1GI7B

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 52
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi7B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi7B01
1O0DH 1ZOMA 1SGNE 4OGXA 1HAVB 1WCZA 1BB0B 4JZEH 4Q2KA 4IN1A 1P0SH 1DDJA 4TY6A 3E6PH 1D3DB 2Z6BD 2AYWA 1EOJA 2C8XB 5A8ZA 1EATA 1GHAG 4J1YA 1WTHD 4B76A 1ZMLA 1GBEA 1JIRA 2XTTB 4X1RU 7ESTE 5JYIA 1NO9H 2YNAA 1MAXA 4OS1A 2BDHA 1P2KA 1B0FA 1QQUA 3NWUA 1QJ1B 2XXLA 1FAKH 3M36A 1O2HA 1WYKA 2PLXA 3MTYA 1UVSH 1ZGIA 4Z6AH 1CA0B 1OWHA 1K1JA 3MU4A 4M7GA 2ZO3H 3LGIA 3PMJA 3TITA 1ELCA 3LGVA 2ZHDA 4NA8A 1KLIH 1EAIA 3CENA 1DXWA 2TGAA 3BTFE 2FOCA 3IWMA 1UTLM 1H1BA 3MNCA 3TJNA 4Y8YA 2O9QA 1GJDB 3GISB 4Y79A 3F9EA 4NCYA 3FP8E 2PKSC 2UUJB 1KLTA 1YLCA 1HB0B 2FTMA 1GBMA 3OYPA 1HUTH 1SGCA 4MNXA 3UWJH 2JETC 4H4FA 2BQWB 4RSPA 1K1IA 1C1QA 3ATWA 1BCUH 2BM2A 1DWEH 1P04A 3PO1B 5F8ZA 1UK2A 4FUHA 1CU1A 2QXGA 3ITIA 1LO6A 1P2QA 2AIPA 1G9IE 3QN7A 3LJOA 1GJBB 2BZ6H 2GV6A 4NIYA 1GBIA 3VB6A 1P9UA 1RXPA 2QF0A 1UVPA 1WBGB 1IHTH 2K1QA 3SNEA 1V2VT 3OY6U 2I6QA 3RXVA 1KXDA 2UWOA 4CHAB 1HAYB 1AKSA 1AQ7A 1MZDA 2GCHF 2HPQH 3RU4T 3PWBA 2R2MB 4NIWA 2C8WB 5ABWA 4WY3A 1ID5H 1T8MA 1EAXA 2G5NA 1MBMA 4GAWA 1S0RA 2TGPZ 3O8BA 1TE0A 1O3GA 2H9HA 3SHAH 3ZZAA 1SGDE 2PKAA 3PYHA 4FU7A 1FPCH 4MPUA 2VWNA 1LVOA 5CHAB 3MWIU 9ESTA 2BDAA 1EQ9A 3PLPA 4NSYA 1SR5C 4DIIH 1ZYOA 1KXEA 2OP9A 3BG4C 2AGIX 1WOFA 3MNSA 3RC6A 1YCPM 5JBAS 3URCA 4OGYA 1P3CA 1C5LH 4MQAA 1MTSA 1TNKA 1Z71A 1AHTH 1TBRH 2ALPA 2SGAA 4O03A 1HAXB 2VIQA 2F91A 4CRCA 4MDSA 3AVZA 3T62A 3RP2A 2ZFFH 1AE5A 1QIXB 2CJIA 3GDUA 4VGCB 3RXQA 2ODPA 1W10U 2OXSA 3F9HA 1THSH 2O8TA 4ASHA 2GCTC 3A7XA 3KQEA 4OS7A 1A3EH 3LONA 2ZDAH 2ILNA 1GVZA 2ZFTA 1ZPZA 1SHYA 1Y5UT 1DUEA 4IC5A 1C1OA 2QF3A 3BTGE 4FUFA 4ZKSU 1GPZA 3DD2H 4NWLA 5GCHG 1BJUA 3KIDU 5EXMA 4AZ2B 4NFFA 4K60A 3UNSA 3ELAH 1QBNA 3BG8A 1C5YB 2DE9A 3URDA 1LCYA 3A85A 2VWOA 3SI4H 2VU8E 2XWAA 2ZU2A 1G30B 1G3CA 2WPKS 4ABDA 4FUJA 4OS6A 2FOAA 4X6NA 1K1OA 3I77A 4FUGA 4BAKB 1OYTH 1MCVA 1Y3VA 2IJOB 1CGIE 1LMWB 1K1MA 3LGTA 2Z7FE 2D1JA 3SU3A 4TYDA 5AFZH 1VJ9U 2TGDA 3A87A 1MKXH 1UTQA 5HXFA 3KF2A 4B71A 1BRAA 1OXGA 1THPB 1O3BA 2H1UA 1LPKB 1MUEB 1ZTJA 1QA0A 3PV4A 1NU7B 2BMGB 3R0FA 3PO1C 2ZHQH 2BD2A 3QLPH 3Q3XA 1O2LA 1N8OC 4Y8XA 4WXVA 2BQ6B 1BITA 3U1IB 1TGCA 1JMOH 3PWCA 1SPJA 3QO6A 1GCDA 5EU8A 5GPIB 1QL9A 1GDQA 1PJPA 2PSYA 4U2WA 4TPYA 3LH3A 3RLYH 3LT3A 2B7DH 2SGPE 1T31A 1H8IH 1DVAH 1XVMA 4K5ZA 4AYVB 4JZ1A 3RXTA 5F8TA 1FDPA 3U8TH 4A1XA 1HFDA 1TBZH 1G3EA 3ODFA 3R3GB 1ZJKA 1FNIA 1TX7A 2XC0A 1L4DA 1P57B 2QA9E 4JK6A 2A2QH 4Y76A 4ISHH 1XUHA 4JZDH 4AORA 3QX5H 4ZAEA 1C1MA 5CHAC 3TH3H 1S5SA 1F5RA 4AFSA 2ZIQH 4D9RA 1QY6A 3A7ZA 1PPZA 1GMHF 2VIVA 2HNTE 5HMAA 1O2ZA 1MU6B 1Z6JH 4YT7H 2PUQH 5T6DA 3K9XB 3P92A 2WPJS 1DICA 4XBDA 1G3BA 1Z6EA 4UFDH 3TH4H 1UTOA 2ANMH 3SNBA 4DCDA 3V13A 5SGAE 1K1NA 4JYTA 1DY9A 5A0AE 1MKWK 1TA2A 2FOEA 1DOJA 1NPMA 1UCYE 4I8JA 1GDUA 2SGDE 3S7HB 2BB4A 3T29A 1E37B 1MTVA 5H4IB 1F2SE 5CE1A 2FOFA 5FX5A 5L2YH 1ETTH 1EOLA 1O2KA 1Y3XA 1ZJDA 1GJ4H 2AIQA 2WV4A 4VGCC 3UREA 3A84A 2AGEX 3U8RH 1V6DA 2Q6FA 1JIMA 1BHXF 2GDEH 2W5EA 4GCHF 2BVSH 2ZC9H 3I29A 1D4PB 2A1DB 4NA9H 4WXIA 3ZV8A 3ZZ9A 4X2XA 1SLVB 4AN7A 5EPNA 6LPRA 3UQVA 1QRWA 4ABEA 1SGIB 5JPMH 4FVDA 3SU5A 2ZI2H 4FUCA 2EA3A 1Q3XA 3TLOA 1O38A 3P6ZB 1SL3A 3QDZB 1QL8A 3UY9A 1TX8A 1AFEH 4R8TB 1EPTA 1IQMA 1C5OH 2G4TA 1XXFA 2FS8A 1H9LB 1D9IA 1DWCH 3LH1A 3RXOA 3ZVCA 1SGQE 4IW4E 2VVCA 1A0LA 1BOQA 3B9FH 2NU3E 4DOQA 2IPHA 1GHAF 2FDAA 1K9OE 1SFIA 1O3IA 4MLFB 4YOIA 1FIZA 1L1GA 1JWTA 1PPFE 1WV7H 4B2AA 2BLWA 3STIA 5JBCS 1T4VH 2GT8A 4A92A 1QURH 2YNBA 1MQ5A 3ZZ3A 3PM3A 4A1VA 1Z8GA 1XXDA 3F68H 5LH8A 2W26A 1TGTA 4ZH8A 5F03A 4YT6H 5C5OA 2VIWA 4WMEA 1RIWC 1W7GH 1BRUP 1C2HA 3VB5A 2B5TB 3UFAA 4H42U 1TA6A 5EQQA 1RTKA 4AOQA 4A5TS 1EPTB 2ZU1A 1P2JA 4FUBA 1T4UH 4JMYA 4BXSA 1HAIH 1VGCB 1YC0A 1AWFH 2G4UA 1KXCA 1C2EA 4I33A 1C2KA 1YPGH 3S9CA 3FANA 2A45B 2PR3A 4X6MA 4WF8A 1M9UA 1AUJA 7GCHG 4FUIA 3T27A 4BAHB 1DSTA 2WYJA 2Y5HA 1K2I1 2BDYA 2QAAA 1BMNH 1F0UA 2B9LA 2ULLA 1HAHH 1YPEH 1W13U 3S7KB 5IYTA 1CT2E 1ZPBA 4D76A 1HJ8A 2STAE 1H4WA 3BSQA 1HAOH 2TGTA 1QQ4A 4WMDA 4CH2B 2ZU3A 5JB9S 1TALA 2JKHA 2ZG0H 1O3PB 4DIHH 4TY7A 1A1RA 1O3AA 1YCPH 2VB0A 3UUZA 2PGQB 5BPEA 4X1PU 1QFKH 3ZZ4A 3ZZ5A 1P03A 1MU8B 2QC2A 1O5GH 1XUIA 3KCGH 1G2MA 1ARCA 2PKSB 3LIWA 3F6UH 2AMQA 2O8WA 5AF9H 3LC5A 1BTPA 1AUTC 4A7IB 3AAUA 3FP6E 2A5AA 2J94A 3SV9A 3GCHC 4HZHA 5EGMA 3LGYA 3PTNA 4I31A 2EI7A 3MYWA 5TCAA 2RCEA 5C67A 4X8VH 2CHAB 1OPHB 1V2ST 5C1YA 2Q1JA 3KQCA 2G55A 3T5FH 2PV9B 1IQLA 1ZRKA 3EE0B 3S69A 3MHWU 3A89A 3UNRA 2SGEE 4KGAA 1AIXH 2BLVA 4AFQA 3QK1A 4UFGH 5FXLA 4ABFA 5DJ7A 4NZQA 2P3TB 2XWBI 1FZZA 4Q7YA 3LKWA 3FZZA 3SQHE 1ZHMA 5FBIA 1C2GA 1NFWA 1D6WA 1O5CB 3UR9A 2H5DA 2ZPRA 1HBTH 2TRMA 3HKJB 3VPKA 3NZIA 6GCHF 2P59A 1ELAA 1GI5A 3Q3KA 1IAUA 2SNVA 4CRFA 1QR3E 3O8DA 3BIVH 5I46H 4MNVA 1L2EA 2A2XH 2ZU5A 3UTUH 1GBCA 1AMHA 1EX3A 2WV5A 1FY4A 1V2RT 2XCNA 3ZVGA 1VR1H 1O5AB 2GP9B 1TLDA 3ATMA 2UUFB 4DJZB 1PQ8A 2V0BA 4NGAH 1C1TA 3BG4B 5GCHF 4GCHG 1K1PA 1Y8TA 2Z9KA 2O8LA 2OUAA 2RA0A 2QYIA 2VH6A 3ZYEA 1A61H 3U1JB 1O5BB 1MD7A 4YLUA 2ZFSA 1TIOA 1SB1H 2ZKSA 2BTCE 2J92A 1F0RA 3CP7A 3A7VA 1EPTC 1SGFA 3ZVDA 1EZSC 3E8LA 2WPLS 1O3FA 1VGCC 3GYLB 1TPOA 1TOMH 1BQYA 4MPXA 4X8TH 2A4GA 5A0CA 5L6NH 1IQIA 4CH8B 2GZ9A 3BTDE 4HFPB 2GCTB 1FJSA 1BBRE 3BEFB 2Z94A 1FN6A 2SFAA 2GT7A 1EB2A 1NC6A 3P70B 1IQFA 4I8HA 4UD9H 3SZNA 1HPGA 1WSSH 1FMGA 3B23B 4B1TA 4X8SH 3RXHA 4CBOA 4FU9A 4OS5A 1CHGA 1L1NA 1GI2A 1BDAA 1RGQA 3L6PA 2P16A 1CGJE 4ABJA 3KQBA 1P05A 1DPOA 1OKXA 3SU6A 2OC1A 2HNTC 1Z8IB 4THNH 1O2UA 1UCYK 2J95A 2HRVA 4X2YA 2NU1E 3SU2A 4Z0KA 2OINA 1GJCB 4WMFA 1QB1A 3E90B 4BAQB 1W0YH 1PPCE 3EA8A 3RXKA 3OTJE 1GI9B 4E05H 1X7AC 1GJ8B 3PMHB 1KXBA 1FN8A 3RLWH 1SC8U 1C4U2 1E0FD 2P3UB 2WPMS 3NKKA 5EXLA 1HAPH 4YLQH 1LPGB 3A88A 1LQDB 3RMLH 4OS4A 4XE4A 5F8XA 2CHAC 4LZ1H 4K2YA 2BD5A 5LPRA 2A4OA 3V12A 1N8OB 1SHHB 3SV2H 3KEEA 2ZDLA 1C5RA 2ZPQA 4UDWH 2R0KA 1LVBA 1SG8B 3TK5A 3HKIB 5L30H 3HGNA 5FPTA 1ELEE 2ANYA 2BXUH 2ZTZA 1LHDH 1FPHH 2ESTE 2W3KA 2V3HH 4IMZA 1BA8B 4SGBE 1MH0A 3TGJE 2Y7XA 1HXFH 4WVPE 2BX4A 4QT8C 3RXIA 3P17H 5E0HA 4K1SA 3VB3A 1HIAA 1O2OA 1QB6A 3TK9A 1VJAU 1AD8H 2G8TA 1C5PA 3RDZA 1C1RA 1MTNC 4FVBA 1C5QA 1IQKA 1K22H 3GY2A 1T8LA 1W12U 2C3SA 4YESB 3UQOA 5FX6A 2IOTA 4ZXYH 1CGHA 3ATLA 2BD4A 2G52A 5FPYA 1E34B 3D49H 1VCQA 1QJ6B 6CHAC 3A7WA 1TPSA 2GKVE 1YP9A 2J2UA 3MOCA 1HJAB 1C5TA 1O5DH 2QXIA 4X0WU 3UNQA 4UONA 1BIOA 3AAVA 4A6LA 1SVPA 2VINA 8LPRA 1CA8B 3BTTE 3T26A 1AKSB 2FOGA 2VIDA 2ZGCA 4DY7B 4RKJB 2QV1A 3MU8A 2ZU4A 1WUNH 2A5IA 3TVJB 4KTCA 1KTTB 6GCHG 1GBFA 3O8CA 5B6OA 4X6PA 1BTUA 5ETXA 1UHBA 2PKAB 1YLDA 1JRTA 1GHXH 2ZTYA 5A2MH 4MTBA 1P2MA 3M5MA 3LPRA 1P11E 3GICB 2OD3B 1EXFA 1WU1A 2V3OH 3RXLA 1ABIH 1SGEE 4LOYH 5DP5A 3TK6A 5DKMA 2F9UA 3AW0A 2Z9GA 1K28D 3N7OA 2ZP0H 1LHCH 3T2NA 4KELA 2OC8A 1S6HA 2C90B 5EPYA 1O2JA 9LPRA 3PMAB 2BX3A 2XBWA 3TNTA 4ISOA 1O3CA 2AGGX 1PPEE 2ALVA 2M5TA 1XX9A 3RXDA 2ZGHA 3TU7H 7GCHF 3TH2H 2Q6GA 1YBWA 1GI1A 3LU9B 3NCLA 1TRYA 3MO3A 1P09A 2HALA 3SJOA 1XM1A 3RXBA 1DFPA 2FOHA 3BN9A 1L0ZA 5GDSH 3BV9B 3MH6A 2WYGA 4CBNA 4KTUA 3A8BA 3BTQE 1O3JA 2BY5X 2Y5GA 4IGDA 3V0XA 3U98H 3SGQE 3GDVA 2FLRH 1NTPA 1O3OA 2GZ8A 1C2IA 1C5SA 1RIWB 1KIGH 3RUOA 3UWIA 1J15A 3BTWE 1PYTD 3SGAE 5CMXH 1ESBA 1P01A 3QTVH 1RFNA 1S81A 2G5VA 2O8UA 1OWDA 1FY8E 1XKAC 1A5GH 3A7YA 4D9QA 1Z8JB 3KNXA 1EP5A 3MNXA 1LTOA 1C5XB 2KAIA 3RM2H 1KDQA 3TJUA 2A32A 2DUCA 3TJVA 1O31A 1GI0A 1S0QA 3OSYA 1D6RA 1ZHPA 3D62A 2ZF0H 3RXUA 1NN6A 2VIOA 4YOJA 3GY8A 4KKDA 2R3UA 5EXNA 3M35A 3SN8A 3ZVFA 4INHA 2OTVA 4YZUA 1C4Y2 4Y7BA 3QWCH 2FEQH 3RC4A 4INKA 3MU5A 1Q2WA 1YPMH 2P93A 2CF8H 3O8RA 2PGBB 1O36A 2C93B 5EODA 2H9EH 3PLKA 3STJA 1AZ8A 1OP2A 3CS0A 3RXPA 1FLEE 1Z1JA 2VVUA 3UOUA 2Y82A 4I8LA 3RXFA 1LDTT 4MNWA 4I8KA 1SGRE 4X1QU 1UK4A 1ZMNA 2FESH 1L1JA 2WPHS 5ESBA 3T28A 5C20A 4TWYA 2UWLA 3U69H 4O9VA 3EAJA 1ZMJA 4IMQA 1INCA 1HJAC 4XSKU 1B5GH 1GBAA 4GLYA 3PB1E 1DANH 2H6MA 1SLWB 5FBEA 1KLJH 2GTBA 4YO9A 1C5NH 1O2IA 3MO6A 1C1WH 1N1LA 1ZSKA 2ZPSA 4IBLH 1JBUH 2NU2E 3MI4A 3GCHB 1RTLA 2CN0H 5EOKA 1A2CH 3BTHE 2QIQA 1QBVH 1C2LA 1ZSJA 1DUAA 3DT0H 1BTYA 8GCHF 1C1PA 3SBKA 3TPIZ 1GHYH 3SU4A 1GMDF 4O3UA 3PLBA 5LPFA 1HGTH 3EA9A 4MPVA 1C5UA 2HOBA 1TX6A 2CXVA 3RXEA 3SJ8A 1AFQC 1AI8H 3RMOH 1NRPH 5E8EH 1VITG 1GVLA 1BRBE 4YM9A 1KY9A 3SGBE 2ZDNA 3SHCH 2FPZA 3ZZ7A 5FAHA 1OWJA 4B74A 4MG3A 4DG4A 1PFXC 3DHKH 3LGUA 3QGNB 1A0HB 1ELDE 5DP4A 1GBBA 1ELBA 1IQEA 4ZUHA 1TQ0B 1AO5A 1O2VA 1OWEA 2FMJA 2HLCA 5LPEA 2HNTF 4F4OC 1U6QA 1WAYB 4AYYB 1SOTA 4X2WA 1AZZA 1K1LA 1ETSH 1NESE 1TGNA 1BRCE 3RMNH 1UTNA 2FYQA 4CREA 1GWAA 2XYAA 4D7GA 1O3DA 3M5NA 1GJ6A 2NU0E 3HK6B 4GVUA 2WUBA 1O35A 1JXPA 1YF4A 1GBHA 1P8VC 4AGJA 1V2KT 2ZNKH 1ANEA 4X1SU 4ZKOU 4BXWA 2SNWA 3A83A 1AVWA 3C27B 4UEHH 3A8DA 1SBWA 3P8OA 4AB8A 4CRBA 4NZLA 1TOCB 3IG6B 4Y11E 1GVKB 3U9AH 4AFUA 3SU0A 3L33A 3RXAA 2VGCC 2PW8H 4AB9A 2A7CA 2GD4B 3FFGA 3SJIA 1IHSH 5DGJA 5T6GA 4D8NA 1QB9A 5DP3A 1LKBA 1LHEH 2AFQB 1AB9B 4E7RG 5EQSA 3LDXH 3A86A 5TCCA 1S83A 2RDLA 1RRKA 4U30A 5JB8S 1O5EH 3Q76A 5FCKA 4Y71A 5EG4A 3Q3YA 1YKTA 2EI8A 4BTTB 3SNDA 2ZHEH 1OWIA 3RM0H 4X1NU 3M5LA 1WQSA 2FX4A 2Z9IA 1H8DH 2VNTA 1FI8A 1FY3A 1DY8A 5TJXA 1GI8B 2RG3A 1YM0A 1TNJA 1C5VA 1TBQH 4ZROA 2FP7B 1CO7E 3Q77A 1EJNA 1MMJN 3SORA 4ABAA 1GGDB 1HAZB 4CRAA 1MQ6A 1NRQH 3BF6H 4NWKA 5DO4H 4NG9H 2XRCA 4MPWA 5DG6A 3H7TA 1TGBA 1V3XA 1YPKH 5F6MA 1CHOF 1F0SA 1W3CA 4Q7ZA 1W2KH 4OS2A 4XDEA 1V2NT 4B2BA 3SJKA 1GDNA 2FI4E 2R9PA 3DFLA 1P10A 3UOPA 2ANKH 1TABE 1BMLA 5A09A 3M5OA 2XCFA 5C5NA 1D3PB 1Y3WA 4ZHAA 1LHFH 2SGQE 1GHBF 2HPPH 1V2PT 3A81A 2BOHB 2A31A 1GBKA 1BMAA 4CRDA 1UTJA 3A8CA 1XMNB 2O8MA 1E38B 1IQJA 4PROA 5FCRA 4ZKRU 3SV8A 2QXJA 3FZDA 4ABGA 1EB1H 1DWDH 5E0JA 1P2NA 1MKWH 2JH6D 3ZVBA 2OC7A 2FOBA 3ZZCA 1AE8H 1NM6A 2WUCA 1ZRBA 2ZGXH 1NROH 2AERH 1P06A 1T8OA 1P2OA 5J4SA 1J16A 2YOLA 3MFJA 3EYDA 2GMTB 1ETRH 4X6OA 1SSXA 1MTNB 1DT2A 1W0ZU 4XBBA 1C5MD 5C1UA 1CSOE 3AASA 2ZWLH 2LPRA 2RA3A 1EJMA 1WTGH 2ZDMA 4BAOB 3SJ9A 4ZKNU 2A0QB 5DP7A 3MU1A 3MMGA 8GCHG 1C1VH 4DT7B 6CHAB 2FODA 2QXHA 2GVFA 1HAVA 4NFEA 2VVVA 1GMDG 1VCWA 3EQ0H 3RMMH 3RXRA 4ZHMU 2XW9A 1ELGA 2C4FH 2R0LA 2LNCA 1B0EA 1VCPA 5DK1A 1GJAB 4K1TA 2Y6TA 2PTCE 4GHQA 1ARBA 1G36A 2ZCLP 1T8NA 1AGJA 2AEIH 4HGCA 4ZHLU 2H5CA 3RXMA 1J9CH 1T7CA 3GYMA 1E35B 2OCVB 4DW2U 2Z3DA 1O2TA 1EP6A 3GY5A 1ELVA 2FI5E 3K2UA 3G01A 4B2CA 1KXFA 1TRMA 2FIRH 1TMTH 2Z3CA 1GI6A 5E0GA 2WPIS 1CQQA 1KYNA 3UR6A 1FV9A 4Y10E 4ZMAH 4K8YA 1CVWH 1QL7A 4I7YH 1AB9C 1ANCA 5EQRA 3RU4D 1S85A 2ZA5A 4YOGA 5DP8A 3SNAA 2A7HA 3ZVAA 2D2DA 1N6XA 4JZFH 2PHBA 1C2JA 2ZQ1A 4NIVA 1H9HE 2B0FA 3B8JA 1TPPA 4WH6A 1AN1E 1B7XB 1SLUB 3V3MA 1V2MT 3RXSA 4NIXA 1Y5BT 1TRNA 1RTFB 2ZFQH 3ZV9A 3RXGA 2C8YB 3NPSA 5G4BA 1W7XH 4NA7A 1XUKA 1CBWB 4MNYA 2FO9A 4LK4A 2D26C 1TGSZ 2OQ5A 2CMYA 3VXFH 3E3TA 2FYRA 1GGDC 4BTIB 3OU0A 1CT4E 1QRXA 1MKXK 1IQGA 1J17T 5FHTA 3VB4A 4B75A 4SGAE 3VEQB 1V2QT 3ATIA 3KHVA 1GCTC 3GCNA 2BY6X 4IS5A 1LKAA 1O3LA 4FXGH 3F9FA 4FUDA 5IDKA 1SMFE 4HI3A 4X2VA 1O3MA 3RXCA 1E36B 1OX1A 2VWLA 1Y5AT 4TWWA 1TFXA 1QTFA 3GY3A 1Z7KA 2W7UA 1T32A 4UE7H 1SQTA 5E2OA 3SV7A 1H9IE 1MZAA 4BAMB 1G32B 3WY8A 3GY4A 1TMBH 4YTAA 3QZQA 4BANB 5A8XA 2V35A 5GJ4B 1WQVH 2P8OB 2DE8A 2I6SA 1OSSA 2ZFRH 2GV7A 2NU4E 2TBSA 3GCTG 4AG1A 1CT0E 2ZFPH 1CHOG 1P9SA 1C2DA 3QGJA 1F92A 4O97A 1G3DA 1V2JT 2GMTC 1FY5A 1TYNA 1LHGH 3A7TA 4RKOB 4BNRA 2OC0A 4JCNA 3ZZBA 3RXJA 5JDUB 3BTKE 1OOKB 3JZ2B 4AX9H 1EZXC 4I32A 2G51A 1VITF 2VH0A 2PWXA 2HWLB 1GHBG 4A1TA 1MAYA 5PTPA 1GI7B 1GJ5H 1OWKA 1UVOA 1AY6H 3M61U 4ISNA 3M37A 1GBJA 1O2WA 1S6FA 3M7TA 1SGYE 4KP0A 3VGCC 2ZCHP 1BMMH 3LOXA 3IITA 2UUKB 1CE5A 1GG6B 3ZVEA 3KL6A 1QBOA 2JH5D 2F9BH 5C3NA 1OP0A 1TWXB 2ANWA 1NU9A 1AVXA 1NRSH 1PPHE 1UK3A 2BVXH 3EGKH 4JYUH 2J34A 2Y7ZA 3ODDA 1QNJA 1O5FH 2VIPA 3A8AA 1O2QA 1HIAB 5BRRE 1SQAA 1PQAA 1FUJA 1GHZA 1F5LA 1O2PA 3M3TA 2PSXA 2ZGJA 2GX4A 1GJ7B 1HNEE 2W3IA 4AGKA 1MTWA 1SGFG 1PPBH 1MBQA 2BD7A 1AFQB 3CS7A 1BZXE 4Q7XA 5DPAA 5HYOA 3DUXH 1SOZA 2SGFE 3BTME 1DE7H 1V2WT 2BDGA 3SOSA 1OYQA 2ZTXA 1MCTA 3LGWA 3PROA 3ZYDA 1IOEA 2BXTH 1TNLA 1YPHC 3SUFA 2XBYA 3TIUA 2EEKA 3A80A 4R0IA 1HV7A 2GZ7A 3E0NB 2Y80A 1THRH 3FVFB 4JZIA 1DITH 4K8BA 1CBWC 1YYY1 4U01A 1OP8A 1A46H 3HATH 1JOUB 1TQ7B 3E91A 1EZUC 4Y6DA 1DLEA 3E16B 1ELFA 2EC9H 2TPIZ 3M7UA 1UHBB 2FX6A 2GDDA 3UIRA 4U32A 4ISIH 1KSNA 4H6TA 1FONA 1F0TA 1O2YA 1CA0C 1Y59T 2ASUB 1SGPE 1EJAA 1ORFA 1O2RA 2XBVA 2ODYB 4CR5A 1LVMA 1QGFA 1P2IA 1C1SA 1HRTH 1JRSA 3A82A 3D65E 2G00A 1UCYH 1DWBH 1YPJH 2GGVB 1FIWA 1QCPA 2BQ7B 1QRZA 3GDSA 1ANDA 1TONA 1S84A 4UFEH 1HAGE 1ESAA 1HLTH 2VGCB 1YPLH 1C1UH 2V6NA 1HXEH 5EW2H 1NS3A 4JK5A 4ESTE 2JH0D 1DSUA 2P8OC 1PPGE 2UUYA 2VJ1A 3SU1A 4XOJA 5LGOA 3D23A 1D3QB 4I8GA 5E2PA 1O3KA 1UMAH 2PTNA 3F1SB 5C1XA 1MD8A 3MO9A 4DVAU 4NSVA 1O2NA 2AH4X 2ZGBH 4Y7AA 1F7ZA 4Y8ZA 1ZSLA 1O2MA 1C1NA 1RJXB 2ZDKA 2BHGA 2STBE 2ZEBA 1EASA 3DA9B 3MH4A 1O37A 1SQOA 3K6ZA 1N6YA 3M3SA 1YCPK 3V7TA 3KGPA 2EI6A 1EAUA 1O3NA 4XFQA 4CHAC 2CV3A 3T25A 1UVUH 2CGAA 4RN6A 1BTZA 4LXBH 3VXEH 2XBXA 3GY6A 1EUFA 3OX7U 3DFJA 2KAIB 3MH5A 1DXPA 3S0NA 4WJG2 1KDQB 3M7QA 4KTSA 1EZQA 1GI3A 1ACBE 1C2MA 2F9NA 1VZQH 1O2SA 3LJJA 1V2OT 1LQEA 1GG6C 1O33A 1BBRK 1GMCF 5EW1H 3NXPA 2FZZA 3FP7E 3ATKA 1DS2E 1DLKB 1G37A 1TNGA 1P12E 1V2TT 1HDTH 2AMPA 3AW1A 1ZHRA 3ENSB 1SFQB 1SI5H 3M3VA 1GBTA 2D8WA 1IQNA 1ZGVA 3PTBA 3H5CB 2Y81A 2ODQA 3TNSA 2A4RA 2BOKA 3EA7A 2B8OH 1TPAE 4F49A 4INLA 1Y3UA 1FY1A 1UJ1A 2A7JA 2BYAX 3H7OA 1F5KU 2P94A 2NWNA 2GCHG 5AFYH 1ZZZA 3SUEA 2BZAA 4ISLA 2FTLE 4AFZA 2BDCA 2QCYA 1A4WH 1A7SA 5AHGH 3BTEE 2H9TH 1MTUA 3TGIE 3C1KA 3QZRA 3SW2B 1PQ5A 3ESTA 5GWZA 4BOHA 1UVTH 3S9AA 2XC4A 1W14U 4WH8A 1QA7A 1ZR0A 4K3JA 1TAWA 3ZZ8A 2XC5A 4XBCA 1GBDA 5C2ZA 1NRNH 3SNCA 1EKBB 1C4V2 2H2ZA 2ZZUH 3SV6A 2R3YA 4CRGA 2FLBH 4E7NA 3W95A 3MNBA 4TPIZ 2ZCKP 2WINI 3JZ1B 1XUJA 2FXRA 2QGRA 1C9PA 3P8GA 5A8YA 4FU8A 2C8ZB 1RS0A 2FOMB 2HGTH 3SUDA 5T6FA 1W11U 3RC5A 2BD9A 1UO6A 3VB7A 4DGJA 3BEIB 1XVOA 1ZTKA 3NUMA 1UTMA 2VWMA 1NFYA 3SUGA 3BEUA 2BD3A 5FPSA 2AMDA 5I25A 2ZHFH 2QY0B 1ANBA 3K6YA 4X8UH 5A0BA 1ZLRA 3P8NA 2FM2A 1QHRB 1DX5M 4H6SB 3UPEA 1TB6H 5DP6A 2F83A 1K21H 4IC6A 4K1EA 1J8AA 1V2UT 4D7FA 1P3EA 2BLQA 1AU8A 3E0PB 2ZHWH 4LZ4B 5GIBA 3GOVB 1W8BH 3PMBB 1OS8A 1NRRH 1BHXB 1DM4B 1ABJH 3ZZ6A 5GXPA 1BTXA 1YPHE 3GY7A 1O30A 1BTHH 3KQDA 1FAXA 4Q80A 1C9TA 2J4IA 1O39A 1GL0E 5HGGA 5K0HA 1O32A 5JBBS 3L3TA 3W94A 2FWWA 3KN2A 4GHTA 2OBOA 1TNHA 1GHVH 3GCTF 1NY22 2BY8X 2XNIA 3OY5U 2R2WU 1Y3YA 1XKBC 1QJ7B 5JBTA 2J9NA 1LVYA 4AG2A 1YGCH 2HVXA 1BT7A 1GCTB 2QN5T 4MVNA 2A4QA 2AS9A 1Z8RA 2BY7X 2BVRH 1S82A 5ESTE 3GCOA 3U8OH 1V2LT 3SI3H 2PUXB 1GJ9B 1SLXB 1UTPA 2IN2A 2F9PA 1Q31A 4GPGA 2Z9LA 8KME2 2F3CE 3P8FA 4ZXXH 2OBQA 1GI4A 5T3HA 2Q6DA 1ESTA 2P95A 3SO3A 3NK8A 2F9VA 2ZDVH 4J2YB 2BY9X 3BIUH 1FQ3A 1LPZB 1ZPCA 4K69A 2JETB 5HM9A 1O3HA 2FS9A 2UWPA 2CF9H 3S9BA 2PFEA 1BBRH 2Z3EA 2BDBA 1SGTA 1ELTA 3E1XB 3VFEA 4E06H 1PQ7A 4FUEA 4HTCH 4ABIA 1RD3B 4JYVH 3EDXB 3K65B 1O3EA 4GSOA 2P3FH 2A5KA 3HGPA 1BJVA 1NZQH 1A5IA 1EAWA 1NFXA 5DP9A 1AWHB 1NFUA 2J38A 1GMCG 1A0JA 1NT1A 1TMUH 2Y5FA 3TJOA 1UTKA 2FI3E 1GMHG 1P02A 2BLOA 2Z9JA 3HPTB 2TIOA 4ABHA 7LPRA 3LC3A 3QUMP 1HCGA 5AVDA 1KXAA 5HM2A 3TGKE 2ZECA 1L4ZA 4GUXA 2F9OA 3P95A 1BTWA 1ZTLA 1FXYA 1BUIA 1GHWH 4ABBA 3MH7A 2OLGA 6ESTA 3MU0A 1Z1IA 1O2XA 1D3TB 2THFB 4IN2A 4Y0ZE 1VITH 1PYTC 2BD8A 3VGCB 4BTUB 1O34A 5J4QA 1A3BH 1J14A 3HK3B 7KMEH 2G81E 3I78A 1TNIA 2BDIA 1KTSB 1A5HA 1HYLA 2ZQ2A 4UFFH 4O3TA 3QTOH 3SQEE 1GBLA 4WWYA 4Y0YE 1C5ZB 1HJ9A 1G2LA 3Q00A 1XUGA 5L2ZH 3F9GA 4DURA 3FAOA 1C2FA 1IQHA 3RU4E 1GL1A 8ESTE 1XUFA 4B73A 3ZZDA 5K7RA 1C5WB 1O2GH 2OQUA 2W7SA 4CR9A 1AVGH
chains in the Genus database with same CATH superfamily
1O0DH 1ZOMA 1SGNE 4OGXA 1HAVB 1WCZA 1BB0B 4JZEH 4Q2KA 4IN1A 1P0SH 2YMSB 1DDJA 4TY6A 3E6PH 1D3DB 3KYFA 2Z6BD 2AYWA 1EOJA 4I86A 2C8XB 5A8ZA 1EATA 2W6JD 1GHAG 4J1YA 1WTHD 4B76A 1ZMLA 1GBEA 1JIRA 2XTTB 4X1RU 7ESTE 5JYIA 1NO9H 2YNAA 1MAXA 4OS1A 2BDHA 1P2KA 1B0FA 1QQUA 3NWUA 1QJ1B 2XXLA 5KGOA 2RFKC 1FAKH 3M36A 1O2HA 1WYKA 2PLXA 3MTYA 1UVSH 1ZGIA 4Z6AH 1CA0B 1OWHA 1K1JA 1MABB 3MU4A 4M7GA 2ZO3H 3LGIA 3PMJA 3TITA 1ELCA 3LGVA 2ZHDA 4NA8A 1KLIH 1EAIA 3CENA 1DXWA 2TGAA 3BTFE 2FOCA 3IWMA 1UTLM 1H1BA 3MNCA 3TJNA 4Y8YA 2O9QA 1GJDB 4XRNA 3GISB 4Y79A 3F9EA 4NCYA 3FP8E 2PKSC 2UUJB 1KLTA 1YLCA 1HB0B 5HKKD 2FTMA 1GBMA 3OYPA 1HUTH 1SGCA 4MNXA 3UWJH 2JETC 3N7DA 4H4FA 2BQWB 4RSPA 1K1IA 1C1QA 3ATWA 1BCUH 2BM2A 1DWEH 1P04A 3PO1B 5F8ZA 1UK2A 1YY3A 4FUHA 1CU1A 2QXGA 3ITIA 1LO6A 1P2QA 2AIPA 1G9IE 2QE7D 3QN7A 3LJOA 1GJBB 2BZ6H 2GV6A 4NIYA 2GJGA 1GBIA 3VB6A 1P9UA 1RXPA 2QF0A 1UVPA 1WBGB 1IHTH 2K1QA 3SNEA 3PRBA 1V2VT 3OY6U 2I6QA 3RXVA 1KXDA 2UWOA 4CHAB 3WW7A 1HAYB 1AKSA 1AQ7A 1MZDA 2GCHF 2HPQH 3H09A 3RU4T 3PWBA 2R2MB 4NIWA 2C8WB 5ABWA 4WY3A 1ID5H 1T8MA 1EAXA 2G5NA 1MBMA 4GAWA 1S0RA 2TGPZ 3O8BA 1TE0A 1O3GA 2H9HA 3SHAH 3ZZAA 1SGDE 2PKAA 3PYHA 4FU7A 1FPCH 4MPUA 2VWNA 1LVOA 5CHAB 3MWIU 9ESTA 2BDAA 1EQ9A 1W0KD 3PLPA 4NSYA 1SR5C 1YWUA 4DIIH 4P00A 1ZYOA 1KXEA 2OP9A 3BG4C 2AGIX 1WOFA 2WHXA 3MNSA 3RC6A 1YCPM 5JBAS 3URCA 4OGYA 1P3CA 1C5LH 4MQAA 1MTSA 1TNKA 1Z71A 1AHTH 1TBRH 2ALPA 2SGAA 4O03A 1HAXB 2VIQA 2F91A 4CRCA 4MDSA 3AVZA 3T62A 3RP2A 2ZFFH 1AE5A 1QIXB 2CJIA 2YMSC 3GDUA 4VGCB 2L6OA 2IJD1 3RXQA 2ODPA 1W10U 2OXSA 3F9HA 1THSH 2O8TA 4ASHA 2GCTC 3A7XA 3KQEA 4OS7A 1A3EH 3LONA 2ZDAH 2ILNA 1GVZA 2ZFTA 1ZPZA 1SHYA 1Y5UT 1DUEA 4IC5A 1C1OA 3SZEA 2QF3A 3BTGE 4FUFA 4ZKSU 1GPZA 3DD2H 4NWLA 5GCHG 1BJUA 3KIDU 5EXMA 4AZ2B 4NFFA 4K60A 1KMHB 3UNSA 3ELAH 1QBNA 3BG8A 1C5YB 2DE9A 3URDA 1LCYA 3A85A 2VWOA 2HLDD 3SI4H 2VU8E 1E1QD 2XWAA 2ZU2A 1G30B 1G3CA 2KZ4A 2WPKS 4ABDA 4FUJA 4OS6A 2FOAA 4X6NA 1K1OA 3I77A 4FUGA 4BAKB 1OYTH 1MCVA 1Y3VA 2IJOB 1CGIE 1LMWB 1K1MA 3LGTA 2Z7FE 2D1JA 3SU3A 4TYDA 5AFZH 1VJ9U 3DSPA 2J98A 2TGDA 3A87A 1SKYE 1MKXH 1UTQA 3FKSD 5HXFA 3KF2A 4B71A 1BRAA 1OXGA 1THPB 1O3BA 2EY4C 2H1UA 1LPKB 1MUEB 1ZTJA 1QA0A 3PV4A 1NU7B 2BMGB 3R0FA 4RT0A 3PO1C 2ZHQH 2BD2A 3QLPH 2KCYA 3Q3XA 1O2LA 1N8OC 4Y8XA 4WXVA 2BQ6B 1BITA 3U1IB 1TGCA 1JMOH 3PWCA 1SPJA 3QO6A 1GCDA 5EU8A 5GPIB 1QL9A 1GDQA 1PJPA 2PSYA 4U2WA 4TPYA 3LH3A 3RLYH 3LT3A 2B7DH 2SGPE 1T31A 1H8IH 1DVAH 1XVMA 4K5ZA 4AYVB 4JZ1A 3RXTA 5F8TA 1FDPA 3U8TH 4A1XA 1HFDA 1TBZH 2W6ID 1G3EA 3ODFA 3R3GB 1ZJKA 1FNIA 5C0TA 1TX7A 2XC0A 1L4DA 1K0HA 1P57B 2QA9E 4JK6A 2A2QH 4Y76A 4ISHH 1XUHA 4JZDH 4AORA 3QX5H 4ZAEA 3N99A 1C1MA 5CHAC 3TH3H 1S5SA 1F5RA 4AFSA 2ZIQH 4D9RA 1QY6A 3A7ZA 1PPZA 1GMHF 2VIVA 2HNTE 5HMAA 1O2ZA 1MU6B 1Z6JH 4YT7H 2PUQH 5T6DA 3K9XB 3P92A 1VKYA 2WPJS 1DICA 4XBDA 1G3BA 1Z6EA 4UFDH 3TH4H 1UTOA 2ANMH 3SNBA 4DCDA 2RDEA 3V13A 5SGAE 1K1NA 4JYTA 1DY9A 5A0AE 1MKWK 1TA2A 2FOEA 1DOJA 1NPMA 1UCYE 4I8JA 1GDUA 2SGDE 3S7HB 2BB4A 3T29A 1E37B 1MTVA 5H4IB 1F2SE 2KR7A 5CE1A 2FOFA 5FX5A 5L2YH 1ETTH 1EOLA 1O2KA 1Y3XA 1ZJDA 1GJ4H 2AIQA 2WV4A 3FO8D 4VGCC 1H8HD 3UREA 3A84A 2AGEX 3U8RH 1V6DA 2Q6FA 1JIMA 1BHXF 2GDEH 5HIYA 2W5EA 4GCHF 2BVSH 2ZC9H 3I29A 1D4PB 2A1DB 4NA9H 4WXIA 3PRDA 3ZV8A 3ZZ9A 4X2XA 1SLVB 4AN7A 5EPNA 6LPRA 3UQVA 1QRWA 4ABEA 1SGIB 5JPMH 4FVDA 3SU5A 2ZI2H 4FUCA 2EA3A 1Q3XA 5FL7D 3TLOA 3OAAD 1O38A 3P6ZB 1SL3A 3QDZB 1QL8A 3UY9A 1TX8A 1AFEH 4R8TB 1EPTA 1IQMA 1C5OH 2G4TA 1XXFA 2FS8A 1H9LB 1D9IA 1DWCH 3LH1A 3RXOA 3ZVCA 1SGQE 4IW4E 2VVCA 1A0LA 1BOQA 3B9FH 2NU3E 4DOQA 2IPHA 1GHAF 2FDAA 1K9OE 1SFIA 1O3IA 4MLFB 4YOIA 1FIZA 1L1GA 1JWTA 1PPFE 1WV7H 4B2AA 2BLWA 3STIA 5JBCS 1T4VH 2GT8A 4A92A 1QURH 3UAIC 2YNBA 1MQ5A 3ZZ3A 3PM3A 4A1VA 1Z8GA 1XXDA 3F68H 5LH8A 2W26A 1TGTA 4ZH8A 5F03A 4YT6H 5C5OA 2VIWA 4WMEA 1RIWC 1W7GH 1BRUP 1C2HA 3VB5A 2B5TB 3UFAA 4H42U 1TA6A 3GS9A 1RTKA 5EQQA 4AOQA 1EPTB 4A5TS 2ZU1A 1P2JA 4FUBA 1T4UH 4JMYA 4BXSA 1HAIH 2F4LA 1VGCB 3EE7A 1YC0A 1AWFH 2G4UA 1KXCA 1C2EA 4I33A 1C2KA 1YPGH 3S9CA 3FANA 2A45B 2PR3A 5HIZA 4X6MA 4WF8A 1M9UA 1AUJA 7GCHG 4FUIA 3T27A 4BAHB 1DSTA 2WYJA 2Y5HA 4F55A 1K2I1 2BDYA 2QAAA 1BMNH 1F0UA 2B9LA 2ULLA 1HAHH 1YPEH 1W13U 3S7KB 5IYTA 5C94A 1CT2E 1ZPBA 4D76A 1HJ8A 2STAE 1H4WA 3BSQA 1HAOH 2TGTA 1QQ4A 4WMDA 4CH2B 2ZU3A 5JB9S 1TALA 2JKHA 2ZG0H 1O3PB 4DIHH 4TY7A 1A1RA 1O3AA 1YCPH 2VB0A 3UUZA 2PGQB 5BPEA 4X1PU 1QFKH 3ZZ4A 3ZZ5A 1P03A 1MU8B 2QC2A 1O5GH 1XUIA 3KCGH 1G2MA 1ARCA 2PKSB 3LIWA 3F6UH 2AMQA 2O8WA 5AF9H 3LC5A 1BTPA 1AUTC 4A7IB 3AAUA 3FP6E 2A5AA 2J94A 3SV9A 3GCHC 4HZHA 5EGMA 3LGYA 3PTNA 4I31A 2EI7A 3MYWA 5TCAA 2RCEA 5C67A 4X8VH 2CHAB 1OPHB 1V2ST 5C1YA 2Q1JA 3KQCA 2G55A 3T5FH 2PV9B 1IQLA 1ZRKA 3EE0B 3S69A 3MHWU 3A89A 3UNRA 2SGEE 4KGAA 1AIXH 2BLVA 4AFQA 3QK1A 4UFGH 5FXLA 4ABFA 5DJ7A 4NZQA 2P3TB 2XWBI 1FZZA 2F43B 3LKWA 4Q7YA 3FZZA 3SQHE 1ZHMA 5FBIA 1C2GA 1NFWA 2KCPA 1UW7A 1D6WA 1O5CB 3UR9A 2H5DA 2ZPRA 1HBTH 2TRMA 3HKJB 3VPKA 3NZIA 6GCHF 5GNDA 2P59A 2JDID 1ELAA 1GI5A 3Q3KA 1IAUA 2SNVA 4CRFA 1QR3E 3O8DA 3BIVH 5I46H 4MNVA 1L2EA 2A2XH 2ZU5A 3UTUH 1GBCA 1AMHA 1EX3A 2WV5A 1FY4A 1V2RT 2XCNA 3ZVGA 1VR1H 1O5AB 2GP9B 1TLDA 3ATMA 2UUFB 4DJZB 4M9FA 1PQ8A 2V0BA 4NGAH 1C1TA 3BG4B 5GCHF 5F53A 4GCHG 1K1PA 1Y8TA 2Z9KA 2O8LA 2OUAA 2RA0A 2QYIA 2VH6A 3ZYEA 1A61H 3U1JB 1O5BB 4Q63A 1MD7A 4YLUA 2ZFSA 1TIOA 1SB1H 2ZKSA 2BTCE 2J92A 1F0RA 3CP7A 3A7VA 2EQNA 1EPTC 1SGFA 3ZVDA 1EZSC 2QF5A 3E8LA 2WPLS 1O3FA 1VGCC 3GYLB 1TPOA 3SYJA 1TOMH 1BQYA 4MPXA 4X8TH 2A4GA 5A0CA 5L6NH 1IQIA 4CH8B 2GZ9A 3BTDE 4HFPB 2GCTB 1FJSA 3F3BA 1BBRE 3BEFB 2Z94A 1FN6A 2SFAA 2GT7A 1EB2A 1NC6A 3P70B 1IQFA 4I8HA 2OK5A 4UD9H 3SZNA 2M2AA 1HPGA 1WSSH 1FMGA 3B23B 4B1TA 4X8SH 3RXHA 4CBOA 4FU9A 4OS5A 1CHGA 1L1NA 1GI2A 1BDAA 1RGQA 3L6PA 2P16A 1CGJE 4ABJA 3KQBA 1P05A 1DPOA 1OKXA 3SU6A 2OC1A 2HNTC 1Z8IB 4THNH 1O2UA 1UCYK 2J95A 2HRVA 4X2YA 2NU1E 3SU2A 4Z0KA 2OINA 1GJCB 4WMFA 1QB1A 3E90B 4BAQB 1W0YH 1PPCE 3EA8A 3RXKA 3OTJE 1GI9B 4E05H 1X7AC 1GJ8B 2L74A 3PMHB 1KXBA 1FN8A 3RLWH 1SC8U 1C4U2 1E0FD 4Q4LA 2P3UB 2WPMS 3NKKA 5EXLA 1HAPH 4YLQH 1LPGB 3A88A 1LQDB 3RMLH 4OS4A 4XE4A 5F8XA 2CHAC 4LZ1H 4K2YA 2BD5A 5LPRA 2A4OA 3V12A 1N8OB 1SHHB 3SV2H 3KEEA 2ZDLA 1C5RA 2ZPQA 4UDWH 2R0KA 1LVBA 1SG8B 3TK5A 3HKIB 5L30H 3HGNA 5FPTA 1ELEE 2ANYA 1BMFD 2BXUH 2ZTZA 1LHDH 1FPHH 2ESTE 2W3KA 2V3HH 4IMZA 1BA8B 4SGBE 1MH0A 3TGJE 2Y7XA 3OFND 2V3MA 1HXFH 4WVPE 2BX4A 4QT8C 3RXIA 3P17H 5E0HA 4K1SA 3VB3A 1HIAA 1O2OA 1QB6A 3TK9A 1VJAU 1AD8H 2G8TA 1C5PA 4ACBA 3RDZA 1C1RA 1MTNC 4FVBA 2KFWA 1C5QA 1IQKA 1K22H 3GY2A 1T8LA 1W12U 2C3SA 4YESB 3UQOA 5FX6A 2IOTA 4ZXYH 1CGHA 3ATLA 2BD4A 2G52A 5FPYA 1E34B 3D49H 1VCQA 1QJ6B 6CHAC 3A7WA 1TPSA 2GKVE 1YP9A 2J2UA 3MOCA 1HJAB 1C5TA 1O5DH 2QXIA 4X0WU 3UNQA 4UONA 5KECA 1BIOA 3AAVA 4A6LA 1SVPA 2VINA 8LPRA 1CA8B 3BTTE 3T26A 1AKSB 2FOGA 2VIDA 2ZGCA 4DY7B 4RKJB 2QV1A 3MU8A 2ZU4A 1WUNH 3MQKC 2A5IA 3TVJB 4KTCA 1KTTB 6GCHG 1GBFA 3O8CA 1NBMD 5B6OA 4X6PA 1H8ED 1BTUA 5ETXA 1UHBA 2PKAB 1YLDA 1JRTA 1GHXH 2ZTYA 5A2MH 4MTBA 1P2MA 3M5MA 3LPRA 1P11E 3GICB 5EJLA 2OD3B 4B6FA 1EXFA 1WU1A 2V3OH 3RXLA 1ABIH 1SGEE 4LOYH 5DP5A 3TK6A 5DKMA 2F9UA 3AW0A 2Z9GA 1K28D 3N7OA 2ZP0H 1LHCH 3T2NA 4KELA 5EJ1A 2OC8A 1S6HA 2C90B 5EPYA 1O2JA 9LPRA 4DT4A 3PMAB 2BX3A 2XBWA 3TNTA 4ISOA 1O3CA 2AGGX 1PPEE 2ALVA 2M5TA 1XX9A 3RXDA 2ZGHA 3TU7H 7GCHF 3TH2H 2Q6GA 1YBWA 3F2FA 1GI1A 3LU9B 3NCLA 1TRYA 3MO3A 1P09A 2HALA 3SJOA 1XM1A 3RXBA 1DFPA 2FOHA 3BN9A 1L0ZA 5GDSH 3BV9B 3MH6A 2WYGA 4CBNA 4KTUA 3A8BA 3BTQE 1O3JA 2BY5X 2Y5GA 4IGDA 3V0XA 3U98H 3SGQE 3GDVA 2FLRH 1NTPA 1O3OA 2GZ8A 1C2IA 1C5SA 1RIWB 1KIGH 3RUOA 3UWIA 1J15A 2VBCA 3BTWE 1PYTD 3SGAE 5CMXH 5DN6D 1ESBA 1P01A 3QTVH 1RFNA 1S81A 3KYGA 3OTPA 2G5VA 2O8UA 1OWDA 1WXRA 1FY8E 1XKAC 1A5GH 3A7YA 4D9QA 1Z8JB 3KNXA 1EP5A 3MNXA 1LTOA 1C5XB 2KAIA 4FETA 3RM2H 1KDQA 3TJUA 2A32A 2DUCA 3TJVA 1O31A 1GI0A 1S0QA 3OSYA 1D6RA 1ZHPA 3D62A 2ZF0H 3RXUA 1NN6A 2VIOA 4YOJA 3GY8A 4KKDA 2R3UA 5EXNA 3M35A 3SN8A 3ZVFA 4INHA 2OTVA 4YZUA 1C4Y2 5DSFA 4Y7BA 3QWCH 2FEQH 3RC4A 4INKA 3MU5A 1Q2WA 1YPMH 2J98B 2P93A 2CF8H 3O8RA 2PGBB 1O36A 2XOKD 2C93B 5EODA 2H9EH 3PLKA 2QF4A 3STJA 1AZ8A 2KCAA 1OP2A 3CS0A 3RXPA 1FLEE 1Z1JA 2VVUA 3UOUA 3U28C 2Y82A 4I8LA 3RXFA 1LDTT 4MNWA 4I8KA 2AHME 1SGRE 4F48B 4X1QU 1UK4A 1ZMNA 2FESH 1L1JA 2WPHS 2J5UA 5ESBA 3T28A 5C20A 4TWYA 2UWLA 3U69H 4O9VA 3EAJA 1ZMJA 4IMQA 1INCA 1HJAC 4XSKU 1B5GH 1GBAA 4GLYA 3PB1E 1DANH 2H6MA 1SLWB 5FBEA 1KLJH 2GTBA 4YO9A 1C5NH 1O2IA 3MO6A 1C1WH 1N1LA 1ZSKA 4TSFD 2ZPSA 4IBLH 5C17A 1JBUH 2NU2E 3MI4A 3GCHB 1RTLA 2CN0H 5EOKA 1A2CH 3BTHE 2QIQA 1QBVH 2JJ2D 1C2LA 1ZSJA 1DUAA 3DT0H 1BTYA 8GCHF 1C1PA 3SBKA 3TPIZ 1GHYH 3SU4A 1GMDF 4TT3D 4O3UA 3PLBA 5LPFA 1HGTH 3EA9A 4MPVA 1C5UA 2HOBA 1TX6A 2CXVA 3RXEA 3SJ8A 2XNDD 1AFQC 1AI8H 3RMOH 1NRPH 5E8EH 1VITG 1GVLA 1BRBE 4YM9A 1KY9A 1E79D 3SGBE 2ZDNA 3SHCH 2FPZA 3ZZ7A 5FAHA 1OWJA 4B74A 4MG3A 4DG4A 1PFXC 3DHKH 3LGUA 3QGNB 1A0HB 1ELDE 5DP4A 1GBBA 1ELBA 1IQEA 4ZUHA 1TQ0B 1AO5A 1O2VA 1OWEA 2FMJA 2HLCA 5IK2D 5LPEA 2HNTF 4F4OC 2KX4A 1U6QA 1WAYB 2JJ1D 4AYYB 1SOTA 4X2WA 1AZZA 1K1LA 1ETSH 1NESE 1TGNA 1BRCE 3RMNH 1UTNA 2FYQA 4CREA 1GWAA 2XYAA 4D7GA 1O3DA 3M5NA 1GJ6A 2NU0E 3HK6B 4GVUA 2WUBA 1O35A 1JXPA 1YF4A 1GBHA 1P8VC 4AGJA 1V2KT 3W1EA 2ZNKH 5EJZA 4ASUD 1ANEA 4X1SU 4ZKOU 1S6LA 4BXWA 2SNWA 3A83A 1AVWA 3C27B 4UEHH 3A8DA 1SBWA 3P8OA 4AB8A 4CRBA 4NZLA 1TOCB 3IG6B 4Y11E 1GVKB 3U9AH 4AFUA 3SU0A 3L33A 3RXAA 2VGCC 2PW8H 4AB9A 2A7CA 2GD4B 3FFGA 2LELA 3SJIA 1IHSH 5DGJA 5T6GA 4D8NA 1QB9A 5DP3A 1LKBA 1LHEH 2AFQB 1AB9B 4E7RG 5EQSA 3LDXH 3A86A 5TCCA 2WSSD 1S83A 2RDLA 1RRKA 4U30A 5JB8S 1O5EH 3Q76A 5FCKA 4Y71A 5EG4A 3Q3YA 2IPQX 1YKTA 2EI8A 4BTTB 3SNDA 4B6EA 2ZHEH 1OWIA 3RM0H 4X1NU 3M5LA 1WQSA 2FX4A 2Z9IA 1H8DH 2VNTA 1FI8A 1FY3A 1DY8A 2YMSD 5TJXA 1GI8B 2RG3A 1YM0A 1TNJA 1C5VA 1COWD 1TBQH 4ZROA 2FP7B 1CO7E 1W0JD 2CK3D 3Q77A 2J97A 1EJNA 1MMJN 3SORA 4ABAA 1GGDB 1HAZB 4CRAA 1MQ6A 1NRQH 3BF6H 4NWKA 5DO4H 4NG9H 2XRCA 4MPWA 4XD7D 3H7TA 1TGBA 1V3XA 1YPKH 5DG6A 1CHOF 5F6MA 1F0SA 1W3CA 4Q7ZA 1W2KH 4OS2A 4XDEA 1V2NT 4B2BA 3SJKA 1GDNA 2FI4E 2R9PA 3DFLA 1P10A 3UOPA 2ANKH 1TABE 1BMLA 5A09A 3M5OA 2XCFA 5C5NA 1D3PB 1Y3WA 4ZHAA 1LHFH 2SGQE 1GHBF 2HPPH 1V2PT 3A81A 2BOHB 2A31A 1GBKA 1BMAA 4CRDA 1UTJA 3A8CA 4HG6A 1XMNB 2O8MA 1E38B 1IQJA 4PROA 5FCRA 4ZKRU 3SV8A 2QXJA 3FZDA 3PV2A 1EB1H 1DWDH 4ABGA 5E0JA 1P2NA 1MKWH 2JH6D 3ZVBA 2OC7A 2FOBA 3ZZCA 1AE8H 1NM6A 2WUCA 1ZRBA 2ZGXH 1NROH 2AERH 1P06A 1T8OA 1P2OA 5J4SA 1J16A 2YOLA 3MFJA 3EYDA 2GMTB 1ETRH 3FOAA 4X6OA 1SSXA 1MTNB 1DT2A 1W0ZU 4XBBA 1C5MD 5C1UA 1CSOE 3AASA 2ZWLH 2LPRA 2RA3A 1EJMA 1WTGH 2ZDMA 4BAOB 3SJ9A 4ZKNU 2A0QB 5DP7A 3MU1A 3MMGA 8GCHG 1C1VH 4DT7B 6CHAB 2FODA 2QXHA 2GVFA 1HAVA 4NFEA 2VVVA 1GMDG 1VCWA 3EQ0H 3RMMH 3RXRA 4ZHMU 2XW9A 1ELGA 2C4FH 2R0LA 2LNCA 1B0EA 1VCPA 5DK1A 1GJAB 4K1TA 2Y6TA 2PTCE 4GHQA 1ARBA 1G36A 2ZCLP 1T8NA 1AGJA 2AEIH 4HGCA 4ZHLU 2H5CA 3RXMA 1J9CH 1T7CA 3GYMA 1E35B 2OCVB 4DW2U 2Z3DA 1O2TA 1EP6A 3GY5A 1ELVA 2FI5E 3K2UA 3G01A 4B2CA 1KXFA 1TRMA 2FIRH 1TMTH 2Z3CA 1GI6A 5E0GA 2WPIS 1CQQA 1KYNA 3UR6A 1FV9A 5CDFE 4Y10E 4ZMAH 4K8YA 1CVWH 1QL7A 4I7YH 1AB9C 1ANCA 5EQRA 3RU4D 1S85A 2ZA5A 4YOGA 5DP8A 3SNAA 2A7HA 3ZVAA 1YLNA 2D2DA 1N6XA 4JZFH 2PHBA 1C2JA 2ZQ1A 4NIVA 1H9HE 2B0FA 3B8JA 1TPPA 4WH6A 1AN1E 1B7XB 1SLUB 3V3MA 1V2MT 3RXSA 4NIXA 1Y5BT 1TRNA 1RTFB 2ZFQH 3ZV9A 3RXGA 2C8YB 3NPSA 5G4BA 1W7XH 4NA7A 1XUKA 1CBWB 4MNYA 2FO9A 4LK4A 2D26C 1TGSZ 2OQ5A 3DSOA 2CMYA 3VXFH 3E3TA 2FYRA 1GGDC 4BTIB 3OU0A 1CT4E 1QRXA 1MKXK 1IQGA 1J17T 5FHTA 3VB4A 4B75A 4SGAE 3VEQB 1V2QT 3ATIA 3KHVA 1GCTC 3GCNA 2BY6X 2HVYB 4IS5A 3DSGA 1LKAA 1O3LA 4FXGH 3F9FA 4FUDA 5IDKA 1SMFE 4HI3A 4X2VA 1O3MA 3RXCA 1E36B 1OX1A 2VWLA 1Y5AT 4TWWA 1TFXA 1QTFA 3GY3A 1Z7KA 2W7UA 1T32A 4UE7H 1SQTA 5E2OA 3SV7A 1H9IE 1MZAA 4BAMB 1G32B 4AC9A 2K0QA 3WY8A 3GY4A 3ZIAD 1TMBH 4YTAA 3QZQA 4BANB 5C0UA 5A8XA 2V35A 5GJ4B 1WQVH 2DE8A 2P8OB 2I6SA 1OSSA 2ZFRH 2GV7A 2NU4E 2TBSA 3GCTG 4AG1A 1CT0E 2ZFPH 1CHOG 1P9SA 1C2DA 3N7EA 3QGJA 1F92A 4O97A 1G3DA 1V2JT 2GMTC 1FY5A 1TYNA 1LHGH 3A7TA 4RKOB 4BNRA 2OC0A 4JCNA 3ZZBA 3RXJA 5JDUB 3BTKE 1OOKB 3JZ2B 4AX9H 1EZXC 4I32A 2LP6A 2G51A 1VITF 2VH0A 2PWXA 2HWLB 1GHBG 4A1TA 1MAYA 5PTPA 1GI7B 1GJ5H 1OWKA 1UVOA 1AY6H 3M61U 2WV9A 4ISNA 3M37A 1GBJA 1O2WA 1S6FA 3M7TA 1SGYE 4KP0A 3VGCC 2ZCHP 1BMMH 3LOXA 3IITA 2UUKB 1CE5A 1GG6B 3ZVEA 3KL6A 1QBOA 2JH5D 2F9BH 5C3NA 1OP0A 1TWXB 2ANWA 1NU9A 1AVXA 1NRSH 1PPHE 1UK3A 2BVXH 2KCOA 3EGKH 4JYUH 5CHBA 2J34A 2Y7ZA 1NBME 3ODDA 1QNJA 1O5FH 2VIPA 3A8AA 1O2QA 1HIAB 5BRRE 1SQAA 1PQAA 1FUJA 1GHZA 4OM9A 1F5LA 1O2PA 4RI0A 3M3TA 2PSXA 2ZGJA 2GX4A 1GJ7B 1HNEE 2W3IA 4AGKA 1MTWA 1SGFG 1PPBH 1MBQA 2BD7A 1AFQB 3CS7A 1BZXE 1E1RD 4Q7XA 5DPAA 5HYOA 3DUXH 1SOZA 5KEDA 2SGFE 3BTME 1DE7H 1V2WT 2BDGA 3SOSA 1OYQA 2ZTXA 1MCTA 3LGWA 3PROA 3ZYDA 1IOEA 2BXTH 1TNLA 3OE7D 1YPHC 3SUFA 2XBYA 3TIUA 2EEKA 3A80A 2WZQA 1HV7A 2GZ7A 3E0NB 4R0IA 2Y80A 1THRH 3FVFB 4JZIA 1DITH 4K8BA 1CBWC 1YYY1 4U01A 1OP8A 1A46H 3HATH 1JOUB 1TQ7B 3E91A 1EZUC 4Y6DA 1DLEA 3E16B 1ELFA 2EC9H 2TPIZ 3M7UA 1UHBB 2FX6A 2GDDA 3UIRA 4U32A 4ISIH 3NRLA 1KSNA 4H6TA 1FONA 1F0TA 5B6LA 1O2YA 1CA0C 1Y59T 2ASUB 1SGPE 1EJAA 1ORFA 1O2RA 2XBVA 2ODYB 4CR5A 1LVMA 1QGFA 1P2IA 2V7QD 1C1SA 1HRTH 1JRSA 3A82A 3D65E 2G00A 1UCYH 1DWBH 1YPJH 2GGVB 1FIWA 1QCPA 2BQ7B 1QRZA 3GDSA 1ANDA 1TONA 1S84A 4UFEH 1HAGE 1ESAA 1HLTH 3OEHD 2VGCB 1YPLH 1C1UH 2V6NA 1HXEH 5EW2H 1NS3A 4JK5A 4ESTE 2JH0D 1DSUA 2P8OC 1PPGE 2UUYA 2VJ1A 3SU1A 4XOJA 5LGOA 3D23A 1D3QB 4I8GA 5E2PA 1O3KA 1UMAH 2PTNA 3F1SB 5C1XA 1MD8A 3MO9A 4DVAU 4NSVA 1O2NA 2AH4X 2ZGBH 4Y7AA 1F7ZA 4Y8ZA 1ZSLA 1O2MA 1C1NA 1RJXB 2ZDKA 2BHGA 2STBE 2ZEBA 3F0PA 1EASA 3DA9B 3MH4A 1O37A 1SQOA 3K6ZA 1N6YA 3M3SA 3PV5A 1YCPK 3V7TA 3KGPA 2EI6A 1EAUA 1O3NA 4XFQA 4CHAC 2CV3A 1OHHD 3T25A 1UVUH 2CGAA 4RN6A 1BTZA 4LXBH 3VXEH 3WWBA 2XBXA 3GY6A 1EUFA 3OX7U 3DFJA 2KAIB 3MH5A 1DXPA 3S0NA 4WJG2 1KDQB 3M7QA 4KTSA 1EZQA 1GI3A 1ACBE 1C2MA 3AK5A 2F9NA 1VZQH 1O2SA 3LJJA 1V2OT 1LQEA 1GG6C 1O33A 1BBRK 1GMCF 5T1VA 5EW1H 3NXPA 2FZZA 3FP7E 3ATKA 1DS2E 1DLKB 1G37A 1TNGA 1P12E 1V2TT 1HDTH 2AMPA 3AW1A 3FN8A 1ZHRA 3ENSB 1SFQB 1SI5H 3M3VA 1GBTA 2D8WA 1IQNA 4ACAA 1ZGVA 3PTBA 3H5CB 2Y81A 2ODQA 3TNSA 2A4RA 2BOKA 3EA7A 2B8OH 3OEED 1WDIA 2PP6A 1TPAE 4F49A 4P02A 4INLA 1Y3UA 1FY1A 1UJ1A 2A7JA 2BYAX 3H7OA 2JIZD 1F5KU 2P94A 2KM0A 2NWNA 2GCHG 5AFYH 1ZZZA 3SUEA 2BZAA 4ISLA 2FTLE 4AFZA 2BDCA 2QCYA 1A4WH 1A7SA 5AHGH 3BTEE 2H9TH 1MTUA 3TGIE 3C1KA 3QZRA 3SW2B 1PQ5A 3ESTA 5GWZA 4BOHA 1UVTH 3S9AA 2XC4A 1W14U 4WH8A 1QA7A 1ZR0A 4K3JA 1TAWA 3ZZ8A 2XC5A 4XBCA 1GBDA 5C2ZA 1NRNH 3SNCA 1EKBB 1C4V2 2H2ZA 2ZZUH 3SV6A 2R3YA 4CRGA 2FLBH 4E7NA 3W95A 1QZ8A 3MNBA 4TPIZ 1EFRD 2ZCKP 2WINI 3JZ1B 1XUJA 2FXRA 2QGRA 1C9PA 3P8GA 5A8YA 4FU8A 2C8ZB 1RS0A 2FOMB 2HGTH 3SUDA 5T6FA 1W11U 3RC5A 2BD9A 1UO6A 3VB7A 4DGJA 3BEIB 1XVOA 1ZTKA 3NUMA 1UTMA 2VWMA 1NFYA 3SUGA 3BEUA 2BD3A 5FPSA 2AMDA 3F2HA 5I25A 2ZHFH 2QY0B 1ANBA 3K6YA 4X8UH 5A0BA 1ZLRA 3P8NA 2FM2A 4RT1A 1QHRB 1DX5M 4H6SB 3UPEA 1TB6H 5DP6A 2F83A 1K21H 4IC6A 4K1EA 1J8AA 1V2UT 4D7FA 1P3EA 3F2GA 2BLQA 1AU8A 3E0PB 2ZHWH 4LZ4B 5GIBA 3GOVB 1W8BH 3PMBB 1OS8A 4Z1MD 3WWFA 4ZCNA 1NRRH 1BHXB 1DM4B 1ABJH 3ZZ6A 3KQ5A 5GXPA 1BTXA 1YPHE 3GY7A 1O30A 1BTHH 1SQRA 3KQDA 1FAXA 4Q80A 1C9TA 2J4IA 1O39A 1GL0E 5HGGA 5K0HA 1O32A 5JBBS 1FX0B 3L3TA 3W94A 2FWWA 3KN2A 4GHTA 2OBOA 1TNHA 1GHVH 3GCTF 1NY22 2BY8X 2XNIA 3OY5U 2R2WU 1Y3YA 1XKBC 1QJ7B 5JBTA 2J9NA 1LVYA 4AG2A 1YGCH 2HVXA 1BT7A 1GCTB 2QN5T 4MVNA 2A4QA 2AS9A 1Z8RA 2BY7X 2BVRH 1S82A 3UB0A 5ESTE 3GCOA 3U8OH 1V2LT 3SI3H 2PUXB 1GJ9B 1SLXB 1UTPA 2IN2A 2F9PA 1Q31A 4GPGA 2Z9LA 8KME2 2F3CE 3P8FA 4ZXXH 2OBQA 1GI4A 5T3HA 2Q6DA 1ESTA 2P95A 3SO3A 3NK8A 2F9VA 2ZDVH 4J2YB 2BY9X 3BIUH 1FQ3A 1LPZB 1ZPCA 4K69A 2JETB 5HM9A 1O3HA 2FS9A 2UWPA 2CF9H 3S9BA 5EIYA 2PFEA 1BBRH 2Z3EA 2BDBA 1SGTA 1ELTA 3E1XB 3VFEA 4E06H 1PQ7A 4FUEA 4HTCH 4ABIA 1RD3B 4JYVH 3EDXB 3K65B 1O3EA 4GSOA 2P3FH 2A5KA 3HGPA 1BJVA 1NZQH 1A5IA 1EAWA 1NFXA 5DP9A 1AWHB 1NFUA 2J38A 1GMCG 1A0JA 1NT1A 1TMUH 4FOUC 2Y5FA 3TJOA 1UTKA 2FI3E 1GMHG 1P02A 2BLOA 2Z9JA 3HPTB 2TIOA 4ABHA 7LPRA 3LC3A 3QUMP 1HCGA 5AVDA 1KXAA 5HM2A 3TGKE 2ZECA 3VG8A 1L4ZA 4GUXA 2F9OA 3P95A 1BTWA 1ZTLA 1FXYA 1BUIA 1GHWH 4ABBA 3MH7A 2OLGA 6ESTA 3MU0A 1Z1IA 1O2XA 1D3TB 2THFB 4IN2A 4Y0ZE 1VITH 1PYTC 2BD8A 3VGCB 4BTUB 1O34A 5J4QA 1A3BH 1J14A 2WPDD 3HK3B 7KMEH 2K8IA 2G81E 3I78A 4YXWD 1TNIA 2BDIA 1KTSB 1A5HA 1HYLA 2ZQ2A 4UFFH 3F0OA 4O3TA 3QTOH 3SQEE 3CNRA 3DCLA 1GBLA 4WWYA 4Y0YE 1C5ZB 1HJ9A 1G2LA 3Q00A 1XUGA 5L2ZH 3F9GA 4DURA 3FAOA 1C2FA 1IQHA 3RU4E 1GL1A 8ESTE 1XUFA 4B73A 3ZZDA 5K7RA 1C5WB 1O2GH 2OQUA 2W7SA 4CR9A 1AVGH
chains in the Genus database with same CATH topology
1O0DH 1ZOMA 1SGNE 4OGXA 1HAVB 1WCZA 1BB0B 4JZEH 4Q2KA 4IN1A 1P0SH 1DDJA 4TY6A 3E6PH 1D3DB 2Z6BD 2AYWA 1EOJA 2C8XB 5A8ZA 1EATA 1GHAG 4J1YA 1WTHD 4B76A 1ZMLA 1GBEA 1JIRA 2XTTB 4X1RU 7ESTE 5JYIA 1NO9H 2YNAA 1MAXA 4OS1A 2BDHA 1P2KA 1B0FA 1QQUA 3NWUA 1QJ1B 2XXLA 1FAKH 3M36A 1O2HA 1WYKA 2PLXA 3MTYA 1UVSH 1ZGIA 4Z6AH 1CA0B 1OWHA 1K1JA 3MU4A 4M7GA 2ZO3H 3LGIA 3PMJA 3TITA 1ELCA 3LGVA 2ZHDA 4NA8A 1KLIH 1EAIA 3CENA 1DXWA 2TGAA 3BTFE 2FOCA 3IWMA 1UTLM 1H1BA 3MNCA 3TJNA 4Y8YA 2O9QA 1GJDB 3GISB 4Y79A 3F9EA 4NCYA 3FP8E 2PKSC 2UUJB 1KLTA 1YLCA 1HB0B 2FTMA 1GBMA 3OYPA 1HUTH 1SGCA 4MNXA 3UWJH 2JETC 4H4FA 2BQWB 4RSPA 1K1IA 1C1QA 3ATWA 1BCUH 2BM2A 1DWEH 1P04A 3PO1B 5F8ZA 1UK2A 4FUHA 1CU1A 2QXGA 3ITIA 1LO6A 1P2QA 2AIPA 1G9IE 3QN7A 3LJOA 1GJBB 2BZ6H 2GV6A 4NIYA 1GBIA 3VB6A 1P9UA 1RXPA 2QF0A 1UVPA 1WBGB 1IHTH 2K1QA 3SNEA 1V2VT 3OY6U 2I6QA 3RXVA 1KXDA 2UWOA 4CHAB 1HAYB 1AKSA 1AQ7A 1MZDA 2GCHF 2HPQH 3RU4T 3PWBA 2R2MB 4NIWA 2C8WB 5ABWA 4WY3A 1ID5H 1T8MA 1EAXA 2G5NA 1MBMA 4GAWA 1S0RA 2TGPZ 3O8BA 1TE0A 1O3GA 2H9HA 3SHAH 3ZZAA 1SGDE 2PKAA 3PYHA 4FU7A 1FPCH 4MPUA 2VWNA 1LVOA 5CHAB 3MWIU 9ESTA 2BDAA 1EQ9A 3PLPA 4NSYA 1SR5C 4DIIH 1ZYOA 1KXEA 2OP9A 3BG4C 2AGIX 1WOFA 3MNSA 3RC6A 1YCPM 5JBAS 3URCA 4OGYA 1P3CA 1C5LH 4MQAA 1MTSA 1TNKA 1Z71A 1AHTH 1TBRH 2ALPA 2SGAA 4O03A 1HAXB 2VIQA 2F91A 4CRCA 4MDSA 3AVZA 3T62A 3RP2A 2ZFFH 1AE5A 1QIXB 2CJIA 3GDUA 4VGCB 3RXQA 2ODPA 1W10U 2OXSA 3F9HA 1THSH 2O8TA 4ASHA 2GCTC 3A7XA 3KQEA 4OS7A 1A3EH 3LONA 2ZDAH 2ILNA 1GVZA 2ZFTA 1ZPZA 1SHYA 1Y5UT 1DUEA 4IC5A 1C1OA 2QF3A 3BTGE 4FUFA 4ZKSU 1GPZA 3DD2H 4NWLA 5GCHG 1BJUA 3KIDU 5EXMA 4AZ2B 4NFFA 4K60A 3UNSA 3ELAH 1QBNA 3BG8A 1C5YB 2DE9A 3URDA 1LCYA 3A85A 2VWOA 3SI4H 2VU8E 2XWAA 2ZU2A 1G30B 1G3CA 2WPKS 4ABDA 4FUJA 4OS6A 2FOAA 4X6NA 1K1OA 3I77A 4FUGA 4BAKB 1OYTH 1MCVA 1Y3VA 2IJOB 1CGIE 1LMWB 1K1MA 3LGTA 2Z7FE 2D1JA 3SU3A 4TYDA 5AFZH 1VJ9U 2TGDA 3A87A 1MKXH 1UTQA 5HXFA 3KF2A 4B71A 1BRAA 1OXGA 1THPB 1O3BA 2H1UA 1LPKB 1MUEB 1ZTJA 1QA0A 3PV4A 1NU7B 2BMGB 3R0FA 3PO1C 2ZHQH 2BD2A 3QLPH 3Q3XA 1O2LA 1N8OC 4Y8XA 4WXVA 2BQ6B 1BITA 3U1IB 1TGCA 1JMOH 3PWCA 1SPJA 3QO6A 1GCDA 5EU8A 5GPIB 1QL9A 1GDQA 1PJPA 2PSYA 4U2WA 4TPYA 3LH3A 3RLYH 3LT3A 2B7DH 2SGPE 1T31A 1H8IH 1DVAH 1XVMA 4K5ZA 4AYVB 4JZ1A 3RXTA 5F8TA 1FDPA 3U8TH 4A1XA 1HFDA 1TBZH 1G3EA 3ODFA 3R3GB 1ZJKA 1FNIA 1TX7A 2XC0A 1L4DA 1P57B 2QA9E 4JK6A 2A2QH 4Y76A 4ISHH 1XUHA 4JZDH 4AORA 3QX5H 4ZAEA 1C1MA 5CHAC 3TH3H 1S5SA 1F5RA 4AFSA 2ZIQH 4D9RA 1QY6A 3A7ZA 1PPZA 1GMHF 2VIVA 2HNTE 5HMAA 1O2ZA 1MU6B 1Z6JH 4YT7H 2PUQH 5T6DA 3K9XB 3P92A 2WPJS 1DICA 4XBDA 1G3BA 1Z6EA 4UFDH 3TH4H 1UTOA 2ANMH 3SNBA 4DCDA 3V13A 5SGAE 1K1NA 4JYTA 1DY9A 5A0AE 1MKWK 1TA2A 2FOEA 1DOJA 1NPMA 1UCYE 4I8JA 1GDUA 2SGDE 3S7HB 2BB4A 3T29A 1E37B 1MTVA 5H4IB 1F2SE 5CE1A 2FOFA 5FX5A 5L2YH 1ETTH 1EOLA 1O2KA 1Y3XA 1ZJDA 1GJ4H 2AIQA 2WV4A 4VGCC 3UREA 3A84A 2AGEX 3U8RH 1V6DA 2Q6FA 1JIMA 1BHXF 2GDEH 2W5EA 4GCHF 2BVSH 2ZC9H 3I29A 1D4PB 2A1DB 4NA9H 4WXIA 3ZV8A 3ZZ9A 4X2XA 1SLVB 4AN7A 5EPNA 6LPRA 3UQVA 1QRWA 4ABEA 1SGIB 5JPMH 4FVDA 3SU5A 2ZI2H 4FUCA 2EA3A 1Q3XA 3TLOA 1O38A 3P6ZB 1SL3A 3QDZB 1QL8A 3UY9A 1TX8A 1AFEH 4R8TB 1EPTA 1IQMA 1C5OH 2G4TA 1XXFA 2FS8A 1H9LB 1D9IA 1DWCH 3LH1A 3RXOA 3ZVCA 1SGQE 4IW4E 2VVCA 1A0LA 1BOQA 3B9FH 2NU3E 4DOQA 2IPHA 1GHAF 2FDAA 1K9OE 1SFIA 1O3IA 4MLFB 4YOIA 1FIZA 1L1GA 1JWTA 1PPFE 1WV7H 4B2AA 2BLWA 3STIA 5JBCS 1T4VH 2GT8A 4A92A 1QURH 2YNBA 1MQ5A 3ZZ3A 3PM3A 4A1VA 1Z8GA 1XXDA 3F68H 5LH8A 2W26A 1TGTA 4ZH8A 5F03A 4YT6H 5C5OA 2VIWA 4WMEA 1RIWC 1W7GH 1BRUP 1C2HA 3VB5A 2B5TB 3UFAA 4H42U 1TA6A 5EQQA 1RTKA 4AOQA 4A5TS 1EPTB 2ZU1A 1P2JA 4FUBA 1T4UH 4JMYA 4BXSA 1HAIH 1VGCB 1YC0A 1AWFH 2G4UA 1KXCA 1C2EA 4I33A 1C2KA 1YPGH 3S9CA 3FANA 2A45B 2PR3A 4X6MA 4WF8A 1M9UA 1AUJA 7GCHG 4FUIA 3T27A 4BAHB 1DSTA 2WYJA 2Y5HA 1K2I1 2BDYA 2QAAA 1BMNH 1F0UA 2B9LA 2ULLA 1HAHH 1YPEH 1W13U 3S7KB 5IYTA 1CT2E 1ZPBA 4D76A 1HJ8A 2STAE 1H4WA 3BSQA 1HAOH 2TGTA 1QQ4A 4WMDA 4CH2B 2ZU3A 5JB9S 1TALA 2JKHA 2ZG0H 1O3PB 4DIHH 4TY7A 1A1RA 1O3AA 1YCPH 2VB0A 3UUZA 2PGQB 5BPEA 4X1PU 1QFKH 3ZZ4A 3ZZ5A 1P03A 1MU8B 2QC2A 1O5GH 1XUIA 3KCGH 1G2MA 1ARCA 2PKSB 3LIWA 3F6UH 2AMQA 2O8WA 5AF9H 3LC5A 1BTPA 1AUTC 4A7IB 3AAUA 3FP6E 2A5AA 2J94A 3SV9A 3GCHC 4HZHA 5EGMA 3LGYA 3PTNA 4I31A 2EI7A 3MYWA 5TCAA 2RCEA 5C67A 4X8VH 2CHAB 1OPHB 1V2ST 5C1YA 2Q1JA 3KQCA 2G55A 3T5FH 2PV9B 1IQLA 1ZRKA 3EE0B 3S69A 3MHWU 3A89A 3UNRA 2SGEE 4KGAA 1AIXH 2BLVA 4AFQA 3QK1A 4UFGH 5FXLA 4ABFA 5DJ7A 4NZQA 2P3TB 2XWBI 1FZZA 4Q7YA 3LKWA 3FZZA 3SQHE 1ZHMA 5FBIA 1C2GA 1NFWA 1D6WA 1O5CB 3UR9A 2H5DA 2ZPRA 1HBTH 2TRMA 3HKJB 3VPKA 3NZIA 6GCHF 2P59A 1ELAA 1GI5A 3Q3KA 1IAUA 2SNVA 4CRFA 1QR3E 3O8DA 3BIVH 5I46H 4MNVA 1L2EA 2A2XH 2ZU5A 3UTUH 1GBCA 1AMHA 1EX3A 2WV5A 1FY4A 1V2RT 2XCNA 3ZVGA 1VR1H 1O5AB 2GP9B 1TLDA 3ATMA 2UUFB 4DJZB 1PQ8A 2V0BA 4NGAH 1C1TA 3BG4B 5GCHF 4GCHG 1K1PA 1Y8TA 2Z9KA 2O8LA 2OUAA 2RA0A 2QYIA 2VH6A 3ZYEA 1A61H 3U1JB 1O5BB 1MD7A 4YLUA 2ZFSA 1TIOA 1SB1H 2ZKSA 2BTCE 2J92A 1F0RA 3CP7A 3A7VA 1EPTC 1SGFA 3ZVDA 1EZSC 3E8LA 2WPLS 1O3FA 1VGCC 3GYLB 1TPOA 1TOMH 1BQYA 4MPXA 4X8TH 2A4GA 5A0CA 5L6NH 1IQIA 4CH8B 2GZ9A 3BTDE 4HFPB 2GCTB 1FJSA 1BBRE 3BEFB 2Z94A 1FN6A 2SFAA 2GT7A 1EB2A 1NC6A 3P70B 1IQFA 4I8HA 4UD9H 3SZNA 1HPGA 1WSSH 1FMGA 3B23B 4B1TA 4X8SH 3RXHA 4CBOA 4FU9A 4OS5A 1CHGA 1L1NA 1GI2A 1BDAA 1RGQA 3L6PA 2P16A 1CGJE 4ABJA 3KQBA 1P05A 1DPOA 1OKXA 3SU6A 2OC1A 2HNTC 1Z8IB 4THNH 1O2UA 1UCYK 2J95A 2HRVA 4X2YA 2NU1E 3SU2A 4Z0KA 2OINA 1GJCB 4WMFA 1QB1A 3E90B 4BAQB 1W0YH 1PPCE 3EA8A 3RXKA 3OTJE 1GI9B 4E05H 1X7AC 1GJ8B 3PMHB 1KXBA 1FN8A 3RLWH 1SC8U 1C4U2 1E0FD 2P3UB 2WPMS 3NKKA 5EXLA 1HAPH 4YLQH 1LPGB 3A88A 1LQDB 3RMLH 4OS4A 4XE4A 5F8XA 2CHAC 4LZ1H 4K2YA 2BD5A 5LPRA 2A4OA 3V12A 1N8OB 1SHHB 3SV2H 3KEEA 2ZDLA 1C5RA 2ZPQA 4UDWH 2R0KA 1LVBA 1SG8B 3TK5A 3HKIB 5L30H 3HGNA 5FPTA 1ELEE 2ANYA 2BXUH 2ZTZA 1LHDH 1FPHH 2ESTE 2W3KA 2V3HH 4IMZA 1BA8B 4SGBE 1MH0A 3TGJE 2Y7XA 1HXFH 4WVPE 2BX4A 4QT8C 3RXIA 3P17H 5E0HA 4K1SA 3VB3A 1HIAA 1O2OA 1QB6A 3TK9A 1VJAU 1AD8H 2G8TA 1C5PA 3RDZA 1C1RA 1MTNC 4FVBA 1C5QA 1IQKA 1K22H 3GY2A 1T8LA 1W12U 2C3SA 4YESB 3UQOA 5FX6A 2IOTA 4ZXYH 1CGHA 3ATLA 2BD4A 2G52A 5FPYA 1E34B 3D49H 1VCQA 1QJ6B 6CHAC 3A7WA 1TPSA 2GKVE 1YP9A 2J2UA 3MOCA 1HJAB 1C5TA 1O5DH 2QXIA 4X0WU 3UNQA 4UONA 1BIOA 3AAVA 4A6LA 1SVPA 2VINA 8LPRA 1CA8B 3BTTE 3T26A 1AKSB 2FOGA 2VIDA 2ZGCA 4DY7B 4RKJB 2QV1A 3MU8A 2ZU4A 1WUNH 2A5IA 3TVJB 4KTCA 1KTTB 6GCHG 1GBFA 3O8CA 5B6OA 4X6PA 1BTUA 5ETXA 1UHBA 2PKAB 1YLDA 1JRTA 1GHXH 2ZTYA 5A2MH 4MTBA 1P2MA 3M5MA 3LPRA 1P11E 3GICB 2OD3B 1EXFA 1WU1A 2V3OH 3RXLA 1ABIH 1SGEE 4LOYH 5DP5A 3TK6A 5DKMA 2F9UA 3AW0A 2Z9GA 1K28D 3N7OA 2ZP0H 1LHCH 3T2NA 4KELA 2OC8A 1S6HA 2C90B 5EPYA 1O2JA 9LPRA 3PMAB 2BX3A 2XBWA 3TNTA 4ISOA 1O3CA 2AGGX 1PPEE 2ALVA 2M5TA 1XX9A 3RXDA 2ZGHA 3TU7H 7GCHF 3TH2H 2Q6GA 1YBWA 1GI1A 3LU9B 3NCLA 1TRYA 3MO3A 1P09A 2HALA 3SJOA 1XM1A 3RXBA 1DFPA 2FOHA 3BN9A 1L0ZA 5GDSH 3BV9B 3MH6A 2WYGA 4CBNA 4KTUA 3A8BA 3BTQE 1O3JA 2BY5X 2Y5GA 4IGDA 3V0XA 3U98H 3SGQE 3GDVA 2FLRH 1NTPA 1O3OA 2GZ8A 1C2IA 1C5SA 1RIWB 1KIGH 3RUOA 3UWIA 1J15A 3BTWE 1PYTD 3SGAE 5CMXH 1ESBA 1P01A 3QTVH 1RFNA 1S81A 2G5VA 2O8UA 1OWDA 1FY8E 1XKAC 1A5GH 3A7YA 4D9QA 1Z8JB 3KNXA 1EP5A 3MNXA 1LTOA 1C5XB 2KAIA 3RM2H 1KDQA 3TJUA 2A32A 2DUCA 3TJVA 1O31A 1GI0A 1S0QA 3OSYA 1D6RA 1ZHPA 3D62A 2ZF0H 3RXUA 1NN6A 2VIOA 4YOJA 3GY8A 4KKDA 2R3UA 5EXNA 3M35A 3SN8A 3ZVFA 4INHA 2OTVA 4YZUA 1C4Y2 4Y7BA 3QWCH 2FEQH 3RC4A 4INKA 3MU5A 1Q2WA 1YPMH 2P93A 2CF8H 3O8RA 2PGBB 1O36A 2C93B 5EODA 2H9EH 3PLKA 3STJA 1AZ8A 1OP2A 3CS0A 3RXPA 1FLEE 1Z1JA 2VVUA 3UOUA 2Y82A 4I8LA 3RXFA 1LDTT 4MNWA 4I8KA 1SGRE 4X1QU 1UK4A 1ZMNA 2FESH 1L1JA 2WPHS 5ESBA 3T28A 5C20A 4TWYA 2UWLA 3U69H 4O9VA 3EAJA 1ZMJA 4IMQA 1INCA 1HJAC 4XSKU 1B5GH 1GBAA 4GLYA 3PB1E 1DANH 2H6MA 1SLWB 5FBEA 1KLJH 2GTBA 4YO9A 1C5NH 1O2IA 3MO6A 1C1WH 1N1LA 1ZSKA 2ZPSA 4IBLH 1JBUH 2NU2E 3MI4A </