4IC6A 1CE5A 2DUCA 2BDYA 1SI5H 3K6ZA 1RTKA 2VINA 1FNIA 1BRBE 3PMHB 2XW9A 1L4DA 4NCYA 3V3MA 2IOTA 1G9IE 3TGJE 2P95A 1YF4A 3BTFE 4MPVA 2XNIA 1MCVA 1A0LA 2VVUA 1C5WB 4NA8A 4FUIA 1ELEE 4X2WA 1OXGA 2W5EA 2W7UA 2A5AA 3VB7A 1S0RA 1GBEA 1FZZA 4ZAEA 1Z1JA 2Z9IA 5L30H 4AYYB 1BMNH 3KCGH 3MU0A 1AWHB 1ZSKA 1TPAE 3KQBA 1TNIA 4X6NA 3TPIZ 5HGGA 4JZEH 2FPZA 1K1NA 2BVSH 4Y8ZA 2FEQH 4IW4E 4NSVA 4ZXYH 5LPFA 1O3CA 4U01A 1A3EH 1GHBG 1INCA 4K3JA 2JH0D 1CGHA 1ZTJA 3RM0H 1O2UA 1GI5A 5E2OA 3P92A 1MTVA 1FONA 5FPYA 1ZMNA 3SJKA 7KMEH 2BQ7B 4ZMAH 3T62A 1H8DH 1IQEA 2FOEA 2C8ZB 1VITF 1BTPA 1O3EA 1THPB 1GMCG 3RXGA 2VGCB 4X2XA 1MD8A 4TWWA 2PV9B 2GMTB 2WPKS 5EOKA 1XUFA 4ZKNU 2ZF0H 1XUHA 3P70B 4MLFB 1LHFH 2ZPSA 4UFEH 4F4OC 5K0HA 3VB6A 4LZ1H 2O8UA 1V2PT 1YM0A 1GDNA 1GBMA 3PTBA 1ELAA 2PGQB 5JYIA 4NWLA 1H1BA 2R3YA 4FUGA 1C5OH 5F8ZA 1QJ6B 1BTHH 3Q76A 1GVLA 2ANMH 2EI6A 4J2YB 1B0EA 2GT7A 2G8TA 3S9BA 1TBRH 1GJCB 3A80A 5C3NA 2TGPZ 1O3JA 2ZKSA 1LPZB 3ZVEA 1IQNA 3NPSA 1MU8B 3E1XB 4GHTA 2FTLE 4OS5A 5LH8A 4GCHF 7GCHF 4ISHH 1AVGH 4WH8A 4CHAC 1BB0B 2FOBA 2OC1A 1SGTA 1O3DA 3GYMA 1VR1H 1W11U 2OTVA 2TGTA 3RU4D 1C1OA 1KDQB 2JH5D 2HALA 3TH3H 3JZ2B 4ABFA 1QFKH 2ANKH 3AVZA 2AMDA 1O2YA 1BMAA 1Y3WA 1Y5BT 2CHAC 3TK5A 1LKBA 2WV5A 2ZFQH 2ZG0H 4BXSA 4Y7AA 4Y76A 1YPMH 2EI8A 1EAWA 3RXCA 1QGFA 1MAYA 1BUIA 2STAE 3RXBA 1CA0B 2ZTZA 5GIBA 3MOCA 2O8LA 4QT8C 1SPJA 1WTGH 3RMMH 2A45B 3BTWE 1GWAA 1O2XA 3VGCC 1WQVH 1IHTH 1O3NA 3RXEA 2W26A 1DXWA 1PPEE 1Y3YA 1AUTC 1EKBB 1P10A 1J16A 2G81E 1IQLA 1N8OC 1OP2A 3UTUH 1PJPA 1DSTA 4JYTA 4KTUA 1Z8JB 2STBE 2Y80A 3BEIB 2RDLA 2BY9X 5EU8A 1T4VH 2F9BH 1C5XB 1SHYA 3V13A 4A1XA 1BMMH 5EXLA 2OXSA 1O5EH 2ULLA 3SU0A 4UFDH 1TX6A 3Q77A 2GDEH 1TAWA 2B0FA 5TCAA 3PLBA 3M5LA 2ODPA 1O2VA 3TU7H 1PYTC 2O8TA 1GBFA 2QYIA 3U9AH 3OY6U 1P3CA 2BX4A 1HB0B 2D1JA 2IN2A 1ORFA 3BEUA 1DWBH 1K1MA 1LVOA 1V2TT 1HAZB 4X8UH 5EODA 3MI4A 1VCPA 2Q1JA 3AAUA 1SGQE 1W8BH 1XVOA 1K22H 1RIWB 4MNVA 4OS6A 2FS8A 3T25A 5A09A 3TK6A 5L2ZH 4ISNA 2V0BA 1AZ8A 1YPJH 3MH7A 1EP6A 4DURA 1GDUA 5FCRA 1SHHB 3URCA 2Y7ZA 1BZXE 4ABGA 1ZJKA 4A1VA 1PPHE 3CS7A 3ZZ4A 1DS2E 2A5IA 5CHAB 3URDA 2QAAA 1KDQA 4O3UA 2QC2A 3PROA 1DE7H 5CHAC 2F9OA 1Z8IB 4NIWA 4JK6A 2V6NA 3RXQA 2QA9E 1F2SE 2FOHA 1NFXA 1NY22 2TPIZ 4TY6A 3GY2A 1TNGA 1ZMJA 2ZNKH 3ZVCA 2OLGA 1XMNB 3RUOA 3TJNA 4AOQA 2GV7A 1O30A 4MQAA 1QY6A 1GJ6A 3LGVA 2JETB 2ZHFH 4IN1A 2ZDMA 3KQCA 4AG2A 2XCFA 1EP5A 3W95A 2JETC 2BVXH 5E0GA 2ZTYA 3R0FA 1EZSC 1SFQB 2Z7FE 1DFPA 1F5LA 2A7CA 4DCDA 3E3TA 5T6GA 1TGTA 2ANYA 1XM1A 8KME2 1DWEH 3GYLB 1UMAH 1C5SA 3OX7U 3PWBA 3DD2H 3TVJB 4XBDA 3M5OA 1BTXA 1CO7E 3LH3A 1S84A 1O2LA 2Q6GA 3ZZ8A 1F0RA 2BXUH 1P09A 1D3QB 3KIDU 1GGDC 5EPYA 4YZUA 1OWKA 2BY6X 4ESTE 4TY7A 2ZU3A 1PQAA 3ZZDA 2GV6A 5TJXA 4CREA 2KAIB 4O3TA 1MQ6A 1E35B 1C1PA 3N7OA 1AFQC 2BYAX 1NESE 1L1JA 4D7GA 1EZXC 1OYQA 3QLPH 4Y79A 3GDVA 2SGPE 1BMLA 6ESTA 1TPSA 2J94A 1PPCE 3DA9B 3SHCH 1YCPH 3PYHA 2RG3A 1TPPA 4WVPE 2R2MB 2BD8A 1ZGIA 2Z9JA 2HNTC 3NCLA 3T29A 4KP0A 4HFPB 1IHSH 3T28A 3LGUA 1NT1A 3GY7A 5AHGH 1O5BB 4UFGH 4YT7H 1GG6B 4Y71A 1ZGVA 1ZPCA 1QNJA 2TGDA 3AW0A 3A8AA 3P8GA 1QQ4A 4K1TA 2CGAA 2J92A 1MTNC 4MNYA 3SU2A 1N6XA 1QHRB 1GJ4H 3ZVBA 1WTHD 4FUDA 2CJIA 1FN8A 3EA9A 2ZO3H 3ATWA 1SB1H 3HKIB 3AAVA 3LH1A 1W3CA 3MH5A 4X6PA 1HJAB 4CR5A 2WV4A 1QA0A 2AGGX 2P16A 1AUJA 2ZPRA 3GCNA 1O5GH 3LGWA 3SGBE 2FTMA 4X6MA 4FUFA 1NPMA 3VB5A 1EB1H 3EYDA 1AB9B 1F0UA 1ZZZA 2XTTB 1AKSB 4HTCH 2B5TB 2OP9A 1F0TA 1EB2A 2VVVA 2R3UA 2SGFE 4MG3A 1MKWH 1O36A 3RDZA 4X1RU 3CP7A 4ISLA 1JRTA 3UWIA 2GCHF 3RXVA 1IQFA 1XX9A 5AFZH 1BQYA 1XKAC 3S7KB 5C67A 3D23A 5LGOA 3A8BA 1CU1A 1KXDA 4RSPA 2JKHA 1FAXA 3BTDE 2BD5A 2VJ1A 1NRNH 2ZQ1A 1AHTH 1NFYA 3CENA 3E16B 3FANA 3MNXA 4FU8A 5GPIB 3TNTA 1B5GH 2GVFA 2DE8A 1K1JA 4FUEA 3C1KA 2VWLA 1MBQA 1ZHRA 2UWPA 2J95A 3A87A 5IYTA 3ENSB 2P3TB 4AX9H 1QBVH 2VH6A 4NZQA 5DP6A 4WMEA 1T8LA 2BD9A 4Y6DA 3M7QA 3RU4E 1C2IA 3M3VA 1QBOA 4A6LA 2P93A 1GHWH 2F3CE 3A81A 3BTKE 1FY1A 1Y3VA 4CRBA 2A31A 1E38B 1UTMA 2BOHB 1GVZA 3QUMP 1HAHH 3UNSA 4HGCA 2KAIA 2BZAA 2EEKA 1O0DH 5DP9A 1KTTB 1P11E 1ZTKA 2ZQ2A 1C2LA 1H9IE 2HRVA 1LVYA 3MHWU 2A7HA 3V0XA 1AY6H 1JIMA 1GDQA 3SOSA 6GCHF 1F92A 3ATMA 5ETXA 1UCYK 4KTSA 1O2NA 1BRAA 5A8XA 1WU1A 4ZXXH 3F9HA 5DG6A 3ZVAA 1C1RA 2GZ7A 1QL9A 3UFAA 2FXRA 1LHGH 2ZI2H 1HYLA 4AB8A 3S9CA 4UONA 1UCYH 2ZDLA 2ASUB 3NXPA 1LO6A 3OY5U 1GCTB 3KQEA 1OP8A 1MKXK 1EQ9A 1O2GH 4IMQA 1ELDE 1UTLM 3O8DA 1CGIE 1UVUH 4I8KA 2FI4E 3I78A 5JBBS 2FMJA 4H6TA 3KNXA 2XWAA 4SGBE 2ZU2A 4K8YA 3SJIA 1OWEA 3DUXH 2PUXB 4JZ1A 3FAOA 4LOYH 3ZVFA 4B74A 3PV4A 1AKSA 1MKXH 1PPGE 3I29A 3BTME 3UR9A 1QL7A 1ZRKA 3GY5A 4M7GA 5DO4H 1P9UA 4BANB 3CS0A 2ALVA 4GUXA 1T7CA 1P2NA 5T6DA 2PGBB 3HK6B 1UTNA 1C2HA 1FPHH 3DT0H 3EA7A 3ZZ5A 2BB4A 2CXVA 4OS2A 1UCYE 3RXPA 1EPTC 3UPEA 1P2QA 1TE0A 1B7XB 4GCHG 1BHXB 1FV9A 1SOTA 1ZR0A 4AG1A 2ESTE 1LQEA 3LIWA 1SGRE 5F8TA 1SOZA 1IQKA 3L33A 1TONA 1ZPBA 2D26C 1S82A 3QZQA 3HKJB 1QA7A 2PKSB 3E91A 3S69A 1T31A 2YNAA 1MQ5A 4YOJA 2AYWA 2OQUA 3M36A 1L4ZA 2PKSC 1YYY1 3GOVB 4CRAA 3RM2H 4RKOB 2BD3A 1Z1IA 3RXKA 2ODQA 4GVUA 4H6SB 1VCWA 2W7SA 3UNQA 4H4FA 2XBVA 1F0SA 2Z9GA 2VWMA 2QGRA 1F7ZA 1YP9A 1G36A 2G4UA 3MO9A 1P8VC 2AIPA 4U32A 1A1RA 1C1SA 3BEFB 3NKKA 4ZKRU 4NFEA 3SBKA 1V2QT 2VIWA 1J8AA 2ZFTA 2FLBH 3QK1A 1WV7H 3LJOA 3OU0A 3Q3XA 4OS4A 3HGPA 1BITA 1V2NT 1DOJA 2HPPH 2R0KA 3H7TA 1UVOA 1C5UA 5E0HA 3TITA 1NS3A 3F9GA 4BAQB 1HAGE 1C5QA 2PSXA 2RA0A 2ZFRH 2TIOA 2OCVB 2D2DA 2ZA5A 2C90B 1W7GH 5JBTA 3QX5H 1NU7B 4WJG2 1ZJDA 4XOJA 2FDAA 2GGVB 2WPIS 2XRCA 3ATIA 4IMZA 7ESTE 2C8XB 1TQ0B 4WF8A 3ODDA 1AFEH 4YESB 1YPHC 5T6FA 1C1WH 1JIRA 1YLCA 3I77A 5DGJA 5A0CA 3RXDA 1XKBC 3W94A 3BG8A 3U8TH 3KHVA 3ATLA 1UK3A 1YPKH 3P8FA 4WH6A 4CBNA 5A2MH 1GMHG 2VNTA 2AFQB 3OTJE 2ODYB 1S0QA 2ZGBH 2VH0A 5EW1H 3ELAH 1Z71A 4NFFA 3SU4A 2BTCE 3OYPA 1AN1E 2BLOA 1KXFA 1A0JA 4ZROA 2FI5E 1SGDE 2SGDE 3E6PH 3L3TA 4A1TA 1MTUA 2ZFPH 3MMGA 4GLYA 5FBIA 1BBRK 3RXSA 3ATKA 1V2KT 1A4WH 1MUEB 2F9UA 4A92A 4ZKOU 2UUJB 4I31A 2B9LA 2WYGA 1EATA 3FP8E 5C5OA 3ZYEA 1HRTH 1OPHB 1QR3E 1OWIA 1BBRH 2C8WB 5CMXH 1OSSA 3U1JB 3ITIA 4CHAB 2THFB 3SNAA 1TFXA 1BT7A 2BXTH 3UNRA 1ELFA 1O5DH 1KXAA 2Y6TA 4B2CA 2Y5HA 1ELVA 2OINA 4AFUA 1VGCC 2C3SA 3UWJH 1O3KA 4INHA 1M9UA 3FP6E 4DY7B 5BPEA 1TABE 2CHAB 2AEIH 1N6YA 5FHTA 1TGCA 2AMQA 3MU4A 4OGXA 3RLWH 3VPKA 2QXHA 1O3OA 1KSNA 1AIXH 2BQ6B 1HJ8A 2J34A 3U69H 1ETSH 1O2OA 2ZHQH 4AGKA 2XWBI 1JWTA 2VIQA 3VGCB 1KLIH 1BOQA 1MZAA 3A7WA 3A7YA 3EAJA 5DP8A 1BBRE 1SBWA 4YTAA 1AI8H 2W3IA 2H9EH 2Z94A 1HV7A 3UQVA 1ZOMA 1AO5A 1EOLA 2UUYA 1PQ8A 1N8OB 3SGQE 2LNCA 3O8BA 1Z7KA 3IWMA 3T5FH 2G52A 3BTTE 1G2MA 4ABHA 4K8BA 3AASA 2OBQA 1BDAA 2GDDA 1O37A 3S9AA 1MMJN 5PTPA 2HLCA 1TOCB 3SI3H 1NO9H 1C1TA 2PHBA 1D4PB 1SGCA 3LGYA 2PKAB 1CT0E 1WBGB 3STJA 1O3FA 2FOFA 3ZZBA 4KGAA 1H9HE 1S6HA 2ZECA 1DWCH 3UOPA 2Y81A 1YBWA 1O5AB 3M61U 3LGIA 5JB8S 1P2MA 1SG8B 2ZC9H 2F9NA 2BD2A 1PQ5A 5GDSH 4OS1A 2FO9A 2UWLA 3TK9A 1Y5UT 4UFFH 2FIRH 3FVFB 2IJOB 1C4Y2 4R0IA 1CA8B 1HAYB 1Y59T 3BG4C 3TGKE 1IQMA 1MTSA 3KEEA 1O5FH 4X8SH 4XE4A 2F9VA 1J17T 1DDJA 1O2WA 1K1IA 1SGPE 1EOJA 4TPIZ 3A86A 4WMFA 1GMCF 3PLPA 4DG4A 3LKWA 1DANH 3RXOA 4K69A 4I8JA 3BTQE 3EE0B 3SUDA 2A4GA 2BOKA 1RTLA 5TCCA 1O2RA 3RP2A 1EAUA 8GCHF 1ZHPA 3T26A 4B76A 1AMHA 1W0ZU 3QDZB 1ZRBA 2F91A 1D9IA 1P12E 1H4WA 2SGQE 5A0AE 2GCTC 4X8VH 1K2I1 1OS8A 4I8LA 1P2KA 4K1EA 3SNEA 3SU3A 4DT7B 1Q31A 1SGEE 4JZDH 1PYTD 7LPRA 3IG6B 2Z9KA 2ZEBA 5EQRA 3ZV9A 3SQHE 1YPGH 4ISIH 5DP4A 1LHEH 3SHAH 1GI6A 1O3PB 1LVMA 1NFUA 2A5KA 3M5MA 3GY6A 4BAHB 1O2KA 4NZLA 4XDEA 1GHVH 1SC8U 2JH6D 1QRWA 4X1PU 2A4OA 2FLRH 3MH4A 1UTOA 2CMYA 4BOHA 2ZZUH 2ZIQH 1NFWA 1S85A 1C5NH 2ZHEH 1OX1A 3QGJA 1DXPA 4WY3A 2J9NA 2LPRA 1D6RA 1O2TA 3SNDA 1GGDB 1K1OA 1RXPA 1ANDA 5JBAS 2ZHWH 1GVKB 2ZDNA 3NZIA 1DITH 1AFQB 1YCPK 2PKAA 1SGNE 5SGAE 4JYVH 1GI7B 2ZCHP 4X6OA 6LPRA 2P8OC 1EZQA 1FPCH 2PW8H 4FUJA 2GKVE 1Z8RA 4HZHA 4HI3A 4K5ZA 5F03A 1TMTH 4FXGH 2O9QA 4MPUA 4I8HA 1XUGA 2J38A 4I32A 1XVMA 4DGJA 1WOFA 1FY4A 1NM6A 3GCHC 5AVDA 3B8JA 4ZKSU 1G37A 4WMDA 1LVBA 3C27B 1AGJA 1GHYH 1O32A 1O5CB 4IN2A 1YC0A 1KTSB 1UVSH 1WYKA 1L0ZA 1MU6B 4NA9H 5DKMA 1SMFE 1HNEE 2GD4B 1MTNB 2VIVA 2QIQA 1U6QA 4Z0KA 2SGEE 1E0FD 1UJ1A 3SV9A 1TIOA 4JZIA 4X1QU 1BA8B 3V7TA 2ZGCA 1TNHA 1NRPH 1GL1A 3BIVH 4Y8YA 2WPHS 3A8DA 4X0WU 2Z9LA 4MPWA 4NIYA 3BTHE 3SORA 4D9RA 2G5VA 1HBTH 1WSSH 1V2OT 4ZHAA 3VB3A 1FI8A 1MKWK 3D62A 2FYQA 1GHAF 1S6FA 5FXLA 1THRH 2A2XH 3TH4H 4IBLH 3QTOH 4UE7H 1ETTH 1G2LA 1V2LT 5AF9H 1FN6A 1VJAU 3A84A 1GBLA 2NU4E 2ZWLH 4FU7A 2BQWB 3GISB 4A5TS 1EAIA 4B1TA 1HAPH 1SLXB 2J2UA 1P02A 2XBYA 4YOIA 3ZZ6A 1P05A 1QCPA 1GJDB 1V2MT 6CHAC 3ZZ7A 1JXPA 4DVAU 1GJBB 1UTJA 4H42U 1UK4A 2F9PA 1TBQH 1J14A 1SVPA 2F83A 1J15A 2C93B 2H2ZA 3RMOH 1C2JA 4DIHH 3LC5A 1TGSZ 1A7SA 4AFZA 2H9HA 4BTTB 2SNVA 3A7XA 3RMLH 4K2YA 4Q7XA 3RXAA 2QF0A 2OC7A 1HGTH 3QN7A 3MTYA 4FUBA 1C2EA 1LPKB 1SGFG 1EZUC 1LHDH 1HAOH 4DOQA 2ZHDA 2V3HH 5JPMH 2K1QA 3A83A 2SFAA 3RXRA 1DT2A 1EAXA 2NU2E 3U8RH 3BV9B 3M3TA 2WPLS 3PMJA 2FOGA 4THNH 1ANEA 4ZH8A 4X1NU 3UOUA 2XYAA 1WQSA 4KELA 1DUEA 2ZCLP 2H5DA 4CH2B 1TA2A 5ESBA 4U30A 4YLUA 1ESAA 3B9FH 1XXFA 3SU6A 1A5GH 5A0BA 1MBMA 4AB9A 4JYUH 2A0QB 5GXPA 2P94A 1KLTA 1ZYOA 2PSYA 1ZLRA 1EX3A 3K65B 3SJ8A 1MD7A 2P3FH 3DFJA 3FP7E 5HM2A 1GI8B 1SLVB 1FXYA 1TB6H 1TGBA 1TYNA 1YGCH 2XC5A 1UTPA 2QF3A 4RKJB 4U2WA 4CRGA 1JMOH 4AFQA 4B2AA 5EXMA 1HJ9A 1G32B 3GDUA 3ESTA 3SV6A 2FWWA 3GICB 5J4QA 5C1YA 4GAWA 1VITG 1TX8A 3PMBB 5J4SA 2BDHA 2UUFB 5I46H 1T32A 1Y3UA 3H7OA 1D3TB 2XCNA 1D3PB 4INKA 5L6NH 1QURH 1Y3XA 1AWFH 1NRSH 1C1NA 2ILNA 3E0PB 1TNLA 1EUFA 1OYTH 3VEQB 1PPFE 1NN6A 4K1SA 4GSOA 3A7ZA 2PLXA 4I8GA 5EG4A 2ZFFH 1Z6JH 2H1UA 4X1SU 3L6PA 3BTGE 2BLWA 4AORA 2YNBA 5H4IB 1A46H 1HDTH 2FX6A 1GBAA 2SNWA 1KIGH 4GPGA 4Y7BA 5EPNA 3TJOA 1PPZA 4DW2U 1TPOA 1L1NA 1A2CH 1P57B 3LT3A 1EPTB 3F1SB 1W7XH 2RCEA 2OBOA 2CV3A 1CBWC 5ESTE 2BM2A 4ZHMU 4WWYA 3HATH 3SO3A 7GCHG 2EI7A 4UEHH 1BRUP 2ZU5A 2B7DH 3HPTB 2PR3A 1CQQA 4JK5A 5FX5A 1KLJH 3SGAE 4JZFH 3QWCH 1O3BA 2HOBA 1V2JT 1AD8H 5A8ZA 3GY8A 4AGJA 1MCTA 1O2IA 2CF9H 3TIUA 4NIVA 1T4UH 1C1MA 1P06A 3SJ9A 2AS9A 1EASA 2Z3DA 3FZZA 1RD3B 3M7UA 2EC9H 2G00A 3RMNH 3F6UH 1PPBH 4ABDA 1UHBB 1TX7A 1BIOA 1QJ7B 1TA6A 1GL0E 2R2WU 1Z6EA 3DFLA 1FJSA 5FPSA 3LONA 2WUBA 3MO6A 2VIOA 1GPZA 4PROA 1XUKA 1CHOF 2J4IA 1Q2WA 4XSKU 1GJAB 3GCTF 3PLKA 4B71A 2GX4A 1DLKB 1HAVB 1NROH 1EJMA 1OOKB 1L2EA 1C4V2 1KYNA 2YOLA 3M5NA 3SI4H 1SLUB 1NRQH 2G5NA 3P8NA 3LJJA 2OUAA 3H5CB 5AFYH 1SSXA 1ZSJA 4FUCA 5C20A 1TRNA 2ZU1A 2BDIA 3GY3A 5FBEA 1C1QA 2I6SA 5ABWA 1C5YB 4LZ4B 1RRKA 1A5IA 1EJNA 4E06H 2ZTXA 3MFJA 1C5LH 1O2QA 2Z3CA 1O3IA 4B73A 2FOAA 2HPQH 4ABAA 1W10U 2FZZA 4BAKB 2NU0E 3MU5A 3TH2H 2BD7A 4E7NA 1S81A 4INLA 3SUGA 5GWZA 1GJ5H 4VGCB 1W0YH 1NTPA 1TWXB 3F9FA 4CRFA 3LU9B 3NK8A 3VXEH 4VGCC 5HMAA 3EDXB 3UY9A 1HIAB 3NUMA 1D3DB 3V12A 4FVDA 1ACBE 1GBBA 4JMYA 5GCHF 3TNSA 1C4U2 1JRSA 5EQSA 1SQTA 1HAIH 1ID5H 4Y0ZE 1QB1A 4TPYA 2C4FH 1RTFB 4FU9A 2W3KA 3A7VA 4X8TH 2BDAA 1SLWB 2VWOA 1ANBA 1CT4E 1DVAH 3RXFA 3ZVGA 5EXNA 1C5VA 3A8CA 1NZQH 4XBBA 3SW2B 2QXJA 5C5NA 1EPTA 2WPMS 2Y82A 1ARCA 3RXHA 1LMWB 4D76A 1HFDA 3SZNA 2QXIA 1QB9A 2PUQH 1OWHA 3O8RA 2G4TA 4DIIH 4CH8B 2VGCC 1ELTA 2ZCKP 1SL3A 2GMTC 1EJAA 1AU8A 4I33A 1ABJH 8GCHG 1GHXH 1ANCA 1C2GA 2WYJA 1VGCB 3F9EA 4UD9H 4MNWA 2WUCA 2TRMA 2BLQA 2UUKB 3RXJA 2I6QA 4AYVB 1UHBA 2ZGJA 3IITA 1MAXA 2Q6DA 3ODFA 1KXBA 2HNTE 5T3HA 1P0SH 1BHXF 1F5RA 3MU1A 1DSUA 2VWNA 4ABBA 3VB4A 1NRRH 1AE5A 1TMBH 1KY9A 3PMAB 4B75A 2V35A 4I7YH 1TALA 1HAVA 1OWDA 2VVCA 2OD3B 1E37B 1UVTH 1O39A 1ELCA 4MTBA 1QBNA 3MO3A 4ASHA 1GI3A 2AERH 2BDBA 1ZHMA 5HYOA 2ZP0H 2OC0A 2QN5T 1S83A 3KN2A 3SU1A 3TGIE 1RGQA 2ZDAH 1F5KU 3P17H 1YPLH 1RS0A 1GMDF 4AN7A 1G3BA 4Y0YE 2O8WA 5IDKA 1QQUA 9LPRA 2BDGA 2P3UB 3F68H 1J9CH 1CT2E 3LDXH 5FAHA 4CBOA 3STIA 1W12U 1L1GA 5EGMA 2BX3A 2H5CA 1FQ3A 1O2JA 2GP9B 1TRMA 4O03A 2QY0B 3ZZAA 4NA7A 3A7TA 2ZDVH 3Q3KA 1K1PA 1GI0A 1SGIB 3SNCA 4KTCA 1CA0C 1T8OA 3SNBA 1HUTH 4SGAE 1HIAA 3TLOA 1YLDA 1T8NA 3SV7A 1E36B 1DPOA 1H8IH 1GBCA 5CE1A 1W14U 1Y5AT 1C2MA 2A1DB 3M3SA 3MNBA 3QO6A 5FX6A 4BNRA 1V2UT 4YM9A 5A8YA 2WPJS 4FUHA 3U98H 3ZZ9A 2GT8A 4ISOA 4Y10E 3RXTA 1B0FA 3BG4B 5BRRE 1BJUA 3MNSA 3TJUA 3RXUA 5JDUB 2AGEX 2AIQA 1DX5M 5DJ7A 1GHBF 1FMGA 5JB9S 1O34A 1V2VT 1C9TA 4ZHLU 5B6OA 3PO1B 1P3EA 1HCGA 1GMHF 1SQOA 3LPRA 3PO1C 1ZTLA 1YKTA 4Q2KA 4BAOB 1YCPM 1GHAG 1GCDA 4CRCA 1YPEH 1ELBA 3FFGA 1CSOE 1GBTA 3FZDA 4IC5A 3ZZCA 1RJXB 1LHCH 1V2WT 1P9SA 3MYWA 3TJVA 3UIRA 2A32A 1VITH 1W2KH 1O2HA 3K6YA 4BTUB 1NC6A 1UO6A 2Y5GA 3ZYDA 1BTUA 1LTOA 1FUJA 5LPEA 3KQDA 2Z3EA 1ESTA 2GCTB 2QV1A 2OQ5A 1VJ9U 1CGJE 2GCHG 1V2ST 1RIWC 1CVWH 2HVXA 1E34B 1Q3XA 1BTWA 1OWJA 3KGPA 4GHQA 1DM4B 1KXEA 1FAKH 1GBDA 1GI1A 5FCKA 1O3GA 2AMPA 3P8OA 4Q7YA 3ZZ3A 3BSQA 1ARBA 2ZFSA 4ABEA 4AZ2B 1TBZH 1W13U 1C1VH 2BZ6H 4XFQA 4OS7A 1GBHA 1IQJA 3SN8A 3OSYA 2A2QH 2BVRH 1A5HA 1HXEH 5E8EH 3BN9A 2PTNA 1BRCE 3JZ1B 5E0JA 3S0NA 1O3MA 3PB1E 1GI4A 3SJOA 2XXLA 3S7HB 4MVNA 3M37A 1ETRH 4X2VA 1LDTT 1DICA 1O2MA 2XBWA 2B8OH 3Q00A 4D9QA 1K9OE 1V2RT 1GBJA 1A61H 1P2IA 3SU5A 1O31A 1FIWA 1BTZA 1C1UH 2Y5FA 3RC4A 4DJZB 1S5SA 2Q6FA 3GY4A 4UDWH 1LCYA 1UK2A 2P8OB 3D65E 5C1XA 1FY5A 1GJ9B 3E8LA 6GCHG 1DY8A 1K1LA 2O8MA 1P03A 2ANWA 1X7AC 1N1LA 3KF2A 4NSYA 1C5TA 3GCHB 3PM3A 1JOUB 2PWXA 1LQDB 1XXDA 1TGNA 4F49A 1HLTH 2NWNA 2H6MA 3AW1A 2GZ8A 5F8XA 4A7IB 3B23B 4AFSA 1GBKA 1C5MD 1MZDA 2CF8H 2DE9A 2HWLB 1V3XA 3EQ0H 1Y8TA 4Q7ZA 1GBIA 1UTQA 5FPTA 3WY8A 1V6DA 1HAXB 2ZGXH 3SV2H 2OC8A 1O2PA 1IOEA 4WXVA 1IAUA 8ESTE 3U1IB 2A4QA 1LPGB 3UREA 3T2NA 2BY8X 3R3GB 3ZV8A 4BXWA 2TGAA 2BLVA 2VB0A 2M5TA 2FOCA 4O9VA 1AE8H 1HPGA 2R9PA 4NWKA 2QCYA 1O2SA 4JCNA 4NGAH 1GI2A 2EA3A 1AQ7A 3K9XB 1GG6C 4XBCA 2GZ9A 1TNJA 2ZU4A 3DHKH 4NIXA 3T27A 2Y7XA 1O2ZA 1XUIA 1UTKA 2PFEA 1QRXA 1HXFH 1GHZA 1KXCA 2G51A 3MWIU 1BJVA 1H9LB 3RXLA 5L2YH 4K60A 3Q3YA 1SFIA 1OP0A 1NU9A 4RN6A 4WXIA 4Y8XA 6CHAB 4ZUHA 4O97A 1ESBA 1O3HA 1FIZA 1DUAA 1P2JA 1HJAC 4MDSA 4D8NA 3O8CA 1GJ8B 1EXFA 2A7JA 3ZVDA 8LPRA 1GJ7B 1PFXC 2ZGHA 3PTNA 1AB9C 1P01A 2CN0H 1YPHE 2XC4A 2XC0A 2A4RA 1O35A 5DPAA 1DWDH 2FI3E 1TRYA 3M7TA 3SV8A 1G3DA 4YT6H 1QB6A 1JBUH 1DLEA 1ZSLA 1P2OA 1P04A 3RXIA 2XBXA 2AH4X 3D49H 3QTVH 4Q80A 3A85A 2RA3A 4TYDA 2NU1E 1AVXA 1WUNH 2FM2A 3MH6A 5E2PA 1IQHA 1ZPZA 4ABJA 1CHOG 1GI9B 1MTWA 2ALPA 1BCUH 1OKXA 3P6ZB 2FP7B 1O38A 3GCTG 1IQGA 4B2BA 1O3AA 3GCOA 4E05H 1AZZA 1ELGA 3SUEA 5C2ZA 2WINI 1A3BH 3RU4T 1WAYB 1C2KA 3UR6A 2BDCA 2G55A 2FOMB 5DK1A 2FX4A 1G30B 1IQIA 5F6MA 2BHGA 3HK3B 2BD4A 4NG9H 1K28D 1ZMLA 1DY9A 4YO9A 4OGYA 1T8MA 4J1YA 3QZRA 5HXFA 1C5RA 4R8TB 1TOMH 1FY3A 2H9TH 3BF6H 5GJ4B 1C2DA 3VFEA 1C5PA 5LPRA 5K7RA 1RFNA 3K2UA 5I25A 1UVPA 3EGKH 3GDSA 4YLQH 1SQAA 1SR5C 3RXMA 2VIPA 1FY8E 3A89A 2D8WA 2HNTF 3SUFA 2P59A 4IS5A 3KL6A 3LGTA 5GCHG 2FESH 3RLYH 4MNXA 2NU3E 5EW2H 5G4BA 1K21H 1QTFA 2QXGA 3PWCA 4BAMB 5EQQA 1C2FA 1Z8GA 2VIDA 4KKDA 1D6WA 5JBCS 1G3CA 1QJ1B 1PQ7A 9ESTA 2Z6BD 4MPXA 1TQ7B 2ZPQA 2UWOA 1A0HB 2FYRA 2IPHA 3QGNB 1GCTC 4Y11E 1TNKA 2R0LA 1C9PA 2HGTH 1O3LA
chains in the Genus database with same CATH superfamily
3UQOA 1G3EA 3A82A 3A88A 1THSH 4X2YA 2BY7X 1CBWB 3FOAA 2C8YB 2AGIX 1TLDA 4CRDA 5DP5A 1TMUH 2SGAA 2ZDKA 1FDPA 5DP3A 1C5ZB 3P95A 3BIUH 1SGYE 1AVWA 3U8OH 3SQEE 2V3OH 4IGDA 5FL7D 4E7RG 1ABIH 4BTIB 3E90B 3MNCA 3MU8A 2BMGB 1O33A 3LC3A 3EA8A 1SQRA 1WCZA 1FLEE 3G01A 2BY5X 1XUJA 4CR9A 1BTYA 4ABIA 3RC6A 2GTBA 2TBSA 1QRZA 3M35A 1SGFA 3VXFH 1VZQH 3NWUA 5HM9A 4LXBH 2VU8E 3BTEE 4YOGA 3UUZA 4Z6AH 4LK4A 3E0NB 1QIXB 2FS9A 4D7FA 5C1UA 1QL8A 1CHGA 1LKAA 1MH0A 3HGNA 3LOXA 4FVBA 2FODA 2V7QD 4TWYA 2PTCE 1VCQA 3RC5A 1GMDG 5DP7A 4IC6A 1CE5A 2DUCA 2BDYA 1SI5H 3K6ZA 1RTKA 2VINA 1FNIA 2QF5A 1BRBE 3PMHB 2XW9A 1L4DA 4NCYA 3V3MA 2IOTA 1G9IE 3TGJE 2P95A 1YF4A 3BTFE 4MPVA 2XNIA 1MCVA 1A0LA 2VVUA 1C5WB 4NA8A 4FUIA 1ELEE 4X2WA 1OXGA 2W5EA 2W7UA 2A5AA 3VB7A 1S0RA 1GBEA 1FZZA 4ZAEA 3PV5A 1Z1JA 2Z9IA 5L30H 4AYYB 1BMNH 3KCGH 3MU0A 1AWHB 1ZSKA 1TPAE 3KQBA 1TNIA 4X6NA 3TPIZ 5HGGA 5EJLA 4JZEH 2FPZA 1K1NA 2BVSH 4Y8ZA 2FEQH 4IW4E 4NSVA 4ZXYH 5LPFA 1O3CA 4U01A 1A3EH 1GHBG 1INCA 5F53A 4K3JA 2JH0D 3H09A 1CGHA 1ZTJA 3RM0H 1O2UA 2WPDD 1GI5A 5E2OA 3P92A 1MTVA 1FONA 5FPYA 1ZMNA 3SJKA 7KMEH 2BQ7B 4ZMAH 3T62A 1H8DH 1IQEA 2FOEA 2C8ZB 1VITF 1BTPA 1O3EA 1THPB 1GMCG 3RXGA 2VGCB 4X2XA 1MD8A 4TWWA 4TT3D 2JDID 2PV9B 2GMTB 2WPKS 5EOKA 1XUFA 4ZKNU 2ZF0H 1XUHA 3P70B 4MLFB 1LHFH 3PRBA 2ZPSA 3FO8D 4UFEH 4F4OC 5K0HA 3VB6A 4LZ1H 2O8UA 5CDFE 1V2PT 1YM0A 1GDNA 1GBMA 3PTBA 1ELAA 2PGQB 5JYIA 4NWLA 1H1BA 2R3YA 4FUGA 1C5OH 5F8ZA 1QJ6B 1BTHH 3Q76A 1GVLA 2ANMH 2EI6A 4J2YB 1B0EA 2GT7A 2G8TA 3S9BA 1TBRH 1GJCB 3A80A 5C3NA 2TGPZ 1O3JA 2ZKSA 1LPZB 3ZVEA 1IQNA 3NPSA 1MU8B 3E1XB 4GHTA 2FTLE 4OS5A 5LH8A 2IPQX 2JIZD 4GCHF 4ISHH 1AVGH 4WH8A 7GCHF 3PRDA 1BB0B 4CHAC 2FOBA 2OC1A 1SGTA 1O3DA 3GYMA 1VR1H 3NRLA 1W11U 2OTVA 2TGTA 3RU4D 1C1OA 1KDQB 2JH5D 2HALA 3TH3H 3JZ2B 4ABFA 1QFKH 3SZEA 2ANKH 3AVZA 2AMDA 1O2YA 1BMAA 1Y3WA 1Y5BT 2CHAC 3TK5A 2V3MA 1LKBA 2WV5A 2ZFQH 2ZG0H 4BXSA 5C0UA 4Y7AA 4Y76A 1YPMH 2EI8A 1EAWA 3RXCA 1QGFA 1MAYA 1BUIA 2STAE 3RXBA 1CA0B 2ZTZA 5GIBA 3MOCA 2O8LA 4QT8C 3AK5A 1SPJA 1WTGH 3RMMH 2A45B 4P00A 3BTWE 1GWAA 1O2XA 3VGCC 5HIZA 1WQVH 1IHTH 1O3NA 2LP6A 3RXEA 2W26A 1DXWA 1PPEE 1Y3YA 1AUTC 1EKBB 2F43B 3MQKC 1P10A 1J16A 2XNDD 2G81E 1K0HA 1IQLA 1N8OC 4M9FA 1OHHD 1OP2A 3UTUH 1PJPA 1DSTA 3FN8A 4JYTA 4KTUA 1Z8JB 2STBE 2Y80A 3BEIB 2RDLA 2BY9X 5EU8A 1T4VH 2F9BH 1C5XB 1SHYA 3V13A 4A1XA 1BMMH 5EXLA 2OXSA 1O5EH 2ULLA 3SU0A 4UFDH 1TX6A 3Q77A 2GDEH 1TAWA 2B0FA 5TCAA 3PLBA 3M5LA 2ODPA 1O2VA 3TU7H 1PYTC 2O8TA 1GBFA 2QYIA 3U9AH 3OY6U 1P3CA 2BX4A 1HB0B 2D1JA 2IN2A 1ORFA 3BEUA 1DWBH 1K1MA 1LVOA 2KCOA 1V2TT 1HAZB 4X8UH 5EODA 3MI4A 1VCPA 2Q1JA 3AAUA 1SGQE 1W8BH 3FKSD 1XVOA 1K22H 1RIWB 4MNVA 4OS6A 2FS8A 3T25A 5A09A 3TK6A 5L2ZH 4ISNA 2V0BA 1AZ8A 1YPJH 3MH7A 1EP6A 4DURA 3OTPA 1GDUA 5FCRA 1SHHB 2K8IA 3URCA 2Y7ZA 1BZXE 4ABGA 1ZJKA 4A1VA 1PPHE 3CS7A 3ZZ4A 1DS2E 2A5IA 5CHAB 3URDA 2QAAA 1KDQA 4O3UA 2QC2A 3PROA 1DE7H 5CHAC 2F9OA 1Z8IB 2YMSD 4NIWA 4JK6A 2V6NA 2W6JD 3RXQA 2QA9E 1F2SE 2FOHA 1NFXA 1NY22 2TPIZ 4TY6A 3GY2A 5EIYA 1TNGA 1ZMJA 2ZNKH 3ZVCA 2OLGA 1XMNB 3RUOA 3TJNA 4AOQA 2GV7A 1O30A 4MQAA 1QY6A 1GJ6A 3LGVA 2JETB 2ZHFH 4IN1A 2ZDMA 3KQCA 4AG2A 2XCFA 1EP5A 3W95A 2JETC 2BVXH 5E0GA 2ZTYA 3R0FA 1EZSC 1SFQB 2Z7FE 1BMFD 1DFPA 1F5LA 1H8HD 2A7CA 4DCDA 3E3TA 5T6GA 1TGTA 2IJD1 2ANYA 1XM1A 8KME2 1DWEH 3GYLB 1UMAH 1C5SA 3OX7U 3PWBA 3DD2H 3TVJB 4XBDA 3M5OA 5GNDA 5KEDA 1BTXA 1CO7E 3LH3A 3VG8A 1S84A 1O2LA 1W0JD 2Q6GA 3ZZ8A 1F0RA 2BXUH 1P09A 1D3QB 3KIDU 1GGDC 5EPYA 4YZUA 1OWKA 2BY6X 4ESTE 4TY7A 2ZU3A 1PQAA 3ZZDA 2GV6A 5TJXA 4CREA 2KAIB 4O3TA 1MQ6A 1E35B 1C1PA 3N7OA 1AFQC 2BYAX 1NESE 1L1JA 4D7GA 1EZXC 1OYQA 3QLPH 4Y79A 3GDVA 2SGPE 1BMLA 5KGOA 6ESTA 1TPSA 2J94A 1PPCE 3DA9B 3SHCH 1YCPH 3PYHA 2RG3A 1TPPA 4WVPE 3F3BA 2R2MB 2BD8A 1ZGIA 2Z9JA 2HNTC 3NCLA 3T29A 4KP0A 4HFPB 1IHSH 3T28A 3LGUA 1NT1A 3GY7A 5AHGH 1O5BB 4UFGH 4YT7H 3GS9A 1GG6B 4Y71A 1ZGVA 1ZPCA 3OEED 1QNJA 2TGDA 2HVYB 3AW0A 5DN6D 3A8AA 3P8GA 1QQ4A 4K1TA 2CGAA 2J92A 1MTNC 4MNYA 3SU2A 1N6XA 1QHRB 1GJ4H 3ZVBA 1WTHD 2AHME 4FUDA 2CJIA 1FN8A 3EA9A 2ZO3H 3ATWA 1SB1H 3HKIB 3AAVA 3LH1A 1W3CA 3MH5A 4X6PA 1HJAB 4CR5A 2WV4A 1QA0A 2AGGX 5EJZA 2P16A 1AUJA 2ZPRA 3F2HA 1O5GH 3GCNA 3LGWA 3SGBE 2EQNA 2FTMA 4X6MA 4FUFA 1NPMA 3VB5A 1EB1H 3EYDA 1AB9B 1F0UA 1ZZZA 2XTTB 1AKSB 4HTCH 2B5TB 2OP9A 1F0TA 1EB2A 2VVVA 2R3UA 2SGFE 4MG3A 1MKWH 1O36A 3RDZA 4X1RU 3CP7A 4ISLA 1JRTA 3UWIA 2GCHF 3RXVA 1IQFA 1XX9A 5AFZH 1BQYA 1XKAC 3S7KB 5C67A 3D23A 5LGOA 3A8BA 1CU1A 1KXDA 1E1QD 4RSPA 5C0TA 2JKHA 2L6OA 1FAXA 3BTDE 2BD5A 2VJ1A 1NRNH 2ZQ1A 1AHTH 1NFYA 3CENA 3E16B 3FANA 3MNXA 4FU8A 5GPIB 3TNTA 1B5GH 2GVFA 5C94A 2DE8A 1K1JA 4FUEA 3C1KA 2VWLA 1MBQA 1ZHRA 4AC9A 2UWPA 2J95A 3A87A 5IYTA 3ENSB 2P3TB 4AX9H 1QBVH 2VH6A 4NZQA 5DP6A 4WMEA 1T8LA 2BD9A 4Y6DA 3M7QA 3RU4E 1C2IA 3M3VA 1QBOA 4A6LA 3PV2A 2P93A 1GHWH 2F3CE 3A81A 3BTKE 1FY1A 1Y3VA 4CRBA 2A31A 1E38B 3SYJA 1UTMA 2BOHB 1GVZA 3QUMP 1HAHH 3UNSA 4HGCA 2KAIA 2BZAA 2EEKA 1O0DH 5DP9A 1KTTB 1P11E 1ZTKA 2ZQ2A 1C2LA 1H9IE 2HRVA 1LVYA 3MHWU 2A7HA 4B6FA 3V0XA 1AY6H 1JIMA 1GDQA 3SOSA 6GCHF 1F92A 3ATMA 5ETXA 1UCYK 4KTSA 1O2NA 1BRAA 5A8XA 1WU1A 4ZXXH 3F9HA 5DG6A 3ZVAA 1C1RA 2GZ7A 1QL9A 3UFAA 2FXRA 1LHGH 2ZI2H 1HYLA 4AB8A 3OE7D 3S9CA 4UONA 1UCYH 2ZDLA 2ASUB 3NXPA 1LO6A 3OY5U 1GCTB 3KQEA 1OP8A 1MKXK 1EQ9A 1O2GH 4IMQA 1ELDE 1UTLM 3O8DA 1CGIE 1UVUH 4I8KA 2FI4E 3I78A 5JBBS 2FMJA 4H6TA 3KNXA 2XWAA 4SGBE 2ZU2A 4K8YA 3SJIA 1OWEA 3DUXH 2PUXB 4JZ1A 3FAOA 4LOYH 2WZQA 3ZVFA 4B74A 3PV4A 1AKSA 1MKXH 1PPGE 3I29A 3BTME 3UR9A 1QL7A 1ZRKA 3GY5A 4M7GA 5DO4H 1P9UA 4BANB 3F0OA 3CS0A 2ALVA 4GUXA 2WV9A 1T7CA 1P2NA 5T6DA 2PGBB 3HK6B 1UTNA 1C2HA 1FPHH 3DT0H 2WHXA 3EA7A 3ZZ5A 2EY4C 2BB4A 2CXVA 4OS2A 1UCYE 3RXPA 1EPTC 3UPEA 1P2QA 2RFKC 1TE0A 1B7XB 4GCHG 1BHXB 1FV9A 1SOTA 1ZR0A 4AG1A 2ESTE 1LQEA 2KR7A 1SGRE 3LIWA 5F8TA 1SOZA 1IQKA 3L33A 1YY3A 1TONA 1ZPBA 2D26C 1S82A 3OAAD 3QZQA 3HKJB 1QA7A 2PKSB 3E91A 1MABB 3S69A 1T31A 2YNAA 1MQ5A 4YOJA 2AYWA 2OQUA 3M36A 1L4ZA 2PKSC 1YYY1 3GOVB 4CRAA 3RM2H 4RKOB 2BD3A 1Z1IA 3RXKA 2ODQA 4GVUA 1KMHB 4H6SB 1VCWA 2W7SA 5EJ1A 3UNQA 4H4FA 2XBVA 1F0SA 2Z9GA 2VWMA 2QGRA 1F7ZA 1YP9A 1G36A 2G4UA 3MO9A 1P8VC 2AIPA 4U32A 3DSGA 1A1RA 1C1SA 3BEFB 3NKKA 3WWFA 4ZKRU 4NFEA 3SBKA 1V2QT 2VIWA 1J8AA 2ZFTA 2FLBH 3QK1A 1WV7H 3LJOA 3OU0A 3Q3XA 4OS4A 3HGPA 1BITA 1V2NT 1DOJA 2HPPH 2R0KA 3H7TA 1UVOA 1C5UA 5E0HA 3TITA 5HKKD 1NS3A 3F9GA 4BAQB 1HAGE 1C5QA 2PSXA 2RA0A 2ZFRH 2TIOA 2OCVB 2D2DA 5IK2D 2ZA5A 2C90B 1W7GH 5JBTA 3QX5H 1NU7B 4WJG2 1ZJDA 4XOJA 2FDAA 2GGVB 2KCPA 2WPIS 2XRCA 3ATIA 4IMZA 7ESTE 2C8XB 1TQ0B 4WF8A 3ODDA 1AFEH 4YESB 1YPHC 5T6FA 1C1WH 1JIRA 1YLCA 3I77A 5DGJA 5A0CA 3RXDA 1XKBC 3W94A 3BG8A 3N7DA 3U8TH 3KHVA 3ATLA 1UK3A 1YPKH 3P8FA 4WH6A 4CBNA 5A2MH 1GMHG 2VNTA 2AFQB 3OTJE 4ACBA 2ODYB 1S0QA 2ZGBH 2VH0A 5EW1H 3ELAH 1Z71A 4NFFA 3SU4A 2BTCE 3OYPA 1AN1E 2BLOA 1KXFA 2QF4A 1A0JA 4YXWD 4ZROA 2FI5E 1SGDE 2SGDE 3E6PH 3L3TA 4A1TA 1MTUA 2ZFPH 3MMGA 4GLYA 5FBIA 1BBRK 3RXSA 3ATKA 1V2KT 1A4WH 1WDIA 1MUEB 2F9UA 4A92A 4ZKOU 2UUJB 4I31A 2B9LA 2WYGA 1EATA 2J5UA 3FP8E 5C5OA 3ZYEA 1HRTH 1OPHB 1QR3E 1OWIA 1BBRH 2C8WB 5CMXH 1OSSA 3U1JB 3ITIA 4CHAB 2THFB 3SNAA 1TFXA 1BT7A 2BXTH 3UNRA 1ELFA 1O5DH 1KXAA 2Y6TA 4B2CA 2Y5HA 1ELVA 2OINA 4AFUA 1VGCC 2C3SA 3UWJH 1O3KA 4INHA 1M9UA 3FP6E 4DY7B 5BPEA 1TABE 2CHAB 2AEIH 1N6YA 5FHTA 1TGCA 2AMQA 3MU4A 4OGXA 3RLWH 2JJ2D 3VPKA 2QXHA 1O3OA 1KSNA 1AIXH 3DSPA 2BQ6B 1HJ8A 2J34A 3U69H 1ETSH 1O2OA 2ZHQH 4AGKA 2XWBI 1YWUA 1JWTA 2VIQA 3VGCB 1KLIH 1BOQA 1MZAA 3A7WA 3A7YA 3EAJA 5DP8A 1BBRE 1SBWA 4YTAA 1AI8H 2W3IA 2H9EH 2Z94A 1HV7A 3UQVA 1ZOMA 2L74A 1AO5A 1EOLA 2UUYA 1PQ8A 1N8OB 3SGQE 2LNCA 3O8BA 1Z7KA 3IWMA 3T5FH 2G52A 3BTTE 1G2MA 4ABHA 2GJGA 4K8BA 2CK3D 3AASA 2OBQA 1BDAA 2GDDA 1O37A 3S9AA 1MMJN 5PTPA 2HLCA 1TOCB 5CHBA 3SI3H 1NO9H 1C1TA 2PHBA 5T1VA 1D4PB 1SGCA 3LGYA 2PKAB 1CT0E 1WBGB 3STJA 1O3FA 2FOFA 3ZZBA 4KGAA 1H9HE 1S6HA 2ZECA 1DWCH 3UOPA 2Y81A 1YBWA 1O5AB 3F2FA 3M61U 3LGIA 5JB8S 1P2MA 1SG8B 2ZC9H 2F9NA 2BD2A 1PQ5A 5GDSH 4OS1A 2FO9A 2UWLA 3TK9A 1Y5UT 4UFFH 2FIRH 3FVFB 2IJOB 1C4Y2 4R0IA 1CA8B 1HAYB 1Y59T 3BG4C 2YMSC 3TGKE 1IQMA 1MTSA 3KEEA 1O5FH 4X8SH 4XE4A 2F9VA 1J17T 1DDJA 1O2WA 1K1IA 1SGPE 1EOJA 4TPIZ 3A86A 4WMFA 1GMCF 3PLPA 4DG4A 3LKWA 1DANH 3RXOA 4Z1MD 4K69A 2J97A 4I8JA 3BTQE 3EE0B 3SUDA 2A4GA 2BOKA 1RTLA 5TCCA 1O2RA 3RP2A 1EAUA 8GCHF 1ZHPA 3T26A 4B76A 1AMHA 1W0ZU 3QDZB 1ZRBA 2F91A 1D9IA 1P12E 1H4WA 2SGQE 5A0AE 2GCTC 4X8VH 1K2I1 1OS8A 4I8LA 1P2KA 4FETA 4K1EA 3SNEA 3SU3A 1SKYE 4DT7B 1Q31A 1SGEE 4JZDH 1PYTD 7LPRA 3IG6B 2Z9KA 2ZEBA 5EQRA 3ZV9A 3SQHE 1YPGH 4ISIH 5DP4A 1LHEH 3SHAH 1GI6A 4TSFD 1O3PB 1LVMA 1NFUA 3UB0A 2A5KA 3M5MA 3GY6A 4BAHB 1O2KA 4NZLA 4XDEA 1GHVH 1SC8U 2JH6D 1QRWA 4X1PU 2A4OA 2FLRH 3MH4A 1UTOA 2CMYA 4BOHA 2ZZUH 2ZIQH 1NFWA 1S85A 1C5NH 1E79D 2ZHEH 1OX1A 3QGJA 1DXPA 4WY3A 2J9NA 2LPRA 1D6RA 1O2TA 3SNDA 1GGDB 1K1OA 1RXPA 1ANDA 5JBAS 2ZHWH 1GVKB 2ZDNA 3NZIA 1DITH 1AFQB 1YCPK 2PKAA 2KFWA 1SGNE 5SGAE 4JYVH 1GI7B 2ZCHP 4X6OA 6LPRA 2P8OC 1EZQA 1FPCH 2PW8H 4FUJA 2GKVE 1Z8RA 4HZHA 4HI3A 4K5ZA 5F03A 1TMTH 4FXGH 2O9QA 4MPUA 4I8HA 4XRNA 1XUGA 2J38A 4I32A 1XVMA 4DGJA 1WOFA 1FY4A 1NM6A 3GCHC 5AVDA 3B8JA 4ZKSU 1G37A 4WMDA 2KCAA 1LVBA 3C27B 1AGJA 1GHYH 1O32A 1O5CB 4IN2A 1YC0A 1KTSB 1UVSH 1WYKA 1L0ZA 1MU6B 4NA9H 5DKMA 1SMFE 1HNEE 2GD4B 1MTNB 2VIVA 2QIQA 1U6QA 4Z0KA 2SGEE 1E0FD 1UJ1A 3SV9A 1TIOA 4JZIA 4X1QU 1BA8B 3V7TA 2ZGCA 1TNHA 1NRPH 1GL1A 3BIVH 4Y8YA 2WPHS 3A8DA 4X0WU 2Z9LA 4MPWA 4NIYA 3BTHE 3SORA 4D9RA 1YLNA 1HBTH 1WSSH 1V2OT 2G5VA 4ZHAA 3VB3A 1FI8A 1MKWK 3D62A 2FYQA 1GHAF 1S6FA 5FXLA 1THRH 2A2XH 3TH4H 4IBLH 3QTOH 4UE7H 1ETTH 1G2LA 1V2LT 3N7EA 5AF9H 1FN6A 1VJAU 3A84A 2J98B 1GBLA 2NU4E 2ZWLH 4FU7A 2BQWB 3GISB 4A5TS 1EAIA 4B1TA 1HAPH 1SLXB 2J2UA 1P02A 2XBYA 4YOIA 3ZZ6A 1P05A 1QCPA 1GJDB 1V2MT 6CHAC 3ZZ7A 1JXPA 4DVAU 1GJBB 1UTJA 4H42U 1UK4A 2F9PA 1TBQH 1J14A 1SVPA 2F83A 1J15A 2C93B 2H2ZA 3RMOH 1C2JA 4DIHH 3LC5A 1TGSZ 1A7SA 4AFZA 2H9HA 4BTTB 2SNVA 3A7XA 3RMLH 4K2YA 4Q7XA 3RXAA 2QF0A 2OC7A 1HGTH 3QN7A 3MTYA 4FUBA 1C2EA 1LPKB 1SGFG 1EZUC 1LHDH 1HAOH 4DOQA 2ZHDA 2V3HH 5JPMH 2K1QA 3A83A 2SFAA 3RXRA 1DT2A 1EAXA 2NU2E 3U8RH 3BV9B 3M3TA 5HIYA 2WPLS 3PMJA 2FOGA 4THNH 1ANEA 4ZH8A 4X1NU 3UOUA 2XYAA 1WQSA 4KELA 1DUEA 2ZCLP 2H5DA 4CH2B 1TA2A 5ESBA 4RI0A 4U30A 4YLUA 1ESAA 3B9FH 1XXFA 3SU6A 1A5GH 5A0BA 1MBMA 4AB9A 4JYUH 2A0QB 5GXPA 2P94A 1KLTA 1ZYOA 2PSYA 1ZLRA 1EX3A 3K65B 3SJ8A 1MD7A 2P3FH 3DFJA 1QZ8A 3FP7E 5HM2A 1GI8B 1SLVB 1FXYA 1TB6H 1TGBA 1TYNA 1YGCH 2XC5A 1UTPA 2QF3A 4RKJB 4U2WA 4CRGA 1WXRA 1JMOH 4AFQA 4B2AA 5EXMA 1HJ9A 1G32B 3GDUA 2HLDD 3ESTA 3SV6A 2FWWA 3GICB 5J4QA 5C1YA 4GAWA 1VITG 1TX8A 3PMBB 5J4SA 2BDHA 2UUFB 5I46H 1T32A 1Y3UA 3H7OA 4DT4A 1D3TB 3KQ5A 2XCNA 1D3PB 4INKA 5L6NH 1QURH 1Y3XA 1AWFH 1EFRD 1NRSH 1C1NA 2ILNA 3E0PB 1TNLA 1EUFA 1OYTH 3VEQB 1PPFE 1NN6A 2J98A 4K1SA 4GSOA 3A7ZA 2PLXA 4I8GA 5EG4A 2ZFFH 1Z6JH 2H1UA 4X1SU 3L6PA 3BTGE 2BLWA 4AORA 2YNBA 5H4IB 1A46H 1HDTH 2FX6A 1GBAA 2SNWA 1KIGH 4GPGA 4Y7BA 5EPNA 3TJOA 1PPZA 4DW2U 1TPOA 1L1NA 1A2CH 1P57B 3LT3A 1EPTB 3F1SB 2LELA 1W7XH 2RCEA 2OBOA 2CV3A 1CBWC 5ESTE 2BM2A 4ZHMU 4WWYA 5B6LA 3HATH 3SO3A 7GCHG 2EI7A 4UEHH 1BRUP 2ZU5A 2B7DH 3HPTB 2PR3A 1CQQA 4JK5A 5FX5A 1KLJH 3SGAE 4JZFH 3QWCH 1O3BA 2HOBA 1V2JT 1AD8H 5A8ZA 3GY8A 4AGJA 1MCTA 1O2IA 4B6EA 2CF9H 4I86A 3TIUA 1NBME 4NIVA 1T4UH 1C1MA 1P06A 3SJ9A 2AS9A 1EASA 2Z3DA 3KYFA 3FZZA 1RD3B 3M7UA 2EC9H 2G00A 3RMNH 3F6UH 1PPBH 4ABDA 1UHBB 1TX7A 1BIOA 1QJ7B 3KYGA 1TA6A 1GL0E 2R2WU 1Z6EA 2K0QA 3DFLA 1FJSA 5FPSA 3LONA 2WUBA 3MO6A 2VIOA 1GPZA 4PROA 1XUKA 1CHOF 2J4IA 3U28C 1Q2WA 4XSKU 1GJAB 3GCTF 3PLKA 4B71A 2GX4A 1DLKB 1HAVB 1NROH 1EJMA 1OOKB 1L2EA 1C4V2 1KYNA 2YOLA 3M5NA 3SI4H 1SLUB 1NRQH 2G5NA 3P8NA 3LJJA 2OUAA 3H5CB 5AFYH 1SSXA 1ZSJA 4FUCA 5C20A 1TRNA 2ZU1A 2BDIA 3GY3A 5FBEA 1C1QA 2I6SA 5ABWA 1C5YB 4LZ4B 1RRKA 1A5IA 1EJNA 4E06H 2ZTXA 2QE7D 3MFJA 1C5LH 1O2QA 2Z3CA 1O3IA 4B73A 2FOAA 2HPQH 4ABAA 1W10U 2FZZA 4P02A 4BAKB 2NU0E 3MU5A 3TH2H 2BD7A 4E7NA 1S81A 4INLA 3SUGA 5DSFA 5GWZA 1GJ5H 4VGCB 1W0YH 1NTPA 1TWXB 3F9FA 4CRFA 3LU9B 3NK8A 3VXEH 2PP6A 3DCLA 4VGCC 5HMAA 3EDXB 2KZ4A 3UY9A 1HIAB 3NUMA 1D3DB 3V12A 4FVDA 1ACBE 1GBBA 4JMYA 5GCHF 3TNSA 1C4U2 1JRSA 3N99A 3WW7A 5EQSA 1SQTA 1HAIH 1ID5H 4Y0ZE 1QB1A 4TPYA 2C4FH 1RTFB 4FU9A 1COWD 2W3KA 3A7VA 4X8TH 2BDAA 1SLWB 2VWOA 1W0KD 1ANBA 1CT4E 1DVAH 3RXFA 3ZVGA 5EXNA 1C5VA 3A8CA 1NZQH 4XBBA 3SW2B 2QXJA 5C5NA 1EPTA 4F55A 2WPMS 2Y82A 1ARCA 3RXHA 1LMWB 4D76A 1HFDA 3SZNA 2QXIA 1QB9A 2PUQH 3F2GA 1OWHA 3O8RA 2G4TA 4DIIH 4CH8B 4OM9A 4XD7D 2VGCC 1ELTA 2ZCKP 1SL3A 2GMTC 2VBCA 1EJAA 1AU8A 4I33A 1ABJH 8GCHG 1GHXH 1ANCA 1E1RD 1C2GA 2WYJA 1VGCB 3F9EA 4UD9H 4MNWA 2WUCA 2TRMA 2BLQA 2UUKB 3RXJA 2I6QA 4AYVB 1UHBA 2ZGJA 3IITA 1MAXA 3UAIC 2Q6DA 3ODFA 1KXBA 2HNTE 5T3HA 1P0SH 1BHXF 1F5RA 3MU1A 1DSUA 2VWNA 4ABBA 3VB4A 1NRRH 1AE5A 1TMBH 1KY9A 3PMAB 4B75A 2V35A 1H8ED 4I7YH 4FOUC 1TALA 1HAVA 1OWDA 2VVCA 2OD3B 1E37B 1UW7A 1UVTH 1O39A 1ELCA 4MTBA 1QBNA 3MO3A 4ASHA 1GI3A 2AERH 2BDBA 1ZHMA 5HYOA 2KM0A 2ZP0H 2OC0A 2QN5T 1S83A 3KN2A 3SU1A 3TGIE 1RGQA 2ZDAH 1F5KU 3P17H 1YPLH 1RS0A 1GMDF 4AN7A 1G3BA 4Y0YE 2M2AA 2O8WA 5IDKA 1QQUA 3F0PA 2BDGA 2P3UB 3F68H 9LPRA 1J9CH 1CT2E 3LDXH 5FAHA 4CBOA 3STIA 1W12U 1L1GA 5EGMA 2BX3A 2H5CA 1FQ3A 1O2JA 2GP9B 1TRMA 4O03A 2QY0B 3ZZAA 4HG6A 4NA7A 3A7TA 2ZDVH 3Q3KA 1K1PA 1GI0A 1SGIB 3SNCA 4F48B 4KTCA 1CA0C 1T8OA 3WWBA 3SNBA 1HUTH 4SGAE 1HIAA 3TLOA 1YLDA 1T8NA 3SV7A 1E36B 1DPOA 1H8IH 1GBCA 5CE1A 1W14U 1Y5AT 3DSOA 1C2MA 2A1DB 3M3SA 3MNBA 3QO6A 5FX6A 4BNRA 1V2UT 4YM9A 5A8YA 2WPJS 2JJ1D 4FUHA 3U98H 2XOKD 3ZZ9A 2GT8A 4ISOA 4RT1A 4Y10E 1B0FA 3RXTA 3BG4B 5BRRE 2YMSB 1BJUA 3MNSA 3TJUA 3RXUA 5JDUB 2AGEX 2AIQA 1DX5M 5DJ7A 1GHBF 1FMGA 5JB9S 1O34A 1V2VT 1C9TA 4ZHLU 5B6OA 3PO1B 3OEHD 1P3EA 1HCGA 1GMHF 1SQOA 3LPRA 3PO1C 1ZTLA 1YKTA 4Q2KA 4BAOB 1YCPM 1GHAG 1GCDA 4CRCA 1YPEH 1ELBA 3FFGA 1CSOE 1GBTA 3FZDA 4IC5A 3ZZCA 1RJXB 1LHCH 1V2WT 1P9SA 3MYWA 3TJVA 3UIRA 2A32A 1VITH 1W2KH 1O2HA 3K6YA 4BTUB 1NC6A 1UO6A 2Y5GA 3ZYDA 1BTUA 1LTOA 1FUJA 5LPEA 3KQDA 2Z3EA 1ESTA 2GCTB 2QV1A 2OQ5A 1VJ9U 1CGJE 2GCHG 1V2ST 1RIWC 1CVWH 2HVXA 1E34B 1Q3XA 1BTWA 1OWJA 3KGPA 4Q4LA 1NBMD 4GHQA 1DM4B 4ZCNA 1KXEA 1FAKH 1GBDA 1GI1A 5FCKA 1O3GA 2AMPA 3P8OA 4Q7YA 3ZZ3A 3BSQA 1ARBA 2ZFSA 4ABEA 2KCYA 4AZ2B 1TBZH 1W13U 1C1VH 2BZ6H 2W6ID 4XFQA 4OS7A 3OFND 1GBHA 1IQJA 3SN8A 3OSYA 2A2QH 2BVRH 1A5HA 1HXEH 5E8EH 3BN9A 2PTNA 1BRCE 3JZ1B 5E0JA 3S0NA 1O3MA 3PB1E 1GI4A 3SJOA 2XXLA 3S7HB 4MVNA 3M37A 1ETRH 4X2VA 1LDTT 1DICA 1O2MA 2XBWA 2B8OH 3Q00A 4D9QA 1K9OE 1V2RT 1GBJA 1A61H 1P2IA 3SU5A 1O31A 1FIWA 3ZIAD 1BTZA 1C1UH 2Y5FA 3RC4A 4DJZB 1S5SA 3EE7A 2Q6FA 3GY4A 4UDWH 1LCYA 1UK2A 2P8OB 3D65E 5C1XA 1FY5A 1GJ9B 3E8LA 6GCHG 1DY8A 1K1LA 2O8MA 1P03A 2ANWA 1X7AC 3W1EA 1N1LA 3KF2A 4NSYA 1C5TA 3GCHB 2KX4A 3PM3A 1JOUB 2PWXA 1LQDB 1XXDA 1TGNA 4F49A 1HLTH 2NWNA 2H6MA 3AW1A 2GZ8A 5F8XA 4A7IB 3B23B 4AFSA 1GBKA 1C5MD 1MZDA 2CF8H 2DE9A 2HWLB 1V3XA 3EQ0H 1Y8TA 4Q7ZA 4RT0A 1GBIA 1UTQA 5FPTA 3WY8A 1V6DA 1HAXB 2ZGXH 3SV2H 2OC8A 1O2PA 1IOEA 4WXVA 1IAUA 8ESTE 2RDEA 3U1IB 2A4QA 1LPGB 3UREA 3T2NA 2BY8X 3R3GB 3ZV8A 4BXWA 2TGAA 2BLVA 2VB0A 1FX0B 2M5TA 2FOCA 4O9VA 1AE8H 1HPGA 2R9PA 4NWKA 2OK5A 2QCYA 1O2SA 4JCNA 4NGAH 1GI2A 2EA3A 1AQ7A 3K9XB 1GG6C 4XBCA 2GZ9A 1TNJA 2ZU4A 3DHKH 4NIXA 3T27A 2Y7XA 1O2ZA 1XUIA 1UTKA 2PFEA 1QRXA 1HXFH 1GHZA 1KXCA 2G51A 3MWIU 1BJVA 1H9LB 4Q63A 3RXLA 5L2YH 4K60A 3Q3YA 1SFIA 1OP0A 1NU9A 4RN6A 4WXIA 4Y8XA 6CHAB 4ZUHA 4O97A 1ESBA 1O3HA 1FIZA 1DUAA 1P2JA 1HJAC 4MDSA 4D8NA 3O8CA 1GJ8B 1EXFA 2A7JA 3ZVDA 8LPRA 1GJ7B 1PFXC 2ZGHA 3PTNA 1AB9C 1P01A 2CN0H 1YPHE 2XC4A 2XC0A 2A4RA 1O35A 5DPAA 1DWDH 2FI3E 1TRYA 3M7TA 4ASUD 3SV8A 1G3DA 4YT6H 1QB6A 1JBUH 1DLEA 1ZSLA 1P2OA 1P04A 3RXIA 2XBXA 2AH4X 3D49H 3QTVH 4Q80A 3A85A 2RA3A 4TYDA 2NU1E 1AVXA 1WUNH 2FM2A 3MH6A 5E2PA 5C17A 1IQHA 1ZPZA 4ABJA 1CHOG 1GI9B 1MTWA 2ALPA 1BCUH 1OKXA 3P6ZB 2FP7B 1O38A 3GCTG 1IQGA 4B2BA 1O3AA 3GCOA 4E05H 1AZZA 1ELGA 3SUEA 5C2ZA 2WINI 1A3BH 3RU4T 1WAYB 1C2KA 3UR6A 2WSSD 2BDCA 2G55A 2FOMB 5DK1A 2FX4A 1G30B 1IQIA 5F6MA 2BHGA 3HK3B 2BD4A 4NG9H 1K28D 1ZMLA 1DY9A 4YO9A 4OGYA 1T8MA 4J1YA 3QZRA 5HXFA 1C5RA 4R8TB 1TOMH 1FY3A 2H9TH 3BF6H 5GJ4B 1C2DA 3VFEA 1C5PA 5LPRA 1VKYA 5K7RA 1RFNA 3K2UA 5I25A 1UVPA 3EGKH 3GDSA 4YLQH 4ACAA 1SQAA 1SR5C 3RXMA 2VIPA 5KECA 1FY8E 3A89A 2D8WA 2HNTF 3SUFA 2P59A 4IS5A 3KL6A 3LGTA 5GCHG 2FESH 3RLYH 4MNXA 2NU3E 5EW2H 5G4BA 1K21H 1QTFA 2QXGA 3PWCA 4BAMB 5EQQA 1C2FA 1Z8GA 2VIDA 3CNRA 4KKDA 1D6WA 5JBCS 1G3CA 1QJ1B 1PQ7A 9ESTA 2F4LA 2Z6BD 4MPXA 1TQ7B 2ZPQA 2UWOA 1A0HB 2FYRA 2IPHA 3QGNB 1GCTC 4Y11E 1TNKA 2R0LA 1C9PA 2HGTH 1O3LA 1S6LA
chains in the Genus database with same CATH topology
3UQOA 1G3EA 3A82A 3A88A 1THSH 4X2YA 2BY7X 1CBWB 2C8YB 2AGIX 1TLDA 4CRDA 5DP5A 1TMUH 2SGAA 2ZDKA 1FDPA 5DP3A 1C5ZB 3P95A 3BIUH 1SGYE 1AVWA 3U8OH 3SQEE 2V3OH 4IGDA 4E7RG 1ABIH 4BTIB 3E90B 3MNCA 3MU8A 2BMGB 1O33A 3LC3A 3EA8A 1WCZA 1FLEE 3G01A 2BY5X 1XUJA 4CR9A 1BTYA 4ABIA 3RC6A 2GTBA 2TBSA 1QRZA 3M35A 1SGFA 3VXFH 1VZQH 3NWUA 5HM9A 4LXBH 2VU8E 3BTEE 4YOGA 3UUZA 4Z6AH 4LK4A 3E0NB 1QIXB 2FS9A 4D7FA 5C1UA 1QL8A 1CHGA 1LKAA 1MH0A 3HGNA 3LOXA 4FVBA 2FODA 4TWYA 2PTCE 1VCQA 3RC5A 1GMDG 5DP7A 4IC6A 1CE5A 2DUCA 2BDYA 1SI5H 3K6ZA 1RTKA 2VINA 1FNIA 1BRBE 3PMHB 2XW9A 1L4DA 4NCYA 3V3MA 2IOTA 1G9IE 3TGJE 2P95A 1YF4A 3BTFE 4MPVA 2XNIA 1MCVA 1A0LA 2VVUA 1C5WB 4NA8A 4FUIA 1ELEE 4X2WA 1OXGA 2W5EA 2W7UA 2A5AA 3VB7A 1S0RA 1GBEA 1FZZA 4ZAEA 1Z1JA 2Z9IA 5L30H 4AYYB 1BMNH 3KCGH 3MU0A 1AWHB 1ZSKA 1TPAE 3KQBA 1TNIA 4X6NA 3TPIZ 5HGGA 4JZEH 2FPZA 1K1NA 2BVSH 4Y8ZA 2FEQH 4IW4E 4NSVA 4ZXYH 5LPFA 1O3CA 4U01A 1A3EH 1GHBG 1INCA 4K3JA 2JH0D 1CGHA 1ZTJA 3RM0H 1O2UA 1GI5A 5E2OA 3P92A 1MTVA 1FONA 5FPYA 1ZMNA 3SJKA 7KMEH 2BQ7B 4ZMAH 3T62A 1H8DH 1IQEA 2FOEA 2C8ZB 1VITF 1BTPA 1O3EA 1THPB 1GMCG 3RXGA 2VGCB 4X2XA 1MD8A 4TWWA 2PV9B 2GMTB 2WPKS 5EOKA 1XUFA 4ZKNU 2ZF0H 1XUHA 3P70B 4MLFB 1LHFH 2ZPSA 4UFEH 4F4OC 5K0HA 3VB6A 4LZ1H 2O8UA 1V2PT 1YM0A 1GDNA 1GBMA 3PTBA 1ELAA 2PGQB 5JYIA 4NWLA 1H1BA 2R3YA 4FUGA 1C5OH 5F8ZA 1QJ6B 1BTHH 3Q76A 1GVLA 2ANMH 2EI6A 4J2YB 1B0EA 2GT7A 2G8TA 3S9BA 1TBRH 1GJCB 3A80A 5C3NA 2TGPZ 1O3JA 2ZKSA 1LPZB 3ZVEA 1IQNA 3NPSA 1MU8B 3E1XB 4GHTA 2FTLE 4OS5A 5LH8A 4GCHF 7GCHF 4ISHH 1AVGH 4WH8A 4CHAC 1BB0B 2FOBA 2OC1A 1SGTA 1O3DA 3GYMA 1VR1H 1W11U 2OTVA 2TGTA 3RU4D 1C1OA 1KDQB 2JH5D 2HALA 3TH3H 3JZ2B 4ABFA 1QFKH 2ANKH 3AVZA 2AMDA 1O2YA 1BMAA 1Y3WA 1Y5BT 2CHAC 3TK5A 1LKBA 2WV5A 2ZFQH 2ZG0H 4BXSA 4Y7AA 4Y76A 1YPMH 2EI8A 1EAWA 3RXCA 1QGFA 1MAYA 1BUIA 2STAE 3RXBA 1CA0B 2ZTZA 5GIBA 3MOCA 2O8LA 4QT8C 1SPJA 1WTGH 3RMMH 2A45B 3BTWE 1GWAA 1O2XA 3VGCC 1WQVH 1IHTH 1O3NA 3RXEA 2W26A 1DXWA 1PPEE 1Y3YA 1AUTC 1EKBB 1P10A 1J16A 2G81E 1IQLA 1N8OC 1OP2A 3UTUH 1PJPA 1DSTA 4JYTA 4KTUA 1Z8JB 2STBE 2Y80A 3BEIB 2RDLA 2BY9X 5EU8A 1T4VH 2F9BH 1C5XB 1SHYA 3V13A 4A1XA 1BMMH 5EXLA 2OXSA 1O5EH 2ULLA 3SU0A 4UFDH 1TX6A 3Q77A 2GDEH 1TAWA 2B0FA 5TCAA 3PLBA 3M5LA 2ODPA 1O2VA 3TU7H 1PYTC 2O8TA 1GBFA 2QYIA 3U9AH 3OY6U 1P3CA 2BX4A 1HB0B 2D1JA 2IN2A 1ORFA 3BEUA 1DWBH 1K1MA 1LVOA 1V2TT 1HAZB 4X8UH 5EODA 3MI4A 1VCPA 2Q1JA 3AAUA 1SGQE 1W8BH 1XVOA 1K22H 1RIWB 4MNVA 4OS6A 2FS8A 3T25A 5A09A 3TK6A 5L2ZH 4ISNA 2V0BA 1AZ8A 1YPJH 3MH7A 1EP6A 4DURA 1GDUA 5FCRA 1SHHB 3URCA 2Y7ZA 1BZXE 4ABGA 1ZJKA 4A1VA 1PPHE 3CS7A 3ZZ4A 1DS2E 2A5IA 5CHAB 3URDA 2QAAA 1KDQA 4O3UA 2QC2A 3PROA 1DE7H 5CHAC 2F9OA 1Z8IB 4NIWA 4JK6A 2V6NA 3RXQA 2QA9E 1F2SE 2FOHA 1NFXA 1NY22 2TPIZ 4TY6A 3GY2A 1TNGA 1ZMJA 2ZNKH 3ZVCA 2OLGA 1XMNB 3RUOA 3TJNA 4AOQA 2GV7A 1O30A 4MQAA 1QY6A 1GJ6A 3LGVA 2JETB 2ZHFH 4IN1A 2ZDMA 3KQCA 4AG2A 2XCFA 1EP5A 3W95A 2JETC 2BVXH 5E0GA 2ZTYA 3R0FA 1EZSC 1SFQB 2Z7FE 1DFPA 1F5LA 2A7CA 4DCDA 3E3TA 5T6GA 1TGTA 2ANYA 1XM1A 8KME2 1DWEH 3GYLB 1UMAH 1C5SA 3OX7U 3PWBA 3DD2H 3TVJB 4XBDA 3M5OA 1BTXA 1CO7E 3LH3A 1S84A 1O2LA 2Q6GA 3ZZ8A 1F0RA 2BXUH 1P09A 1D3QB 3KIDU 1GGDC 5EPYA 4YZUA 1OWKA 2BY6X 4ESTE 4TY7A 2ZU3A 1PQAA 3ZZDA 2GV6A 5TJXA 4CREA 2KAIB 4O3TA 1MQ6A 1E35B 1C1PA 3N7OA 1AFQC 2BYAX 1NESE 1L1JA 4D7GA 1EZXC 1OYQA 3QLPH 4Y79A 3GDVA 2SGPE 1BMLA 6ESTA 1TPSA 2J94A 1PPCE 3DA9B 3SHCH 1YCPH 3PYHA 2RG3A 1TPPA 4WVPE 2R2MB 2BD8A 1ZGIA 2Z9JA 2HNTC 3NCLA 3T29A 4KP0A 4HFPB 1IHSH 3T28A 3LGUA 1NT1A 3GY7A 5AHGH 1O5BB 4UFGH 4YT7H 1GG6B 4Y71A 1ZGVA 1ZPCA 1QNJA 2TGDA 3AW0A 3A8AA 3P8GA 1QQ4A 4K1TA 2CGAA 2J92A 1MTNC 4MNYA 3SU2A 1N6XA 1QHRB 1GJ4H 3ZVBA 1WTHD 4FUDA 2CJIA 1FN8A 3EA9A 2ZO3H 3ATWA 1SB1H 3HKIB 3AAVA 3LH1A 1W3CA 3MH5A 4X6PA 1HJAB 4CR5A 2WV4A 1QA0A 2AGGX 2P16A 1AUJA 2ZPRA 3GCNA 1O5GH 3LGWA 3SGBE 2FTMA 4X6MA 4FUFA 1NPMA 3VB5A 1EB1H 3EYDA 1AB9B 1F0UA 1ZZZA 2XTTB 1AKSB 4HTCH 2B5TB 2OP9A 1F0TA 1EB2A 2VVVA 2R3UA 2SGFE 4MG3A 1MKWH 1O36A 3RDZA 4X1RU 3CP7A 4ISLA 1JRTA 3UWIA 2GCHF 3RXVA 1IQFA 1XX9A 5AFZH 1BQYA 1XKAC 3S7KB 5C67A 3D23A 5LGOA 3A8BA 1CU1A 1KXDA 4RSPA 2JKHA 1FAXA 3BTDE 2BD5A 2VJ1A 1NRNH 2ZQ1A 1AHTH 1NFYA 3CENA 3E16B 3FANA 3MNXA 4FU8A 5GPIB 3TNTA 1B5GH 2GVFA 2DE8A 1K1JA 4FUEA 3C1KA 2VWLA 1MBQA 1ZHRA 2UWPA 2J95A 3A87A 5IYTA 3ENSB 2P3TB 4AX9H 1QBVH 2VH6A 4NZQA 5DP6A 4WMEA 1T8LA 2BD9A 4Y6DA 3M7QA 3RU4E 1C2IA 3M3VA 1QBOA 4A6LA 2P93A 1GHWH 2F3CE 3A81A 3BTKE 1FY1A 1Y3VA 4CRBA 2A31A 1E38B 1UTMA 2BOHB 1GVZA 3QUMP 1HAHH 3UNSA 4HGCA 2KAIA 2BZAA 2EEKA 1O0DH 5DP9A 1KTTB 1P11E 1ZTKA 2ZQ2A 1C2LA 1H9IE 2HRVA 1LVYA 3MHWU 2A7HA 3V0XA 1AY6H 1JIMA 1GDQA 3SOSA 6GCHF 1F92A 3ATMA 5ETXA 1UCYK 4KTSA 1O2NA 1BRAA 5A8XA 1WU1A 4ZXXH 3F9HA 5DG6A 3ZVAA 1C1RA 2GZ7A 1QL9A 3UFAA 2FXRA 1LHGH 2ZI2H 1HYLA 4AB8A 3S9CA 4UONA 1UCYH 2ZDLA 2ASUB 3NXPA 1LO6A 3OY5U 1GCTB 3KQEA 1OP8A 1MKXK 1EQ9A 1O2GH 4IMQA 1ELDE 1UTLM 3O8DA 1CGIE 1UVUH 4I8KA 2FI4E 3I78A 5JBBS 2FMJA 4H6TA 3KNXA 2XWAA 4SGBE 2ZU2A 4K8YA 3SJIA 1OWEA 3DUXH 2PUXB 4JZ1A 3FAOA 4LOYH 3ZVFA 4B74A 3PV4A 1AKSA 1MKXH 1PPGE 3I29A 3BTME 3UR9A 1QL7A 1ZRKA 3GY5A 4M7GA 5DO4H 1P9UA 4BANB 3CS0A 2ALVA 4GUXA 1T7CA 1P2NA 5T6DA 2PGBB 3HK6B 1UTNA 1C2HA 1FPHH 3DT0H 3EA7A 3ZZ5A 2BB4A 2CXVA 4OS2A 1UCYE 3RXPA 1EPTC 3UPEA 1P2QA 1TE0A 1B7XB 4GCHG 1BHXB 1FV9A 1SOTA 1ZR0A 4AG1A 2ESTE 1LQEA 3LIWA 1SGRE 5F8TA 1SOZA 1IQKA 3L33A 1TONA 1ZPBA 2D26C 1S82A 3QZQA 3HKJB 1QA7A 2PKSB 3E91A 3S69A 1T31A 2YNAA 1MQ5A 4YOJA 2AYWA 2OQUA 3M36A 1L4ZA 2PKSC 1YYY1 3GOVB 4CRAA 3RM2H 4RKOB 2BD3A 1Z1IA 3RXKA 2ODQA 4GVUA 4H6SB 1VCWA 2W7SA 3UNQA 4H4FA 2XBVA 1F0SA 2Z9GA 2VWMA 2QGRA 1F7ZA 1YP9A 1G36A 2G4UA 3MO9A 1P8VC 2AIPA 4U32A 1A1RA 1C1SA 3BEFB 3NKKA 4ZKRU 4NFEA 3SBKA 1V2QT 2VIWA 1J8AA 2ZFTA 2FLBH 3QK1A 1WV7H 3LJOA 3OU0A 3Q3XA 4OS4A 3HGPA 1BITA 1V2NT 1DOJA 2HPPH 2R0KA 3H7TA 1UVOA 1C5UA 5E0HA 3TITA 1NS3A 3F9GA 4BAQB 1HAGE 1C5QA 2PSXA 2RA0A 2ZFRH 2TIOA 2OCVB 2D2DA 2ZA5A 2C90B 1W7GH 5JBTA 3QX5H 1NU7B 4WJG2 1ZJDA 4XOJA 2FDAA 2GGVB 2WPIS 2XRCA 3ATIA 4IMZA 7ESTE 2C8XB 1TQ0B 4WF8A 3ODDA 1AFEH 4YESB 1YPHC 5T6FA 1C1WH 1JIRA 1YLCA 3I77A 5DGJA 5A0CA 3RXDA 1XKBC 3W94A 3BG8A 3U8TH 3KHVA 3ATLA 1UK3A 1YPKH 3P8FA 4WH6A 4CBNA 5A2MH 1GMHG 2VNTA 2AFQB 3OTJE 2ODYB 1S0QA 2ZGBH 2VH0A 5EW1H 3ELAH 1Z71A 4NFFA 3SU4A 2BTCE 3OYPA 1AN1E 2BLOA 1KXFA 1A0JA 4ZROA 2FI5E 1SGDE 2SGDE 3E6PH 3L3TA 4A1TA 1MTUA 2ZFPH 3MMGA 4GLYA 5FBIA 1BBRK 3RXSA 3ATKA 1V2KT 1A4WH 1MUEB 2F9UA 4A92A 4ZKOU 2UUJB 4I31A 2B9LA 2WYGA 1EATA 3FP8E 5C5OA 3ZYEA 1HRTH 1OPHB 1QR3E 1OWIA 1BBRH 2C8WB 5CMXH 1OSSA 3U1JB 3ITIA 4CHAB 2THFB 3SNAA 1TFXA 1BT7A 2BXTH 3UNRA 1ELFA 1O5DH 1KXAA 2Y6TA 4B2CA 2Y5HA 1ELVA 2OINA 4AFUA 1VGCC 2C3SA 3UWJH 1O3KA 4INHA 1M9UA 3FP6E 4DY7B 5BPEA 1TABE 2CHAB 2AEIH 1N6YA 5FHTA 1TGCA 2AMQA 3MU4A 4OGXA 3RLWH 3VPKA 2QXHA 1O3OA 1KSNA 1AIXH 2BQ6B 1HJ8A 2J34A 3U69H 1ETSH 1O2OA 2ZHQH 4AGKA 2XWBI 1JWTA 2VIQA 3VGCB 1KLIH 1BOQA 1MZAA 3A7WA 3A7YA 3EAJA 5DP8A 1BBRE 1SBWA 4YTAA 1AI8H 2W3IA 2H9EH 2Z94A 1HV7A 3UQVA 1ZOMA 1AO5A 1EOLA 2UUYA 1PQ8A 1N8OB 3SGQE 2LNCA 3O8BA 1Z7KA 3IWMA 3T5FH 2G52A 3BTTE 1G2MA 4ABHA 4K8BA 3AASA 2OBQA 1BDAA 2GDDA 1O37A 3S9AA 1MMJN 5PTPA 2HLCA 1TOCB 3SI3H 1NO9H 1C1TA 2PHBA 1D4PB 1SGCA 3LGYA 2PKAB 1CT0E 1WBGB 3STJA 1O3FA 2FOFA 3ZZBA 4KGAA 1H9HE 1S6HA 2ZECA 1DWCH 3UOPA 2Y81A 1YBWA 1O5AB 3M61U 3LGIA 5JB8S 1P2MA 1SG8B 2ZC9H 2F9NA 2BD2A 1PQ5A 5GDSH 4OS1A 2FO9A 2UWLA 3TK9A 1Y5UT 4UFFH 2FIRH 3FVFB 2IJOB 1C4Y2 4R0IA 1CA8B 1HAYB 1Y59T 3BG4C 3TGKE 1IQMA 1MTSA 3KEEA 1O5FH 4X8SH 4XE4A 2F9VA 1J17T 1DDJA 1O2WA 1K1IA 1SGPE 1EOJA 4TPIZ 3A86A 4WMFA 1GMCF 3PLPA 4DG4A 3LKWA 1DANH 3RXOA 4K69A 4I8JA 3BTQE 3EE0B 3SUDA 2A4GA 2BOKA 1RTLA 5TCCA 1O2RA 3RP2A 1EAUA 8GCHF 1ZHPA 3T26A 4B76A 1AMHA 1W0ZU 3QDZB 1ZRBA 2F91A 1D9IA 1P12E 1H4WA 2SGQE 5A0AE 2GCTC 4X8VH 1K2I1 1OS8A 4I8LA 1P2KA 4K1EA 3SNEA 3SU3A 4DT7B 1Q31A 1SGEE 4JZDH 1PYTD 7LPRA 3IG6B 2Z9KA 2ZEBA 5EQRA 3ZV9A 3SQHE