1BRCE

Relocating a negative charge in the binding pocket of trypsin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKGSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPDVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relocating a negative charge in the binding pocket of trypsin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1992-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1brcE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1brcE02
2H1UA 3EAJA 2GV7A 4I8HA 2OC0A 1JRTA 4TYDA 3SUDA 3UFAA 4I8LA 3Q76A 1OKXA 3P17H 3ZVBA 1HYLA 1AKSB 1TNKA 1SSXA 1MD8A 1HAHH 2XTTB 4I32A 1HAPH 2F83A 2UUFB 4NWLA 3P6ZB 2G51A 2ASUB 2J92A 3JZ1B 1UVPA 4GAWA 1DDJA 1FY8E 3BTFE 3S69A 1XXFA 5E8EH 2FXRA 4INLA 1O2YA 3LJJA 2A31A 2QCYA 4B2BA 3LH1A 1BRCE 3A8BA 1F5RA 4JYVH 2C8WB 1VJ9U 2FI4E 4FUJA 3Q3YA 3F6UH 3VGCC 3RXHA 3TLOA 3O8BA 2FOCA 1TBZH 3ESTA 1TX8A 2BTCE 2C90B 1QL9A 1LKAA 2HRVA 1T8LA 2VGCB 4GHQA 3SJOA 1CGHA 2JKHA 1GCTC 1ARCA 4XE4A 4ZHAA 4IW4E 2G4TA 3I77A 3Q77A 1K1OA 1FV9A 1YPHC 1TONA 4WMDA 3BIVH 8ESTE 1GHBF 2BB4A 3PO1C 2A4QA 1NFWA 1BITA 1F0UA 3U8TH 1HB0B 1EQ9A 4O3UA 2XCNA 1NT1A 2RA3A 4Y71A 2FOEA 1V2PT 2DE9A 2GMTB 2TBSA 1Z8JB 2FPZA 1AI8H 3MYWA 4AX9H 1IQLA 4INHA 1C2IA 2WPKS 4ISNA 1V2LT 2BX3A 1TGBA 3T62A 2TGPZ 3DA9B 4YOIA 1LHCH 3EA7A 3GOVB 5LPFA 1T31A 1EB2A 1TLDA 2O8UA 4WF8A 2XWBI 1FPCH 1O3GA 3TJNA 1LHDH 3UWIA 1TNHA 3SNAA 1O2ZA 2C8YB 2FX4A 3VB3A 1SGCA 2F9OA 3T27A 4ZUHA 4X6OA 3RU4T 4B2AA 2BOKA 4ZHLU 1TE0A 2RCEA 1BDAA 4AOQA 8GCHG 1ORFA 1SGYE 1T7CA 3BV9B 1CT0E 4QT8C 1O3LA 1NTPA 1YLCA 2BZ6H 3M5MA 1C4U2 3F1SB 1QJ6B 3RMMH 2SGEE 3K6ZA 3QZRA 1UTJA 1CU1A 2QV1A 4IMQA 2WPIS 3SBKA 1P06A 5FPSA 2O9QA 1ZTLA 1YC0A 1XKBC 2D2DA 3LGWA 1P11E 1SMFE 3HGPA 2ANYA 3SJIA 1C5UA 1K21H 3ZZ9A 2CHAB 1QFKH 1NFYA 1K28D 3TU7H 1NFXA 3ENSB 3SOSA 3P92A 3F68H 1ZHRA 1GJ6A 1A5IA 3EQ0H 3RXDA 3E0NB 1ZSKA 1O3OA 2TIOA 3M7UA 4KELA 4K8BA 1DFPA 1RTLA 5T6DA 1G2LA 3I29A 1NESE 2BDAA 4JYTA 3ZV9A 1QRWA 4FUCA 3BSQA 3SV2H 1TGCA 4JZFH 2ANMH 2FP7B 2FOHA 1C5YB 2CMYA 1TNJA 3RM0H 4BXSA 2W7UA 3P95A 2CHAC 4AB8A 1O5AB 1BTWA 3QO6A 4TY6A 2HPPH 2F9NA 3KQEA 3BG4C 1SC8U 1PFXC 2BY5X 1HDTH 1O32A 1PPCE 4K2YA 1RRKA 1PYTC 3PROA 3QUMP 4BTUB 1CHOF 2ZFPH 1YM0A 2ALVA 3LPRA 2ZGHA 1A0LA 4DT7B 1O3BA 1OX1A 1D6WA 1THPB 2J9NA 5JBBS 1BBRK 4UDWH 1QL8A 4K8YA 1D4PB 1WBGB 1G9IE 2PGQB 3TGJE 2TGAA 3SU6A 1HXEH 1DWBH 3GY3A 1F5LA 1KDQA 2V0BA 5JBAS 3ZZ6A 1H1BA 2A7CA 4MTBA 1KIGH 1ZPBA 4B74A 7LPRA 1A0JA 2W5EA 2ZCLP 3BTHE 3M7QA 5E0HA 2JH0D 1ZOMA 1YF4A 4Y6DA 3E8LA 4NA8A 2OC1A 4Y8XA 2XW9A 5DP3A 1EATA 3MU5A 3BG8A 5DG6A 1PPGE 1TRYA 1KXBA 1DPOA 1O2OA 1YLDA 4BAQB 3HK6B 1DE7H 1O37A 3UOPA 3A8DA 3CENA 3SU0A 1SGRE 3IWMA 1ELVA 3A89A 3KEEA 3DHKH 1Y3WA 1TPOA 3RC6A 4AN7A 5A0AE 1SGFG 4I7YH 1O36A 2OBOA 1P2KA 2R3UA 4RSPA 3RU4D 1UVSH 1XUJA 3LONA 2BD3A 3V12A 3KN2A 1HIAA 4LZ1H 4MPUA 2BY7X 1ELBA 3GCTF 1FMGA 4DJZB 4XBDA 3I78A 4Y79A 1EB1H 5HYOA 4FU8A 3UY9A 3EDXB 2Z9LA 1E36B 1CA0B 2W7SA 3S9AA 1HUTH 1PQ7A 1C5TA 1NPMA 2PLXA 5DP8A 1OP2A 4OS2A 2FOGA 2NU4E 1TYNA 4X2XA 5AVDA 5A8YA 1GI9B 3LDXH 5JBTA 4GCHF 1L1NA 1ELAA 2SGPE 1O3IA 5JPMH 2ZNKH 2XBYA 3R3GB 5B6OA 1DXWA 1LKBA 1UVOA 1ELEE 4ZH8A 3MOCA 3PMJA 4ISOA 1FN6A 3RXMA 1ETSH 2AMQA 1EP6A 3QWCH 3BTGE 2JH6D 3BG4B 1NRNH 1BTUA 3ZYEA 1XUGA 5JDUB 1L2EA 1A7SA 3G01A 1GBBA 4LZ4B 2QXGA 1L1GA 3NK8A 1NS3A 3GCHB 3VB4A 2IPHA 5L30H 1EJNA 1NM6A 2UUYA 2QF3A 3RM2H 5H4IB 3M3VA 1THSH 3A7VA 1P8VC 5DP9A 1G37A 2VIQA 1YKTA 2P95A 2BOHB 1KXAA 2JETB 3MNBA 4AYVB 1VITF 1U6QA 4ZKRU 2WINI 2BXUH 1GG6B 1ETTH 2GCTB 2BY6X 3SQEE 1CA0C 1QQ4A 4ISLA 4YT6H 2H5DA 2YOLA 1DS2E 2ZDNA 1ZLRA 4IS5A 3SI4H 3M37A 2Y5HA 1IQJA 1YPLH 5EXLA 1BTHH 3UR9A 4ASHA 4UONA 2Y7XA 1UCYK 3QGNB 4XFQA 1BT7A 2LPRA 2EI7A 4AFUA 1O2LA 4U2WA 4YOJA 5EW1H 3NPSA 1ZTKA 1BMLA 1SFIA 5FCKA 2RDLA 1JMOH 3UREA 4K1TA 3GCOA 1Q3XA 4WWYA 3PTBA 2AMPA 3SORA 4RKJB 1ELDE 2ZU5A 3RXFA 1Z6JH 1BZXE 4D7FA 1ELTA 1LVMA 3O8CA 1LHEH 5AF9H 4I8KA 1FY5A 1TRMA 1QB1A 4DVAU 2AERH 1A2CH 2B0FA 4D9QA 5JB8S 1W12U 3MO3A 4OS1A 4D7GA 2FTLE 2IOTA 3Q00A 4Y7BA 1P09A 4CBOA 4D9RA 1MD7A 1OWKA 3P8OA 5FHTA 2ZGXH 3LGYA 1C4Y2 4MDSA 4R0IA 5FAHA 1P3EA 1RIWB 3D23A 2FI3E 5EG4A 1V2UT 2AIQA 1BMAA 3SGAE 3M7TA 2QYIA 1YCPK 1SQOA 1P9UA 1SHHB 1YPJH 1L0ZA 5EQQA 3BN9A 1GI3A 2G5VA 4Z6AH 4K1SA 1UTPA 5C5OA 2Q6DA 2ZFTA 5AFYH 1G32B 3ZZ7A 1HJAC 1C5PA 4JK6A 1BA8B 1B0FA 2PUQH 4WJG2 4Z0KA 3C27B 4WXIA 1BHXB 4X2VA 1K22H 2WPHS 1WV7H 1V2OT 4X0WU 2F9VA 1BRUP 1SOZA 1O5EH 5DJ7A 4KP0A 2G55A 3SZNA 2PFEA 2NU3E 1G3CA 3GYMA 4ZROA 1BQYA 1Y5UT 3ODFA 1YPHE 4RKOB 3PYHA 1GHAF 3ODDA 1P10A 1GPZA 2STAE 4DG4A 3RXUA 2ANKH 4B73A 1SGIB 3V0XA 4CH8B 1O3NA 3FP7E 3NXPA 2QA9E 1FI8A 1O2WA 1O2TA 3ZVCA 4JZEH 4UD9H 3IG6B 2EI6A 3EA8A 3KNXA 4TWWA 2WUCA 7GCHG 1F5KU 2J2UA 2P16A 2P94A 2ZA5A 1YBWA 4OS4A 5FCRA 3LGUA 1BTYA 3EYDA 2Y5FA 3RXTA 1DWEH 1FN8A 1WSSH 4YT7H 3BEFB 1IQMA 2OC7A 3H5CB 1UTKA 4K69A 4YTAA 3LKWA 3RXBA 1PQ5A 5TCAA 3MNCA 3U98H 3VXEH 2AIPA 4OS6A 1EJAA 3F9FA 2EEKA 1W0YH 1V2JT 4CRBA 5C20A 2BVRH 1C1NA 5DP5A 1ZYOA 3BTQE 4NIWA 1NY22 3BTWE 4FUIA 5GDSH 4THNH 3V13A 1FDPA 1VZQH 2FS8A 1DY9A 4ZKNU 5E2PA 1GI5A 1QB9A 2V35A 1GDUA 3KGPA 1C5ZB 2R0LA 2HGTH 3ZVAA 5EW2H 1OXGA 1ZJDA 2WUBA 5EPNA 5ESTE 2Q1JA 1Y3YA 1NRRH 2BLWA 3T25A 2Z94A 3A86A 2WV5A 4GCHG 1AFQB 2AGGX 3MNSA 4IN2A 2G5NA 2BD4A 8KME2 1DM4B 1ANDA 2WPJS 2ZU1A 4YM9A 4FU9A 3T29A 1F2SE 3TNSA 5A8ZA 1BCUH 1H8DH 4MNVA 1UTQA 3MFJA 1JXPA 3MMGA 2FM2A 5DP6A 1HFDA 5FPYA 1WU1A 1GJBB 2YNAA 3W95A 1O2SA 1S6FA 2BXTH 2D8WA 5L2ZH 2Z9GA 3GDUA 5L6NH 3GYLB 4ISHH 1THRH 2ZPSA 1AB9C 1D3PB 4GHTA 1N6YA 1CQQA 1TOMH 4YLQH 3SUFA 2ZC9H 3OY6U 2PW8H 4X6MA 1GCDA 4IC5A 1OWIA 1P2IA 5E0JA 3RLYH 3HKJB 4X8VH 1SI5H 2GD4B 3V7TA 1OP8A 1O2UA 4ABBA 3V3MA 1GHBG 1A0HB 1MMJN 5F8TA 2GTBA 2PTNA 1SL3A 4AG2A 6GCHG 3OYPA 1YYY1 1O2NA 1HV7A 4I31A 5E0GA 1AGJA 5EU8A 1IOEA 3PLPA 1GI8B 1QB6A 1AFQC 4ABHA 1HJAB 1UCYH 1MCTA 1AD8H 2QXIA 1MKWH 2SGQE 1P05A 5DK1A 1CHOG 2HNTC 8LPRA 1GBEA 3LGTA 2KAIA 3NWUA 1AY6H 2SNWA 5GCHF 2ZEBA 4I33A 1LPGB 2Y81A 1EZSC 1MTSA 3PMHB 1PJPA 1SQTA 2F3CE 3RP2A 3UIRA 1HIAB 1LPKB 2PV9B 2NU1E 3DFLA 1TGTA 5CE1A 4LXBH 1DSTA 1GMHF 4CR5A 2ZDMA 3RXKA 3ATLA 1A3BH 1Y5BT 3B23B 4B76A 4VGCB 1ZHMA 1RFNA 3P8FA 1O2JA 3U9AH 5F8XA 1P2OA 5K0HA 3O8DA 1GWAA 2J38A 1SGNE 5DP7A 1WOFA 1T8MA 1LVYA 3LJOA 1V2VT 4XDEA 5PTPA 1BTPA 4NSVA 3ZVFA 1O3HA 5C3NA 5GIBA 4DW2U 1KXFA 1LTOA 1HAVA 1MU8B 1T8NA 1TABE 1UMAH 3BTTE 1GHVH 1W14U 1GGDB 3R0FA 1NO9H 4H4FA 4AB9A 2ZF0H 1HAIH 2Q6FA 3VPKA 3H7TA 2BVXH 1MTNC 3S7HB 2Q6GA 2ZG0H 3QZQA 3MWIU 4BANB 3WY8A 2ZDLA 3DT0H 1AO5A 2Z3DA 1O5CB 1CHGA 1TPPA 2J34A 1C5RA 1K2I1 2ALPA 1A3EH 2Z3CA 2ZWLH 4UFDH 1GVKB 1EUFA 3SGBE 2V3HH 2OD3B 3T5FH 3GCTG 3SHAH 2BDGA 1XUKA 1P04A 2BHGA 4Y8YA 2BY8X 4ZKSU 4GVUA 3KQDA 1QJ1B 2ZKSA 1QL7A 4YESB 5EOKA 3A8CA 1SFQB 2PSXA 2XC4A 1XKAC 1YPEH 4BAKB 1N1LA 1MTWA 4A1XA 2NWNA 4FXGH 3RMLH 1PPEE 1HGTH 3QDZB 1CBWB 1Q31A 1W8BH 3BF6H 5FBIA 5C5NA 3M3TA 4IGDA 1EZXC 2AS9A 4NIYA 2PKAA 1AWHB 1B7XB 2PHBA 2GCHG 4Y11E 2I6SA 1AVWA 1NRQH 4NCYA 3SU3A 1LVBA 3M3SA 2CXVA 1O5BB 1QR3E 1UCYE 3PLKA 3MU4A 2BQ7B 1AVGH 1NU9A 4BAOB 1ZGVA 1GBTA 1XMNB 3STIA 1P2MA 1TFXA 2ZCHP 2XNIA 1UHBA 2VNTA 1CO7E 1MCVA 2A4OA 4KTSA 5HXFA 2G81E 1RD3B 1YCPM 2EI8A 2XYAA 1G3EA 3A7XA 3SU4A 5A09A 1FY3A 1QIXB 2AFQB 2PGBB 2FI5E 1Z8RA 4ZKOU 1O3EA 2ODYB 1CSOE 3UWJH 3SQHE 1QCPA 1IAUA 2VIPA 5C1XA 4CRGA 2XBXA 2VVCA 3SNDA 1DOJA 2GMTC 2A5KA 1C2MA 2Z7FE 2CV3A 1GHYH 3HATH 2SGAA 1XVOA 2ZZUH 2IJOB 3RXGA 4UE7H 3PO1B 1Z71A 2ZI2H 3FP8E 3PMBB 4ABEA 4X6NA 3SN8A 1GI6A 4BAHB 1XM1A 3SJ8A 4A1TA 1HAZB 3F9GA 1P2JA 3RC5A 1IQEA 3ZZ4A 2R0KA 3DUXH 1WCZA 1D3TB 1P01A 3TJVA 3LU9B 1O2PA 1A5GH 1GCTB 5JBCS 1DXPA 2FOFA 1W2KH 2I6QA 3QLPH 3KIDU 2GV6A 1S0QA 1SQAA 1O2IA 1ZMJA 1UVTH 2OLGA 1K1NA 3ATWA 1TB6H 4B71A 2ZHWH 2BMGB 1C1TA 1O3PB 2JETC 1TNIA 3BTEE 1O31A 1DUEA 2BLQA 1IQHA 1Y59T 4Q2KA 1A1RA 3ITIA 4IN1A 3AW0A 5ABWA 8GCHF 3RXEA 2PR3A 1O34A 2UWOA 2V6NA 1B5GH 3CP7A 1HAGE 3AVZA 4MG3A 2SNVA 1OSSA 1F0TA 5A0BA 1MKWK 1O2KA 1H8IH 4BXWA 1TPAE 1GBKA 5FPTA 2AGEX 3GICB 1PQAA 4TPIZ 5DPAA 4B75A 1OYTH 3HGNA 2G8TA 1O33A 1IQGA 1C1MA 2XXLA 3GCNA 4Q7ZA 2TGTA 4XBBA 1TBQH 3E91A 4Q80A 2C8XB 1O2QA 5J4SA 1FONA 4X1RU 4D76A 3ZV8A 1MKXK 1ESBA 3ZZ3A 2FMJA 3MO9A 1FY4A 1DANH 3VFEA 1QBNA 1ZMNA 1QA0A 4X2YA 1ACBE 2RA0A 1XUIA 1Z6EA 1T32A 5CMXH 1XXDA 2UWLA 3A85A 3MH4A 4U01A 1S5SA 1ELGA 1XUFA 1AHTH 4Y76A 1KLTA 3D49H 4E05H 1MTUA 1MTVA 1VJAU 5C1YA 1NRPH 3PV4A 5J4QA 4FVDA 3SV7A 5A8XA 1QBOA 2O8WA 2F9BH 3M5LA 3QN7A 5HGGA 6CHAB 1AFEH 3KQCA 1O3MA 5E2OA 1BUIA 5F03A 1ABJH 2ODPA 3E1XB 3GDSA 4OS5A 1UHBB 1OS8A 2FEQH 1C2LA 5EQSA 2WYJA 4X8UH 1S84A 2A7HA 3DFJA 1O2GH 3E90B 1V2MT 4MNYA 2HOBA 4ZXYH 1GGDC 2QC2A 2Y82A 4Q7XA 3NZIA 1PYTD 4X1SU 1GBDA 5GCHG 2UUJB 2WYGA 3B8JA 4R8TB 3GDVA 2V3OH 1MTNB 5T6GA 3K9XB 2P59A 1GG6C 1WTHD 1GMDG 3LIWA 2BYAX 4JZDH 3PTNA 2QF0A 1SR5C 1EAWA 2NU2E 2BD2A 3TITA 1N8OB 2WPLS 4KGAA 3AAVA 4X2WA 1CVWH 1LHFH 5LGOA 2ZDKA 1KYNA 2R2MB 1UTMA 4TPYA 2BD7A 1P02A 1EZQA 1V2ST 3TH3H 2GT8A 3SNEA 1W7XH 1BBRH 1GBHA 1HXFH 2G52A 2SGDE 2ZFSA 4GUXA 5FXLA 1GJ7B 2FYRA 3OU0A 1E34B 1ZSJA 4O9VA 1AZZA 4B1TA 2GCTC 2BY9X 2ZGCA 1GHWH 3FAOA 1G2MA 4XSKU 2BDIA 2GZ8A 1TIOA 1YGCH 2VWMA 2PKSB 1WYKA 1VCQA 3MH7A 5EXNA 2G4UA 2J4IA 3M35A 4J1YA 2A0QB 3U69H 3T2NA 2GZ7A 1Y5AT 2A4RA 4HI3A 1W3CA 1GI2A 4E7RG 2ILNA 4Y0ZE 4JZ1A 1SG8B 1O5DH 1EKBB 3M5OA 1SOTA 1TQ0B 2ZTXA 2FDAA 4YOGA 2ZPQA 1V2KT 1IHSH 1C1UH 1S81A 2F9UA 2ZPRA 2OTVA 1TBRH 2A7JA 1MBQA 4JZIA 1A5HA 1P9SA 1TGNA 1AZ8A 2VIDA 1KLIH 2FIRH 3MU0A 1EJMA 1HAYB 1KTSB 2BDCA 2VWLA 4OGXA 3GY7A 2CF8H 1E37B 1ANEA 3K2UA 4AFZA 3ZVEA 3P8GA 1OWJA 3T28A 1RS0A 3BTME 1GJ8B 2CF9H 2CN0H 3STJA 3FP6E 4FUDA 2R2WU 3PLBA 4FU7A 3RXCA 2PTCE 4PROA 4UFFH 2GVFA 4AGJA 1C2HA 1EAIA 4CR9A 2ZGBH 1D9IA 9ESTA 4AFSA 4F4OC 1JOUB 5GXPA 1W11U 3M5NA 3A82A 5ESBA 1KTTB 1WQVH 4Y7AA 1VCPA 2ZTZA 1IQKA 5T6FA 4MQAA 4U32A 2VH0A 1DVAH 1V2RT 1QTFA 2R3YA 1NU7B 4BNRA 1H9HE 1QBVH 1GBFA 4DIHH 4B2CA 3AAUA 3ATKA 2BM2A 4ISIH 4MNXA 3UNSA 1JIRA 1TAWA 3FANA 3S9BA 1B0EA 2A2QH 2B9LA 1EP5A 2ZHDA 4ABGA 5IDKA 1S83A 3SI3H 4NSYA 1K1JA 1W13U 3VEQB 3QX5H 4K60A 3VXFH 1GBLA 4Q7YA 1LDTT 1ZPCA 1BTZA 3B9FH 4CRAA 2FODA 1Z7KA 1FAXA 3SU5A 1C1RA 3E16B 4NGAH 1ANBA 2FS9A 1JRSA 4YLUA 4NIXA 4WMFA 4ESTE 1F92A 3ZZAA 3RXLA 2TGDA 3GY4A 2VIWA 3T26A 2VVUA 2P93A 3L3TA 1C4V2 1V3XA 1O3JA 5DP4A 1EASA 2ZIQH 1HLTH 3SGQE 1YPKH 4OGYA 5G4BA 1AUTC 1ARBA 2PSYA 1GBIA 2D1JA 3TIUA 3EE0B 3ZVDA 1IHTH 2J95A 1ZRBA 4F49A 3ZZBA 1ID5H 1HJ8A 1TMBH 2M5TA 2QXJA 5C2ZA 2C93B 4E06H 3A81A 4X8TH 2NU0E 1UTOA 1C1QA 3ATIA 1EPTB 1Y3UA 1DUAA 4X1PU 2ZU4A 1F0SA 1TMUH 3LGVA 4A7IB 1DLKB 1C5SA 1NRSH 5K7RA 1S85A 2H9HA 5ETXA 3RXJA 5TJXA 4FUHA 3LH3A 5CHAB 5FX6A 2ZGJA 2Z9JA 1MUEB 2GDDA 1BTXA 1BRAA 4OS7A 3GY8A 2K1QA 2Z6BD 1MAYA 4M7GA 3MTYA 4WH6A 4Y8ZA 3TH4H 1GJ5H 3DD2H 4GLYA 4Y10E 1OWEA 1DWCH 1FY1A 1QNJA 2BDYA 1ELCA 2CJIA 1GI4A 2H2ZA 1C5WB 1S0RA 3VB6A 1AUJA 3ZZCA 1QY6A 1V2QT 2BDBA 2W3KA 5LPEA 2A4GA 3A8AA 4JYUH 4ABAA 2ZHEH 1BIOA 1QRZA 3A7ZA 5EPYA 1F7ZA 3GY2A 1NFUA 3MH5A 1XUHA 1CT2E 1DLEA 2P3TB 3C1KA 1W10U 3NCLA 3LC5A 3URDA 2BQWB 2WV4A 1T4VH 2ZO3H 1C1VH 4SGAE 1C1SA 4HFPB 1GBAA 5L2YH 3K6YA 2VINA 2ZFFH 3SU2A 1ELFA 4MPXA 3UQOA 4KTCA 2P3UB 1C9PA 3SUGA 3P70B 5HMAA 1O3AA 1VCWA 3HPTB 3D62A 4X1NU 4IC6A 1P03A 3P8NA 3U1IB 5DGJA 2TRMA 1TX6A 3ZZDA 1J17T 3KHVA 3MU1A 1EZUC 2XC5A 1N6XA 1SLUB 1Q2WA 4K5ZA 1C1WH 3RXRA 1LMWB 3GY5A 2ZFQH 2VVVA 1G30B 2PUXB 3E0PB 1EAUA 4AORA 1BB0B 2OC8A 1GJDB 1OPHB 1TPSA 1C2GA 3RXIA 1ZPZA 5I46H 1CBWC 3U8OH 1C2DA 2FWWA 4LOYH 1Z1JA 1XVMA 1D3DB 2H9EH 7ESTE 4JCNA 3OY5U 1AWFH 1D3QB 2BD9A 4TWYA 5FX5A 2SFAA 3UOUA 1C2FA 1Y8TA 4NA9H 1NN6A 5I25A 4ABJA 3UNRA 2D26C 3U8RH 1E38B 1EXFA 2HWLB 2VIOA 3QK1A 1HAXB 1Z8IB 4FVBA 4J2YB 3RDZA 5DKMA 1WQSA 1V2TT 1CE5A 2HALA 3KQBA 2H5CA 2XC0A 2ZFRH 3PWBA 3RMOH 5EQRA 1EPTA 2OQUA 2O8MA 1GI1A 4AFQA 6LPRA 1TGSZ 3ZZ5A 3GCHC 2OXSA 1P3CA 1GMDF 1IQNA 3LT3A 1LQDB 4IMZA 1O0DH 1C5OH 4X6PA 3FZDA 1CGJE 2Z9KA 2DE8A 4DGJA 1FLEE 3VGCB 4ABDA 4WXVA 1GJAB 1OWDA 2ZU2A 4NFFA 3LC3A 2FOAA 1G36A 1MZDA 9LPRA 1MU6B 2ZECA 2YNBA 1EOLA 2VIVA 4JK5A 1IQIA 1LO6A 2FZZA 1L4ZA 1WUNH 1C5VA 2RG3A 3KF2A 3PWCA 4NIVA 1QGFA 1W0ZU 2Y6TA 1DSUA 2QAAA 3JZ2B 1NC6A 4WY3A 1QHRB 1ZHPA 1IQFA 2ZQ2A 1DX5M 2EC9H 1GDQA 1O3FA 4INKA 1KXCA 2QIQA 2FLBH 1BOQA 3O8RA 4HTCH 1ZTJA 3BEUA 1O2MA 2DUCA 2OUAA 1WAYB 1OP0A 1SGFA 2R9PA 1OOKB 3VB5A 3M36A 1VITH 4WH8A 1DY8A 2PKSC 4H6SB 3TGIE 2LNCA 5T3HA 3FFGA 5DO4H 3FZZA 1GBJA 2VB0A 3RLWH 1CGIE 2B8OH 3N7OA 1W7GH 1RTKA 1PPBH 1CA8B 3E6PH 4Y0YE 3S9CA 3TPIZ 2EA3A 1ZSLA 3M61U 3UR6A 3SO3A 2AMDA 1SPJA 2P8OB 4UEHH 1AB9B 1C1PA 3MI4A 1K1MA 5JYIA 1TALA 3BTKE 1C9TA 2BLOA 3ZYDA 3IITA 2GT7A 1GMHG 4BOHA 2SGFE 1C5NH 3SNCA 1AQ7A 1O38A 1TA6A 1X7AC 1LQEA 2Y5GA 3TGKE 3RU4E 2GX4A 3E3TA 1TNLA 1FAKH 1GVZA 4AYYB 5TCCA 1QURH 1A46H 3SW2B 1EAXA 2WPMS 4A92A 1UVUH 1FZZA 1O3CA 3Q3XA 4BTIB 1HCGA 2ODQA 3GISB 1TQ7B 3W94A 2TPIZ 3TK5A 2CGAA 1A4WH 1H9LB 1GJ4H 3TVJB 1SB1H 2BZAA 4WVPE 3ELAH 2ZQ1A 1MH0A 6GCHF 1CT4E 3PM3A 1EOJA 1O30A 4AG1A 2QGRA 5CHAC 1WTGH 1C2EA 4FUGA 1JWTA 2HNTE 1GBCA 1GDNA 1TNGA 3L6PA 1AE5A 1FPHH 5BRRE 6ESTA 1O2HA 3UQVA 3GY6A 7GCHF 1S6HA 2AYWA 1KLJH 3UTUH 4ABFA 1UO6A 2C8ZB 1Y3VA 4FUEA 4GPGA 1MQ5A 1ZJKA 1OYQA 3PB1E 3RC4A 3SV9A 1ANCA 2AH4X 3QGJA 3NKKA 2OBQA 4A1VA 3SHCH 4LK4A 1EX3A 1T4UH 2GKVE 5HM9A 1P12E 4JMYA 3A80A 3L33A 1L4DA 4O3TA 1GMCG 3A83A 3A87A 1C1OA 2THFB 4IBLH 1GL1A 2BD8A 1RXPA 4BAMB 4NA7A 3NUMA 2HLCA 3RXQA 1SGDE 2ESTE 2FESH 5GWZA 4MLFB 3TNTA 3F9HA 1J15A 2A32A 3H7OA 3EGKH 3TK6A 2ZU3A 1OWHA 2Y80A 4FUBA 1C2KA 2BX4A 4DURA 1JBUH 3VB7A 3RXSA 3D65E 4NFEA 1DITH 1C5LH 1FUJA 1PPFE 1A61H 1MBMA 4K3JA 1AKSA 2OCVB 1ZMLA 2UUKB 5EXMA 2UWPA 1VR1H 3ZVGA 1SLVB 3AW1A 1AN1E 2VWNA 2ZCKP 1UK3A 1Y3XA 3SNBA 1E0FD 4BTTB 2VWOA 2GCHF 5EODA 1GHXH 1NZQH 3SV6A 1UK4A 1GBMA 2ZHFH 1BRBE 2ZHQH 3TH2H 1QRXA 1HAVB 1V6DA 1VGCB 2O8TA 2QY0B 1Z1IA 3A84A 2W26A 2C3SA 3TJUA 1O35A 5GJ4B 1BMNH 3PMAB 1UJ1A 1TMTH 2AEIH 1O5FH 2P3FH 2Z9IA 2A45B 2BDHA 4E7NA 1FXYA 2OQ5A 4AGKA 1F0RA 2FOBA 2ZDVH 1FJSA 3SUEA 6CHAC 2P8OC 3HKIB 7KMEH 2XBWA 1HRTH 5AHGH 5SGAE 1G3DA 1PPHE 4FUFA 4ZMAH 3BIUH 5GPIB 1HAOH 2JH5D 2HNTF 1C5QA 1DT2A 1V2WT 1BJVA 2A5AA 1LPZB 1H9IE 2H6MA 1SLXB 3A7YA 1YPGH 1SVPA 5AFZH 4DCDA 4GSOA 1J8AA 2XRCA 4MNWA 1E35B 4K1EA 1P0SH 1XX9A 1SHYA 1GI0A 2STBE 1J16A 3RXPA 3UNQA 5F8ZA 1K1LA 1C5XB 2F91A 2FO9A 3OSYA 4WMEA 1MQ6A 4UFGH 4ABIA 2VH6A 2IN2A 3HK3B 3K65B 3ATMA 1LVOA 1LHGH 1RGQA 2B7DH 1P2NA 1VGCC 2PKAB 4I8GA 1HJ9A 5A0CA 1YPMH 4KKDA 4ZHMU 1DWDH 1RIWC 4NWKA 4CHAB 2QXHA 1K9OE 1TA2A 1P2QA 3SV8A 4KTUA 1V2NT 1BMMH 1J14A 2QN5T 2ZDAH 4O03A 1K1PA 1GJCB 1N8OC 1P57B 1GVLA 3MO6A 4X1QU 3CS0A 2OP9A 2Y7ZA 2FTMA 4DOQA 4CH2B 4HGCA 3S0NA 1SGPE 2HVXA 1M9UA 4A5TS 1O2VA 1GMCF 1PQ8A 1RTFB 1SGTA 4ZXXH 4X8SH 1YCPH 1D6RA 3SJKA 3U1JB 2ZTYA 5BPEA 1FIWA 1AVXA 3KCGH 1HNEE 4I8JA 2GZ9A 2KAIB 2GDEH 5A2MH 3A7TA 3TJOA 2AGIX 2BLVA 1H4WA 1SGEE 1MZAA 3LGIA 2XWAA 1KSNA 1YP9A 4CREA 1MKXH 2F9PA 3MU8A 1BHXF 2G00A 4H6TA 1ZR0A 2VJ1A 2ZP0H 1ETRH 3SU1A 2FYQA 3OX7U 3LOXA 3URCA 4CHAC 2A2XH 3FVFB 1EPTC 4HZHA 1SLWB 1KDQB 1SBWA 1BBRE 1SGQE 5F6MA 4YZUA 4NG9H 4CBNA 1HBTH 2GP9B 1NROH 1TOCB 5JB9S 1MAXA 3RXAA 1ZGIA 5IYTA 1JIMA 3A88A 1FIZA 1L1JA 1UTNA 4AZ2B 4XOJA 2FX6A 3RXVA 1ABIH 1GHAG 1O39A 2ANWA 2A1DB 1LCYA 4YO9A 4CRDA 1AE8H 1GL0E 1G3BA 5EGMA 3UUZA 4MVNA 2BQ6B 1KXDA 1TRNA 2HPQH 1T8OA 2C4FH 4O97A 3MHWU 1TWXB 2FLRH 1KXEA 2VU8E 3RUOA 1VITG 1TX7A 4XBCA 3OTJE 2PWXA 2J94A 1O5GH 4D8NA 3CS7A 1FNIA 2XBVA 2XCFA 1GHZA 3QTOH 3F9EA 4H42U 4DY7B 4ZAEA 4MPVA 3RXOA 1O3KA 1BJUA 4CRCA 4U30A 3Q3KA 1QA7A 2B5TB 3TK9A 4TY7A 3EA9A 2BVSH 4CRFA 1DICA 1AMHA 1C2JA 5C67A 1FQ3A 1ESAA 4UFEH 2ULLA 3UPEA 3KL6A 3BTDE 3SJ9A 2Z3EA 2A5IA 3S7KB 3RMNH 1QJ7B 1J9CH 1O3DA 5C1UA 4NZLA 3QTVH 5HM2A 2BD5A 4SGBE 2OINA 2H9TH 1ZZZA 1PPZA 3A7WA 4RN6A 4VGCC 1UK2A 3AASA 1GJ9B 1C5MD 1INCA 1O2RA 2W3IA 1Z8GA 1AIXH 4MPWA 1QQUA 1ESTA 5LPRA 2O8LA 3BEIB 1O2XA 1GI7B 1KY9A 3MNXA 4DIIH 3ZZ8A 3MH6A 1HPGA 2FOMB 4NZQA 5FBEA 1AU8A 5LH8A 1S82A 4A6LA 2VGCC 2GGVB 1UTLM 1ZRKA 1K1IA 1RJXB
chains in the Genus database with same CATH superfamily
2EY4C 2H1UA 3EAJA 2GV7A 4I8HA 2OC0A 1JRTA 4TYDA 3SUDA 3UFAA 4I8LA 3Q76A 1OKXA 3P17H 3ZVBA 1HYLA 1AKSB 1TNKA 1SSXA 1MD8A 1HAHH 2XTTB 4I32A 1HAPH 2F83A 1H8ED 2UUFB 4NWLA 3P6ZB 2G51A 2ASUB 2J92A 3JZ1B 1UVPA 4GAWA 1DDJA 1FY8E 3BTFE 3S69A 1XXFA 5E8EH 2FXRA 4INLA 1O2YA 3LJJA 2A31A 2QCYA 4B2BA 3LH1A 1BRCE 3A8BA 1F5RA 4JYVH 2C8WB 1VJ9U 2FI4E 4FUJA 3Q3YA 3F6UH 3VGCC 3RXHA 3TLOA 2WZQA 3O8BA 2FOCA 1TBZH 3ESTA 1TX8A 2BTCE 5EIYA 2C90B 1QL9A 1LKAA 2HRVA 3FOAA 1T8LA 2VGCB 4GHQA 3SJOA 1CGHA 2JKHA 1GCTC 4XD7D 1ARCA 4XE4A 4ZHAA 4IW4E 2G4TA 3I77A 3Q77A 1K1OA 1FV9A 1YPHC 1TONA 4WMDA 3BIVH 8ESTE 1GHBF 2BB4A 3PO1C 2A4QA 1NFWA 1BITA 1F0UA 3U8TH 1HB0B 1EQ9A 4O3UA 2XCNA 1NT1A 2RA3A 5HIYA 4Y71A 2FOEA 1V2PT 2DE9A 2GMTB 2TBSA 1Z8JB 2FPZA 1AI8H 3MYWA 4AX9H 1IQLA 2KR7A 4INHA 1C2IA 2WPKS 4ISNA 1V2LT 2BX3A 1TGBA 3T62A 2TGPZ 3DA9B 4YOIA 1LHCH 3EA7A 3GOVB 5LPFA 1T31A 1EB2A 1TLDA 2O8UA 4WF8A 2XWBI 2YMSB 1FPCH 1O3GA 3TJNA 1LHDH 3UWIA 1TNHA 3SNAA 1O2ZA 2C8YB 2FX4A 4Q63A 3F2GA 3VB3A 1SGCA 2F9OA 3T27A 4ZUHA 4X6OA 3RU4T 4B2AA 2BOKA 4ZHLU 1TE0A 2RCEA 1BDAA 4AOQA 8GCHG 1ORFA 1SGYE 1T7CA 3BV9B 1CT0E 4QT8C 1O3LA 1NTPA 4P00A 1YLCA 2BZ6H 3M5MA 1C4U2 3F1SB 1QJ6B 3RMMH 2SGEE 3K6ZA 3QZRA 1UTJA 1CU1A 2QV1A 4IMQA 2WPIS 3SBKA 1P06A 5FPSA 2O9QA 1ZTLA 1YC0A 1XKBC 2D2DA 3LGWA 1P11E 4ZCNA 1SMFE 3HGPA 2ANYA 3SJIA 1C5UA 1K21H 3ZZ9A 2CHAB 1QFKH 1NFYA 1K28D 3TU7H 1NFXA 3ENSB 3SOSA 3P92A 3F68H 1ZHRA 1GJ6A 1A5IA 3EQ0H 3RXDA 1W0JD 3E0NB 1ZSKA 1O3OA 2TIOA 3M7UA 4KELA 4K8BA 1DFPA 3WWFA 1RTLA 5T6DA 1G2LA 3I29A 1NESE 2BDAA 4JYTA 3ZV9A 1QRWA 4FUCA 3BSQA 3SV2H 1TGCA 4JZFH 2ANMH 2FP7B 2FOHA 2HLDD 1C5YB 2CMYA 1TNJA 3RM0H 4BXSA 2W7UA 3P95A 2CHAC 4AB8A 1O5AB 1BTWA 3QO6A 4TY6A 2HPPH 2F9NA 3KQEA 3BG4C 1SC8U 1PFXC 2BY5X 1HDTH 1O32A 1PPCE 4K2YA 1RRKA 1PYTC 3PROA 5DN6D 3QUMP 4BTUB 1CHOF 2ZFPH 1YM0A 2ALVA 3LPRA 2ZGHA 1A0LA 4DT7B 1O3BA 1OX1A 1D6WA 1THPB 2J9NA 5JBBS 1BBRK 4UDWH 1QL8A 1OHHD 4K8YA 1D4PB 1WBGB 1G9IE 2PGQB 3TGJE 2TGAA 3SU6A 1HXEH 1DWBH 3GY3A 1F5LA 1KDQA 2V0BA 5JBAS 3ZZ6A 1H1BA 2A7CA 4MTBA 1KIGH 1ZPBA 4B74A 7LPRA 1A0JA 2W5EA 2ZCLP 3BTHE 3M7QA 5E0HA 2JH0D 1ZOMA 1YF4A 4Y6DA 3E8LA 2QE7D 4NA8A 3CNRA 2OC1A 4Y8XA 2XW9A 5DP3A 1EATA 3MU5A 2L74A 2KX4A 3BG8A 2KCOA 1KMHB 5DG6A 1PPGE 1TRYA 1KXBA 1DPOA 1O2OA 1YLDA 4BAQB 3HK6B 1DE7H 1O37A 3UOPA 3A8DA 3CENA 3SU0A 1SGRE 3IWMA 1ELVA 3A89A 3KEEA 3DHKH 1Y3WA 1TPOA 3RC6A 4AN7A 5A0AE 1SGFG 4I7YH 1O36A 2OBOA 1P2KA 2R3UA 4RSPA 3RU4D 1UVSH 1XUJA 3LONA 2BD3A 3V12A 1SKYE 3KN2A 1HIAA 4LZ1H 4MPUA 2BY7X 1ELBA 3GCTF 5B6LA 1FMGA 3PV2A 4DJZB 4XBDA 3I78A 4Y79A 1EB1H 5HYOA 4FU8A 3UY9A 3EDXB 2Z9LA 1E36B 1CA0B 2W7SA 3S9AA 1HUTH 1PQ7A 1C5TA 1NPMA 2PLXA 5DP8A 1OP2A 4OS2A 2FOGA 2NU4E 1TYNA 4X2XA 5AVDA 5A8YA 1GI9B 3LDXH 5JBTA 4GCHF 1L1NA 1ELAA 2SGPE 1O3IA 5JPMH 2ZNKH 2XBYA 3R3GB 5B6OA 1DXWA 2W6ID 1LKBA 3F3BA 1UVOA 1ELEE 4ZH8A 3MOCA 3PMJA 4ISOA 1FN6A 3N7EA 3OEHD 3RXMA 1ETSH 2AMQA 1EP6A 3QWCH 4RT0A 3BTGE 2JH6D 3BG4B 1NRNH 1BTUA 3ZYEA 1XUGA 5JDUB 1L2EA 1A7SA 3G01A 1GBBA 4LZ4B 2QXGA 1UW7A 1L1GA 3NK8A 1NS3A 3GCHB 3VB4A 2IPHA 5L30H 1EJNA 1NM6A 2UUYA 2QF3A 3RM2H 2JDID 5H4IB 3M3VA 1THSH 5C94A 3A7VA 1P8VC 5DP9A 1G37A 2VIQA 3WWBA 1YKTA 2P95A 2BOHB 1KXAA 2JETB 5T1VA 3MNBA 4AYVB 1VITF 1U6QA 4ZKRU 2WINI 2BXUH 1GG6B 1ETTH 3H09A 2GCTB 2BY6X 3SQEE 1CA0C 1QQ4A 4ISLA 4YT6H 2H5DA 2YOLA 1DS2E 2ZDNA 1ZLRA 4IS5A 3SI4H 3M37A 2Y5HA 1IQJA 1YPLH 5EXLA 1BTHH 3UR9A 4ASHA 4UONA 2Y7XA 1UCYK 3QGNB 4XFQA 1BT7A 2LPRA 2EI7A 2V3MA 4AFUA 1O2LA 3AK5A 4U2WA 4YOJA 5EW1H 3NPSA 1ZTKA 1BMLA 1SFIA 2JJ1D 5FCKA 2RDLA 1JMOH 3UREA 4K1TA 3GCOA 1Q3XA 4WWYA 3PTBA 2AMPA 3SORA 4RKJB 1ELDE 2ZU5A 3RXFA 1Z6JH 1BZXE 4D7FA 1ELTA 1LVMA 3O8CA 1LHEH 5AF9H 4I8KA 1FY5A 1TRMA 1QB1A 4DVAU 2AERH 1A2CH 2B0FA 4D9QA 5JB8S 1W12U 3MO3A 4OS1A 4D7GA 2FTLE 2IOTA 3Q00A 4Y7BA 5HKKD 1P09A 4CBOA 4D9RA 1MD7A 1OWKA 3P8OA 5FHTA 2ZGXH 3LGYA 1C4Y2 4RT1A 4MDSA 4R0IA 5FAHA 1P3EA 1RIWB 3D23A 2FI3E 5EG4A 1V2UT 2AIQA 1BMAA 3SGAE 3M7TA 2QYIA 1YCPK 1SQOA 4AC9A 1P9UA 1SHHB 1YPJH 1L0ZA 5EQQA 3BN9A 5EJ1A 1GI3A 2G5VA 4Z6AH 4K1SA 1UTPA 5C5OA 2Q6DA 2ZFTA 5AFYH 1G32B 3ZZ7A 1HJAC 1C5PA 4JK6A 1BA8B 1B0FA 2PUQH 4WJG2 4Z0KA 2K8IA 3C27B 4WXIA 1BHXB 4X2VA 1K22H 2WPHS 1WV7H 2YMSD 1V2OT 4X0WU 2F9VA 1BRUP 1SOZA 1O5EH 5DJ7A 4KP0A 2G55A 3SZNA 2J97A 2PFEA 2NU3E 2XNDD 1G3CA 3GYMA 4ZROA 2KCPA 1BQYA 1Y5UT 3ODFA 1YPHE 4RKOB 3PYHA 1GHAF 3ODDA 1P10A 1GPZA 2STAE 4DG4A 3RXUA 3VG8A 2ANKH 4B73A 1SGIB 3V0XA 4CH8B 1O3NA 3FP7E 5HIZA 3NXPA 2QA9E 1FI8A 1O2WA 1O2TA 3ZVCA 4JZEH 4UD9H 3IG6B 2EI6A 3EA8A 3KNXA 4TWWA 2WUCA 7GCHG 1F5KU 2J2UA 2P16A 2P94A 2ZA5A 1YBWA 4OS4A 5FCRA 3LGUA 1BTYA 3EYDA 2Y5FA 3RXTA 1DWEH 1FN8A 1WSSH 3F0PA 4YT7H 3BEFB 1IQMA 2OC7A 5C17A 3H5CB 1UTKA 4K69A 4YTAA 3LKWA 3RXBA 1PQ5A 5TCAA 3MNCA 3U98H 3VXEH 2AIPA 2WSSD 4OS6A 1EJAA 3F9FA 2EEKA 1W0YH 1V2JT 4CRBA 5C20A 2BVRH 1C1NA 5DP5A 1ZYOA 3BTQE 4NIWA 1NY22 3BTWE 4FUIA 5GDSH 4THNH 3ZIAD 3V13A 1FDPA 4TSFD 1VZQH 2FS8A 1DY9A 4ZKNU 3F0OA 5E2PA 1GI5A 1QB9A 2V35A 2WHXA 1GDUA 1VKYA 3KGPA 1C5ZB 2R0LA 2HGTH 3ZVAA 5EW2H 1OXGA 1ZJDA 2J98B 2WUBA 5EPNA 5ESTE 2Q1JA 1Y3YA 1NRRH 2BLWA 3T25A 2Z94A 3A86A 2WV5A 4GCHG 1AFQB 2AGGX 3MNSA 4IN2A 2J5UA 2G5NA 2BD4A 8KME2 1DM4B 1ANDA 2WPJS 2CK3D 2ZU1A 4YM9A 3FN8A 4FU9A 3T29A 3KYGA 1F2SE 3TNSA 5A8ZA 1BCUH 1H8DH 4MNVA 1UTQA 3MFJA 1JXPA 3MMGA 2FM2A 3KQ5A 5DP6A 1HFDA 5FPYA 1WU1A 1GJBB 2YNAA 3W95A 1O2SA 1S6FA 2BXTH 2D8WA 5L2ZH 2Z9GA 3GDUA 5L6NH 3GYLB 4ISHH 1THRH 2ZPSA 1AB9C 1D3PB 4GHTA 1N6YA 1CQQA 1TOMH 4YLQH 3SUFA 2ZC9H 3OY6U 2PW8H 4X6MA 1GCDA 4IC5A 2XOKD 1OWIA 1P2IA 5E0JA 3RLYH 3HKJB 4X8VH 1SI5H 2GD4B 3V7TA 1OP8A 1O2UA 4ABBA 3V3MA 1GHBG 1A0HB 1MMJN 5F8TA 2GTBA 2PTNA 2VBCA 1SL3A 4AG2A 6GCHG 3OYPA 1YYY1 1O2NA 1HV7A 4I31A 5E0GA 1AGJA 3OAAD 5CHBA 5EU8A 1IOEA 3PLPA 1GI8B 1QB6A 1AFQC 4ABHA 1HJAB 1UCYH 1MCTA 1AD8H 2QXIA 1MKWH 2SGQE 1P05A 5DK1A 1CHOG 2HNTC 8LPRA 1GBEA 3LGTA 2KAIA 3NWUA 1AY6H 2SNWA 3GS9A 5GCHF 2ZEBA 4I33A 1LPGB 2Y81A 1EZSC 1MTSA 3PMHB 1PJPA 1SQTA 2F3CE 3RP2A 3UIRA 1HIAB 1LPKB 1S6LA 2NU1E 2PV9B 3DFLA 1TGTA 5CE1A 4LXBH 1DSTA 1GMHF 4CR5A 2ZDMA 3RXKA 3ATLA 1A3BH 1Y5BT 3B23B 3OFND 4B76A 4VGCB 4XRNA 1ZHMA 1RFNA 3P8FA 1O2JA 3U9AH 5F8XA 1P2OA 5K0HA 3O8DA 1GWAA 2J38A 1SGNE 5DP7A 1WOFA 1T8MA 1LVYA 3LJOA 1V2VT 4XDEA 5PTPA 2WV9A 1BTPA 4NSVA 3ZVFA 1O3HA 5C3NA 5GIBA 4DW2U 1KXFA 1LTOA 1HAVA 1MU8B 1T8NA 1TABE 1UMAH 3BTTE 2K0QA 1GHVH 1W14U 1GGDB 3R0FA 1NO9H 4H4FA 3SYJA 4AB9A 2KM0A 2ZF0H 1HAIH 2Q6FA 3VPKA 3H7TA 2BVXH 1MTNC 3S7HB 2Q6GA 2ZG0H 3QZQA 5DSFA 3MWIU 3N7DA 4BANB 3WY8A 2ZDLA 3DT0H 1AO5A 2Z3DA 1O5CB 1CHGA 1TPPA 2J34A 1C5RA 1K2I1 2ALPA 1A3EH 2Z3CA 2ZWLH 4UFDH 1GVKB 1EUFA 3SGBE 2V3HH 2OD3B 3T5FH 3GCTG 3SHAH 2BDGA 1XUKA 1P04A 2BHGA 4Y8YA 2KZ4A 2BY8X 4ZKSU 4GVUA 3KQDA 1QJ1B 2ZKSA 1QL7A 4YESB 5EOKA 3A8CA 1SFQB 2PSXA 2XC4A 1XKAC 1YPEH 4BAKB 1N1LA 1MTWA 4A1XA 2NWNA 4FXGH 3RMLH 1PPEE 1HGTH 2JJ2D 3QDZB 2LELA 1CBWB 1Q31A 1W8BH 3BF6H 5FBIA 5C5NA 3M3TA 4IGDA 5EJLA 1EZXC 2AS9A 4NIYA 2PKAA 1AWHB 1B7XB 2PHBA 4P02A 2GCHG 4Y11E 2I6SA 1AVWA 2KCYA 1NRQH 4NCYA 3SU3A 1LVBA 3M3SA 2CXVA 1O5BB 1QR3E 1UCYE 3PLKA 3MU4A 2BQ7B 1AVGH 1NU9A 4BAOB 1ZGVA 1GBTA 1XMNB 3STIA 1P2MA 1TFXA 2ZCHP 2XNIA 1UHBA 2QF4A 2VNTA 1CO7E 1MCVA 2A4OA 4KTSA 5HXFA 1E1RD 2G81E 1RD3B 1YCPM 2EI8A 2XYAA 1G3EA 3A7XA 3SU4A 5A09A 1FY3A 1QIXB 2AFQB 2PGBB 2FI5E 1Z8RA 2RFKC 4ZKOU 1O3EA 2ODYB 1CSOE 3UWJH 3SQHE 1QCPA 1IAUA 2VIPA 5C1XA 4CRGA 2XBXA 2VVCA 1NBMD 2PP6A 1DOJA 2GMTC 3SNDA 2A5KA 1C2MA 3FKSD 2Z7FE 2CV3A 1GHYH 3HATH 2SGAA 1XVOA 2ZZUH 2IJOB 3RXGA 4UE7H 3PO1B 1Z71A 2ZI2H 3FP8E 3PMBB 4ABEA 4X6NA 3SN8A 1GI6A 4BAHB 1XM1A 3SJ8A 4A1TA 1HAZB 3F9GA 1P2JA 3RC5A 4ACBA 1IQEA 3ZZ4A 2R0KA 3DUXH 1WCZA 1D3TB 1P01A 3TJVA 3LU9B 1O2PA 1A5GH 5KGOA 1GCTB 5JBCS 1DXPA 2FOFA 1W2KH 2I6QA 1K0HA 3QLPH 3KIDU 2GV6A 1S0QA 1SQAA 1O2IA 1ZMJA 5GNDA 1UVTH 2OLGA 1K1NA 3ATWA 1TB6H 4B71A 2ZHWH 2BMGB 1C1TA 1O3PB 2JETC 1TNIA 3BTEE 1O31A 1DUEA 2BLQA 1IQHA 1Y59T 4Q2KA 1A1RA 3ITIA 4IN1A 3AW0A 5ABWA 8GCHF 3RXEA 2PR3A 1O34A 2UWOA 2V6NA 1B5GH 3CP7A 1HAGE 3AVZA 4MG3A 2SNVA 1OSSA 1F0TA 5A0BA 2RDEA 1MKWK 1O2KA 1H8IH 4BXWA 1TPAE 1GBKA 5FPTA 2AGEX 5CDFE 3GICB 1PQAA 4TPIZ 5DPAA 1H8HD 4B75A 1OYTH 3HGNA 2G8TA 1O33A 5KEDA 1IQGA 1C1MA 2XXLA 3GCNA 4Q7ZA 2TGTA 4XBBA 5EJZA 1TBQH 3E91A 4Q80A 2C8XB 1O2QA 5J4SA 1FONA 4X1RU 4D76A 3ZV8A 1MKXK 1ESBA 3ZZ3A 2FMJA 3MO9A 1FY4A 1DANH 3VFEA 1QBNA 1ZMNA 1QA0A 4X2YA 1ACBE 2RA0A 1XUIA 1Z6EA 1T32A 5CMXH 1XXDA 2UWLA 3A85A 3MH4A 4U01A 1S5SA 1ELGA 1XUFA 1AHTH 4Y76A 1KLTA 3D49H 4E05H 1MTUA 1MTVA 1VJAU 5C1YA 1NRPH 1E79D 3PV4A 5J4QA 4FVDA 3SV7A 5A8XA 1QBOA 2O8WA 2F9BH 3M5LA 3QN7A 5HGGA 6CHAB 1AFEH 3KQCA 3OEED 1O3MA 5E2OA 1BUIA 5F03A 1ABJH 2ODPA 3E1XB 3GDSA 4OS5A 1UHBB 1OS8A 2FEQH 1C2LA 5EQSA 2WYJA 4X8UH 1WXRA 1S84A 2A7HA 3DFJA 1O2GH 3E90B 1V2MT 4MNYA 2HOBA 4ZXYH 1GGDC 2QC2A 2Y82A 4Q7XA 3NZIA 1PYTD 4X1SU 1GBDA 5GCHG 2UUJB 2WYGA 3B8JA 3MQKC 4R8TB 3GDVA 2V3OH 1MTNB 5T6GA 3PRBA 3K9XB 2P59A 1GG6C 1WTHD 1GMDG 3LIWA 2BYAX 4JZDH 3PTNA 2QF0A 1SR5C 1EAWA 2NU2E 3SZEA 2BD2A 3TITA 1N8OB 2WPLS 4KGAA 3AAVA 4X2WA 1CVWH 1LHFH 5LGOA 2ZDKA 1KYNA 2R2MB 1UTMA 4TPYA 2BD7A 1P02A 1EZQA 1V2ST 3TH3H 2GT8A 3SNEA 1W7XH 1BBRH 1GBHA 1HXFH 2G52A 2SGDE 2ZFSA 4GUXA 5FXLA 1GJ7B 2FYRA 3OU0A 1E34B 1ZSJA 4O9VA 1AZZA 4B1TA 2GCTC 2BY9X 2ZGCA 1GHWH 2W6JD 3FAOA 1G2MA 4TT3D 4XSKU 2BDIA 2GZ8A 1TIOA 1YGCH 2VWMA 2PKSB 1WYKA 1VCQA 3MH7A 5EXNA 2G4UA 2J4IA 3M35A 4J1YA 2A0QB 3U69H 3T2NA 2M2AA 2EQNA 5C0UA 2GZ7A 1Y5AT 2A4RA 2GJGA 4HI3A 4B6FA 1W3CA 1GI2A 4E7RG 2ILNA 4Y0ZE 3OE7D 4JZ1A 1SG8B 2IPQX 1O5DH 1EKBB 3M5OA 1SOTA 1TQ0B 2ZTXA 2FDAA 4YOGA 2ZPQA 1V2KT 1IHSH 1C1UH 1S81A 2F9UA 2AHME 2ZPRA 2OTVA 1TBRH 2A7JA 1MBQA 4JZIA 1W0KD 1A5HA 1P9SA 1TGNA 1AZ8A 2VIDA 1KLIH 2FIRH 3MU0A 1EJMA 1HAYB 1KTSB 2BDCA 2VWLA 4OGXA 3GY7A 2CF8H 1E37B 1ANEA 3K2UA 4AFZA 3ZVEA 1E1QD 3P8GA 1OWJA 3T28A 1RS0A 3BTME 1GJ8B 2CF9H 2CN0H 3STJA 3FP6E 4FUDA 2R2WU 3PLBA 4FU7A 3RXCA 4Q4LA 2PTCE 4PROA 4UFFH 2GVFA 4AGJA 1C2HA 1EAIA 4CR9A 2ZGBH 1D9IA 9ESTA 4AFSA 4F4OC 1JOUB 5GXPA 3F2HA 1W11U 4ASUD 3M5NA 3A82A 5ESBA 3UB0A 1KTTB 1WQVH 4Y7AA 1VCPA 2ZTZA 1IQKA 5T6FA 4MQAA 4U32A 2VH0A 1DVAH 1V2RT 1QTFA 2R3YA 1NU7B 4BNRA 1H9HE 1QBVH 1GBFA 4DIHH 4B2CA 3AAUA 3ATKA 2BM2A 4ISIH 4MNXA 3UNSA 1JIRA 1TAWA 3FANA 3S9BA 1B0EA 2A2QH 2B9LA 1EP5A 2ZHDA 4ABGA 5IDKA 1S83A 3SI3H 4NSYA 1K1JA 1W13U 3VEQB 3QX5H 4K60A 3VXFH 1GBLA 4Q7YA 3EE7A 1LDTT 1ZPCA 1BTZA 3B9FH 4CRAA 2FODA 1Z7KA 1FAXA 3SU5A 1C1RA 3E16B 4NGAH 1ANBA 2FS9A 1JRSA 4YLUA 4NIXA 4WMFA 4ESTE 1F92A 3ZZAA 3RXLA 2TGDA 3GY4A 2VIWA 3T26A 2VVUA 2P93A 3L3TA 1C4V2 1V3XA 1O3JA 5DP4A 1EASA 2ZIQH 1HLTH 3SGQE 1FX0B 1YPKH 4OGYA 5G4BA 1AUTC 1ARBA 2PSYA 1GBIA 2D1JA 3TIUA 3EE0B 3ZVDA 2J95A 1IHTH 1ZRBA 4F49A 3ZZBA 1ID5H 1HJ8A 1TMBH 2M5TA 2QXJA 5C2ZA 2C93B 4E06H 3A81A 4X8TH 2NU0E 1UTOA 1C1QA 3ATIA 1EPTB 1Y3UA 1DUAA 4X1PU 2ZU4A 1F0SA 2HVYB 1TMUH 3LGVA 4A7IB 1DLKB 1C5SA 1NRSH 5K7RA 1S85A 2H9HA 5ETXA 3RXJA 5TJXA 4FUHA 3LH3A 5CHAB 5FX6A 1YWUA 2ZGJA 1COWD 2Z9JA 1MUEB 4Z1MD 2GDDA 1BTXA 1BRAA 4OS7A 3GY8A 2K1QA 2Z6BD 1MAYA 4M7GA 3MTYA 4WH6A 4Y8ZA 3TH4H 1GJ5H 3DD2H 4GLYA 4Y10E 1OWEA 1DWCH 1FY1A 1QNJA 2BDYA 1ELCA 2CJIA 1GI4A 2H2ZA 1C5WB 1S0RA 3VB6A 1AUJA 3ZZCA 1QY6A 1V2QT 2BDBA 2W3KA 5LPEA 2A4GA 3A8AA 4JYUH 4ABAA 2ZHEH 1BIOA 1QRZA 3A7ZA 5EPYA 1F7ZA 3GY2A 1NFUA 3MH5A 1XUHA 1CT2E 1DLEA 2P3TB 3C1KA 1W10U 3NCLA 3LC5A 3URDA 2BQWB 2WV4A 1T4VH 2ZO3H 1C1VH 4SGAE 1C1SA 4HFPB 1GBAA 5L2YH 3K6YA 2VINA 5KECA 2ZFFH 3SU2A 1ELFA 4MPXA 3UQOA 4KTCA 2P3UB 1C9PA 3SUGA 3P70B 5HMAA 1O3AA 1VCWA 3HPTB 3D62A 4X1NU 4IC6A 1P03A 3P8NA 3U1IB 5DGJA 2TRMA 1TX6A 3ZZDA 1J17T 3KHVA 3MU1A 1EZUC 2XC5A 1N6XA 1SLUB 1Q2WA 4K5ZA 1C1WH 3RXRA 1LMWB 3GY5A 2ZFQH 2VVVA 1G30B 2PUXB 3E0PB 1EAUA 4AORA 1BB0B 2OC8A 1GJDB 1OPHB 1TPSA 1C2GA 3RXIA 1ZPZA 5I46H 1CBWC 3U8OH 1BMFD 1C2DA 2FWWA 3KYFA 4LOYH 1Z1JA 3W1EA 1XVMA 1D3DB 2H9EH 5FL7D 7ESTE 4JCNA 3OY5U 1AWFH 1D3QB 2BD9A 4TWYA 5FX5A 2SFAA 3UOUA 1C2FA 1Y8TA 4NA9H 1NN6A 5I25A 4ABJA 3UNRA 2D26C 3U8RH 1E38B 1EXFA 2HWLB 2VIOA 3QK1A 1HAXB 1Z8IB 4FOUC 4FVBA 4J2YB 1WDIA 3RDZA 5DKMA 1WQSA 1V2TT 1CE5A 2HALA 3KQBA 2H5CA 2F43B 2XC0A 2ZFRH 3PWBA 3RMOH 5EQRA 1EPTA 2OQUA 2O8MA 1GI1A 4AFQA 6LPRA 1TGSZ 3ZZ5A 3GCHC 2OXSA 1P3CA 1GMDF 1IQNA 3LT3A 1LQDB 4IMZA 1O0DH 1C5OH 4X6PA 3FZDA 1CGJE 2Z9KA 2DE8A 4DGJA 1FLEE 3VGCB 4ABDA 4WXVA 1GJAB 1OWDA 2ZU2A 4NFFA 3LC3A 3WW7A 2FOAA 1G36A 1MZDA 9LPRA 1MU6B 2ZECA 2OK5A 2YNBA 1EOLA 2LP6A 2VIVA 4JK5A 1IQIA 1LO6A 2FZZA 1L4ZA 1WUNH 1C5VA 2RG3A 3KF2A 3PWCA 4NIVA 1QGFA 1W0ZU 2Y6TA 1DSUA 2QAAA 2JIZD 3JZ2B 1NC6A 4WY3A 1QHRB 1ZHPA 1IQFA 2ZQ2A 1DX5M 2EC9H 1GDQA 1O3FA 4INKA 1KXCA 2QIQA 2FLBH 1BOQA 3O8RA 4HTCH 1EFRD 1ZTJA 3BEUA 1O2MA 2DUCA 2OUAA 1WAYB 1OP0A 1SGFA 2R9PA 1OOKB 3VB5A 3M36A 1VITH 3NRLA 4WH8A 1DY8A 2PKSC 4H6SB 3TGIE 2LNCA 5T3HA 3FFGA 5DO4H 3FZZA 1GBJA 2VB0A 3RLWH 1CGIE 2B8OH 3N7OA 1W7GH 1RTKA 1PPBH 1CA8B 3E6PH 4Y0YE 3S9CA 3TPIZ 2EA3A 1ZSLA 3M61U 3UR6A 3SO3A 2AMDA 1SPJA 2P8OB 4UEHH 4DT4A 1AB9B 1C1PA 3MI4A 1K1MA 5JYIA 1TALA 3BTKE 1C9TA 2BLOA 3ZYDA 3IITA 2GT7A 1GMHG 4BOHA 2SGFE 1C5NH 3SNCA 1AQ7A 1O38A 1TA6A 1X7AC 1LQEA 2Y5GA 3TGKE 3RU4E 2GX4A 3E3TA 1TNLA 1FAKH 1GVZA 4AYYB 5TCCA 1QURH 1A46H 3SW2B 1EAXA 2WPMS 4A92A 1UVUH 1FZZA 1O3CA 3Q3XA 4BTIB 1HCGA 2ODQA 3GISB 1TQ7B 3W94A 2TPIZ 3TK5A 1YY3A 2CGAA 4YXWD 1A4WH 1H9LB 1GJ4H 3TVJB 1SB1H 2BZAA 4WVPE 4ACAA 3ELAH 2ZQ1A 1MH0A 6GCHF 1CT4E 3PM3A 1EOJA 1O30A 4AG1A 2QGRA 5CHAC 1WTGH 1C2EA 4FUGA 1JWTA 2HNTE 1GBCA 1GDNA 1TNGA 3L6PA 1AE5A 1FPHH 5BRRE 6ESTA 1O2HA 3UQVA 2IJD1 3GY6A 7GCHF 1S6HA 2AYWA 1KLJH 3UTUH 4ABFA 1UO6A 2C8ZB 1Y3VA 4FUEA 4GPGA 1MQ5A 1ZJKA 1OYQA 3PB1E 3RC4A 3SV9A 1ANCA 2KCAA 2AH4X 3QGJA 3NKKA 2OBQA 4A1VA 3SHCH 4LK4A 1EX3A 1T4UH 2GKVE 5HM9A 1P12E 4B6EA 4JMYA 3A80A 4M9FA 3L33A 1L4DA 4O3TA 1GMCG 3A83A 3A87A 1C1OA 2THFB 4IBLH 1GL1A 1QZ8A 2BD8A 1RXPA 4BAMB 4NA7A 3NUMA 2HLCA 3RXQA 1SGDE 2ESTE 2FESH 5GWZA 4MLFB 3TNTA 1YLNA 3F9HA 1J15A 2A32A 3H7OA 3EGKH 3TK6A 2ZU3A 1OWHA 2Y80A 4FUBA 1C2KA 2BX4A 4DURA 1JBUH 1NBME 3OTPA 3VB7A 3RXSA 3D65E 4NFEA 1DITH 3FO8D 1C5LH 1FUJA 1PPFE 1A61H 2F4LA 1MBMA 4K3JA 1AKSA 4I86A 2OCVB 1ZMLA 2UUKB 5EXMA 2UWPA 2QF5A 1VR1H 3ZVGA 1SLVB 3AW1A 1AN1E 2VWNA 2ZCKP 1UK3A 1Y3XA 3SNBA 1E0FD 4BTTB 2VWOA 2GCHF 5EODA 1GHXH 1NZQH 3SV6A 1UK4A 1GBMA 2ZHFH 1BRBE 2ZHQH 3TH2H 1QRXA 1HAVB 1V6DA 1VGCB 2O8TA 2QY0B 1Z1IA 3A84A 2W26A 2C3SA 3TJUA 1O35A 5GJ4B 1BMNH 3PMAB 1MABB 1UJ1A 1TMTH 2AEIH 1O5FH 2P3FH 2Z9IA 2A45B 2BDHA 4E7NA 1FXYA 2OQ5A 4AGKA 1F0RA 2FOBA 2ZDVH 1FJSA 3SUEA 6CHAC 2P8OC 3HKIB 7KMEH 2XBWA 1HRTH 5AHGH 5SGAE 1G3DA 1PPHE 4FUFA 4ZMAH 2YMSC 3BIUH 3DSGA 5GPIB 1SQRA 1HAOH 2JH5D 2HNTF 1C5QA 3DSOA 2J98A 1DT2A 1V2WT 1BJVA 2A5AA 1LPZB 1H9IE 2H6MA 3UAIC 1SLXB 3A7YA 1YPGH 1SVPA 5AFZH 4DCDA 4GSOA 1J8AA 2XRCA 4MNWA 1E35B 4K1EA 1P0SH 1XX9A 1SHYA 1GI0A 2STBE 1J16A 3RXPA 3UNQA 5F8ZA 1K1LA 5F53A 1C5XB 2F91A 2FO9A 3OSYA 4WMEA 1MQ6A 4UFGH 4ABIA 2VH6A 2IN2A 3HK3B 3K65B 3ATMA 3DSPA 1LVOA 1LHGH 1RGQA 2B7DH 1P2NA 1VGCC 2PKAB 4I8GA 1HJ9A 5A0CA 1YPMH 4KKDA 4ZHMU 1DWDH 1RIWC 4NWKA 4CHAB 2QXHA 1K9OE 1TA2A 1P2QA 3SV8A 4KTUA 1V2NT 1BMMH 1J14A 2QN5T 2ZDAH 4O03A 1K1PA 1GJCB 1N8OC 1P57B 1GVLA 3MO6A 4X1QU 3CS0A 2OP9A 4HG6A 2Y7ZA 2FTMA 4DOQA 4CH2B 4HGCA 3S0NA 1SGPE 2HVXA 1M9UA 4A5TS 1O2VA 1GMCF 1PQ8A 1RTFB 1SGTA 4ZXXH 4X8SH 1YCPH 1D6RA 3SJKA 3U1JB 2ZTYA 5BPEA 1FIWA 1AVXA 3KCGH 1HNEE 4I8JA 2GZ9A 2KAIB 2GDEH 5A2MH 2L6OA 3A7TA 3PRDA 2AGIX 3TJOA 2BLVA 1H4WA 1SGEE 1MZAA 3LGIA 2XWAA 1KSNA 1YP9A 4CREA 1MKXH 2F9PA 3MU8A 1BHXF 2G00A 4H6TA 1ZR0A 2VJ1A 2ZP0H 1ETRH 3SU1A 2FYQA 4F55A 3OX7U 3LOXA 3URCA 4RI0A 4CHAC 2A2XH 3FVFB 1EPTC 4HZHA 1SLWB 1KDQB 1SBWA 1BBRE 1SGQE 5F6MA 4YZUA 4NG9H 4CBNA 1HBTH 2GP9B 1NROH 1TOCB 5JB9S 1MAXA 3RXAA 1ZGIA 3DCLA 5IYTA 1JIMA 3A88A 1FIZA 1L1JA 1UTNA 4AZ2B 2KFWA 4XOJA 2FX6A 2V7QD 3RXVA 1ABIH 1GHAG 1O39A 2ANWA 2A1DB 1LCYA 4YO9A 4CRDA 1AE8H 1GL0E 1G3BA 5EGMA 3UUZA 4MVNA 4OM9A 2BQ6B 1KXDA 1TRNA 2HPQH 1T8OA 2C4FH 4O97A 3MHWU 1TWXB 2FLRH 1KXEA 2VU8E 3RUOA 1VITG 1TX7A 4XBCA 3OTJE 2PWXA 2WPDD 3U28C 2J94A 1O5GH 4D8NA 3CS7A 1FNIA 2XBVA 2XCFA 1GHZA 3QTOH 3F9EA 4H42U 4DY7B 4ZAEA 4MPVA 3N99A 3RXOA 1O3KA 1BJUA 4CRCA 4U30A 3Q3KA 1QA7A 2B5TB 3TK9A 4TY7A 5C0TA 4F48B 3EA9A 2BVSH 4CRFA 1DICA 1AMHA 1C2JA 5C67A 1FQ3A 1ESAA 4UFEH 2ULLA 3UPEA 3KL6A 3BTDE 3SJ9A 2Z3EA 2A5IA 3S7KB 3RMNH 1QJ7B 1J9CH 1O3DA 5C1UA 4NZLA 3QTVH 5HM2A 2BD5A 4SGBE 5IK2D 2OINA 2H9TH 1ZZZA 1PPZA 3A7WA 4RN6A 4VGCC 1UK2A 3AASA 1GJ9B 1C5MD 1INCA 1O2RA 2W3IA 4FETA 1Z8GA 1AIXH 4MPWA 1QQUA 1ESTA 5LPRA 2O8LA 3BEIB 1O2XA 3F2FA 1GI7B 1KY9A 3MNXA 4DIIH 3ZZ8A 3MH6A 3PV5A 1HPGA 2FOMB 4NZQA 5FBEA 1AU8A 5LH8A 1S82A 4A6LA 2VGCC 2GGVB 1UTLM 1ZRKA 1K1IA 1RJXB
chains in the Genus database with same CATH topology
2H1UA 3EAJA 2GV7A 4I8HA 2OC0A 1JRTA 4TYDA 3SUDA 3UFAA 4I8LA 3Q76A 1OKXA 3P17H 3ZVBA 1HYLA 1AKSB 1TNKA 1SSXA 1MD8A 1HAHH 2XTTB 4I32A 1HAPH 2F83A 2UUFB 4NWLA 3P6ZB 2G51A 2ASUB 2J92A 3JZ1B 1UVPA 4GAWA 1DDJA 1FY8E 3BTFE 3S69A 1XXFA 5E8EH 2FXRA 4INLA 1O2YA 3LJJA 2A31A 2QCYA 4B2BA 3LH1A 1BRCE 3A8BA 1F5RA 4JYVH 2C8WB 1VJ9U 2FI4E 4FUJA 3Q3YA 3F6UH 3VGCC 3RXHA 3TLOA 3O8BA 2FOCA 1TBZH 3ESTA 1TX8A 2BTCE 2C90B 1QL9A 1LKAA 2HRVA 1T8LA 2VGCB 4GHQA 3SJOA 1CGHA 2JKHA 1GCTC 1ARCA 4XE4A 4ZHAA 4IW4E 2G4TA 3I77A 3Q77A 1K1OA 1FV9A 1YPHC 1TONA 4WMDA 3BIVH 8ESTE 1GHBF 2BB4A 3PO1C 2A4QA 1NFWA 1BITA 1F0UA 3U8TH 1HB0B 1EQ9A 4O3UA 2XCNA 1NT1A 2RA3A 4Y71A 2FOEA 1V2PT 2DE9A 2GMTB 2TBSA 1Z8JB 2FPZA 1AI8H 3MYWA 4AX9H 1IQLA 4INHA 1C2IA 2WPKS 4ISNA 1V2LT 2BX3A 1TGBA 3T62A 2TGPZ 3DA9B 4YOIA 1LHCH 3EA7A 3GOVB 5LPFA 1T31A 1EB2A 1TLDA 2O8UA 4WF8A 2XWBI 1FPCH 1O3GA 3TJNA 1LHDH 3UWIA 1TNHA 3SNAA 1O2ZA 2C8YB 2FX4A 3VB3A 1SGCA 2F9OA 3T27A 4ZUHA 4X6OA 3RU4T 4B2AA 2BOKA 4ZHLU 1TE0A 2RCEA 1BDAA 4AOQA 8GCHG 1ORFA 1SGYE 1T7CA 3BV9B 1CT0E 4QT8C 1O3LA 1NTPA 1YLCA 2BZ6H 3M5MA 1C4U2 3F1SB 1QJ6B 3RMMH 2SGEE 3K6ZA 3QZRA 1UTJA 1CU1A 2QV1A 4IMQA 2WPIS 3SBKA 1P06A 5FPSA 2O9QA 1ZTLA 1YC0A 1XKBC 2D2DA 3LGWA 1P11E 1SMFE 3HGPA 2ANYA 3SJIA 1C5UA 1K21H 3ZZ9A 2CHAB 1QFKH 1NFYA 1K28D 3TU7H 1NFXA 3ENSB 3SOSA 3P92A 3F68H 1ZHRA 1GJ6A 1A5IA 3EQ0H 3RXDA 3E0NB 1ZSKA 1O3OA 2TIOA 3M7UA 4KELA 4K8BA 1DFPA 1RTLA 5T6DA 1G2LA 3I29A 1NESE 2BDAA 4JYTA 3ZV9A 1QRWA 4FUCA 3BSQA 3SV2H 1TGCA 4JZFH 2ANMH 2FP7B 2FOHA 1C5YB 2CMYA 1TNJA 3RM0H 4BXSA 2W7UA 3P95A 2CHAC 4AB8A 1O5AB 1BTWA 3QO6A 4TY6A 2HPPH 2F9NA 3KQEA 3BG4C 1SC8U 1PFXC 2BY5X 1HDTH 1O32A 1PPCE 4K2YA 1RRKA 1PYTC 3PROA 3QUMP 4BTUB 1CHOF 2ZFPH 1YM0A 2ALVA 3LPRA 2ZGHA 1A0LA 4DT7B 1O3BA 1OX1A 1D6WA 1THPB 2J9NA 5JBBS 1BBRK 4UDWH 1QL8A 4K8YA 1D4PB 1WBGB 1G9IE 2PGQB 3TGJE 2TGAA 3SU6A 1HXEH 1DWBH 3GY3A 1F5LA 1KDQA 2V0BA 5JBAS 3ZZ6A 1H1BA 2A7CA 4MTBA 1KIGH 1ZPBA 4B74A 7LPRA 1A0JA 2W5EA 2ZCLP 3BTHE 3M7QA 5E0HA 2JH0D 1ZOMA 1YF4A 4Y6DA 3E8LA 4NA8A 2OC1A 4Y8XA 2XW9A 5DP3A 1EATA 3MU5A 3BG8A 5DG6A 1PPGE 1TRYA 1KXBA 1DPOA 1O2OA 1YLDA 4BAQB 3HK6B 1DE7H 1O37A 3UOPA 3A8DA 3CENA 3SU0A 1SGRE 3IWMA 1ELVA 3A89A 3KEEA 3DHKH 1Y3WA 1TPOA 3RC6A 4AN7A 5A0AE 1SGFG 4I7YH 1O36A 2OBOA 1P2KA 2R3UA 4RSPA 3RU4D 1UVSH 1XUJA 3LONA 2BD3A 3V12A 3KN2A 1HIAA 4LZ1H 4MPUA 2BY7X 1ELBA 3GCTF 1FMGA 4DJZB 4XBDA 3I78A 4Y79A 1EB1H 5HYOA 4FU8A 3UY9A 3EDXB 2Z9LA 1E36B 1CA0B 2W7SA 3S9AA 1HUTH 1PQ7A 1C5TA 1NPMA 2PLXA 5DP8A 1OP2A 4OS2A 2FOGA 2NU4E 1TYNA 4X2XA 5AVDA 5A8YA 1GI9B 3LDXH 5JBTA 4GCHF 1L1NA 1ELAA 2SGPE 1O3IA 5JPMH 2ZNKH 2XBYA 3R3GB 5B6OA 1DXWA 1LKBA 1UVOA 1ELEE 4ZH8A 3MOCA 3PMJA 4ISOA 1FN6A 3RXMA 1ETSH 2AMQA 1EP6A 3QWCH 3BTGE 2JH6D 3BG4B 1NRNH 1BTUA 3ZYEA 1XUGA 5JDUB 1L2EA 1A7SA 3G01A 1GBBA 4LZ4B 2QXGA 1L1GA 3NK8A 1NS3A 3GCHB 3VB4A 2IPHA 5L30H 1EJNA 1NM6A 2UUYA 2QF3A 3RM2H 5H4IB 3M3VA 1THSH 3A7VA 1P8VC 5DP9A 1G37A 2VIQA 1YKTA 2P95A 2BOHB 1KXAA 2JETB 3MNBA 4AYVB 1VITF 1U6QA 4ZKRU 2WINI 2BXUH 1GG6B 1ETTH 2GCTB 2BY6X 3SQEE 1CA0C 1QQ4A 4ISLA 4YT6H 2H5DA 2YOLA 1DS2E 2ZDNA 1ZLRA 4IS5A 3SI4H 3M37A 2Y5HA 1IQJA 1YPLH 5EXLA 1BTHH 3UR9A 4ASHA 4UONA 2Y7XA 1UCYK 3QGNB 4XFQA 1BT7A 2LPRA 2EI7A 4AFUA 1O2LA 4U2WA 4YOJA 5EW1H 3NPSA 1ZTKA 1BMLA 1SFIA 5FCKA 2RDLA 1JMOH 3UREA 4K1TA 3GCOA 1Q3XA 4WWYA 3PTBA 2AMPA 3SORA 4RKJB 1ELDE 2ZU5A 3RXFA 1Z6JH 1BZXE 4D7FA 1ELTA 1LVMA 3O8CA 1LHEH 5AF9H 4I8KA 1FY5A 1TRMA 1QB1A 4DVAU 2AERH 1A2CH 2B0FA 4D9QA 5JB8S 1W12U 3MO3A 4OS1A 4D7GA 2FTLE 2IOTA 3Q00A 4Y7BA 1P09A 4CBOA 4D9RA 1MD7A 1OWKA 3P8OA 5FHTA 2ZGXH 3LGYA 1C4Y2 4MDSA 4R0IA 5FAHA 1P3EA 1RIWB 3D23A 2FI3E 5EG4A 1V2UT 2AIQA 1BMAA 3SGAE 3M7TA 2QYIA 1YCPK 1SQOA 1P9UA 1SHHB 1YPJH 1L0ZA 5EQQA 3BN9A 1GI3A 2G5VA 4Z6AH 4K1SA 1UTPA 5C5OA 2Q6DA 2ZFTA 5AFYH 1G32B 3ZZ7A 1HJAC 1C5PA 4JK6A 1BA8B 1B0FA 2PUQH 4WJG2 4Z0KA 3C27B 4WXIA 1BHXB 4X2VA 1K22H 2WPHS 1WV7H 1V2OT 4X0WU 2F9VA 1BRUP 1SOZA 1O5EH 5DJ7A 4KP0A 2G55A 3SZNA 2PFEA 2NU3E 1G3CA 3GYMA 4ZROA 1BQYA 1Y5UT 3ODFA 1YPHE 4RKOB 3PYHA 1GHAF 3ODDA 1P10A 1GPZA 2STAE 4DG4A 3RXUA 2ANKH 4B73A 1SGIB 3V0XA 4CH8B 1O3NA 3FP7E 3NXPA 2QA9E 1FI8A 1O2WA 1O2TA 3ZVCA 4JZEH 4UD9H 3IG6B 2EI6A 3EA8A 3KNXA 4TWWA 2WUCA 7GCHG 1F5KU 2J2UA 2P16A 2P94A 2ZA5A 1YBWA 4OS4A 5FCRA 3LGUA 1BTYA 3EYDA 2Y5FA 3RXTA 1DWEH 1FN8A 1WSSH 4YT7H 3BEFB 1IQMA 2OC7A 3H5CB 1UTKA 4K69A 4YTAA 3LKWA 3RXBA 1PQ5A 5TCAA 3MNCA 3U98H 3VXEH 2AIPA 4OS6A 1EJAA 3F9FA 2EEKA 1W0YH 1V2JT 4CRBA 5C20A 2BVRH 1C1NA 5DP5A 1ZYOA 3BTQE 4NIWA 1NY22 3BTWE 4FUIA 5GDSH 4THNH 3V13A 1FDPA 1VZQH 2FS8A 1DY9A 4ZKNU 5E2PA 1GI5A 1QB9A 2V35A 1GDUA 3KGPA 1C5ZB 2R0LA 2HGTH 3ZVAA 5EW2H 1OXGA 1ZJDA 2WUBA 5EPNA 5ESTE 2Q1JA 1Y3YA 1NRRH 2BLWA 3T25A 2Z94A 3A86A 2WV5A 4GCHG 1AFQB 2AGGX 3MNSA 4IN2A 2G5NA 2BD4A 8KME2 1DM4B 1ANDA 2WPJS 2ZU1A 4YM9A 4FU9A 3T29A 1F2SE 3TNSA 5A8ZA 1BCUH 1H8DH 4MNVA 1UTQA 3MFJA 1JXPA 3MMGA 2FM2A 5DP6A 1HFDA 5FPYA 1WU1A 1GJBB 2YNAA 3W95A 1O2SA 1S6FA 2BXTH 2D8WA 5L2ZH 2Z9GA 3GDUA 5L6NH 3GYLB 4ISHH 1THRH 2ZPSA 1AB9C 1D3PB 4GHTA 1N6YA 1CQQA 1TOMH 4YLQH 3SUFA 2ZC9H 3OY6U 2PW8H 4X6MA 1GCDA 4IC5A 1OWIA 1P2IA 5E0JA 3RLYH 3HKJB 4X8VH 1SI5H 2GD4B 3V7TA 1OP8A 1O2UA 4ABBA 3V3MA 1GHBG 1A0HB 1MMJN 5F8TA 2GTBA 2PTNA 1SL3A 4AG2A 6GCHG 3OYPA 1YYY1 1O2NA 1HV7A 4I31A 5E0GA 1AGJA 5EU8A 1IOEA 3PLPA 1GI8B 1QB6A 1AFQC 4ABHA 1HJAB 1UCYH 1MCTA 1AD8H 2QXIA 1MKWH 2SGQE 1P05A 5DK1A 1CHOG 2HNTC 8LPRA 1GBEA 3LGTA 2KAIA 3NWUA 1AY6H 2SNWA 5GCHF 2ZEBA 4I33A 1LPGB 2Y81A 1EZSC 1MTSA 3PMHB 1PJPA 1SQTA 2F3CE 3RP2A 3UIRA 1HIAB 1LPKB 2PV9B 2NU1E 3DFLA 1TGTA 5CE1A 4LXBH 1DSTA 1GMHF 4CR5A 2ZDMA 3RXKA 3ATLA 1A3BH 1Y5BT 3B23B 4B76A 4VGCB 1ZHMA 1RFNA 3P8FA 1O2JA 3U9AH 5F8XA 1P2OA 5K0HA 3O8DA 1GWAA 2J38A 1SGNE 5DP7A 1WOFA 1T8MA 1LVYA 3LJOA 1V2VT 4XDEA 5PTPA 1BTPA 4NSVA 3ZVFA 1O3HA 5C3NA 5GIBA 4DW2U 1KXFA 1LTOA 1HAVA 1MU8B 1T8NA 1TABE 1UMAH 3BTTE 1GHVH 1W14U 1GGDB 3R0FA 1NO9H 4H4FA 4AB9A 2ZF0H 1HAIH 2Q6FA 3VPKA 3H7TA 2BVXH 1MTNC 3S7HB 2Q6GA 2ZG0H 3QZQA 3MWIU 4BANB 3WY8A 2ZDLA 3DT0H 1AO5A 2Z3DA 1O5CB 1CHGA 1TPPA 2J34A 1C5RA 1K2I1 2ALPA 1A3EH 2Z3CA 2ZWLH 4UFDH 1GVKB 1EUFA 3SGBE 2V3HH 2OD3B 3T5FH 3GCTG 3SHAH 2BDGA 1XUKA 1P04A 2BHGA 4Y8YA 2BY8X 4ZKSU 4GVUA 3KQDA 1QJ1B 2ZKSA 1QL7A 4YESB 5EOKA 3A8CA 1SFQB 2PSXA 2XC4A 1XKAC 1YPEH 4BAKB 1N1LA 1MTWA 4A1XA 2NWNA 4FXGH 3RMLH 1PPEE 1HGTH 3QDZB 1CBWB 1Q31A 1W8BH 3BF6H 5FBIA 5C5NA 3M3TA 4IGDA 1EZXC 2AS9A 4NIYA 2PKAA 1AWHB 1B7XB 2PHBA 2GCHG 4Y11E 2I6SA 1AVWA 1NRQH 4NCYA 3SU3A 1LVBA 3M3SA 2CXVA 1O5BB 1QR3E 1UCYE 3PLKA 3MU4A 2BQ7B 1AVGH 1NU9A 4BAOB 1ZGVA 1GBTA 1XMNB 3STIA 1P2MA 1TFXA 2ZCHP 2XNIA 1UHBA 2VNTA 1CO7E 1MCVA 2A4OA 4KTSA 5HXFA 2G81E 1RD3B 1YCPM 2EI8A 2XYAA 1G3EA 3A7XA 3SU4A 5A09A 1FY3A 1QIXB 2AFQB 2PGBB 2FI5E 1Z8RA 4ZKOU 1O3EA 2ODYB 1CSOE 3UWJH 3SQHE 1QCPA 1IAUA 2VIPA 5C1XA 4CRGA 2XBXA 2VVCA 3SNDA 1DOJA 2GMTC 2A5KA 1C2MA 2Z7FE 2CV3A 1GHYH 3HATH 2SGAA 1XVOA 2ZZUH 2IJOB 3RXGA 4UE7H 3PO1B 1Z71A 2ZI2H 3FP8E 3PMBB 4ABEA 4X6NA 3SN8A 1GI6A 4BAHB 1XM1A 3SJ8A 4A1TA 1HAZB 3F9GA 1P2JA 3RC5A 1IQEA 3ZZ4A 2R0KA 3DUXH 1WCZA 1D3TB 1P01A 3TJVA 3LU9B 1O2PA 1A5GH 1GCTB 5JBCS 1DXPA 2FOFA 1W2KH 2I6QA 3QLPH 3KIDU 2GV6A 1S0QA 1SQAA 1O2IA 1ZMJA 1UVTH 2OLGA 1K1NA 3ATWA 1TB6H 4B71A 2ZHWH 2BMGB 1C1TA 1O3PB 2JETC 1TNIA 3BTEE 1O31A 1DUEA 2BLQA 1IQHA 1Y59T 4Q2KA 1A1RA 3ITIA 4IN1A 3AW0A 5ABWA 8GCHF 3RXEA 2PR3A 1O34A 2UWOA 2V6NA 1B5GH 3CP7A 1HAGE 3AVZA 4MG3A 2SNVA 1OSSA 1F0TA 5A0BA 1MKWK 1O2KA 1H8IH 4BXWA 1TPAE 1GBKA 5FPTA 2AGEX 3GICB 1PQAA 4TPIZ 5DPAA 4B75A 1OYTH 3HGNA 2G8TA 1O33A 1IQGA 1C1MA 2XXLA 3GCNA 4Q7ZA 2TGTA 4XBBA 1TBQH 3E91A 4Q80A 2C8XB 1O2QA 5J4SA 1FONA 4X1RU 4D76A 3ZV8A 1MKXK 1ESBA 3ZZ3A 2FMJA 3MO9A 1FY4A 1DANH 3VFEA 1QBNA 1ZMNA 1QA0A 4X2YA 1ACBE 2RA0A 1XUIA 1Z6EA 1T32A 5CMXH 1XXDA 2UWLA 3A85A 3MH4A 4U01A 1S5SA 1ELGA 1XUFA 1AHTH 4Y76A 1KLTA 3D49H 4E05H 1MTUA 1MTVA 1VJAU 5C1YA 1NRPH 3PV4A 5J4QA 4FVDA