1BRCE

Relocating a negative charge in the binding pocket of trypsin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKGSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPDVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Relocating a negative charge in the binding pocket of trypsin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1992-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1brcE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1brcE02
4Y10E 1GBCA 1O2QA 3VPKA 2WV5A 5T6DA 1BTWA 3TLOA 1NPMA 1YCPK 2Y5FA 2QGRA 4ISNA 1D3QB 1TONA 2XBYA 3ATMA 5T3HA 2ZECA 4X1RU 1ID5H 1FPCH 4SGAE 3RLYH 2FX6A 2PGQB 1YC0A 3RXTA 2PUXB 2GKVE 1D9IA 3TJVA 3U98H 1PPGE 3T26A 5DKMA 4X1QU 3S0NA 1Y3UA 1O3JA 1SC8U 1SFIA 2XC0A 3BTHE 1EB2A 1SGNE 1SGEE 4IN1A 2ZCKP 3UOPA 2B5TB 2BTCE 5FX6A 1L4DA 1V2NT 2QV1A 1FAKH 3DA9B 1RXPA 3D23A 4ZH8A 1MUEB 3RUOA 1H1BA 4XOJA 1TNIA 1JRSA 1S6FA 1WSSH 4IMZA 1XVMA 3KQEA 4XBCA 4FUDA 1NFUA 1OXGA 3F68H 1SMFE 4CH8B 4X1NU 1KXFA 1O2RA 2ANYA 2VGCB 2PKSB 1P02A 2GMTC 5DO4H 5EPYA 1C1WH 3P17H 4A1TA 2O8MA 5DP3A 1F0RA 1INCA 1D3TB 1K2I1 5DP4A 5FPTA 5FBEA 3R0FA 5EXMA 2A4OA 1O3CA 1G36A 2ZDMA 1MQ6A 3HK6B 1GJ5H 1V6DA 4TYDA 1AE5A 1MD7A 4FUHA 4ABBA 1MAYA 3ZZ6A 3T29A 5AFZH 1ABIH 2FTMA 1CU1A 3E3TA 2Y7ZA 3PWBA 2H5DA 3U9AH 1SI5H 1KY9A 3RXRA 2STAE 1QQUA 1BMNH 1LPKB 1Y3YA 4YESB 4ISOA 1ELEE 4XDEA 1ZMLA 3KL6A 1TX8A 3MYWA 1N8OC 3BG8A 3SNAA 1PYTD 3MU1A 3ZZ4A 3PLKA 3UPEA 1EATA 1MZAA 4JK5A 1TALA 2AGIX 3SV9A 5JBCS 3P8FA 1O3HA 1DM4B 1V2LT 2ZU5A 1GMHF 1HLTH 4WWYA 5EQSA 1FONA 3DD2H 3RXMA 3NXPA 2CN0H 4ESTE 4AFUA 4Q7ZA 5EG4A 3IWMA 1GI5A 1MTWA 3LDXH 3D65E 1WV7H 1C4U2 4F49A 1VITH 1IQGA 1QQ4A 4GHTA 4BAMB 2OC1A 2JETB 4F4OC 5CMXH 4D8NA 1DICA 1H9IE 4B75A 4GSOA 1GHZA 5DPAA 2QXHA 1P09A 4UFEH 1FUJA 3HGPA 1XUGA 1BCUH 3QUMP 1G3CA 3A85A 1C5RA 1V2TT 4Z0KA 2XCFA 1FIWA 2ZTYA 2W5EA 3BEUA 2VH0A 2WPKS 4BAQB 1AO5A 2XYAA 4GVUA 5HXFA 1YPLH 3O8RA 1KSNA 3M5LA 2RG3A 4IC5A 1T4VH 2Z3EA 2ALPA 1UVOA 4Y8ZA 4ZROA 3M7TA 5A8XA 1O3LA 5CE1A 1BZXE 1W11U 3GY2A 1GI7B 5ETXA 3SO3A 5L2ZH 1Z8GA 3A82A 1SPJA 4UONA 1AFQB 1PQ7A 2XNIA 1RIWC 2W7SA 1C1TA 4U2WA 1O2TA 1K1NA 3H7TA 4D7FA 5K0HA 5GIBA 1CA8B 2F9NA 3EYDA 4VGCB 1S83A 1WUNH 3Q00A 3R3GB 1MTUA 4AYYB 3GYMA 2ZEBA 1IQJA 4JCNA 5E8EH 1DWEH 3SV8A 3VXFH 1WU1A 1O2WA 2V35A 1JBUH 3LPRA 1KLIH 4BNRA 4QT8C 3MH6A 2BLQA 1C2JA 2TPIZ 3WY8A 1QA0A 3HKIB 1GBFA 3NCLA 3M3VA 3K9XB 1O2LA 1JMOH 2GCTB 1TQ0B 3S69A 3CP7A 3T62A 1GG6C 3O8CA 1E35B 3ZZ7A 4DOQA 5LH8A 1S84A 1ZHMA 3ZVBA 1QL8A 2XWAA 3GY3A 2PSYA 1XX9A 2WPIS 4K1TA 1O2JA 2VVCA 5EXNA 2BD7A 6LPRA 2FLRH 2G8TA 5JDUB 1ZTLA 2F9PA 5C1YA 1QJ7B 1O33A 1ESTA 3BTQE 1IAUA 2QYIA 3LONA 2QF0A 4B76A 4K2YA 2BDBA 1V2MT 1TOMH 1GHYH 1HAVB 1OWIA 4Q7YA 1J15A 1GCTC 3A83A 1MBMA 5LPFA 3SQHE 3VB6A 3RXOA 3ZVDA 1IQLA 2I6SA 3P70B 3G01A 2FOGA 2SGAA 4LOYH 3AAVA 3E0PB 1C5QA 1SGTA 2FOAA 4MQAA 5FBIA 1KIGH 1YKTA 3E1XB 3MTYA 4OS2A 1LKBA 1AZ8A 2P16A 1BUIA 1SBWA 1SG8B 3OU0A 2OTVA 3PO1C 3NKKA 3T28A 4NG9H 2VIPA 2OQUA 2GZ9A 4MPXA 3SHAH 3SGAE 1UK4A 1FLEE 5LPRA 2P94A 1BRUP 2Z9GA 1TPSA 2AYWA 1EXFA 5JPMH 1GJAB 1DDJA 1IOEA 1F0SA 2PFEA 1EZSC 1Z6JH 2CMYA 4RKOB 2BOHB 1CBWC 3UTUH 4ZHMU 1E34B 2Y5HA 2FS8A 2ZFSA 4X2XA 1HNEE 1LQDB 4O3UA 1BBRH 3LGVA 5EU8A 2FOBA 2Q6FA 3RXBA 3QWCH 1J8AA 5GDSH 3FP6E 5A8YA 3QZQA 1DE7H 4FUJA 2BY6X 1G2LA 3BV9B 2P3FH 4HZHA 2W3KA 4OS4A 2VINA 8KME2 2J38A 2JH0D 5E0JA 4UFGH 2O8TA 4A92A 3UNQA 2ZFQH 3MU8A 1W2KH 5EQRA 1P2OA 3M7QA 3ZVEA 2ZGJA 2O9QA 1EJNA 4BOHA 4CRCA 2NU3E 3LJJA 3M61U 1HIAB 4TY7A 1TBRH 1ZRKA 2GMTB 3SUFA 1UTKA 3BTEE 3MH7A 1GI2A 3P8GA 1UTPA 1XUKA 3AVZA 3SBKA 1BIOA 1SL3A 4BTIB 1MTNC 2ZU3A 4E7RG 2QXGA 3F9EA 4NSYA 1CO7E 5FCRA 1LHEH 4OGXA 1TRYA 1T8NA 3F9GA 4Y0ZE 3RXKA 1XKAC 2Q6DA 2AIQA 1CGJE 2YOLA 2H6MA 2PGBB 4TPYA 4X1SU 1FN6A 3SQEE 1EAUA 1GBKA 4WXIA 3E16B 3HGNA 2RDLA 2ZFRH 1YGCH 1N8OB 2OD3B 1O2GH 4K5ZA 1GBBA 2R3UA 1ZMJA 1B0EA 1GI1A 1EZUC 2BDCA 1ZTJA 4Y7AA 9ESTA 1BA8B 1O3EA 2Y82A 1TNHA 1L2EA 2UWOA 3TGKE 3A7ZA 3DHKH 3H7OA 1ELGA 3V7TA 4KELA 2GTBA 3BEIB 5I25A 1C5PA 3ZZAA 2Y81A 2A2XH 1EUFA 4I8GA 4E05H 4WH6A 1UK2A 1VJ9U 1HB0B 2P95A 1EP6A 1QA7A 2Z94A 4AFSA 3UWJH 3M7UA 2P8OC 3EDXB 3SJ9A 4CR9A 2RA3A 3S9CA 1C5LH 1HAVA 3D49H 3OY5U 1GVKB 2ANWA 2BB4A 2CGAA 3A88A 5C3NA 4FUGA 3LH3A 1K22H 1LCYA 1XKBC 2OXSA 5ESTE 2Z9IA 4MTBA 4X1PU 2XRCA 2C8YB 1YYY1 3H5CB 3ZZCA 1ORFA 3W94A 7ESTE 5A8ZA 4Q80A 1EPTA 3EQ0H 1O2VA 4B74A 3UY9A 1GVLA 2V3HH 2ZZUH 1SGCA 1OWJA 1A2CH 1WCZA 3RC4A 5JYIA 1O3FA 3CS0A 3SHCH 1C4Y2 2F9BH 4ABDA 2VIVA 3RM0H 2Z3DA 3TJUA 2FOFA 2GZ8A 1GHWH 3GY4A 4WJG2 3Q76A 1IQEA 5E2OA 3EA7A 2B7DH 3GYLB 4FU9A 5FXLA 5FX5A 1BRCE 1ANCA 4CRGA 1SOZA 1V2PT 1C5SA 2FM2A 1G3BA 1RIWB 1W8BH 3E90B 1MZDA 2GGVB 3RXVA 2ZQ1A 2Y6TA 1HGTH 4Y6DA 1SQAA 3BF6H 2B9LA 3V13A 1KYNA 4B2BA 5C5NA 2F83A 1P3EA 1HBTH 3ZVCA 3PMAB 1FN8A 4FUFA 1O3NA 5ESBA 2ALVA 2ANKH 3SNDA 4GPGA 4MPWA 3EA8A 1H8DH 2B8OH 3F9FA 2A7CA 2ZIQH 1O3DA 1GMDF 2QF3A 2FMJA 1Y59T 2I6QA 3ITIA 2FESH 4LK4A 1C2MA 1TNJA 4Y79A 2FI4E 1QFKH 4UD9H 2Q6GA 3MU4A 2G00A 2W26A 1S82A 2TRMA 1GG6B 4UDWH 4DW2U 1HYLA 2B0FA 1C5OH 1BQYA 2BMGB 1T32A 2GDDA 2Z9LA 3SU4A 1AUJA 3BIUH 3SJKA 5HMAA 3SJOA 2BOKA 1O2SA 1SGFG 2FI5E 5FPSA 1CGIE 4ZMAH 1EB1H 1HIAA 3I29A 1SLVB 2WPJS 4X2WA 3GY8A 2HNTC 3M3TA 1FPHH 1C1UH 2GT7A 1TRMA 2ZPQA 1PPCE 1CHOF 5A0CA 4U32A 1KXAA 1QRZA 2RA0A 4GLYA 7KMEH 2P93A 2R2MB 3A81A 1FV9A 1L4ZA 3RMOH 1BMLA 1TLDA 4IN2A 1O3OA 9LPRA 1AE8H 3UUZA 2PTCE 1UO6A 2V0BA 1GJDB 3VB5A 3QGNB 2G4UA 3KF2A 1P3CA 1GCTB 1W3CA 2BZAA 5DP7A 2BD3A 1Y5AT 3MHWU 1AKSB 1EPTC 2A7HA 1GGDC 2BYAX 3ATKA 1BBRK 1UJ1A 1SQOA 5GCHG 5F8TA 2J34A 1PQAA 1BTUA 2BY9X 1FY3A 1LDTT 2ZU4A 2V3OH 1O5GH 1UK3A 2HWLB 3A84A 3U8TH 2G51A 2J95A 5DP5A 2F9VA 2FO9A 2ZDNA 1H9LB 4H6SB 1QURH 1P05A 2O8WA 1Z8IB 1P12E 3U69H 4ABAA 3SU6A 1O3PB 4XE4A 3PO1B 3T25A 2Z9KA 1DITH 1TE0A 1Z6EA 4X6NA 2Y80A 2EI8A 1ETRH 1UCYK 2PR3A 1MTSA 1QY6A 2Z9JA 3N7OA 2VIDA 3AASA 1FJSA 4O97A 4DVAU 3EE0B 1IQHA 2HLCA 6GCHF 5AHGH 3A8AA 1CBWB 4JYUH 7GCHF 4WVPE 1F5RA 1QJ1B 3VB7A 3ZZ3A 3ZYDA 1KLTA 2DUCA 1MKXH 8GCHF 3RC6A 1DLEA 2ZGXH 3LIWA 1C2LA 4FVBA 3L3TA 3T5FH 5FCKA 1OPHB 3MNBA 2EI6A 1O2HA 1YM0A 4AOQA 1DWBH 3A7WA 4ZKNU 1QTFA 1P2JA 3F6UH 2ZHFH 3FZDA 4TPIZ 3URDA 1C5WB 1GI9B 1OP2A 1P57B 1QJ6B 3SW2B 1MCTA 3MNSA 1C1RA 4AFQA 2BD2A 4B1TA 1PPFE 1GJ6A 2A2QH 2C8XB 3LC3A 3QZRA 4HFPB 4X8VH 3OX7U 3STJA 2BDHA 1DANH 3PROA 1DT2A 1XM1A 4NZLA 2BQ6B 3FAOA 1MTNB 1UVTH 1BBRE 1T8MA 4Y8YA 3DUXH 6CHAC 1HAYB 1XXDA 1ZTKA 2ZDLA 2H5CA 3DFJA 3RMLH 1QB1A 3HK3B 4X6MA 1TA6A 4JZEH 1YLCA 1YPHC 1F2SE 4X6OA 2AGGX 3QTOH 1QL7A 3MH4A 1AUTC 4NWLA 3RC5A 1HAXB 1RJXB 2XXLA 3S7HB 1AFEH 1TMBH 4ABHA 1MMJN 1X7AC 2CF9H 5JB8S 3Q3KA 1TMTH 2BD8A 1UCYE 5HGGA 1GJCB 1C1NA 1BMMH 1THRH 1KXBA 3RXQA 1XMNB 4SGBE 2OC7A 1O39A 3TK6A 4JZFH 4Y11E 2BM2A 1GVZA 2PTNA 2WYJA 4TWYA 3UREA 3KQDA 3E0NB 1FI8A 1DY8A 2A0QB 4YO9A 4AX9H 1PFXC 1UVPA 2FODA 1GHAF 2C90B 5HM2A 5E2PA 3MI4A 3LC5A 4ZKRU 2O8UA 1CT0E 3O8DA 1S85A 1W10U 1SGQE 1TFXA 2TBSA 3AW0A 3PTNA 3KIDU 3BG4C 1BOQA 3ZV8A 4DG4A 4YT7H 5AVDA 4DT7B 3U1JB 3UOUA 1G3EA 2XBWA 3NZIA 1LVMA 4Y7BA 5C1UA 3BTDE 1AKSA 4IMQA 2OQ5A 3GICB 2BDIA 2AERH 2FOCA 3SNBA 1LKAA 3LT3A 2P59A 3V12A 5C2ZA 3K6YA 1CHOG 3SNEA 1VGCC 4B2CA 1H9HE 1TQ7B 1CGHA 1KXDA 2VVUA 4ABFA 3OY6U 1BHXB 1K1JA 4UFFH 3UQOA 1GHBG 3GOVB 1LQEA 1YPJH 1BHXF 1SVPA 1GJ4H 1ZYOA 2ZHEH 4BTTB 1PPEE 1SGRE 1NFWA 3FVFB 4Y76A 3BTFE 3S9BA 2BVRH 2EEKA 4WXVA 3EGKH 3ODFA 1ANDA 3SJ8A 4JMYA 1DY9A 2A5IA 4GCHF 1GI4A 2FI3E 5BRRE 1NO9H 2HGTH 3LOXA 1TIOA 5EPNA 1C9TA 4FUBA 4BXSA 5FHTA 4D9QA 4ABEA 3TH4H 1V2WT 5C5OA 5FAHA 2AEIH 2BX3A 1G9IE 1O5DH 2H9HA 1GDNA 4MNVA 2BLVA 3SV7A 1IHTH 1U6QA 1MD8A 1QBOA 4I7YH 2ZFFH 1GBLA 4ZXYH 4D9RA 1C2KA 3RMMH 4X8UH 4RN6A 1EOLA 1FMGA 2M5TA 2WPHS 1THPB 1TB6H 1AI8H 1ELAA 1TNLA 2ZU1A 2GT8A 4MNYA 4J1YA 2P3UB 1TNGA 1ZHPA 3SI3H 1W13U 3SU1A 1TAWA 1ZMNA 7GCHG 4K1SA 1NTPA 4U01A 4FU7A 1NRRH 2JH6D 4K3JA 4UEHH 2HNTF 3RXJA 4D7GA 2GVFA 3PMJA 1PQ8A 1P2KA 1IQIA 3RXPA 5GPIB 4NIYA 5T6GA 2ZGCA 4X8TH 1A3EH 2SGPE 2Z6BD 4IS5A 3LGYA 1KDQA 1C4V2 2EI7A 3TK9A 5DGJA 2IPHA 1TGTA 4K1EA 1PYTC 3RXDA 1E36B 3MO3A 5DP8A 1TGBA 1ZJKA 1TX7A 4X2YA 1ELCA 2ZDAH 3GDSA 1MKXK 1YPKH 1EPTB 1SLUB 2UUYA 4O3TA 1GGDB 1ELBA 4WMFA 1GI6A 1O34A 2J94A 2BHGA 2PKAA 1DXWA 5IDKA 2LNCA 1HFDA 3EAJA 1Y3WA 3GCNA 1NROH 1BB0B 3PTBA 1QHRB 2G52A 3GDUA 1AY6H 1N6YA 3ELAH 1O3AA 5TCCA 2AH4X 1PQ5A 4B71A 1QL9A 2THFB 1S81A 4NWKA 3S7KB 3GY5A 3A80A 3TGIE 1TPOA 4LZ1H 2Q1JA 1GMHG 3TJNA 2HOBA 2C8ZB 2FPZA 3PMHB 3UIRA 1V2RT 1GBIA 1O38A 2LPRA 1G30B 3D62A 1AHTH 1O2UA 1THSH 2SGEE 1SOTA 3RU4E 5I46H 3BSQA 4HGCA 3T27A 2FTLE 2HRVA 3M37A 1YBWA 2XCNA 2OINA 2CHAC 1WAYB 1AMHA 4A5TS 1FY1A 4MPUA 3SJIA 1O5AB 3PM3A 1N6XA 2IN2A 5EXLA 4CREA 2ANMH 1BT7A 3KEEA 1W7GH 3KNXA 1K1IA 1AB9C 1HJAC 5BPEA 1UTOA 1DOJA 1Y3VA 4NIXA 2H1UA 2FIRH 1UCYH 1A4WH 1EAXA 1O35A 1HAOH 4AN7A 1ZJDA 1UTQA 2ZDVH 3TPIZ 1BTYA 3P92A 1AN1E 4OS7A 4BAOB 2AIPA 1HJ9A 4A1XA 1OYQA 1Z7KA 2F3CE 1DVAH 1FNIA 2PWXA 1EAWA 4I8HA 2W3IA 3C27B 6CHAB 2ZPRA 1GMCF 2OBOA 3CS7A 2A4GA 2GD4B 5G4BA 4HI3A 3PLBA 1CVWH 2J9NA 1CA0C 1GBEA 3KN2A 1P2NA 1SB1H 3LU9B 3SGQE 3OSYA 3M3SA 1GBJA 4MG3A 3LGTA 1EQ9A 4R0IA 1TOCB 4I33A 2HALA 1QR3E 1O0DH 2HNTE 2KAIA 1A0JA 3UR6A 1GJ9B 1TPPA 2VIWA 1P11E 2ZFPH 1P2QA 4D76A 2ZF0H 1B5GH 3GCTF 4FVDA 2ZNKH 2FOMB 1RGQA 1DLKB 4WMDA 2NU0E 1ABJH 1C5NH 1YPEH 2NU2E 2C93B 3MNCA 2XBVA 1P2IA 5H4IB 1E37B 3RU4T 1ESAA 3B9FH 4ZUHA 4X6PA 1GHXH 3BG4B 3ZVGA 2GZ7A 3ZZBA 4LZ4B 1C2IA 3KHVA 4ZHAA 6ESTA 1L0ZA 1Q2WA 1VCQA 1KXCA 3I78A 4JYVH 1H4WA 3KGPA 1IQNA 2RCEA 3TGJE 2PHBA 1K1OA 1GBTA 2G55A 4KTSA 4AYVB 1LVOA 4FUEA 3ZZ5A 2K1QA 4ZAEA 3HPTB 5HM9A 3SUGA 5HYOA 1DUEA 4HTCH 1NU9A 5J4SA 1NRQH 1C5MD 1O3KA 1VGCB 2VB0A 3MO9A 2A5KA 1RTLA 3TITA 5E0HA 2D2DA 3SU0A 8LPRA 1AVGH 3M35A 1O2PA 1MU8B 4WMEA 2WV4A 3TIUA 3BTME 3U8OH 2SNVA 1OWKA 4TY6A 1GL0E 2ESTE 1F7ZA 1NRPH 1MAXA 2H2ZA 4Y0YE 5E0GA 1JRTA 2XC5A 1D3PB 1OOKB 1BJUA 2C8WB 2TGDA 3M5NA 5T6FA 5LPEA 5EOKA 4ZXXH 3AAUA 4IBLH 4J2YB 3EA9A 1EP5A 1G37A 4OS5A 2BD9A 4YZUA 1OKXA 4NA9H 4AGJA 2ZHDA 1S0RA 3QLPH 1GBDA 1V2VT 3KCGH 2BY7X 1DWDH 4X8SH 2G81E 3F1SB 3QK1A 5EODA 1AVWA 2OC8A 1F0TA 3MOCA 3ZZ9A 1L1JA 1SGDE 2ZP0H 1AWFH 2ZCHP 1SHYA 1EJAA 1HXEH 3ESTA 4INLA 2YNAA 3I77A 3B8JA 2ZGBH 2JH5D 3PWCA 5JBBS 2SFAA 3UQVA 4E06H 1ZPZA 2QN5T 1N1LA 3SU5A 4XBBA 4H42U 1WOFA 1NS3A 1NRSH 3OYPA 2F9OA 1WTHD 2VIQA 1O3GA 2BY8X 2WUBA 2FS9A 3PB1E 2FOEA 2BDYA 1EZQA 1QNJA 1TYNA 4Q2KA 4FXGH 2BD4A 2R3YA 4YOIA 5L6NH 4BAKB 2UWLA 1NC6A 2VIOA 1YPHE 1A0LA 4GUXA 1G32B 1K1LA 1YPGH 4WF8A 1UTJA 2ZDKA 2BDGA 3B23B 2BDAA 3RDZA 2A45B 1JWTA 1DS2E 3M36A 1MBQA 2XWBI 1SGYE 1SGPE 2A31A 2ODPA 1T8LA 4X0WU 1ELVA 1UMAH 3ZVFA 1O2IA 3AW1A 2ODYB 2UWPA 5A0AE 4H4FA 2XTTB 3RXCA 4YT6H 1C1MA 2TGAA 1GBAA 1LMWB 1FXYA 1PPBH 1B0FA 1UVUH 4MNWA 1XUIA 2R2WU 1SFQB 5IYTA 3IG6B 3MMGA 5EW2H 1AWHB 4PROA 3SUEA 2PLXA 2FOHA 3K6ZA 1P10A 2QXJA 2FX4A 1P8VC 1DWCH 3ZZDA 1BJVA 3TH3H 2SNWA 4NGAH 1ETSH 1DXPA 2ZKSA 1P04A 1SLWB 1LVYA 4O03A 4I8JA 1TNKA 5EW1H 4I32A 2PW8H 4NIVA 7LPRA 4AG1A 4UE7H 1P06A 2FP7B 1AU8A 3VGCC 3PYHA 1QB9A 3UNSA 3GCTG 3E91A 4ZHLU 2CF8H 2HPQH 3TNSA 1GJ8B 2BVSH 4BTUB 3NUMA 4MNXA 1VR1H 1T4UH 2F91A 4B73A 5F8ZA 3ATLA 2CHAB 1GJ7B 4RSPA 2OUAA 1ACBE 3E8LA 1WBGB 2BXUH 1K1PA 4CR5A 2AMPA 1AB9B 4DJZB 1HJAB 2ZTXA 1D3DB 4ISHH 3SOSA 3TH2H 1C5VA 1QGFA 2FWWA 4THNH 1G3DA 3A87A 1ZHRA 1OP0A 1O3MA 3ATWA 1ANBA 3RXFA 2BD5A 1IQFA 2PUQH 2XW9A 4NCYA 2A4RA 1A3BH 4FU8A 1BITA 2Z7FE 2ZQ2A 4WY3A 4IW4E 5AF9H 1AD8H 1V2JT 1BMAA 1FQ3A 3Q3XA 2ZGHA 4WH8A 1KDQB 5GXPA 4INHA 2ZTZA 1ETTH 1WTGH 5PTPA 4CH2B 1CA0B 1O36A 1C1OA 4ZKOU 2BLWA 1K9OE 1MU6B 4CHAC 1SSXA 4E7NA 5J4QA 3P95A 2O8LA 1FDPA 1ELFA 3SV6A 3LKWA 4I31A 3SV2H 4YOJA 1MTVA 1IHSH 1OP8A 1MCVA 1ARBA 2GX4A 2PKAB 5DK1A 2QIQA 1AIXH 1TGSZ 2J92A 1C5UA 2ODQA 1O2ZA 4AZ2B 1JOUB 5A2MH 3BIVH 1GMDG 1NFYA 1YF4A 3GCHC 3RXSA 3FZZA 5JBAS 1C5TA 1Y5UT 1GHVH 2VNTA 1O2YA 5DJ7A 1V3XA 1W0YH 4MDSA 3RXHA 3Q77A 1A5HA 2P8OB 3HATH 2BXTH 4XBDA 4KP0A 2FDAA 4K8BA 1QCPA 1O5EH 3RMNH 1GI0A 4MPVA 2OCVB 3UWIA 1BTXA 5DG6A 1VZQH 1O2KA 1NESE 1T31A 1VCPA 1HCGA 3UNRA 1O5CB 1O31A 2FEQH 1RTKA 3MU0A 1BTPA 1B7XB 4NFFA 4X2VA 5DP9A 1RFNA 2NWNA 1HAIH 3A7VA 2FYQA 1Z71A 2JKHA 1QIXB 3GCOA 1M9UA 1S0QA 3JZ2B 3E6PH 5F03A 3ENSB 3P8OA 3LH1A 1ANEA 1GCDA 3A86A 2D8WA 3F9HA 1FZZA 3L33A 4RKJB 1GBHA 1UVSH 8ESTE 1RTFB 2BQWB 4FUIA 4U30A 1CHGA 1EX3A 1RD3B 1V2UT 2ZA5A 4NA7A 4NFEA 5TJXA 1E0FD 1FAXA 4DY7B 1J17T 1Z8RA 3SORA 2NU1E 4H6TA 1H8IH 2DE8A 3RM2H 1Z1IA 1E38B 3JZ1B 4Y8XA 2GV6A 1LO6A 3QTVH 2OBQA 1F92A 3SN8A 1RS0A 4XSKU 2ZI2H 4JZ1A 3A8BA 1KTSB 4Y71A 1S5SA 3A8DA 4Z6AH 1NU7B 1CE5A 1TRNA 4UFDH 3U8RH 2A32A 1TA2A 3TU7H 2Z3CA 3PMBB 1GDQA 1O5BB 1DSUA 1C2FA 3URCA 2SGQE 1Y5BT 1V2KT 1FY5A 3MWIU 6GCHG 2KAIB 5JBTA 1UHBB 3A89A 4NZQA 1Y8TA 1HAHH 1ZGVA 2J4IA 3UFAA 1TX6A 2ZHQH 3RXIA 1O2NA 1HPGA 2BVXH 1NT1A 2OP9A 2VWOA 2VWMA 1JIRA 5B6OA 8GCHG 1OWDA 1YCPM 1P9SA 3K2UA 1C2DA 1A0HB 1V2ST 4IGDA 2ZO3H 1ZSKA 2ZPSA 5CHAC 3VFEA 2VWLA 2SGFE 4DIHH 1SHHB 4M7GA 2CJIA 1C2HA 1G2MA 1HJ8A 4B2AA 2BX4A 3V3MA 1J16A 3TK5A 2ULLA 1OYTH 1C5YB 1QRWA 5C1XA 1NZQH 5F8XA 3BTKE 1KXEA 4I8LA 2ZU2A 2ZCLP 2AS9A 4CRDA 1EAIA 3P6ZB 3A8CA 1PJPA 1QRXA 2YNBA 2R0LA 3ATIA 2V6NA 3MFJA 1C1PA 4K69A 1GJBB 1Z8JB 2ZFTA 1HAGE 1C2GA 1MKWH 2WPLS 3VEQB 1HUTH 4YLUA 1LPGB 1Q3XA 4A6LA 1GBMA 1ZGIA 3VB4A 2XBXA 2FZZA 3QO6A 4ISLA 4BXWA 1OWHA 1C1SA 1J14A 1AVXA 1DX5M 5F6MA 4I8KA 1F5LA 1W7XH 4ZKSU 1PPZA 1D6RA 5A0BA 3SU3A 2Y7XA 1ZR0A 1BRAA 2VWNA 2GCHF 1P9UA 1W12U 3RU4D 1UTMA 3ODDA 2ZC9H 3V0XA 3FP7E 4AGKA 3HKJB 4A7IB 1HAZB 2HPPH 1VCWA 1BRBE 1GPZA 2ZHWH 3SNCA 2PSXA 2EA3A 4KTUA 4CBOA 1FY4A 3SI4H 3VGCB 3TVJB 4DURA 1TMUH 3ZZ8A 4KGAA 3TNTA 1VITF 1EASA 1LPZB 2CXVA 1GHAG 2UUKB 3O8BA 4BANB 4YM9A 1XXFA 2QC2A 3LGIA 1MQ5A 4YTAA 1BTZA 1W14U 2G5NA 5DP6A 4TWWA 1ZPCA 4GAWA 1K1MA 4K8YA 3U1IB 3BTWE 4CBNA 4AB8A 1NRNH 1WYKA 1S6HA 1P2MA 4NA8A 3ZVAA 2STBE 1LHFH 4AG2A 5EQQA 1ZZZA 2J2UA 1O3BA 1TWXB 2VVVA 3PLPA 1SGIB 4AORA 2ZG0H 3BN9A 3QN7A 1O2OA 1JIMA 2VGCC 2PKSC 1DPOA 5A09A 2GDEH 3BTTE 1OWEA 5GWZA 3FFGA 1ZLRA 1YCPH 1BDAA 1WQVH 2R9PA 2TIOA 3L6PA 2EC9H 1AGJA 2TGTA 3KQCA 1P03A 5GCHF 1ARCA 1W0ZU 4Q7XA 5JB9S 2P3TB 1K21H 1SR5C 4OS1A 2SGDE 2C4FH 2C3SA 1ELTA 1A46H 1A7SA 1IQKA 1DUAA 1O3IA 2AGEX 2IJOB 1EKBB 1QBNA 1TGCA 1Z1JA 2ILNA 1KTTB 4R8TB 4ABJA 4GCHG 4BAHB 2OC0A 4CHAB 3DFLA 4DGJA 4ABGA 4DCDA 1UHBA 3LGWA 3PV4A 4CRFA 3A7YA 1O37A 1GI8B 1XUFA 2WYGA 4FUCA 4MLFB 1ZSJA 2OLGA 1ZPBA 1XUJA 3RXUA 4ASHA 2AMDA 1CT4E 5K7RA 3GCHB 3NWUA 2IOTA 1VJAU 3SUDA 3IITA 2R0KA 3W95A 1LTOA 4AFZA 1WQSA 1LHDH 3RXAA 4JZDH 4CRBA 2UUFB 5TCAA 1Y3XA 4INKA 1UTLM 5LGOA 5AFYH 4ISIH 3SU2A 1FY8E 3GISB 1T7CA 2G5VA 4JYTA 1O2MA 1O32A 3GY6A 4LXBH 2JETC 3C1KA 1L1NA 2WPMS 1D6WA 1SLXB 1TPAE 2CV3A 1JXPA 2QAAA 3P8NA 4JZIA 4XFQA 2D26C 1XUHA 4KKDA 1HAPH 1NM6A 2FLBH 1ZOMA 5EGMA 2DE9A 5SGAE 2GV7A 1SQTA 3ZV9A 1CSOE 1HV7A 4IC6A 5C20A 3GDVA 1C1VH 3M5OA 2G4TA 2A1DB 3KQBA 5L2YH 3GY7A 1A1RA 4GHQA 3BTGE 3QGJA 2BY5X 2H9EH 2NU4E 1LHCH 2BZ6H 1F5KU 1LVBA 3A7XA 3FP8E 1AFQC 2QA9E 1A5GH 1AZZA 2GP9B 1YP9A 1YPMH 3VB3A 1EOJA 2QXIA 3NK8A 3RLWH 4VGCC 2XC4A 1SGFA 1TBZH 1K28D 1HXFH 1GDUA 4NSVA 1OS8A 1F0UA 4MVNA 1DSTA 1OSSA 1UTNA 3LGUA 3S9AA 3MO6A 5FPYA 1GWAA 3RXEA 1C9PA 4OGYA 1EJMA 4ABIA 4OS6A 2BQ7B 1NFXA 1P01A 1MH0A 2GCHG 1CQQA 2ASUB 2GCTC 2UUJB 1C2EA 1ZRBA 4AB9A 1MKWK 2HVXA 1GI3A 3SGBE 4YOGA 2WINI 2VJ1A 2Y5GA 3MH5A 1ESBA 1L1GA 2F9UA 2VU8E 2AFQB 3MU5A 1O30A 2QCYA 4JK6A 1VITG 2VH6A 3LJOA 2BLOA 1DFPA 3Q3YA 2D1JA 2W7UA 1XVOA 1EZXC 3M5MA 5CHAB 4K60A 1OX1A 5C67A 4NIWA 1Q31A 1C1QA 1A5IA 1YLDA 3BEFB 3SZNA 3MNXA 3A7TA 4A1VA 1HDTH 1V2QT 3UR9A 1HRTH 1QB6A 1RRKA 2TGPZ 1A61H 1KLJH 1LHGH 1O2XA 1IQMA 1TBQH 1D4PB 3RXGA 2A4QA 2AMQA 4KTCA 2PV9B 1GHBF 5ABWA 1CT2E 3ZYEA 3QDZB 5GJ4B 1C5ZB 1FIZA 3QX5H 3VXEH 2WUCA 1PPHE 1ZSLA 2ZWLH 1O5FH 3T2NA 1GMCG 1NY22 1NN6A 2FYRA 3K65B 5L30H 2A7JA 3OTJE 1P0SH 3RXLA 2A5AA 4O9VA 3STIA 1BTHH 3RP2A 1GL1A 1T8OA 3FANA 2QY0B 1AQ7A 2FXRA 1J9CH 1V2OT 2H9TH 4DIIH 1TABE 4YLQH 1C5XB 1ELDE 1TGNA 3TJOA 1QBVH 3CENA 3DT0H 3NPSA 4CRAA
chains in the Genus database with same CATH superfamily
4Y10E 1GBCA 1O2QA 3VPKA 2WV5A 5T6DA 1BTWA 3TLOA 1NPMA 1YCPK 2Y5FA 2QGRA 4ISNA 1D3QB 1TONA 2XBYA 3ATMA 1EFRD 5T3HA 2ZECA 4X1RU 1ID5H 1FPCH 4SGAE 3GS9A 3RLYH 2FX6A 2PGQB 1YC0A 3RXTA 2PUXB 2GKVE 1D9IA 3TJVA 3U98H 1PPGE 3T26A 5DKMA 4X1QU 3S0NA 1Y3UA 1O3JA 1SC8U 1SFIA 2XC0A 3BTHE 1EB2A 1SGNE 1SGEE 4IN1A 2ZCKP 3F2HA 3UOPA 2B5TB 2BTCE 5FX6A 1L4DA 1V2NT 2QV1A 1FAKH 3DA9B 1RXPA 3D23A 4ZH8A 1MUEB 3RUOA 1H1BA 4XOJA 1TNIA 1JRSA 1S6FA 1WSSH 4IMZA 1XVMA 3KQEA 4XBCA 4FUDA 1MABB 1NFUA 1OXGA 3F68H 1SMFE 2AHME 4CH8B 4X1NU 1KXFA 1O2RA 2ANYA 2VGCB 2PKSB 1P02A 2GMTC 5DO4H 5EPYA 1C1WH 3NRLA 3P17H 4A1TA 2O8MA 5DP3A 1F0RA 1INCA 1D3TB 1K2I1 5DP4A 5FPTA 5FBEA 3R0FA 5EXMA 2A4OA 1O3CA 1G36A 2ZDMA 1MQ6A 3HK6B 1GJ5H 1V6DA 4TYDA 1AE5A 1MD7A 4FUHA 4ABBA 1MAYA 3ZZ6A 3T29A 1WDIA 5AFZH 1ABIH 2FTMA 1CU1A 3E3TA 2Y7ZA 3PWBA 2H5DA 3U9AH 1SI5H 1KY9A 3RXRA 2STAE 3ZIAD 1QQUA 1W0JD 1BMNH 1LPKB 1Y3YA 4YESB 4ISOA 1ELEE 4XDEA 1ZMLA 3KL6A 1TX8A 3MYWA 1N8OC 3BG8A 3SNAA 1PYTD 3MU1A 3ZZ4A 3PLKA 3UPEA 1EATA 3VG8A 1MZAA 4JK5A 1TALA 2AGIX 3SV9A 5JBCS 3P8FA 1O3HA 1DM4B 4M9FA 1V2LT 3UB0A 2ZU5A 1GMHF 1HLTH 4WWYA 5EQSA 1FONA 3DD2H 3RXMA 3NXPA 2CN0H 4ESTE 4AFUA 4Q7ZA 5EG4A 3PV5A 2KCYA 3IWMA 1GI5A 1MTWA 3LDXH 3D65E 1WV7H 1C4U2 4F49A 1VITH 1IQGA 1QQ4A 4GHTA 4BAMB 2OC1A 2JETB 4F4OC 5CMXH 4D8NA 1DICA 1H9IE 4B75A 4GSOA 1GHZA 5DPAA 2QXHA 1P09A 5C94A 4UFEH 1FUJA 3HGPA 1XUGA 1BCUH 3QUMP 1G3CA 3A85A 1C5RA 1V2TT 4Z0KA 2XCFA 1FIWA 2ZTYA 2W5EA 3BEUA 2VH0A 2WPKS 4BAQB 1AO5A 2XYAA 4GVUA 5HXFA 1YPLH 3O8RA 1KSNA 3M5LA 2RG3A 4IC5A 1T4VH 5F53A 2Z3EA 3PV2A 2ALPA 1UVOA 4Y8ZA 4ZROA 2J98A 3M7TA 5A8XA 1O3LA 5CE1A 1BZXE 1W11U 3GY2A 1GI7B 5ETXA 3SO3A 5L2ZH 1Z8GA 3A82A 3FO8D 1SPJA 2W6ID 4UONA 1AFQB 1PQ7A 2XNIA 1RIWC 2W7SA 1C1TA 4U2WA 1O2TA 1K1NA 3EE7A 3H7TA 4D7FA 5K0HA 5GIBA 1CA8B 2F9NA 3EYDA 4VGCB 1S83A 1WUNH 2QF5A 3Q00A 3R3GB 1MTUA 4AYYB 3PRBA 2KR7A 4ASUD 3GYMA 2ZEBA 1IQJA 4JCNA 5E8EH 1DWEH 3SV8A 3VXFH 1WU1A 1O2WA 2V35A 1JBUH 3LPRA 1KLIH 4BNRA 4QT8C 3MH6A 2BLQA 1C2JA 2TPIZ 3WY8A 1QA0A 3HKIB 1GBFA 2QE7D 3NCLA 3M3VA 1KMHB 3K9XB 1O2LA 1JMOH 2GCTB 1TQ0B 3S69A 3CP7A 3T62A 1GG6C 3O8CA 1E35B 3ZZ7A 4DOQA 5LH8A 1S84A 1ZHMA 3ZVBA 2L6OA 1QL8A 2XWAA 3GY3A 2PSYA 1XX9A 2WPIS 4K1TA 1O2JA 2VVCA 5EXNA 2BD7A 6LPRA 2FLRH 2G8TA 5JDUB 1ZTLA 2F9PA 5C1YA 1QJ7B 1O33A 1ESTA 3BTQE 1IAUA 1K0HA 2QYIA 3LONA 2QF0A 4B76A 4K2YA 2BDBA 1V2MT 1TOMH 1GHYH 1HAVB 1OWIA 4Q7YA 1J15A 1GCTC 3A83A 1MBMA 5LPFA 3SQHE 3VB6A 3RXOA 3ZVDA 1IQLA 2I6SA 3P70B 3G01A 2FOGA 2SGAA 4LOYH 3AAVA 3E0PB 1C5QA 1SGTA 2FOAA 4MQAA 5FBIA 1KIGH 1YKTA 3E1XB 3MTYA 4OS2A 1LKBA 1AZ8A 2P16A 1BUIA 1SBWA 1SG8B 3OU0A 2OTVA 3PO1C 3NKKA 3T28A 4NG9H 2VIPA 2OQUA 2GZ9A 4MPXA 1SKYE 3SHAH 5T1VA 1UW7A 3SGAE 1UK4A 1FLEE 5LPRA 2P94A 1BRUP 2Z9GA 1TPSA 2AYWA 1EXFA 5JPMH 1GJAB 1DDJA 1IOEA 1F0SA 2PFEA 1EZSC 1Z6JH 2CMYA 4RKOB 2BOHB 2V3MA 1CBWC 3UTUH 4ZHMU 1E34B 2Y5HA 1COWD 2FS8A 2ZFSA 4X2XA 1HNEE 1LQDB 4O3UA 1BBRH 3LGVA 5EU8A 2FOBA 2Q6FA 3RXBA 3QWCH 1J8AA 5GDSH 3FP6E 5A8YA 3QZQA 1DE7H 4FUJA 2BY6X 1G2LA 3BV9B 2P3FH 4HZHA 2W3KA 4OS4A 2VINA 8KME2 2J38A 2JH0D 5E0JA 4UFGH 2O8TA 4A92A 3UNQA 5FL7D 2ZFQH 3MU8A 1W2KH 5EQRA 1P2OA 3M7QA 3ZVEA 2ZGJA 5HIZA 2O9QA 1EJNA 4BOHA 4CRCA 2NU3E 3LJJA 3M61U 1HIAB 4TY7A 1TBRH 1ZRKA 2GMTB 3SUFA 1UTKA 3BTEE 3MH7A 1GI2A 3P8GA 1UTPA 1XUKA 3AVZA 3SBKA 1BIOA 1SL3A 4BTIB 5EJZA 1MTNC 2ZU3A 4E7RG 2QXGA 3F9EA 4NSYA 5KECA 1CO7E 5FCRA 1LHEH 4OGXA 1TRYA 1T8NA 3F9GA 4Y0ZE 3RXKA 1XKAC 1YLNA 2Q6DA 2AIQA 1CGJE 2YOLA 2H6MA 2PGBB 4TPYA 4X1SU 1FN6A 3SQEE 1EAUA 1GBKA 4WXIA 3E16B 2KCPA 2PP6A 3HGNA 2RDLA 2ZFRH 1YGCH 1N8OB 2OD3B 1O2GH 4B6FA 4K5ZA 1GBBA 2R3UA 1ZMJA 1B0EA 1GI1A 1EZUC 2BDCA 1ZTJA 4Y7AA 9ESTA 1BA8B 1O3EA 2Y82A 1TNHA 1L2EA 2UWOA 3TGKE 3A7ZA 3DHKH 3FOAA 3H7OA 1ELGA 3V7TA 4KELA 4RT1A 2GTBA 3BEIB 5I25A 1C5PA 3ZZAA 1S6LA 2Y81A 2A2XH 1EUFA 4I8GA 4E05H 4WH6A 1UK2A 1VJ9U 1HB0B 2P95A 1EP6A 1QA7A 2Z94A 4AFSA 3UWJH 3M7UA 2P8OC 2F43B 3EDXB 3SJ9A 4CR9A 2RA3A 3S9CA 1C5LH 1HAVA 3D49H 3OY5U 1GVKB 2ANWA 2BB4A 2CGAA 3A88A 5C3NA 4FUGA 1E79D 3LH3A 1K22H 1LCYA 1XKBC 2OXSA 5ESTE 2Z9IA 4MTBA 4X1PU 2XRCA 2C8YB 1YYY1 3H5CB 3ZZCA 1ORFA 3W94A 7ESTE 5A8ZA 4Q80A 1EPTA 3EQ0H 1O2VA 4B74A 3UY9A 1GVLA 2V3HH 2ZZUH 1SGCA 1OWJA 4HG6A 1A2CH 1WCZA 3RC4A 5JYIA 1O3FA 3CS0A 3SHCH 1C4Y2 2F9BH 4ABDA 2VIVA 3RM0H 4Z1MD 2Z3DA 3TJUA 2FOFA 2GZ8A 1GHWH 3GY4A 4WJG2 3Q76A 1IQEA 5E2OA 3EA7A 2B7DH 3GYLB 4FU9A 5FXLA 5FX5A 2LP6A 1BRCE 1ANCA 4CRGA 1SOZA 2J5UA 3WWFA 1V2PT 1C5SA 2FM2A 1G3BA 1RIWB 1W8BH 3E90B 1MZDA 2GGVB 3RXVA 2XOKD 2ZQ1A 2Y6TA 1SQRA 1HGTH 4Y6DA 1SQAA 3BF6H 2B9LA 3V13A 1KYNA 4B2BA 5C5NA 2F83A 1P3EA 1HBTH 3ZVCA 3PMAB 1FN8A 4FUFA 1O3NA 5ESBA 2ALVA 1FX0B 2ANKH 4XD7D 4GPGA 3SNDA 4MPWA 3EA8A 1H8DH 2B8OH 3F9FA 2A7CA 2ZIQH 1O3DA 1GMDF 2QF3A 2FMJA 1Y59T 2I6QA 3ITIA 3W1EA 2FESH 4LK4A 1C2MA 1TNJA 4Y79A 2FI4E 1QFKH 4UD9H 2Q6GA 3MU4A 2G00A 2W26A 1S82A 2TRMA 1GG6B 4UDWH 4DW2U 1HYLA 2B0FA 1C5OH 1BQYA 2BMGB 1T32A 2GDDA 2Z9LA 3SU4A 1AUJA 3BIUH 3SJKA 5HMAA 4FOUC 3SJOA 2BOKA 1O2SA 1SGFG 2FI5E 4RI0A 1CGIE 5FPSA 3F3BA 4ZMAH 1EB1H 1HIAA 3I29A 1SLVB 2WPJS 4X2WA 3GY8A 2HNTC 3M3TA 1FPHH 1C1UH 2GT7A 1TRMA 4P02A 5EJ1A 2ZPQA 1PPCE 1CHOF 5A0CA 4U32A 1KXAA 1QRZA 2RA0A 4GLYA 7KMEH 2P93A 2R2MB 3A81A 1FV9A 1L4ZA 3RMOH 1BMLA 1TLDA 4IN2A 1O3OA 9LPRA 1AE8H 3UUZA 2PTCE 1UO6A 2V0BA 1GJDB 3VB5A 3QGNB 2G4UA 3KF2A 1P3CA 1GCTB 1W3CA 2BZAA 5DP7A 2BD3A 1Y5AT 3MHWU 1AKSB 1EPTC 2A7HA 1GGDC 2BYAX 3ATKA 1BBRK 1UJ1A 1SQOA 5GCHG 5F8TA 2J34A 1PQAA 1BTUA 2BY9X 1FY3A 1LDTT 2ZU4A 2V3OH 1O5GH 1UK3A 2HWLB 3A84A 3U8TH 2G51A 2J95A 5DP5A 2F9VA 2FO9A 2ZDNA 1H9LB 4H6SB 1QURH 1P05A 2O8WA 1Z8IB 1P12E 1W0KD 3U69H 4ABAA 3SU6A 1O3PB 4XE4A 3PO1B 3T25A 2KM0A 2Z9KA 1DITH 1TE0A 1Z6EA 4F55A 4X6NA 2Y80A 2EI8A 1ETRH 1UCYK 2PR3A 1MTSA 1QY6A 2Z9JA 3N7OA 2VIDA 3AASA 1FJSA 4O97A 4DVAU 3EE0B 1IQHA 2HLCA 6GCHF 5AHGH 3A8AA 1CBWB 4JYUH 7GCHF 4WVPE 1F5RA 1QJ1B 3VB7A 3ZZ3A 3ZYDA 1KLTA 2DUCA 5C17A 1MKXH 8GCHF 3RC6A 1DLEA 2ZGXH 3LIWA 1C2LA 4FVBA 3L3TA 3T5FH 5FCKA 1OPHB 3MNBA 2EI6A 1O2HA 1YM0A 4AOQA 1DWBH 3A7WA 4ZKNU 1QTFA 1P2JA 3F6UH 2ZHFH 3FZDA 4TPIZ 3URDA 3DSGA 1C5WB 1GI9B 1OP2A 1P57B 1QJ6B 2KZ4A 3SW2B 1MCTA 4P00A 3MNSA 1C1RA 4AFQA 2BD2A 4B1TA 1PPFE 1GJ6A 2A2QH 2C8XB 3LC3A 2JJ1D 3QZRA 4HFPB 4X8VH 3OX7U 3STJA 2BDHA 1DANH 3PROA 1DT2A 1XM1A 4NZLA 2BQ6B 3FAOA 1MTNB 1UVTH 1BBRE 1T8MA 4Y8YA 3DUXH 6CHAC 1HAYB 1XXDA 1ZTKA 2ZDLA 2H5CA 3DFJA 3RMLH 1QB1A 3HK3B 4X6MA 1TA6A 4JZEH 1YLCA 2QF4A 1YPHC 1F2SE 4X6OA 2AGGX 3QTOH 1QL7A 3MH4A 1AUTC 4NWLA 3RC5A 1HAXB 1RJXB 2XXLA 3S7HB 1AFEH 1TMBH 4ABHA 1MMJN 1X7AC 2CF9H 5JB8S 3Q3KA 1TMTH 2BD8A 1UCYE 5HGGA 1GJCB 1C1NA 1BMMH 1THRH 1KXBA 3RXQA 1XMNB 4SGBE 2OC7A 1O39A 3TK6A 4JZFH 4Y11E 2BM2A 1GVZA 2PTNA 2WYJA 4TWYA 3UREA 3KQDA 1VKYA 3E0NB 1FI8A 1DY8A 2A0QB 4YO9A 4AX9H 1PFXC 1UVPA 2FODA 1GHAF 2C90B 5HM2A 5E2PA 3MI4A 3LC5A 4ZKRU 2O8UA 1CT0E 3O8DA 1S85A 1W10U 1SGQE 1TFXA 2TBSA 3AW0A 3PTNA 3KIDU 3BG4C 1BOQA 3ZV8A 2V7QD 4DG4A 4YT7H 5AVDA 2IPQX 4DT7B 3U1JB 3UOUA 1G3EA 2XBWA 3NZIA 1LVMA 4Y7BA 5C1UA 3BTDE 1AKSA 4IMQA 2OQ5A 3GICB 2BDIA 2M2AA 2AERH 2F4LA 2FOCA 3SNBA 1LKAA 3LT3A 2P59A 5C0TA 1E1RD 3V12A 5C2ZA 3K6YA 1CHOG 2K8IA 3SNEA 1VGCC 4B2CA 1H9HE 1TQ7B 3KYGA 1CGHA 1KXDA 2VVUA 4ABFA 3OY6U 1BHXB 1K1JA 4UFFH 3UQOA 1GHBG 3GOVB 1LQEA 1YPJH 1BHXF 1SVPA 1GJ4H 1ZYOA 2ZHEH 4BTTB 1PPEE 5CDFE 1SGRE 1NFWA 3FVFB 3DSPA 4Y76A 3BTFE 4ZCNA 3S9BA 2BVRH 2EEKA 4WXVA 3EGKH 3ODFA 1ANDA 3SJ8A 5HKKD 4JMYA 1DY9A 2A5IA 3OTPA 4GCHF 1GI4A 5DSFA 2FI3E 4I86A 5BRRE 1NO9H 2HGTH 3LOXA 1TIOA 5EPNA 1YY3A 1C9TA 4FUBA 4BXSA 5FHTA 4D9QA 4ABEA 3TH4H 1V2WT 5C5OA 5FAHA 2AEIH 2BX3A 1G9IE 1O5DH 2H9HA 1GDNA 4MNVA 2BLVA 3SV7A 1IHTH 1U6QA 1MD8A 1QBOA 4I7YH 2ZFFH 1GBLA 4ZXYH 4D9RA 1C2KA 3RMMH 4FETA 4X8UH 4RN6A 1EOLA 1FMGA 2M5TA 2WPHS 1THPB 1TB6H 1AI8H 1ELAA 1TNLA 2ZU1A 2GT8A 4MNYA 4J1YA 2P3UB 1TNGA 1ZHPA 3SI3H 1W13U 3SU1A 1TAWA 1ZMNA 7GCHG 4K1SA 1NTPA 4U01A 4FU7A 1NRRH 2JH6D 4K3JA 4UEHH 2HNTF 3RXJA 4D7GA 2GVFA 3PMJA 1PQ8A 1P2KA 1IQIA 3RXPA 5GPIB 4NIYA 5T6GA 2ZGCA 4X8TH 1A3EH 2SGPE 2Z6BD 4IS5A 3LGYA 1KDQA 1C4V2 2EI7A 2RDEA 3TK9A 5DGJA 2IPHA 1TGTA 4K1EA 1PYTC 3RXDA 1E36B 3MO3A 5DP8A 1TGBA 1ZJKA 1TX7A 3OFND 4X2YA 1ELCA 2ZDAH 1H8HD 3GDSA 1MKXK 1YPKH 4YXWD 1EPTB 1SLUB 5CHBA 2UUYA 4O3TA 1GGDB 1ELBA 4WMFA 1GI6A 1O34A 2J94A 2BHGA 2PKAA 1DXWA 5IDKA 2LNCA 1HFDA 3EAJA 1Y3WA 3GCNA 5B6LA 1NROH 1BB0B 3PTBA 1QHRB 2G52A 3GDUA 1AY6H 1N6YA 3ELAH 2KX4A 1O3AA 2WPDD 5TCCA 2AH4X 1PQ5A 4B71A 1QL9A 2THFB 1S81A 4NWKA 3S7KB 3GY5A 3A80A 3TGIE 1TPOA 3N7EA 2KCAA 4LZ1H 2Q1JA 1GMHG 3TJNA 2HOBA 2C8ZB 2FPZA 1OHHD 3PMHB 3UIRA 1V2RT 1GBIA 1O38A 2LPRA 1G30B 3D62A 1AHTH 1NBMD 1O2UA 1THSH 2SGEE 1SOTA 3RU4E 3OAAD 3BSQA 5I46H 4HGCA 3T27A 2FTLE 2HRVA 3M37A 5GNDA 1YBWA 2XCNA 2OINA 2CHAC 2YMSD 1WAYB 1AMHA 4A5TS 1FY1A 4MPUA 3SJIA 1O5AB 3PM3A 5EIYA 1N6XA 2IN2A 5EXLA 4CREA 3F2FA 2ANMH 1BT7A 3KEEA 1W7GH 3KNXA 1K1IA 1AB9C 1HJAC 5BPEA 1UTOA 1DOJA 1Y3VA 4NIXA 2H1UA 2FIRH 1UCYH 1A4WH 1EAXA 1O35A 1HAOH 4AN7A 1ZJDA 1UTQA 2ZDVH 3TPIZ 1BTYA 3P92A 1AN1E 4OS7A 4BAOB 2AIPA 1HJ9A 4A1XA 1OYQA 1Z7KA 2F3CE 1DVAH 1FNIA 2PWXA 1EAWA 4I8HA 2W3IA 3C27B 6CHAB 2ZPRA 1GMCF 2OBOA 3CS7A 2A4GA 2GD4B 5G4BA 4HI3A 3PLBA 1CVWH 2J9NA 1CA0C 1GBEA 3KN2A 1P2NA 1SB1H 3LU9B 3SGQE 3OSYA 3M3SA 1GBJA 4MG3A 3LGTA 1EQ9A 4R0IA 1TOCB 4I33A 2HALA 3WWBA 1QR3E 1O0DH 2HNTE 2KAIA 1A0JA 3UR6A 1GJ9B 1TPPA 2VIWA 1P11E 2ZFPH 1P2QA 4D76A 2ZF0H 1B5GH 3GCTF 4FVDA 2ZNKH 2FOMB 1RGQA 1DLKB 4WMDA 2NU0E 1ABJH 1C5NH 1YPEH 2NU2E 2C93B 3MNCA 2XBVA 4ACBA 1P2IA 5H4IB 1E37B 3RU4T 1ESAA 3B9FH 4ZUHA 3AK5A 4X6PA 1GHXH 3BG4B 3ZVGA 2GZ7A 3ZZBA 4LZ4B 1C2IA 3KHVA 4ZHAA 6ESTA 1L0ZA 1Q2WA 1VCQA 1KXCA 3I78A 4JYVH 1H4WA 5DN6D 3KGPA 1IQNA 2RCEA 3TGJE 2PHBA 1K1OA 1GBTA 2G55A 4KTSA 4AYVB 1LVOA 4FUEA 3ZZ5A 2K1QA 4ZAEA 3HPTB 5HM9A 3SUGA 5HYOA 1DUEA 4HTCH 1NU9A 5J4SA 1NRQH 2RFKC 1C5MD 1O3KA 1VGCB 2VB0A 3MO9A 2A5KA 1RTLA 3TITA 5E0HA 2D2DA 3SU0A 8LPRA 1AVGH 3M35A 1O2PA 1MU8B 4WMEA 2WV4A 3TIUA 3BTME 3U8OH 2SNVA 1OWKA 4TY6A 1GL0E 2ESTE 1F7ZA 1NRPH 1MAXA 2H2ZA 2W6JD 4Y0YE 1H8ED 5E0GA 1JRTA 2XC5A 1D3PB 1OOKB 1BJUA 2C8WB 2TGDA 3M5NA 5T6FA 5LPEA 5EOKA 2OK5A 1QZ8A 4ZXXH 3AAUA 4IBLH 4J2YB 3EA9A 1EP5A 1G37A 4OS5A 2BD9A 4YZUA 1OKXA 4NA9H 4AGJA 5C0UA 2ZHDA 1S0RA 3QLPH 2YMSC 1GBDA 1V2VT 3KCGH 2BY7X 1DWDH 4X8SH 2G81E 3F1SB 3QK1A 5EODA 1AVWA 2OC8A 1F0TA 3MOCA 3ZZ9A 1L1JA 1SGDE 2ZP0H 1AWFH 2ZCHP 1SHYA 3H09A 1EJAA 1HXEH 3ESTA 4INLA 2YNAA 3I77A 3B8JA 2ZGBH 2JH5D 3PWCA 5JBBS 2SFAA 3UQVA 4E06H 1ZPZA 2QN5T 1N1LA 3OE7D 3SU5A 4XBBA 4H42U 1WOFA 1NS3A 1NRSH 3OYPA 2F9OA 1WTHD 2VIQA 1O3GA 2BY8X 2WUBA 4Q4LA 2FS9A 3PB1E 2FOEA 2BDYA 1EZQA 1QNJA 3CNRA 1TYNA 4Q2KA 4FXGH 2BD4A 2R3YA 4YOIA 5L6NH 4BAKB 2UWLA 1NC6A 2VIOA 1YPHE 1A0LA 4GUXA 1G32B 1K1LA 1YPGH 4WF8A 1UTJA 2ZDKA 2BDGA 3B23B 2BDAA 3RDZA 2A45B 1JWTA 1DS2E 3M36A 1MBQA 2XWBI 1SGYE 1SGPE 2A31A 2ODPA 1T8LA 4X0WU 1ELVA 1UMAH 1YWUA 3ZVFA 1O2IA 3AW1A 2ODYB 2UWPA 5A0AE 4F48B 4H4FA 2XTTB 3RXCA 4AC9A 4YT6H 1C1MA 2TGAA 1GBAA 1LMWB 1FXYA 1PPBH 1B0FA 1UVUH 3F2GA 4MNWA 1XUIA 2R2WU 1SFQB 5IYTA 3IG6B 3MMGA 5EW2H 3F0OA 1AWHB 4PROA 3SUEA 2PLXA 2FOHA 3K6ZA 1P10A 2QXJA 3UAIC 2FX4A 1P8VC 1DWCH 3ZZDA 1BJVA 3TH3H 2SNWA 4NGAH 1ETSH 1DXPA 2ZKSA 1P04A 1SLWB 1LVYA 4O03A 4I8JA 1TNKA 5EW1H 4I32A 2PW8H 4NIVA 7LPRA 4AG1A 4UE7H 1P06A 2FP7B 1AU8A 3VGCC 3PYHA 1QB9A 3UNSA 3GCTG 3E91A 4ZHLU 2CF8H 2HPQH 3TNSA 1GJ8B 2BVSH 4BTUB 3NUMA 4MNXA 1VR1H 1T4UH 2F91A 4B73A 5F8ZA 3ATLA 2CHAB 1GJ7B 5IK2D 4RSPA 2OUAA 1ACBE 3E8LA 1WBGB 2BXUH 1K1PA 4CR5A 2AMPA 1AB9B 4DJZB 1HJAB 2ZTXA 1D3DB 4ISHH 3U28C 3SOSA 3TH2H 1C5VA 1QGFA 2FWWA 4THNH 1G3DA 3A87A 1ZHRA 1OP0A 3DSOA 1O3MA 3ATWA 1ANBA 3RXFA 2BD5A 1IQFA 2PUQH 2XW9A 5HIYA 4NCYA 2A4RA 1A3BH 4FU8A 1BITA 2Z7FE 2ZQ2A 4WY3A 4IW4E 5AF9H 1AD8H 1V2JT 1BMAA 1FQ3A 3Q3XA 2ZGHA 4WH8A 1KDQB 5GXPA 4INHA 2ZTZA 1ETTH 1WTGH 5PTPA 4CH2B 1CA0B 1O36A 1C1OA 4ZKOU 2BLWA 1K9OE 1MU6B 4CHAC 1SSXA 4E7NA 5J4QA 3P95A 2O8LA 1FDPA 1ELFA 3SV6A 3LKWA 3PRDA 4I31A 3SV2H 4YOJA 1MTVA 2J97A 1IHSH 1OP8A 1MCVA 1ARBA 2GX4A 2PKAB 5DK1A 2QIQA 1AIXH 1TGSZ 2J92A 1C5UA 2ODQA 2HLDD 1O2ZA 4AZ2B 1JOUB 5A2MH 3BIVH 1GMDG 1NFYA 1YF4A 3GCHC 3RXSA 3FZZA 5JBAS 1C5TA 1Y5UT 1GHVH 2VNTA 1O2YA 5DJ7A 1V3XA 1W0YH 4MDSA 3RXHA 3Q77A 1A5HA 2LELA 2P8OB 3HATH 2BXTH 4XBDA 4KP0A 2FDAA 4K8BA 1QCPA 1O5EH 3RMNH 2EY4C 1GI0A 4MPVA 3N99A 2OCVB 3UWIA 1BTXA 5DG6A 1VZQH 1O2KA 1NESE 1T31A 1VCPA 1HCGA 3UNRA 1O5CB 1O31A 2FEQH 1RTKA 3MU0A 1BTPA 1B7XB 4NFFA 4X2VA 5DP9A 1RFNA 2NWNA 1HAIH 3A7VA 1BMFD 2FYQA 1Z71A 2EQNA 2JKHA 1QIXB 3GCOA 1M9UA 1S0QA 3JZ2B 3E6PH 5F03A 3ENSB 3KQ5A 4OM9A 3P8OA 3LH1A 1ANEA 1GCDA 3A86A 2D8WA 3F9HA 1FZZA 3SYJA 3L33A 4RKJB 1GBHA 2XNDD 1UVSH 8ESTE 1RTFB 2BQWB 4FUIA 4U30A 1CHGA 1EX3A 1RD3B 1V2UT 2ZA5A 4NA7A 4NFEA 5TJXA 1E0FD 1FAXA 4DY7B 1J17T 1Z8RA 3SORA 2NU1E 4H6TA 1H8IH 2DE8A 3RM2H 2WV9A 1Z1IA 1E38B 3JZ1B 4Y8XA 2GV6A 1LO6A 3QTVH 2OBQA 1F92A 3SN8A 1RS0A 2YMSB 4XSKU 2ZI2H 4JZ1A 3A8BA 1KTSB 4Y71A 1S5SA 3A8DA 3N7DA 2KCOA 4Z6AH 1NU7B 1CE5A 1TRNA 2L74A 4UFDH 3U8RH 2A32A 1TA2A 3TU7H 2Z3CA 3PMBB 1GDQA 1O5BB 1DSUA 1C2FA 3URCA 2SGQE 1Y5BT 1V2KT 1FY5A 3MWIU 6GCHG 2KAIB 5JBTA 1UHBB 3A89A 4NZQA 1Y8TA 1HAHH 1ZGVA 2J4IA 3UFAA 1TX6A 2ZHQH 3RXIA 1O2NA 1HPGA 2BVXH 1NT1A 2OP9A 2VWOA 2VWMA 1JIRA 5B6OA 8GCHG 1OWDA 1YCPM 1P9SA 3K2UA 1C2DA 1A0HB 1V2ST 4IGDA 2ZO3H 1ZSKA 2ZPSA 5CHAC 3VFEA 2VWLA 2SGFE 4DIHH 1SHHB 4M7GA 2HVYB 2CJIA 1C2HA 1G2MA 1HJ8A 4B2AA 2BX4A 3V3MA 1J16A 3TK5A 2ULLA 1OYTH 1C5YB 1QRWA 5C1XA 1NZQH 5F8XA 3BTKE 1KXEA 4I8LA 2ZU2A 2ZCLP 2AS9A 4CRDA 1EAIA 3P6ZB 3A8CA 1PJPA 1QRXA 2YNBA 2R0LA 3ATIA 2V6NA 3MFJA 1C1PA 4K69A 1GJBB 1Z8JB 2ZFTA 1HAGE 1C2GA 1MKWH 2WPLS 3VEQB 1HUTH 4YLUA 1LPGB 1Q3XA 4A6LA 1GBMA 1ZGIA 2WSSD 2XBXA 2FZZA 3QO6A 4ISLA 3VB4A 4BXWA 1OWHA 1C1SA 1J14A 1AVXA 1DX5M 5F6MA 4I8KA 1F5LA 1W7XH 4ZKSU 1PPZA 1D6RA 4DT4A 5A0BA 3SU3A 2KFWA 2Y7XA 1ZR0A 1BRAA 2VWNA 5EJLA 2GCHF 1P9UA 1W12U 3RU4D 1UTMA 3ODDA 2ZC9H 3V0XA 3FP7E 4AGKA 3HKJB 4A7IB 1HAZB 2HPPH 1VCWA 1BRBE 1GPZA 2ZHWH 3SNCA 2PSXA 2EA3A 4KTUA 4CBOA 1FY4A 3SI4H 3VGCB 3TVJB 4DURA 1TMUH 3ZZ8A 4KGAA 3TNTA 1VITF 1EASA 1LPZB 3F0PA 2CXVA 1GHAG 2UUKB 3O8BA 4BANB 4YM9A 1XXFA 2QC2A 3DCLA 3LGIA 1MQ5A 4YTAA 1BTZA 1W14U 1WXRA 2G5NA 5DP6A 4TWWA 1ZPCA 4GAWA 1K1MA 4K8YA 3U1IB 3BTWE 4CBNA 2VBCA 4AB8A 1NRNH 1WYKA 1S6HA 1P2MA 4NA8A 3ZVAA 2STBE 1LHFH 4AG2A 5EQQA 1ZZZA 2J2UA 1O3BA 1TWXB 2VVVA 3PLPA 1SGIB 4AORA 2ZG0H 3BN9A 3QN7A 1NBME 1O2OA 1JIMA 2VGCC 2PKSC 1DPOA 5A09A 2GDEH 3BTTE 1OWEA 5GWZA 3FFGA 4RT0A 1ZLRA 1YCPH 1BDAA 1WQVH 2R9PA 2TIOA 3L6PA 2EC9H 1AGJA 2TGTA 3KQCA 1P03A 5GCHF 5KEDA 1ARCA 1W0ZU 4Q7XA 5JB9S 2P3TB 1K21H 1SR5C 4OS1A 2SGDE 2C4FH 2C3SA 1ELTA 1A46H 1A7SA 1IQKA 1DUAA 1O3IA 2AGEX 2IJOB 1EKBB 1QBNA 1TGCA 1Z1JA 2ILNA 1KTTB 4R8TB 4ABJA 4GCHG 4BAHB 2OC0A 4CHAB 3DFLA 3KYFA 4DGJA 4ABGA 4DCDA 1UHBA 3LGWA 3PV4A 4CRFA 3A7YA 1O37A 1GI8B 1XUFA 2JDID 2WYGA 4FUCA 4MLFB 1ZSJA 2OLGA 4ACAA 1ZPBA 1XUJA 3RXUA 4ASHA 2AMDA 1CT4E 5K7RA 3GCHB 3NWUA 2IOTA 1VJAU 4Q63A 2JIZD 3SUDA 3IITA 2R0KA 3W95A 1LTOA 4AFZA 1WQSA 4XRNA 1LHDH 3FN8A 3RXAA 4JZDH 4CRBA 2UUFB 5TCAA 1Y3XA 4INKA 1UTLM 5LGOA 5AFYH 4ISIH 3SU2A 1FY8E 3GISB 1T7CA 2G5VA 4JYTA 1O2MA 1O32A 3GY6A 4LXBH 2WHXA 2JETC 3C1KA 1L1NA 2WPMS 3MQKC 1D6WA 1SLXB 1TPAE 2CV3A 1JXPA 2QAAA 3P8NA 4JZIA 4XFQA 2D26C 1XUHA 4KKDA 1HAPH 1NM6A 2FLBH 1ZOMA 5EGMA 2DE9A 5SGAE 2GV7A 1SQTA 3ZV9A 1CSOE 1HV7A 4IC6A 5C20A 3GDVA 1C1VH 3M5OA 2G4TA 2A1DB 3KQBA 5L2YH 3GY7A 1A1RA 4GHQA 3BTGE 3QGJA 2GJGA 2BY5X 2H9EH 2NU4E 1LHCH 2IJD1 2BZ6H 1F5KU 1LVBA 3A7XA 3FP8E 1AFQC 2QA9E 1A5GH 1E1QD 1AZZA 2GP9B 4B6EA 1YP9A 1YPMH 3VB3A 1EOJA 2QXIA 3NK8A 3RLWH 2WZQA 4VGCC 2XC4A 1SGFA 1TBZH 1K28D 1HXFH 1GDUA 4NSVA 1OS8A 1F0UA 4MVNA 1DSTA 1OSSA 1UTNA 3LGUA 3S9AA 3MO6A 5FPYA 1GWAA 3RXEA 1C9PA 4OGYA 1EJMA 4ABIA 4OS6A 2BQ7B 1NFXA 1P01A 1MH0A 2GCHG 1CQQA 2ASUB 2GCTC 2CK3D 2UUJB 1C2EA 1ZRBA 4AB9A 1MKWK 2HVXA 1GI3A 3SGBE 4YOGA 3WW7A 2WINI 2VJ1A 2Y5GA 3MH5A 1ESBA 1L1GA 2F9UA 2VU8E 3FKSD 2AFQB 3MU5A 1O30A 2QCYA 4JK6A 1VITG 2VH6A 3LJOA 2BLOA 1DFPA 3Q3YA 2D1JA 2W7UA 1XVOA 1EZXC 3M5MA 5CHAB 4K60A 1OX1A 5C67A 4NIWA 1Q31A 1C1QA 1A5IA 1YLDA 3BEFB 3SZNA 3MNXA 3A7TA 4A1VA 1HDTH 1V2QT 3UR9A 1HRTH 1QB6A 1RRKA 2TGPZ 1A61H 1KLJH 1LHGH 1O2XA 1IQMA 1TBQH 1D4PB 3RXGA 2A4QA 2AMQA 4TT3D 2K0QA 3OEHD 4KTCA 2PV9B 1GHBF 5ABWA 1CT2E 3ZYEA 3QDZB 5GJ4B 1C5ZB 1FIZA 3QX5H 3VXEH 2WUCA 1PPHE 1ZSLA 2ZWLH 1O5FH 3T2NA 1GMCG 1NY22 1NN6A 2FYRA 3K65B 5L30H 2A7JA 3OTJE 1P0SH 3RXLA 2A5AA 4O9VA 3STIA 1BTHH 3RP2A 3OEED 1GL1A 1T8OA 3FANA 2QY0B 2FXRA 1AQ7A 1J9CH 1V2OT 2H9TH 3SZEA 1TABE 4YLQH 2JJ2D 1C5XB 1ELDE 4DIIH 1TGNA 2J98B 3TJOA 1QBVH 4TSFD 3CENA 3DT0H 3NPSA 5KGOA 4CRAA
chains in the Genus database with same CATH topology
4Y10E 1GBCA 1O2QA 3VPKA 2WV5A 5T6DA 1BTWA 3TLOA 1NPMA 1YCPK 2Y5FA 2QGRA 4ISNA 1D3QB 1TONA 2XBYA 3ATMA 5T3HA 2ZECA 4X1RU 1ID5H 1FPCH 4SGAE 3RLYH 2FX6A 2PGQB 1YC0A 3RXTA 2PUXB 2GKVE 1D9IA 3TJVA 3U98H 1PPGE 3T26A 5DKMA 4X1QU 3S0NA 1Y3UA 1O3JA 1SC8U 1SFIA 2XC0A 3BTHE 1EB2A 1SGNE 1SGEE 4IN1A 2ZCKP 3UOPA 2B5TB 2BTCE 5FX6A 1L4DA 1V2NT 2QV1A 1FAKH 3DA9B 1RXPA 3D23A 4ZH8A 1MUEB 3RUOA 1H1BA 4XOJA 1TNIA 1JRSA 1S6FA 1WSSH 4IMZA 1XVMA 3KQEA 4XBCA 4FUDA 1NFUA 1OXGA 3F68H 1SMFE 4CH8B 4X1NU 1KXFA 1O2RA 2ANYA 2VGCB 2PKSB 1P02A 2GMTC 5DO4H 5EPYA 1C1WH 3P17H 4A1TA 2O8MA 5DP3A 1F0RA 1INCA 1D3TB 1K2I1 5DP4A 5FPTA 5FBEA 3R0FA 5EXMA 2A4OA 1O3CA 1G36A 2ZDMA 1MQ6A 3HK6B 1GJ5H 1V6DA 4TYDA 1AE5A 1MD7A 4FUHA 4ABBA 1MAYA 3ZZ6A 3T29A 5AFZH 1ABIH 2FTMA 1CU1A 3E3TA 2Y7ZA 3PWBA 2H5DA 3U9AH 1SI5H 1KY9A 3RXRA 2STAE 1QQUA 1BMNH 1LPKB 1Y3YA 4YESB 4ISOA 1ELEE 4XDEA 1ZMLA 3KL6A 1TX8A 3MYWA 1N8OC 3BG8A 3SNAA 1PYTD 3MU1A 3ZZ4A 3PLKA 3UPEA 1EATA 1MZAA 4JK5A 1TALA 2AGIX 3SV9A 5JBCS 3P8FA 1O3HA 1DM4B 1V2LT 2ZU5A 1GMHF 1HLTH 4WWYA 5EQSA 1FONA 3DD2H 3RXMA 3NXPA 2CN0H 4ESTE 4AFUA 4Q7ZA 5EG4A 3IWMA 1GI5A 1MTWA 3LDXH 3D65E 1WV7H 1C4U2 4F49A 1VITH 1IQGA 1QQ4A 4GHTA 4BAMB 2OC1A 2JETB 4F4OC 5CMXH 4D8NA 1DICA 1H9IE 4B75A 4GSOA 1GHZA 5DPAA 2QXHA 1P09A 4UFEH 1FUJA 3HGPA 1XUGA 1BCUH 3QUMP 1G3CA 3A85A 1C5RA 1V2TT 4Z0KA 2XCFA 1FIWA 2ZTYA 2W5EA 3BEUA 2VH0A 2WPKS 4BAQB 1AO5A 2XYAA 4GVUA 5HXFA 1YPLH 3O8RA 1KSNA 3M5LA 2RG3A 4IC5A 1T4VH 2Z3EA 2ALPA 1UVOA 4Y8ZA 4ZROA 3M7TA 5A8XA 1O3LA 5CE1A 1BZXE 1W11U 3GY2A 1GI7B 5ETXA 3SO3A 5L2ZH 1Z8GA 3A82A 1SPJA 4UONA 1AFQB 1PQ7A 2XNIA 1RIWC 2W7SA 1C1TA 4U2WA 1O2TA 1K1NA 3H7TA 4D7FA 5K0HA 5GIBA 1CA8B 2F9NA 3EYDA 4VGCB 1S83A 1WUNH 3Q00A 3R3GB 1MTUA 4AYYB 3GYMA 2ZEBA 1IQJA 4JCNA 5E8EH 1DWEH 3SV8A 3VXFH 1WU1A 1O2WA 2V35A 1JBUH 3LPRA 1KLIH 4BNRA 4QT8C 3MH6A 2BLQA 1C2JA 2TPIZ 3WY8A 1QA0A 3HKIB 1GBFA 3NCLA 3M3VA 3K9XB 1O2LA 1JMOH 2GCTB 1TQ0B 3S69A 3CP7A 3T62A 1GG6C 3O8CA 1E35B 3ZZ7A 4DOQA 5LH8A 1S84A 1ZHMA 3ZVBA 1QL8A 2XWAA 3GY3A 2PSYA 1XX9A 2WPIS 4K1TA 1O2JA 2VVCA 5EXNA 2BD7A 6LPRA 2FLRH 2G8TA 5JDUB 1ZTLA 2F9PA 5C1YA 1QJ7B 1O33A 1ESTA 3BTQE 1IAUA 2QYIA 3LONA 2QF0A 4B76A 4K2YA 2BDBA 1V2MT 1TOMH 1GHYH 1HAVB 1OWIA 4Q7YA 1J15A 1GCTC 3A83A 1MBMA 5LPFA 3SQHE 3VB6A 3RXOA 3ZVDA 1IQLA 2I6SA 3P70B 3G01A 2FOGA 2SGAA 4LOYH 3AAVA 3E0PB 1C5QA 1SGTA 2FOAA 4MQAA 5FBIA 1KIGH 1YKTA 3E1XB 3MTYA 4OS2A 1LKBA 1AZ8A 2P16A 1BUIA 1SBWA 1SG8B 3OU0A 2OTVA 3PO1C 3NKKA 3T28A 4NG9H 2VIPA 2OQUA 2GZ9A 4MPXA 3SHAH 3SGAE 1UK4A 1FLEE 5LPRA 2P94A 1BRUP 2Z9GA 1TPSA 2AYWA 1EXFA 5JPMH 1GJAB 1DDJA 1IOEA 1F0SA 2PFEA 1EZSC 1Z6JH 2CMYA 4RKOB 2BOHB 1CBWC 3UTUH 4ZHMU 1E34B 2Y5HA 2FS8A 2ZFSA 4X2XA 1HNEE 1LQDB 4O3UA 1BBRH 3LGVA 5EU8A 2FOBA 2Q6FA 3RXBA 3QWCH 1J8AA 5GDSH 3FP6E 5A8YA 3QZQA 1DE7H 4FUJA 2BY6X 1G2LA 3BV9B 2P3FH 4HZHA 2W3KA 4OS4A 2VINA 8KME2 2J38A 2JH0D 5E0JA 4UFGH 2O8TA 4A92A 3UNQA 2ZFQH 3MU8A 1W2KH 5EQRA 1P2OA 3M7QA 3ZVEA 2ZGJA 2O9QA 1EJNA 4BOHA 4CRCA 2NU3E 3LJJA 3M61U 1HIAB 4TY7A 1TBRH 1ZRKA 2GMTB 3SUFA 1UTKA 3BTEE 3MH7A 1GI2A 3P8GA 1UTPA 1XUKA 3AVZA 3SBKA 1BIOA 1SL3A 4BTIB 1MTNC 2ZU3A 4E7RG 2QXGA 3F9EA 4NSYA 1CO7E 5FCRA 1LHEH 4OGXA 1TRYA 1T8NA 3F9GA 4Y0ZE 3RXKA 1XKAC 2Q6DA 2AIQA 1CGJE 2YOLA 2H6MA 2PGBB 4TPYA 4X1SU 1FN6A 3SQEE 1EAUA 1GBKA 4WXIA 3E16B 3HGNA 2RDLA 2ZFRH 1YGCH 1N8OB 2OD3B 1O2GH 4K5ZA 1GBBA 2R3UA 1ZMJA 1B0EA 1GI1A 1EZUC 2BDCA 1ZTJA 4Y7AA 9ESTA 1BA8B 1O3EA 2Y82A 1TNHA 1L2EA 2UWOA 3TGKE 3A7ZA 3DHKH 3H7OA 1ELGA 3V7TA 4KELA 2GTBA 3BEIB 5I25A 1C5PA 3ZZAA 2Y81A 2A2XH 1EUFA 4I8GA 4E05H 4WH6A 1UK2A 1VJ9U 1HB0B 2P95A 1EP6A 1QA7A 2Z94A 4AFSA 3UWJH 3M7UA 2P8OC 3EDXB 3SJ9A 4CR9A 2RA3A 3S9CA 1C5LH 1HAVA 3D49H 3OY5U 1GVKB 2ANWA 2BB4A 2CGAA 3A88A 5C3NA 4FUGA 3LH3A 1K22H 1LCYA 1XKBC 2OXSA 5ESTE 2Z9IA 4MTBA 4X1PU 2XRCA 2C8YB 1YYY1 3H5CB 3ZZCA 1ORFA 3W94A 7ESTE 5A8ZA 4Q80A 1EPTA 3EQ0H 1O2VA 4B74A 3UY9A 1GVLA 2V3HH 2ZZUH 1SGCA 1OWJA 1A2CH 1WCZA 3RC4A 5JYIA 1O3FA 3CS0A 3SHCH 1C4Y2 2F9BH 4ABDA 2VIVA 3RM0H 2Z3DA 3TJUA 2FOFA 2GZ8A 1GHWH 3GY4A 4WJG2 3Q76A 1IQEA 5E2OA 3EA7A 2B7DH 3GYLB 4FU9A 5FXLA 5FX5A 1BRCE 1ANCA 4CRGA 1SOZA 1V2PT 1C5SA 2FM2A 1G3BA 1RIWB 1W8BH 3E90B 1MZDA 2GGVB 3RXVA 2ZQ1A 2Y6TA 1HGTH 4Y6DA 1SQAA 3BF6H 2B9LA 3V13A 1KYNA 4B2BA 5C5NA 2F83A 1P3EA 1HBTH 3ZVCA 3PMAB 1FN8A 4FUFA 1O3NA 5ESBA 2ALVA 2ANKH 3SNDA 4GPGA 4MPWA 3EA8A 1H8DH 2B8OH 3F9FA 2A7CA 2ZIQH 1O3DA 1GMDF 2QF3A 2FMJA 1Y59T 2I6QA 3ITIA 2FESH 4LK4A 1C2MA 1TNJA 4Y79A 2FI4E 1QFKH 4UD9H 2Q6GA 3MU4A 2G00A 2W26A 1S82A 2TRMA 1GG6B 4UDWH 4DW2U 1HYLA 2B0FA 1C5OH 1BQYA 2BMGB 1T32A 2GDDA 2Z9LA 3SU4A 1AUJA 3BIUH 3SJKA 5HMAA 3SJOA 2BOKA 1O2SA 1SGFG 2FI5E 5FPSA 1CGIE 4ZMAH 1EB1H 1HIAA 3I29A 1SLVB 2WPJS 4X2WA 3GY8A 2HNTC 3M3TA 1FPHH 1C1UH 2GT7A 1TRMA 2ZPQA 1PPCE 1CHOF 5A0CA 4U32A 1KXAA 1QRZA 2RA0A 4GLYA 7KMEH 2P93A 2R2MB 3A81A 1FV9A 1L4ZA 3RMOH 1BMLA 1TLDA 4IN2A 1O3OA 9LPRA 1AE8H 3UUZA 2PTCE 1UO6A 2V0BA 1GJDB 3VB5A 3QGNB 2G4UA 3KF2A 1P3CA 1GCTB 1W3CA 2BZAA 5DP7A 2BD3A 1Y5AT 3MHWU 1AKSB 1EPTC 2A7HA 1GGDC 2BYAX 3ATKA 1BBRK 1UJ1A 1SQOA 5GCHG 5F8TA 2J34A 1PQAA 1BTUA 2BY9X 1FY3A 1LDTT 2ZU4A 2V3OH 1O5GH 1UK3A 2HWLB 3A84A 3U8TH 2G51A 2J95A 5DP5A 2F9VA 2FO9A 2ZDNA 1H9LB 4H6SB 1QURH 1P05A 2O8WA 1Z8IB 1P12E 3U69H 4ABAA 3SU6A 1O3PB 4XE4A 3PO1B 3T25A 2Z9KA 1DITH 1TE0A 1Z6EA 4X6NA 2Y80A 2EI8A 1ETRH 1UCYK 2PR3A 1MTSA 1QY6A 2Z9JA 3N7OA 2VIDA 3AASA 1FJSA 4O97A 4DVAU 3EE0B 1IQHA 2HLCA 6GCHF 5AHGH 3A8AA 1CBWB 4JYUH 7GCHF 4WVPE 1F5RA 1QJ1B 3VB7A 3ZZ3A 3ZYDA 1KLTA 2DUCA 1MKXH 8GCHF 3RC6A 1DLEA 2ZGXH 3LIWA 1C2LA 4FVBA 3L3TA 3T5FH 5FCKA 1OPHB 3MNBA 2EI6A 1O2HA 1YM0A 4AOQA 1DWBH 3A7WA 4ZKNU 1QTFA 1P2JA 3F6UH 2ZHFH 3FZDA 4TPIZ 3URDA 1C5WB 1GI9B 1OP2A 1P57B 1QJ6B 3SW2B 1MCTA 3MNSA 1C1RA 4AFQA 2BD2A 4B1TA 1PPFE 1GJ6A 2A2QH 2C8XB 3LC3A 3QZRA 4HFPB 4X8VH 3OX7U 3STJA 2BDHA 1DANH 3PROA 1DT2A 1XM1A 4NZLA 2BQ6B 3FAOA 1MTNB 1UVTH 1BBRE 1T8MA 4Y8YA 3DUXH 6CHAC 1HAYB 1XXDA 1ZTKA 2ZDLA 2H5CA 3DFJA 3RMLH 1QB1A 3HK3B 4X6MA 1TA6A 4JZEH 1YLCA 1YPHC 1F2SE 4X6OA 2AGGX 3QTOH 1QL7A 3MH4A 1AUTC 4NWLA 3RC5A 1HAXB 1RJXB 2XXLA 3S7HB 1AFEH 1TMBH 4ABHA 1MMJN 1X7AC 2CF9H 5JB8S 3Q3KA 1TMTH 2BD8A 1UCYE 5HGGA 1GJCB 1C1NA 1BMMH 1THRH 1KXBA 3RXQA 1XMNB 4SGBE 2OC7A 1O39A 3TK6A 4JZFH 4Y11E 2BM2A 1GVZA 2PTNA 2WYJA 4TWYA 3UREA 3KQDA 3E0NB 1FI8A 1DY8A 2A0QB 4YO9A 4AX9H 1PFXC 1UVPA 2FODA 1GHAF 2C90B 5HM2A 5E2PA 3MI4A 3LC5A 4ZKRU 2O8UA 1CT0E 3O8DA 1S85A 1W10U 1SGQE 1TFXA 2TBSA 3AW0A 3PTNA 3KIDU 3BG4C 1BOQA 3ZV8A 4DG4A 4YT7H 5AVDA 4DT7B 3U1JB 3UOUA 1G3EA 2XBWA 3NZIA 1LVMA 4Y7BA 5C1UA 3BTDE 1AKSA 4IMQA 2OQ5A 3GICB 2BDIA 2AERH 2FOCA 3SNBA 1LKAA 3LT3A 2P59A 3V12A 5C2ZA 3K6YA 1CHOG 3SNEA 1VGCC 4B2CA 1H9HE 1TQ7B 1CGHA 1KXDA 2VVUA 4ABFA 3OY6U 1BHXB 1K1JA 4UFFH 3UQOA 1GHBG 3GOVB 1LQEA 1YPJH 1BHXF 1SVPA 1GJ4H 1ZYOA 2ZHEH 4BTTB 1PPEE 1SGRE 1NFWA 3FVFB 4Y76A 3BTFE 3S9BA 2BVRH 2EEKA 4WXVA 3EGKH 3ODFA 1ANDA 3SJ8A 4JMYA 1DY9A 2A5IA 4GCHF 1GI4A 2FI3E 5BRRE 1NO9H 2HGTH 3LOXA 1TIOA 5EPNA 1C9TA 4FUBA 4BXSA 5FHTA 4D9QA 4ABEA 3TH4H 1V2WT 5C5OA 5FAHA 2AEIH 2BX3A 1G9IE 1O5DH 2H9HA 1GDNA 4MNVA 2BLVA 3SV7A 1IHTH 1U6QA 1MD8A 1QBOA 4I7YH 2ZFFH 1GBLA 4ZXYH 4D9RA 1C2KA 3RMMH 4X8UH 4RN6A 1EOLA 1FMGA 2M5TA 2WPHS 1THPB 1TB6H 1AI8H 1ELAA 1TNLA 2ZU1A 2GT8A 4MNYA 4J1YA 2P3UB 1TNGA 1ZHPA 3SI3H 1W13U 3SU1A 1TAWA 1ZMNA 7GCHG 4K1SA 1NTPA 4U01A 4FU7A 1NRRH 2JH6D 4K3JA 4UEHH 2HNTF 3RXJA 4D7GA 2GVFA 3PMJA 1PQ8A 1P2KA 1IQIA 3RXPA 5GPIB 4NIYA 5T6GA 2ZGCA 4X8TH 1A3EH 2SGPE 2Z6BD 4IS5A 3LGYA 1KDQA 1C4V2 2EI7A 3TK9A 5DGJA 2IPHA 1TGTA 4K1EA 1PYTC 3RXDA 1E36B 3MO3A 5DP8A 1TGBA 1ZJKA 1TX7A 4X2YA 1ELCA 2ZDAH 3GDSA 1MKXK 1YPKH 1EPTB 1SLUB 2UUYA 4O3TA 1GGDB 1ELBA 4WMFA 1GI6A 1O34A 2J94A 2BHGA 2PKAA 1DXWA 5IDKA 2LNCA 1HFDA 3EAJA 1Y3WA 3GCNA 1NROH 1BB0B 3PTBA 1QHRB 2G52A 3GDUA 1AY6H 1N6YA 3ELAH 1O3AA 5TCCA 2AH4X 1PQ5A 4B71A 1QL9A 2THFB 1S81A 4NWKA 3S7KB 3GY5A 3A80A 3TGIE 1TPOA 4LZ1H