1BRCE

Relocating a negative charge in the binding pocket of trypsin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKGSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPDVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Relocating a negative charge in the binding pocket of trypsin.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1992-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1brcE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1brcE02
3RXFA 4WH8A 4JZIA 1H8IH 2ANMH 1C2GA 2FOHA 1SHHB 2BY7X 2XC5A 3G01A 3SJ8A 5DP3A 3TK5A 3HK6B 4K1SA 2JETB 1P2MA 3PMAB 1H8DH 1HNEE 4WXIA 4X6MA 4CRBA 2CN0H 1W2KH 2C90B 1F92A 3PWCA 4J2YB 2GDDA 3IWMA 1FZZA 3BG4B 4CHAC 3BTHE 1E36B 1P10A 2AS9A 1ZGIA 1GI8B 2BOHB 1J8AA 2BLOA 3PO1B 3QN7A 2C8YB 2ZCHP 1G9IE 1DWDH 1WCZA 3RXHA 1O2JA 2AGGX 3NCLA 2C3SA 1NESE 2VH0A 2BB4A 2ZEBA 3RMLH 1YF4A 2RDLA 1SQOA 2UWPA 3SV7A 5G4BA 2R9PA 3KQDA 5DG6A 3A7YA 3PYHA 3BEFB 2A5IA 3TLOA 1GCTB 1J9CH 3E8LA 2A5AA 2BLVA 2BQ7B 3S9BA 3LC3A 2F9UA 1O3OA 3RC5A 1GBMA 3RXJA 4UFEH 3ZVBA 2FP7B 3PMJA 1O2SA 3EDXB 1GHZA 2ZU3A 1KSNA 1C4V2 4FU7A 5F8XA 3BEUA 1LHFH 1C4U2 1RTFB 3MH6A 1AQ7A 4X8UH 1Z8RA 2FO9A 1J15A 3GY8A 1GBTA 3O8RA 1O2HA 4GPGA 3ZZ3A 1O3AA 3MYWA 3VB4A 6CHAB 4NSVA 1VGCB 2XTTB 1HRTH 2QXJA 4Y11E 3S9AA 7KMEH 9ESTA 1AKSB 4BTTB 4NA9H 3OU0A 1GHYH 1YP9A 3A7WA 3M7TA 3HATH 1DLKB 2QXHA 2BD5A 3T62A 2AH4X 3ATWA 4NFEA 2YNAA 3ESTA 1UHBA 2TGAA 3GCOA 4ZAEA 1HAOH 3LH3A 2JH5D 2VGCB 3A84A 1A4WH 2ZHQH 1NRSH 3ZZAA 3QLPH 1C2DA 1UTMA 1HPGA 5A2MH 2GGVB 1O33A 4FUCA 3RMMH 2FDAA 1XUJA 3T5FH 4TY6A 1AHTH 3RXVA 1NZQH 1OX1A 1GJ4H 2P8OC 2GZ8A 2P94A 3EA9A 2BLWA 1NY22 3RLYH 1QA0A 4IN1A 1XXDA 2J38A 3L3TA 1RIWC 2ZPRA 1FY1A 1QL7A 3FAOA 1O3GA 2Z3EA 1LVMA 5T6DA 1ANDA 2PGBB 1XVOA 2NWNA 2XWAA 1A0LA 1EJAA 2AYWA 1MBMA 1UCYE 1SMFE 1DE7H 1KLIH 4KGAA 4H4FA 1GJ6A 5E2OA 2UWLA 1SSXA 2KAIB 3LONA 5HM9A 2QXGA 4AYYB 2VWLA 2ZQ2A 3A7VA 3EA8A 1LHGH 4CRAA 1GJ7B 3OY5U 3UQVA 1IQLA 4AB9A 3FP6E 2PLXA 1BMNH 3CP7A 1DDJA 1KXBA 1SB1H 3SBKA 2ASUB 3TGIE 1T8MA 1DSTA 3RXRA 1P3EA 2QXIA 3D23A 4MG3A 4NFFA 3MMGA 1K1IA 3M5NA 3LOXA 3ZVDA 4BAHB 2BQ6B 1E38B 3RU4D 1O2NA 5ESTE 2JKHA 2BY5X 2Z94A 1QL9A 1ZJDA 3SU2A 4JYVH 1P03A 2P3UB 2J92A 1YLDA 2HNTE 3DT0H 2CF9H 3U9AH 4I33A 3C1KA 3UY9A 1MMJN 1QFKH 2VWNA 3B9FH 4ESTE 2Z3CA 5DJ7A 3BTME 5ESBA 2CHAC 1UK3A 1C5SA 3RDZA 3VXFH 1TNKA 4BAKB 4MPUA 1DWCH 1GVKB 2XWBI 3GY6A 2WINI 2F83A 1NFYA 1GDUA 3M5OA 4DCDA 2PKAB 3RXOA 1GMDG 2H9HA 1A3BH 3PM3A 2B5TB 3A8DA 1SGCA 1HAGE 2BXTH 1TPOA 2A45B 4I8KA 2ZDVH 1K9OE 1DFPA 1YPMH 2BD4A 2SGDE 1CU1A 1O3CA 4B73A 3V12A 4K60A 1QB1A 3KQEA 1WAYB 1NROH 1LHDH 3O8DA 4MNXA 2AMDA 4ZKNU 1ZOMA 3N7OA 1Y5BT 2G51A 2W5EA 1OXGA 3NPSA 4Y8YA 2ZGXH 2CF8H 4A1VA 3PLKA 4X8VH 2SGQE 1AVWA 2BX4A 4ZHAA 1S83A 4CRGA 3MH5A 1CGIE 1ZSLA 1ZJKA 1OWDA 1Y59T 1O3BA 3ENSB 5EW1H 1SR5C 5HXFA 3SU1A 1F5LA 3RM2H 1YPHE 1TX7A 3GCNA 1TRYA 5GWZA 1WSSH 1FN8A 4ZHLU 1OKXA 1IOEA 1HJAC 4M7GA 1EXFA 2B0FA 1BMAA 3Q76A 2BTCE 5EXLA 3LGIA 4K1EA 4HI3A 1C1RA 5JB9S 1BTXA 2FS9A 2F9BH 3MU5A 2Y80A 1O2MA 3GDUA 4IC5A 3A88A 3JZ2B 4Y0ZE 3NZIA 2BD3A 5J4QA 1GBFA 3SJOA 3SGQE 1XX9A 1LKAA 1PQ8A 1TPAE 5E0GA 4BOHA 1FIZA 4KKDA 1NO9H 5JDUB 1QBOA 3EE0B 1O35A 2C8XB 1DUAA 3AW0A 2D26C 1HDTH 2TBSA 3UNQA 5FHTA 3CS7A 3TNSA 4BNRA 2NU2E 1QGFA 3ZZ6A 1BIOA 3EQ0H 2QYIA 1UVOA 3U8RH 1GVZA 5EOKA 4U2WA 1B5GH 2RCEA 3TVJB 2QY0B 3ODFA 2AMQA 2ZPQA 2BQWB 2A4OA 2NU3E 1LPZB 5HM2A 3D65E 4I8HA 1GJBB 1W8BH 1BT7A 3MO9A 2UUKB 3C27B 1GJ9B 1WUNH 3GDVA 3S7KB 1PQAA 2VNTA 3TPIZ 4CH8B 5J4SA 1GHWH 4B1TA 5A0CA 1NN6A 1ELCA 3E0NB 1C9TA 4OS7A 4UE7H 2NU1E 3MU4A 2O9QA 5GPIB 1W7GH 3SV8A 4CR5A 1HAZB 2OLGA 3UOPA 1ZTKA 1ZSKA 4FUDA 1O2YA 3FANA 2RA0A 2OINA 5FX5A 1K1PA 1KXEA 3RXMA 1P9UA 2Y5FA 1SC8U 1SHYA 2Y5HA 2ZTYA 1PPHE 4DIIH 1A7SA 1EPTB 8LPRA 4X1PU 3ZV8A 3BTWE 1OWHA 2NU0E 1UTQA 8GCHG 3ZZCA 2GCTB 1JMOH 2J9NA 3PB1E 9LPRA 1AO5A 1FY3A 2UUJB 5L30H 4X8TH 1HIAB 2A2XH 2AFQB 4JZEH 2K1QA 1AFQC 1NRRH 4B76A 3IG6B 1OS8A 1B0EA 2Y81A 2G55A 2CJIA 2ZI2H 3H7TA 3TK6A 1CA0B 1GMCF 3RXTA 1HGTH 2BVRH 3SUGA 3OY6U 3S0NA 2CV3A 3HKIB 1BITA 2PWXA 3F9EA 1G3CA 3VB7A 3F9HA 4TWWA 2UUYA 1Z6EA 2VIPA 1P06A 2TGPZ 1H4WA 2VWMA 5DKMA 5JBCS 3PTNA 1BBRK 4X2VA 1UTLM 2QF0A 1O5DH 1C1TA 2OCVB 4DOQA 2DE9A 1OWIA 2KAIA 2ZU4A 4AFSA 3PWBA 1IHTH 3SV9A 4JYTA 1Y3UA 1C5LH 1KDQB 3PV4A 1F0TA 3S7HB 3RC6A 1C4Y2 1W10U 1HFDA 3EYDA 2EI6A 3UNSA 1PPCE 1THPB 5FX6A 1G3EA 1KIGH 1A5GH 1SGEE 2AMPA 3SI4H 2ZHFH 2TRMA 5FBEA 3KQCA 1TX8A 1ELFA 1DXPA 4ASHA 1OPHB 1Y3YA 6ESTA 1SOZA 1RTLA 1ELAA 4AN7A 2ZPSA 4Y8ZA 3E16B 1WBGB 2WYGA 3BG4C 3RP2A 1ARBA 1DX5M 1LVYA 3VB5A 1BBRH 1SLWB 1O2TA 3BG8A 3O8BA 3TU7H 4A1TA 4INKA 1P3CA 2Z9GA 1S84A 4A6LA 1K1NA 4TPYA 1AI8H 2ZFTA 1P02A 5JYIA 2IPHA 2QF3A 2B7DH 2VIOA 1X7AC 1DANH 2C8WB 1G2MA 3NWUA 2ZFSA 1TQ0B 2FI4E 1G37A 1O2PA 2ZCKP 5A0BA 2SNWA 1AD8H 2G4UA 1GCTC 1S82A 5FPTA 3UNRA 1N8OC 4RSPA 2BXUH 4Y8XA 3QX5H 1C1WH 2ZC9H 1HAXB 3IITA 3KF2A 1LVOA 4KTCA 3AVZA 2ZTZA 1LHEH 5HGGA 2W26A 1GPZA 2J94A 1P57B 2H5DA 3A8CA 5F03A 2Z9KA 4CR9A 3VFEA 3W95A 2PUXB 2BMGB 3D49H 5T3HA 6GCHF 3LPRA 4B2AA 1SLXB 2BY9X 4XE4A 1O2KA 2WYJA 6CHAC 1VGCC 1GBEA 2PW8H 2A0QB 5A09A 2ZNKH 4Q7ZA 3WY8A 4Y7BA 2W7SA 5JB8S 4LZ1H 1XUIA 1Z8GA 3DFJA 3PMBB 1IHSH 1QY6A 3ITIA 4OGYA 4B75A 5EG4A 4FUFA 3RMNH 1OP2A 2FM2A 3V0XA 5EW2H 1A61H 4IMZA 4MNWA 4CH2B 1EATA 2QGRA 2HPQH 1D4PB 1DWBH 3SU3A 4Y71A 3SQHE 3VPKA 2A4RA 1CHOF 2VJ1A 3SZNA 3MNCA 2XC0A 4UEHH 1F5KU 2FPZA 4JYUH 3TIUA 4JZFH 1C5RA 2A1DB 1IQMA 1SVPA 1ELTA 3Q77A 5E2PA 2J4IA 1BQYA 1ID5H 1TYNA 3QO6A 2BX3A 4X6PA 1V2UT 4WMDA 3KL6A 4H42U 2FYQA 3LGTA 1GL1A 1V2MT 3A80A 4DG4A 1G36A 4YTAA 1MCVA 4AG2A 3RC4A 3SNAA 4KP0A 1GVLA 1PPBH 4YESB 6GCHG 5CHAB 2ZP0H 5L6NH 4IMQA 3T2NA 1W0YH 4NWLA 3SU6A 2WUBA 4GCHG 1TWXB 1IQKA 3LJJA 3RXAA 1WQSA 4GUXA 3UWJH 3JZ1B 2G00A 1PQ7A 2A7HA 4RN6A 4YOJA 1V2RT 2BDHA 1TOMH 1ELBA 1F2SE 2ZG0H 2ESTE 1O2OA 2P59A 1MBQA 2BD9A 1SLVB 4O3UA 3U1IB 1C5XB 1C5ZB 1S85A 2FZZA 4ABDA 1UVTH 2HPPH 1C2KA 4OS5A 5BRRE 5FXLA 1CHOG 1BTZA 1VITF 1GMHG 1C2MA 2VIQA 4ISNA 1S6FA 5EU8A 4I8LA 3ZYEA 1MAYA 3V7TA 3NXPA 1K28D 3SHAH 4DY7B 2Z9LA 4IS5A 1ELGA 2ZDAH 1GGDC 2HGTH 2EA3A 1UTNA 4WVPE 4AX9H 1O32A 1PPFE 1TA6A 1WOFA 1N8OB 1LO6A 1ANEA 2QA9E 1SFQB 1OP0A 2Z7FE 3BF6H 1IQJA 3MO3A 1V2JT 2ZDMA 1AVXA 4UDWH 3KIDU 1IQGA 1C2JA 4K69A 3NKKA 1P2OA 3GY4A 3M7QA 4FUEA 4OS2A 1GI5A 3UOUA 1BJUA 1V2VT 1LKBA 2VINA 4F49A 2PKSC 4WMFA 4CBOA 1GJ8B 1TRNA 1FY8E 1N1LA 3T25A 1O2XA 3ZVAA 4DVAU 1AY6H 1GJDB 2F3CE 3LU9B 4ZMAH 2ULLA 5L2ZH 1OYTH 5I46H 1VITG 3FVFB 1C1MA 1S0QA 3O8CA 1RTKA 3BIVH 4RKOB 2OP9A 2VIWA 1O3NA 1C2LA 3MH4A 2ZHEH 5C5NA 1CE5A 5ABWA 1HBTH 3BTDE 2ZU5A 1O2ZA 3VXEH 1IQNA 1SGDE 4ABIA 1TABE 1V2ST 1NFXA 1MTUA 1Y3VA 3KGPA 4UD9H 3DFLA 5DPAA 1EB2A 1NU9A 2ANKH 3E6PH 2ZGHA 1BTPA 2ZGJA 2VVVA 3TJNA 4ABBA 1T8LA 1OSSA 4NIXA 5EPNA 3RXSA 1GHXH 2XNIA 1O36A 3A82A 2G81E 2IN2A 4MTBA 1OYQA 1C2FA 3F68H 1Q31A 2FESH 3K2UA 4FUJA 3QTOH 3T29A 2STAE 3M37A 1YPEH 1BHXF 2XBXA 3RLWH 2WPKS 1T8OA 2O8MA 1J16A 1TRMA 2Q1JA 4YO9A 2P3FH 2F9PA 2IOTA 1SPJA 4Y7AA 4GSOA 2B8OH 1NU7B 4Y79A 2EI7A 3E3TA 4I8JA 3SNCA 4NIYA 3ZZ5A 1FAKH 2HNTC 5PTPA 4AG1A 1LQEA 1EAIA 1QNJA 4AFQA 3SNBA 1Q2WA 1ZPBA 2R2MB 1P9SA 3I78A 1T4UH 1YYY1 1GI9B 1ETRH 1GMDF 3HPTB 1AGJA 1PYTD 4I7YH 4LOYH 1GG6B 1BMMH 1O5CB 5LPFA 3ZZ9A 4MNVA 3GY5A 3L33A 3DHKH 1K21H 4THNH 3UWIA 1GCDA 1ZMJA 1FY5A 3ODDA 1ORFA 3RXDA 3TH2H 1WQVH 1K1JA 1O3PB 1G32B 5F6MA 5C1UA 3GOVB 4GAWA 1V2WT 4R8TB 5LGOA 2XC4A 4TYDA 3GY7A 1GGDB 3P8GA 1RXPA 2W7UA 2H2ZA 1G3DA 3RXQA 2GCHF 3GCHC 7GCHF 1BTUA 1ANBA 4K2YA 4NWKA 2XBYA 5FBIA 1Z8JB 2OUAA 3EAJA 3DD2H 1S6HA 1F5RA 5AF9H 1ETTH 1TNHA 1NFWA 3FFGA 1EAWA 1LTOA 4ABEA 5FCRA 1YPHC 4BAMB 3F6UH 4O03A 2WPHS 3T28A 4ZKSU 3I77A 4WXVA 3SGAE 1O2LA 2GX4A 2PKSB 2VWOA 1EPTC 1C5QA 1A0JA 1L1GA 5FPYA 2Z9IA 4HFPB 1IAUA 4Y0YE 3K6ZA 1CVWH 2GCTC 3M5LA 3UUZA 1W7XH 2FLRH 5A0AE 1C1SA 1TIOA 2SNVA 4X8SH 1YCPM 4ISLA 1MZAA 4LK4A 2XXLA 3P70B 5K7RA 3DA9B 1GI0A 1C1VH 1DICA 3NUMA 2AGEX 1CA0C 2SFAA 1O3JA 1TGSZ 4FVBA 1KTTB 5I25A 5AFYH 1MUEB 2GCHG 2V0BA 1IQHA 7GCHG 1MU8B 1HAVB 1MKWK 1TBQH 3BTTE 1XXFA 4K3JA 3RM0H 1V2PT 1QCPA 1VCWA 1P2IA 3R3GB 4E7RG 3AASA 1KYNA 3AAUA 1P2NA 1EKBB 1HCGA 4GHTA 1ZPZA 2GV6A 2GVFA 4Z0KA 1O3EA 3D62A 4NSYA 2NU4E 4DIHH 1EZUC 3MU8A 1FV9A 2HOBA 3QUMP 1ZHMA 2ZU2A 4O9VA 2OC0A 1AE5A 2BDAA 2FODA 2OD3B 4U30A 2FX4A 3STIA 1OWKA 2F9NA 1C2EA 1KXFA 1ARCA 3STJA 4SGBE 5ETXA 1LVBA 4A92A 3RXUA 1MKWH 3QTVH 2ZIQH 1ACBE 8GCHF 2UWOA 1FI8A 2FYRA 3KHVA 1NRPH 1L4ZA 1FDPA 3TH3H 1CGHA 3OYPA 2H5CA 1HB0B 3SUEA 1W0ZU 3EGKH 2J2UA 2HVXA 1H9LB 2Q6GA 2D2DA 4INLA 1C5UA 1HXFH 2TIOA 1XVMA 3ZVEA 1D3TB 1VZQH 1DSUA 1A1RA 2AIPA 1UTOA 2OC8A 1TB6H 2ZGBH 4H6TA 4NA7A 1QRWA 4TY7A 3GCHB 1SLUB 5HYOA 1ZZZA 3E91A 4X0WU 1AE8H 2GKVE 2BDCA 4D9RA 1NM6A 2D1JA 1SQTA 3LGUA 1C5NH 1VCQA 3FP8E 1PYTC 1ABJH 1AKSA 2OQ5A 3SO3A 4HZHA 2WV5A 1ZHRA 4WH6A 3RXLA 1SG8B 2XW9A 1MQ6A 1MAXA 3ZZDA 1TALA 1H9HE 1W14U 2QIQA 4CBNA 1YCPK 4XFQA 2VIDA 1V2TT 4ISOA 1WU1A 1KXDA 1GJ5H 1EZSC 1TONA 2TPIZ 1MD7A 2GTBA 3KNXA 4U01A 3RXPA 2HWLB 2WPMS 1BDAA 1SGTA 1C2HA 4NA8A 3A87A 1GJCB 1ZRBA 4YT7H 5A8ZA 3LC5A 1VCPA 3ZZ7A 5A8YA 3MHWU 3MNXA 1N6XA 3VB6A 3LGWA 1LPKB 1J14A 3H7OA 4YM9A 5T6GA 2ZECA 1BB0B 4IW4E 2BOKA 4X2YA 4ZXYH 1XM1A 2BD2A 1BOQA 1LMWB 5BPEA 2FTMA 3GYLB 4F4OC 4ISIH 1YCPH 1FMGA 1DITH 1GJAB 4SGAE 5DP5A 1FJSA 1UHBB 2CMYA 5CHAC 2D8WA 3B8JA 1P2KA 3M3SA 2YOLA 4K8BA 4WY3A 5EGMA 4MNYA 1O3DA 1BZXE 1O34A 1GDQA 2GDEH 1SFIA 4ZKOU 3ATKA 2GMTC 1SGQE 1ELDE 1O31A 1PPEE 3KEEA 5H4IB 2VVUA 3A83A 3Q3KA 3HK3B 4D8NA 4XDEA 1A5IA 1VJ9U 1B0FA 4ABJA 2ZDKA 1AWFH 4BANB 5GIBA 1GDNA 2QV1A 3M3VA 2PGQB 1O3KA 1SGNE 1L0ZA 1DUEA 1TE0A 1T7CA 1H9IE 3GCTF 1EB1H 2ZWLH 2OBQA 3QWCH 4VGCB 3SJIA 4B2CA 3P6ZB 3RXBA 1P05A 1QR3E 3LDXH 1TGTA 1BJVA 2WV4A 2O8UA 4YOGA 1ZHPA 5B6OA 3QDZB 3BN9A 1G3BA 1TQ7B 1HUTH 3ZV9A 1GBBA 1AMHA 2WUCA 4Y76A 1ESAA 2AEIH 1K1OA 2I6SA 2BY8X 3QGNB 2PKAA 4NZLA 4XBDA 1O5FH 2C8ZB 1NT1A 2ZZUH 3E1XB 1GBAA 5C5OA 1XKBC 1F0SA 3QZRA 2TGTA 1TPSA 2W3KA 3RU4T 1L1NA 1QQUA 1EASA 1EZXC 1PJPA 1THSH 1P2JA 2P3TB 1O2RA 4GCHF 4X6OA 1XUFA 1Q3XA 2ILNA 1HJ9A 1VITH 1BBRE 1FUJA 5JPMH 2FOBA 2ZGCA 5EQSA 4XOJA 1GBCA 1EOJA 3KCGH 1DWEH 1QTFA 1AZZA 4ZKRU 3QZQA 1DS2E 1GI3A 1E37B 1C5VA 2GZ7A 3P17H 1P01A 2JH6D 3AW1A 3GCTG 1Z1JA 5C1YA 4BXSA 2FOCA 5FCKA 1GBHA 2BVSH 4HGCA 3E0PB 1TMBH 4WMEA 2VU8E 4ABHA 1GMHF 3CS0A 3Q3XA 5E0JA 5FPSA 1F7ZA 1O2WA 1GBIA 4D9QA 1QJ7B 2PUQH 2G5NA 4AORA 3K9XB 3B23B 4MDSA 1JIMA 1O3HA 1Z71A 1TNJA 3BTQE 1NFUA 3BIUH 3K6YA 1GWAA 1JOUB 4JMYA 3SV2H 1WTHD 5LPRA 2ZA5A 4R0IA 1HLTH 3V3MA 2P93A 3LGYA 3SW2B 1S0RA 3A85A 1O38A 1GBJA 5SGAE 2SGFE 2GMTB 2HRVA 3T27A 1XKAC 1C2IA 4K1TA 4KTUA 2Z9JA 4DURA 2ALPA 1KLTA 1GBKA 1S5SA 3ATLA 3M35A 1TPPA 1K1MA 1RS0A 2H1UA 3A7TA 3BTKE 3MOCA 1S81A 3RMOH 4NG9H 2PSYA 3TGJE 2WPLS 1GG6C 1OP8A 1NPMA 3QGJA 4OS6A 1FPCH 2WPIS 4KTSA 3TK9A 1A0HB 1O3IA 3HGPA 5E8EH 1AU8A 2Y5GA 1T32A 5C1XA 3S9CA 4U32A 1P04A 1WTGH 4I8GA 1D6RA 1EP5A 3ZZ8A 1W12U 1EAUA 2XBVA 3W94A 2SGEE 1GI6A 2FOMB 3RXCA 3MTYA 1PPZA 4GHQA 3UR6A 3VGCB 1Z7KA 1C5YB 1V2OT 4GLYA 3MU1A 3UREA 2ZFRH 1UCYK 2ZFPH 5A8XA 1Y3WA 2J34A 1EPTA 1QL8A 1AWHB 3F9FA 1MKXK 2AIQA 1ABIH 1HIAA 2QN5T 4FUBA 2RG3A 4DT7B 1ZMLA 1G2LA 3SNDA 4K5ZA 3U8OH 1E35B 1XMNB 1SGYE 1SL3A 1VJAU 3UQOA 1D3DB 1TGNA 4QT8C 4A7IB 3F1SB 3S69A 1O30A 3LJOA 1C1NA 1SI5H 1B7XB 3ZYDA 4MLFB 1QRZA 1CBWB 1OWEA 5DK1A 2ZFFH 2OBOA 3BTFE 2Y7XA 3BSQA 3ELAH 2TGDA 1O2UA 4HTCH 3SI3H 4A1XA 1UCYH 1UVSH 1V2QT 1JRTA 4X1QU 2ODPA 1TOCB 2FX6A 1DXWA 1MKXH 1L2EA 1TAWA 3SORA 3BEIB 5K0HA 1UTKA 2DE8A 1KDQA 3RUOA 1FQ3A 1GHBF 4DJZB 2R0LA 1T31A 2PTCE 1MD8A 2PFEA 5AFZH 4BAQB 1U6QA 1QIXB 4NIWA 2ZF0H 1GI2A 4CRCA 1P11E 4IBLH 1JWTA 1AIXH 2G5VA 1CA8B 5F8ZA 1CQQA 1LHCH 2A4QA 2GV7A 3BV9B 1K1LA 2A2QH 1IQFA 1F0RA 4YLQH 1P8VC 3RXEA 2XYAA 4GVUA 4MPVA 3GISB 2PR3A 2PHBA 1HXEH 1W3CA 1FN6A 1EAXA 4I32A 2R0KA 4YZUA 1HAHH 4AZ2B 1QA7A 1TA2A 1L1JA 3GYMA 4MPXA 4OS4A 1A2CH 4ZUHA 1O3LA 4FUHA 4Z6AH 4UONA 1P2QA 3GICB 1P12E 1BTHH 1ELEE 2ZHDA 3M5MA 3K65B 1C5OH 2O8WA 3PTBA 1TGBA 4B71A 1SGFA 4D76A 1P0SH 1KLJH 5C20A 1N6YA 4WJG2 4RKJB 1G30B 5DP7A 4A5TS 1GHBG 1FY4A 1RFNA 1ZTJA 3SNEA 1OWJA 5DP4A 4CHAB 1MTVA 3ATMA 3QK1A 3P8NA 2VB0A 3UPEA 1EJNA 1DT2A 1HAYB 3A8BA 2F9VA 3ZVCA 3ZZ4A 2C93B 3PLPA 4ZHMU 1SBWA 2ODYB 1Z6JH 1KXCA 5T6FA 2XCNA 2VH6A 1TBZH 2QCYA 1BHXB 1O37A 5E0HA 1GHVH 1TNGA 1VR1H 5AVDA 4WF8A 2FI5E 1V2LT 5GCHF 5TJXA 1MH0A 3HGNA 2G52A 2A32A 1EP6A 3I29A 1DY8A 4JZDH 1FXYA 1MTSA 1UK2A 4AB8A 3TJUA 3PMHB 5CE1A 4CRFA 1Y5AT 1IQEA 3CENA 4D7FA 4YOIA 1YBWA 5IYTA 1LQDB 1LDTT 1TLDA 1E0FD 1BTYA 2P95A 2BYAX 1EQ9A 3TGKE 2JH0D 2G4TA 1Y8TA 2FIRH 1SGIB 3EA7A 3URCA 1O2VA 2LPRA 1BRAA 3Q00A 4UFGH 3MNSA 1GL0E 4UFFH 1H1BA 2M5TA 2AERH 4OGXA 1ZRKA 1D3PB 1D6WA 1M9UA 3SV6A 3TJVA 2ANWA 4Q7YA 1SGPE 1AZ8A 2V6NA 1V2KT 4BAOB 2SGAA 2HNTF 5CMXH 2Q6DA 4TWYA 4NIVA 5LPEA 1JRSA 1O2IA 2BDGA 2Y82A 2J95A 1W11U 1RJXB 2ZKSA 1YGCH 6LPRA 1TGCA 1YM0A 2FI3E 2ODQA 2DUCA 1ESBA 1YPGH 4FXGH 5GCHG 2HLCA 4AFUA 3R0FA 1T8NA 3F9GA 4X2WA 3DUXH 4X6NA 3FP7E 4FVDA 3L6PA 1W13U 3U69H 3UTUH 1O5BB 2R2WU 1MTWA 2V35A 3A86A 1ZMNA 4AFZA 3MU0A 1SQAA 1K22H 1HYLA 1DY9A 1UTPA 1C1UH 2P8OB 1BCUH 1ZYOA 1O5EH 5IDKA 4I31A 2OC7A 2Q6FA 4NZQA 4ISHH 1OOKB 2BDIA 1CSOE 1JBUH 3U1JB 1ETSH 1GHAF 4ABGA 1YPKH 2ZU1A 4BXWA 2ZDLA 1V2NT 1RIWB 1TMUH 2H9EH 1ELVA 2O8TA 4DGJA 1O5GH 2V3HH 3P95A 1XUGA 2AGIX 4CREA 1WYKA 1UK4A 1C5WB 3VB3A 1IQIA 2BD7A 1BRBE 1CT0E 1O2QA 4FU9A 3OX7U 2CXVA 4NCYA 2HALA 4XSKU 5L2YH 4UFDH 4OS1A 2YNBA 2IJOB 2FLBH 1UTJA 1YPLH 2BY6X 1HAIH 5EPYA 2R3UA 1CGJE 1ZR0A 2W3IA 4VGCC 5HMAA 2BM2A 2Y6TA 4ZROA 1RRKA 1FIWA 3NK8A 4Q7XA 1CO7E 2UUFB 3RXGA 1Y3XA 1ZSJA 1GI7B 3SGBE 1QJ1B 1Y5UT 2XBWA 4KELA 1NRNH 1TBRH 3A7ZA 3LIWA 3V13A 5DP9A 2PV9B 2A5KA 1QQ4A 3TJOA 2GT7A 1DOJA 5DO4H 1GBDA 1KXAA 1GHAG 3MWIU 5GJ4B 4X1SU 4Q80A 3UR9A 1MCTA 1ZLRA 2FEQH 1YLCA 1JIRA 3GY2A 5JBAS 5TCCA 4AOQA 5DP8A 1GI4A 3BTGE 2BHGA 5AHGH 2A7CA 2ZO3H 1BMLA 2CHAB 1BUIA 2H9TH 1AB9C 2RA3A 1QJ6B 4INHA 3M7UA 4O3TA 2GZ9A 4Q2KA 1FNIA 1TMTH 1A5HA 3OTJE 4ABAA 5LH8A 1EJMA 5C3NA 1F0UA 1FONA 3PROA 1GI1A 1V6DA 2GP9B 2C4FH 1EZQA 1C5MD 1UVPA 4XBCA 1THRH 2FS8A 3TITA 1QBNA 2ZQ1A 4MVNA 1WV7H 4MPWA 4E7NA 2VIVA 3UFAA 2QAAA 2BDBA 2ZHWH 2OQUA 1CHGA 5JBBS 1YC0A 1AFEH 1FPHH 4PROA 2CGAA 1LCYA 4J1YA 1AUTC 4AYVB 2ANYA 1C9PA 4IN2A 4IGDA 3PLBA 2SGPE 3SJ9A 2ZDNA 1JXPA 1EOLA 3ZZBA 4JK6A 3SN8A 3TNTA 3AAVA 2BLQA 2XCFA 4BTIB 3Q3YA 3SUDA 7ESTE 4X1RU 1MTNC 2XRCA 1Z1IA 3A81A 2A31A 3P92A 4XBBA 5JBTA 2OXSA 3GY3A 1TFXA 1RD3B 1HJAB 1GBLA 2R3YA 3SU4A 5F8TA 1V3XA 2FOEA 1DM4B 3BTEE 2FOFA 3KN2A 4B2BA 2I6QA 1BRUP 3ATIA 1PQ5A 3MI4A 3T26A 1MQ5A 3LKWA 1NRQH 1SGRE 1UMAH 4AGJA 3M36A 1ZTLA 3OSYA 4LXBH 2FOGA 3RU4E 5GXPA 3A8AA 4ABFA 1FAXA 4YLUA 1BTWA 2VVCA 3ZVGA 3GDSA 3URDA 1CT4E 4NGAH 3SU5A 1HJ8A 3P8OA 1KTSB 2O8LA 1BA8B 2JETC 3SOSA 1D9IA 1TX6A 2FOAA 2PTNA 4LZ4B 3RXIA 1FLEE 3SHCH 1RGQA 1C1QA 1Z8IB 5EODA 1AVGH 1QRXA 5DP6A 3FZZA 1NC6A 1PFXC 4CRDA 1O39A 1GMCG 3UIRA 1K2I1 2OC1A 5C67A 1MU6B 4Y10E 3PO1C 3VGCC 1TNLA 3LH1A 4FUIA 1QB9A 1C1PA 1DLEA 2OTVA 5FAHA 3MFJA 2BD8A 4WWYA 3M3TA 1HV7A 2BZAA 4O97A 2A7JA 1SGFG 1D3QB 2GD4B 1O3MA 8KME2 4JZ1A 2BDYA 3SU0A 4B74A 5GDSH 1AN1E 1NTPA 1EX3A 1QURH 4AGKA 1EUFA 3SUFA 1AUJA 3A89A 1CT2E 1XUHA 4E06H 4YT6H 4JK5A 2STBE 1HAPH 1ZGVA 1ESTA 1A46H 2P16A 3KQBA 2FXRA 1PPGE 1AB9B 1INCA 2F9OA 3RXKA 2BZ6H 4JCNA 3MNBA 4X2XA 1CBWC 2Z3DA 2BVXH 2WPJS 3H5CB 1HAVA 3SQEE 2B9LA 2EI8A 2A4GA 1QHRB 4TPIZ 2V3OH 3P8FA 5EXMA 1BRCE 2THFB 2H6MA 5EQQA 4E05H 1TNIA 2EEKA 2Y7ZA 3A7XA 1O3FA 1DVAH 3E90B 1AFQB 1UO6A 3FZDA 1J17T 2F91A 1DPOA 2Z6BD 1QB6A 1ANCA 2QC2A 1L4DA 3SJKA 2GT8A 2LNCA 3MO6A 7LPRA 1C5PA 2FWWA 1A3EH 1O2GH 2VGCC 4FU8A 4D7GA 1C1OA 1LPGB 1YKTA 3LGVA 5EQRA 2PSXA 2ZCLP 5EXNA 1ZPCA 1MTNB 5TCAA 2FMJA 4Y6DA 3U8TH 1YPJH 1MZDA 1E34B 3LT3A 2ALVA 2ZTXA 4MQAA 8ESTE 4BTUB 4H6SB 3MH7A 4ZH8A 1NS3A 1UJ1A 2EC9H 4X1NU 1XUKA 1O5AB 1O0DH 4FUGA 2FTLE 1KY9A 4ZXXH 2G8TA 4IC6A 3U98H 5DGJA 1C5TA 5C2ZA 1QBVH 2ZFQH 3TH4H 1T4VH 4DW2U 3HKJB 3VEQB 1UVUH 1P09A 3M61U 1SOTA 3ZVFA 4K8YA
chains in the Genus database with same CATH superfamily
3RXFA 4WH8A 4JZIA 1H8IH 2ANMH 1C2GA 2FOHA 1SHHB 2BY7X 2XC5A 3G01A 3MQKC 3SJ8A 5DP3A 3TK5A 3HK6B 4K1SA 2JETB 1P2MA 3PMAB 1H8DH 1HNEE 4WXIA 4X6MA 4CRBA 2CN0H 1W2KH 2C90B 1F92A 3PWCA 4J2YB 2GDDA 3IWMA 1FZZA 3BG4B 4CHAC 3BTHE 1E36B 1P10A 2AS9A 1ZGIA 1GI8B 2BOHB 1J8AA 2BLOA 3PO1B 3QN7A 2C8YB 2ZCHP 1G9IE 1DWDH 1WCZA 3RXHA 1O2JA 2AGGX 3NCLA 2C3SA 1NESE 2VH0A 2BB4A 2ZEBA 3RMLH 1YF4A 2RDLA 1SQOA 2UWPA 3SV7A 5G4BA 2R9PA 3KQDA 5DG6A 3A7YA 3PYHA 3BEFB 2A5IA 3TLOA 1GCTB 1J9CH 3E8LA 2A5AA 2BLVA 2BQ7B 3S9BA 3LC3A 3F0PA 2F9UA 1O3OA 3RC5A 1GBMA 3RXJA 4UFEH 3ZVBA 2FP7B 3PMJA 1O2SA 3EDXB 1GHZA 2ZU3A 1KSNA 1C4V2 4FU7A 5F8XA 3BEUA 1LHFH 1C4U2 1RTFB 3MH6A 1AQ7A 4X8UH 3N7EA 1Z8RA 2FO9A 1J15A 3GY8A 1GBTA 3O8RA 1O2HA 4GPGA 3ZZ3A 1O3AA 3KYFA 3MYWA 3VB4A 4I86A 2YMSD 6CHAB 4NSVA 1VGCB 2XNDD 2XTTB 1HRTH 2QXJA 4Y11E 3S9AA 7KMEH 9ESTA 1AKSB 4BTTB 4NA9H 3OU0A 1GHYH 1YP9A 3A7WA 3M7TA 3HATH 1DLKB 2QXHA 2BD5A 3T62A 2AH4X 3ATWA 4NFEA 3H09A 2YNAA 3ESTA 1UHBA 2XOKD 2J98B 2TGAA 3GCOA 4HG6A 4ZAEA 1HAOH 2PP6A 3LH3A 2JH5D 2VGCB 3A84A 1A4WH 2ZHQH 1NRSH 3ZZAA 3QLPH 1C2DA 1UTMA 1HPGA 5A2MH 2GGVB 1O33A 4FUCA 3RMMH 2FDAA 1XUJA 3SZEA 3T5FH 4TY6A 1AHTH 3RXVA 1NZQH 1OX1A 1GJ4H 2P8OC 2GZ8A 2P94A 3EA9A 2BLWA 1NY22 3RLYH 1QA0A 4IN1A 1XXDA 2J38A 3L3TA 1RIWC 2ZPRA 1FY1A 1QL7A 3FAOA 1O3GA 5EJLA 2Z3EA 1LVMA 5T6DA 1ANDA 2PGBB 1XVOA 2NWNA 2XWAA 1A0LA 1EJAA 2AYWA 1MBMA 1UCYE 1SMFE 1DE7H 1KLIH 4KGAA 4H4FA 1GJ6A 5E2OA 2UWLA 1SSXA 2KAIB 4ACBA 3LONA 5HM9A 2QXGA 4AYYB 2VWLA 2ZQ2A 3A7VA 3EA8A 1LHGH 4CRAA 5GNDA 1GJ7B 3OY5U 3UQVA 1IQLA 4AB9A 3FP6E 2PLXA 1BMNH 3CP7A 1DDJA 5C0TA 1KXBA 1SB1H 3SBKA 2ASUB 3TGIE 1T8MA 1DSTA 3RXRA 1P3EA 2QXIA 3D23A 4MG3A 4NFFA 3MMGA 1K1IA 3M5NA 3LOXA 3ZVDA 4BAHB 2BQ6B 1E38B 3RU4D 1O2NA 5ESTE 2JKHA 2BY5X 2Z94A 1QL9A 1ZJDA 3SU2A 4JYVH 1P03A 2P3UB 2J92A 1YLDA 1SQRA 2HNTE 3DT0H 2CF9H 3U9AH 4I33A 3C1KA 3UY9A 1MMJN 1QFKH 2VWNA 3B9FH 4ESTE 5B6LA 5C94A 2Z3CA 5DJ7A 3BTME 5ESBA 2CHAC 1UK3A 1C5SA 3RDZA 1H8ED 2F43B 3VXFH 1TNKA 4BAKB 4MPUA 1DWCH 4YXWD 1GVKB 2XWBI 3GY6A 2WINI 2F83A 2EY4C 1NFYA 1GDUA 3M5OA 4DCDA 2PKAB 3RXOA 1GMDG 2H9HA 1A3BH 3PM3A 2B5TB 3A8DA 1SGCA 1HAGE 2BXTH 1TPOA 2A45B 4I8KA 3N99A 2ZDVH 1K9OE 1DFPA 1YPMH 2BD4A 2SGDE 1CU1A 1O3CA 4B73A 3V12A 4K60A 1QB1A 3KQEA 1WAYB 1NROH 1LHDH 3O8DA 4MNXA 2AMDA 4ZKNU 1ZOMA 3N7OA 1Y5BT 2G51A 2W5EA 1OXGA 3NPSA 2JJ2D 4Y8YA 2ZGXH 2CF8H 4A1VA 3PLKA 4X8VH 2SGQE 1AVWA 2BX4A 4ZHAA 1S83A 4CRGA 3MH5A 1CGIE 1ZSLA 1ZJKA 1OWDA 1Y59T 1O3BA 3ENSB 5EW1H 1SR5C 5HXFA 3SU1A 1F5LA 3RM2H 1YPHE 1TX7A 3GCNA 1TRYA 5GWZA 1WSSH 1FN8A 4ZHLU 1OKXA 1IOEA 1HJAC 4M7GA 1EXFA 2B0FA 1BMAA 3Q76A 2BTCE 5EXLA 3LGIA 4K1EA 4HI3A 2YMSC 1C1RA 5JB9S 2J5UA 1BTXA 2FS9A 2F9BH 3MU5A 2Y80A 1O2MA 3GDUA 4IC5A 3A88A 3JZ2B 4Y0ZE 3NZIA 2BD3A 5J4QA 1GBFA 3SJOA 3SGQE 1XX9A 1LKAA 1PQ8A 1QZ8A 1TPAE 5E0GA 1FIZA 4KKDA 4BOHA 1NO9H 5JDUB 1QBOA 3EE0B 1O35A 2C8XB 1DUAA 3AW0A 2D26C 1HDTH 3FO8D 2TBSA 3UNQA 5FHTA 3CS7A 3TNSA 4BNRA 2NU2E 1QGFA 3ZZ6A 1BIOA 3EQ0H 2QYIA 1UVOA 3U8RH 1GVZA 5EOKA 4U2WA 1B5GH 2RCEA 3TVJB 2QY0B 3ODFA 2AMQA 2ZPQA 2BQWB 2A4OA 2NU3E 1LPZB 5HM2A 3D65E 4I8HA 1GJBB 2K0QA 1W8BH 1BT7A 3MO9A 2UUKB 3C27B 3F2GA 1GJ9B 1WUNH 3GDVA 4XD7D 3S7KB 1PQAA 2VNTA 3TPIZ 4CH8B 5J4SA 1GHWH 4B1TA 5A0CA 1NN6A 1ELCA 3E0NB 1C9TA 4OS7A 4UE7H 2NU1E 3MU4A 2O9QA 5GPIB 1W7GH 3SV8A 4CR5A 1HAZB 2OLGA 3UOPA 1ZTKA 1ZSKA 4FUDA 1O2YA 3FANA 4FOUC 2RA0A 2OINA 5FX5A 1K1PA 1KXEA 3RXMA 1P9UA 2Y5FA 1SC8U 1SHYA 2Y5HA 2ZTYA 3CNRA 1PPHE 4DIIH 1A7SA 1EPTB 8LPRA 4X1PU 3ZV8A 3BTWE 1OWHA 2NU0E 1UTQA 8GCHG 3ZZCA 2GCTB 1JMOH 2J9NA 3PB1E 4M9FA 1AO5A 1FY3A 2UUJB 9LPRA 5L30H 4X8TH 1HIAB 2A2XH 2AFQB 4JZEH 2K1QA 1AFQC 1NRRH 4B76A 3IG6B 3KYGA 1OS8A 1B0EA 2Y81A 2G55A 2CJIA 2ZI2H 3H7TA 3TK6A 1CA0B 1GMCF 3RXTA 1HGTH 2BVRH 3SUGA 3OY6U 3S0NA 2CV3A 3HKIB 1BITA 2PWXA 3F9EA 1G3CA 3VB7A 3F9HA 4TWWA 2UUYA 2IPQX 1Z6EA 2VIPA 1P06A 2TGPZ 1H4WA 2VWMA 5DKMA 5JBCS 3PTNA 1BBRK 4X2VA 1UTLM 5HKKD 2QF0A 1O5DH 1C1TA 1W0KD 2OCVB 4DOQA 2DE9A 1OWIA 2KAIA 2V7QD 2YMSB 2ZU4A 1IHTH 3PWBA 4JYTA 1Y3UA 1C5LH 1KDQB 3PV4A 3SV9A 1F0TA 3OTPA 3S7HB 3RC6A 1C4Y2 1W10U 1HFDA 3EYDA 2EI6A 3UNSA 1PPCE 1THPB 5FX6A 1G3EA 1KIGH 1A5GH 1SGEE 2AMPA 4RT0A 2ZHFH 3SI4H 2TRMA 5FBEA 3KQCA 1TX8A 1ELFA 1DXPA 4ASHA 1OPHB 1Y3YA 6ESTA 1SOZA 1RTLA 1ELAA 4AN7A 2ZPSA 4Y8ZA 3E16B 3DSPA 1WBGB 2WYGA 3BG4C 3F0OA 3RP2A 1ARBA 1DX5M 1LVYA 3VB5A 2L6OA 1BBRH 1SLWB 1O2TA 3BG8A 3O8BA 3TU7H 4A1TA 4INKA 1P3CA 2Z9GA 1S84A 2KCOA 4A6LA 4TSFD 1K1NA 4TPYA 1AI8H 2ZFTA 4P00A 1P02A 5JYIA 2IPHA 2QF3A 2B7DH 2VIOA 1X7AC 3ZIAD 1DANH 2C8WB 1G2MA 3NWUA 2ZFSA 1TQ0B 2FI4E 1G37A 1O2PA 2ZCKP 5A0BA 2SNWA 1AD8H 2G4UA 1GCTC 1S82A 5FPTA 3UNRA 1N8OC 4RSPA 2BXUH 4Y8XA 3QX5H 1C1WH 2ZC9H 1HAXB 3IITA 3KF2A 1LVOA 4KTCA 3AVZA 2ZTZA 1LHEH 5HGGA 2W26A 1GPZA 2J94A 1P57B 2H5DA 3A8CA 5F03A 2Z9KA 4CR9A 3VFEA 1BMFD 2PUXB 3W95A 2BMGB 3D49H 5T3HA 6GCHF 3LPRA 4B2AA 1SLXB 2BY9X 4XE4A 1O2KA 2WYJA 6CHAC 1VGCC 1GBEA 2PW8H 2A0QB 5A09A 2ZNKH 2M2AA 4Q7ZA 3WY8A 4Y7BA 2W7SA 5JB8S 4LZ1H 1XUIA 1Z8GA 3DFJA 3PMBB 1IHSH 1QY6A 3ITIA 4OGYA 4B75A 5EG4A 4FUFA 3RMNH 1OP2A 2FM2A 3V0XA 5EW2H 1A61H 4IMZA 4MNWA 4CH2B 1EATA 2QGRA 1W0JD 2HPQH 1D4PB 1DWBH 2QF4A 3SU3A 3U28C 4TT3D 4Y71A 3SQHE 3VPKA 2A4RA 1CHOF 2VJ1A 3SZNA 3MNCA 2XC0A 4UEHH 1F5KU 2FPZA 4JYUH 3TIUA 1UW7A 4JZFH 1C5RA 2A1DB 1IQMA 1SVPA 1ELTA 3Q77A 5E2PA 2J4IA 1YY3A 1BQYA 1ID5H 1TYNA 1WXRA 3QO6A 2BX3A 4X6PA 1V2UT 4WMDA 2QF5A 3KL6A 4H42U 2FYQA 3LGTA 1GL1A 1V2MT 3A80A 4DG4A 1G36A 4YTAA 1MCVA 4AG2A 3RC4A 3SNAA 4KP0A 1GVLA 1PPBH 4YESB 6GCHG 5CHAB 2ZP0H 5L6NH 4IMQA 3T2NA 1W0YH 4NWLA 3SU6A 2WUBA 4GCHG 1TWXB 1IQKA 3LJJA 3RXAA 1WQSA 4GUXA 3UWJH 3JZ1B 2G00A 1PQ7A 2A7HA 4RN6A 4YOJA 1V2RT 2BDHA 1TOMH 1ELBA 2QE7D 1OHHD 1F2SE 2ZG0H 2ESTE 1O2OA 2P59A 1MBQA 2BD9A 1SLVB 4O3UA 3U1IB 1C5XB 1C5ZB 1S85A 2FZZA 4ABDA 1UVTH 2HPPH 1C2KA 4OS5A 5BRRE 5FXLA 1CHOG 1BTZA 1VITF 4RT1A 1GMHG 1C2MA 2VIQA 4ISNA 1S6FA 2LP6A 5EU8A 4I8LA 3ZYEA 1MAYA 3V7TA 3NXPA 1K28D 3SHAH 4DY7B 2Z9LA 4IS5A 1ELGA 2ZDAH 1GGDC 2HGTH 2EA3A 1UTNA 4WVPE 4AX9H 1O32A 1PPFE 1TA6A 1WOFA 3WW7A 1N8OB 2KM0A 1LO6A 1ANEA 2QA9E 1SFQB 1OP0A 2Z7FE 3BF6H 1IQJA 3MO3A 1V2JT 2ZDMA 1AVXA 3OFND 4UDWH 3KIDU 1IQGA 1C2JA 4K69A 3NKKA 4ZCNA 1P2OA 3GY4A 3M7QA 4FUEA 4OS2A 4AC9A 1GI5A 3UOUA 1BJUA 1V2VT 1LKBA 2VINA 4F49A 2PKSC 4WMFA 4CBOA 1GJ8B 1TRNA 1FY8E 1N1LA 3T25A 1O2XA 3ZVAA 4DVAU 1AY6H 1GJDB 2F3CE 3LU9B 4ZMAH 2WPDD 2ULLA 5L2ZH 1OYTH 5I46H 1VITG 3FVFB 1C1MA 1S0QA 3O8CA 1RTKA 3BIVH 4RKOB 2OP9A 2VIWA 1O3NA 1C2LA 3MH4A 2ZHEH 5C5NA 1CE5A 5ABWA 1HBTH 3BTDE 2ZU5A 1O2ZA 3VXEH 1IQNA 1SGDE 4ABIA 1TABE 1V2ST 1NFXA 1MTUA 1Y3VA 3KGPA 4UD9H 3DFLA 5DPAA 1EB2A 1NU9A 2ANKH 3E6PH 2ZGHA 1BTPA 2ZGJA 2VVVA 3TJNA 4ABBA 1T8LA 1OSSA 4NIXA 5EPNA 3RXSA 1GHXH 2XNIA 1O36A 3A82A 2G81E 2IN2A 4MTBA 1OYQA 1C2FA 3F68H 4ASUD 1Q31A 5C0UA 2FESH 3K2UA 4FUJA 3QTOH 3T29A 2STAE 3M37A 1YPEH 1BHXF 2XBXA 3RLWH 2WPKS 1T8OA 2O8MA 1J16A 1TRMA 2Q1JA 4YO9A 2P3FH 2F9PA 2IOTA 1SPJA 4Y7AA 2JIZD 4GSOA 2B8OH 1NU7B 4Y79A 2EI7A 3E3TA 4I8JA 3SNCA 4NIYA 3ZZ5A 1FAKH 2HNTC 5PTPA 4AG1A 1LQEA 1EAIA 1QNJA 4AFQA 3SNBA 1Q2WA 1ZPBA 2R2MB 1P9SA 2V3MA 3I78A 2KCYA 1T4UH 1YYY1 3F2HA 1GI9B 1ETRH 1GMDF 3HPTB 1AGJA 1PYTD 4I7YH 4LOYH 1GG6B 1BMMH 5EIYA 1O5CB 5LPFA 3ZZ9A 4MNVA 3GY5A 3L33A 3DHKH 3OEHD 1K21H 4THNH 3UWIA 1GCDA 1ZMJA 1FY5A 3ODDA 1ORFA 3RXDA 3TH2H 1WQVH 1K1JA 1O3PB 1G32B 5F6MA 5C1UA 3GOVB 4GAWA 1V2WT 4R8TB 5LGOA 2XC4A 4TYDA 3GY7A 1GGDB 3P8GA 1RXPA 2W7UA 2H2ZA 1G3DA 1NBME 3RXQA 2GCHF 3GCHC 7GCHF 1BTUA 1ANBA 4K2YA 4NWKA 2XBYA 5FBIA 1Z8JB 2OUAA 3EAJA 3DD2H 1S6HA 1F5RA 5AF9H 1ETTH 1TNHA 1NFWA 3FFGA 1EAWA 1LTOA 4ABEA 5FCRA 1YPHC 4BAMB 4Z1MD 3F6UH 4O03A 2WPHS 3T28A 4ZKSU 3I77A 4WXVA 3SGAE 1O2LA 2GX4A 2PKSB 2VWOA 1EPTC 1C5QA 1A0JA 1L1GA 5FPYA 2Z9IA 4HFPB 1IAUA 4Y0YE 3K6ZA 1CVWH 2GCTC 3M5LA 3UUZA 1W7XH 2FLRH 5A0AE 1C1SA 1TIOA 2SNVA 4X8SH 1YCPM 4ISLA 5CDFE 1MZAA 4LK4A 2XXLA 3P70B 5K7RA 3DA9B 1GI0A 1C1VH 1DICA 3NUMA 2AGEX 1CA0C 2SFAA 1O3JA 1TGSZ 4FVBA 1KTTB 5I25A 5AFYH 1MUEB 2GCHG 2V0BA 1IQHA 7GCHG 1MU8B 1HAVB 1MKWK 1TBQH 3BTTE 1XXFA 4K3JA 3RM0H 1V2PT 1QCPA 1VCWA 1P2IA 3R3GB 4E7RG 3AASA 1KYNA 3AAUA 1P2NA 1EKBB 2F4LA 1HCGA 4GHTA 1ZPZA 2GV6A 2GVFA 4Z0KA 1O3EA 3D62A 4NSYA 2NU4E 4DIHH 1EZUC 3MU8A 1FV9A 2HOBA 3QUMP 1ZHMA 2GJGA 2ZU2A 2JJ1D 4O9VA 2OC0A 1AE5A 2BDAA 2FODA 2OD3B 4U30A 2FX4A 2AHME 1OWKA 3STIA 5DN6D 2F9NA 1C2EA 1KXFA 1ARCA 3STJA 4SGBE 5ETXA 1LVBA 4A92A 3RXUA 3DSOA 1MKWH 3QTVH 2ZIQH 2LELA 1ACBE 8GCHF 2UWOA 1FI8A 2FYRA 3KHVA 1KMHB 1NRPH 1L4ZA 1FDPA 3TH3H 1CGHA 3OYPA 2H5CA 1HB0B 3SUEA 1W0ZU 3EGKH 2J2UA 2HVXA 1H9LB 2Q6GA 2D2DA 5KECA 4INLA 1C5UA 4RI0A 1HXFH 2TIOA 1XVMA 2OK5A 3ZVEA 1D3TB 1VZQH 1DSUA 1A1RA 2AIPA 1UTOA 2OC8A 1TB6H 2ZGBH 4H6TA 4NA7A 1QRWA 4TY7A 3GCHB 3F3BA 1SLUB 3PRDA 5HYOA 1ZZZA 3E91A 4X0WU 1AE8H 2GKVE 3PV5A 2BDCA 4D9RA 1NM6A 2D1JA 3SYJA 1SQTA 3LGUA 1C5NH 1VCQA 3FP8E 1PYTC 1ABJH 1AKSA 2OQ5A 3SO3A 4HZHA 2WV5A 1ZHRA 4WH6A 3RXLA 5FL7D 1SG8B 2XW9A 2HLDD 1MQ6A 1MAXA 3ZZDA 1TALA 1H9HE 1W14U 2QIQA 4CBNA 1YCPK 4XFQA 2VIDA 1V2TT 2J98A 4ISOA 1WU1A 1KXDA 1GJ5H 1EZSC 4P02A 1TONA 2TPIZ 1MD7A 2GTBA 3KNXA 4U01A 3RXPA 2HWLB 2WPMS 1BDAA 2WHXA 1SGTA 1C2HA 4NA8A 3A87A 1GJCB 1ZRBA 4YT7H 5A8ZA 3LC5A 1VCPA 3ZZ7A 5A8YA 2J97A 3MHWU 3MNXA 1N6XA 3VB6A 3LGWA 1LPKB 1J14A 5EJ1A 3H7OA 4YM9A 5T6GA 4Q63A 2ZECA 1BB0B 4IW4E 2BOKA 4X2YA 4ZXYH 1EFRD 2L74A 1XM1A 2BD2A 1BOQA 1LMWB 5BPEA 2FTMA 3GYLB 4F4OC 1VKYA 1YCPH 4ISIH 1FMGA 1DITH 1GJAB 4SGAE 5DP5A 1FJSA 1UHBB 2CMYA 5CHAC 2D8WA 3B8JA 1P2KA 3M3SA 2YOLA 4K8BA 4WY3A 5EGMA 4MNYA 1O3DA 1BZXE 4Q4LA 1O34A 1GDQA 2GDEH 1SFIA 1E79D 4ZKOU 2RFKC 3ATKA 2GMTC 1SGQE 1ELDE 1O31A 1PPEE 3KEEA 5H4IB 2VVUA 3A83A 3Q3KA 3HK3B 4D8NA 4XDEA 1A5IA 1SKYE 1VJ9U 2KFWA 1B0FA 4ABJA 1H8HD 2ZDKA 1AWFH 4BANB 4OM9A 5GIBA 1GDNA 2QV1A 3M3VA 2PGQB 1O3KA 1SGNE 1L0ZA 1DUEA 1TE0A 1T7CA 1H9IE 3GCTF 1EB1H 2ZWLH 2OBQA 3QWCH 4VGCB 3SJIA 4B2CA 3P6ZB 3RXBA 1P05A 1QR3E 5CHBA 3LDXH 1TGTA 1BJVA 2WV4A 2O8UA 4YOGA 1ZHPA 5B6OA 3N7DA 3QDZB 3BN9A 1G3BA 1TQ7B 1HUTH 3ZV9A 1GBBA 1AMHA 2WUCA 4Y76A 1ESAA 2AEIH 1K1OA 2I6SA 2BY8X 3QGNB 2PKAA 4NZLA 4XBDA 1O5FH 2C8ZB 1NT1A 2ZZUH 3E1XB 1GBAA 5C5OA 1XKBC 2K8IA 1F0SA 3QZRA 2TGTA 1TPSA 2W3KA 3RU4T 1L1NA 1QQUA 1EASA 1EZXC 1PJPA 1THSH 1P2JA 2P3TB 3UB0A 1O2RA 4GCHF 4X6OA 1XUFA 1E1QD 1Q3XA 2ILNA 1HJ9A 1VITH 1BBRE 1FUJA 5JPMH 2FOBA 2ZGCA 5EQSA 4XOJA 1GBCA 1EOJA 3KCGH 1DWEH 1QTFA 1NBMD 1AZZA 4ZKRU 3QZQA 1DS2E 1GI3A 1E37B 1C5VA 2GZ7A 3P17H 1P01A 2JH6D 3AW1A 3GCTG 3OAAD 1Z1JA 5C1YA 4BXSA 2FOCA 2KR7A 5FCKA 1GBHA 2BVSH 4HGCA 3E0PB 1TMBH 4WMEA 2VU8E 4ABHA 1GMHF 3CS0A 3Q3XA 5E0JA 5FPSA 1F7ZA 1O2WA 1GBIA 4D9QA 1QJ7B 2PUQH 1FX0B 2G5NA 4AORA 3K9XB 3B23B 4MDSA 1JIMA 1O3HA 1Z71A 1TNJA 3BTQE 1NFUA 3BIUH 3K6YA 1GWAA 1JOUB 4JMYA 3SV2H 1WTHD 5LPRA 2ZA5A 1COWD 1HLTH 4R0IA 3V3MA 2P93A 3LGYA 3SW2B 1S0RA 3A85A 5T1VA 1O38A 1GBJA 5SGAE 2SGFE 2GMTB 2HRVA 3T27A 1XKAC 1E1RD 1C2IA 4K1TA 4KTUA 2Z9JA 4DURA 2ALPA 1KLTA 1GBKA 1S5SA 3ATLA 3M35A 1TPPA 1K1MA 1RS0A 2H1UA 3A7TA 3BTKE 3MOCA 1S81A 3RMOH 4NG9H 2PSYA 3PV2A 3TGJE 2WPLS 1GG6C 1OP8A 1NPMA 3QGJA 4OS6A 1FPCH 2WPIS 4KTSA 3TK9A 3FOAA 1A0HB 1O3IA 3HGPA 5E8EH 3UAIC 1AU8A 2Y5GA 3DSGA 4XRNA 1T32A 5C1XA 3S9CA 4U32A 1P04A 1WTGH 4I8GA 1D6RA 1EP5A 3ZZ8A 1W12U 1EAUA 2XBVA 3W94A 2SGEE 4DT4A 1GI6A 2FOMB 3RXCA 3MTYA 1PPZA 4GHQA 3UR6A 3VGCB 1Z7KA 1C5YB 1V2OT 2CK3D 4GLYA 3MU1A 3UREA 2ZFRH 3KQ5A 2W6JD 1UCYK 3EE7A 5F53A 2ZFPH 5A8XA 1Y3WA 2J34A 1EPTA 1QL8A 1AWHB 3F9FA 1MKXK 2AIQA 1ABIH 1HIAA 2QN5T 4FUBA 2RG3A 4DT7B 1ZMLA 1G2LA 3SNDA 4K5ZA 3U8OH 1E35B 1XMNB 1SGYE 1SL3A 1VJAU 3UQOA 1D3DB 1TGNA 4B6FA 4QT8C 4A7IB 3F1SB 3S69A 1O30A 3LJOA 1C1NA 1SI5H 4AFSA 1B7XB 3ZYDA 4MLFB 1QRZA 1CBWB 1OWEA 5DK1A 2ZFFH 2OBOA 3BTFE 2Y7XA 3BSQA 3ELAH 1K0HA 2TGDA 1O2UA 4HTCH 3SI3H 4A1XA 1UCYH 1UVSH 1V2QT 1JRTA 4X1QU 2ODPA 1TOCB 2FX6A 1DXWA 1MKXH 1L2EA 1TAWA 3SORA 3BEIB 5K0HA 1UTKA 2DE8A 1KDQA 3RUOA 1FQ3A 1GHBF 4DJZB 2R0LA 1T31A 2PTCE 1MD8A 2PFEA 5AFZH 3WWBA 4BAQB 1U6QA 1QIXB 4NIWA 2ZF0H 1GI2A 4CRCA 1P11E 3DCLA 4IBLH 1JWTA 1AIXH 2G5VA 1CA8B 5F8ZA 1CQQA 1LHCH 2A4QA 2GV7A 3BV9B 1K1LA 2A2QH 1IQFA 1F0RA 4YLQH 1P8VC 3RXEA 5HIYA 2RDEA 2XYAA 3OEED 4GVUA 4MPVA 3GISB 2PR3A 2PHBA 1HXEH 1W3CA 1FN6A 1EAXA 4I32A 2R0KA 4YZUA 1HAHH 4AZ2B 1QA7A 1TA2A 1L1JA 3GYMA 4MPXA 4OS4A 1YWUA 1A2CH 4ZUHA 1O3LA 4FUHA 1S6LA 4Z6AH 4UONA 1P2QA 3GICB 1P12E 1BTHH 3F2FA 1ELEE 2ZHDA 3M5MA 3K65B 1C5OH 2O8WA 3PTBA 1TGBA 4B71A 1SGFA 4D76A 1P0SH 1KLJH 5C20A 1N6YA 4WJG2 4RKJB 1G30B 5DP7A 4A5TS 1GHBG 1FY4A 1RFNA 1ZTJA 3SNEA 1OWJA 5DP4A 4CHAB 1MTVA 3ATMA 3QK1A 3P8NA 2VB0A 3UPEA 1EJNA 1DT2A 1HAYB 2KCAA 2F9VA 3A8BA 3ZVCA 2C93B 3ZZ4A 3PLPA 2VBCA 4ZHMU 1SBWA 2WSSD 2ODYB 1Z6JH 1KXCA 3NRLA 5T6FA 2XCNA 2VH6A 1TBZH 2QCYA 1BHXB 1O37A 5E0HA 1GHVH 1TNGA 1VR1H 5AVDA 4WF8A 2FI5E 1V2LT 5GCHF 5TJXA 1MH0A 3HGNA 2G52A 2A32A 1EP6A 3I29A 1DY8A 4JZDH 1FXYA 1MTSA 1UK2A 4AB8A 3TJUA 3PMHB 5CE1A 4CRFA 1Y5AT 1IQEA 3CENA 4D7FA 4YOIA 1YBWA 1WDIA 5IYTA 1LQDB 1LDTT 1TLDA 1E0FD 1BTYA 2P95A 2BYAX 1EQ9A 3TGKE 2JH0D 2G4TA 1Y8TA 2FIRH 1SGIB 3EA7A 3URCA 1O2VA 2LPRA 1BRAA 3Q00A 4UFGH 3MNSA 1GL0E 4UFFH 1H1BA 2M5TA 2AERH 4OGXA 1ZRKA 5C17A 1D3PB 1D6WA 1M9UA 4F48B 3SV6A 3TJVA 2ANWA 4Q7YA 1SGPE 1AZ8A 2V6NA 1V2KT 4BAOB 2SGAA 2HNTF 5CMXH 2Q6DA 4TWYA 4NIVA 5LPEA 1JRSA 1O2IA 2BDGA 2Y82A 2J95A 1W11U 1RJXB 2ZKSA 1YGCH 5KGOA 6LPRA 1TGCA 5DSFA 1YM0A 2FI3E 2ODQA 2DUCA 1ESBA 1YPGH 4FXGH 5GCHG 2HLCA 4AFUA 3R0FA 1T8NA 3F9GA 4X2WA 3DUXH 2HVYB 4X6NA 3FP7E 4FVDA 2KX4A 3L6PA 1W13U 3U69H 3UTUH 1O5BB 2R2WU 1MTWA 2V35A 3A86A 1ZMNA 4AFZA 3MU0A 1SQAA 1K22H 1HYLA 1DY9A 1UTPA 1C1UH 2P8OB 1BCUH 1ZYOA 1O5EH 5IDKA 4I31A 2OC7A 2Q6FA 3OE7D 4NZQA 4ISHH 1OOKB 2BDIA 1CSOE 1JBUH 3U1JB 1ETSH 1GHAF 4ABGA 1YPKH 2ZU1A 4BXWA 2ZDLA 1V2NT 1RIWB 1TMUH 2H9EH 1ELVA 2O8TA 4DGJA 1O5GH 2V3HH 3P95A 1XUGA 2AGIX 4CREA 1WYKA 1UK4A 5HIZA 1C5WB 2JDID 1IQIA 3VB3A 2BD7A 1BRBE 1CT0E 1O2QA 4FU9A 3OX7U 2CXVA 4NCYA 2HALA 4XSKU 5L2YH 4UFDH 4OS1A 2YNBA 2IJOB 2FLBH 1UTJA 1YPLH 2BY6X 1HAIH 5EPYA 2R3UA 1CGJE 1ZR0A 2W3IA 4VGCC 5HMAA 2BM2A 2Y6TA 4ZROA 1RRKA 1FIWA 3NK8A 4Q7XA 1CO7E 2UUFB 3RXGA 1Y3XA 1ZSJA 1GI7B 3SGBE 1QJ1B 1Y5UT 2XBWA 4KELA 1NRNH 1TBRH 3A7ZA 3LIWA 3V13A 5DP9A 2PV9B 2A5KA 1QQ4A 3TJOA 2GT7A 1DOJA 5DO4H 1GBDA 1KXAA 1GHAG 3MWIU 5GJ4B 3WWFA 4X1SU 4Q80A 3UR9A 1MCTA 1ZLRA 2FEQH 1YLCA 1JIRA 3GY2A 5JBAS 5TCCA 4AOQA 5DP8A 1GI4A 3BTGE 2BHGA 5AHGH 2A7CA 2ZO3H 1BMLA 2CHAB 1BUIA 2H9TH 1AB9C 2RA3A 1QJ6B 4INHA 3M7UA 4O3TA 2GZ9A 4Q2KA 1FNIA 1TMTH 1A5HA 5IK2D 3OTJE 4ABAA 5LH8A 1EJMA 5C3NA 1F0UA 1FONA 3PROA 1GI1A 1MABB 1V6DA 2GP9B 2C4FH 1EZQA 1C5MD 1UVPA 4XBCA 1THRH 2FS8A 3TITA 1QBNA 2ZQ1A 4MVNA 1WV7H 4MPWA 4E7NA 2VIVA 3UFAA 2IJD1 2QAAA 2BDBA 2ZHWH 2W6ID 2OQUA 1CHGA 5JBBS 1YC0A 1AFEH 1FPHH 4PROA 2CGAA 1LCYA 4J1YA 1AUTC 4AYVB 2ANYA 1C9PA 4IN2A 4IGDA 3PLBA 2SGPE 3SJ9A 2ZDNA 1JXPA 1EOLA 3ZZBA 3AK5A 4JK6A 3SN8A 3TNTA 2KZ4A 3AAVA 2BLQA 2XCFA 4BTIB 3Q3YA 3SUDA 7ESTE 4X1RU 1MTNC 2XRCA 1Z1IA 3A81A 2A31A 4F55A 3P92A 3W1EA 4XBBA 5JBTA 2OXSA 3GY3A 1TFXA 1RD3B 4ACAA 1HJAB 1GBLA 2R3YA 3SU4A 5F8TA 1V3XA 2FOEA 1DM4B 3BTEE 2FOFA 3KN2A 4B2BA 2I6QA 1BRUP 3ATIA 1PQ5A 3MI4A 3T26A 1MQ5A 3LKWA 1NRQH 1SGRE 1UMAH 4AGJA 3M36A 1ZTLA 3OSYA 4LXBH 2FOGA 3RU4E 5GXPA 3A8AA 4ABFA 1FAXA 4YLUA 1BTWA 2VVCA 3ZVGA 3GDSA 3URDA 1CT4E 3GS9A 4NGAH 3SU5A 1HJ8A 3P8OA 1KTSB 2O8LA 1BA8B 2JETC 3SOSA 1D9IA 1TX6A 2FOAA 2PTNA 4LZ4B 3RXIA 1FLEE 5EJZA 3SHCH 1RGQA 1C1QA 1Z8IB 5EODA 1AVGH 1QRXA 2WV9A 5DP6A 3FZZA 1NC6A 1PFXC 4CRDA 1O39A 1GMCG 2WZQA 3UIRA 1K2I1 2OC1A 5C67A 1MU6B 4Y10E 3PO1C 3VGCC 1TNLA 3LH1A 4FUIA 1QB9A 1C1PA 1DLEA 2OTVA 5FAHA 3MFJA 2BD8A 4WWYA 3M3TA 1HV7A 2BZAA 4O97A 2A7JA 1SGFG 1D3QB 2GD4B 1O3MA 8KME2 4JZ1A 2BDYA 3SU0A 4B74A 5GDSH 1AN1E 1NTPA 1EX3A 1QURH 4AGKA 1EUFA 3SUFA 1AUJA 3A89A 1CT2E 1XUHA 4E06H 4YT6H 4JK5A 2STBE 1HAPH 1ZGVA 1ESTA 1A46H 2P16A 3KQBA 2FXRA 1PPGE 1AB9B 1INCA 2F9OA 3RXKA 2BZ6H 4JCNA 3MNBA 4X2XA 1CBWC 2Z3DA 2BVXH 2WPJS 3H5CB 1HAVA 3SQEE 2B9LA 2EI8A 2A4GA 1QHRB 4TPIZ 2V3OH 3P8FA 5EXMA 1BRCE 2THFB 2H6MA 5EQQA 4E05H 1TNIA 2EEKA 2Y7ZA 3A7XA 5KEDA 1O3FA 1DVAH 3E90B 1AFQB 1UO6A 3FZDA 1J17T 2F91A 1DPOA 2Z6BD 1QB6A 1ANCA 2KCPA 1YLNA 2QC2A 1L4DA 3SJKA 2GT8A 2LNCA 3MO6A 7LPRA 3FN8A 1C5PA 2FWWA 1A3EH 1O2GH 2VGCC 4FU8A 4D7GA 1C1OA 1LPGB 1YKTA 3LGVA 5EQRA 2PSXA 2ZCLP 5EXNA 4B6EA 1ZPCA 1MTNB 3FKSD 5TCAA 2FMJA 4Y6DA 3U8TH 1YPJH 1MZDA 1E34B 3LT3A 2ALVA 2ZTXA 4MQAA 8ESTE 3PRBA 4BTUB 4H6SB 3MH7A 4ZH8A 1NS3A 1UJ1A 2EC9H 4X1NU 1XUKA 1O5AB 4FETA 1O0DH 4FUGA 2FTLE 1KY9A 4ZXXH 2G8TA 4IC6A 3VG8A 3U98H 5DGJA 1C5TA 5C2ZA 2EQNA 1QBVH 2ZFQH 3TH4H 1T4VH 4DW2U 3HKJB 3VEQB 1UVUH 1P09A 3M61U 1SOTA 3ZVFA 4K8YA
chains in the Genus database with same CATH topology
3RXFA 4WH8A 4JZIA 1H8IH 2ANMH 1C2GA 2FOHA 1SHHB 2BY7X 2XC5A 3G01A 3SJ8A 5DP3A 3TK5A 3HK6B 4K1SA 2JETB 1P2MA 3PMAB 1H8DH 1HNEE 4WXIA 4X6MA 4CRBA 2CN0H 1W2KH 2C90B 1F92A 3PWCA 4J2YB 2GDDA 3IWMA 1FZZA 3BG4B 4CHAC 3BTHE 1E36B 1P10A 2AS9A 1ZGIA 1GI8B 2BOHB 1J8AA 2BLOA 3PO1B 3QN7A 2C8YB 2ZCHP 1G9IE 1DWDH 1WCZA 3RXHA 1O2JA 2AGGX 3NCLA 2C3SA 1NESE 2VH0A 2BB4A 2ZEBA 3RMLH 1YF4A 2RDLA 1SQOA 2UWPA 3SV7A 5G4BA 2R9PA 3KQDA 5DG6A 3A7YA 3PYHA 3BEFB 2A5IA 3TLOA 1GCTB 1J9CH 3E8LA 2A5AA 2BLVA 2BQ7B 3S9BA 3LC3A 2F9UA 1O3OA 3RC5A 1GBMA 3RXJA 4UFEH 3ZVBA 2FP7B 3PMJA 1O2SA 3EDXB 1GHZA 2ZU3A 1KSNA 1C4V2 4FU7A 5F8XA 3BEUA 1LHFH 1C4U2 1RTFB 3MH6A 1AQ7A 4X8UH 1Z8RA 2FO9A 1J15A 3GY8A 1GBTA 3O8RA 1O2HA 4GPGA 3ZZ3A 1O3AA 3MYWA 3VB4A 6CHAB 4NSVA 1VGCB 2XTTB 1HRTH 2QXJA 4Y11E 3S9AA 7KMEH 9ESTA 1AKSB 4BTTB 4NA9H 3OU0A 1GHYH 1YP9A 3A7WA 3M7TA 3HATH 1DLKB 2QXHA 2BD5A 3T62A 2AH4X 3ATWA 4NFEA 2YNAA 3ESTA 1UHBA 2TGAA 3GCOA 4ZAEA 1HAOH 3LH3A 2JH5D 2VGCB 3A84A 1A4WH 2ZHQH 1NRSH 3ZZAA 3QLPH 1C2DA 1UTMA 1HPGA 5A2MH 2GGVB 1O33A 4FUCA 3RMMH 2FDAA 1XUJA 3T5FH 4TY6A 1AHTH 3RXVA 1NZQH 1OX1A 1GJ4H 2P8OC 2GZ8A 2P94A 3EA9A 2BLWA 1NY22 3RLYH 1QA0A 4IN1A 1XXDA 2J38A 3L3TA 1RIWC 2ZPRA 1FY1A 1QL7A 3FAOA 1O3GA 2Z3EA 1LVMA 5T6DA 1ANDA 2PGBB 1XVOA 2NWNA 2XWAA 1A0LA 1EJAA 2AYWA 1MBMA 1UCYE 1SMFE 1DE7H 1KLIH 4KGAA 4H4FA 1GJ6A 5E2OA 2UWLA 1SSXA 2KAIB 3LONA 5HM9A 2QXGA 4AYYB 2VWLA 2ZQ2A 3A7VA 3EA8A 1LHGH 4CRAA 1GJ7B 3OY5U 3UQVA 1IQLA 4AB9A 3FP6E 2PLXA 1BMNH 3CP7A 1DDJA 1KXBA 1SB1H 3SBKA 2ASUB 3TGIE 1T8MA 1DSTA 3RXRA 1P3EA 2QXIA 3D23A 4MG3A 4NFFA 3MMGA 1K1IA 3M5NA 3LOXA 3ZVDA 4BAHB 2BQ6B 1E38B 3RU4D 1O2NA 5ESTE 2JKHA 2BY5X 2Z94A 1QL9A 1ZJDA 3SU2A 4JYVH 1P03A 2P3UB 2J92A 1YLDA 2HNTE 3DT0H 2CF9H 3U9AH 4I33A 3C1KA 3UY9A 1MMJN 1QFKH 2VWNA 3B9FH 4ESTE 2Z3CA 5DJ7A 3BTME 5ESBA 2CHAC 1UK3A 1C5SA 3RDZA 3VXFH 1TNKA 4BAKB 4MPUA 1DWCH 1GVKB 2XWBI 3GY6A 2WINI 2F83A 1NFYA 1GDUA 3M5OA 4DCDA 2PKAB 3RXOA 1GMDG 2H9HA 1A3BH 3PM3A 2B5TB 3A8DA 1SGCA 1HAGE 2BXTH 1TPOA 2A45B 4I8KA 2ZDVH 1K9OE 1DFPA 1YPMH 2BD4A 2SGDE 1CU1A 1O3CA 4B73A 3V12A 4K60A 1QB1A 3KQEA 1WAYB 1NROH 1LHDH 3O8DA 4MNXA 2AMDA 4ZKNU 1ZOMA 3N7OA 1Y5BT 2G51A 2W5EA 1OXGA 3NPSA 4Y8YA 2ZGXH 2CF8H 4A1VA 3PLKA 4X8VH 2SGQE 1AVWA 2BX4A 4ZHAA 1S83A 4CRGA 3MH5A 1CGIE 1ZSLA 1ZJKA 1OWDA 1Y59T 1O3BA 3ENSB 5EW1H 1SR5C 5HXFA 3SU1A 1F5LA 3RM2H 1YPHE 1TX7A 3GCNA 1TRYA 5GWZA 1WSSH 1FN8A 4ZHLU 1OKXA 1IOEA 1HJAC 4M7GA 1EXFA 2B0FA 1BMAA 3Q76A 2BTCE 5EXLA 3LGIA 4K1EA 4HI3A 1C1RA 5JB9S 1BTXA 2FS9A 2F9BH 3MU5A 2Y80A 1O2MA 3GDUA 4IC5A 3A88A 3JZ2B 4Y0ZE 3NZIA 2BD3A 5J4QA 1GBFA 3SJOA 3SGQE 1XX9A 1LKAA 1PQ8A 1TPAE 5E0GA 4BOHA 1FIZA 4KKDA 1NO9H 5JDUB 1QBOA 3EE0B 1O35A 2C8XB 1DUAA 3AW0A 2D26C 1HDTH 2TBSA 3UNQA 5FHTA 3CS7A 3TNSA 4BNRA 2NU2E 1QGFA 3ZZ6A 1BIOA 3EQ0H 2QYIA 1UVOA 3U8RH 1GVZA 5EOKA 4U2WA 1B5GH 2RCEA 3TVJB 2QY0B 3ODFA 2AMQA 2ZPQA 2BQWB 2A4OA 2NU3E 1LPZB 5HM2A 3D65E 4I8HA 1GJBB 1W8BH 1BT7A 3MO9A 2UUKB 3C27B 1GJ9B 1WUNH 3GDVA 3S7KB 1PQAA 2VNTA 3TPIZ 4CH8B 5J4SA 1GHWH 4B1TA 5A0CA 1NN6A 1ELCA 3E0NB 1C9TA 4OS7A 4UE7H 2NU1E 3MU4A 2O9QA 5GPIB 1W7GH 3SV8A 4CR5A 1HAZB 2OLGA 3UOPA 1ZTKA 1ZSKA 4FUDA 1O2YA 3FANA 2RA0A 2OINA 5FX5A 1K1PA 1KXEA 3RXMA 1P9UA 2Y5FA 1SC8U 1SHYA 2Y5HA 2ZTYA 1PPHE 4DIIH 1A7SA 1EPTB 8LPRA 4X1PU 3ZV8A 3BTWE 1OWHA 2NU0E 1UTQA 8GCHG 3ZZCA 2GCTB 1JMOH 2J9NA 3PB1E 9LPRA 1AO5A 1FY3A 2UUJB 5L30H 4X8TH 1HIAB 2A2XH 2AFQB 4JZEH 2K1QA 1AFQC 1NRRH 4B76A 3IG6B 1OS8A 1B0EA 2Y81A 2G55A 2CJIA 2ZI2H 3H7TA 3TK6A 1CA0B 1GMCF 3RXTA 1HGTH 2BVRH 3SUGA 3OY6U 3S0NA 2CV3A 3HKIB 1BITA 2PWXA 3F9EA 1G3CA 3VB7A 3F9HA 4TWWA 2UUYA 1Z6EA 2VIPA 1P06A 2TGPZ 1H4WA 2VWMA 5DKMA 5JBCS 3PTNA 1BBRK 4X2VA 1UTLM 2QF0A 1O5DH 1C1TA 2OCVB 4DOQA 2DE9A 1OWIA 2KAIA 2ZU4A 4AFSA 3PWBA 1IHTH 3SV9A 4JYTA 1Y3UA 1C5LH 1KDQB 3PV4A 1F0TA 3S7HB 3RC6A 1C4Y2 1W10U 1HFDA 3EYDA 2EI6A 3UNSA 1PPCE 1THPB 5FX6A 1G3EA 1KIGH 1A5GH 1SGEE 2AMPA 3SI4H 2ZHFH 2TRMA 5FBEA 3KQCA 1TX8A 1ELFA 1DXPA 4ASHA 1OPHB 1Y3YA 6ESTA 1SOZA 1RTLA 1ELAA 4AN7A 2ZPSA 4Y8ZA 3E16B 1WBGB 2WYGA 3BG4C 3RP2A 1ARBA 1DX5M 1LVYA 3VB5A 1BBRH 1SLWB 1O2TA 3BG8A 3O8BA 3TU7H 4A1TA 4INKA 1P3CA 2Z9GA 1S84A 4A6LA 1K1NA 4TPYA 1AI8H 2ZFTA 1P02A 5JYIA 2IPHA 2QF3A 2B7DH 2VIOA 1X7AC 1DANH 2C8WB 1G2MA 3NWUA 2ZFSA 1TQ0B 2FI4E 1G37A 1O2PA 2ZCKP 5A0BA 2SNWA 1AD8H 2G4UA 1GCTC 1S82A 5FPTA 3UNRA 1N8OC 4RSPA 2BXUH 4Y8XA 3QX5H 1C1WH 2ZC9H 1HAXB 3IITA 3KF2A 1LVOA 4KTCA 3AVZA 2ZTZA 1LHEH 5HGGA 2W26A 1GPZA 2J94A 1P57B 2H5DA 3A8CA 5F03A 2Z9KA 4CR9A 3VFEA 3W95A 2PUXB 2BMGB 3D49H 5T3HA 6GCHF 3LPRA 4B2AA 1SLXB 2BY9X 4XE4A 1O2KA 2WYJA 6CHAC 1VGCC 1GBEA 2PW8H 2A0QB 5A09A 2ZNKH 4Q7ZA 3WY8A 4Y7BA 2W7SA 5JB8S 4LZ1H 1XUIA 1Z8GA 3DFJA 3PMBB 1IHSH 1QY6A 3ITIA 4OGYA 4B75A 5EG4A 4FUFA 3RMNH 1OP2A 2FM2A 3V0XA 5EW2H 1A61H 4IMZA 4MNWA 4CH2B 1EATA 2QGRA 2HPQH 1D4PB 1DWBH 3SU3A 4Y71A 3SQHE 3VPKA 2A4RA 1CHOF 2VJ1A 3SZNA 3MNCA 2XC0A 4UEHH 1F5KU 2FPZA 4JYUH 3TIUA 4JZFH 1C5RA 2A1DB 1IQMA 1SVPA 1ELTA 3Q77A 5E2PA 2J4IA 1BQYA 1ID5H 1TYNA 3QO6A 2BX3A 4X6PA 1V2UT 4WMDA 3KL6A 4H42U 2FYQA 3LGTA 1GL1A 1V2MT 3A80A 4DG4A 1G36A 4YTAA 1MCVA 4AG2A 3RC4A 3SNAA 4KP0A 1GVLA 1PPBH 4YESB 6GCHG 5CHAB 2ZP0H 5L6NH 4IMQA 3T2NA 1W0YH 4NWLA 3SU6A 2WUBA 4GCHG 1TWXB 1IQKA 3LJJA 3RXAA 1WQSA 4GUXA 3UWJH 3JZ1B 2G00A 1PQ7A 2A7HA 4RN6A 4YOJA 1V2RT 2BDHA 1TOMH 1ELBA 1F2SE 2ZG0H 2ESTE 1O2OA 2P59A 1MBQA 2BD9A 1SLVB 4O3UA 3U1IB 1C5XB 1C5ZB 1S85A 2FZZA 4ABDA 1UVTH 2HPPH 1C2KA 4OS5A 5BRRE 5FXLA 1CHOG 1BTZA 1VITF 1GMHG 1C2MA 2VIQA 4ISNA 1S6FA 5EU8A 4I8LA 3ZYEA 1MAYA 3V7TA 3NXPA 1K28D 3SHAH 4DY7B 2Z9LA 4IS5A 1ELGA 2ZDAH 1GGDC 2HGTH 2EA3A 1UTNA 4WVPE 4AX9H 1O32A 1PPFE 1TA6A 1WOFA 1N8OB 1LO6A 1ANEA 2QA9E 1SFQB 1OP0A 2Z7FE 3BF6H 1IQJA 3MO3A 1V2JT 2ZDMA 1AVXA 4UDWH 3KIDU 1IQGA 1C2JA 4K69A 3NKKA 1P2OA 3GY4A 3M7QA 4FUEA 4OS2A 1GI5A 3UOUA 1BJUA 1V2VT 1LKBA 2VINA 4F49A 2PKSC 4WMFA 4CBOA 1GJ8B 1TRNA 1FY8E 1N1LA 3T25A 1O2XA 3ZVAA 4DVAU 1AY6H 1GJDB 2F3CE 3LU9B 4ZMAH 2ULLA 5L2ZH 1OYTH 5I46H 1VITG 3FVFB 1C1MA 1S0QA 3O8CA 1RTKA 3BIVH 4RKOB 2OP9A 2VIWA 1O3NA 1C2LA 3MH4A 2ZHEH 5C5NA 1CE5A 5ABWA 1HBTH 3BTDE 2ZU5A 1O2ZA 3VXEH 1IQNA 1SGDE 4ABIA 1TABE 1V2ST 1NFXA 1MTUA 1Y3VA 3KGPA 4UD9H 3DFLA 5DPAA 1EB2A 1NU9A 2ANKH 3E6PH 2ZGHA 1BTPA 2ZGJA 2VVVA 3TJNA 4ABBA 1T8LA 1OSSA 4NIXA 5EPNA 3RXSA 1GHXH 2XNIA 1O36A 3A82A 2G81E 2IN2A 4MTBA 1OYQA 1C2FA 3F68H 1Q31A 2FESH 3K2UA 4FUJA 3QTOH 3T29A 2STAE 3M37A 1YPEH 1BHXF 2XBXA 3RLWH 2WPKS 1T8OA 2O8MA 1J16A 1TRMA 2Q1JA 4YO9A 2P3FH 2F9PA 2IOTA 1SPJA 4Y7AA 4GSOA 2B8OH 1NU7B 4Y79A 2EI7A 3E3TA 4I8JA 3SNCA 4NIYA 3ZZ5A 1FAKH 2HNTC 5PTPA 4AG1A 1LQEA 1EAIA 1QNJA 4AFQA 3SNBA 1Q2WA 1ZPBA 2R2MB 1P9SA 3I78A 1T4UH 1YYY1 1GI9B 1ETRH 1GMDF 3HPTB 1AGJA 1PYTD 4I7YH 4LOYH 1GG6B 1BMMH 1O5CB 5LPFA 3ZZ9A 4MNVA 3GY5A 3L33A 3DHKH 1K21H 4THNH 3UWIA 1GCDA 1ZMJA 1FY5A 3ODDA 1ORFA 3RXDA 3TH2H 1WQVH 1K1JA 1O3PB 1G32B 5F6MA 5C1UA 3GOVB 4GAWA 1V2WT 4R8TB 5LGOA 2XC4A 4TYDA 3GY7A 1GGDB 3P8GA 1RXPA 2W7UA 2H2ZA 1G3DA 3RXQA 2GCHF 3GCHC 7GCHF 1BTUA 1ANBA 4K2YA 4NWKA 2XBYA 5FBIA 1Z8JB 2OUAA 3EAJA 3DD2H 1S6HA 1F5RA 5AF9H 1ETTH 1TNHA 1NFWA 3FFGA 1EAWA 1LTOA 4ABEA 5FCRA 1YPHC 4BAMB 3F6UH 4O03A 2WPHS 3T28A 4ZKSU 3I77A 4WXVA 3SGAE 1O2LA 2GX4A 2PKSB 2VWOA 1EPTC 1C5QA 1A0JA 1L1GA 5FPYA 2Z9IA 4HFPB 1IAUA 4Y0YE 3K6ZA 1CVWH 2GCTC 3M5LA 3UUZA 1W7XH 2FLRH 5A0AE 1C1SA 1TIOA 2SNVA 4X8SH 1YCPM 4ISLA 1MZAA 4LK4A 2XXLA 3P70B 5K7RA 3DA9B 1GI0A 1C1VH 1DICA 3NUMA 2AGEX 1CA0C 2SFAA 1O3JA 1TGSZ 4FVBA 1KTTB 5I25A 5AFYH 1MUEB 2GCHG 2V0BA 1IQHA 7GCHG 1MU8B 1HAVB 1MKWK 1TBQH 3BTTE 1XXFA 4K3JA 3RM0H 1V2PT 1QCPA 1VCWA 1P2IA 3R3GB 4E7RG 3AASA 1KYNA 3AAUA 1P2NA 1EKBB 1HCGA 4GHTA 1ZPZA 2GV6A 2GVFA 4Z0KA 1O3EA 3D62A 4NSYA 2NU4E 4DIHH 1EZUC 3MU8A 1FV9A 2HOBA 3QUMP 1ZHMA 2ZU2A 4O9VA 2OC0A 1AE5A 2BDAA 2FODA 2OD3B 4U30A 2FX4A 3STIA 1OWKA 2F9NA 1C2EA 1KXFA 1ARCA 3STJA 4SGBE 5ETXA 1LVBA 4A92A 3RXUA 1MKWH 3QTVH 2ZIQH 1ACBE