4AFUA

Human chymase - fynomer complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
226
structure length
221
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 221
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4afuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4afuA02
4IS5A 3PO1B 1T8NA 3H5CB 3SGQE 1O5BB 2BHGA 8KME2 4MLFB 4I8LA 1TB6H 1WTHD 4AYYB 1S5SA 1NT1A 2PR3A 1SGEE 3JZ2B 2FDAA 1GBLA 1AU8A 1MD7A 1W13U 2JH0D 7GCHG 2G5VA 3O8RA 3M61U 5LH8A 2J92A 1TFXA 1O3EA 1GL0E 1Y5AT 2ANMH 2BLQA 1SQTA 2GV7A 4WMDA 5TJXA 1DSTA 3VXEH 3A89A 1UVOA 3V13A 3DA9B 4Z6AH 2XC0A 1OXGA 3TVJB 4IN2A 3QGJA 2P8OB 1AWHB 1HAVB 1O5GH 1B5GH 1C5RA 2C8WB 1OX1A 2ZPSA 1MH0A 2F9BH 4JZIA 5FHTA 1GWAA 1HJ9A 1TA2A 1QY6A 1ZTKA 2FX4A 2ZA5A 5EG4A 4IGDA 4TPIZ 4A1TA 1YPMH 5DP6A 3OSYA 1UCYK 2IN2A 4XBDA 4O3UA 2VIVA 1BTHH 2NU0E 2ZPQA 1QQ4A 2WV4A 1GCTB 3GCTF 3U8RH 2OC7A 4GLYA 3LT3A 3FVFB 1TE0A 4NZLA 3NWUA 1O2XA 2OC8A 1O2ZA 4DIIH 1QL7A 4Q80A 2SFAA 2A7HA 4KKDA 1IHTH 1CT0E 2A4OA 1TNKA 2IOTA 4H42U 1GPZA 1S82A 2ZDNA 4BAQB 1P8VC 1TOCB 2F3CE 3STIA 1WAYB 3ZZ7A 1CVWH 1O2RA 4CHAC 3SU6A 3I77A 4UFEH 4OGXA 2XBWA 1VGCC 2SGEE 1O2WA 3RXSA 1HJAC 2AERH 1LVMA 1ARBA 2WPLS 3LC5A 1D3PB 1C9PA 1AFEH 1GHAG 1TRMA 4JZDH 1FXYA 1C1TA 2VU8E 4ABFA 4DGJA 2HVXA 2GT7A 3SQHE 2SGAA 3A86A 2HPPH 3U69H 6CHAB 4WXVA 3VGCC 3B9FH 2FX6A 2G4UA 4ESTE 1GMCG 1FN6A 3UWIA 1F0TA 1IQLA 3RP2A 4NGAH 1QRWA 3QZRA 1LTOA 1DY9A 2ZFQH 3SNEA 4ZAEA 1S0RA 4K8BA 4AFZA 4NA7A 2R0KA 2B7DH 1YGCH 1ZJDA 3SGBE 3NCLA 3GCOA 1D3TB 1FIWA 1TBRH 4UONA 4UE7H 2QY0B 3F9GA 1GHZA 1G30B 3SUGA 1YPJH 2XNIA 3L6PA 3URCA 4AORA 1A3EH 1UTJA 3MNSA 2G8TA 4BTUB 1AMHA 4ZKOU 1AFQC 3VFEA 2FOMB 4THNH 1ZZZA 1Z1IA 3LDXH 5EOKA 1RXPA 3RM2H 8ESTE 4NWLA 1QA0A 2GD4B 1MBMA 2FOEA 3HK3B 2AGEX 4DCDA 3SUEA 1ZSJA 4GSOA 4B71A 4JK5A 3ODDA 2PGQB 2SGDE 1KTSB 2LNCA 1PPEE 1ESAA 5FX5A 1GG6B 4HZHA 4INLA 1NZQH 2ZDAH 3ZZBA 1EOJA 1Z8JB 2AS9A 5EQRA 1HJAB 1BBRH 1KIGH 4MG3A 1GI1A 2GKVE 3ZVCA 3B8JA 1MAXA 3QTOH 3ATIA 3ZVBA 2ESTE 1MTNB 1BMLA 1SGIB 1SPJA 5JBCS 1AGJA 3U9AH 1D6RA 3OY6U 1OSSA 3A8BA 3LJJA 2FIRH 3A88A 3RXBA 2OQUA 4UFFH 3A80A 2XCFA 5DP5A 5F8XA 1AD8H 1V2LT 2GDEH 3BTQE 2FZZA 3F9HA 2ZFTA 1TBQH 2Z9IA 1QBOA 1AE8H 4F49A 3TK5A 5C2ZA 4K1TA 1DY8A 1XKBC 1PQAA 3U98H 1AVGH 5EODA 4JZFH 2H2ZA 1MUEB 5FAHA 3BTWE 3NUMA 3SJIA 1CBWB 2GT8A 1L0ZA 1UVTH 3OY5U 1DUEA 3MO9A 3ODFA 4ZHMU 3CP7A 1ZHPA 1GI6A 2R9PA 2GCHG 2BY9X 1BIOA 1XUKA 3PWBA 2VIDA 3LIWA 1KLIH 4X1PU 1T7CA 4ABBA 2BMGB 1P2MA 4JZ1A 1NRQH 4X6MA 3SORA 1SFIA 3KQBA 4IC5A 3UR6A 4CH8B 1KXDA 5DPAA 1JMOH 1V2PT 2FS9A 4I8HA 1P12E 1T4VH 1MCTA 4IMZA 4VGCB 3ATLA 4YLQH 4ABJA 2A32A 2VVCA 2AH4X 1TLDA 3D65E 1L4ZA 2AGIX 3PMJA 4ZUHA 1IOEA 1D3QB 1YPKH 4ZHAA 1C1NA 3SU1A 3A8DA 1O2TA 1O39A 1THSH 3BTKE 4K3JA 5EQSA 1CGIE 4K8YA 1GVKB 1LHGH 4UEHH 1UHBB 5LGOA 2PLXA 1TMUH 4BAHB 2XYAA 1A4WH 1O3BA 2AIQA 3VB4A 1O3JA 2TGAA 2C3SA 1AB9B 5ESBA 5TCCA 3ESTA 4XBBA 2A2XH 1NU9A 3SNCA 2BQ6B 2WYGA 1THPB 4GVUA 1W12U 1LVYA 2EA3A 3BTGE 4HTCH 4X1QU 1GI8B 1ZHRA 4B76A 2QAAA 3RU4D 3NKKA 3LGIA 4AFQA 3BTEE 1C1WH 1FY8E 2PKSC 3A84A 3RXGA 3BG4C 1BA8B 1MU8B 2EEKA 4U32A 1KY9A 3T26A 2PKAA 1TYNA 5T6GA 1YF4A 2JH5D 3MMGA 2BM2A 1HGTH 3EQ0H 2ZEBA 1S84A 1SGYE 2XWBI 3BN9A 2VNTA 1XM1A 2O8TA 2ANYA 1FUJA 2OINA 5FPYA 3PM3A 1TNIA 2CN0H 1AN1E 3LONA 1LPGB 7LPRA 3LPRA 4CRFA 1BJUA 4SGAE 4YT6H 1UTNA 1BB0B 3U8OH 1TGTA 2A5AA 2H9EH 1QBVH 2PSYA 1DPOA 1F7ZA 1D9IA 3MI4A 2BDYA 1C2IA 3TLOA 4B1TA 1K28D 1PYTC 1TX8A 1XVMA 3FP6E 1QFKH 3FP7E 4D7GA 1D6WA 1F5KU 1FIZA 2TPIZ 1G37A 1RIWC 3A7VA 3GCHC 3LGUA 3WY8A 2SGPE 4WWYA 3V12A 2A45B 1GBTA 5AVDA 3RMMH 4CREA 3TK9A 4ZXYH 1H9LB 2TGDA 1Y5UT 5T6DA 1NFWA 1QR3E 3SN8A 3ENSB 2RDLA 4IMQA 1EAUA 1LHDH 1DWEH 2P3UB 3FP8E 1L2EA 2P95A 3KEEA 2FESH 1MD8A 1P01A 3DT0H 1O3KA 3SUDA 3GDSA 2ZHEH 3TU7H 3MU0A 1O5CB 1SR5C 4K60A 2UWLA 1CA0C 1HAVA 4DIHH 3VB3A 1YYY1 1SGNE 5HMAA 3LH3A 3TJVA 1TRYA 1G2LA 3R0FA 2Y82A 1P0SH 2ZKSA 1TNJA 1ZTLA 5DP9A 1BMMH 2NU2E 5C5NA 1SOTA 1NN6A 1BZXE 1ZGVA 1GBIA 3P70B 1MQ6A 2GGVB 4NIXA 1CT4E 1MKXK 3UTUH 1FMGA 4ABEA 1O3IA 5IDKA 1UVSH 1TX7A 1YPEH 2Y81A 3DUXH 4E7NA 1OP8A 1YP9A 2BOKA 3AASA 1L1NA 4TY6A 1A0HB 5EPYA 1N6YA 1NS3A 3M36A 4DJZB 2H6MA 2M5TA 1EXFA 3LGTA 1GI2A 1J8AA 3JZ1B 2CHAB 2V3HH 1KXBA 3S0NA 1B0EA 1SBWA 1C5TA 2OC1A 3K2UA 1LCYA 1SLUB 4X8VH 2Z9LA 5FCKA 4ISNA 3SQEE 1WBGB 4B74A 1CHOF 2FS8A 3P8FA 4QT8C 3ZVDA 1P2KA 3RMOH 3A7TA 1WCZA 3RMNH 2DE8A 5LPEA 2BDCA 2H5DA 3MO3A 4OS6A 1ZTJA 4TPYA 4BXSA 3ZVFA 2HNTE 5GWZA 1WQVH 1UTMA 1ZRBA 1ABJH 1SLVB 3RU4T 3EA8A 3UNSA 3GCTG 3GISB 3ZZ4A 4CBNA 1IQHA 3MH7A 1P09A 4J1YA 1EZXC 3PO1C 2Z94A 2ZO3H 2OTVA 1GL1A 1WOFA 1PQ8A 1MKWK 4MNVA 3VXFH 1ZGIA 2VH6A 1QJ6B 2FI4E 3GY2A 2ODQA 1ZPBA 1VCQA 1QIXB 1KXEA 1LVOA 2B8OH 1O3HA 3GY8A 3SHAH 4BTIB 3ZVAA 1TPPA 2BZ6H 3CS0A 4X1NU 4DOQA 1AZZA 1Q2WA 1Z1JA 3BEIB 1YCPH 3NK8A 1BTYA 1C2FA 1RD3B 1V2RT 2ZP0H 2EI8A 2FPZA 1O2KA 4WY3A 1CHGA 3MH5A 3SV7A 1LHCH 1NFXA 5EXLA 2P8OC 5E0HA 1A0LA 5JB9S 4E7RG 5F8ZA 2ZGBH 2ZDLA 5DKMA 4YOIA 1EB1H 3PMAB 1FY4A 1KLJH 3E6PH 3A81A 2BD5A 2BQWB 1BTPA 3MU1A 1GCTC 5CE1A 4AGJA 2AGGX 1XX9A 4Q7YA 4YTAA 4FUGA 1SGPE 1PYTD 3LJOA 1C1PA 4H4FA 1SGCA 1MTSA 2BLVA 3RXPA 2J94A 3O8DA 4NSVA 1F0SA 4GAWA 1NRSH 1FONA 1MU6B 1EASA 2F9UA 3RC6A 1ZSLA 2B9LA 1GDQA 1CO7E 3MU4A 1DITH 3S7HB 4WF8A 1BHXF 2BQ7B 3L33A 2C90B 4ISHH 1IQMA 3PLBA 3RXOA 2VVUA 1QQUA 2TRMA 1UK2A 3SV8A 1GBCA 1JOUB 1DLKB 3OTJE 1JBUH 2A4GA 2Y7ZA 2FMJA 2I6SA 4OS2A 1P05A 1EP5A 4HGCA 3IWMA 3KIDU 1GBBA 1INCA 1T8MA 1YCPM 4JYVH 4CRAA 4MTBA 4LZ4B 6CHAC 2IJOB 1FPHH 1QB6A 3TNSA 4GCHF 3GY7A 5F6MA 1GHBF 4A6LA 3U8TH 4IC6A 3RXCA 1P11E 1B0FA 1K9OE 1DOJA 4UDWH 1O2UA 3RMLH 2OP9A 2BX4A 1OWHA 1GJ5H 1TA6A 2V35A 1J15A 5J4QA 1MKXH 5I25A 1ELFA 1OYQA 5DP3A 1AKSB 1C4Y2 1BRAA 1JIRA 1BBRE 4YZUA 4AN7A 4FUBA 2GZ7A 4ISOA 1UHBA 2GZ9A 4AGKA 1NRRH 2RA0A 4WJG2 5L6NH 4FVBA 1TPOA 4LK4A 3ZZ8A 1QJ1B 5FPTA 1HNEE 1AHTH 4Q7XA 1FY5A 1GBHA 3QWCH 4X2YA 4OS5A 2H9TH 2VWMA 1O3PB 2NU4E 1G3CA 1GG6C 1AUJA 1QL8A 1E36B 1F2SE 2VWOA 3DFJA 3SHCH 4DW2U 1OWIA 4I7YH 5HYOA 1A5IA 3UR9A 5C5OA 2Z7FE 3EGKH 1LVBA 2UWPA 1TPAE 1O3GA 1HB0B 1KTTB 1WYKA 3GICB 3BEFB 4IN1A 1ESTA 2B0FA 5ESTE 2H9HA 1PPBH 1Z8RA 1GJ9B 3HPTB 1TQ7B 2FTLE 4WMFA 3W95A 1MTNC 3BSQA 4FVDA 4XFQA 1EKBB 1OWEA 7KMEH 2V3OH 1VR1H 5EGMA 1BT7A 1PQ5A 5ABWA 2HPQH 2F9PA 2ZFPH 4BAOB 4AOQA 4D9QA 1YPHE 5GPIB 3S9BA 1MKWH 5GCHF 5LPRA 1X7AC 3V7TA 1THRH 1UCYE 1N1LA 1TGNA 3STJA 2DE9A 1Y59T 5DGJA 3ZZ9A 1S81A 3PTBA 1SLWB 2ZNKH 3ZV8A 3MU8A 2XRCA 2C4FH 3BTHE 1E38B 1O2VA 3OYPA 1VJAU 1DWDH 2ZFRH 1CBWC 5GIBA 2BLOA 2R3UA 3AAVA 3KQDA 1BRUP 1ELGA 3SU4A 2A1DB 2ZU1A 3SW2B 1YLDA 3A85A 1P9SA 4NWKA 1C2DA 2FI5E 2WV5A 3KNXA 3RXRA 3RXLA 4MQAA 1O31A 3UOUA 1MZDA 4OGYA 1SVPA 4OS7A 4NG9H 1OWDA 2VB0A 2XBYA 1SQAA 3EE0B 1MZAA 4VGCC 4WH8A 3RDZA 4CR9A 4A7IB 3UQOA 3F9EA 4IBLH 1FJSA 1C2JA 5L2YH 5TCAA 4FXGH 4D9RA 3C27B 2GCTB 2VWLA 4AG2A 1L4DA 4Y76A 1UO6A 2W3IA 8GCHF 4UFGH 5JBTA 2VJ1A 2ZQ1A 1GVZA 2G00A 4D76A 1XXDA 1IQEA 3EA7A 1AB9C 5CMXH 1IQGA 4H6TA 5A2MH 1GI9B 3KL6A 1GDUA 1GI0A 1JRSA 1JWTA 5G4BA 2W3KA 1C5NH 2R2WU 4FUHA 2VIWA 2ZDKA 1Z8IB 2XC5A 5C1XA 1V2TT 1GGDB 1SGQE 1BTZA 3TPIZ 1A0JA 2BTCE 3SU5A 1SB1H 1EZQA 4TY7A 4NA8A 1TNHA 1C2MA 1SHYA 2PWXA 1EAWA 3BIVH 2ILNA 3T62A 4GHTA 1Y3XA 2SNWA 5DP8A 5HXFA 2ZCKP 1K21H 1BRBE 3QN7A 1KYNA 3RXFA 1V2QT 5BRRE 3NPSA 4NSYA 1DWCH 1QNJA 1TONA 2J34A 3FZDA 3ZYDA 3MU5A 2RCEA 3T28A 1CGJE 2AFQB 1UCYH 1CA8B 1GDNA 1V2VT 1O2GH 2QN5T 4AB8A 1HAGE 2ANKH 5EW1H 4Y10E 5FBIA 2JETB 2D8WA 1TAWA 2WYJA 1O5EH 3BTFE 2A7JA 4ZXXH 5FX6A 1P9UA 3M7UA 4X8SH 1QB9A 3TIUA 4BAKB 5A8YA 2WPKS 1W7XH 2BYAX 3Q3KA 1QB1A 1SGTA 4KTCA 4LZ1H 1BQYA 1KXFA 1DLEA 1N8OC 2GV6A 3CS7A 4FU9A 3P6ZB 4JYTA 3ZZ3A 2F91A 1CGHA 1DM4B 1TNLA 2ZU4A 1BOQA 2QF0A 4Y7AA 3SZNA 3ZZ6A 1HXEH 4A1XA 1O2JA 2Y5FA 3A8CA 1O2YA 4Y8ZA 3NXPA 2FEQH 3O8BA 1H9IE 3IITA 4Y11E 1DT2A 3GCNA 1S6HA 2WPHS 4WXIA 2BLWA 4GHQA 4JMYA 1C5XB 1HAIH 1CHOG 1KSNA 1O0DH 1OP2A 2QIQA 1TRNA 2K1QA 3RLWH 1G3BA 2XCNA 2ZZUH 5C20A 3TJNA 4U30A 2ZF0H 3EA9A 2OBQA 3SUFA 3MNCA 1OYTH 1UTQA 2AMPA 1GMDF 1ZYOA 2J2UA 4YOJA 4AFUA 1OOKB 1FY3A 1A2CH 5SGAE 1MCVA 1NFUA 3QTVH 4R0IA 4FUDA 2HNTF 2VWNA 1GJ8B 1ZRKA 3RM0H 4ABHA 2J9NA 3P8NA 1RTKA 3E3TA 1NC6A 2ZI2H 1C5VA 2GMTB 1Y8TA 4FUCA 1O32A 3HK6B 2G55A 3PB1E 5B6OA 3TK6A 1HCGA 3BTDE 2CHAC 3KHVA 8LPRA 4IW4E 2W7SA 1XMNB 3G01A 3GDUA 4B73A 1CT2E 1V2UT 3K6ZA 4MPUA 2R0LA 3T27A 1O38A 5E2OA 3V3MA 3SJKA 2CGAA 1GBJA 2Z3EA 4AYVB 1W2KH 3FAOA 3RXJA 1N8OB 2CF9H 1VITH 5JBBS 3BTTE 2PTNA 1ANBA 1EOLA 2AIPA 1GI4A 4ZKNU 2F9VA 2VVVA 3PMHB 1HV7A 4AFSA 4XOJA 2VGCB 4X6PA 3ELAH 3E1XB 1C9TA 2PV9B 2P3TB 1V2KT 2C93B 1YBWA 1C1MA 4FU7A 1TBZH 2VINA 1EPTB 2FTMA 1RTFB 3BF6H 1NROH 1TX6A 3DD2H 2BY7X 1H1BA 2FXRA 3A7WA 1FDPA 1GBMA 3HATH 3RXDA 5JDUB 2G51A 1M9UA 1N6XA 4ZKRU 1ZPCA 1DANH 1FPCH 1EAIA 1AKSA 4AZ2B 1DS2E 1P3EA 3HKIB 2V6NA 1O5DH 2ZU3A 1ANCA 1O33A 1QGFA 3L3TA 4O9VA 3HGPA 2BXTH 2Q6FA 1EJMA 1XUFA 2Q6GA 3A87A 3S9CA 1TWXB 4U01A 2ZTXA 3D49H 2FOAA 1EB2A 1QRZA 2W5EA 4O97A 3TH3H 2FOCA 3W94A 2GVFA 3GOVB 2ZGJA 4M7GA 1NY22 2TGTA 3O8CA 2GDDA 1MAYA 2FWWA 3H7OA 3Q77A 1C2EA 2Y6TA 4INKA 1EJNA 4RKJB 4GPGA 3PMBB 4X1SU 4DY7B 1PPZA 2ZDVH 3Q3XA 4XBCA 1J16A 2BD9A 1AIXH 1F0RA 1PPFE 1O3NA 3GDVA 3A83A 4BAMB 3ZVEA 4GCHG 1ETRH 1Z8GA 1O3MA 1GHBG 3ATKA 3DHKH 3LKWA 1E0FD 1LHFH 2W7UA 1C5UA 1BHXB 4DVAU 2BY5X 1BUIA 2QXJA 1BITA 1XUGA 1B7XB 1Z7KA 1C1SA 5C3NA 5BPEA 2XBXA 1DICA 3RXKA 4TWYA 1GHWH 1SSXA 5EXMA 1ZMLA 3PROA 1GJAB 4UFDH 3EAJA 4ZKSU 2H5CA 2EI6A 1TQ0B 1EP6A 4B2CA 5A0BA 4WH6A 1IQKA 1YM0A 3VB7A 4X2XA 4E05H 1K1NA 3RU4E 3ATMA 2BD3A 1HPGA 4B75A 3LC3A 2A4RA 2OC0A 1KXAA 1V6DA 4BNRA 1GBEA 2THFB 5FPSA 1Z71A 2ZGHA 4I33A 2ZTZA 3UNQA 1WTGH 4FU8A 5DG6A 4J2YB 1J17T 3AW1A 2P93A 3CENA 2FOGA 3V0XA 3SJ9A 2QV1A 1A46H 1WV7H 1KXCA 1TALA 3HGNA 4JCNA 4HFPB 1CSOE 3E0NB 4CRDA 4D8NA 3M7QA 1DX5M 2XWAA 5K0HA 4NIWA 5T3HA 1DUAA 2PUXB 2WPMS 2CV3A 1LO6A 2ZFSA 1BRCE 4ASHA 2O8MA 1QTFA 1W10U 1V2MT 2ANWA 5H4IB 1GBAA 2OBOA 4JZEH 4MDSA 2PSXA 3P92A 1FZZA 1DE7H 2C8ZB 3BG8A 1WSSH 1UJ1A 1IQNA 1Y5BT 5FCRA 2STBE 1ZOMA 4B2AA 3P95A 1H8IH 1F92A 1E37B 1C5SA 1HAHH 3SI3H 5GCHG 3MFJA 1HJ8A 3U1IB 2CJIA 3AW0A 3QGNB 2DUCA 1RFNA 4RSPA 5HGGA 2V0BA 4X6OA 3RXIA 1SGFA 5L2ZH 2BOHB 2YNBA 1V3XA 5E2PA 4A1VA 3OX7U 1GBDA 2EI7A 2ALVA 1NM6A 3ZVGA 1TOMH 2ZGXH 1WU1A 3MTYA 4WVPE 1ESBA 2UUKB 1PQ7A 2FLRH 1C5WB 3S69A 2OD3B 2YNAA 1Q31A 3K6YA 5HM2A 1ANDA 2UUYA 2XBVA 4A5TS 3RXUA 2QXHA 3MYWA 4SGBE 4X1RU 1Z6EA 1W14U 3E8LA 4FUEA 2HRVA 1GHVH 1O2HA 2HLCA 1P04A 1KLTA 4Y0ZE 2ULLA 1ZR0A 4LXBH 5DP4A 1C2HA 1W0ZU 2A5IA 2Y80A 4KTUA 5AFYH 6ESTA 5E0GA 2G5NA 3PLKA 4ZHLU 1K1MA 3D62A 1HAYB 2Z3DA 3RXEA 1D3DB 3LU9B 4CBOA 1O3DA 1DWBH 1O2SA 1SLXB 2CMYA 2QF3A 1EZSC 4LOYH 2SNVA 3FZZA 4Y7BA 4INHA 3T2NA 1HAXB 1AVXA 2Q6DA 4NFEA 8GCHG 4K1SA 4NCYA 5K7RA 1TIOA 3SV2H 3T29A 2BB4A 2FP7B 3E91A 4K69A 2F9NA 1FI8A 1Z6JH 4B2BA 3TITA 4MNWA 4K5ZA 1YPGH 1PPHE 2BDHA 1P2QA 1GHYH 3P17H 1C5ZB 2ZHWH 1ABIH 5DO4H 2WUBA 1AUTC 1L1JA 2P3FH 2A0QB 4A92A 1C5MD 1W8BH 4DURA 3E90B 1W7GH 1SGRE 2ALPA 1SHHB 3M5MA 1O2IA 4YOGA 3M3TA 1NU7B 5PTPA 5JPMH 1GI3A 2STAE 1P10A 2QA9E 1HAPH 3K9XB 5AHGH 3KQCA 2NWNA 2HALA 4MPWA 4AG1A 3M5OA 2Y5HA 4KGAA 5JB8S 9LPRA 1OP0A 3ZZ5A 2BDAA 1H8DH 3SGAE 1QRXA 3LGWA 1SC8U 1DFPA 1KDQB 2GCTC 2BDBA 1MMJN 1WQSA 5A0CA 1MTWA 1AI8H 1GBKA 1VITF 1ZMJA 1C2LA 1G3EA 3U1JB 3HKJB 3TH2H 3RXMA 2LPRA 1ETTH 2RA3A 3LGYA 1WUNH 2HWLB 2D26C 6GCHF 1LQDB 1CU1A 2Z9KA 3RXAA 1DVAH 4I8KA 2F9OA 3MHWU 1K1LA 5IYTA 1G32B 3TJOA 4ISLA 1C1RA 4FUIA 2ZCLP 4X8TH 3ZZAA 4NFFA 1S85A 3RXHA 1T8LA 1LDTT 4MPXA 2NU1E 2RG3A 3SJ8A 1SFQB 1LHEH 1SOZA 2HNTC 2I6QA 1IQFA 1GGDC 3SV6A 3QK1A 1ELTA 2ZHDA 4FUFA 1O3FA 1U6QA 3LOXA 4XE4A 1QCPA 1LQEA 1HRTH 3UPEA 1W3CA 2O8LA 2UUJB 1LPKB 3AAUA 5EPNA 1V2WT 3F68H 2WUCA 1AE5A 4MNYA 1EAXA 1SGFG 3OU0A 2D1JA 3GY4A 5E8EH 1SMFE 4NZQA 2JKHA 1ELAA 5L30H 1TGSZ 1GMHF 5EQQA 3QDZB 1PJPA 1O34A 1NO9H 1GMDG 1HXFH 3D23A 1GBFA 1EPTA 3A8AA 1XXFA 4YLUA 2KAIB 2BDIA 2JETC 2BVRH 1RTLA 2G4TA 1P02A 4CRGA 1K1PA 1LPZB 1AQ7A 2J95A 2G81E 1V2ST 2GX4A 2BD4A 1AWFH 1ZLRA 2ZCHP 3VEQB 4NA9H 4ZH8A 2ZQ2A 1TMBH 2J4IA 1H4WA 2PUQH 2HGTH 1C2KA 2OQ5A 4NIYA 4ZMAH 2BY6X 3SU0A 4NIVA 2FYQA 5GJ4B 7GCHF 1OKXA 1RRKA 5LPFA 3LGVA 1NRNH 1IHSH 2Y7XA 4O3TA 4CHAB 1L1GA 1O3CA 2SGFE 1UTPA 1VGCB 5F8TA 3UQVA 3A7YA 4ABIA 1JXPA 2C8XB 3UWJH 3VB5A 7ESTE 2A2QH 3ZZCA 3C1KA 1JIMA 1ORFA 1VCPA 3FANA 4X2VA 1SI5H 3GY5A 1TABE 1F0UA 1SG8B 2QC2A 3TNTA 3TGIE 1FY1A 1K22H 2P94A 4ISIH 3M35A 1AY6H 2BD2A 1GI7B 3A82A 3VGCB 3QUMP 1Y3YA 2IPHA 4JYUH 1P06A 4OS4A 1VJ9U 2O8UA 3VB6A 5HM9A 1LKBA 1VCWA 1O3AA 1XKAC 1YKTA 2Q1JA 3M3SA 3ZV9A 4ABDA 2WINI 5J4SA 4AX9H 1YLCA 1T31A 1V2JT 3GYMA 3S9AA 3UY9A 4WMEA 2Z6BD 4X6NA 1ELVA 4YESB 1C5YB 2AEIH 1O5AB 2BD7A 1G2MA 1UK4A 2QYIA 2GMTC 3ATWA 3S7KB 5C1UA 2SGQE 1AFQB 1A5GH 3URDA 3RUOA 5ETXA 5DK1A 3N7OA 4D7FA 4X0WU 3DFLA 5EXNA 2FI3E 1SQOA 1O30A 1GHXH 3FFGA 1GHAF 2YOLA 1ACBE 3SNBA 1UTKA 1EATA 1RJXB 1GVLA 3E16B 4Y8YA 5CHAC 5FBEA 3QLPH 5FXLA 1NPMA 2BD8A 2UUFB 1TMTH 4YT7H 1GMCF 3KN2A 1TGBA 1UTLM 1OWJA 2A31A 2VGCC 4BXWA 1ZPZA 1LMWB 2AYWA 5F03A 2PW8H 2O9QA 1CE5A 1C1OA 1EPTC 2Z9GA 3H7TA 1GJ7B 1P03A 3TGKE 3TGJE 1O3LA 1BTWA 1T32A 2OLGA 1BTXA 1CQQA 1ELCA 1UMAH 2BY8X 2AMDA 4Q2KA 1OPHB 1J14A 2AMQA 4X8UH 4AB9A 2ZU5A 1D4PB 2ZHQH 1GCDA 3NZIA 4I32A 1DDJA 1HFDA 2ZHFH 4KELA 1AO5A 2NU3E 1HDTH 5EW2H 2ZDMA 5JBAS 3GY6A 2XC4A 2WPIS 1MBQA 1TNGA 3SU3A 3SOSA 1Y3WA 5GXPA 2TIOA 1O2MA 1ZHMA 1ID5H 4HI3A 4CRCA 4MPVA 4X2WA 1O36A 2BDGA 3F1SB 1YPHC 4O03A 2Z3CA 1YCPK 3T5FH 3UIRA 1S6FA 2HOBA 1UVUH 1V2OT 1T4UH 1C4V2 1EX3A 1HIAA 4XDEA 2FM2A 3M37A 3PV4A 5C67A 5GDSH 1A7SA 1T8OA 2GZ8A 1BMNH 1FNIA 1A61H 4F4OC 1AZ8A 1PPGE 1V2NT 1G36A 1QA7A 1YC0A 2FODA 1F5LA 2R3YA 1O2PA 1BMAA 2QGRA 3MWIU 2A5KA 1HAOH 3RXQA 1QURH 3P8OA 1P2NA 2PHBA 2H1UA 1ELBA 1O5FH 4I31A 3UREA 4KTSA 1RS0A 3SJOA 1BTUA 2CF8H 4I8JA 4KP0A 3M5NA 4PROA 1G9IE 1C1QA 5CHAB 2O8WA 2ZPRA 4TYDA 3P8GA 3MH6A 5A0AE 1FLEE 1E35B 1HLTH 4ABGA 1XVOA 2VIOA 3EDXB 5EU8A 1OWKA 3SNDA 1FAKH 4RKOB 1TPSA 1K1IA 4Y71A 3ZYEA 1QJ7B 1Q3XA 3M7TA 2UWOA 2ZFFH 1QBNA 3UUZA 3MOCA 1HAZB 1OS8A 3LH1A 2ASUB 3QO6A 3I29A 1DSUA 5A8XA 1O3OA 3SO3A 1SL3A 3A7XA 5DP7A 1GJBB 6LPRA 3GY3A 2PFEA 2GCHF 1Y3UA 2VIQA 2VH0A 3GYLB 4CR5A 1J9CH 1ZJKA 1XUIA 2PKSB 2TBSA 3BG4B 2Z9JA 3E0PB 3ZZDA 2ODPA 1ELEE 2BXUH 1Y3VA 1EQ9A 3KGPA 3RC4A 1A3BH 1EZUC 1QHRB 4Y0YE 2QXIA 1K1JA 2R2MB 1K1OA 4Y6DA 1O2OA 5I46H 3MNXA 1KDQA 5T6FA 2JH6D 1FN8A 5E0JA 1SGDE 2OCVB 1HUTH 1O35A 2QXGA 3T25A 1TGCA 1GJDB 2VIPA 3KCGH 3AVZA 3RXVA 3I78A 2WPJS 1E34B 1QL9A 1FAXA 1P2OA 2P59A 3RLYH 2P16A 4DG4A 1ARCA 1FQ3A 3MO6A 1IQIA 5A09A 4BANB 2QCYA 2FYRA 2XW9A 1GJ4H 2Y5GA 1C5LH 1RIWB 3GCHB 4YM9A 4BTTB 2ODYB 1A5HA 1BCUH 2EC9H 2FO9A 4MNXA 1MTUA 5AFZH 3Q76A 4CH2B 3Q3YA 3PYHA 1UK3A 3VPKA 1PPCE 1UVPA 3QX5H 3BIUH 3QZQA 5AF9H 2ZGCA 2BVSH 2ZIQH 4XSKU 1P2JA 3SNAA 5A8ZA 2BZAA 3MH4A 1C5OH 1DXPA 1BJVA 3F6UH 4YO9A 1EJAA 2OXSA 3PWCA 4CRBA 2GTBA 3RC5A 1O2NA 2FLBH 2FOHA 1CA0B 4Q7ZA 1ETSH 3PLPA 1C5PA 4U2WA 3KF2A 1GI5A 1S0QA 1YPLH 1FV9A 2TGPZ 3MNBA 1S83A 1VITG 1O2LA 4Y8XA 1GJCB 1BDAA 1NRPH 2BVXH 1W0YH 2KAIA 2W26A 4ZROA 1IAUA 6GCHG 3M3VA 2G52A 1NESE 3R3GB 3BV9B 4FUJA 1H9HE 1F5RA 1ZSKA 2FOBA 2ZC9H 3ITIA 3SBKA 1JRTA 1EUFA 3BEUA 5DJ7A 1K2I1 1O2QA 1RGQA 1LKAA 3SV9A 1C5QA 1XUJA 4H6SB 2BX3A 1ZMNA 1IQJA 4TWWA 1MQ5A 3TH4H 3IG6B 4GUXA 2D2DA 4R8TB 4K1EA 1C1VH 1O37A 2A7CA 1DXWA 4Y79A 2PKAB 1AVWA 1MTVA 3SU2A 3K65B 3UNRA 1XUHA 2ZU2A 2F83A 3A7ZA 3UFAA 2PGBB 2ZG0H 2J38A 2B5TB 1HBTH 4MVNA 1HIAB 1W11U 4UD9H 1ANEA 5C1YA 1GJ6A 2ZWLH 2PTCE 4K2YA 4OS1A 3UOPA 1HYLA 1C1UH 1NFYA 2C8YB 2GP9B 3M5LA 1A1RA 1G3DA 1P57B 2XTTB 3SI4H 1C2GA 1BBRK 4I8GA 3TJUA 1VZQH 5JYIA 1P3CA 1GMHG 4BOHA 9ESTA 3RXTA 4RN6A 2FOFA 2XXLA 2ZTYA 4E06H 2OUAA 4Z0KA 1C4U2 4ABAA 2CXVA 3KQEA 4JK6A 1UTOA 1ELDE 3PTNA 1P2IA 3B23B 3F9FA 2A4QA 3BTME 1PFXC 2ZECA 1NTPA 3Q00A 4DT7B 3EYDA
chains in the Genus database with same CATH superfamily
4IS5A 3PO1B 1T8NA 3H5CB 3SGQE 1O5BB 2BHGA 8KME2 4MLFB 4I8LA 1TB6H 1WTHD 4AYYB 1S5SA 1NT1A 2PR3A 1SGEE 3JZ2B 2FDAA 1GBLA 1AU8A 1MD7A 1W13U 2JH0D 7GCHG 2G5VA 3O8RA 3M61U 5LH8A 2J92A 1TFXA 1O3EA 1GL0E 1Y5AT 2ANMH 2BLQA 1SQTA 2GV7A 4WMDA 5TJXA 1DSTA 3VXEH 3A89A 1UVOA 3V13A 3DA9B 4Z6AH 5B6LA 2XC0A 1OXGA 3TVJB 4IN2A 3QGJA 2P8OB 3F0PA 1AWHB 1HAVB 1O5GH 1B5GH 1C5RA 2C8WB 5GNDA 1OX1A 2ZPSA 1MH0A 2F9BH 4JZIA 5FHTA 1GWAA 1HJ9A 1TA2A 1QY6A 1ZTKA 2FX4A 2ZA5A 5EG4A 4IGDA 4TPIZ 4A1TA 1YPMH 2PP6A 5DP6A 3OSYA 1UCYK 2IN2A 4XBDA 4O3UA 2VIVA 1BTHH 2NU0E 2ZPQA 1QQ4A 2WV4A 1GCTB 3GCTF 3U8RH 2OC7A 4GLYA 3LT3A 3FVFB 1TE0A 4NZLA 3NWUA 1O2XA 2OC8A 1O2ZA 4DIIH 1QL7A 4Q80A 2SFAA 2A7HA 4KKDA 1WDIA 1IHTH 1CT0E 2A4OA 1TNKA 2IOTA 4H42U 1GPZA 1S82A 2ZDNA 2JIZD 4BAQB 1P8VC 1TOCB 2J98B 2F3CE 3STIA 1WAYB 3ZZ7A 1CVWH 1O2RA 4CHAC 3SU6A 3I77A 4UFEH 4OGXA 2XBWA 1VGCC 2SGEE 1O2WA 3RXSA 1HJAC 2AERH 1LVMA 1ARBA 2WPLS 3LC5A 1D3PB 1C9PA 1AFEH 1GHAG 1TRMA 4JZDH 4Q63A 1FXYA 1C1TA 2VU8E 4ABFA 4DGJA 2HVXA 2GT7A 3SQHE 2SGAA 3A86A 2HPPH 3U69H 6CHAB 4WXVA 3VGCC 3B9FH 1COWD 2FX6A 2G4UA 4ESTE 1GMCG 1FN6A 3UWIA 1F0TA 1IQLA 3RP2A 4NGAH 1QRWA 3QZRA 1LTOA 1DY9A 2ZFQH 3SNEA 4ZAEA 1S0RA 3DSPA 4K8BA 4NA7A 4AFZA 2R0KA 2B7DH 1YGCH 1ZJDA 3SGBE 3NCLA 3GCOA 1D3TB 1FIWA 1TBRH 4UONA 4UE7H 2QY0B 3F9GA 1GHZA 1G30B 3SUGA 1YPJH 2XNIA 3L6PA 3URCA 4AORA 1A3EH 1UTJA 3MNSA 2G8TA 4BTUB 1AMHA 4ZKOU 3WWFA 1AFQC 3VFEA 2FOMB 3N99A 4THNH 1ZZZA 1Z1IA 3LDXH 4XD7D 5EOKA 1RXPA 3RM2H 8ESTE 4NWLA 1QA0A 2GD4B 1MBMA 2FOEA 3HK3B 2AGEX 4DCDA 3SUEA 5IK2D 2IJD1 1ZSJA 3SYJA 4GSOA 4B71A 4JK5A 3ODDA 2PGQB 2SGDE 1KTSB 2LNCA 1PPEE 1ESAA 5FX5A 1GG6B 4HZHA 4INLA 1NZQH 2ZDAH 3ZZBA 1EOJA 1Z8JB 2AS9A 5EQRA 1HJAB 5HIYA 1BBRH 1KIGH 4MG3A 1GI1A 2GKVE 4DT4A 3ZVCA 3B8JA 1MAXA 3QTOH 3ATIA 3ZVBA 2ESTE 1MTNB 1BMLA 1SGIB 1SPJA 5JBCS 3ZIAD 1AGJA 3U9AH 1D6RA 3OY6U 1OSSA 3A8BA 3LJJA 2FIRH 3A88A 3RXBA 2OQUA 4UFFH 3A80A 2XCFA 5DP5A 5F8XA 1AD8H 1V2LT 2GDEH 3BTQE 2FZZA 3F9HA 2ZFTA 1TBQH 2Z9IA 1QBOA 1AE8H 4F49A 2WPDD 3TK5A 5C2ZA 4K1TA 1DY8A 1XKBC 1PQAA 3U98H 1AVGH 5EODA 4JZFH 3OE7D 2H2ZA 1MUEB 5FAHA 3BTWE 3NUMA 3SJIA 1CBWB 2GT8A 1L0ZA 1UVTH 3OY5U 1DUEA 3MO9A 3ODFA 1E79D 3CP7A 1ZHPA 1GI6A 2R9PA 4ZHMU 2GCHG 2BY9X 1BIOA 1XUKA 3PWBA 2VIDA 3LIWA 1KLIH 4X1PU 1T7CA 4ABBA 2BMGB 1P2MA 4JZ1A 1NRQH 4X6MA 3SORA 1SFIA 3KQBA 4IC5A 3UR6A 4CH8B 1KXDA 5DPAA 1JMOH 1V2PT 2FS9A 4I8HA 1P12E 5EJZA 1T4VH 1MCTA 4IMZA 4VGCB 3ATLA 4YLQH 4ABJA 2A32A 2VVCA 2AH4X 1TLDA 3OEED 1MABB 3D65E 1L4ZA 2AGIX 3PMJA 4ZUHA 1IOEA 1D3QB 1YPKH 4ZHAA 1C1NA 3SU1A 3A8DA 1O2TA 1O39A 1THSH 3BTKE 4K3JA 5EQSA 1CGIE 4K8YA 1GVKB 1LHGH 4UEHH 1UHBB 5LGOA 2PLXA 1TMUH 4BAHB 2XYAA 3N7DA 1A4WH 1O3BA 2AIQA 3VB4A 1O3JA 2TGAA 2C3SA 1AB9B 5ESBA 5TCCA 3ESTA 2KCYA 4XBBA 2A2XH 1NU9A 3SNCA 2BQ6B 2WYGA 2K8IA 1THPB 4GVUA 1W12U 3AK5A 1LVYA 2EA3A 2F43B 3BTGE 4HTCH 4X1QU 1GI8B 1ZHRA 4B76A 2QAAA 3RU4D 3NKKA 3LGIA 4AFQA 3BTEE 1C1WH 1FY8E 2PKSC 3A84A 3RXGA 3BG4C 1BA8B 1MU8B 1VKYA 2EEKA 1KY9A 4U32A 3T26A 2PKAA 3CNRA 1TYNA 5T6GA 1YF4A 2JH5D 3MMGA 2BM2A 1HGTH 3W1EA 3EQ0H 2ZEBA 1S84A 1SGYE 2XWBI 3BN9A 2VNTA 1XM1A 2O8TA 1KMHB 1FUJA 2ANYA 2OINA 5FPYA 3PM3A 1TNIA 2CN0H 1AN1E 3LONA 1LPGB 7LPRA 3LPRA 4CRFA 1BJUA 2OK5A 4SGAE 4YT6H 1UTNA 1BB0B 2QF5A 3U8OH 1TGTA 2A5AA 2H9EH 1QBVH 2PSYA 1DPOA 1F7ZA 1D9IA 3MI4A 2BDYA 1C2IA 3TLOA 4B1TA 1K28D 1NBME 1PYTC 1TX8A 1XVMA 3FP6E 1QFKH 3FP7E 4D7GA 1D6WA 1F5KU 1FIZA 2TPIZ 1G37A 1RIWC 3A7VA 3GCHC 3LGUA 3WY8A 2SGPE 4WWYA 3V12A 2A45B 1GBTA 5AVDA 3RMMH 4CREA 3TK9A 4ZXYH 1H9LB 2TGDA 1Y5UT 5DSFA 5T6DA 1NFWA 1QR3E 3SN8A 3GS9A 3ENSB 5CHBA 2RDLA 4IMQA 1EAUA 1LHDH 1DWEH 2P3UB 3FP8E 1L2EA 2P95A 3KEEA 2FESH 1MD8A 1E1QD 1P01A 3DT0H 1O3KA 3SUDA 3GDSA 2ZHEH 2CK3D 3TU7H 3MU0A 1O5CB 1SR5C 4K60A 2UWLA 1CA0C 1HAVA 4DIHH 3VB3A 1YYY1 1SGNE 5HMAA 3LH3A 3TJVA 1TRYA 1G2LA 1WXRA 3R0FA 2Y82A 1P0SH 2ZKSA 1TNJA 1ZTLA 5DP9A 1BMMH 2NU2E 5C5NA 1SOTA 1NN6A 1BZXE 1ZGVA 1GBIA 3P70B 1MQ6A 2GGVB 4NIXA 1CT4E 1MKXK 3UTUH 1FMGA 4ABEA 1O3IA 5IDKA 1UVSH 1TX7A 1YPEH 3WWBA 2Y81A 3DUXH 4E7NA 1OP8A 1YP9A 2BOKA 3AASA 4OM9A 1L1NA 2J98A 4TY6A 1A0HB 5EPYA 1N6YA 1NS3A 3M36A 4DJZB 2H6MA 2M5TA 1EXFA 1FX0B 3LGTA 1GI2A 1J8AA 3JZ1B 2CHAB 2V3HH 1KXBA 3S0NA 1B0EA 1SBWA 1C5TA 2OC1A 3K2UA 1LCYA 1SLUB 4X8VH 2Z9LA 5FCKA 4ISNA 3SQEE 1WBGB 4B74A 4XRNA 1CHOF 2FS8A 3P8FA 3PV5A 4QT8C 3ZVDA 1P2KA 3RMOH 3A7TA 1WCZA 3RMNH 2DE8A 5LPEA 2KR7A 2BDCA 2H5DA 3MO3A 4OS6A 1ZTJA 4TPYA 4BXSA 3ZVFA 2HNTE 5GWZA 1WQVH 1UTMA 3F2HA 1ZRBA 1ABJH 1SLVB 3RU4T 3EA8A 3UNSA 3GCTG 3GISB 3ZZ4A 4CBNA 1IQHA 3MH7A 1P09A 4J1YA 1EZXC 3PO1C 2Z94A 2ZO3H 2OTVA 1GL1A 1WOFA 1PQ8A 1MKWK 4MNVA 3VXFH 1ZGIA 2VH6A 1QJ6B 2FI4E 3GY2A 2ODQA 1ZPBA 1VCQA 1QIXB 1KXEA 1LVOA 2B8OH 1O3HA 3GY8A 3SHAH 4BTIB 3ZVAA 1TPPA 2BZ6H 3CS0A 3FN8A 4X1NU 3SZEA 4DOQA 1AZZA 1Q2WA 1Z1JA 3BEIB 1YCPH 3NK8A 1BTYA 1C2FA 1RD3B 1V2RT 2ZP0H 2EI8A 2FPZA 1O2KA 4WY3A 1CHGA 3MH5A 3SV7A 1LHCH 1NFXA 5EXLA 2P8OC 5E0HA 4Z1MD 1A0LA 5JB9S 4E7RG 5F8ZA 2ZGBH 2ZDLA 5DKMA 4YOIA 1EB1H 3PMAB 1FY4A 1KLJH 3E6PH 3A81A 2BD5A 2BQWB 1BTPA 3MU1A 1GCTC 5CE1A 4AGJA 1E1RD 2AGGX 1XX9A 4Q7YA 4YTAA 4FUGA 1SGPE 1PYTD 3LJOA 4FOUC 1C1PA 4H4FA 1SGCA 1MTSA 2BLVA 3RXPA 2J94A 3O8DA 4NSVA 1F0SA 4GAWA 1NRSH 3EE7A 1FONA 1MU6B 1EASA 2F9UA 3RC6A 1ZSLA 2B9LA 1GDQA 1CO7E 3MU4A 1DITH 3S7HB 4WF8A 1BHXF 2BQ7B 3L33A 2C90B 4ISHH 1IQMA 3PLBA 3RXOA 2VVUA 1QQUA 2TRMA 1UK2A 3SV8A 1GBCA 1JOUB 1W0JD 1DLKB 3OTJE 1JBUH 2A4GA 5HIZA 2Y7ZA 2FMJA 2I6SA 4OS2A 1P05A 1EP5A 4HGCA 3IWMA 3KIDU 1GBBA 1INCA 1T8MA 1YCPM 4JYVH 4CRAA 4MTBA 4LZ4B 6CHAC 2IJOB 1FPHH 1QB6A 3TNSA 4GCHF 3GY7A 5F6MA 1GHBF 4A6LA 3U8TH 4IC6A 3RXCA 1P11E 1B0FA 3PV2A 1K9OE 1DOJA 4UDWH 1O2UA 3RMLH 2OP9A 2BX4A 1OWHA 1GJ5H 1TA6A 2KCPA 5FL7D 2W6JD 2V35A 1J15A 5J4QA 1MKXH 5I25A 1ELFA 1OYQA 5DP3A 1AKSB 1C4Y2 1BRAA 1JIRA 1BBRE 4YZUA 4AN7A 4FUBA 2GZ7A 3KYGA 4ISOA 1UHBA 2GZ9A 4AGKA 1NRRH 2RA0A 4WJG2 5L6NH 4FVBA 1TPOA 4LK4A 3ZZ8A 1QJ1B 5FPTA 1HNEE 1AHTH 4Q7XA 1FY5A 1GBHA 3QWCH 4X2YA 4OS5A 4P02A 2H9TH 3DSOA 2VWMA 1O3PB 2NU4E 1G3CA 1GG6C 1AUJA 1QL8A 1E36B 1F2SE 2VWOA 3DFJA 3SHCH 4DW2U 1OWIA 4I7YH 5HYOA 1A5IA 3UR9A 5C5OA 2Z7FE 3EGKH 1LVBA 2UWPA 1TPAE 1O3GA 1HB0B 1KTTB 5CDFE 1WYKA 3GICB 3BEFB 4IN1A 1ESTA 2B0FA 5ESTE 2H9HA 1PPBH 1Z8RA 1GJ9B 3HPTB 1TQ7B 2FTLE 4WMFA 3W95A 1MTNC 3BSQA 4FVDA 4XFQA 1EKBB 1OWEA 2L74A 7KMEH 2V3OH 1VR1H 5EGMA 1BT7A 1PQ5A 4F55A 5ABWA 2HPQH 2F9PA 2ZFPH 4BAOB 4AOQA 4D9QA 1YPHE 5GPIB 3S9BA 1MKWH 5GCHF 2V7QD 5LPRA 1X7AC 3V7TA 1THRH 1UCYE 1N1LA 1TGNA 3STJA 2DE9A 1Y59T 5DGJA 3ZZ9A 1S81A 3PTBA 1SLWB 2ZNKH 3ZV8A 3MU8A 2XRCA 2C4FH 3BTHE 1E38B 1O2VA 2L6OA 3OYPA 1VJAU 1DWDH 2ZFRH 1CBWC 5GIBA 2BLOA 2R3UA 3AAVA 3KQDA 1BRUP 1ELGA 3SU4A 2A1DB 2ZU1A 3SW2B 1YLDA 3A85A 1P9SA 4NWKA 1C2DA 2FI5E 2WV5A 3KNXA 3RXRA 3RXLA 4MQAA 1O31A 3UOUA 1MZDA 4OGYA 3WW7A 1SVPA 4OS7A 4NG9H 1OWDA 2VB0A 2XBYA 1SQAA 3EE0B 1MZAA 4VGCC 4YXWD 4WH8A 2EY4C 3RDZA 4CR9A 4A7IB 3UQOA 2KX4A 3F9EA 4IBLH 1FJSA 1C2JA 5L2YH 1YWUA 5TCAA 4FXGH 4D9RA 3C27B 2GCTB 2VWLA 4AG2A 1L4DA 4Y76A 1UO6A 2W3IA 8GCHF 4UFGH 5JBTA 2VJ1A 2ZQ1A 1GVZA 1H8HD 2G00A 4D76A 1XXDA 1IQEA 3EA7A 1AB9C 5CMXH 1IQGA 4H6TA 5A2MH 1GI9B 3KL6A 1GDUA 1GI0A 1JRSA 1JWTA 5G4BA 2W3KA 5EIYA 1C5NH 3PRDA 2R2WU 4FUHA 2VIWA 1SQRA 5DN6D 2ZDKA 1Z8IB 2XC5A 5C1XA 1V2TT 1GGDB 1SGQE 1BTZA 3TPIZ 1A0JA 2BTCE 3SU5A 1SB1H 1EZQA 4TY7A 4NA8A 1TNHA 1C2MA 2KZ4A 1SHYA 2PWXA 1EAWA 3BIVH 2ILNA 3T62A 4GHTA 1Y3XA 2SNWA 5DP8A 5HXFA 2ZCKP 1K21H 1BRBE 3QN7A 1KYNA 3RXFA 1V2QT 5BRRE 3NPSA 3OEHD 4NSYA 1DWCH 1QNJA 1TONA 2J34A 3FZDA 3ZYDA 3MU5A 2RCEA 3T28A 1CGJE 2AFQB 1UCYH 1CA8B 1GDNA 1V2VT 1O2GH 2QN5T 4AB8A 1HAGE 2ANKH 5EW1H 4Y10E 5FBIA 2JETB 2D8WA 1TAWA 2WYJA 1O5EH 3BTFE 2A7JA 3U28C 4ZXXH 5FX6A 4ASUD 1P9UA 3M7UA 4X8SH 1QB9A 3TIUA 4BAKB 5A8YA 2WPKS 5KEDA 1W7XH 2BYAX 3Q3KA 1QB1A 1SGTA 5C0UA 2KCAA 4KTCA 4LZ1H 2IPQX 1BQYA 1KXFA 1DLEA 1N8OC 2GV6A 3CS7A 4FU9A 3P6ZB 4JYTA 3ZZ3A 2F91A 1CGHA 1DM4B 1TNLA 2ZU4A 1BOQA 2QF0A 4Y7AA 3SZNA 3ZZ6A 1HXEH 4A1XA 1O2JA 2Y5FA 3A8CA 1O2YA 4Y8ZA 3NXPA 2FEQH 3O8BA 1H9IE 3IITA 4Y11E 1DT2A 3GCNA 1S6HA 2WPHS 4WXIA 2BLWA 4GHQA 4JMYA 1C5XB 1HAIH 1CHOG 1KSNA 1O0DH 1OP2A 2QIQA 1TRNA 2K1QA 3RLWH 1G3BA 2XCNA 2ZZUH 5C20A 3TJNA 2KCOA 4U30A 2ZF0H 3EA9A 2OBQA 3SUFA 3MNCA 1OYTH 1UTQA 2AMPA 1GMDF 1ZYOA 2J2UA 4YOJA 4AFUA 1OOKB 1FY3A 1A2CH 5C17A 4RT1A 5SGAE 1MCVA 1NFUA 3QTVH 4R0IA 1EFRD 4FUDA 2HNTF 2VWNA 1GJ8B 3F2GA 1ZRKA 3RM0H 4ABHA 2J9NA 3P8NA 1RTKA 3E3TA 1OHHD 1NC6A 2ZI2H 1C5VA 2GMTB 1Y8TA 4FUCA 1O32A 3HK6B 2G55A 3PB1E 5B6OA 3TK6A 1HCGA 3BTDE 2CHAC 3KHVA 8LPRA 4IW4E 2W7SA 1XMNB 3FOAA 3G01A 3GDUA 4B73A 1CT2E 1V2UT 3K6ZA 4MPUA 2R0LA 3T27A 1O38A 5E2OA 3V3MA 2GJGA 3SJKA 2CGAA 4I86A 1GBJA 2Z3EA 4AYVB 1W2KH 3FAOA 3RXJA 5HKKD 3OTPA 1N8OB 2CF9H 1VITH 5JBBS 3BTTE 2PTNA 1ANBA 1EOLA 2AIPA 1GI4A 4ZKNU 2F9VA 2VVVA 3PMHB 1HV7A 4AFSA 4XOJA 2VGCB 4X6PA 3ELAH 3E1XB 1C9TA 2PV9B 2P3TB 1V2KT 2C93B 1YBWA 1C1MA 4FU7A 1TBZH 2VINA 1EPTB 2FTMA 1RTFB 3BF6H 1NROH 1TX6A 3DD2H 2BY7X 1H1BA 2FXRA 2QF4A 3A7WA 1FDPA 1GBMA 2J97A 3HATH 3RXDA 5JDUB 2G51A 1M9UA 1N6XA 4ZKRU 1ZPCA 1DANH 1FPCH 1EAIA 1AKSA 4AZ2B 1DS2E 1P3EA 3HKIB 2V6NA 1O5DH 2ZU3A 1ANCA 1O33A 1QGFA 3L3TA 4O9VA 3HGPA 2BXTH 2Q6FA 1EJMA 1XUFA 2Q6GA 3A87A 3S9CA 1TWXB 4U01A 2ZTXA 3D49H 2FOAA 1EB2A 1QRZA 2W5EA 4O97A 3TH3H 2FOCA 3W94A 2GVFA 3GOVB 2ZGJA 4M7GA 1NY22 2TGTA 3O8CA 2GDDA 1MAYA 2FWWA 3H7OA 3Q77A 1C2EA 2Y6TA 4INKA 1EJNA 4RKJB 4GPGA 3PMBB 4X1SU 4DY7B 1PPZA 2ZDVH 2JJ1D 3Q3XA 4XBCA 1J16A 2BD9A 5T1VA 1AIXH 1F0RA 1PPFE 1O3NA 3GDVA 3A83A 4BAMB 3ZVEA 4GCHG 1ETRH 1Z8GA 1O3MA 1GHBG 3ATKA 3DHKH 3LKWA 1E0FD 1LHFH 2W7UA 1C5UA 1BHXB 4DVAU 3F0OA 2BY5X 1BUIA 2QXJA 1BITA 1XUGA 1B7XB 1Z7KA 1C1SA 5C3NA 5BPEA 2QE7D 2XBXA 2KM0A 1DICA 3RXKA 3FO8D 4TWYA 2J5UA 3NRLA 1GHWH 1SSXA 5EXMA 1ZMLA 1QZ8A 1GJAB 3PROA 4UFDH 3EAJA 4ZKSU 2H5CA 2EI6A 1TQ0B 1EP6A 4B2CA 1BMFD 5A0BA 4WH6A 1IQKA 1YM0A 3VB7A 4X2XA 4E05H 1K1NA 3RU4E 3ATMA 2BD3A 1HPGA 4B75A 3LC3A 2A4RA 2OC0A 1KXAA 1V6DA 4BNRA 1GBEA 2THFB 5FPSA 1Z71A 2ZGHA 4I33A 2ZTZA 3UNQA 1WTGH 4FU8A 5DG6A 4J2YB 1J17T 3AW1A 2P93A 3CENA 2FOGA 3UB0A 3V0XA 3SJ9A 2QV1A 1A46H 1WV7H 1KXCA 1TALA 3HGNA 4JCNA 4HFPB 1CSOE 3E0NB 4CRDA 4D8NA 3M7QA 2EQNA 1DX5M 2XWAA 5K0HA 4NIWA 5T3HA 2KFWA 1DUAA 2PUXB 2WPMS 2K0QA 2CV3A 1LO6A 2ZFSA 1BRCE 4ASHA 2O8MA 1QTFA 1W10U 1V2MT 2ANWA 5H4IB 1GBAA 2OBOA 4JZEH 4MDSA 2PSXA 3P92A 1FZZA 1DE7H 2C8ZB 3BG8A 1WSSH 1UJ1A 1IQNA 1Y5BT 5FCRA 2STBE 1ZOMA 2VBCA 4B2AA 3P95A 1H8IH 1F92A 2V3MA 1E37B 1C5SA 1HAHH 3SI3H 5GCHG 3MFJA 1HJ8A 3U1IB 2CJIA 3AW0A 3QGNB 2DUCA 1RFNA 4RSPA 5HGGA 2V0BA 4X6OA 3RXIA 1SGFA 1YY3A 5L2ZH 2BOHB 2YNBA 1V3XA 5E2PA 4A1VA 3OX7U 1GBDA 2HLDD 2EI7A 2ALVA 1NM6A 3ZVGA 1TOMH 2ZGXH 1WU1A 3MTYA 4WVPE 1ESBA 2UUKB 1PQ7A 2FLRH 2W6ID 1C5WB 3S69A 2OD3B 2YNAA 1Q31A 3K6YA 5HM2A 1ANDA 2UUYA 2XBVA 4AC9A 4A5TS 3RXUA 2QXHA 3MYWA 4SGBE 4X1RU 1Z6EA 1W14U 3E8LA 2LELA 4FUEA 2HRVA 1GHVH 1O2HA 2HLCA 5F53A 1P04A 1KLTA 4Y0ZE 2ULLA 1ZR0A 4LXBH 5DP4A 1C2HA 1W0ZU 2A5IA 2Y80A 4KTUA 5AFYH 6ESTA 5E0GA 2G5NA 4FETA 3PLKA 2YMSC 4ZHLU 1K1MA 3D62A 1HAYB 2Z3DA 3RXEA 1D3DB 1K0HA 3LU9B 4CBOA 1O3DA 4HG6A 1DWBH 1O2SA 1SLXB 2CMYA 2QF3A 1EZSC 4LOYH 2WV9A 2SNVA 3FZZA 4Y7BA 4INHA 3T2NA 1HAXB 1AVXA 2Q6DA 4NFEA 8GCHG 4K1SA 4NCYA 5KECA 5K7RA 1TIOA 3SV2H 3T29A 2BB4A 2FP7B 3E91A 4K69A 2F9NA 1FI8A 1Z6JH 4TT3D 3TITA 4B2BA 4MNWA 4K5ZA 1YPGH 1PPHE 2BDHA 1P2QA 4Q4LA 1GHYH 3P17H 1C5ZB 2ZHWH 1ABIH 5KGOA 2WUBA 1AUTC 3F3BA 5DO4H 1L1JA 2P3FH 5EJLA 2A0QB 4A92A 1C5MD 1W8BH 4DURA 3E90B 1W7GH 1SGRE 2RFKC 2ALPA 1SHHB 3M5MA 1O2IA 4YOGA 3M3TA 1NU7B 5PTPA 5JPMH 1GI3A 2STAE 1P10A 2QA9E 1HAPH 3K9XB 5AHGH 3KQCA 2NWNA 4M9FA 2HALA 3MQKC 4MPWA 4AG1A 5C94A 3M5OA 2Y5HA 4KGAA 5JB8S 9LPRA 1OP0A 3ZZ5A 2BDAA 1H8DH 3SGAE 1QRXA 3LGWA 1SC8U 1DFPA 1KDQB 2GCTC 2BDBA 1MMJN 1WQSA 5A0CA 1MTWA 1AI8H 1GBKA 1VITF 1ZMJA 1C2LA 1G3EA 3U1JB 3HKJB 3TH2H 3RXMA 2LPRA 1ETTH 2RA3A 3LGYA 1WUNH 2HWLB 2D26C 6GCHF 1LQDB 1CU1A 2Z9KA 3RXAA 2YMSB 1DVAH 4I8KA 2F9OA 3MHWU 1K1LA 5IYTA 1G32B 3TJOA 4ISLA 1C1RA 4FUIA 2ZCLP 4X8TH 3ZZAA 4NFFA 1S85A 3RXHA 1T8LA 1LDTT 4MPXA 2NU1E 2RG3A 3SJ8A 1SFQB 1LHEH 1SOZA 2HNTC 2I6QA 1IQFA 1GGDC 3SV6A 3QK1A 1ELTA 1W0KD 2ZHDA 4FUFA 1O3FA 1U6QA 3LOXA 4XE4A 1QCPA 1LQEA 1HRTH 3UPEA 1W3CA 2O8LA 2UUJB 1LPKB 3AAUA 5EPNA 1V2WT 3F68H 2WUCA 1AE5A 4MNYA 1EAXA 1SGFG 3OU0A 2D1JA 3GY4A 4P00A 5E8EH 1SMFE 4NZQA 2JKHA 1ELAA 5L30H 1TGSZ 1GMHF 5EQQA 3QDZB 1PJPA 1O34A 1NO9H 1GMDG 1HXFH 4RI0A 3D23A 1GBFA 1EPTA 3A8AA 1XXFA 2M2AA 4YLUA 2KAIB 2BDIA 2JETC 2BVRH 1RTLA 2G4TA 1P02A 4CRGA 3PRBA 1K1PA 1LPZB 1AQ7A 2J95A 2WHXA 2G81E 1V2ST 2GX4A 2BD4A 1AWFH 1ZLRA 2ZCHP 3VEQB 4NA9H 4ZH8A 2ZQ2A 1TMBH 2J4IA 1H4WA 2PUQH 2HGTH 1C2KA 2OQ5A 4NIYA 4ZMAH 2BY6X 3SU0A 4NIVA 2FYQA 5GJ4B 7GCHF 1OKXA 1RRKA 5LPFA 3LGVA 1NRNH 1IHSH 2Y7XA 4O3TA 4CHAB 1NBMD 1L1GA 1O3CA 2SGFE 1UTPA 1VGCB 5F8TA 3UQVA 3A7YA 4ABIA 1JXPA 2C8XB 3UWJH 3VB5A 7ESTE 2A2QH 3ZZCA 3C1KA 1JIMA 1ORFA 1VCPA 3FANA 4X2VA 4F48B 1SI5H 3GY5A 1TABE 1F0UA 1SG8B 2QC2A 3TNTA 3TGIE 1FY1A 1K22H 2YMSD 2P94A 4ISIH 3M35A 1AY6H 2BD2A 1GI7B 3A82A 3VGCB 3QUMP 3FKSD 1Y3YA 2IPHA 4JYUH 1P06A 2XNDD 4OS4A 1VJ9U 2O8UA 3VB6A 5HM9A 1LKBA 1VCWA 1O3AA 1XKAC 1YKTA 2Q1JA 3M3SA 4ACBA 3ZV9A 4ABDA 2WINI 5J4SA 4AX9H 1YLCA 1T31A 3OFND 2AHME 1V2JT 3GYMA 3S9AA 3UY9A 4WMEA 2Z6BD 4X6NA 1ELVA 4YESB 1C5YB 2AEIH 1O5AB 2BD7A 1G2MA 1UK4A 2QYIA 2GMTC 3ATWA 3S7KB 5C1UA 2SGQE 1AFQB 1A5GH 3URDA 3RUOA 5ETXA 5DK1A 3N7OA 4D7FA 4X0WU 3UAIC 3DFLA 5EXNA 3F2FA 2FI3E 1SQOA 1O30A 1GHXH 3FFGA 1GHAF 2YOLA 1ACBE 3SNBA 1UTKA 1EATA 1RJXB 1GVLA 3E16B 4Y8YA 5CHAC 5FBEA 3QLPH 5FXLA 1NPMA 2BD8A 2UUFB 1TMTH 4YT7H 1GMCF 3KN2A 1TGBA 1UTLM 1OWJA 2A31A 2VGCC 3KYFA 4BXWA 1ZPZA 1LMWB 2AYWA 5F03A 2PW8H 2O9QA 1CE5A 2HVYB 1C1OA 1EPTC 2Z9GA 3H7TA 1GJ7B 1P03A 3TGKE 3TGJE 1O3LA 1BTWA 1T32A 2OLGA 1BTXA 1CQQA 1ELCA 1UMAH 2BY8X 2AMDA 1S6LA 3N7EA 1OPHB 1J14A 2AMQA 2LP6A 4Q2KA 4X8UH 4AB9A 2ZU5A 1D4PB 2ZHQH 1GCDA 3NZIA 4I32A 1DDJA 1HFDA 2ZHFH 4KELA 1AO5A 2NU3E 1HDTH 5EW2H 2ZDMA 5JBAS 1SKYE 3GY6A 2XC4A 4ZCNA 2WPIS 1MBQA 1TNGA 3SU3A 3SOSA 1Y3WA 5GXPA 2TIOA 1O2MA 1ZHMA 1ID5H 4HI3A 4CRCA 4MPVA 4X2WA 1O36A 2BDGA 3F1SB 1YPHC 4O03A 2Z3CA 1YCPK 3T5FH 3UIRA 1S6FA 2HOBA 1UVUH 1V2OT 1T4UH 1C4V2 1EX3A 1HIAA 4XDEA 2FM2A 2WSSD 3M37A 3PV4A 5C67A 5GDSH 1A7SA 1T8OA 2GZ8A 1BMNH 1FNIA 1A61H 4F4OC 1AZ8A 1PPGE 1V2NT 1G36A 1QA7A 1YC0A 2FODA 1F5LA 2R3YA 1O2PA 1BMAA 2QGRA 3MWIU 2A5KA 1HAOH 3RXQA 1QURH 3P8OA 1P2NA 2PHBA 2H1UA 1ELBA 1O5FH 4I31A 3UREA 4KTSA 1RS0A 3SJOA 1BTUA 2CF8H 4I8JA 4KP0A 3M5NA 4PROA 1G9IE 1C1QA 5CHAB 2O8WA 2ZPRA 4TYDA 3P8GA 3MH6A 5A0AE 1FLEE 1E35B 1HLTH 4ABGA 1XVOA 2VIOA 3EDXB 5EU8A 1OWKA 3SNDA 1FAKH 4RKOB 1TPSA 1K1IA 4Y71A 3ZYEA 1QJ7B 1Q3XA 3M7TA 2UWOA 2ZFFH 1QBNA 1UW7A 3UUZA 3MOCA 1HAZB 1OS8A 3LH1A 2ASUB 3QO6A 3I29A 1DSUA 5A8XA 1O3OA 3SO3A 1SL3A 3A7XA 5C0TA 5DP7A 1GJBB 2JDID 6LPRA 3GY3A 2PFEA 2GCHF 1Y3UA 2VIQA 2VH0A 2WZQA 3GYLB 4B6EA 4CR5A 1J9CH 1ZJKA 1XUIA 2PKSB 2TBSA 3BG4B 2Z9JA 3E0PB 3ZZDA 2ODPA 1ELEE 2BXUH 1Y3VA 1EQ9A 3KGPA 3RC4A 1A3BH 1EZUC 1QHRB 4Y0YE 2QXIA 1K1JA 2R2MB 1K1OA 4Y6DA 1O2OA 5I46H 3MNXA 1KDQA 5T6FA 2JH6D 1FN8A 5E0JA 1SGDE 2OCVB 1HUTH 1O35A 2QXGA 3T25A 1TGCA 1GJDB 2VIPA 3KCGH 3AVZA 3RXVA 3I78A 2WPJS 1E34B 1QL9A 1FAXA 1P2OA 2P59A 3RLYH 2P16A 4DG4A 4TSFD 1ARCA 1FQ3A 1H8ED 3MO6A 1IQIA 5A09A 3DSGA 4BANB 2QCYA 2FYRA 2XW9A 1GJ4H 2Y5GA 1C5LH 1RIWB 3GCHB 4YM9A 5EJ1A 4BTTB 2ODYB 1A5HA 1BCUH 2EC9H 2FO9A 4MNXA 1MTUA 2RDEA 5AFZH 3Q76A 4CH2B 3Q3YA 3VG8A 3PYHA 1UK3A 3VPKA 1PPCE 1UVPA 3QX5H 3BIUH 3QZQA 5AF9H 2ZGCA 2BVSH 4ACAA 2ZIQH 4XSKU 1P2JA 3SNAA 5A8ZA 2BZAA 3MH4A 1C5OH 1DXPA 2JJ2D 1BJVA 3F6UH 4YO9A 1EJAA 2OXSA 3PWCA 4CRBA 2GTBA 3RC5A 1O2NA 2FLBH 2FOHA 1CA0B 4Q7ZA 1ETSH 3PLPA 1C5PA 4U2WA 3KF2A 1GI5A 1S0QA 1YPLH 1FV9A 2TGPZ 3MNBA 1S83A 1VITG 1O2LA 4Y8XA 1GJCB 1BDAA 1NRPH 2BVXH 1W0YH 4RT0A 2KAIA 2W26A 4ZROA 1IAUA 6GCHG 3M3VA 2G52A 1NESE 3R3GB 3BV9B 4FUJA 1H9HE 1F5RA 1ZSKA 2FOBA 2ZC9H 3ITIA 3SBKA 1JRTA 1EUFA 3BEUA 5DJ7A 1K2I1 1O2QA 1RGQA 1LKAA 3SV9A 1C5QA 1XUJA 4H6SB 2BX3A 1ZMNA 1IQJA 4TWWA 1MQ5A 3TH4H 3IG6B 4GUXA 2D2DA 4R8TB 4K1EA 1C1VH 1O37A 2A7CA 1DXWA 2F4LA 2XOKD 4Y79A 2PKAB 1AVWA 1MTVA 3SU2A 3K65B 3UNRA 1XUHA 4B6FA 2ZU2A 2F83A 3A7ZA 3KQ5A 3UFAA 2PGBB 2ZG0H 2J38A 2B5TB 1HBTH 4MVNA 1HIAB 1W11U 4UD9H 1ANEA 5C1YA 1GJ6A 2ZWLH 2PTCE 4K2YA 4OS1A 3UOPA 1HYLA 1C1UH 1NFYA 2C8YB 2GP9B 3H09A 1A1RA 3M5LA 1G3DA 1P57B 2XTTB 3SI4H 1C2GA 1BBRK 4I8GA 3TJUA 1VZQH 3DCLA 1P3CA 1GMHG 5JYIA 4BOHA 9ESTA 3RXTA 4RN6A 2FOFA 2XXLA 2ZTYA 4E06H 2OUAA 4Z0KA 1C4U2 4ABAA 2CXVA 1YLNA 3KQEA 4JK6A 1UTOA 1ELDE 3OAAD 3PTNA 1P2IA 3B23B 3F9FA 2A4QA 3BTME 1PFXC 2ZECA 1NTPA 3Q00A 4DT7B 3EYDA
chains in the Genus database with same CATH topology
4IS5A 3PO1B 1T8NA 3H5CB 3SGQE 1O5BB 2BHGA 8KME2 4MLFB 4I8LA 1TB6H 1WTHD 4AYYB 1S5SA 1NT1A 2PR3A 1SGEE 3JZ2B 2FDAA 1GBLA 1AU8A 1MD7A 1W13U 2JH0D 7GCHG 2G5VA 3O8RA 3M61U 5LH8A 2J92A 1TFXA 1O3EA 1GL0E 1Y5AT 2ANMH 2BLQA 1SQTA 2GV7A 4WMDA 5TJXA 1DSTA 3VXEH 3A89A 1UVOA 3V13A 3DA9B 4Z6AH 2XC0A 1OXGA 3TVJB 4IN2A 3QGJA 2P8OB 1AWHB 1HAVB 1O5GH 1B5GH 1C5RA 2C8WB 1OX1A 2ZPSA 1MH0A 2F9BH 4JZIA 5FHTA 1GWAA 1HJ9A 1TA2A 1QY6A 1ZTKA 2FX4A 2ZA5A 5EG4A 4IGDA 4TPIZ 4A1TA 1YPMH 5DP6A 3OSYA 1UCYK 2IN2A 4XBDA 4O3UA 2VIVA 1BTHH 2NU0E 2ZPQA 1QQ4A 2WV4A 1GCTB 3GCTF 3U8RH 2OC7A 4GLYA 3LT3A 3FVFB 1TE0A 4NZLA 3NWUA 1O2XA 2OC8A 1O2ZA 4DIIH 1QL7A 4Q80A 2SFAA 2A7HA 4KKDA 1IHTH 1CT0E 2A4OA 1TNKA 2IOTA 4H42U 1GPZA 1S82A 2ZDNA 4BAQB 1P8VC 1TOCB 2F3CE 3STIA 1WAYB 3ZZ7A 1CVWH 1O2RA 4CHAC 3SU6A 3I77A 4UFEH 4OGXA 2XBWA 1VGCC 2SGEE 1O2WA 3RXSA 1HJAC 2AERH 1LVMA 1ARBA 2WPLS 3LC5A 1D3PB 1C9PA 1AFEH 1GHAG 1TRMA 4JZDH 1FXYA 1C1TA 2VU8E 4ABFA 4DGJA 2HVXA 2GT7A 3SQHE 2SGAA 3A86A 2HPPH 3U69H 6CHAB 4WXVA 3VGCC 3B9FH 2FX6A 2G4UA 4ESTE 1GMCG 1FN6A 3UWIA 1F0TA 1IQLA 3RP2A 4NGAH 1QRWA 3QZRA 1LTOA 1DY9A 2ZFQH 3SNEA 4ZAEA 1S0RA 4K8BA 4AFZA 4NA7A 2R0KA 2B7DH 1YGCH 1ZJDA 3SGBE 3NCLA 3GCOA 1D3TB 1FIWA 1TBRH 4UONA 4UE7H 2QY0B 3F9GA 1GHZA 1G30B 3SUGA 1YPJH 2XNIA 3L6PA 3URCA 4AORA 1A3EH 1UTJA 3MNSA 2G8TA 4BTUB 1AMHA 4ZKOU 1AFQC 3VFEA 2FOMB 4THNH 1ZZZA 1Z1IA 3LDXH 5EOKA 1RXPA 3RM2H 8ESTE 4NWLA 1QA0A 2GD4B 1MBMA 2FOEA 3HK3B 2AGEX 4DCDA 3SUEA 1ZSJA 4GSOA 4B71A 4JK5A 3ODDA 2PGQB 2SGDE 1KTSB 2LNCA 1PPEE 1ESAA 5FX5A 1GG6B 4HZHA 4INLA 1NZQH 2ZDAH 3ZZBA 1EOJA 1Z8JB 2AS9A 5EQRA 1HJAB 1BBRH 1KIGH 4MG3A 1GI1A 2GKVE 3ZVCA 3B8JA 1MAXA 3QTOH 3ATIA 3ZVBA 2ESTE 1MTNB 1BMLA 1SGIB 1SPJA 5JBCS 1AGJA 3U9AH 1D6RA 3OY6U 1OSSA 3A8BA 3LJJA 2FIRH 3A88A 3RXBA 2OQUA 4UFFH 3A80A 2XCFA 5DP5A 5F8XA 1AD8H 1V2LT 2GDEH 3BTQE 2FZZA 3F9HA 2ZFTA 1TBQH 2Z9IA 1QBOA 1AE8H 4F49A 3TK5A 5C2ZA 4K1TA 1DY8A 1XKBC 1PQAA 3U98H 1AVGH 5EODA 4JZFH 2H2ZA 1MUEB 5FAHA 3BTWE 3NUMA 3SJIA 1CBWB 2GT8A 1L0ZA 1UVTH 3OY5U 1DUEA 3MO9A 3ODFA 4ZHMU 3CP7A 1ZHPA 1GI6A 2R9PA 2GCHG 2BY9X 1BIOA 1XUKA 3PWBA 2VIDA 3LIWA 1KLIH 4X1PU 1T7CA 4ABBA 2BMGB 1P2MA 4JZ1A 1NRQH 4X6MA 3SORA 1SFIA 3KQBA 4IC5A 3UR6A 4CH8B 1KXDA 5DPAA 1JMOH 1V2PT 2FS9A 4I8HA 1P12E 1T4VH 1MCTA 4IMZA 4VGCB 3ATLA 4YLQH 4ABJA 2A32A 2VVCA 2AH4X 1TLDA 3D65E 1L4ZA 2AGIX 3PMJA 4ZUHA 1IOEA 1D3QB 1YPKH 4ZHAA 1C1NA 3SU1A 3A8DA 1O2TA 1O39A 1THSH 3BTKE 4K3JA 5EQSA 1CGIE 4K8YA 1GVKB 1LHGH 4UEHH 1UHBB 5LGOA 2PLXA 1TMUH 4BAHB 2XYAA 1A4WH 1O3BA 2AIQA 3VB4A 1O3JA 2TGAA 2C3SA 1AB9B 5ESBA 5TCCA 3ESTA 4XBBA 2A2XH 1NU9A 3SNCA 2BQ6B 2WYGA 1THPB 4GVUA 1W12U 1LVYA 2EA3A 3BTGE 4HTCH 4X1QU 1GI8B 1ZHRA 4B76A 2QAAA 3RU4D 3NKKA 3LGIA 4AFQA 3BTEE 1C1WH 1FY8E 2PKSC 3A84A 3RXGA 3BG4C 1BA8B 1MU8B 2EEKA 4U32A 1KY9A 3T26A 2PKAA 1TYNA 5T6GA 1YF4A 2JH5D 3MMGA 2BM2A 1HGTH 3EQ0H 2ZEBA 1S84A 1SGYE 2XWBI 3BN9A 2VNTA 1XM1A 2O8TA 2ANYA 1FUJA 2OINA 5FPYA 3PM3A 1TNIA 2CN0H 1AN1E 3LONA 1LPGB 7LPRA 3LPRA 4CRFA 1BJUA 4SGAE 4YT6H 1UTNA 1BB0B 3U8OH 1TGTA 2A5AA 2H9EH 1QBVH 2PSYA 1DPOA 1F7ZA 1D9IA 3MI4A 2BDYA 1C2IA 3TLOA 4B1TA 1K28D 1PYTC 1TX8A 1XVMA 3FP6E 1QFKH 3FP7E 4D7GA 1D6WA 1F5KU 1FIZA 2TPIZ 1G37A 1RIWC 3A7VA 3GCHC 3LGUA 3WY8A 2SGPE 4WWYA 3V12A 2A45B 1GBTA 5AVDA 3RMMH 4CREA 3TK9A 4ZXYH 1H9LB 2TGDA 1Y5UT 5T6DA 1NFWA 1QR3E 3SN8A 3ENSB 2RDLA 4IMQA 1EAUA 1LHDH 1DWEH 2P3UB 3FP8E 1L2EA 2P95A 3KEEA 2FESH 1MD8A 1P01A 3DT0H 1O3KA 3SUDA 3GDSA 2ZHEH 3TU7H 3MU0A 1O5CB 1SR5C 4K60A 2UWLA 1CA0C 1HAVA 4DIHH 3VB3A 1YYY1 1SGNE 5HMAA 3LH3A 3TJVA 1TRYA 1G2LA 3R0FA 2Y82A 1P0SH 2ZKSA 1TNJA 1ZTLA 5DP9A 1BMMH 2NU2E 5C5NA 1SOTA 1NN6A 1BZXE 1ZGVA 1GBIA 3P70B 1MQ6A 2GGVB 4NIXA 1CT4E 1MKXK 3UTUH 1FMGA 4ABEA 1O3IA 5IDKA 1UVSH 1TX7A 1YPEH 2Y81A 3DUXH 4E7NA 1OP8A 1YP9A 2BOKA 3AASA 1L1NA 4TY6A 1A0HB 5EPYA 1N6YA 1NS3A 3M36A 4DJZB 2H6MA 2M5TA 1EXFA 3LGTA 1GI2A 1J8AA 3JZ1B 2CHAB 2V3HH 1KXBA 3S0NA 1B0EA 1SBWA 1C5TA 2OC1A 3K2UA 1LCYA 1SLUB 4X8VH 2Z9LA 5FCKA 4ISNA 3SQEE 1WBGB 4B74A 1CHOF 2FS8A 3P8FA 4QT8C 3ZVDA 1P2KA 3RMOH 3A7TA 1WCZA 3RMNH 2DE8A 5LPEA 2BDCA 2H5DA 3MO3A 4OS6A 1ZTJA 4TPYA 4BXSA 3ZVFA 2HNTE 5GWZA 1WQVH 1UTMA 1ZRBA 1ABJH 1SLVB 3RU4T 3EA8A 3UNSA 3GCTG 3GISB 3ZZ4A 4CBNA 1IQHA 3MH7A 1P09A 4J1YA 1EZXC 3PO1C 2Z94A 2ZO3H 2OTVA 1GL1A 1WOFA 1PQ8A 1MKWK 4MNVA 3VXFH 1ZGIA 2VH6A 1QJ6B 2FI4E 3GY2A 2ODQA 1ZPBA 1VCQA 1QIXB 1KXEA 1LVOA 2B8OH 1O3HA 3GY8A 3SHAH 4BTIB 3ZVAA 1TPPA 2BZ6H 3CS0A 4X1NU 4DOQA 1AZZA 1Q2WA 1Z1JA 3BEIB 1YCPH 3NK8A 1BTYA 1C2FA 1RD3B 1V2RT 2ZP0H 2EI8A 2FPZA 1O2KA 4WY3A 1CHGA 3MH5A 3SV7A 1LHCH 1NFXA 5EXLA 2P8OC 5E0HA 1A0LA 5JB9S 4E7RG 5F8ZA 2ZGBH 2ZDLA 5DKMA 4YOIA 1EB1H 3PMAB 1FY4A 1KLJH 3E6PH 3A81A 2BD5A 2BQWB 1BTPA 3MU1A 1GCTC 5CE1A 4AGJA 2AGGX 1XX9A 4Q7YA 4YTAA 4FUGA 1SGPE 1PYTD 3LJOA 1C1PA 4H4FA 1SGCA 1MTSA 2BLVA 3RXPA 2J94A 3O8DA 4NSVA 1F0SA 4GAWA 1NRSH 1FONA 1MU6B 1EASA 2F9UA 3RC6A 1ZSLA 2B9LA 1GDQA 1CO7E 3MU4A 1DITH 3S7HB 4WF8A 1BHXF 2BQ7B 3L33A 2C90B 4ISHH 1IQMA 3PLBA 3RXOA 2VVUA 1QQUA 2TRMA 1UK2A 3SV8A 1GBCA 1JOUB 1DLKB 3OTJE 1JBUH 2A4GA 2Y7ZA 2FMJA 2I6SA 4OS2A 1P05A 1EP5A 4HGCA 3IWMA 3KIDU 1GBBA 1INCA 1T8MA 1YCPM 4JYVH 4CRAA 4MTBA 4LZ4B 6CHAC 2IJOB 1FPHH 1QB6A 3TNSA 4GCHF 3GY7A 5F6MA 1GHBF 4A6LA 3U8TH 4IC6A 3RXCA 1P11E 1B0FA 1K9OE 1DOJA 4UDWH 1O2UA 3RMLH 2OP9A 2BX4A 1OWHA 1GJ5H 1TA6A 2V35A 1J15A 5J4QA 1MKXH 5I25A 1ELFA 1OYQA 5DP3A 1AKSB 1C4Y2 1BRAA 1JIRA 1BBRE 4YZUA 4AN7A 4FUBA 2GZ7A 4ISOA 1UHBA 2GZ9A 4AGKA 1NRRH 2RA0A 4WJG2 5L6NH 4FVBA 1TPOA 4LK4A 3ZZ8A 1QJ1B 5FPTA 1HNEE 1AHTH 4Q7XA 1FY5A 1GBHA 3QWCH 4X2YA 4OS5A 2H9TH 2VWMA 1O3PB 2NU4E 1G3CA 1GG6C 1AUJA 1QL8A 1E36B 1F2SE 2VWOA 3DFJA 3SHCH 4DW2U 1OWIA 4I7YH 5HYOA 1A5IA 3UR9A 5C5OA 2Z7FE 3EGKH 1LVBA 2UWPA 1TPAE 1O3GA 1HB0B 1KTTB 1WYKA 3GICB 3BEFB 4IN1A 1ESTA 2B0FA 5ESTE 2H9HA 1PPBH 1Z8RA 1GJ9B 3HPTB 1TQ7B 2FTLE 4WMFA 3W95A 1MTNC 3BSQA 4FVDA 4XFQA 1EKBB 1OWEA 7KMEH 2V3OH 1VR1H 5EGMA 1BT7A 1PQ5A 5ABWA 2HPQH 2F9PA 2ZFPH 4BAOB 4AOQA 4D9QA 1YPHE 5GPIB 3S9BA 1MKWH 5GCHF 5LPRA 1X7AC 3V7TA 1THRH 1UCYE 1N1LA 1TGNA 3STJA 2DE9A 1Y59T 5DGJA 3ZZ9A 1S81A 3PTBA 1SLWB 2ZNKH 3ZV8A 3MU8A 2XRCA 2C4FH 3BTHE 1E38B 1O2VA 3OYPA 1VJAU 1DWDH 2ZFRH 1CBWC 5GIBA 2BLOA 2R3UA 3AAVA 3KQDA 1BRUP 1ELGA 3SU4A 2A1DB 2ZU1A 3SW2B 1YLDA 3A85A 1P9SA 4NWKA 1C2DA 2FI5E 2WV5A 3KNXA 3RXRA 3RXLA 4MQAA 1O31A 3UOUA 1MZDA 4OGYA 1SVPA 4OS7A 4NG9H 1OWDA 2VB0A 2XBYA 1SQAA 3EE0B 1MZAA 4VGCC 4WH8A 3RDZA 4CR9A 4A7IB 3UQOA 3F9EA 4IBLH 1FJSA 1C2JA 5L2YH 5TCAA 4FXGH 4D9RA 3C27B 2GCTB 2VWLA 4AG2A 1L4DA 4Y76A 1UO6A 2W3IA 8GCHF 4UFGH 5JBTA 2VJ1A 2ZQ1A 1GVZA 2G00A 4D76A 1XXDA 1IQEA 3EA7A 1AB9C 5CMXH 1IQGA 4H6TA 5A2MH 1GI9B 3KL6A 1GDUA 1GI0A 1JRSA 1JWTA 5G4BA 2W3KA 1C5NH 2R2WU 4FUHA 2VIWA 2ZDKA 1Z8IB 2XC5A 5C1XA 1V2TT 1GGDB 1SGQE 1BTZA 3TPIZ 1A0JA 2BTCE 3SU5A 1SB1H 1EZQA 4TY7A 4NA8A 1TNHA 1C2MA 1SHYA 2PWXA 1EAWA 3BIVH 2ILNA 3T62A 4GHTA 1Y3XA 2SNWA 5DP8A 5HXFA 2ZCKP 1K21H 1BRBE 3QN7A 1KYNA 3RXFA 1V2QT 5BRRE 3NPSA 4NSYA 1DWCH 1QNJA 1TONA 2J34A 3FZDA 3ZYDA 3MU5A 2RCEA 3T28A 1CGJE 2AFQB 1UCYH 1CA8B 1GDNA 1V2VT 1O2GH 2QN5T 4AB8A 1HAGE 2ANKH 5EW1H 4Y10E 5FBIA 2JETB 2D8WA 1TAWA 2WYJA 1O5EH 3BTFE 2A7JA 4ZXXH 5FX6A 1P9UA 3M7UA 4X8SH 1QB9A 3TIUA 4BAKB 5A8YA 2WPKS 1W7XH 2BYAX 3Q3KA 1QB1A 1SGTA 4KTCA 4LZ1H 1BQYA 1KXFA 1DLEA 1N8OC 2GV6A 3CS7A 4FU9A 3P6ZB 4JYTA 3ZZ3A 2F91A 1CGHA 1DM4B 1TNLA 2ZU4A 1BOQA 2QF0A 4Y7AA 3SZNA 3ZZ6A 1HXEH 4A1XA 1O2JA 2Y5FA 3A8CA 1O2YA 4Y8ZA 3NXPA 2FEQH 3O8BA 1H9IE 3IITA 4Y11E 1DT2A 3GCNA 1S6HA 2WPHS 4WXIA 2BLWA 4GHQA 4JMYA 1C5XB 1HAIH 1CHOG 1KSNA 1O0DH 1OP2A 2QIQA 1TRNA 2K1QA 3RLWH 1G3BA 2XCNA 2ZZUH 5C20A 3TJNA 4U30A 2ZF0H 3EA9A 2OBQA 3SUFA 3MNCA 1OYTH 1UTQA 2AMPA 1GMDF 1ZYOA 2J2UA 4YOJA 4AFUA 1OOKB 1FY3A 1A2CH 5SGAE 1MCVA 1NFUA 3QTVH 4R0IA 4FUDA 2HNTF 2VWNA 1GJ8B 1ZRKA 3RM0H 4ABHA 2J9NA 3P8NA 1RTKA 3E3TA 1NC6A 2ZI2H 1C5VA 2GMTB 1Y8TA 4FUCA 1O32A