4AFUA

Human chymase - fynomer complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
226
structure length
221
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 51
structure length 221
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4afuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4afuA02
2I6SA 1ABJH 4YT7H 1DITH 2XW9A 4NCYA 5DKMA 1F0SA 3KQEA 3P95A 2C3SA 1AD8H 2FI5E 2C8ZB 5EQRA 5LH8A 4ABJA 1DY9A 2ALPA 1SVPA 1O5BB 2WV4A 4O97A 1SLWB 3EA9A 1TX6A 3P17H 2ZEBA 1T31A 2XC4A 1GBIA 3A88A 2VVUA 1H9IE 4AGJA 3PYHA 4F4OC 1J14A 1N6XA 4MDSA 3HATH 1EAUA 4OGYA 3TJNA 2AFQB 2YOLA 1W14U 1XUHA 2VGCB 3IG6B 1A0LA 1D3DB 4MQAA 1ACBE 2PGBB 1YCPK 4NIXA 1E36B 1Z8RA 2GZ8A 3GYMA 1YBWA 2XNIA 1CGHA 4YLUA 3ZZ7A 1Q31A 1H4WA 1O35A 1A3EH 1GG6B 3NWUA 5BPEA 1P11E 1ZHPA 4ABHA 4AFQA 3O8RA 5EXMA 4ABIA 1P3CA 5GWZA 2ANKH 3ATMA 2P8OB 8KME2 2P3TB 1A7SA 3O8DA 1ELVA 2A5AA 2R0KA 2F9NA 2OC0A 1ETTH 3TLOA 1QA7A 2FMJA 3RDZA 2JH0D 4AOQA 2GVFA 4YO9A 1UK4A 2A4RA 2PKSC 1ELTA 4K8BA 3WY8A 4XBCA 2A7HA 2VIDA 4Y11E 1P2IA 1NT1A 1HIAA 4WY3A 5C2ZA 2C8WB 3BF6H 5F8ZA 1IHTH 4Y8YA 1QB1A 2ZFSA 2HRVA 2ZI2H 3LGYA 3SNEA 2P95A 4WMFA 1F5RA 2XBXA 1TPSA 1DFPA 4MPWA 5DG6A 1SGPE 3TU7H 2QAAA 2V35A 2BX4A 3A8BA 1TGNA 4CHAB 1DX5M 1E38B 3TH4H 1Z8GA 1UJ1A 2PKAA 1KXEA 2ZU4A 2ZPRA 3TJOA 3VFEA 4B2BA 2BDHA 4B1TA 1WAYB 1LHCH 3GDUA 4X1NU 2H9HA 4E7NA 4XOJA 3UIRA 1AY6H 1L0ZA 4TPIZ 2JKHA 1QRZA 4K60A 1HJAB 1B7XB 3KCGH 3KNXA 1AFQB 4ISHH 1VJ9U 4I8KA 1ANEA 3SUDA 1QGFA 2ZG0H 1FZZA 1C9TA 1MBQA 1C5SA 5HXFA 4WWYA 1OX1A 4OS2A 4IN1A 2ZU3A 2ZCLP 2QXIA 2XTTB 2RA3A 4RKJB 4X8UH 3BN9A 3UWJH 1BRUP 3HKJB 1O3PB 1CT0E 3M61U 3ZYEA 2J92A 5FBEA 1GHZA 5LPRA 3VB4A 2GDDA 5FCRA 1O5FH 3VPKA 1NS3A 1GCTC 1WTHD 2AERH 4OS1A 5B6OA 1IQLA 1TNIA 1SHYA 2ZWLH 1DE7H 2Q1JA 1SLVB 1P2KA 1BCUH 1DICA 2ZDAH 2BY9X 1AN1E 2FOAA 4A1VA 1O2WA 2G4TA 5EXLA 1P9UA 1XUKA 1PJPA 2VVVA 3O8BA 3ZV8A 5C5NA 5IDKA 1IQJA 1SGFG 2PLXA 1D6WA 3LC5A 2BMGB 2CV3A 1S81A 2A5KA 2GDEH 5AF9H 1TFXA 2H2ZA 4U2WA 3RM2H 1K1LA 1RTKA 2BXTH 3M3SA 1O2NA 1QB6A 1UVTH 2UUJB 4DGJA 2ZO3H 3LPRA 2BD4A 1BB0B 1ZMJA 5FPTA 1O2QA 2VWNA 1QJ6B 3SU0A 4X1RU 1ELAA 1O2KA 3RXPA 1NRSH 1FV9A 1QBNA 1IQKA 1GI8B 3VGCC 1XMNB 2A2QH 2VWMA 4FUBA 2V6NA 4AG1A 2SNWA 4VGCC 4OS4A 2WYGA 1HAVB 1FPHH 4RN6A 4MTBA 4X6PA 1O3CA 3S69A 3S7KB 1K1IA 1FNIA 1GHXH 1SQTA 1XUGA 2ZIQH 2XBWA 4KP0A 1SG8B 1BTYA 2F3CE 1DWDH 3F68H 4JYTA 4WXVA 3EE0B 3M5NA 4H6TA 4X1PU 1DLKB 1GI4A 1WOFA 1GI3A 5A09A 1O39A 3RMNH 3KN2A 1AQ7A 2RCEA 1V6DA 4GHTA 3Q00A 2OXSA 2BLQA 4CRGA 1BBRK 1TMUH 2M5TA 1BTPA 3FANA 1G3DA 3BTKE 3UPEA 1GGDC 1O3KA 2R0LA 1A1RA 2BYAX 1ZHRA 4BTUB 3SZNA 1FPCH 1HFDA 3MYWA 1BTUA 3H7TA 1P57B 1EPTC 1GMDF 2OC8A 1KDQB 1W12U 2FXRA 4DT7B 2A7JA 1JXPA 3UNRA 2WUBA 4D8NA 1TE0A 1QL8A 1WU1A 3GCHB 4I32A 3EQ0H 1UTLM 1AWHB 1NY22 1QJ7B 2PTNA 1GI2A 1YLDA 1FUJA 2EI7A 1GJ5H 1O36A 1K1PA 3RXBA 1ZTKA 1ARCA 1J9CH 1FONA 2Q6DA 2UUFB 5T6GA 1BTZA 4NIVA 1MTNC 2ZDLA 3F9GA 5C5OA 3S0NA 1LVOA 1H8IH 1SSXA 4ZKSU 3ZZBA 1EPTA 1SGIB 4NSYA 1DS2E 5FBIA 1QBVH 2GGVB 2C8YB 1ZOMA 2VINA 3BV9B 1Y5UT 2QF0A 2VWOA 1S6FA 2NU0E 2W3IA 1P06A 1C1NA 2HNTC 2O8MA 1MD8A 1MD7A 1V2QT 1BDAA 2ULLA 1A0HB 2Z3EA 1RGQA 2DE8A 2FYQA 1SMFE 3S7HB 2ZHWH 3BIUH 1V2MT 1GVLA 1P2QA 2PSYA 3SI3H 1INCA 3L3TA 3SNBA 4E06H 5EQSA 1C2GA 1CO7E 2PGQB 3AW0A 2RDLA 1W11U 2VJ1A 2FZZA 5ABWA 3MNSA 5EXNA 1P12E 2GV7A 3BTDE 3RM0H 3BTTE 1C1WH 4B76A 9ESTA 1C2JA 4NWLA 5IYTA 2IOTA 2QXJA 1WV7H 8GCHG 3U1IB 2GCTC 3Q3XA 2PW8H 1DUEA 2D26C 5TCCA 1RS0A 1IHSH 2JH5D 2XBVA 3SU6A 2AGEX 3C1KA 3PV4A 3TJVA 2FI4E 1PYTC 4IBLH 3UNSA 3LGUA 3RXCA 3NCLA 1MUEB 3M3TA 2TPIZ 2FEQH 3V3MA 4AYVB 3OY6U 1OWJA 1O2GH 2PUQH 1PQAA 2GZ9A 1VGCB 1BJVA 1EZUC 1MMJN 1P2JA 4YOJA 2ZHEH 3SU3A 2FOBA 3NKKA 3A87A 2GTBA 1A3BH 3ZZ8A 4LOYH 5L30H 4FU8A 2Y5FA 2FWWA 1EZSC 1JIMA 4CR5A 1C1RA 2A2XH 4B71A 2ZQ1A 1V2VT 4WXIA 1MCTA 1K28D 1O2ZA 4KTCA 4DIHH 2TGDA 7LPRA 5PTPA 3KF2A 4FUHA 1YYY1 4H4FA 1P04A 1KSNA 1VZQH 4IW4E 1D9IA 1C2LA 2F9BH 1OPHB 3V12A 2Y7ZA 4J2YB 1LHFH 5DJ7A 5F03A 8GCHF 2Y82A 4OGXA 1F7ZA 2XCFA 2QA9E 3NXPA 2J9NA 4NA8A 1HXEH 4ABGA 1YPEH 3ZZ9A 2WPJS 3AW1A 5EU8A 3MNCA 3SORA 1YPJH 1SGNE 1P02A 3ESTA 2ZF0H 4WH6A 1TMBH 1BITA 3GY5A 3S9AA 4CBOA 4UD9H 1BJUA 4X6MA 2VIVA 2ZGHA 1UHBA 2Y81A 4GAWA 3MH5A 1EX3A 1V2TT 1ZGVA 5HM9A 1GJ4H 1BRAA 2YNBA 1WQSA 4X6OA 4YLQH 3DFJA 3PM3A 4AFSA 2B7DH 1ZR0A 2VIOA 4KGAA 2OQ5A 2AGGX 3URDA 1GMHF 1IQNA 1YPHC 3GCOA 3QGNB 5DP5A 1T8OA 2FS8A 3K2UA 3GDSA 4U01A 1KXFA 4LZ4B 3CS0A 1T4VH 1O2SA 1GCTB 2ZDKA 1ARBA 2BZ6H 3BEFB 5J4QA 1TIOA 3VEQB 1TBZH 1AZZA 4FUDA 1OXGA 2ANYA 4CH8B 2ZFRH 3SNAA 4TYDA 3RMMH 3OYPA 1TONA 1C5RA 2CN0H 2A45B 3BTFE 3SW2B 5LPFA 3P8FA 2F9PA 1A5GH 6LPRA 2PSXA 1C5OH 5HYOA 2Z9JA 1HAZB 1O2JA 2PR3A 1O3JA 6ESTA 3NPSA 1AU8A 1TX8A 1BTHH 2FOEA 2KAIA 1O3HA 4BAHB 1C2HA 3LDXH 4WF8A 2F9UA 1IQIA 1KLTA 3A89A 1VCWA 4MNVA 3ZZ5A 2Z3DA 1YPLH 4Y79A 1O5GH 2VNTA 5EQQA 2STAE 3KHVA 2GMTB 3QTOH 1AKSA 5C1UA 1UCYK 1WSSH 5DGJA 1C2FA 1C5ZB 2J94A 1O5AB 1JRSA 3BG4C 3FAOA 1D3TB 1UTJA 3FFGA 1H8DH 5ESTE 1Z8IB 2BZAA 1O2PA 3UNQA 1MKXH 3SN8A 4BXWA 2JETB 1GBCA 3GY7A 1ZGIA 3L6PA 2AMDA 2BOKA 1MAXA 5DP3A 3A85A 5T3HA 4AG2A 1LQEA 3D23A 1ABIH 1FY4A 3UOPA 1MCVA 3LGWA 3P8OA 1GJ8B 3A8AA 1P8VC 3BTME 4BTTB 3MNXA 2CF8H 3KQCA 1Z1IA 2Z9GA 1JIRA 4B73A 3B8JA 1BTXA 1U6QA 4XBDA 4BNRA 5A8YA 2B8OH 2Z3CA 5EPNA 3FP7E 3NK8A 1NROH 1GGDB 4ISIH 1TPPA 2SGDE 4NFFA 1O3DA 2FS9A 1FIZA 2F9VA 1NFYA 2IJOB 3LT3A 5E8EH 4Y0ZE 3SJKA 3TH3H 1GBKA 5JBAS 1GHAG 1O2HA 3I77A 1K2I1 1EPTB 1P09A 2BY6X 3TGKE 2ZCHP 3D62A 4X1SU 1AE5A 1DWCH 1FMGA 4NZLA 1LPZB 1HAYB 3MOCA 3EA7A 1DSUA 1EOJA 1OP2A 3M5OA 2BD9A 5A8XA 4DY7B 1W2KH 4ZROA 1OS8A 2XCNA 4H42U 1LHEH 1JWTA 4ZMAH 4AGKA 1OSSA 3U9AH 3PWBA 2HGTH 3PLKA 2ZGBH 1SPJA 3SNDA 2XYAA 2HALA 4ABAA 1CA8B 2VU8E 1PPZA 1EZXC 1WBGB 3G01A 1C1TA 1TRNA 3RUOA 1G3BA 1MZDA 2FOMB 4Y8XA 2QGRA 1LVYA 3AVZA 1GI9B 1D4PB 4TWYA 1P03A 3RXLA 1QA0A 2BLWA 4K1SA 5AFYH 2FIRH 1GPZA 3GCTF 2ZU1A 1GBHA 3HGNA 3LJJA 1HDTH 1XX9A 5EW1H 1HJ9A 1O32A 1QIXB 2Z94A 1SGDE 3MO9A 3U8TH 3M35A 3W94A 2BD3A 1C2IA 3BTWE 3HGPA 3GYLB 2CHAC 4K1EA 1QURH 4BAKB 4CREA 5ETXA 2EEKA 1A2CH 2FOCA 1RD3B 1E37B 4JMYA 4NSVA 1TNJA 1T32A 1GL1A 2OC1A 1SQOA 2FO9A 3PLPA 1F2SE 3F9EA 3PROA 1C1MA 2J38A 1N1LA 1QQ4A 3SU1A 1EXFA 1SGCA 3RXFA 1XUFA 3E3TA 3MH4A 1TA6A 1CGJE 3E0NB 4HZHA 3RXIA 1CA0C 4X6NA 5LGOA 1P2OA 1RIWC 1PQ7A 4BOHA 3A8CA 1FXYA 5EGMA 3LIWA 4ZXXH 1A4WH 4NA9H 7GCHG 3QDZB 4D7GA 3VB6A 5FX6A 2WUCA 2FESH 3A80A 1JOUB 1KTTB 1M9UA 1OWDA 2GX4A 1C9PA 2HWLB 1CBWC 4CR9A 4X8TH 4AYYB 2FLRH 1UVUH 1BHXB 4JZIA 3SV6A 1LPGB 1L4DA 1DOJA 1EB1H 3KIDU 1HGTH 4FU9A 1DDJA 2OD3B 1RTLA 3K9XB 3ITIA 4Y10E 4AFUA 4B74A 3GDVA 1NTPA 3RC4A 2STBE 1QTFA 2W7UA 5HMAA 4K8YA 2ZU5A 1XUIA 2BD2A 2ANMH 1FJSA 3PB1E 2BDIA 1ZPCA 2AMPA 1UHBB 3EA8A 4DCDA 3BTQE 4ESTE 5L6NH 2Y7XA 2W3KA 4NZQA 1D3QB 1A5IA 5F6MA 1G2LA 3DHKH 3KGPA 1KXDA 3T25A 1TMTH 5DP7A 1AVXA 1DPOA 1QR3E 5JDUB 3QLPH 1YCPH 2A4OA 4MNXA 2PUXB 1ELDE 2THFB 5GDSH 4CRAA 1XXFA 4XDEA 3ZVAA 7GCHF 3AASA 1TB6H 3RXDA 2FX4A 3RXMA 2W26A 2G8TA 2J4IA 4IS5A 5C1YA 1K21H 3K6ZA 1C1SA 4CRCA 1WTGH 3ZVFA 1BA8B 2YNAA 2ZECA 3SJ9A 3VXFH 1OYQA 4GPGA 1XM1A 4OS6A 2XC0A 3C27B 1FN6A 2IPHA 2H5DA 1AGJA 4X0WU 1PPHE 3F1SB 1O2UA 2C90B 2R9PA 1C5LH 1B0FA 3ZZDA 1SGYE 2NU1E 4YT6H 1BIOA 2Y5GA 1GI0A 4OS7A 2OBOA 5FPYA 5K0HA 2OC7A 1AB9B 2AGIX 3ZZ6A 2A4GA 3T2NA 3UOUA 4KTSA 1F0UA 1YPKH 2KAIB 1L1JA 2AYWA 1NPMA 3A84A 3GOVB 4ABEA 1TOMH 3A7WA 1B5GH 3ZVCA 3RXKA 1V2PT 1AKSB 1HJ8A 2SGFE 3QGJA 3SUEA 1CSOE 1HV7A 2P3UB 4HFPB 1PQ8A 1O3FA 2ZFQH 3SQHE 3RU4D 2B5TB 3A7TA 3E6PH 1GDQA 1XKBC 4A92A 1GDNA 3HKIB 1C4V2 1C1PA 3SU5A 3SGAE 2CGAA 1C5QA 1O2MA 1ZHMA 4X2WA 3R3GB 1GJ6A 4BAMB 2TGAA 2Z7FE 1MTWA 3IITA 5SGAE 3O8CA 1L1NA 3RP2A 4TY7A 1ESTA 3E16B 1N8OC 2GD4B 2H9TH 3K6YA 3DD2H 2V0BA 4BXSA 4TPYA 3LOXA 1TNGA 2WPKS 1IQHA 4X1QU 1L1GA 1FLEE 1FIWA 2PFEA 2QIQA 1SBWA 2P3FH 3MH6A 1O2LA 2H6MA 2FPZA 2DUCA 3PO1C 4Y7BA 3CS7A 1LMWB 1ZLRA 1LVMA 2VIQA 1MTSA 1FDPA 1C5TA 1S82A 3A82A 4GSOA 3A7ZA 3SO3A 1XVMA 2AMQA 3ZZ4A 4FU7A 3MNBA 1C1VH 2O8UA 1UMAH 1TNLA 2ZA5A 1GMCG 1W8BH 2FM2A 2GKVE 1WUNH 3SI4H 1LKBA 2ZDMA 1UTMA 4ABDA 1BMNH 4KELA 3SV7A 5L2YH 2CJIA 5TJXA 2OTVA 2PWXA 1J16A 1PPGE 2LPRA 4Y0YE 3DT0H 4Q2KA 1SQAA 4AFZA 2UWPA 4SGBE 3KQDA 3DA9B 1S83A 3M5MA 2UUKB 1O3LA 3KEEA 1X7AC 2HLCA 3RMLH 3UUZA 1F0RA 1P01A 1V2ST 1GBEA 4ZH8A 2ZNKH 2ZDNA 4CRFA 3E90B 1CHGA 1TALA 3UR6A 1NRNH 1Q2WA 2A32A 4I33A 1GJDB 8LPRA 1N6YA 4FUCA 1LTOA 2OBQA 1EP6A 2K1QA 4WMEA 1EJAA 2R2WU 4NA7A 3ZV9A 5EODA 1FY5A 1GMCF 1OWKA 2ZFPH 1HAIH 2SFAA 4HI3A 1GDUA 2VH0A 1OYTH 1BBRE 1G3CA 1ZMLA 1P10A 1HIAB 1TWXB 3LH3A 3MU1A 1TGSZ 1XXDA 1IOEA 2ZPQA 1Z7KA 3BTHE 2FOGA 1ESBA 5I25A 5I46H 2PV9B 3T5FH 1BBRH 3BSQA 1PPEE 4MVNA 1A5HA 1H9LB 4WVPE 4A6LA 1TRYA 1KIGH 3FP8E 5T6DA 2ZKSA 1OOKB 3P70B 2CMYA 2ZP0H 1F92A 5JB9S 4NIWA 2CHAB 2ODQA 2PKSB 2UUYA 2TGTA 1T7CA 4I8LA 2BQWB 3A8DA 2SGEE 2PKAB 1UVPA 4FUEA 2ZTXA 4UEHH 3SV2H 3ZZ3A 1K1NA 3M7QA 4FVDA 4H6SB 6GCHG 1ZPZA 3S9BA 2FTLE 2Y5HA 1QHRB 2GP9B 1GI5A 1ANBA 1HAXB 3LC3A 1ESAA 3E8LA 1MKWK 2VB0A 2QXHA 1PPCE 4IN2A 1SL3A 1G2MA 1LPKB 1EJNA 4A5TS 2BVSH 3ATWA 1UK3A 3CENA 4UDWH 1GL0E 1MQ6A 1TBQH 3H7OA 3RXVA 2Z9LA 1G30B 4JYVH 4NWKA 3SNCA 2A31A 2BDYA 4K5ZA 3KL6A 1V2NT 1V3XA 1EP5A 1GJAB 3TK6A 3QX5H 1O3EA 3K65B 1HXFH 1LHGH 5DP4A 2FTMA 3IWMA 1MU6B 5HM2A 1OWHA 4DOQA 1O2YA 1O0DH 3ZVDA 1YF4A 3M7UA 3V13A 1UVSH 3SOSA 1GCDA 1ZTJA 1TGTA 3B9FH 2WYJA 4JK6A 3ZZAA 1PQ5A 1C5VA 4UE7H 3A83A 6GCHF 3E1XB 1ZSJA 3TK9A 1Q3XA 4WH8A 4AB8A 2HNTF 1YPMH 1YP9A 1SOTA 2WV5A 1PYTD 1S84A 1NU7B 1GI6A 3HK3B 3RXAA 1E34B 3QTVH 1MTUA 2ZFFH 1YM0A 3GISB 2HNTE 2GT7A 1AIXH 3MH7A 2NU3E 3QO6A 1ZSKA 2OQUA 1PPFE 1O3IA 1NN6A 1EAXA 2OCVB 1K1JA 2HPPH 3GY3A 3T28A 3W95A 2ZCKP 4MPUA 2Z9KA 1C5PA 5T6FA 3U98H 2ZTYA 1QCPA 4BAOB 1FY8E 2IN2A 1XVOA 3UR9A 3VB5A 3QK1A 3B23B 1QRWA 3M5LA 1UO6A 1D6RA 1Y8TA 3AAUA 1F0TA 1ZRBA 1O3MA 1T8NA 1NU9A 1TX7A 2ZHQH 3TNTA 1QY6A 1KXBA 2AEIH 4B75A 4Z6AH 4FUFA 4FVBA 4CHAC 4R8TB 2C93B 2BB4A 2BOHB 5L2ZH 3PMAB 2BDAA 1G37A 4INKA 3TNSA 1D3PB 4ISLA 5JB8S 1O30A 2RA0A 3ENSB 3FZZA 3DFLA 4FUGA 4I31A 1BTWA 3UY9A 3I29A 2BD7A 2F91A 6CHAC 2BY8X 1GJ7B 3H5CB 5JPMH 1HB0B 1MTVA 3M36A 1BHXF 3P8NA 1ZSLA 1ID5H 1MKWH 1CT2E 2ZGXH 1AUTC 1O2RA 3VGCB 4F49A 1SFIA 8ESTE 2V3HH 3T27A 1EASA 2XC5A 1L4ZA 4VGCB 3TPIZ 4D9RA 4YTAA 3MU4A 2B9LA 2AIPA 5CMXH 5EW2H 1GVKB 2OP9A 3F9HA 4QT8C 3D65E 1DXWA 1W10U 1TYNA 3ODDA 1E35B 2ASUB 1HRTH 1MAYA 2G51A 4B2CA 3ZYDA 1LDTT 3PTBA 1Z8JB 2UWLA 2BXUH 3ELAH 3OTJE 3SGQE 5A0BA 4JK5A 1OKXA 1LKAA 1DVAH 1C5UA 3PMJA 3MTYA 1L2EA 1J8AA 1N8OB 4KKDA 2P59A 1UTPA 1ELEE 1GHBG 1LCYA 2PTCE 2ZDVH 2ZHFH 4CH2B 3A86A 2ZZUH 1HNEE 4Y76A 4ISNA 3MO6A 1P0SH 2QYIA 1CGIE 2SGAA 3UQOA 1O37A 2ODYB 3TH2H 2GV6A 1HYLA 3QN7A 3STJA 3TITA 2QV1A 4ZKRU 3RXGA 1FY1A 4Y71A 4ZXYH 4DIIH 1O3BA 1J15A 1O31A 1HAPH 4AN7A 4MNYA 1GHYH 1MTNB 1T4UH 1H9HE 5A8ZA 1MZAA 2BDGA 2GZ7A 4R0IA 5JYIA 4THNH 1OP8A 2WPIS 4GLYA 1YPHE 1AHTH 1GJCB 2G52A 2GCHG 4ISOA 1DUAA 5A0AE 1F5LA 1O2OA 3HK6B 1Z71A 2ZGCA 3BIVH 3VB7A 3DUXH 4A7IB 1AE8H 3MMGA 1UCYE 3RC6A 1CQQA 5AFZH 2BQ7B 1H1BA 5GJ4B 2EC9H 3RXSA 1V2JT 2QC2A 1VCPA 1EOLA 1JMOH 4SGAE 4A1TA 1BQYA 3PTNA 1WYKA 1GHBF 2AH4X 1KXCA 3MO3A 2QF3A 3QWCH 4ZKOU 1GHAF 1UCYH 2NWNA 3ATIA 2P16A 1ZMNA 3GY4A 5CHAC 5E0GA 1C2EA 1A46H 1ZYOA 1YC0A 2VH6A 1O3OA 4OS5A 1GBMA 4DURA 3SV9A 4XBBA 1DWEH 1EATA 2NU4E 4TY6A 2TBSA 2V3OH 4FUJA 2EA3A 3LGTA 5E0HA 1FQ3A 5FPSA 4MPVA 2BQ6B 3LJOA 1GI7B 3SUFA 3M37A 3L33A 4DJZB 1MH0A 4YOIA 4B2AA 1DXPA 1VGCC 1CT4E 2QXGA 1BMLA 1O3GA 3ZVGA 4Q7YA 1WQVH 4NIYA 3RXEA 2FYRA 5DK1A 2GCTB 3FZDA 1O38A 4ABBA 1BZXE 2GCHF 1GWAA 2QN5T 3NUMA 2ZGJA 4AZ2B 1O2TA 4ZHAA 1C5XB 1SGQE 4JYUH 5GCHG 1UVOA 2I6QA 1GBBA 3A7YA 3UQVA 4AX9H 2H1UA 2ZQ2A 3MU5A 1V2LT 1V2OT 2G55A 1S6HA 4E05H 2BTCE 1O5EH 1OP0A 3RXRA 1C1UH 7KMEH 1UK2A 1ELBA 2BVRH 2BD5A 1NESE 4Q7XA 3STIA 2WPHS 2WPLS 2FODA 3SJIA 3A81A 5EG4A 4O03A 2EI6A 4A1XA 1C5WB 2A5IA 5DP6A 1C1OA 1UTNA 1W3CA 5E2PA 1MBMA 1TABE 2ODPA 2G81E 2BY7X 3BEIB 1HUTH 1K1MA 1W0YH 1DT2A 1TRMA 1Y5AT 7ESTE 4AORA 2BHGA 4MG3A 1ELCA 1ZZZA 3P92A 3F6UH 4XSKU 1UTKA 4Q7ZA 1B0EA 5GIBA 3SUGA 2ZPSA 1C2KA 1TBRH 1BMMH 1CHOG 2CXVA 1SGFA 5TCAA 2ESTE 4Z0KA 1KTSB 1GJ9B 3HPTB 5JBBS 1BOQA 5GCHF 2ZHDA 2TRMA 3ZVEA 1GVZA 4INHA 1A0JA 2CF9H 1ELGA 3RXJA 1ZTLA 4U32A 3U8RH 2P93A 4D7FA 1ETSH 1NM6A 1FN8A 1MU8B 2UWOA 1RXPA 1OWEA 3ZZCA 2W5EA 2VIPA 3CP7A 3SU2A 1GHWH 1GHVH 3PLBA 3P6ZB 1UTOA 1C5YB 1YLCA 3TGJE 4Q80A 4X2YA 2D2DA 3RXQA 1YPGH 3OU0A 4PROA 5AVDA 5A0CA 5HGGA 4ZUHA 1NRRH 4FUIA 3RXUA 1DWBH 1JRTA 4AB9A 4I7YH 3TK5A 1ZPBA 4GCHG 1CU1A 3BTGE 2GMTC 4X2XA 2Z6BD 2A1DB 2NU2E 2F83A 3VXEH 1V2WT 2R3UA 1GMDG 1CHOF 1TA2A 1RRKA 1SOZA 5DP8A 4MNWA 2HOBA 2EI8A 1O2VA 1FY3A 1K22H 1LHDH 2D1JA 4LK4A 1AMHA 1EKBB 1ETRH 1C5NH 2TIOA 1EAWA 1W0ZU 1ORFA 1Y3YA 2JETC 2JH6D 5F8XA 2C4FH 2PHBA 5AHGH 1QFKH 3GY8A 1AFEH 4XFQA 3SJ8A 2LNCA 3RLWH 1S85A 1GBAA 2Q6GA 1K1OA 1GBTA 1IQGA 2GT8A 3JZ2B 4ASHA 1GBJA 1MQ5A 6CHAB 3BG4B 1SGRE 3URCA 1AVWA 2BLVA 4I8HA 4GVUA 3TJUA 4DVAU 1HAGE 1KLJH 3UFAA 5DPAA 2SGQE 1EAIA 1O2IA 3A7XA 2AIQA 1HBTH 2SGPE 3ATKA 4UFFH 1C1QA 2J34A 1O3NA 5EOKA 4WMDA 1QJ1B 4GCHF 5CE1A 1PPBH 2BDBA 2AS9A 1Y3WA 3PMHB 2G4UA 2XXLA 1IQEA 1V2UT 2C8XB 3BEUA 3GY6A 1EJMA 4X8VH 2FDAA 1O34A 4IC5A 3Q76A 1GI1A 4HGCA 1AI8H 4KTUA 1GBFA 3RU4E 4JZFH 3MHWU 3OSYA 3SBKA 3I78A 4IGDA 3UTUH 2RG3A 2QCYA 1G3EA 3OY5U 4O3TA 1KLIH 3RLYH 4XE4A 3U8OH 4GUXA 1DM4B 1QL7A 1SGEE 2DE9A 2VGCC 3GCNA 1JBUH 3U1JB 4E7RG 4MPXA 2D8WA 1KYNA 1V2KT 2Y6TA 4O3UA 4D76A 2B0FA 1DANH 1FI8A 3RMOH 3EYDA 3PWCA 3T62A 4CBNA 2VIWA 2XBYA 2H5CA 1GG6C 5JBTA 4RSPA 5G4BA 1DY8A 3ZVBA 1SC8U 2F9OA 1QRXA 1CVWH 2P8OC 1Y5BT 4ZHLU 2FI3E 3T26A 1C4Y2 3Q3YA 4JCNA 4UONA 1VCQA 1AWFH 3RU4T 3SHAH 4JZDH 4ZKNU 3LU9B 4JZ1A 1T8MA 1W7GH 1NFUA 1TQ0B 3Q77A 1C4U2 1C2MA 1P2NA 4CRBA 1VITG 5C67A 1TAWA 4UFDH 3D49H 3LGVA 1Y3UA 2ZFTA 3RXHA 1W13U 3BTEE 1NRPH 5DP9A 4BAQB 1P3EA 4NFEA 1ZJDA 4RKOB 2ZTZA 5GXPA 1AO5A 1FAXA 1SHHB 3PMBB 3SGBE 1TPAE 1TLDA 4Y8ZA 2G00A 1C5MD 1O5DH 3E0PB 2G5VA 5CHAB 1EUFA 4K1TA 1O5CB 3MWIU 1NFWA 2VWLA 1E0FD 3QZQA 1SR5C 1QNJA 2A0QB 2WINI 3UREA 1TGBA 1NC6A 1GBLA 1VR1H 1Y3XA 1YCPM 1F5KU 1HJAC 3SV8A 2BM2A 1EQ9A 2XWAA 3F9FA 5FXLA 5J4SA 1O33A 1HAOH 1CA0B 2ILNA 1HCGA 2HPQH 1SLUB 2ZC9H 1AFQC 2P94A 3LGIA 1RIWB 2FOHA 1ZRKA 1TGCA 4D9QA 1VJAU 3QUMP 4DW2U 1VITF 3KQBA 1RTFB 2ZU2A 4ABFA 1GMHG 3NZIA 1V2RT 2O9QA 4LXBH 1HAHH 2J2UA 2FOFA 1ELFA 4K2YA 1MKXK 3A7VA 1CBWB 2VVCA 4MLFB 2J95A 2BY5X 1A61H 1J17T 4YZUA 1G9IE 1G32B 3MI4A 9LPRA 3RXTA 3AAVA 4UFEH 2Y80A 2XWBI 1YGCH 3RXOA 1Y3VA 5LPEA 4FXGH 1VITH 1DSTA 1SGTA 1NZQH 1QQUA 1TPOA 3MFJA 1EB2A 1UTQA 3MU8A 4NGAH 5FAHA 3SHCH 3EAJA 3V0XA 4DG4A 1HPGA 5GPIB 1QL9A 4WJG2 3V7TA 1IAUA 4UFGH 2FP7B 1THRH 3OX7U 1SLXB 1GBDA 1SB1H 2R2MB 3GY2A 4BTIB 3ATLA 4X2VA 3RC5A 5C3NA 2Z9IA 1AZ8A 3MU0A 1P2MA 3P8GA 1AB9C 1WCZA 1HLTH 3N7OA 5C20A 4YESB 3FP6E 1AUJA 4HTCH 4K69A 4ZAEA 1S0RA 1P05A 5H4IB 4O9VA 3M3VA 4I8GA 1RFNA 2W7SA 5ESBA 1FAKH 4GHQA 1XUJA 4U30A 1BUIA 4INLA 1DLEA 5FX5A 1YKTA 2WPMS 3ODFA 1LVBA 1EZQA 2HVXA 1TQ7B 1QBOA 2BD8A 2BX3A 3QZRA 4I8JA 5BRRE 3S9CA 1S5SA 1TOCB 1CE5A 3R0FA 2BVXH 2OLGA 3FVFB 5FCKA 3JZ1B 4CRDA 2OUAA 1IQMA 2TGPZ 1AVGH 3LKWA 1Z1JA 1OWIA 1IQFA 1P9SA 1BT7A 1ANDA 1QB9A 1ZJKA 4K3JA 3LONA 2OINA 3U69H 1G36A 1Y59T 5E0JA 3SQEE 1XKAC 1NO9H 1SI5H 4YOGA 1K9OE 1O2XA 4YM9A 2H9EH 2SNVA 2XRCA 2O8WA 1HAVA 1C2DA 2O8TA 5EPYA 2FX6A 4Y6DA 1KXAA 4IMQA 4LZ1H 2ANWA 1BRBE 1NRQH 5F8TA 1NFXA 4JZEH 5DO4H 4IC6A 1ANCA 2QY0B 2A4QA 5K7RA 3TGIE 3SU4A 1TNKA 2BLOA 4J1YA 3GCHC 4M7GA 1T8LA 5JBCS 3VB3A 1RJXB 4TWWA 1O3AA 1PFXC 4BANB 2G5NA 3T29A 3UWIA 5A2MH 1GJBB 1Z6EA 3GICB 3LH1A 4ZHMU 3SJOA 3TVJB 4IMZA 2BDCA 3BG8A 4X8SH 5C1XA 1BRCE 1LO6A 1TNHA 1THSH 1THPB 2R3YA 2O8LA 2ALVA 3E91A 4NG9H 3PO1B 3TIUA 1S0QA 3Q3KA 1LQDB 2A7CA 5FHTA 3EGKH 5E2OA 1KDQA 1KY9A 2FLBH 3EDXB 4Y7AA 1Z6JH 1W7XH 1SFQB 3M7TA 1BMAA 2Q6FA 3GCTG
chains in the Genus database with same CATH superfamily
2I6SA 1ABJH 4YT7H 1DITH 2XW9A 4NCYA 5DKMA 1F0SA 3KQEA 3P95A 2C3SA 1AD8H 2FI5E 2C8ZB 3DSOA 5EQRA 5LH8A 4ABJA 1DY9A 2ALPA 1SVPA 1VKYA 1O5BB 2WV4A 4O97A 1SLWB 3EA9A 1TX6A 3P17H 2ZEBA 1T31A 2XC4A 1GBIA 3A88A 2VVUA 1H9IE 4AGJA 3PYHA 4F4OC 1J14A 1N6XA 4MDSA 3HATH 1EAUA 4OGYA 3TJNA 2AFQB 2YOLA 1W14U 1XUHA 2VGCB 3IG6B 3WWBA 1A0LA 1D3DB 4MQAA 1ACBE 2PGBB 1YCPK 4NIXA 1E36B 1Z8RA 2GZ8A 3GYMA 1YBWA 2XNIA 1CGHA 4YLUA 3ZZ7A 1Q31A 1H4WA 1O35A 1A3EH 1GG6B 3NWUA 5BPEA 1P11E 1ZHPA 4ABHA 4AFQA 3O8RA 5EXMA 4ABIA 1P3CA 5GWZA 2ANKH 3ATMA 2P8OB 8KME2 2P3TB 1A7SA 2F4LA 3O8DA 1ELVA 2A5AA 2R0KA 2F9NA 2OC0A 1ETTH 4Q63A 3TLOA 1QA7A 2FMJA 3RDZA 2JH0D 4AOQA 2GVFA 4YO9A 1UK4A 2A4RA 2PKSC 3H09A 1ELTA 4K8BA 3WY8A 4XBCA 2A7HA 2VIDA 4Y11E 1P2IA 1NT1A 1HIAA 4WY3A 5C2ZA 2C8WB 3BF6H 5F8ZA 1IHTH 4Y8YA 1QB1A 2ZFSA 2HRVA 2ZI2H 3LGYA 3SNEA 2P95A 4WMFA 3F3BA 1F5RA 2XBXA 1TPSA 1DFPA 4MPWA 5DG6A 1SGPE 2WHXA 3TU7H 2QAAA 2V35A 2BX4A 3A8BA 1TGNA 2WPDD 1DX5M 4CHAB 1E38B 3TH4H 1Z8GA 3OTPA 2LELA 1UJ1A 2PKAA 1KXEA 2ZU4A 2ZPRA 3TJOA 3VFEA 4B2BA 2BDHA 4B1TA 1WAYB 1LHCH 3GDUA 4X1NU 2H9HA 4E7NA 4XOJA 3UIRA 1AY6H 1L0ZA 4TPIZ 2JKHA 1QRZA 4K60A 1HJAB 1B7XB 3KCGH 1K0HA 3KNXA 1AFQB 4ISHH 1VJ9U 4I8KA 1ANEA 3SUDA 1QGFA 2ZG0H 1FZZA 1C9TA 1MBQA 1C5SA 5HXFA 4WWYA 1OX1A 4OS2A 4IN1A 2ZU3A 2ZCLP 2QXIA 2XTTB 2RA3A 4RKJB 4X8UH 3BN9A 3UWJH 1BRUP 3HKJB 1O3PB 1CT0E 3M61U 3ZYEA 2J92A 5FBEA 1GHZA 5LPRA 3VB4A 2GDDA 5FCRA 1O5FH 3VPKA 3FO8D 1NS3A 1GCTC 1WTHD 2AERH 4OS1A 5B6OA 1IQLA 1TNIA 1SHYA 2ZWLH 2RDEA 1DE7H 2Q1JA 1SLVB 1P2KA 1BCUH 1UW7A 1DICA 2ZDAH 2BY9X 2EY4C 1AN1E 2JJ1D 2FOAA 4A1VA 1O2WA 2G4TA 5EXLA 1P9UA 3OAAD 1XUKA 1PJPA 2VVVA 3O8BA 3ZV8A 5C5NA 5IDKA 1IQJA 1SGFG 2PLXA 1D6WA 3LC5A 2BMGB 2CV3A 1S81A 2A5KA 2GDEH 5AF9H 1TFXA 2H2ZA 4U2WA 3RM2H 1K1LA 1RTKA 2BXTH 3M3SA 1O2NA 1QB6A 1UVTH 2UUJB 4DGJA 3FOAA 2ZO3H 3LPRA 2BD4A 1BB0B 1ZMJA 5FPTA 1O2QA 2VWNA 1QJ6B 3SU0A 4X1RU 1ELAA 1O2KA 3RXPA 1NRSH 1FV9A 1QBNA 1IQKA 1GI8B 3VGCC 1XMNB 2A2QH 2VWMA 4FUBA 2V6NA 3SYJA 4AG1A 5B6LA 2SNWA 4VGCC 4OS4A 2WYGA 1HAVB 1FPHH 4RN6A 4MTBA 4X6PA 1O3CA 3S69A 3S7KB 1K1IA 1FNIA 1GHXH 1SQTA 1XUGA 2ZIQH 2XBWA 4KP0A 1SG8B 1BTYA 2F3CE 1DWDH 3F68H 4JYTA 4WXVA 3EE0B 3M5NA 4H6TA 4X1PU 1DLKB 1GI4A 1WOFA 1GI3A 5A09A 1O39A 4P02A 3RMNH 3KN2A 1AQ7A 2RCEA 3VG8A 1V6DA 3F0OA 4GHTA 3Q00A 2OXSA 2BLQA 4CRGA 1BBRK 1TMUH 2M5TA 1BTPA 3FANA 4ZCNA 1G3DA 3BTKE 3UPEA 1GGDC 1O3KA 2R0LA 1A1RA 2BYAX 1ZHRA 2PP6A 4BTUB 3SZNA 1FPCH 1HFDA 3MYWA 5CHBA 1BTUA 3H7TA 1P57B 1EPTC 1GMDF 2OC8A 1KDQB 1W12U 2FXRA 3W1EA 4DT7B 2A7JA 1JXPA 3UNRA 2WUBA 4D8NA 1TE0A 2KM0A 1QL8A 1WU1A 3GCHB 4I32A 3EQ0H 1UTLM 1AWHB 2XNDD 1NY22 1QJ7B 2PTNA 1GI2A 1YLDA 1FUJA 2EI7A 1GJ5H 1O36A 1K1PA 3RXBA 1ZTKA 1ARCA 1J9CH 1FONA 2Q6DA 2UUFB 5T6GA 1BTZA 4NIVA 1MTNC 2ZDLA 3F9GA 5C5OA 3S0NA 1LVOA 1H8IH 1SSXA 4ZKSU 3ZZBA 1EPTA 1SGIB 3SZEA 4NSYA 1DS2E 5FBIA 1QBVH 2GGVB 2C8YB 2AHME 1ZOMA 2VINA 3BV9B 1Y5UT 2QF0A 2VWOA 1S6FA 2NU0E 2YMSC 2W3IA 1P06A 1C1NA 2HNTC 2O8MA 1SKYE 1MD8A 1MD7A 1W0JD 4Z1MD 1V2QT 1BDAA 2ULLA 1A0HB 2Z3EA 1RGQA 2DE8A 5EJZA 4F48B 2FYQA 1W0KD 1SMFE 3S7HB 2ZHWH 1YY3A 3BIUH 1V2MT 4RI0A 1GVLA 1P2QA 2PSYA 3SI3H 1INCA 3L3TA 3SNBA 4E06H 5EQSA 1C2GA 1CO7E 2PGQB 3AW0A 2RDLA 1W11U 2VJ1A 2FZZA 5ABWA 3MNSA 5EXNA 1P12E 2GV7A 2V3MA 4B6FA 3BTDE 3RM0H 3BTTE 1C1WH 4B76A 9ESTA 1C2JA 4NWLA 5KEDA 5IYTA 2IOTA 1S6LA 2QXJA 1WV7H 8GCHG 3U1IB 2GCTC 3Q3XA 2PW8H 1DUEA 2QE7D 2D26C 5TCCA 1RS0A 1IHSH 1E1RD 2JH5D 2XBVA 3SU6A 2AGEX 2XOKD 3C1KA 3PV4A 3TJVA 2FI4E 1PYTC 4IBLH 3UNSA 3LGUA 3RXCA 3NCLA 1MUEB 3M3TA 2TPIZ 2FEQH 3V3MA 4AYVB 3OY6U 1OWJA 1O2GH 2PUQH 1PQAA 2GZ9A 1VGCB 1BJVA 1EZUC 3KQ5A 1MMJN 1P2JA 4YOJA 4OM9A 2ZHEH 3SU3A 2FOBA 3NKKA 3A87A 2GTBA 1A3BH 3ZZ8A 4LOYH 5L30H 4FU8A 2Y5FA 2FWWA 1EZSC 1JIMA 4CR5A 1C1RA 2A2XH 4B71A 2ZQ1A 1V2VT 4WXIA 1MCTA 1K28D 1O2ZA 4KTCA 4DIHH 2TGDA 2KR7A 5PTPA 7LPRA 3KF2A 4FUHA 1YYY1 4H4FA 1P04A 5DN6D 1KSNA 1VZQH 3NRLA 5EIYA 4IW4E 1D9IA 1C2LA 2F9BH 1OPHB 3V12A 2Y7ZA 3OEED 4J2YB 1LHFH 5DJ7A 5F03A 8GCHF 2Y82A 5F53A 4OGXA 1F7ZA 2XCFA 2QA9E 3NXPA 2J9NA 4NA8A 1HXEH 4ABGA 1YPEH 3ZZ9A 2WPJS 3AW1A 5EU8A 3MNCA 3SORA 1YPJH 1SGNE 1P02A 3ESTA 2ZF0H 4WH6A 1TMBH 1BITA 3GY5A 3S9AA 4CBOA 4UD9H 1BJUA 4X6MA 2VIVA 2ZGHA 1UHBA 2Y81A 4RT1A 4GAWA 3MH5A 1EX3A 1V2TT 1ZGVA 5HM9A 1GJ4H 1BRAA 2YNBA 1WQSA 4X6OA 4YLQH 3DFJA 3PM3A 4AFSA 2B7DH 1ZR0A 2VIOA 4KGAA 2OQ5A 2AGGX 3URDA 1GMHF 1IQNA 1YPHC 3GCOA 3QGNB 5DP5A 1T8OA 2HLDD 2FS8A 3K2UA 3GDSA 4U01A 1KXFA 4LZ4B 3CS0A 4F55A 1T4VH 1O2SA 1GCTB 2ZDKA 1ARBA 2BZ6H 3BEFB 5J4QA 5CDFE 2IPQX 1TIOA 3VEQB 1TBZH 1AZZA 4FUDA 1OXGA 2ANYA 4CH8B 2ZFRH 3SNAA 4TYDA 3RMMH 3OYPA 1TONA 1C5RA 2CN0H 2A45B 3BTFE 3SW2B 5LPFA 3P8FA 2F9PA 1A5GH 6LPRA 2PSXA 1C5OH 5HYOA 2Z9JA 1HAZB 1O2JA 2PR3A 1O3JA 4FOUC 6ESTA 3NPSA 1AU8A 1TX8A 1BTHH 2FOEA 2KAIA 1O3HA 4TT3D 4BAHB 1C2HA 3LDXH 4WF8A 2F9UA 1IQIA 1KLTA 3A89A 1VCWA 4MNVA 3ZZ5A 2Z3DA 1YPLH 4Y79A 1O5GH 2VNTA 5EQQA 2STAE 3KHVA 2GMTB 3QTOH 1AKSA 5C1UA 1UCYK 1WSSH 5DGJA 1C2FA 1C5ZB 2J94A 1O5AB 1JRSA 3BG4C 3FAOA 1D3TB 1UTJA 3FFGA 1H8DH 5ESTE 1Z8IB 2BZAA 1O2PA 3UNQA 1MKXH 3SN8A 4BXWA 5T1VA 2JETB 1GBCA 3GY7A 1ZGIA 3L6PA 3UB0A 2AMDA 2BOKA 1MAXA 5DP3A 3A85A 5T3HA 4AG2A 1LQEA 3U28C 3D23A 1ABIH 1FY4A 3UOPA 1MCVA 3LGWA 3P8OA 5C0UA 1GJ8B 3A8AA 1P8VC 3BTME 1QZ8A 4BTTB 3MNXA 3OFND 2CF8H 3KQCA 1Z1IA 2Z9GA 1JIRA 4B73A 3B8JA 1BTXA 1U6QA 4XBDA 4BNRA 5A8YA 2B8OH 2Z3CA 5EPNA 3FP7E 3NK8A 1NROH 1GGDB 4ISIH 1TPPA 2SGDE 4NFFA 1O3DA 2FS9A 1FIZA 2F9VA 1NFYA 2JDID 2IJOB 3LT3A 5E8EH 4Y0ZE 3SJKA 3TH3H 1GBKA 5JBAS 1GHAG 1O2HA 3I77A 1K2I1 1EPTB 1P09A 2BY6X 3TGKE 2ZCHP 3D62A 4X1SU 1AE5A 1DWCH 1FMGA 4NZLA 1LPZB 1HAYB 3MOCA 3EA7A 1DSUA 1EOJA 1OP2A 3M5OA 2BD9A 5A8XA 4DY7B 1W2KH 4ZROA 1OS8A 2XCNA 2LP6A 4H42U 1LHEH 1JWTA 4ZMAH 4AGKA 1OSSA 3U9AH 3PWBA 3F0PA 2HGTH 3PLKA 2ZGBH 1FX0B 1SPJA 3SNDA 2XYAA 2HALA 2CK3D 4ABAA 1CA8B 2VU8E 5KECA 1PPZA 1EZXC 1WBGB 3G01A 4XD7D 2KCPA 1C1TA 1TRNA 5C0TA 3RUOA 1G3BA 1MZDA 2FOMB 4Y8XA 2QGRA 1LVYA 3AVZA 1GI9B 1D4PB 4TWYA 1P03A 4DT4A 3RXLA 1QA0A 2BLWA 4K1SA 5AFYH 2FIRH 1GPZA 3GCTF 2ZU1A 1GBHA 3HGNA 3LJJA 1HDTH 1XX9A 5EW1H 1HJ9A 1O32A 1QIXB 2Z94A 1SGDE 3MO9A 3U8TH 3M35A 3W94A 2BD3A 1C2IA 3BTWE 3HGPA 3GYLB 2CHAC 1NBMD 4K1EA 1QURH 4BAKB 4CREA 5ETXA 2EEKA 1A2CH 2FOCA 1RD3B 1E37B 4JMYA 4NSVA 1TNJA 1T32A 1GL1A 2OC1A 1SQOA 2FO9A 3PLPA 1F2SE 3F9EA 3PROA 1C1MA 2J38A 1N1LA 1QQ4A 3SU1A 1EXFA 1SGCA 3RXFA 1XUFA 3E3TA 3MH4A 1TA6A 1CGJE 3E0NB 4HZHA 3RXIA 1CA0C 4X6NA 5LGOA 1P2OA 1RIWC 1PQ7A 4BOHA 3A8CA 1FXYA 5EGMA 3LIWA 4ZXXH 1A4WH 4NA9H 7GCHG 3QDZB 4D7GA 3VB6A 5FX6A 2WUCA 2FESH 3A80A 1JOUB 1KTTB 1M9UA 1OWDA 2GX4A 1C9PA 2KZ4A 2HWLB 1CBWC 4CR9A 5DSFA 4X8TH 4AYYB 2FLRH 3WW7A 1UVUH 1BHXB 3N7EA 4JZIA 3SV6A 1LPGB 1L4DA 1DOJA 1EB1H 3KIDU 4M9FA 1HGTH 4FU9A 1DDJA 2OD3B 3CNRA 1RTLA 3K9XB 3ITIA 4Y10E 4AFUA 4B74A 3GDVA 1NTPA 3RC4A 2STBE 1QTFA 2W7UA 5HMAA 4K8YA 2ZU5A 1H8HD 3F2FA 1XUIA 2BD2A 2ANMH 1FJSA 3PB1E 2BDIA 1ZPCA 2AMPA 1UHBB 3EA8A 4DCDA 3BTQE 4ESTE 5L6NH 2Y7XA 2W3KA 4NZQA 1D3QB 1A5IA 5F6MA 1G2LA 3DHKH 3KGPA 1KXDA 3T25A 1TMTH 5DP7A 1AVXA 1DPOA 1QR3E 5JDUB 3QLPH 1YCPH 2A4OA 4MNXA 2PUXB 1ELDE 2THFB 5GDSH 4CRAA 1XXFA 4XDEA 3ZVAA 7GCHF 3AASA 1TB6H 3RXDA 2FX4A 3RXMA 2W26A 2G8TA 2J4IA 4IS5A 5C1YA 1K21H 3K6ZA 1C1SA 4CRCA 1WTGH 3ZVFA 1BA8B 2YNAA 2ZECA 3SJ9A 3VXFH 1OYQA 4GPGA 1XM1A 4OS6A 2XC0A 3C27B 1FN6A 2IPHA 2H5DA 1AGJA 4X0WU 1PPHE 3F1SB 1O2UA 2C90B 2R9PA 1C5LH 1B0FA 3ZZDA 1SGYE 2NU1E 4YT6H 1BIOA 2Y5GA 1GI0A 4OS7A 1YLNA 2OBOA 5FPYA 5K0HA 2OC7A 1AB9B 2AGIX 4ACAA 3ZZ6A 2A4GA 3T2NA 2J98A 3UOUA 4KTSA 1F0UA 1YPKH 2KAIB 1L1JA 2AYWA 1NPMA 3A84A 2KCYA 3GOVB 4ABEA 1TOMH 3A7WA 1B5GH 3ZVCA 3RXKA 1V2PT 1AKSB 1HJ8A 2SGFE 3QGJA 3SUEA 1CSOE 1HV7A 2P3UB 4HFPB 1PQ8A 1O3FA 2ZFQH 1YWUA 3SQHE 3RU4D 2B5TB 3A7TA 3E6PH 1GDQA 1XKBC 4A92A 1GDNA 3HKIB 1C4V2 1C1PA 3N99A 3SU5A 3SGAE 2CGAA 1C5QA 1O2MA 1ZHMA 4X2WA 3R3GB 1GJ6A 4BAMB 2TGAA 2Z7FE 1MTWA 3IITA 5SGAE 3O8CA 1L1NA 3MQKC 3RP2A 4TY7A 1ESTA 3E16B 1N8OC 2GD4B 2H9TH 3K6YA 3DD2H 2F43B 2V0BA 4BXSA 4TPYA 3LOXA 1TNGA 2WPKS 1IQHA 4X1QU 1L1GA 1FLEE 1FIWA 2PFEA 2QIQA 1SBWA 2P3FH 3MH6A 1O2LA 2H6MA 2FPZA 2DUCA 3PO1C 4Y7BA 3CS7A 1SQRA 1LMWB 1ZLRA 1LVMA 2VIQA 1MTSA 1FDPA 1C5TA 1S82A 3A82A 4GSOA 3A7ZA 3SO3A 1XVMA 2AMQA 3ZZ4A 4FU7A 3MNBA 1C1VH 2O8UA 1UMAH 2W6ID 1TNLA 2ZA5A 1GMCG 1W8BH 2FM2A 2GKVE 1WUNH 3SI4H 1LKBA 2ZDMA 1UTMA 4ABDA 1BMNH 4KELA 3SV7A 5L2YH 2CJIA 3GS9A 5TJXA 1WXRA 2OTVA 2PWXA 1J16A 1PPGE 2LPRA 4Y0YE 3DT0H 4Q2KA 2M2AA 1SQAA 4AFZA 2UWPA 4SGBE 3KQDA 3DA9B 1S83A 3M5MA 2UUKB 1O3LA 3KEEA 1E79D 1X7AC 2HLCA 3RMLH 3UUZA 1F0RA 1P01A 1V2ST 1GBEA 4ZH8A 2ZNKH 2ZDNA 4CRFA 3E90B 1CHGA 1TALA 3UR6A 1NRNH 1Q2WA 2A32A 4ACBA 4I33A 1GJDB 8LPRA 1N6YA 4FUCA 1LTOA 2OBQA 1EP6A 2K1QA 4WMEA 1EJAA 2R2WU 4NA7A 3ZV9A 5EODA 5EJ1A 1FY5A 1GMCF 1OWKA 2ZFPH 1HAIH 2SFAA 4HI3A 1GDUA 2VH0A 1OYTH 1BBRE 1G3CA 1ZMLA 1P10A 1HIAB 1TWXB 3LH3A 3MU1A 1TGSZ 1XXDA 1IOEA 2L6OA 2ZPQA 1Z7KA 3BTHE 2FOGA 1ESBA 5I25A 5I46H 2PV9B 3T5FH 1BBRH 3BSQA 1PPEE 4MVNA 1A5HA 1H9LB 4WVPE 4A6LA 1TRYA 1KIGH 3FP8E 3FN8A 5GNDA 5T6DA 3DSGA 2ZKSA 1OOKB 3P70B 2CMYA 2ZP0H 1F92A 5JB9S 4NIWA 2CHAB 2ODQA 2PKSB 3DCLA 2UUYA 2TGTA 1T7CA 4I8LA 2BQWB 3A8DA 2SGEE 2PKAB 1UVPA 4FUEA 2ZTXA 4UEHH 3SV2H 3ZZ3A 1K1NA 3M7QA 3WWFA 4FVDA 4H6SB 6GCHG 4ASUD 1ZPZA 3S9BA 2FTLE 2Y5HA 1QHRB 2YMSD 2GP9B 1GI5A 1ANBA 1HAXB 3LC3A 3PV5A 1ESAA 3E8LA 1MKWK 2VB0A 2QXHA 1PPCE 4IN2A 1SL3A 1G2MA 1LPKB 1EJNA 4A5TS 2BVSH 3ATWA 1UK3A 3CENA 4UDWH 1GL0E 1MQ6A 1TBQH 3H7OA 3RXVA 2Z9LA 1G30B 4JYVH 4NWKA 3SNCA 2A31A 2BDYA 4K5ZA 3KL6A 1V2NT 2K0QA 1V3XA 1EP5A 1GJAB 3TK6A 3QX5H 1O3EA 3K65B 1HXFH 1LHGH 5DP4A 2FTMA 3IWMA 1MU6B 5HM2A 1OWHA 4DOQA 1O2YA 1O0DH 3ZVDA 1YF4A 3M7UA 3V13A 5HIYA 1UVSH 3SOSA 1GCDA 1ZTJA 1TGTA 3B9FH 2WYJA 4JK6A 3ZZAA 1PQ5A 1C5VA 4UE7H 3A83A 6GCHF 3E1XB 1ZSJA 3TK9A 1Q3XA 4WH8A 4AB8A 2HNTF 1YPMH 1YP9A 1SOTA 2WV5A 1PYTD 1S84A 1NU7B 1GI6A 3HK3B 3RXAA 1E34B 3QTVH 1MTUA 2ZFFH 1YM0A 3GISB 2HNTE 2GT7A 1AIXH 3MH7A 2NU3E 3QO6A 1ZSKA 2OQUA 1PPFE 1O3IA 1NN6A 1EAXA 2OCVB 1K1JA 2HPPH 3GY3A 3T28A 3W95A 3N7DA 2ZCKP 4MPUA 2Z9KA 1C5PA 5T6FA 3U98H 2ZTYA 1QCPA 4BAOB 1FY8E 2IN2A 1XVOA 3UR9A 3VB5A 3QK1A 3B23B 1QRWA 3M5LA 3PRDA 1UO6A 1D6RA 1Y8TA 3AAUA 1F0TA 1ZRBA 1O3MA 1T8NA 1NU9A 2J5UA 1TX7A 2ZHQH 3TNTA 1QY6A 1KXBA 2AEIH 4B75A 4Z6AH 4FUFA 4FVBA 4CHAC 4R8TB 2C93B 2WZQA 2BB4A 2BOHB 5L2ZH 3PMAB 2BDAA 1G37A 4INKA 3TNSA 1D3PB 4ISLA 5JB8S 1O30A 2RA0A 3ENSB 3FZZA 3DFLA 4FUGA 4I31A 1BTWA 3UY9A 2RFKC 3I29A 2BD7A 2F91A 2K8IA 6CHAC 5HKKD 2BY8X 1GJ7B 3H5CB 5JPMH 1HB0B 1MTVA 3M36A 1BHXF 3P8NA 1ZSLA 1ID5H 1MKWH 1CT2E 2ZGXH 1AUTC 1O2RA 3VGCB 5FL7D 4F49A 1SFIA 8ESTE 2V3HH 3T27A 1EASA 2XC5A 1L4ZA 4VGCB 3TPIZ 4D9RA 4YTAA 3MU4A 2B9LA 2KCOA 2AIPA 5CMXH 5EW2H 1GVKB 2OP9A 3F9HA 4FETA 4QT8C 3D65E 4RT0A 1DXWA 1W10U 1TYNA 3ODDA 1E35B 2ASUB 1HRTH 1MAYA 2G51A 4B2CA 3ZYDA 1LDTT 3PTBA 1Z8JB 2UWLA 2BXUH 3ELAH 3OTJE 3SGQE 5A0BA 4JK5A 1OKXA 1LKAA 1DVAH 1C5UA 3PMJA 3MTYA 1L2EA 1J8AA 3UAIC 1N8OB 4KKDA 2P59A 1UTPA 1ELEE 1GHBG 1LCYA 2PTCE 2ZDVH 2ZHFH 4CH2B 3A86A 2ZZUH 1HNEE 2WV9A 4Y76A 4ISNA 3MO6A 1P0SH 2QYIA 1CGIE 2SGAA 3UQOA 1O37A 2ODYB 3TH2H 2GV6A 1HYLA 3QN7A 3STJA 3TITA 2QV1A 4ZKRU 3RXGA 1FY1A 3F2HA 3OE7D 4Y71A 4ZXYH 1E1QD 4DIIH 1O3BA 1J15A 3AK5A 1O31A 1HAPH 4AN7A 4MNYA 1GHYH 1MTNB 1T4UH 1H9HE 5A8ZA 1MZAA 2BDGA 2GZ7A 4R0IA 5JYIA 4THNH 3PV2A 1OP8A 2WPIS 4GLYA 1YPHE 1AHTH 1GJCB 2G52A 2GCHG 4ISOA 1DUAA 5A0AE 1F5LA 1O2OA 3HK6B 1Z71A 2ZGCA 3BIVH 3VB7A 3DUXH 4A7IB 1AE8H 3MMGA 1UCYE 3RC6A 1CQQA 5AFZH 2BQ7B 1H1BA 2YMSB 5GJ4B 2EC9H 3RXSA 1V2JT 2QC2A 1VCPA 1EOLA 1JMOH 4SGAE 4A1TA 1BQYA 3PTNA 1WYKA 1GHBF 2AH4X 1KXCA 3MO3A 2QF3A 3QWCH 4ZKOU 1GHAF 5C17A 1UCYH 2NWNA 3ATIA 2P16A 1ZMNA 3GY4A 5CHAC 5E0GA 1C2EA 1A46H 1ZYOA 1YC0A 2VH6A 1O3OA 4OS5A 1GBMA 4DURA 3KYFA 3SV9A 4XBBA 1DWEH 1EATA 2NU4E 4TY6A 2TBSA 2V3OH 4FUJA 2EA3A 3LGTA 5E0HA 1FQ3A 5FPSA 4MPVA 2BQ6B 1BMFD 3LJOA 1GI7B 3SUFA 3M37A 3L33A 4DJZB 1MH0A 4YOIA 4B2AA 1DXPA 1VGCC 1CT4E 2QXGA 1BMLA 1O3GA 3ZVGA 4Q7YA 1WQVH 4NIYA 3RXEA 2FYRA 5DK1A 2GCTB 3FZDA 1O38A 4ABBA 1BZXE 2GCHF 1GWAA 2QN5T 3NUMA 2ZGJA 4AZ2B 1O2TA 4ZHAA 1C5XB 2KX4A 1SGQE 4JYUH 5GCHG 1UVOA 2I6QA 1GBBA 3A7YA 3UQVA 4AX9H 2H1UA 2ZQ2A 3MU5A 1V2LT 1V2OT 2G55A 1WDIA 1S6HA 4E05H 2BTCE 1O5EH 1OP0A 3RXRA 1C1UH 7KMEH 4P00A 3PRBA 1UK2A 1ELBA 2BVRH 2BD5A 1NESE 2GJGA 4Q7XA 3STIA 2WPHS 2WPLS 2FODA 3SJIA 3A81A 5EG4A 1NBME 4O03A 2EI6A 4A1XA 1C5WB 2A5IA 5DP6A 1C1OA 1UTNA 1W3CA 5E2PA 1MBMA 1TABE 2ODPA 2G81E 2BY7X 3BEIB 2OK5A 1HUTH 1K1MA 1W0YH 1DT2A 1TRMA 1Y5AT 7ESTE 4AORA 2BHGA 4MG3A 1ELCA 1ZZZA 3P92A 3F6UH 4XSKU 1UTKA 4Q7ZA 1B0EA 5GIBA 3SUGA 2ZPSA 1C2KA 1TBRH 1BMMH 1CHOG 2CXVA 1SGFA 5TCAA 2ESTE 2KFWA 4Z0KA 5EJLA 1KTSB 1GJ9B 3HPTB 5JBBS 1BOQA 5GCHF 2ZHDA 2TRMA 3ZVEA 1GVZA 4INHA 1A0JA 2CF9H 1ELGA 3RXJA 1ZTLA 4U32A 3U8RH 2P93A 4D7FA 4YXWD 1ETSH 1NM6A 1FN8A 1MU8B 2UWOA 1RXPA 1OWEA 3ZZCA 2W5EA 2VIPA 3CP7A 3SU2A 1GHWH 1GHVH 3PLBA 3P6ZB 1UTOA 1C5YB 2HVYB 1YLCA 3TGJE 4Q80A 4X2YA 2D2DA 3RXQA 1YPGH 3OU0A 4PROA 5AVDA 5A0CA 2EQNA 5HGGA 4ZUHA 1NRRH 4FUIA 3RXUA 1DWBH 1JRTA 4AB9A 4I7YH 3TK5A 1ZPBA 4GCHG 1CU1A 3BTGE 2GMTC 4X2XA 2Z6BD 2A1DB 2NU2E 2F83A 2V7QD 3VXEH 1V2WT 2IJD1 2R3UA 1GMDG 1CHOF 1TA2A 1RRKA 1SOZA 5DP8A 4MNWA 2HOBA 2EI8A 1O2VA 1FY3A 1K22H 3OEHD 1LHDH 2D1JA 4LK4A 1AMHA 1EKBB 1ETRH 1C5NH 2TIOA 1EAWA 1W0ZU 1ORFA 1Y3YA 2JETC 2JH6D 5F8XA 2C4FH 2PHBA 5AHGH 1QFKH 3GY8A 1AFEH 4XFQA 3SJ8A 2LNCA 3RLWH 1S85A 1GBAA 2Q6GA 1EFRD 1K1OA 1GBTA 1IQGA 2GT8A 2QF4A 3JZ2B 4ASHA 1GBJA 1MQ5A 6CHAB 3BG4B 1SGRE 4AC9A 3URCA 1AVWA 2BLVA 4I8HA 4GVUA 3TJUA 4DVAU 1HAGE 1KLJH 3UFAA 5DPAA 2SGQE 1EAIA 1O2IA 3A7XA 2AIQA 1HBTH 2SGPE 3ATKA 4UFFH 1C1QA 2J34A 1O3NA 5EOKA 4WMDA 1QJ1B 4GCHF 5CE1A 1PPBH 2BDBA 2AS9A 1Y3WA 3PMHB 2JIZD 2G4UA 2WSSD 2XXLA 1IQEA 1V2UT 2C8XB 5HIZA 3BEUA 3GY6A 1EJMA 4X8VH 2FDAA 1O34A 4IC5A 3Q76A 1GI1A 4HGCA 1AI8H 4KTUA 1GBFA 3RU4E 4JZFH 3MHWU 3OSYA 3SBKA 3I78A 4IGDA 3UTUH 2RG3A 2QCYA 1G3EA 3OY5U 4O3TA 1KLIH 3RLYH 4XE4A 3U8OH 4GUXA 1DM4B 1QL7A 4TSFD 1SGEE 2DE9A 3F2GA 2VGCC 3GCNA 1JBUH 3U1JB 4E7RG 4MPXA 2D8WA 1KYNA 1V2KT 2Y6TA 4O3UA 1COWD 2B0FA 4D76A 1DANH 1FI8A 3RMOH 3EYDA 3PWCA 3T62A 4CBNA 2VIWA 2XBYA 2H5CA 1GG6C 5JBTA 4RSPA 2J97A 5G4BA 5IK2D 1DY8A 3ZVBA 1SC8U 2F9OA 1QRXA 1CVWH 2VBCA 2P8OC 1Y5BT 4ZHLU 2FI3E 3T26A 1C4Y2 3Q3YA 4JCNA 4UONA 1VCQA 1AWFH 3RU4T 3SHAH 4JZDH 4ZKNU 3LU9B 4JZ1A 3FKSD 1T8MA 1W7GH 1NFUA 1TQ0B 3Q77A 1C4U2 1C2MA 1P2NA 4CRBA 1VITG 5C67A 1TAWA 4UFDH 3D49H 3LGVA 1Y3UA 2ZFTA 3RXHA 1W13U 4Q4LA 3BTEE 1NRPH 3ZIAD 5DP9A 4BAQB 1P3EA 2W6JD 3DSPA 4NFEA 1ZJDA 4RKOB 2KCAA 2ZTZA 5GXPA 1AO5A 1FAXA 1SHHB 3PMBB 3SGBE 1KMHB 1TPAE 1TLDA 3KYGA 4Y8ZA 2G00A 1C5MD 1O5DH 3E0PB 2G5VA 5CHAB 1EUFA 4K1TA 1O5CB 3MWIU 1NFWA 2VWLA 1E0FD 3QZQA 1SR5C 1QNJA 2A0QB 2WINI 3UREA 1TGBA 1NC6A 1GBLA 1VR1H 1Y3XA 1YCPM 5C94A 1F5KU 1HJAC 3SV8A 2BM2A 1EQ9A 2XWAA 3F9FA 5FXLA 5J4SA 1O33A 1HAOH 1CA0B 2ILNA 1HCGA 2HPQH 1SLUB 2ZC9H 1AFQC 2P94A 3LGIA 1RIWB 2FOHA 1ZRKA 1TGCA 4D9QA 1VJAU 3QUMP 4DW2U 1VITF 3KQBA 1RTFB 2ZU2A 4ABFA 1GMHG 4B6EA 3NZIA 1V2RT 2O9QA 4LXBH 1HAHH 2J2UA 2FOFA 1ELFA 4K2YA 1MKXK 3A7VA 1CBWB 2VVCA 4MLFB 2J95A 2BY5X 1A61H 1J17T 4YZUA 3EE7A 1G9IE 1MABB 1G32B 3MI4A 9LPRA 3RXTA 3AAVA 4UFEH 2Y80A 2XWBI 4I86A 1YGCH 3RXOA 1Y3VA 5LPEA 4FXGH 1VITH 1DSTA 1SGTA 1NZQH 1QQUA 1TPOA 3MFJA 1EB2A 1UTQA 3MU8A 4NGAH 5FAHA 3SHCH 2L74A 3EAJA 3V0XA 4DG4A 1HPGA 5GPIB 1QL9A 4WJG2 3V7TA 1IAUA 4UFGH 2FP7B 1THRH 3OX7U 1SLXB 1GBDA 1SB1H 2R2MB 3GY2A 4BTIB 3ATLA 4X2VA 3RC5A 5C3NA 2Z9IA 1AZ8A 3MU0A 1P2MA 3P8GA 1AB9C 1WCZA 2J98B 1HLTH 3N7OA 5C20A 4YESB 3FP6E 5KGOA 1AUJA 2QF5A 4HG6A 4HTCH 4K69A 4ZAEA 1S0RA 1P05A 5H4IB 4O9VA 3M3VA 4I8GA 1RFNA 2W7SA 5ESBA 1FAKH 4GHQA 1XUJA 4U30A 1BUIA 4INLA 1DLEA 5FX5A 1YKTA 2WPMS 3ODFA 1LVBA 1EZQA 2HVXA 1TQ7B 1QBOA 2BD8A 2BX3A 3QZRA 4I8JA 5BRRE 3S9CA 1S5SA 1TOCB 1CE5A 3R0FA 2BVXH 2OLGA 3FVFB 5FCKA 3JZ1B 4CRDA 2OUAA 1IQMA 2TGPZ 1AVGH 3LKWA 1Z1JA 1OWIA 1IQFA 1P9SA 1BT7A 1ANDA 1QB9A 1ZJKA 4K3JA 3LONA 2OINA 3U69H 1G36A 1Y59T 5E0JA 3SQEE 1XKAC 1NO9H 1SI5H 4YOGA 1K9OE 1O2XA 4YM9A 2H9EH 2SNVA 2XRCA 2O8WA 1HAVA 1C2DA 2O8TA 5EPYA 2FX6A 4Y6DA 1KXAA 1OHHD 4IMQA 4LZ1H 2ANWA 1BRBE 1NRQH 5F8TA 1NFXA 4JZEH 5DO4H 4IC6A 1ANCA 2QY0B 2A4QA 5K7RA 3TGIE 3SU4A 1TNKA 2BLOA 4J1YA 3GCHC 4M7GA 1T8LA 5JBCS 3VB3A 1RJXB 4TWWA 1O3AA 1PFXC 4BANB 2G5NA 2JJ2D 4XRNA 3T29A 3UWIA 1GJBB 5A2MH 1Z6EA 3GICB 3LH1A 4ZHMU 3SJOA 3TVJB 4IMZA 2BDCA 3BG8A 4X8SH 5C1XA 1BRCE 1LO6A 1TNHA 1THSH 1THPB 2R3YA 2O8LA 2ALVA 3E91A 4NG9H 1H8ED 3PO1B 3TIUA 1S0QA 3Q3KA 1LQDB 2A7CA 5FHTA 3EGKH 5E2OA 1KDQA 1KY9A 2FLBH 3EDXB 4Y7AA 1Z6JH 1W7XH 1SFQB 3M7TA 1BMAA 2Q6FA 3GCTG
chains in the Genus database with same CATH topology
2I6SA 1ABJH 4YT7H 1DITH 2XW9A 4NCYA 5DKMA 1F0SA 3KQEA 3P95A 2C3SA 1AD8H 2FI5E 2C8ZB 5EQRA 5LH8A 4ABJA 1DY9A 2ALPA 1SVPA 1O5BB 2WV4A 4O97A 1SLWB 3EA9A 1TX6A 3P17H 2ZEBA 1T31A 2XC4A 1GBIA 3A88A 2VVUA 1H9IE 4AGJA 3PYHA 4F4OC 1J14A 1N6XA 4MDSA 3HATH 1EAUA 4OGYA 3TJNA 2AFQB 2YOLA 1W14U 1XUHA 2VGCB 3IG6B 1A0LA 1D3DB 4MQAA 1ACBE 2PGBB 1YCPK 4NIXA 1E36B 1Z8RA 2GZ8A 3GYMA 1YBWA 2XNIA 1CGHA 4YLUA 3ZZ7A 1Q31A 1H4WA 1O35A 1A3EH 1GG6B 3NWUA 5BPEA 1P11E 1ZHPA 4ABHA 4AFQA 3O8RA 5EXMA 4ABIA 1P3CA 5GWZA 2ANKH 3ATMA 2P8OB 8KME2 2P3TB 1A7SA 3O8DA 1ELVA 2A5AA 2R0KA 2F9NA 2OC0A 1ETTH 3TLOA 1QA7A 2FMJA 3RDZA 2JH0D 4AOQA 2GVFA 4YO9A 1UK4A 2A4RA 2PKSC 1ELTA 4K8BA 3WY8A 4XBCA 2A7HA 2VIDA 4Y11E 1P2IA 1NT1A 1HIAA 4WY3A 5C2ZA 2C8WB 3BF6H 5F8ZA 1IHTH 4Y8YA 1QB1A 2ZFSA 2HRVA 2ZI2H 3LGYA 3SNEA 2P95A 4WMFA 1F5RA 2XBXA 1TPSA 1DFPA 4MPWA 5DG6A 1SGPE 3TU7H 2QAAA 2V35A 2BX4A 3A8BA 1TGNA 4CHAB 1DX5M 1E38B 3TH4H 1Z8GA 1UJ1A 2PKAA 1KXEA 2ZU4A 2ZPRA 3TJOA 3VFEA 4B2BA 2BDHA 4B1TA 1WAYB 1LHCH 3GDUA 4X1NU 2H9HA 4E7NA 4XOJA 3UIRA 1AY6H 1L0ZA 4TPIZ 2JKHA 1QRZA 4K60A 1HJAB 1B7XB 3KCGH 3KNXA 1AFQB 4ISHH 1VJ9U 4I8KA 1ANEA 3SUDA 1QGFA 2ZG0H 1FZZA 1C9TA 1MBQA 1C5SA 5HXFA 4WWYA 1OX1A 4OS2A 4IN1A 2ZU3A 2ZCLP 2QXIA 2XTTB 2RA3A 4RKJB 4X8UH 3BN9A 3UWJH 1BRUP 3HKJB 1O3PB 1CT0E 3M61U 3ZYEA 2J92A 5FBEA 1GHZA 5LPRA 3VB4A 2GDDA 5FCRA 1O5FH 3VPKA 1NS3A 1GCTC 1WTHD 2AERH 4OS1A 5B6OA 1IQLA 1TNIA 1SHYA 2ZWLH 1DE7H 2Q1JA 1SLVB 1P2KA 1BCUH 1DICA 2ZDAH 2BY9X 1AN1E 2FOAA 4A1VA 1O2WA 2G4TA 5EXLA 1P9UA 1XUKA 1PJPA 2VVVA 3O8BA 3ZV8A 5C5NA 5IDKA 1IQJA 1SGFG 2PLXA 1D6WA 3LC5A 2BMGB 2CV3A 1S81A 2A5KA 2GDEH 5AF9H 1TFXA 2H2ZA 4U2WA 3RM2H 1K1LA 1RTKA 2BXTH 3M3SA 1O2NA 1QB6A 1UVTH 2UUJB 4DGJA 2ZO3H 3LPRA 2BD4A 1BB0B 1ZMJA 5FPTA 1O2QA 2VWNA 1QJ6B 3SU0A 4X1RU 1ELAA 1O2KA 3RXPA 1NRSH 1FV9A 1QBNA 1IQKA 1GI8B 3VGCC 1XMNB 2A2QH 2VWMA 4FUBA 2V6NA 4AG1A 2SNWA 4VGCC 4OS4A 2WYGA 1HAVB 1FPHH 4RN6A 4MTBA 4X6PA 1O3CA 3S69A 3S7KB 1K1IA 1FNIA 1GHXH 1SQTA 1XUGA 2ZIQH 2XBWA 4KP0A 1SG8B 1BTYA 2F3CE 1DWDH 3F68H 4JYTA 4WXVA 3EE0B 3M5NA 4H6TA 4X1PU 1DLKB 1GI4A 1WOFA 1GI3A 5A09A 1O39A 3RMNH 3KN2A 1AQ7A 2RCEA 1V6DA 4GHTA 3Q00A 2OXSA 2BLQA 4CRGA 1BBRK 1TMUH 2M5TA 1BTPA 3FANA 1G3DA 3BTKE 3UPEA 1GGDC 1O3KA 2R0LA 1A1RA 2BYAX 1ZHRA 4BTUB 3SZNA 1FPCH 1HFDA 3MYWA 1BTUA 3H7TA 1P57B 1EPTC 1GMDF 2OC8A 1KDQB 1W12U 2FXRA 4DT7B 2A7JA 1JXPA 3UNRA 2WUBA 4D8NA 1TE0A 1QL8A 1WU1A 3GCHB 4I32A 3EQ0H 1UTLM 1AWHB 1NY22 1QJ7B 2PTNA 1GI2A 1YLDA 1FUJA 2EI7A 1GJ5H 1O36A 1K1PA 3RXBA 1ZTKA 1ARCA 1J9CH 1FONA 2Q6DA 2UUFB 5T6GA 1BTZA 4NIVA 1MTNC 2ZDLA 3F9GA 5C5OA 3S0NA 1LVOA 1H8IH 1SSXA 4ZKSU 3ZZBA 1EPTA 1SGIB 4NSYA 1DS2E 5FBIA 1QBVH 2GGVB 2C8YB 1ZOMA 2VINA 3BV9B 1Y5UT 2QF0A 2VWOA 1S6FA 2NU0E 2W3IA 1P06A 1C1NA 2HNTC 2O8MA 1MD8A 1MD7A 1V2QT 1BDAA 2ULLA 1A0HB 2Z3EA 1RGQA 2DE8A 2FYQA 1SMFE 3S7HB 2ZHWH 3BIUH 1V2MT 1GVLA 1P2QA 2PSYA 3SI3H 1INCA 3L3TA 3SNBA 4E06H 5EQSA 1C2GA 1CO7E 2PGQB 3AW0A 2RDLA 1W11U 2VJ1A 2FZZA 5ABWA 3MNSA 5EXNA 1P12E 2GV7A 3BTDE 3RM0H 3BTTE 1C1WH 4B76A 9ESTA 1C2JA 4NWLA 5IYTA 2IOTA 2QXJA 1WV7H 8GCHG 3U1IB 2GCTC 3Q3XA 2PW8H 1DUEA 2D26C 5TCCA 1RS0A 1IHSH 2JH5D 2XBVA 3SU6A 2AGEX 3C1KA 3PV4A 3TJVA 2FI4E 1PYTC 4IBLH 3UNSA 3LGUA 3RXCA 3NCLA 1MUEB 3M3TA 2TPIZ 2FEQH 3V3MA 4AYVB 3OY6U 1OWJA 1O2GH 2PUQH 1PQAA 2GZ9A 1VGCB 1BJVA 1EZUC 1MMJN 1P2JA 4YOJA 2ZHEH 3SU3A 2FOBA 3NKKA 3A87A 2GTBA 1A3BH 3ZZ8A 4LOYH 5L30H 4FU8A 2Y5FA 2FWWA 1EZSC 1JIMA 4CR5A 1C1RA 2A2XH 4B71A 2ZQ1A 1V2VT 4WXIA 1MCTA 1K28D 1O2ZA 4KTCA 4DIHH 2TGDA 7LPRA 5PTPA 3KF2A 4FUHA 1YYY1 4H4FA 1P04A 1KSNA 1VZQH 4IW4E 1D9IA 1C2LA 2F9BH 1OPHB 3V12A 2Y7ZA 4J2YB 1LHFH 5DJ7A 5F03A 8GCHF 2Y82A 4OGXA 1F7ZA 2XCFA 2QA9E 3NXPA 2J9NA 4NA8A 1HXEH 4ABGA 1YPEH 3ZZ9A 2WPJS 3AW1A 5EU8A 3MNCA 3SORA 1YPJH 1SGNE 1P02A 3ESTA 2ZF0H 4WH6A 1TMBH 1BITA 3GY5A 3S9AA 4CBOA 4UD9H 1BJUA 4X6MA 2VIVA 2ZGHA 1UHBA 2Y81A 4GAWA 3MH5A 1EX3A 1V2TT 1ZGVA 5HM9A 1GJ4H 1BRAA 2YNBA 1WQSA 4X6OA 4YLQH 3DFJA 3PM3A 4AFSA 2B7DH 1ZR0A 2VIOA 4KGAA 2OQ5A 2AGGX 3URDA 1GMHF 1IQNA 1YPHC 3GCOA 3QGNB 5DP5A 1T8OA 2FS8A 3K2UA 3GDSA 4U01A 1KXFA 4LZ4B 3CS0A 1T4VH 1O2SA 1GCTB 2ZDKA 1ARBA 2BZ6H 3BEFB 5J4QA 1TIOA 3VEQB 1TBZH 1AZZA 4FUDA 1OXGA 2ANYA 4CH8B 2ZFRH 3SNAA 4TYDA 3RMMH 3OYPA 1TONA 1C5RA 2CN0H 2A45B 3BTFE 3SW2B 5LPFA 3P8FA 2F9PA 1A5GH 6LPRA 2PSXA 1C5OH 5HYOA 2Z9JA 1HAZB 1O2JA 2PR3A 1O3JA 6ESTA 3NPSA 1AU8A 1TX8A 1BTHH 2FOEA 2KAIA 1O3HA 4BAHB 1C2HA 3LDXH 4WF8A 2F9UA 1IQIA 1KLTA 3A89A 1VCWA 4MNVA 3ZZ5A 2Z3DA 1YPLH 4Y79A 1O5GH 2VNTA 5EQQA 2STAE 3KHVA 2GMTB 3QTOH 1AKSA 5C1UA 1UCYK 1WSSH 5DGJA 1C2FA 1C5ZB 2J94A 1O5AB 1JRSA 3BG4C 3FAOA 1D3TB 1UTJA 3FFGA 1H8DH 5ESTE 1Z8IB 2BZAA 1O2PA 3UNQA 1MKXH 3SN8A 4BXWA 2JETB 1GBCA 3GY7A 1ZGIA 3L6PA 2AMDA 2BOKA 1MAXA 5DP3A 3A85A 5T3HA 4AG2A 1LQEA 3D23A 1ABIH 1FY4A 3UOPA 1MCVA 3LGWA 3P8OA 1GJ8B 3A8AA 1P8VC 3BTME 4BTTB 3MNXA 2CF8H 3KQCA 1Z1IA 2Z9GA 1JIRA 4B73A 3B8JA 1BTXA 1U6QA 4XBDA 4BNRA 5A8YA 2B8OH 2Z3CA 5EPNA 3FP7E 3NK8A 1NROH 1GGDB 4ISIH 1TPPA 2SGDE 4NFFA 1O3DA 2FS9A 1FIZA 2F9VA 1NFYA 2IJOB 3LT3A 5E8EH 4Y0ZE 3SJKA 3TH3H 1GBKA 5JBAS 1GHAG 1O2HA 3I77A 1K2I1 1EPTB 1P09A 2BY6X 3TGKE 2ZCHP 3D62A 4X1SU 1AE5A 1DWCH 1FMGA 4NZLA 1LPZB 1HAYB 3MOCA 3EA7A 1DSUA 1EOJA 1OP2A 3M5OA 2BD9A 5A8XA 4DY7B 1W2KH 4ZROA 1OS8A 2XCNA 4H42U 1LHEH 1JWTA 4ZMAH 4AGKA 1OSSA 3U9AH 3PWBA 2HGTH 3PLKA 2ZGBH 1SPJA 3SNDA 2XYAA 2HALA 4ABAA 1CA8B 2VU8E 1PPZA 1EZXC 1WBGB 3G01A 1C1TA 1TRNA 3RUOA 1G3BA 1MZDA 2FOMB 4Y8XA 2QGRA 1LVYA 3AVZA 1GI9B 1D4PB 4TWYA 1P03A 3RXLA 1QA0A 2BLWA 4K1SA 5AFYH 2FIRH 1GPZA 3GCTF 2ZU1A 1GBHA 3HGNA 3LJJA 1HDTH 1XX9A 5EW1H 1HJ9A 1O32A 1QIXB 2Z94A 1SGDE 3MO9A 3U8TH 3M35A 3W94A 2BD3A 1C2IA 3BTWE 3HGPA 3GYLB 2CHAC 4K1EA 1QURH 4BAKB 4CREA 5ETXA 2EEKA 1A2CH 2FOCA 1RD3B 1E37B 4JMYA 4NSVA 1TNJA 1T32A 1GL1A 2OC1A 1SQOA 2FO9A 3PLPA 1F2SE 3F9EA 3PROA 1C1MA 2J38A 1N1LA 1QQ4A 3SU1A 1EXFA 1SGCA 3RXFA 1XUFA 3E3TA 3MH4A 1TA6A 1CGJE 3E0NB 4HZHA 3RXIA 1CA0C 4X6NA 5LGOA 1P2OA 1RIWC 1PQ7A 4BOHA 3A8CA 1FXYA 5EGMA 3LIWA 4ZXXH 1A4WH 4NA9H 7GCHG 3QDZB 4D7GA 3VB6A 5FX6A 2WUCA 2FESH 3A80A 1JOUB 1KTTB 1M9UA 1OWDA 2GX4A 1C9PA 2HWLB 1CBWC 4CR9A 4X8TH 4AYYB 2FLRH 1UVUH 1BHXB 4JZIA 3SV6A 1LPGB 1L4DA 1DOJA 1EB1H 3KIDU 1HGTH 4FU9A 1DDJA 2OD3B 1RTLA 3K9XB 3ITIA 4Y10E 4AFUA 4B74A 3GDVA 1NTPA 3RC4A 2STBE 1QTFA 2W7UA 5HMAA 4K8YA 2ZU5A 1XUIA 2BD2A 2ANMH 1FJSA 3PB1E 2BDIA 1ZPCA 2AMPA 1UHBB 3EA8A 4DCDA 3BTQE 4ESTE 5L6NH 2Y7XA 2W3KA 4NZQA 1D3QB 1A5IA 5F6MA 1G2LA 3DHKH 3KGPA 1KXDA 3T25A 1TMTH 5DP7A 1AVXA 1DPOA 1QR3E 5JDUB 3QLPH 1YCPH 2A4OA 4MNXA 2PUXB 1ELDE 2THFB 5GDSH 4CRAA 1XXFA 4XDEA 3ZVAA 7GCHF 3AASA 1TB6H 3RXDA 2FX4A 3RXMA 2W26A 2G8TA 2J4IA 4IS5A 5C1YA 1K21H 3K6ZA 1C1SA 4CRCA 1WTGH 3ZVFA 1BA8B 2YNAA 2ZECA 3SJ9A 3VXFH 1OYQA 4GPGA 1XM1A 4OS6A 2XC0A 3C27B 1FN6A 2IPHA 2H5DA 1AGJA 4X0WU 1PPHE 3F1SB 1O2UA 2C90B 2R9PA 1C5LH 1B0FA 3ZZDA 1SGYE 2NU1E 4YT6H 1BIOA 2Y5GA 1GI0A 4OS7A 2OBOA 5FPYA 5K0HA 2OC7A 1AB9B 2AGIX 3ZZ6A 2A4GA 3T2NA 3UOUA 4KTSA 1F0UA 1YPKH 2KAIB 1L1JA 2AYWA 1NPMA 3A84A 3GOVB 4ABEA 1TOMH 3A7WA 1B5GH 3ZVCA 3RXKA 1V2PT 1AKSB 1HJ8A 2SGFE 3QGJA 3SUEA 1CSOE 1HV7A 2P3UB 4HFPB 1PQ8A 1O3FA 2ZFQH 3SQHE 3RU4D 2B5TB 3A7TA 3E6PH 1GDQA 1XKBC 4A92A 1GDNA 3HKIB 1C4V2 1C1PA 3SU5A 3SGAE 2CGAA 1C5QA 1O2MA 1ZHMA 4X2WA 3R3GB 1GJ6A 4BAMB 2TGAA 2Z7FE 1MTWA 3IITA 5SGAE 3O8CA 1L1NA 3RP2A 4TY7A 1ESTA 3E16B 1N8OC 2GD4B 2H9TH 3K6YA 3DD2H 2V0BA 4BXSA 4TPYA 3LOXA 1TNGA 2WPKS 1IQHA 4X1QU 1L1GA 1FLEE 1FIWA 2PFEA 2QIQA 1SBWA 2P3FH 3MH6A 1O2LA 2H6MA 2FPZA 2DUCA 3PO1C 4Y7BA 3CS7A 1LMWB 1ZLRA 1LVMA 2VIQA 1MTSA 1FDPA 1C5TA 1S82A 3A82A 4GSOA 3A7ZA 3SO3A 1XVMA 2AMQA 3ZZ4A 4FU7A 3MNBA 1C1VH 2O8UA 1UMAH 1TNLA 2ZA5A 1GMCG 1W8BH 2FM2A 2GKVE 1WUNH 3SI4H 1LKBA 2ZDMA 1UTMA 4ABDA 1BMNH 4KELA 3SV7A 5L2YH 2CJIA 5TJXA 2OTVA 2PWXA 1J16A 1PPGE 2LPRA 4Y0YE 3DT0H 4Q2KA 1SQAA 4AFZA 2UWPA 4SGBE 3KQDA 3DA9B 1S83A 3M5MA