4AFUA

Human chymase - fynomer complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
226
structure length
221
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 51
structure length 221
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4afuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4afuA02
4U32A 1G36A 4I31A 5AVDA 1FI8A 4BAOB 3P70B 4VGCC 3RDZA 4CRAA 1P01A 1ZHPA 4K5ZA 1Y3YA 2VVUA 3QK1A 1GI9B 2PSXA 1GMHF 2ZPQA 2V3OH 1DUAA 2BDBA 1AFQC 1F92A 1G32B 1V2NT 2WPKS 4UEHH 3RXKA 5T6FA 4Q7YA 2H5CA 1XUHA 1VCQA 1P10A 1YPKH 4LZ1H 1SPJA 3BTME 1SGFG 3ODFA 3ZYEA 2CJIA 1HBTH 1LHDH 1Z71A 2A4RA 4Y0YE 1LPKB 1HCGA 1WU1A 2EI7A 4X2VA 1ZHRA 2VWMA 3NK8A 3A8AA 3EDXB 1XUJA 1OWEA 2QAAA 2A2XH 1GDQA 4ZH8A 1S83A 1O2QA 4TWWA 1FY4A 1MKWK 1TQ7B 4GHQA 4I7YH 2ZU5A 3ZZCA 2Z3CA 5CHAC 4AOQA 1C2LA 8LPRA 5T6DA 4DIHH 1G3CA 3P8OA 1BTPA 5DGJA 2QCYA 3D65E 2ZZUH 4J1YA 1YGCH 1D3PB 2JH5D 4BTIB 1ZPCA 1ACBE 3RXLA 3E16B 1GCDA 5EXLA 3KQCA 1PPHE 1DX5M 1TNHA 1AO5A 2J2UA 1DLEA 2QYIA 1OWHA 5JB9S 1DWBH 4MTBA 3MNBA 3Q3YA 2BX4A 1XM1A 1FY3A 4UFEH 1XUGA 3ZVBA 1NFUA 2CN0H 1ZHMA 4Q7XA 1A5GH 2FLBH 2PKSC 3RLYH 2AGIX 4IMZA 3UWIA 2BTCE 3M37A 4E05H 1CGJE 3AAUA 1Q2WA 3GCOA 1HUTH 2A7JA 3LJJA 3RXPA 3M61U 1NRQH 1C1WH 5DG6A 4XFQA 1MTWA 5E0GA 4AORA 1O2GH 3EYDA 3ZVFA 1O32A 3SJKA 3QDZB 3FVFB 1BTHH 3FZZA 1PYTD 1EJMA 1O3BA 4X2XA 4GUXA 2ESTE 3RC4A 5LPFA 4ISLA 3V3MA 3BF6H 1J9CH 3LGWA 4CRDA 1GMCG 1A0HB 1AKSA 2K1QA 4DURA 3Q77A 1GBEA 1TB6H 2D2DA 3SI4H 8ESTE 1DSUA 4TYDA 2Y5GA 1C2EA 1PFXC 1ZRBA 3T2NA 1N6XA 4TWYA 2FI5E 2QN5T 1GJ6A 2ZWLH 5GCHF 1E36B 1JIRA 3S7KB 3EA8A 2BLWA 4FUHA 3FP7E 2ZCKP 2FOFA 3DFLA 3CS0A 2DE8A 4OS4A 1GHAF 4BAHB 1UTOA 2FM2A 2NU0E 3PM3A 3A8BA 4JYVH 1MKXH 1HJAB 3T29A 2GMTB 3A87A 5FPSA 2BLVA 1UVOA 2GX4A 3OSYA 1ELDE 1GBHA 4B75A 1ETTH 2TRMA 2BB4A 2G8TA 1T8OA 5A09A 2VGCC 1KXCA 3VPKA 2QA9E 1GI2A 1P9SA 3SBKA 1O2WA 4A7IB 1Y5BT 2HPQH 3LC5A 4DJZB 2GVFA 2EI8A 4H4FA 1LVYA 1BMNH 2VIQA 2UUJB 2Y5FA 2BXUH 3ENSB 1C1MA 2H5DA 1THRH 1H9IE 1SOTA 3JZ2B 4FUGA 4ABJA 1EZQA 1Y3VA 1W10U 4CR9A 4ZKRU 4JYUH 1H9HE 1UCYE 4YM9A 1UVUH 3U69H 1O3OA 3CP7A 1DXPA 3MWIU 5EXMA 1VCPA 1GHZA 1EZUC 1FMGA 1YYY1 3IWMA 1P2JA 4KGAA 1CA8B 1T4VH 1MKXK 1Z8GA 4NFFA 1N1LA 3VGCC 1IQHA 2GTBA 4FUFA 4ZKNU 1A5IA 4WJG2 4DY7B 2G51A 3S9BA 3E0NB 5EOKA 4XDEA 3FANA 2G5NA 1QIXB 4R0IA 1Z1IA 1AZZA 4NZQA 1C5OH 2PGQB 2WPMS 1SR5C 1MQ5A 1P09A 4XBCA 2XBVA 2FOCA 5T3HA 1DSTA 1JBUH 1D3TB 1ZTJA 1ANDA 2VIDA 3KN2A 2ODQA 3HPTB 1CGHA 2GCHG 5C5NA 3UNSA 4ZMAH 1MTVA 2IPHA 4U2WA 4DG4A 1GI1A 4KELA 5I46H 1P57B 1EOLA 1FQ3A 1ZR0A 1HAOH 2WPJS 1FUJA 3BG4B 1IHSH 1XVOA 4BAMB 1FZZA 1O0DH 1GMDF 4JYTA 4A92A 4ZAEA 2ODPA 1ZZZA 3F1SB 1K1NA 5A8YA 1EAUA 1LVBA 1TPAE 1KLJH 3UWJH 3MU4A 3F6UH 5AHGH 5C67A 1O2YA 1V2JT 3T27A 2XNIA 3SO3A 2ZGBH 3BTKE 7GCHF 1C1QA 3MU5A 4JCNA 2FOBA 1XX9A 1C2FA 4KTSA 1UTPA 2XWBI 1YCPM 1D9IA 1V2WT 1ESTA 1O2MA 1S85A 1BRUP 4IMQA 1IQJA 1BB0B 2GP9B 4DCDA 5IYTA 1LKBA 1DDJA 1SLUB 1XUIA 4GCHG 3RU4T 1BOQA 1U6QA 1UK2A 1FDPA 1CSOE 1LVMA 2BDAA 3F9GA 1P2IA 3E91A 1GGDB 2F9OA 3O8DA 1HJ9A 1NFXA 5EODA 3GISB 4IC5A 4Y6DA 1HV7A 1EQ9A 1G2MA 2M5TA 2UUKB 2WYGA 1BHXF 4Y71A 3IITA 3LIWA 3BEIB 3F9FA 1NO9H 3PMAB 5FPTA 4GAWA 3A7TA 2P3FH 1TOMH 2V0BA 2F9PA 3SUEA 1YPHC 2R0KA 1F0TA 2GD4B 1SGQE 1NRNH 1YKTA 2Z9GA 4WXIA 5I25A 2BD3A 5JB8S 1HAZB 2A5AA 2ZA5A 4JZFH 1HB0B 2A5KA 2O8WA 3ELAH 1P12E 3QO6A 1OP2A 1XXDA 2YNBA 2VIWA 3SU2A 1YPEH 2PWXA 2Z3DA 3MU0A 3LGTA 2GV6A 1UTMA 1ELAA 4I8HA 5FBIA 4E06H 1ZSKA 5HM9A 1ZOMA 2V6NA 1GJAB 4LOYH 4MNXA 1IQNA 2G55A 4NG9H 1C1UH 4INKA 1N8OB 3T26A 2ASUB 1MTNB 1IOEA 4Q2KA 3A7YA 3TITA 4X6OA 4CBNA 3LOXA 3TJUA 1ELEE 1QNJA 1V2OT 1GG6C 2QXIA 3MI4A 1AFEH 1GWAA 5T6GA 4I8JA 1G30B 3RM0H 2O8UA 2OD3B 4GVUA 1IAUA 1HAVA 4A1VA 1L1JA 1VITH 1A3EH 3W95A 4VGCB 1LMWB 1L4ZA 3RC6A 3BTEE 5GXPA 1TPPA 2SGDE 4A1TA 1AFQB 1S0RA 2BY8X 4MLFB 3ZZBA 1X7AC 5DP5A 3SUDA 1JRTA 4YLUA 5ESTE 1QRWA 3AASA 4B74A 1CHOG 3UR9A 3A81A 2P94A 1JMOH 1GBCA 3GY2A 1EJNA 2ILNA 2Q1JA 2ZHEH 1S0QA 5CHAB 1A0JA 4MNWA 2ZTYA 3SQEE 3U9AH 1GJ7B 1TFXA 2OBQA 4Y8ZA 2KAIB 2VNTA 1O5GH 2FWWA 1V6DA 5AF9H 2F9BH 1O37A 2B9LA 1O31A 3BN9A 1ZJKA 2J94A 2J92A 1GCTC 1TLDA 2ZC9H 4Y11E 3UFAA 3ZZ3A 4AYYB 1EB1H 1F2SE 1DANH 2CF9H 3SU5A 4Q7ZA 3OU0A 2C93B 4UONA 3RXJA 3L3TA 1C2IA 2Y80A 4K69A 1TX8A 3SNAA 1NFWA 4UDWH 1AI8H 4ABEA 1TBQH 1CO7E 3MNSA 1GDUA 1E38B 2PKSB 2ZQ2A 1MU8B 2P3TB 4U01A 1V2LT 1DWEH 2BD8A 3RXVA 3OY6U 2C8XB 4YT6H 4AB9A 4CBOA 1NESE 1HXFH 4OS7A 4NIWA 2W7SA 1EPTC 4DOQA 1P2MA 4NCYA 2TGTA 2FP7B 1GHBF 1GJ9B 1TBRH 1O2IA 3UQOA 1IQFA 3RMNH 3RXSA 1DWCH 4F49A 3MH7A 3DD2H 5JBCS 1B5GH 3BTGE 2O8LA 2FYRA 4OS5A 2RA0A 5E8EH 4E7RG 1SGIB 2PHBA 1FONA 1V2UT 1TA6A 8KME2 2BDYA 3UIRA 1J8AA 1ANEA 1GBDA 2OQUA 3GDSA 3QWCH 3BV9B 3CS7A 3QTVH 3UOPA 2GGVB 1GI5A 3SUFA 4YTAA 1DT2A 2ZHFH 3SGAE 4NWLA 3VB5A 4FU9A 1O3CA 1Y5UT 5FX5A 2FX6A 3MFJA 1QQ4A 5EPYA 1PJPA 4WXVA 2CHAC 2BQWB 3TVJB 4B1TA 2ZI2H 2F3CE 2Y5HA 5J4SA 3DT0H 3ODDA 1LHFH 3DA9B 2Z9LA 4AFSA 2A31A 1CGIE 4A5TS 1F5RA 5TCAA 1W8BH 1TYNA 5SGAE 1OXGA 4A1XA 2ZHWH 1AVGH 1SI5H 3AAVA 4I8KA 3STIA 3VB7A 1ESBA 4OS6A 2PV9B 2R0LA 2J4IA 2SGPE 3FAOA 5BRRE 3A7XA 2JH0D 2ZDVH 1AKSB 1O5BB 1K21H 1OX1A 1K1LA 2KAIA 1VJAU 2W3KA 1SGYE 2EC9H 2RCEA 3BTTE 1MAYA 3GCTF 1C5LH 4NA9H 3NXPA 4D7FA 2QV1A 4INHA 1CHGA 1MCTA 5PTPA 3QUMP 2QGRA 2Z9IA 4RN6A 3BSQA 3GYLB 3RXOA 1C2GA 1OYQA 3EA9A 3GY6A 1G3EA 2P8OB 1GBIA 3VB3A 1T8MA 1NRPH 4Y0ZE 4ABAA 3SHCH 3SV8A 2ZDAH 1FY5A 1ANCA 1O3GA 2YNAA 3Q76A 4BNRA 2Z9KA 3A84A 3HGNA 3LC3A 2Z9JA 1QJ6B 1P2KA 3KGPA 4X1RU 3UTUH 3SHAH 4DW2U 1TNLA 5FHTA 8GCHG 1QB6A 4X6NA 1P3EA 3KCGH 4YOGA 1AUTC 1XUKA 1P06A 2OXSA 2GKVE 2VIPA 3FP8E 4H6SB 4LZ4B 1P9UA 3R0FA 1ELFA 1GJ5H 1C1SA 2A7HA 2D1JA 4ISHH 4AB8A 1ESAA 1W2KH 4E7NA 3T25A 3BTWE 4JZ1A 1P2OA 1ARCA 1ABJH 1RXPA 1PQ8A 3P8GA 1N6YA 3SJIA 3P8FA 2Z7FE 1K22H 2WINI 1H4WA 1QHRB 4ABHA 1TGSZ 1C1TA 1GJ4H 2AIQA 2SGAA 4TY7A 1C5SA 5EG4A 1VGCC 3TK5A 4GPGA 1AB9B 3FP6E 1UTJA 2ZEBA 3TK6A 2CV3A 3UUZA 1L1NA 6CHAC 3LPRA 3RMOH 4YZUA 1HRTH 2BLOA 5JBAS 3O8CA 1V2RT 1KYNA 4CH2B 3GY5A 1FN6A 1O3NA 2SFAA 1O5AB 1NM6A 1TPSA 2ZPSA 1K1MA 1AVWA 2Q6GA 1TALA 1SQAA 3OY5U 1LO6A 1A1RA 5F6MA 2FOAA 2RDLA 3DUXH 2OTVA 3F9HA 4AX9H 4B2BA 3TGKE 4IS5A 1DFPA 1EOJA 1HFDA 2VWLA 2XC4A 3LH1A 2FIRH 1SGRE 4NWKA 1GI6A 5DO4H 1RIWB 3E3TA 3K65B 1DY9A 4X1SU 1MZDA 2ZCHP 3PMHB 4CREA 3EGKH 4JK5A 1DM4B 4HFPB 1LHEH 2FZZA 5ABWA 1O2PA 2D8WA 1HAGE 1WV7H 3TLOA 1SGEE 1OYTH 1SGNE 1GBKA 1THSH 1W0ZU 1KLTA 3V13A 3GY3A 1OWJA 4AFZA 4ZKSU 3PMBB 2GT8A 1FJSA 1KXAA 1HAPH 1TX6A 4AGJA 2FX4A 1JWTA 3TJOA 5EPNA 2WPHS 2FODA 5J4QA 4DGJA 1INCA 2Y82A 4TPIZ 5CMXH 1BRBE 3AVZA 1MMJN 1O2JA 3SNBA 2ZF0H 1NRRH 1BA8B 3B9FH 1AN1E 1VITF 3RXGA 1D3QB 3AW0A 2QXHA 4H6TA 1EASA 3DFJA 1NZQH 4ESTE 1C5RA 2JH6D 2C90B 5DP6A 1V2MT 1GL0E 2VU8E 1FAXA 1KXDA 1DICA 2A4OA 2HNTC 5HYOA 1PPGE 1NTPA 4UD9H 1SGCA 5C2ZA 2AYWA 1QA7A 4J2YB 2AIPA 2FXRA 2ZGCA 2ZNKH 3LKWA 5DPAA 4XBBA 2NU4E 2FS8A 3HKJB 1KTTB 4ZXYH 2D26C 1BBRH 1LQDB 5DP8A 1GJCB 2XCFA 4B76A 1QBVH 2ZQ1A 1P04A 3OYPA 1BTYA 1OP8A 2Q6FA 4YO9A 5DP3A 3TGJE 3SU3A 3K9XB 3V7TA 2A2QH 2QXJA 3NWUA 2JETC 5GIBA 2OQ5A 5FCKA 1AQ7A 2A4QA 3M5OA 1P02A 4CRGA 1MTSA 1SGPE 2SGFE 1BJUA 1TMUH 1FY8E 3MH6A 4X1NU 1QL7A 3ATWA 4ZXXH 3U1IB 3ZV8A 1YPHE 2PUQH 3C27B 1UTQA 2GT7A 3RLWH 2SNWA 1C2JA 2OC1A 1F0SA 2A4GA 3M5NA 5JBBS 3UY9A 1V2TT 3SN8A 1C4V2 2QIQA 3D23A 4FUDA 2ZFFH 1RS0A 3LGYA 3KQBA 3SQHE 5K7RA 1LDTT 1IQMA 1VR1H 3MH5A 1YCPH 3D62A 3TPIZ 1BHXB 3T5FH 1L2EA 3RUOA 1O30A 5L30H 1CVWH 4THNH 1BBRK 4X2WA 3Q00A 3LJOA 1CU1A 1GMHG 5LPEA 1WAYB 1O5EH 1UTKA 3QTOH 4F4OC 1K9OE 1WTGH 3E1XB 1KDQA 1NT1A 4TPYA 2BZAA 4BANB 1HAVB 1ZPBA 2ZFTA 4FUEA 1KXEA 1EAXA 1LCYA 3MMGA 2ANMH 1MTUA 4IGDA 3P95A 1P0SH 4B73A 1EB2A 1BRAA 1SQOA 2AS9A 5E2OA 1THPB 1PPFE 1PPBH 3RXCA 1NRSH 2QF0A 4YOIA 1O2RA 2XRCA 2BYAX 2FOEA 2H9TH 4BAKB 1FLEE 3RXMA 1SQTA 4GHTA 1SLXB 1C2KA 1P2NA 1SC8U 3OTJE 1ZGIA 3UPEA 2A5IA 1GHWH 4NSYA 3VXFH 3W94A 4B2CA 2AGGX 1D4PB 1CBWB 1YCPK 4OS2A 4CHAC 3QZRA 3TIUA 1EPTB 3BG8A 3FZDA 1JOUB 2HLCA 4X1QU 3WY8A 5FAHA 1KXBA 3ATIA 1XMNB 1W0YH 2GZ9A 1P05A 1XUFA 3HATH 1DS2E 2FDAA 4NZLA 1K28D 6GCHF 1F7ZA 3SW2B 2BQ6B 2NU1E 3SUGA 4YLQH 1K1OA 2W5EA 1K2I1 4FU7A 4K60A 2WUBA 4B71A 1Y3XA 4ZUHA 3BTFE 5DP4A 4ABIA 2QC2A 4NGAH 2STAE 1C5UA 3PLPA 5LPRA 2BVXH 3GCNA 1HIAA 1BTWA 3MNCA 4IN1A 3TU7H 1TONA 2CF8H 3A8CA 1QL8A 4LK4A 4DT7B 1O38A 3M5LA 2SGEE 4Y7AA 5F8XA 1UVTH 3TNTA 3M36A 4OGXA 1ELBA 2CHAB 1TIOA 2ZDLA 3ZZ4A 3I77A 1V2QT 1FN8A 3GCHC 3MOCA 2PSYA 2XW9A 1O2XA 1BT7A 1C2HA 1V2KT 3ZYDA 3LU9B 1C2DA 1EUFA 2R3YA 3ZVGA 2CXVA 1FXYA 4DIIH 1J14A 2PR3A 3MH4A 5GJ4B 1O3KA 4FVBA 3TGIE 1V3XA 1EZXC 1GL1A 3GDVA 1NPMA 1A61H 3SZNA 1W3CA 1HJAC 4X8VH 1GJDB 5GCHG 1RTLA 2Y7XA 1O3LA 2BY7X 2GMTC 1C5PA 1GBLA 4FUJA 1QGFA 2IJOB 1E35B 1RTKA 3STJA 4HTCH 4B2AA 2ZFQH 3MHWU 1IQLA 3GICB 1GHAG 5AFYH 1ANBA 1GI0A 4Q80A 2TGDA 3U8OH 4HI3A 1LPZB 4FXGH 5JYIA 2QXGA 1W7GH 1L1GA 1SOZA 1PQ7A 2R2WU 1TGBA 2UWPA 1MH0A 1GBBA 4CH8B 2P95A 2ZECA 3P6ZB 4IC6A 1DUEA 2R3UA 3TJVA 3SOSA 1YPLH 3IG6B 2O8MA 1C4Y2 3V0XA 1Z6JH 2UUYA 1ZSLA 1C9TA 5EU8A 2V3HH 4XSKU 4NA7A 1K1PA 3D49H 2ANYA 1O2TA 1H8IH 1V2VT 2A1DB 3MO6A 2H9HA 3UOUA 2J38A 1C2MA 3UREA 1EATA 4XE4A 5JBTA 1TGCA 1RTFB 1EPTA 1BZXE 2ANWA 3O8RA 1PYTC 2XBXA 5A8XA 3A80A 3A86A 6ESTA 1YPGH 1KLIH 2Y6TA 4D9RA 3RXRA 1YPMH 3CENA 3DHKH 3O8BA 4MPWA 1GHXH 3L33A 4I32A 1SFQB 4O97A 1P03A 3SV6A 1O5FH 1W13U 2Y81A 1Z6EA 4INLA 4AG1A 3RXIA 4NA8A 2C4FH 1GHVH 2F83A 3A7ZA 3BTHE 3UNRA 3A82A 1ELTA 6CHAB 1FNIA 5BPEA 4AZ2B 2GZ8A 1F5LA 2BDGA 4NIXA 1TGTA 5TJXA 1EXFA 4YOJA 2BM2A 2XCNA 3ATLA 4MNYA 1C5XB 2ZHDA 1QFKH 3NKKA 3VB4A 4X1PU 1O3HA 1OWKA 2R2MB 4FVDA 3LH3A 4BTTB 2BLQA 1O3MA 1KY9A 3KQDA 2BVSH 1OSSA 1C1RA 4X8SH 4FUIA 1TX7A 1YF4A 3RU4E 2BDCA 3SJ8A 3MO3A 1WQVH 3VB6A 1GMCF 5GDSH 1Y59T 1ELCA 3HK3B 3PO1C 1HAXB 2ZTZA 1BBRE 5EW2H 2VH6A 3ZV9A 2ZP0H 1AHTH 4OS1A 1SG8B 1GMDG 2PW8H 2LNCA 1SGTA 4O3UA 2XC5A 4WVPE 1EZSC 4XOJA 2DE9A 2OINA 3LT3A 2A32A 1QTFA 2ZPRA 3ZZDA 4GLYA 1MBQA 5JDUB 2FS9A 1HAYB 1F0UA 4RSPA 1KXFA 2BXTH 2F9UA 2PLXA 3ZZ6A 3RXAA 1O33A 2BX3A 1NY22 2HOBA 2B0FA 4MPXA 3KNXA 7GCHG 1C5QA 2BD9A 1NC6A 2AMQA 4UFDH 1DLKB 1LPGB 1C5MD 3M3VA 1GGDC 1NU7B 4CRBA 3EAJA 3HK6B 1QB1A 1DY8A 2IOTA 1E0FD 3A88A 3G01A 2XTTB 1TWXB 1V2PT 1K1JA 3ZZ7A 3ESTA 4Y10E 1MD8A 4NSVA 1O3EA 9ESTA 2OBOA 1C5NH 1WYKA 1RFNA 3FFGA 4NIVA 4O9VA 4R8TB 1BITA 2ZFPH 4AYVB 1YC0A 4UFFH 2FO9A 2VGCB 3ZZ9A 1LVOA 1QURH 1H8DH 3SU4A 4X6PA 1S6FA 1BUIA 1WSSH 3KL6A 4FU8A 4X6MA 3LGIA 6LPRA 3TNSA 1P11E 2ZGJA 1C5VA 2IN2A 3PTBA 1GVZA 1P8VC 5EGMA 3NCLA 2H6MA 4CR5A 1BJVA 3MNXA 3SJOA 1IQIA 3P8NA 3M3TA 3ZVEA 4WMEA 3RM2H 1UTLM 1O3FA 1UTNA 3QGJA 1D6RA 5A0BA 4IW4E 3HKIB 1A5HA 1BTZA 1Z8IB 3RXFA 3SJ9A 4Z6AH 2FEQH 1S84A 2I6QA 5EW1H 1H9LB 1WBGB 1AE8H 1FPHH 1SVPA 3T62A 2FTLE 5LGOA 2PUXB 3RXBA 3A7WA 1Z8JB 2ZDMA 3BEFB 1KIGH 2XWAA 3MTYA 1YPJH 1DPOA 3RC5A 2H9EH 2HPPH 3GY8A 3PV4A 3VGCB 1A0LA 2A7CA 3KF2A 1TABE 3RXTA 2OC7A 1EAIA 2GCHF 4WY3A 2ZCLP 3S9CA 1YP9A 2Y7ZA 4ABGA 5EQQA 5EQSA 4XBDA 2HNTE 1BRCE 4AGKA 3C1KA 2GCTC 5ETXA 3TH4H 4ZHMU 1QB9A 3KHVA 3T28A 3BIVH 5GPIB 1GJ8B 2BY9X 1SHHB 3SV7A 4FUCA 1TPOA 1UJ1A 1VJ9U 1LTOA 4NIYA 1ZMLA 1TA2A 1O5CB 2HNTF 2NU3E 1ZRKA 4IBLH 1C4U2 2B5TB 1GBMA 1S6HA 3UQVA 1FIWA 2W3IA 1GI7B 2VJ1A 2RG3A 4ASHA 4PROA 4ZHAA 4FUBA 3SNDA 3TH2H 1LKAA 1AY6H 4D76A 1B0EA 2TGAA 3PMJA 1O2KA 1AUJA 2SNVA 3GYMA 1GVLA 1WOFA 2C8YB 2G4UA 3ATMA 1TNIA 3M7UA 4MVNA 4D7GA 3E6PH 4O3TA 5E2PA 2P59A 2ZG0H 2ULLA 2ODYB 3MU8A 1EP5A 1UVPA 5L2ZH 1ZLRA 4GCHF 5DP7A 3RXHA 1O3JA 5HXFA 4CHAB 1IQGA 2FI4E 3B8JA 2BHGA 1C1PA 1FY1A 4CRFA 1D3DB 2GV7A 1Y3WA 1UK4A 4MPVA 5F8ZA 1QA0A 2FTMA 3K6YA 5DJ7A 1MQ6A 2VINA 1AD8H 1AE5A 1O2SA 4YESB 3KQEA 1KDQB 2BOHB 3M3SA 2BOKA 5FCRA 1HLTH 3RXDA 4ISNA 3QN7A 5IDKA 2P16A 2FOGA 1TNJA 1A4WH 1MD7A 3SI3H 2XC0A 4GSOA 2ZTXA 3ZVDA 4Y79A 1ID5H 2TIOA 3PB1E 3SGBE 1ABIH 2OC8A 4DVAU 3LGVA 2G5VA 2W7UA 1CA0C 4TY6A 1W14U 4K2YA 3PLKA 4ABDA 3U8TH 3P17H 3E0PB 3H5CB 1GJBB 2HWLB 5E0HA 3SNCA 3RMLH 2ZKSA 1B7XB 1AWHB 1GHBG 2GDEH 1Z8RA 4WF8A 1TRNA 2CMYA 2LPRA 3MO9A 2FESH 1S81A 2BMGB 3GCHB 2GDDA 4OGYA 3EE0B 2PTNA 4ISIH 1WCZA 1A2CH 1AIXH 4JZEH 1PPEE 2J9NA 3K6ZA 5GWZA 1K1IA 1TMTH 3ITIA 3B23B 4AFQA 1T8LA 1OP0A 3BTDE 4KTUA 1RGQA 3S0NA 3SV9A 1Z7KA 1RRKA 3HGPA 5HM2A 1MZAA 4D9QA 2ZFSA 4ZKOU 2UWLA 3ZVCA 2ANKH 1GG6B 4UFGH 1HIAB 3GY4A 1C5WB 1P2QA 1HAHH 1GVKB 2THFB 2ZIQH 2B8OH 3E90B 3AW1A 2BY6X 1QBOA 3M7TA 4ZROA 3BEUA 2VWNA 3SORA 1OWIA 4X8TH 3VXEH 5F8TA 1CHOF 3A83A 2A45B 1TRYA 1ZMJA 3SU6A 1O2UA 2FOHA 1C5TA 5AFZH 2PFEA 3QGNB 4WMDA 1O3AA 1ZSJA 2P93A 2C3SA 1IQKA 4BAQB 3A7VA 1IQEA 1ZGVA 2WUCA 3TH3H 1DVAH 1YBWA 4QT8C 3ZZAA 3MYWA 1QY6A 3R3GB 4HZHA 1QBNA 1GHYH 2BD5A 2P8OC 3K2UA 3PROA 1YLDA 2FOMB 3SU1A 4U30A 4Y8YA 3GCTG 1WUNH 1SFIA 2G4TA 4MDSA 1G9IE 3SV2H 1M9UA 1ORFA 1ETRH 2ZHQH 3RXQA 1T7CA 1SLWB 3PTNA 1O2HA 3UR6A 1QR3E 2TPIZ 2B7DH 2BD7A 5F03A 1UVSH 3EA7A 3ZZ5A 2BDIA 5LH8A 2AGEX 3RP2A 1GCTB 4KKDA 1ZMNA 1SSXA 1FAKH 2WV5A 3PWCA 1O3DA 1AGJA 1BMLA 3N7OA 1ELGA 3A89A 1XVMA 2AH4X 1MAXA 2AMPA 1H1BA 1KSNA 4Y76A 1Z1JA 1MCVA 1ZTKA 2BQ7B 2VWOA 2XBYA 2C8ZB 1C1VH 3A8DA 7LPRA 1O36A 1CQQA 1C5ZB 1BQYA 3QLPH 2PKAB 1B0FA 3RXEA 5K0HA 3QX5H 3A85A 1AB9C 4BTUB 2HVXA 5FXLA 3PLBA 2OUAA 1NN6A 4ABBA 1SL3A 1UHBB 2AERH 1SGDE 2GZ7A 1S82A 1Q31A 1QRZA 3Q3XA 1DE7H 1TGNA 2G52A 5H4IB 2JKHA 2P3UB 1T32A 4ISOA 2I6SA 3PO1B 1ZJDA 2WYJA 5C1UA 1CT4E 1DITH 3MU1A 2QY0B 2W26A 5ESBA 1PPCE 1O35A 2VIVA 1TNKA 3RU4D 1TAWA 4SGAE 1ZTLA 7KMEH 2F9NA 1J15A 1RIWC 2ZFRH 3U98H 1HJ8A 5TCCA 1GBTA 1L4DA 5L2YH 1WQSA 1AWFH 5FX6A 3P92A 1TBZH 1EP6A 1BCUH 4K8YA 1GBFA 1A46H 3LGUA 4K3JA 3EQ0H 1NFYA 1O2LA 1EAWA 1T4UH 5DP9A 2DUCA 1FPCH 3I29A 3JZ1B 3SU0A 3U1JB 1G3DA 3LONA 5L6NH 1O3IA 1SHYA 5C1YA 2ZDKA 1YM0A 3RMMH 5A0AE 4UE7H 1HGTH 2ALPA 5A0CA 2BY5X 5C20A 5A2MH 4BXSA 2AMDA 1BMAA 4X0WU 1HAIH 1J16A 3L6PA 4KTCA 1HDTH 3M35A 4RKJB 3RXUA 5HMAA 2OC0A 4KP0A 1NROH 1P3CA 2O8TA 2WPLS 3URCA 1XKAC 4IN2A 1GBJA 1XXFA 2H1UA 1NS3A 4JZIA 3URDA 1TQ0B 1QCPA 2J95A 1OOKB 1DOJA 2ZU3A 2WV4A 1PQAA 1TRMA 5FPYA 1VITG 4MPUA 1OWDA 4AN7A 4MNVA 3BTQE 1GI4A 1JRSA 1O5DH 3PWBA 2XBWA 1MU6B 2AFQB 1QRXA 2VVVA 5A8ZA 2NWNA 2ZU1A 8GCHF 4D8NA 1LHGH 4JMYA 2Q6DA 4AFUA 1O34A 1QL9A 2EEKA 4ABFA 1SMFE 1TE0A 3LDXH 1HNEE 1O2NA 4WWYA 3M5MA 4MQAA 1BDAA 2PKAA 2OLGA 1HPGA 2TGPZ 1AMHA 3ZZ8A 2HRVA 1XKBC 2OP9A 2VIOA 1TOCB 2Z3EA 1AZ8A 3ATKA 2HGTH 2VB0A 5DK1A 1UHBA 3OX7U 5CE1A 2ZGXH 1CE5A 1O2VA 4AG2A 2EI6A 4MG3A 3S69A 1W7XH 3VEQB 2GCTB 2BD2A 5JPMH 1O3PB 4Y8XA 1SGFA 4M7GA 1UK3A 2STBE 1T31A 2QF3A 3TJNA 2O9QA 2VVCA 2WPIS 1L0ZA 1Y3UA 5C3NA 3I78A 2CGAA 1ZYOA 3V12A 5HGGA 1GDNA 1SLVB 1NU9A 2FPZA 3H7OA 1VCWA 1VZQH 5G4BA 2FI3E 2SGQE 5E0JA 1VGCB 4A6LA 1QQUA 3GDUA 1UMAH 1A7SA 1C1NA 2XYAA 1CT0E 2YOLA 2J34A 4O03A 9LPRA 4BXWA 1WTHD 1PPZA 5C1XA 1EJAA 4WH8A 2C8WB 2ZO3H 2Z94A 4HGCA 2PTCE 1GPZA 1MUEB 3S7HB 2G00A 5EQRA 3BG4C 4SGBE 4K1TA 2NU2E 1BMMH 4YT7H 4CRCA 1FV9A 1HYLA 1LHCH 2XXLA 1S5SA 1BTXA 1E37B 3SNEA 2VH0A 4ZHLU 1O2OA 1J17T 1UCYH 1DXWA 1GBAA 5B6OA 2FMJA 2R9PA 4Z0KA 1SB1H 1AU8A 2A0QB 1CT2E 1ELVA 1EKBB 3NUMA 4K1SA 1FIZA 2EA3A 3VFEA 1A3BH 1MBMA 2BZ6H 1GI3A 1TNGA 4Y7BA 1GI8B 3GOVB 3ZVAA 2BD4A 2V35A 1CBWC 3F9EA 4BOHA 4I33A 1W11U 4I8GA 5DKMA 1G37A 1HXEH 1UO6A 1C5YB 1Y5AT 2FLRH 3TK9A 4WMFA 1O2ZA 1ARBA 3Q3KA 1V2ST 2RA3A 1BTUA 1CA0B 4K8BA 4WH6A 5EXNA 1EX3A 1RD3B 4JK6A 1KTSB 1LQEA 1ETSH 5FBEA 1JXPA 1Q3XA 2UWOA 2Z6BD 2UUFB 3KIDU 1G2LA 1OPHB 2PGBB 1AVXA 1UCYK 1IHTH 3S9AA 6GCHG 1OS8A 2BVRH 1C9PA 2FYQA 4JZDH 2F9VA 3KEEA 2AEIH 1F5KU 1E34B 5C5OA 3H7TA 1F0RA 2BDHA 7ESTE 2H2ZA 2OCVB 1DWDH 1TMBH 2F91A 2ZU4A 3NPSA 2ZU2A 4NFEA 1RJXB 1T8NA 3SGQE 2TBSA 1Y8TA 4I8LA 1YLCA 1D6WA 3UNQA 3E8LA 4RKOB 1N8OC 1PQ5A 3GY7A 1MTNC 3M7QA 1MKWH 4K1EA 1JIMA 3NZIA 4X2YA 3BIUH 2G81E 1C1OA 2JETB 2ALVA 2ZDNA 1OKXA 1W12U 3U8RH 1O39A 2HALA 3F68H 4H42U 3QZQA 1ZPZA 1QJ7B 1SBWA 2ZGHA 4X8UH 1BIOA 4LXBH 3PYHA 1QJ1B 1G3BA
chains in the Genus database with same CATH superfamily
4U32A 1G36A 4I31A 5AVDA 1FI8A 2K0QA 4BAOB 3P70B 4VGCC 3RDZA 4CRAA 1P01A 1ZHPA 4K5ZA 1Y3YA 2VVUA 3QK1A 1GI9B 2PSXA 1GMHF 2ZPQA 2V3OH 1DUAA 2BDBA 1AFQC 1F92A 1G32B 1V2NT 2JJ1D 2WPKS 4UEHH 5T6FA 4Q7YA 3RXKA 2H5CA 1XUHA 1VCQA 1P10A 1YPKH 4LZ1H 1SPJA 3BTME 1SGFG 3ODFA 3ZYEA 2CJIA 1HBTH 1LHDH 1Z71A 2A4RA 4Y0YE 1LPKB 1HCGA 2J5UA 1WU1A 2EI7A 4TT3D 4X2VA 1ZHRA 2VWMA 3NK8A 3A8AA 3EDXB 1XUJA 1OWEA 2QAAA 2A2XH 1GDQA 4ZH8A 1S83A 1O2QA 4TWWA 1FY4A 1MKWK 1TQ7B 4GHQA 4I7YH 2ZU5A 3ZZCA 2Z3CA 5CHAC 4FETA 4AOQA 1C2LA 8LPRA 5T6DA 4DIHH 1G3CA 3P8OA 1BTPA 5DGJA 2QCYA 3D65E 2ZZUH 4J1YA 2YMSD 1YGCH 1D3PB 2JH5D 4BTIB 1ZPCA 1ACBE 3RXLA 4ACBA 3E16B 1GCDA 5EXLA 3KQCA 1PPHE 1DX5M 1TNHA 1AO5A 2J2UA 1DLEA 2QYIA 1OWHA 5JB9S 1DWBH 4MTBA 3MNBA 3Q3YA 2BX4A 1XM1A 1FY3A 4UFEH 1XUGA 3ZVBA 1NFUA 2CN0H 1ZHMA 4Q7XA 1A5GH 2FLBH 2PKSC 3RLYH 2AGIX 4IMZA 3UWIA 2BTCE 3M37A 4E05H 1CGJE 3AAUA 1Q2WA 3GCOA 1HUTH 2A7JA 3LJJA 3RXPA 3M61U 5EJLA 1NRQH 1C1WH 5DG6A 1YWUA 4XFQA 1MTWA 5E0GA 4AORA 1O2GH 3EYDA 2OK5A 3ZVFA 1O32A 3SJKA 3QDZB 3FVFB 1BTHH 3FZZA 1PYTD 1EJMA 1O3BA 4X2XA 4GUXA 2ESTE 3RC4A 5LPFA 4ISLA 3V3MA 3BF6H 1J9CH 3LGWA 4CRDA 1GMCG 3EE7A 1A0HB 1AKSA 2K1QA 4DURA 3Q77A 1GBEA 1TB6H 2D2DA 3SI4H 8ESTE 1DSUA 4TYDA 2Y5GA 1C2EA 1PFXC 1ZRBA 3T2NA 1N6XA 4TWYA 2FI5E 4ZCNA 2QN5T 1GJ6A 2ZWLH 5GCHF 1E36B 1JIRA 3S7KB 3EA8A 2BLWA 4FUHA 3FP7E 1SQRA 2ZCKP 2FOFA 3DFLA 3CS0A 2DE8A 4OS4A 1GHAF 1WXRA 4BAHB 1UTOA 2FM2A 2NU0E 3PM3A 3A8BA 4JYVH 1MKXH 1HJAB 2YMSB 3T29A 2GMTB 3A87A 5FPSA 2BLVA 1UVOA 2GX4A 3OSYA 1ELDE 1GBHA 4B75A 1ETTH 2TRMA 2BB4A 2G8TA 1T8OA 5A09A 2VGCC 1KXCA 3VPKA 2QA9E 1GI2A 1P9SA 3SBKA 4ACAA 1VKYA 1O2WA 2AHME 4A7IB 1Y5BT 2W6JD 2HPQH 3LC5A 1H8ED 4DJZB 2GVFA 2EI8A 4H4FA 1LVYA 1BMNH 2VIQA 2UUJB 2Y5FA 2BXUH 3ENSB 1C1MA 2H5DA 1THRH 1H9IE 1SOTA 3JZ2B 4FUGA 4ABJA 1EZQA 1Y3VA 1W10U 4CR9A 4ZKRU 4JYUH 3F2FA 1H9HE 1UCYE 4YM9A 1UVUH 3U69H 1O3OA 3CP7A 3VG8A 1DXPA 3MWIU 5EXMA 1VCPA 1GHZA 1EZUC 1FMGA 1YYY1 3IWMA 1P2JA 4KGAA 1CA8B 1T4VH 1MKXK 1Z8GA 4NFFA 4AC9A 1N1LA 3VGCC 1IQHA 2GTBA 4FUFA 4ZKNU 1A5IA 4WJG2 4DY7B 2G51A 3S9BA 3E0NB 5EOKA 4XDEA 3FANA 2G5NA 1QIXB 4R0IA 1Z1IA 1AZZA 4NZQA 1C5OH 2PGQB 2WPMS 1SR5C 1MQ5A 1P09A 4XBCA 4P02A 2XBVA 2FOCA 1YY3A 5T3HA 1DSTA 1JBUH 1D3TB 1ZTJA 1ANDA 2VIDA 3KN2A 2ODQA 3HPTB 1CGHA 2GCHG 5C5NA 3UNSA 4ZMAH 1MTVA 2IPHA 4U2WA 4DG4A 1GI1A 4KELA 5I46H 3DSGA 1P57B 1EOLA 1FQ3A 1ZR0A 1HAOH 2WPJS 1FUJA 3BG4B 1IHSH 1XVOA 4BAMB 1FZZA 1O0DH 1GMDF 4JYTA 4A92A 4ZAEA 2ODPA 1ZZZA 3F1SB 4RT0A 1K1NA 5A8YA 1EAUA 1LVBA 1TPAE 1KLJH 3UWJH 3MU4A 4YXWD 3F6UH 5AHGH 5C67A 1O2YA 3SYJA 1V2JT 3T27A 2XNIA 3SO3A 5C0TA 2ZGBH 3BTKE 7GCHF 1C1QA 3MU5A 4JCNA 2FOBA 1XX9A 1C2FA 4KTSA 1UTPA 2XWBI 1YCPM 1D9IA 1V2WT 1ESTA 1O2MA 1S85A 2JJ2D 1BRUP 4IMQA 1KMHB 1IQJA 1BB0B 2GP9B 4DCDA 5IYTA 4RT1A 1LKBA 1DDJA 1SLUB 1XUIA 4GCHG 1EFRD 3RU4T 1BOQA 1U6QA 1UK2A 1FDPA 1CSOE 1LVMA 2BDAA 3F9GA 1P2IA 3E91A 1GGDB 2F9OA 3O8DA 1HJ9A 1NFXA 5EODA 3NRLA 3GISB 4IC5A 4Y6DA 1HV7A 1EQ9A 1G2MA 5HKKD 2M5TA 2UUKB 2WYGA 1BHXF 4Y71A 3IITA 3LIWA 3BEIB 3F9FA 1NO9H 3PMAB 5FPTA 4GAWA 4Q4LA 3A7TA 2P3FH 1TOMH 2V0BA 2F9PA 3SUEA 1YPHC 2R0KA 1F0TA 2GD4B 1SGQE 1NRNH 1YKTA 2Z9GA 4OM9A 5EIYA 4WXIA 5I25A 2BD3A 5JB8S 1HAZB 2A5AA 2EQNA 2ZA5A 4JZFH 1HB0B 2A5KA 2O8WA 3ELAH 1P12E 3QO6A 1OP2A 1XXDA 2YNBA 2VIWA 3SU2A 1YPEH 2PWXA 2Z3DA 3MU0A 3LGTA 2GV6A 1UTMA 1ELAA 4I8HA 5FBIA 4E06H 1ZSKA 3W1EA 5HM9A 1ZOMA 2V6NA 1GJAB 4LOYH 4MNXA 1IQNA 2G55A 4NG9H 1C1UH 2VBCA 4INKA 1N8OB 3T26A 2ASUB 1MTNB 1K0HA 1IOEA 4Q2KA 3A7YA 3TITA 4X6OA 4CBNA 3LOXA 3TJUA 1ELEE 1QNJA 1V2OT 2LELA 1GG6C 2QXIA 3MI4A 5C17A 1AFEH 1GWAA 5T6GA 4I8JA 1G30B 3RM0H 2O8UA 2OD3B 4GVUA 1IAUA 1HAVA 4A1VA 1L1JA 1VITH 1A3EH 3W95A 4VGCB 1LMWB 1L4ZA 3RC6A 3BTEE 5GXPA 1TPPA 2SGDE 4A1TA 1AFQB 5CHBA 1S0RA 2BY8X 4MLFB 3ZZBA 1X7AC 5DP5A 3SUDA 2KCPA 1JRTA 4XD7D 2J98B 4YLUA 5ESTE 1QRWA 3AASA 4B74A 2K8IA 4DT4A 1CHOG 3DSOA 3UR9A 3A81A 2P94A 1JMOH 1GBCA 3GY2A 1EJNA 2ILNA 2Q1JA 2ZHEH 1S0QA 1FX0B 5CHAB 1A0JA 4MNWA 2ZTYA 3SQEE 3U9AH 1GJ7B 1TFXA 2OBQA 4Y8ZA 2KAIB 2VNTA 1O5GH 2FWWA 1V6DA 3OEHD 5AF9H 2F9BH 1O37A 2B9LA 1O31A 3BN9A 1ZJKA 2J94A 2J92A 1GCTC 1TLDA 2ZC9H 4Y11E 3UFAA 3ZZ3A 4AYYB 1EB1H 1F2SE 1DANH 2CF9H 3SU5A 4Q7ZA 3OU0A 2C93B 4UONA 3RXJA 3L3TA 1C2IA 2Y80A 4K69A 1TX8A 3SNAA 1NFWA 4UDWH 1AI8H 4ABEA 1TBQH 4FOUC 4M9FA 1CO7E 1NBME 3SZEA 3MNSA 1GDUA 2KCOA 1E38B 2PKSB 2ZQ2A 1MU8B 2P3TB 4U01A 1V2LT 1DWEH 2BD8A 3RXVA 3OY6U 2C8XB 4YT6H 4AB9A 4CBOA 1NESE 1HXFH 4OS7A 4NIWA 2W7SA 1EPTC 5KEDA 4DOQA 1P2MA 4NCYA 2TGTA 2FP7B 1GHBF 1GJ9B 1TBRH 1O2IA 3UQOA 1IQFA 3RMNH 3RXSA 1DWCH 4F49A 3MH7A 3DD2H 5JBCS 1B5GH 3BTGE 2O8LA 2FYRA 4OS5A 2RA0A 5E8EH 4E7RG 1SGIB 2PHBA 1FONA 1V2UT 1TA6A 8KME2 2BDYA 3UIRA 1J8AA 1ANEA 1GBDA 2OQUA 3GDSA 3QWCH 3BV9B 3CS7A 3QTVH 3UOPA 2GGVB 3OFND 1GI5A 2F4LA 3SUFA 4YTAA 1DT2A 2ZHFH 3SGAE 4NWLA 3VB5A 4FU9A 1O3CA 1Y5UT 5FX5A 2FX6A 3MFJA 1QQ4A 5EPYA 1PJPA 4WXVA 2CHAC 2BQWB 3TVJB 4B1TA 2ZI2H 2F3CE 2Y5HA 5J4SA 3DT0H 3ODDA 1LHFH 3DA9B 2Z9LA 4AFSA 2A31A 1CGIE 4A5TS 1F5RA 5TCAA 1W8BH 1TYNA 5SGAE 1OXGA 4A1XA 2ZHWH 1AVGH 1SI5H 3AAVA 4I8KA 3STIA 3VB7A 1ESBA 4OS6A 2PV9B 2R0LA 2WPDD 2J4IA 2SGPE 3FAOA 5BRRE 3A7XA 2JH0D 2ZDVH 1AKSB 1O5BB 1K21H 1OX1A 1K1LA 2KAIA 1VJAU 2W3KA 3OEED 1SGYE 2EC9H 2RCEA 3BTTE 1MAYA 3GCTF 2KM0A 1C5LH 4NA9H 3NXPA 4D7FA 2QV1A 4INHA 1CHGA 3KYGA 1MCTA 5PTPA 3QUMP 2QGRA 2Z9IA 4RN6A 3BSQA 3GYLB 3RXOA 1C2GA 1OYQA 3EA9A 3GY6A 1G3EA 2P8OB 1GBIA 3VB3A 1T8MA 1NRPH 4Y0ZE 4ABAA 3SHCH 3SV8A 2ZDAH 1FY5A 1ANCA 1O3GA 2YNAA 3Q76A 4BNRA 2Z9KA 3A84A 3HGNA 3LC3A 2Z9JA 1QJ6B 1P2KA 3KGPA 4X1RU 3UTUH 3SHAH 4DW2U 1TNLA 5FHTA 8GCHG 1QB6A 4X6NA 1P3EA 3KCGH 4YOGA 1AUTC 1XUKA 1P06A 2OXSA 2GKVE 2VIPA 3FP8E 4H6SB 4LZ4B 1P9UA 3R0FA 1ELFA 1GJ5H 1C1SA 3UAIC 2XOKD 2A7HA 2D1JA 4ISHH 4AB8A 1ESAA 1W2KH 4E7NA 3T25A 3BTWE 5F53A 4JZ1A 1P2OA 1ARCA 1ABJH 1RXPA 1PQ8A 3P8GA 1N6YA 3SJIA 3P8FA 2Z7FE 1K22H 2WINI 1H4WA 1QHRB 4ABHA 1TGSZ 1C1TA 1GJ4H 2AIQA 2SGAA 4TY7A 1C5SA 5EG4A 1VGCC 3TK5A 4GPGA 1AB9B 3FP6E 1UTJA 2ZEBA 3TK6A 2CV3A 3UUZA 1L1NA 6CHAC 3LPRA 3RMOH 4YZUA 1HRTH 2BLOA 5JBAS 3O8CA 1V2RT 2IJD1 1KYNA 4CH2B 3GY5A 1FN6A 1O3NA 2SFAA 1O5AB 1NM6A 1TPSA 2ZPSA 1K1MA 1AVWA 2Q6GA 1TALA 1SQAA 3OY5U 1LO6A 1A1RA 5F6MA 2FOAA 2RDLA 2WSSD 3DUXH 2OTVA 3F9HA 3H09A 4AX9H 4B2BA 3TGKE 4IS5A 4P00A 1DFPA 1EOJA 1HFDA 2VWLA 2XC4A 3LH1A 2FIRH 1SGRE 4NWKA 1GI6A 5DO4H 5CDFE 1RIWB 3E3TA 3K65B 1DY9A 4X1SU 1MZDA 2ZCHP 3PMHB 4CREA 3EGKH 4JK5A 1DM4B 4HFPB 1LHEH 2FZZA 5ABWA 1O2PA 3F0PA 2D8WA 1HAGE 1WV7H 3TLOA 1SGEE 1OYTH 1SGNE 1GBKA 1THSH 1W0ZU 1KLTA 3V13A 3GY3A 1OWJA 2EY4C 4AFZA 4ZKSU 3PMBB 2GT8A 1FJSA 1KXAA 1HAPH 1TX6A 4AGJA 2FX4A 1JWTA 3TJOA 5EPNA 2WPHS 2FODA 5J4QA 4DGJA 1INCA 2Y82A 4TPIZ 5CMXH 1BRBE 3AVZA 1MMJN 1O2JA 3SNBA 2ZF0H 1NRRH 1BA8B 3B9FH 1AN1E 2KR7A 1VITF 3RXGA 1D3QB 3AW0A 2QXHA 4H6TA 1EASA 3DFJA 1NZQH 4ESTE 1C5RA 2JH6D 2C90B 5DP6A 1V2MT 1GL0E 2RFKC 2VU8E 1FAXA 1KXDA 1DICA 4HG6A 2A4OA 2HNTC 5HYOA 1PPGE 1NTPA 4UD9H 1SGCA 5C2ZA 2AYWA 4ASUD 1QA7A 5IK2D 4J2YB 2AIPA 2FXRA 2ZGCA 2ZNKH 3LKWA 5DPAA 4XBBA 2NU4E 2JIZD 2V7QD 2FS8A 3HKJB 1KTTB 4ZXYH 2D26C 1BBRH 1LQDB 5DP8A 2L74A 1GJCB 2XCFA 4B76A 1QBVH 2ZQ1A 1P04A 3DSPA 3OYPA 1BTYA 1OP8A 2Q6FA 4YO9A 5DP3A 3TGJE 3SU3A 3K9XB 3V7TA 2A2QH 2QXJA 3NWUA 2JETC 5GIBA 2OQ5A 5FCKA 1AQ7A 3FOAA 2A4QA 3FKSD 3M5OA 1P02A 4CRGA 3GS9A 1MTSA 1SGPE 2SGFE 1BJUA 5EJZA 1TMUH 1FY8E 3MH6A 4X1NU 1QL7A 3ATWA 4ZXXH 3U1IB 3ZV8A 1YPHE 2PUQH 3C27B 1UTQA 2GT7A 3RLWH 2SNWA 1C2JA 2OC1A 1F0SA 2A4GA 3M5NA 2WV9A 5JBBS 3UY9A 1V2TT 3SN8A 1C4V2 2QIQA 3D23A 2V3MA 4FUDA 2ZFFH 1RS0A 3LGYA 3KQBA 3SQHE 5K7RA 1LDTT 2JDID 1IQMA 1VR1H 3MH5A 1YCPH 3D62A 3TPIZ 1UW7A 1BHXB 3T5FH 1L2EA 3RUOA 1O30A 5L30H 1CVWH 2QF5A 1BBRK 4THNH 4X2WA 3Q00A 3LJOA 1CU1A 1GMHG 5LPEA 1WAYB 1O5EH 1UTKA 3QTOH 4F4OC 1K9OE 1WTGH 3E1XB 1KDQA 2HLDD 1NT1A 4TPYA 3WWBA 2BZAA 4BANB 1HAVB 1ZPBA 2ZFTA 4FUEA 1KXEA 1EAXA 1LCYA 3MMGA 2ANMH 1MTUA 4IGDA 3P95A 1P0SH 4B73A 1EB2A 1BRAA 1SQOA 2AS9A 5E2OA 1THPB 1PPFE 1PPBH 3RXCA 1NRSH 2QF0A 4YOIA 1O2RA 2XRCA 2BYAX 2FOEA 2H9TH 4BAKB 1FLEE 3RXMA 1SQTA 4GHTA 1SLXB 1C2KA 1P2NA 1SC8U 3OTJE 2CK3D 1ZGIA 3UPEA 2A5IA 1GHWH 4NSYA 3VXFH 3W94A 4B2CA 2AGGX 1D4PB 1CBWB 1YCPK 4OS2A 4CHAC 3QZRA 3TIUA 1EPTB 3BG8A 3FZDA 1JOUB 2HLCA 4X1QU 3WY8A 5FAHA 1KXBA 2KCAA 3ATIA 1XMNB 1NBMD 1W0YH 2GZ9A 1P05A 1XUFA 3HATH 1DS2E 3U28C 3OE7D 2FDAA 4NZLA 1K28D 6GCHF 1F7ZA 1S6LA 3SW2B 2BQ6B 2NU1E 3SUGA 4YLQH 1K1OA 2W5EA 1K2I1 4FU7A 4K60A 2WUBA 4B71A 1Y3XA 3AK5A 4ZUHA 3BTFE 5DP4A 4ABIA 2QC2A 4NGAH 2STAE 1C5UA 2QF4A 3PLPA 5LPRA 2BVXH 3GCNA 1HIAA 1BTWA 3MNCA 4IN1A 3TU7H 1TONA 2CF8H 3A8CA 1QL8A 4LK4A 4DT7B 1O38A 3M5LA 2SGEE 4Y7AA 5F8XA 1UVTH 3TNTA 3M36A 4OGXA 1ELBA 2CHAB 1TIOA 2ZDLA 3ZZ4A 3I77A 1V2QT 1FN8A 3GCHC 3MOCA 2PSYA 2XW9A 1O2XA 1BT7A 1C2HA 1V2KT 3ZYDA 3LU9B 1C2DA 1EUFA 2R3YA 3ZVGA 2CXVA 1FXYA 5HIYA 4DIIH 1J14A 2PR3A 3MH4A 5GJ4B 1O3KA 4FVBA 3TGIE 1V3XA 1EZXC 1GL1A 3GDVA 1NPMA 1A61H 2PP6A 3SZNA 1W3CA 1HJAC 2YMSC 4X8VH 1GJDB 5GCHG 1RTLA 2Y7XA 1O3LA 2BY7X 2GMTC 1C5PA 1GBLA 3N99A 4FUJA 5EJ1A 1QGFA 2IJOB 1E35B 1RTKA 3STJA 4HTCH 4B2AA 2ZFQH 3MHWU 1IQLA 3GICB 1GHAG 5AFYH 5GNDA 1ANBA 3MQKC 1GI0A 4Q80A 2TGDA 3U8OH 4HI3A 1LPZB 2WZQA 4FXGH 5JYIA 2QXGA 1W7GH 1L1GA 1SOZA 3N7EA 1PQ7A 2R2WU 1TGBA 2UWPA 1MH0A 1GBBA 4CH8B 2P95A 2ZECA 3P6ZB 4IC6A 1DUEA 2R3UA 3TJVA 3OTPA 3SOSA 1YPLH 3IG6B 2O8MA 1C4Y2 3V0XA 1Z6JH 2UUYA 1W0KD 1ZSLA 1C9TA 5EU8A 2V3HH 4XSKU 4NA7A 1K1PA 3D49H 2ANYA 1O2TA 1H8IH 1V2VT 2A1DB 3MO6A 2H9HA 3UOUA 2J38A 1C2MA 3UREA 1EATA 4XE4A 5JBTA 1TGCA 1RTFB 1EPTA 1BZXE 3PRDA 2ANWA 3O8RA 1PYTC 2XBXA 2QE7D 5A8XA 3A80A 3A86A 6ESTA 1YPGH 1KLIH 2Y6TA 4D9RA 3RXRA 1YPMH 3CENA 3DHKH 3O8BA 4MPWA 1GHXH 3L33A 4I32A 1SFQB 4O97A 1P03A 3SV6A 1O5FH 1W13U 2Y81A 1Z6EA 4INLA 4AG1A 3RXIA 4NA8A 2C4FH 1GHVH 2F83A 3A7ZA 3BTHE 3UNRA 3A82A 1ELTA 6CHAB 1FNIA 5BPEA 4AZ2B 2GZ8A 1F5LA 2BDGA 4NIXA 1MABB 1TGTA 5TJXA 1EXFA 4YOJA 2BM2A 2XCNA 3ATLA 4MNYA 1C5XB 2ZHDA 1QFKH 3NKKA 3VB4A 4X1PU 1O3HA 1OWKA 2R2MB 4FVDA 3LH3A 4BTTB 2BLQA 1O3MA 1KY9A 3KQDA 2BVSH 1OSSA 1C1RA 4X8SH 4FUIA 1TX7A 1YF4A 3RU4E 2BDCA 3SJ8A 3MO3A 1WQVH 3VB6A 1GMCF 5GDSH 1Y59T 1ELCA 3HK3B 3PO1C 1HAXB 2ZTZA 1BBRE 5EW2H 2VH6A 3ZV9A 2ZP0H 1AHTH 4OS1A 1SG8B 1GMDG 2PW8H 2LNCA 2F43B 1SGTA 4O3UA 2XC5A 4WVPE 1EZSC 4XOJA 2DE9A 2OINA 3LT3A 2A32A 1QTFA 2ZPRA 3ZZDA 4GLYA 1MBQA 5JDUB 2FS9A 1HAYB 1F0UA 3OAAD 1KXFA 2BXTH 4RSPA 2F9UA 2PLXA 3ZZ6A 3RXAA 1O33A 2BX3A 5HIZA 1NY22 2HOBA 2B0FA 4MPXA 3KNXA 7GCHG 1C5QA 2BD9A 3UB0A 1NC6A 2AMQA 4UFDH 1DLKB 1LPGB 1C5MD 3M3VA 1GGDC 1NU7B 4CRBA 3EAJA 3HK6B 1QB1A 1DY8A 2IOTA 1E0FD 3A88A 3G01A 2XTTB 1TWXB 1OHHD 1V2PT 1K1JA 3ZZ7A 3ESTA 2RDEA 4Y10E 1MD8A 4NSVA 1O3EA 9ESTA 2OBOA 1C5NH 1WYKA 1RFNA 3FFGA 4NIVA 4O9VA 4R8TB 1BITA 2ZFPH 4AYVB 1YC0A 4UFFH 2FO9A 2VGCB 3ZZ9A 1LVOA 1QURH 1H8DH 3SU4A 4X6PA 1S6FA 1BUIA 1WSSH 3KL6A 4FU8A 4X6MA 3LGIA 6LPRA 3TNSA 1P11E 2ZGJA 4B6EA 1C5VA 2IN2A 2KCYA 1GVZA 1P8VC 3PTBA 5EGMA 3NCLA 2H6MA 4CR5A 1BJVA 3MNXA 3SJOA 1IQIA 3P8NA 3M3TA 3ZVEA 4WMEA 3RM2H 1UTLM 2KFWA 1O3FA 1UTNA 4RI0A 3QGJA 4TSFD 1D6RA 5A0BA 4IW4E 3FO8D 3HKIB 1A5HA 1BTZA 1Z8IB 3RXFA 3SJ9A 4Z6AH 2FEQH 1S84A 2I6QA 5EW1H 1H9LB 1WBGB 1AE8H 1FPHH 1SVPA 3T62A 2FTLE 3F2HA 5LGOA 2PUXB 3RXBA 3A7WA 1Z8JB 3WWFA 2ZDMA 3BEFB 1KIGH 2XWAA 3MTYA 1YPJH 1DPOA 3RC5A 2H9EH 2HPPH 3GY8A 3PV4A 3VGCB 1A0LA 2A7CA 3KF2A 1TABE 3RXTA 2OC7A 1EAIA 2GCHF 4WY3A 2ZCLP 3S9CA 1YP9A 2Y7ZA 4ABGA 5EQQA 5EQSA 4XBDA 2HNTE 1BRCE 4AGKA 3C1KA 2GCTC 5ETXA 3TH4H 4ZHMU 1QB9A 3KHVA 3T28A 3BIVH 5GPIB 1GJ8B 2BY9X 1SHHB 3SV7A 4FUCA 1TPOA 1UJ1A 1VJ9U 1LTOA 4NIYA 1ZMLA 5DN6D 1TA2A 1O5CB 2HNTF 2NU3E 1ZRKA 4IBLH 1C4U2 2B5TB 1GBMA 1S6HA 3UQVA 1E1QD 1FIWA 1GI7B 2W3IA 2VJ1A 2RG3A 4ASHA 4PROA 4ZHAA 4FUBA 3SNDA 3TH2H 1LKAA 1AY6H 4D76A 1B0EA 2TGAA 3PMJA 1O2KA 1AUJA 2SNVA 3GYMA 1GVLA 1WOFA 2C8YB 2G4UA 3ATMA 1TNIA 3M7UA 4MVNA 4D7GA 3E6PH 4O3TA 1SKYE 5E2PA 2P59A 2ZG0H 2ULLA 2ODYB 2KX4A 3MU8A 5C94A 1EP5A 3PV5A 1UVPA 5L2ZH 1WDIA 1ZLRA 2W6ID 4GCHF 5DP7A 3RXHA 1O3JA 5HXFA 4CHAB 1IQGA 2FI4E 3B8JA 2BHGA 1C1PA 1FY1A 1H8HD 4CRFA 1D3DB 2GV7A 1Y3WA 1UK4A 4MPVA 5F8ZA 1QA0A 2FTMA 3K6YA 5DJ7A 1MQ6A 2VINA 1AD8H 1AE5A 1O2SA 4YESB 3KQEA 1KDQB 2BOHB 3M3SA 2BOKA 5FCRA 1HLTH 3PV2A 3RXDA 4ISNA 3QN7A 5IDKA 2P16A 2FOGA 1TNJA 1A4WH 1MD7A 3SI3H 2XC0A 4GSOA 3FN8A 2ZTXA 3ZVDA 4Y79A 1ID5H 2TIOA 3PB1E 3SGBE 1ABIH 2OC8A 4DVAU 3LGVA 2G5VA 2W7UA 1CA0C 4TY6A 1W14U 4K2YA 5DSFA 3PLKA 4ABDA 3U8TH 3P17H 3E0PB 3H5CB 1GJBB 2HWLB 5E0HA 3SNCA 3RMLH 2ZKSA 1B7XB 1AWHB 1GHBG 2GDEH 1Z8RA 4WF8A 1TRNA 2CMYA 2LPRA 3MO9A 2FESH 1S81A 2BMGB 3GCHB 2GDDA 4OGYA 3EE0B 2PTNA 4ISIH 1WCZA 1A2CH 1AIXH 4JZEH 1PPEE 2J9NA 3F2GA 3K6ZA 5GWZA 1K1IA 1TMTH 3ITIA 3B23B 4AFQA 1T8LA 1OP0A 3BTDE 4KTUA 1RGQA 3S0NA 5C0UA 3SV9A 1Z7KA 1RRKA 3HGPA 3ZIAD 5HM2A 1MZAA 4D9QA 2ZFSA 4ZKOU 2UWLA 3ZVCA 2ANKH 1GG6B 4UFGH 1HIAB 3GY4A 1C5WB 1P2QA 1HAHH 1GVKB 2THFB 2ZIQH 2B8OH 3E90B 3AW1A 2BY6X 1QBOA 3M7TA 4ZROA 3BEUA 2VWNA 3SORA 1OWIA 4X8TH 3VXEH 5F8TA 1CHOF 3A83A 2A45B 1TRYA 1ZMJA 3SU6A 1O2UA 2FOHA 1C5TA 5AFZH 2PFEA 3QGNB 4WMDA 1O3AA 1ZSJA 2P93A 2C3SA 1IQKA 4BAQB 5KGOA 3A7VA 1IQEA 1ZGVA 2WUCA 3TH3H 1DVAH 1YBWA 4QT8C 3ZZAA 3MYWA 1QY6A 3R3GB 4HZHA 1QBNA 1GHYH 2BD5A 2P8OC 3K2UA 3PROA 1YLDA 2FOMB 3SU1A 4U30A 4Y8YA 3GCTG 1WUNH 1SFIA 2G4TA 4MDSA 1G9IE 3SV2H 1M9UA 4XRNA 1ORFA 1ETRH 2ZHQH 3RXQA 1T7CA 1SLWB 3PTNA 1O2HA 3UR6A 1QR3E 2TPIZ 2LP6A 2B7DH 2BD7A 5F03A 1UVSH 3EA7A 2GJGA 3ZZ5A 2BDIA 5LH8A 2AGEX 3RP2A 1GCTB 4KKDA 1ZMNA 1BMFD 1SSXA 1FAKH 2WV5A 3PWCA 1O3DA 2KZ4A 1AGJA 1BMLA 3N7OA 1ELGA 3A89A 1XVMA 2AH4X 1MAXA 2AMPA 1H1BA 1KSNA 4Y76A 1Z1JA 1MCVA 1ZTKA 2BQ7B 2VWOA 2XBYA 2C8ZB 1C1VH 3A8DA 7LPRA 1O36A 1CQQA 2IPQX 1C5ZB 1BQYA 3QLPH 2PKAB 1B0FA 3RXEA 5K0HA 3QX5H 3A85A 1AB9C 4BTUB 2HVXA 5FXLA 3PLBA 2OUAA 1NN6A 4ABBA 1SL3A 1UHBB 2AERH 1SGDE 2GZ7A 1S82A 1Q31A 1QRZA 3Q3XA 1DE7H 1TGNA 2G52A 5H4IB 2JKHA 2P3UB 1T32A 4ISOA 2I6SA 3PO1B 2L6OA 1ZJDA 2WYJA 5C1UA 1CT4E 1DITH 3MU1A 2QY0B 2W26A 5ESBA 1PPCE 1O35A 2VIVA 1TNKA 3RU4D 1TAWA 4SGAE 1ZTLA 7KMEH 2F9NA 1J15A 1RIWC 2ZFRH 3U98H 3PRBA 1HJ8A 5TCCA 1GBTA 1L4DA 5L2YH 1WQSA 1AWFH 5FX6A 3P92A 1TBZH 2WHXA 1EP6A 1BCUH 4K8YA 1GBFA 1A46H 3LGUA 4K3JA 3EQ0H 1NFYA 1O2LA 1EAWA 1T4UH 5DP9A 2DUCA 1FPCH 3I29A 4B6FA 3JZ1B 3SU0A 3U1JB 1G3DA 3LONA 5L6NH 1O3IA 1SHYA 5C1YA 2ZDKA 1YM0A 3RMMH 5A0AE 4UE7H 1HGTH 2ALPA 5A0CA 2BY5X 5C20A 5A2MH 4BXSA 5B6LA 2AMDA 1BMAA 4X0WU 1HAIH 1J16A 3L6PA 4KTCA 1HDTH 3M35A 4RKJB 3RXUA 5HMAA 2OC0A 3F0OA 4KP0A 1NROH 1P3CA 2O8TA 2WPLS 3URCA 1XKAC 4IN2A 1GBJA 5FL7D 3WW7A 1XXFA 2H1UA 1NS3A 4JZIA 3URDA 1TQ0B 1QCPA 2J95A 1OOKB 1DOJA 2ZU3A 2WV4A 1PQAA 1TRMA 5FPYA 1VITG 4MPUA 1OWDA 4AN7A 4MNVA 3BTQE 1GI4A 1JRSA 1O5DH 3PWBA 2XBWA 3KYFA 1MU6B 2AFQB 1QRXA 2VVVA 5A8ZA 2NWNA 2ZU1A 8GCHF 4D8NA 2XNDD 1LHGH 4JMYA 2Q6DA 2M2AA 4AFUA 1O34A 1QL9A 2EEKA 4ABFA 2HVYB 1SMFE 1TE0A 3LDXH 1HNEE 1O2NA 4WWYA 3M5MA 4MQAA 1E1RD 1BDAA 2PKAA 2OLGA 1HPGA 2TGPZ 1AMHA 3ZZ8A 2HRVA 1XKBC 2OP9A 2VIOA 1TOCB 2Z3EA 1AZ8A 3ATKA 2HGTH 2VB0A 5DK1A 1UHBA 3OX7U 1W0JD 5CE1A 2ZGXH 1CE5A 1O2VA 2J97A 4AG2A 2EI6A 4MG3A 3S69A 1W7XH 3VEQB 2GCTB 4I86A 2BD2A 5JPMH 1O3PB 4Y8XA 1SGFA 4M7GA 1UK3A 2STBE 1T31A 2QF3A 3TJNA 2O9QA 2VVCA 2WPIS 1L0ZA 1Y3UA 5C3NA 5T1VA 3I78A 2CGAA 1ZYOA 3V12A 3CNRA 5HGGA 1GDNA 1SLVB 1NU9A 2FPZA 3H7OA 1VCWA 1VZQH 5G4BA 2FI3E 2SGQE 5E0JA 1VGCB 4A6LA 1QQUA 3GDUA 1UMAH 1A7SA 1C1NA 2XYAA 1CT0E 2YOLA 2J34A 4O03A 9LPRA 4BXWA 1WTHD 1PPZA 5C1XA 1EJAA 4WH8A 2C8WB 2ZO3H 2Z94A 4HGCA 2PTCE 1GPZA 1MUEB 3S7HB 2G00A 5EQRA 3BG4C 4SGBE 4K1TA 2NU2E 1BMMH 4YT7H 4CRCA 1FV9A 4Z1MD 1HYLA 1LHCH 2XXLA 1S5SA 3KQ5A 1BTXA 1E37B 3SNEA 2VH0A 4ZHLU 1O2OA 1J17T 1UCYH 1DXWA 1GBAA 5B6OA 5KECA 2FMJA 2R9PA 4Z0KA 1SB1H 1AU8A 2A0QB 1CT2E 1ELVA 1EKBB 3N7DA 3NUMA 4K1SA 1FIZA 2EA3A 3VFEA 1A3BH 1MBMA 2BZ6H 1GI3A 1TNGA 4Y7BA 1GI8B 3GOVB 3ZVAA 2BD4A 2V35A 1CBWC 3F9EA 4BOHA 4I33A 1QZ8A 1W11U 4I8GA 5DKMA 1G37A 1HXEH 1UO6A 1C5YB 1Y5AT 2FLRH 3TK9A 4WMFA 1O2ZA 4F48B 1ARBA 3F3BA 3Q3KA 1V2ST 2RA3A 1BTUA 1CA0B 4F55A 4K8BA 4WH6A 3DCLA 5EXNA 1EX3A 1RD3B 4JK6A 1KTSB 1LQEA 1ETSH 4Q63A 5FBEA 1JXPA 1E79D 1Q3XA 2UWOA 2Z6BD 2UUFB 3KIDU 1G2LA 1OPHB 2PGBB 1AVXA 1UCYK 1IHTH 3S9AA 6GCHG 1OS8A 2BVRH 1C9PA 2FYQA 4JZDH 2F9VA 3KEEA 2AEIH 1F5KU 1E34B 5C5OA 3H7TA 1F0RA 2BDHA 7ESTE 2H2ZA 2OCVB 1DWDH 1TMBH 2F91A 2ZU4A 3NPSA 2ZU2A 4NFEA 1RJXB 1T8NA 3SGQE 2J98A 2TBSA 1Y8TA 1YLNA 4I8LA 1YLCA 1D6WA 3UNQA 3E8LA 4RKOB 1N8OC 1PQ5A 3GY7A 1MTNC 3M7QA 1MKWH 4K1EA 1JIMA 3NZIA 4X2YA 3BIUH 2G81E 1C1OA 2JETB 2ALVA 2ZDNA 1OKXA 1W12U 3U8RH 1O39A 1COWD 2HALA 3F68H 4H42U 3QZQA 1ZPZA 1QJ7B 1SBWA 2ZGHA 4X8UH 1BIOA 4LXBH 3PYHA 1QJ1B 1G3BA
chains in the Genus database with same CATH topology
4U32A 1G36A 4I31A 5AVDA 1FI8A 4BAOB 3P70B 4VGCC 3RDZA 4CRAA 1P01A 1ZHPA 4K5ZA 1Y3YA 2VVUA 3QK1A 1GI9B 2PSXA 1GMHF 2ZPQA 2V3OH 1DUAA 2BDBA 1AFQC 1F92A 1G32B 1V2NT 2WPKS 4UEHH 3RXKA 5T6FA 4Q7YA 2H5CA 1XUHA 1VCQA 1P10A 1YPKH 4LZ1H 1SPJA 3BTME 1SGFG 3ODFA 3ZYEA 2CJIA 1HBTH 1LHDH 1Z71A 2A4RA 4Y0YE 1LPKB 1HCGA 1WU1A 2EI7A 4X2VA 1ZHRA 2VWMA 3NK8A 3A8AA 3EDXB 1XUJA 1OWEA 2QAAA 2A2XH 1GDQA 4ZH8A 1S83A 1O2QA 4TWWA 1FY4A 1MKWK 1TQ7B 4GHQA 4I7YH 2ZU5A 3ZZCA 2Z3CA 5CHAC 4AOQA 1C2LA 8LPRA 5T6DA 4DIHH 1G3CA 3P8OA 1BTPA 5DGJA 2QCYA 3D65E 2ZZUH 4J1YA 1YGCH 1D3PB 2JH5D 4BTIB 1ZPCA 1ACBE 3RXLA 3E16B 1GCDA 5EXLA 3KQCA 1PPHE 1DX5M 1TNHA 1AO5A 2J2UA 1DLEA 2QYIA 1OWHA 5JB9S 1DWBH 4MTBA 3MNBA 3Q3YA 2BX4A 1XM1A 1FY3A 4UFEH 1XUGA 3ZVBA 1NFUA 2CN0H 1ZHMA 4Q7XA 1A5GH 2FLBH 2PKSC 3RLYH 2AGIX 4IMZA 3UWIA 2BTCE 3M37A 4E05H 1CGJE 3AAUA 1Q2WA 3GCOA 1HUTH 2A7JA 3LJJA 3RXPA 3M61U 1NRQH 1C1WH 5DG6A 4XFQA 1MTWA 5E0GA 4AORA 1O2GH 3EYDA 3ZVFA 1O32A 3SJKA 3QDZB 3FVFB 1BTHH 3FZZA 1PYTD 1EJMA 1O3BA 4X2XA 4GUXA 2ESTE 3RC4A 5LPFA 4ISLA 3V3MA 3BF6H 1J9CH 3LGWA 4CRDA 1GMCG 1A0HB 1AKSA 2K1QA 4DURA 3Q77A 1GBEA 1TB6H 2D2DA 3SI4H 8ESTE 1DSUA 4TYDA 2Y5GA 1C2EA 1PFXC 1ZRBA 3T2NA 1N6XA 4TWYA 2FI5E 2QN5T 1GJ6A 2ZWLH 5GCHF 1E36B 1JIRA 3S7KB 3EA8A 2BLWA 4FUHA 3FP7E 2ZCKP 2FOFA 3DFLA 3CS0A 2DE8A 4OS4A 1GHAF 4BAHB 1UTOA 2FM2A 2NU0E 3PM3A 3A8BA 4JYVH 1MKXH 1HJAB 3T29A 2GMTB 3A87A 5FPSA 2BLVA 1UVOA 2GX4A 3OSYA 1ELDE 1GBHA 4B75A 1ETTH 2TRMA 2BB4A 2G8TA 1T8OA 5A09A 2VGCC 1KXCA 3VPKA 2QA9E 1GI2A 1P9SA 3SBKA 1O2WA 4A7IB 1Y5BT 2HPQH 3LC5A 4DJZB 2GVFA 2EI8A 4H4FA 1LVYA 1BMNH 2VIQA 2UUJB 2Y5FA 2BXUH 3ENSB 1C1MA 2H5DA 1THRH 1H9IE 1SOTA 3JZ2B 4FUGA 4ABJA 1EZQA 1Y3VA 1W10U 4CR9A 4ZKRU 4JYUH 1H9HE 1UCYE 4YM9A 1UVUH 3U69H 1O3OA 3CP7A 1DXPA 3MWIU 5EXMA 1VCPA 1GHZA 1EZUC 1FMGA 1YYY1 3IWMA 1P2JA 4KGAA 1CA8B 1T4VH 1MKXK 1Z8GA 4NFFA 1N1LA 3VGCC 1IQHA 2GTBA 4FUFA 4ZKNU 1A5IA 4WJG2 4DY7B 2G51A 3S9BA 3E0NB 5EOKA 4XDEA 3FANA 2G5NA 1QIXB 4R0IA 1Z1IA 1AZZA 4NZQA 1C5OH 2PGQB 2WPMS 1SR5C 1MQ5A 1P09A 4XBCA 2XBVA 2FOCA 5T3HA 1DSTA 1JBUH 1D3TB 1ZTJA 1ANDA 2VIDA 3KN2A 2ODQA 3HPTB 1CGHA 2GCHG 5C5NA 3UNSA 4ZMAH 1MTVA 2IPHA 4U2WA 4DG4A 1GI1A 4KELA 5I46H 1P57B 1EOLA 1FQ3A 1ZR0A 1HAOH 2WPJS 1FUJA 3BG4B 1IHSH 1XVOA 4BAMB 1FZZA 1O0DH 1GMDF 4JYTA 4A92A 4ZAEA 2ODPA 1ZZZA 3F1SB 1K1NA 5A8YA 1EAUA 1LVBA 1TPAE 1KLJH 3UWJH 3MU4A 3F6UH 5AHGH 5C67A 1O2YA 1V2JT 3T27A 2XNIA 3SO3A 2ZGBH 3BTKE 7GCHF 1C1QA 3MU5A 4JCNA 2FOBA 1XX9A 1C2FA 4KTSA 1UTPA 2XWBI 1YCPM 1D9IA 1V2WT 1ESTA 1O2MA 1S85A 1BRUP 4IMQA 1IQJA 1BB0B 2GP9B 4DCDA 5IYTA 1LKBA 1DDJA 1SLUB 1XUIA 4GCHG 3RU4T 1BOQA 1U6QA 1UK2A 1FDPA 1CSOE 1LVMA 2BDAA 3F9GA 1P2IA 3E91A 1GGDB 2F9OA 3O8DA 1HJ9A 1NFXA 5EODA 3GISB 4IC5A 4Y6DA 1HV7A 1EQ9A 1G2MA 2M5TA 2UUKB 2WYGA 1BHXF 4Y71A 3IITA 3LIWA 3BEIB 3F9FA 1NO9H 3PMAB 5FPTA 4GAWA 3A7TA 2P3FH 1TOMH 2V0BA 2F9PA 3SUEA 1YPHC 2R0KA 1F0TA 2GD4B 1SGQE 1NRNH 1YKTA 2Z9GA 4WXIA 5I25A 2BD3A 5JB8S 1HAZB 2A5AA 2ZA5A 4JZFH 1HB0B 2A5KA 2O8WA 3ELAH 1P12E 3QO6A 1OP2A 1XXDA 2YNBA 2VIWA 3SU2A 1YPEH 2PWXA 2Z3DA 3MU0A 3LGTA 2GV6A 1UTMA 1ELAA 4I8HA 5FBIA 4E06H 1ZSKA 5HM9A 1ZOMA 2V6NA 1GJAB 4LOYH 4MNXA 1IQNA 2G55A 4NG9H 1C1UH 4INKA 1N8OB 3T26A 2ASUB 1MTNB 1IOEA 4Q2KA 3A7YA 3TITA 4X6OA 4CBNA 3LOXA 3TJUA 1ELEE 1QNJA 1V2OT 1GG6C 2QXIA 3MI4A 1AFEH 1GWAA 5T6GA 4I8JA 1G30B 3RM0H 2O8UA 2OD3B 4GVUA 1IAUA 1HAVA 4A1VA 1L1JA 1VITH 1A3EH 3W95A 4VGCB 1LMWB 1L4ZA 3RC6A 3BTEE 5GXPA 1TPPA 2SGDE 4A1TA 1AFQB 1S0RA 2BY8X 4MLFB 3ZZBA 1X7AC 5DP5A 3SUDA 1JRTA 4YLUA 5ESTE 1QRWA 3AASA 4B74A 1CHOG 3UR9A 3A81A 2P94A 1JMOH 1GBCA 3GY2A 1EJNA 2ILNA 2Q1JA 2ZHEH 1S0QA 5CHAB 1A0JA 4MNWA 2ZTYA 3SQEE 3U9AH 1GJ7B 1TFXA 2OBQA 4Y8ZA 2KAIB 2VNTA 1O5GH 2FWWA 1V6DA 5AF9H 2F9BH 1O37A 2B9LA 1O31A 3BN9A 1ZJKA 2J94A 2J92A 1GCTC 1TLDA 2ZC9H 4Y11E 3UFAA 3ZZ3A 4AYYB 1EB1H 1F2SE 1DANH 2CF9H 3SU5A 4Q7ZA 3OU0A 2C93B 4UONA 3RXJA 3L3TA 1C2IA 2Y80A 4K69A 1TX8A 3SNAA 1NFWA 4UDWH 1AI8H 4ABEA 1TBQH 1CO7E 3MNSA 1GDUA 1E38B 2PKSB 2ZQ2A 1MU8B 2P3TB 4U01A 1V2LT 1DWEH 2BD8A 3RXVA 3OY6U 2C8XB 4YT6H 4AB9A 4CBOA 1NESE 1HXFH 4OS7A 4NIWA 2W7SA 1EPTC 4DOQA 1P2MA 4NCYA 2TGTA 2FP7B 1GHBF 1GJ9B 1TBRH 1O2IA 3UQOA 1IQFA 3RMNH 3RXSA 1DWCH 4F49A 3MH7A 3DD2H 5JBCS 1B5GH 3BTGE 2O8LA 2FYRA 4OS5A 2RA0A 5E8EH 4E7RG 1SGIB 2PHBA 1FONA 1V2UT 1TA6A 8KME2 2BDYA 3UIRA 1J8AA 1ANEA 1GBDA 2OQUA 3GDSA 3QWCH 3BV9B 3CS7A 3QTVH 3UOPA 2GGVB 1GI5A 3SUFA 4YTAA 1DT2A 2ZHFH 3SGAE 4NWLA 3VB5A 4FU9A 1O3CA 1Y5UT 5FX5A 2FX6A 3MFJA 1QQ4A 5EPYA 1PJPA 4WXVA 2CHAC 2BQWB 3TVJB 4B1TA 2ZI2H 2F3CE 2Y5HA 5J4SA 3DT0H 3ODDA 1LHFH 3DA9B 2Z9LA 4AFSA 2A31A 1CGIE 4A5TS 1F5RA 5TCAA 1W8BH 1TYNA 5SGAE 1OXGA 4A1XA 2ZHWH 1AVGH 1SI5H 3AAVA 4I8KA 3STIA 3VB7A 1ESBA 4OS6A 2PV9B 2R0LA 2J4IA 2SGPE 3FAOA 5BRRE 3A7XA 2JH0D 2ZDVH 1AKSB 1O5BB 1K21H 1OX1A 1K1LA 2KAIA 1VJAU 2W3KA 1SGYE 2EC9H 2RCEA 3BTTE 1MAYA 3GCTF 1C5LH 4NA9H 3NXPA 4D7FA 2QV1A 4INHA 1CHGA 1MCTA 5PTPA 3QUMP 2QGRA 2Z9IA 4RN6A 3BSQA 3GYLB 3RXOA 1C2GA 1OYQA 3EA9A 3GY6A 1G3EA 2P8OB 1GBIA 3VB3A 1T8MA 1NRPH 4Y0ZE 4ABAA 3SHCH 3SV8A 2ZDAH 1FY5A 1ANCA 1O3GA 2YNAA 3Q76A 4BNRA 2Z9KA 3A84A 3HGNA 3LC3A 2Z9JA 1QJ6B 1P2KA 3KGPA 4X1RU 3UTUH 3SHAH 4DW2U 1TNLA 5FHTA 8GCHG 1QB6A 4X6NA 1P3EA 3KCGH 4YOGA 1AUTC 1XUKA 1P06A 2OXSA 2GKVE 2VIPA 3FP8E 4H6SB 4LZ4B 1P9UA 3R0FA 1ELFA 1GJ5H 1C1SA 2A7HA 2D1JA 4ISHH 4AB8A 1ESAA 1W2KH 4E7NA 3T25A 3BTWE 4JZ1A 1P2OA 1ARCA 1ABJH 1RXPA 1PQ8A 3P8GA 1N6YA 3SJIA 3P8FA 2Z7FE 1K22H 2WINI 1H4WA 1QHRB 4ABHA 1TGSZ 1C1TA 1GJ4H 2AIQA 2SGAA 4TY7A 1C5SA 5EG4A 1VGCC 3TK5A 4GPGA 1AB9B 3FP6E 1UTJA 2ZEBA 3TK6A 2CV3A 3UUZA 1L1NA 6CHAC 3LPRA 3RMOH 4YZUA 1HRTH 2BLOA 5JBAS 3O8CA 1V2RT 1KYNA 4CH2B 3GY5A 1FN6A 1O3NA 2SFAA 1O5AB 1NM6A 1TPSA 2ZPSA 1K1MA 1AVWA 2Q6GA 1TALA 1SQAA 3OY5U 1LO6A 1A1RA 5F6MA 2FOAA 2RDLA 3DUXH 2OTVA 3F9HA 4AX9H 4B2BA 3TGKE 4IS5A 1DFPA 1EOJA 1HFDA 2VWLA 2XC4A 3LH1A 2FIRH 1SGRE 4NWKA 1GI6A 5DO4H 1RIWB 3E3TA 3K65B 1DY9A 4X1SU 1MZDA 2ZCHP 3PMHB 4CREA 3EGKH 4JK5A 1DM4B 4HFPB 1LHEH 2FZZA 5ABWA 1O2PA 2D8WA 1HAGE 1WV7H 3TLOA 1SGEE 1OYTH 1SGNE 1GBKA 1THSH 1W0ZU 1KLTA 3V13A 3GY3A 1OWJA 4AFZA 4ZKSU 3PMBB 2GT8A 1FJSA 1KXAA 1HAPH 1TX6A 4AGJA 2FX4A 1JWTA 3TJOA 5EPNA 2WPHS 2FODA 5J4QA 4DGJA 1INCA 2Y82A 4TPIZ 5CMXH 1BRBE 3AVZA 1MMJN 1O2JA 3SNBA 2ZF0H 1NRRH 1BA8B 3B9FH 1AN1E 1VITF 3RXGA 1D3QB 3AW0A 2QXHA 4H6TA 1EASA 3DFJA 1NZQH 4ESTE 1C5RA 2JH6D 2C90B 5DP6A 1V2MT 1GL0E 2VU8E 1FAXA 1KXDA 1DICA 2A4OA 2HNTC 5HYOA 1PPGE 1NTPA 4UD9H 1SGCA 5C2ZA 2AYWA 1QA7A 4J2YB 2AIPA 2FXRA 2ZGCA 2ZNKH 3LKWA 5DPAA 4XBBA 2NU4E 2FS8A 3HKJB 1KTTB 4ZXYH 2D26C 1BBRH 1LQDB 5DP8A 1GJCB 2XCFA 4B76A 1QBVH 2ZQ1A 1P04A 3OYPA 1BTYA 1OP8A 2Q6FA 4YO9A 5DP3A 3TGJE 3SU3A 3K9XB 3V7TA 2A2QH 2QXJA 3NWUA 2JETC 5GIBA 2OQ5A 5FCKA 1AQ7A 2A4QA 3M5OA 1P02A 4CRGA 1MTSA 1SGPE 2SGFE 1BJUA 1TMUH 1FY8E 3MH6A 4X1NU 1QL7A 3ATWA 4ZXXH 3U1IB 3ZV8A 1YPHE 2PUQH 3C27B 1UTQA 2GT7A 3RLWH 2SNWA 1C2JA 2OC1A 1F0SA 2A4GA 3M5NA 5JBBS 3UY9A 1V2TT 3SN8A 1C4V2 2QIQA 3D23A 4FUDA 2ZFFH 1RS0A 3LGYA 3KQBA 3SQHE 5K7RA 1LDTT 1IQMA 1VR1H 3MH5A 1YCPH 3D62A 3TPIZ 1BHXB 3T5FH 1L2EA 3RUOA 1O30A 5L30H 1CVWH 4THNH 1BBRK 4X2WA 3Q00A 3LJOA 1CU1A 1GMHG 5LPEA 1WAYB 1O5EH 1UTKA 3QTOH 4F4OC 1K9OE 1WTGH 3E1XB 1KDQA 1NT1A 4TPYA 2BZAA 4BANB 1HAVB 1ZPBA 2ZFTA 4FUEA 1KXEA 1EAXA 1LCYA 3MMGA 2ANMH 1MTUA 4IGDA 3P95A 1P0SH 4B73A 1EB2A 1BRAA 1SQOA 2AS9A 5E2OA 1THPB 1PPFE 1PPBH 3RXCA 1NRSH 2QF0A 4YOIA 1O2RA 2XRCA 2BYAX 2FOEA 2H9TH 4BAKB 1FLEE 3RXMA 1SQTA 4GHTA 1SLXB 1C2KA 1P2NA 1SC8U 3OTJE 1ZGIA 3UPEA 2A5IA 1GHWH 4NSYA 3VXFH 3W94A 4B2CA 2AGGX 1D4PB 1CBWB 1YCPK 4OS2A 4CHAC 3QZRA 3TIUA 1EPTB 3BG8A 3FZDA 1JOUB 2HLCA 4X1QU 3WY8A 5FAHA 1KXBA 3ATIA 1XMNB 1W0YH 2GZ9A 1P05A 1XUFA 3HATH 1DS2E 2FDAA 4NZLA 1K28D 6GCHF 1F7ZA 3SW2B 2BQ6B 2NU1E 3SUGA 4YLQH 1K1OA 2W5EA 1K2I1 4FU7A 4K60A 2WUBA 4B71A 1Y3XA 4ZUHA 3BTFE 5DP4A 4ABIA 2QC2A 4NGAH 2STAE 1C5UA