1GI7B

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting, hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi7B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi7B01
2BD5A 3GCHC 1K1JA 5EXLA 4IGDA 1W7GH 1HRTH 1O35A 1AIXH 4AFZA 1L1JA 3PMJA 5HYOA 1KY9A 3RXRA 2SNWA 7KMEH 3V7TA 1QBOA 1O2SA 1TGNA 5JBAS 1WQSA 1KTTB 4K5ZA 1SC8U 3UUZA 1KXEA 3NXPA 4Y7AA 3QTOH 4Y8XA 1E38B 4JCNA 1QQ4A 5EXMA 3T25A 1CA0C 4Y76A 5J4SA 4AORA 2IJOB 5F03A 1ELEE 3V12A 3RLWH 4MPUA 4BXSA 1HAIH 3SI4H 1L4DA 2PLXA 1VCWA 1P9SA 2OBQA 5EPNA 4ABDA 1DDJA 3S0NA 1WBGB 5PTPA 2HVXA 3QZRA 3STJA 4GUXA 4LZ1H 1C5RA 3HK6B 1MUEB 1W0YH 2FOEA 4H6SB 1AGJA 1YKTA 5C1XA 1BTUA 1QBNA 2PGBB 3R3GB 1O5GH 1BA8B 2A7HA 2PKAB 2VU8E 1DM4B 1QL8A 4GCHF 5C67A 4JZIA 1O2XA 4D7GA 5GIBA 2HLCA 3UFAA 1GWAA 1O3HA 2FOHA 2WPKS 5ETXA 4B73A 1KTSB 3E0NB 5A8YA 1EAUA 2ILNA 5JPMH 3SU2A 4VGCC 2BX4A 1SGYE 3ESTA 3D62A 2PWXA 1H8IH 1AE5A 1ZOMA 2ZGBH 3M3SA 1NRNH 1O2PA 5E0HA 1GI5A 1ABJH 1AU8A 1D4PB 1NM6A 4Y79A 4WMDA 3GCOA 4NIYA 3LU9B 1GJ6A 1TAWA 3B9FH 1YYY1 1MCVA 2WINI 1CO7E 4ISOA 1GBDA 2JKHA 4MPWA 4NFEA 3BEIB 4FU7A 1TPPA 1DPOA 1YCPK 1WAYB 1MU8B 4X1QU 3VGCC 3LJOA 4RN6A 4IC5A 4DIIH 1GJ7B 1W11U 2ZGHA 4ZKOU 1O33A 1EJNA 1THPB 1FXYA 1C5SA 3P8OA 2UWPA 1A3BH 2FOCA 2A2QH 1AKSA 1MAXA 1V3XA 1ABIH 2STBE 1ZHPA 3NZIA 2BOHB 1AQ7A 4J2YB 3RM0H 2BY8X 1TPAE 1FDPA 3V0XA 2QXHA 8LPRA 3P95A 3U8RH 1H9LB 1LPGB 2GZ7A 3SZNA 3TJOA 2STAE 2Q6FA 2ZTXA 1XUJA 2C90B 2OC1A 3SBKA 1GDNA 1LQEA 1BHXB 1FY5A 4KELA 2J4IA 3GY5A 5FCKA 3UNQA 1Z6JH 1ELCA 1P2NA 4KTCA 1DT2A 1H8DH 1XUGA 2Z3DA 3MU1A 4F49A 2P8OB 5EG4A 1AD8H 1LHCH 1TQ0B 1DWBH 3O8DA 1GCTB 1CSOE 2PSYA 1C2GA 2ALVA 3SJKA 3GY3A 1V2TT 2P3FH 3Q76A 4NZLA 1DOJA 3SI3H 3VPKA 2ZGJA 3C1KA 1RD3B 1SHHB 1PQ7A 1VITF 2Y81A 4AFUA 2W7SA 5TJXA 1A1RA 1ORFA 1YPHC 2BHGA 3MO9A 2I6SA 2QXIA 1NN6A 1UTOA 1GBLA 2F9PA 4IS5A 1AVGH 5LGOA 4O3TA 4ESTE 4JYUH 1OP8A 5HXFA 1FV9A 2IPHA 2VWLA 1ELBA 2JETC 1QCPA 1Y5AT 2BXTH 1C5QA 3M7QA 3T27A 1HIAA 1N1LA 2ZU2A 1EQ9A 2AERH 2H5DA 3B23B 5DK1A 4X8VH 1AN1E 2HNTF 2FOBA 2BD2A 3ATKA 2ZQ1A 4DT7B 1OKXA 1CQQA 3E90B 1L4ZA 3QN7A 1EAXA 4BAKB 2O8UA 1P03A 5GJ4B 4ISHH 2CHAC 1TNGA 1O3IA 3SNDA 2QYIA 4WVPE 1YLDA 4WXIA 3TK9A 3BG8A 2R0KA 2RA3A 2NU3E 3K6YA 4O97A 1ZSLA 2SFAA 2HRVA 4DG4A 1HAZB 2O8MA 5DP3A 2ODPA 1PYTC 1NPMA 1LTOA 4IN2A 2BVSH 1HAVB 1HJ8A 1MTSA 4E7RG 1AFEH 3PROA 2GZ9A 3SU0A 2B9LA 1C2MA 3O8CA 2ZDAH 4MLFB 1GMDF 3MU4A 2A5IA 3SU3A 4CHAB 2Z9LA 4ASHA 2HNTC 3TJUA 3AAUA 1IQNA 2A0QB 2UUJB 4HZHA 1NESE 3P8NA 1W8BH 1V2QT 3MNXA 1TX7A 1O0DH 2ZFPH 1V2NT 2XNIA 3AAVA 5DG6A 1SFQB 3U69H 1BB0B 1BOQA 1T8NA 1K1PA 1C1NA 4Q7ZA 1N8OC 1AUTC 2GDEH 2FTLE 3T62A 2J2UA 4NWKA 1DE7H 2FOFA 1TALA 1P2JA 4AFSA 1GBIA 4NIWA 5A0AE 1Y8TA 1WTHD 4HFPB 3GDSA 5DP6A 4XBBA 3QZQA 3SORA 4BAMB 3SQEE 1TGTA 3KF2A 3P8FA 1UCYE 3DA9B 1EPTC 4MNXA 4HI3A 1ARCA 1DWCH 3A7WA 1HYLA 2H5CA 3OX7U 4IBLH 1GDUA 3TGIE 4D8NA 1GL1A 1MKWK 1O3LA 4GSOA 2ZFQH 3GCHB 1GJDB 4CH8B 1UO6A 2QXJA 5C5OA 1BTWA 5GDSH 3VFEA 2FZZA 1GJ9B 2BDCA 5TCAA 1A61H 4JZ1A 2QCYA 3OYPA 2KAIA 2O9QA 4D9RA 2OLGA 1ETRH 2Z3EA 3RU4D 1C2KA 1YGCH 1CA0B 3RMMH 2ZWLH 4NA8A 2BB4A 2ZU1A 3AW0A 3ZZ6A 3RXDA 5FBIA 1UK4A 7GCHG 2R3YA 1JWTA 1UTNA 4ZKSU 4CR9A 3PLKA 3G01A 2VINA 4BAHB 3WY8A 1EASA 3SN8A 2QA9E 3QGJA 1L1GA 1ESAA 1P2QA 2FO9A 2EI8A 1GJCB 1QNJA 3E3TA 2VVCA 1S84A 2XBYA 3KGPA 1A5IA 5FCRA 3RXTA 3UR6A 4WMFA 3MU8A 3SV9A 2ZP0H 2H2ZA 3PMBB 1BBRH 1WU1A 1O3EA 1O3OA 3FFGA 1SGDE 2A4GA 1G9IE 4KTSA 2ZO3H 1C1TA 3VB6A 2A1DB 2ZTZA 2ZGXH 1RTFB 1S5SA 1CHOG 1O3JA 1VJ9U 1C5PA 2XBXA 2W7UA 3URDA 3SJ9A 3TH2H 2GCHG 5A09A 4U2WA 1UK2A 5FPTA 1BCUH 4VGCB 1O2IA 1Z7KA 4IC6A 4NCYA 3M37A 2P94A 4ZMAH 1T7CA 3SGBE 4BAOB 3U9AH 1FQ3A 3K6ZA 3TNTA 3UY9A 2ODQA 3SQHE 2ZCHP 4ZHAA 3QTVH 3HKIB 1MTWA 1P9UA 2BLOA 3LOXA 4ZUHA 2V35A 1O37A 4CBNA 2BDYA 4OGYA 2G51A 7GCHF 3EA7A 1C2DA 4ABBA 1XUFA 3VGCB 2BD7A 1MKXH 1F2SE 1W13U 1H9IE 1V2MT 4XE4A 1HIAB 3FP6E 2R2WU 1QRWA 3RXHA 2FI3E 2XC0A 2BY5X 1K21H 3I78A 5L2ZH 1ZZZA 1GCTC 2GX4A 4B2CA 1HAHH 3RXAA 1INCA 3ITIA 4WH8A 5GWZA 1NC6A 2H9HA 2FP7B 1TMUH 4HGCA 4I32A 3ELAH 2R9PA 2A5AA 2DUCA 3MHWU 1NU9A 6ESTA 1MH0A 4WMEA 3F9FA 3GY6A 2HPQH 5LPRA 2OCVB 1GJ4H 3H7TA 1O3GA 1YM0A 3RMOH 3T28A 1CVWH 3M5OA 3MU5A 3A7XA 3RU4T 2ANWA 4Z6AH 2GCHF 1SGQE 2J94A 5FBEA 1FI8A 3KQEA 2FYQA 1MQ6A 1HAOH 3NUMA 4AN7A 1VZQH 2UUFB 1B0EA 4SGBE 1QBVH 1SSXA 1MTNC 1HCGA 2BYAX 2BY7X 3PYHA 2FMJA 3MI4A 1S6HA 1F7ZA 2G4TA 3QWCH 1HBTH 2VVVA 2Z9GA 5G4BA 1M9UA 1YCPM 3RM2H 2CJIA 2Y5FA 3ZV8A 2QN5T 4CRBA 2P59A 4MNWA 3SHAH 2ZFSA 2XCFA 2TIOA 1YF4A 1V6DA 3LH3A 1KDQB 1P12E 3R0FA 1AY6H 4LZ4B 2ESTE 1IQIA 4WXVA 3GOVB 3C27B 4QT8C 4A7IB 3NWUA 4ABJA 5EW1H 1Q3XA 1BITA 4I33A 5DP4A 5C2ZA 1IQKA 3W94A 1A0JA 5DGJA 1TMTH 3RXQA 3S7HB 3RDZA 4X6NA 4NSVA 1P2IA 1ESTA 4I8LA 2XXLA 3A86A 1T4UH 1GI2A 1QGFA 2CHAB 1GHZA 3A7TA 7ESTE 5F6MA 2AMQA 2ZDMA 1NFUA 1QR3E 4ABEA 1V2RT 1H9HE 2LNCA 2TPIZ 1V2VT 5A8XA 3PTBA 1TGCA 1GJBB 3E1XB 1T32A 3LONA 3EDXB 5EOKA 1B5GH 2SGAA 2ZHQH 1VITH 1F0SA 1LMWB 3GICB 1BIOA 5AVDA 2ZCKP 3T5FH 2KAIB 1FONA 4E05H 1IQHA 3MH6A 1SGRE 2C3SA 1QA0A 1DWEH 4YLQH 5AF9H 2BDHA 4A6LA 2G5NA 4X1NU 3ATLA 4INKA 1WUNH 2OD3B 1OWKA 3TIUA 2J9NA 1G2LA 4DCDA 1WTGH 4UFFH 1ZPBA 2FS9A 2YNBA 1AUJA 1MCTA 1SGTA 2GDDA 3L3TA 1AVXA 5CHAC 1C1VH 4Q7XA 3EYDA 2BY6X 2NU2E 2VVUA 3FZDA 1N8OB 5F8TA 5C1YA 3SHCH 1BDAA 4X2XA 3M61U 1CHGA 2WV5A 2GT7A 2IN2A 3F1SB 2A31A 2VIQA 2P93A 1YCPH 2Q6GA 1MU6B 2ANYA 1TPOA 1KLJH 2ZFFH 1P57B 1KSNA 1ZJDA 4MPVA 4R8TB 1GHAG 2RCEA 2BOKA 1UHBA 1EPTB 2GD4B 1PJPA 1O34A 1T8MA 3LGWA 1YPHE 2A4QA 2W3KA 4ABGA 4WY3A 1G36A 3P17H 2ZHEH 4IMZA 5FHTA 3OY6U 1NY22 3U98H 3MOCA 1NRQH 2G8TA 1K1LA 4DURA 1P2MA 4JK5A 1GG6C 4Y11E 5JDUB 2CF9H 4XBCA 1QURH 1O5CB 3FP8E 4OS6A 3LPRA 3SNAA 1F0UA 5LPFA 1CE5A 1XUHA 2VH6A 2G52A 2ZEBA 3A8BA 2AIPA 3DFLA 4OS7A 1BRAA 2F9BH 4ABFA 1J16A 1O3NA 2GV7A 1O2KA 3VB5A 3BEUA 3VXFH 1KLTA 1VR1H 4Y8ZA 3LGIA 3SJIA 3ZZ3A 2ZHWH 2ZCLP 3FP7E 1SLVB 3SV7A 2XC4A 1O2MA 3QX5H 3PTNA 1TNJA 1DX5M 1GHAF 4H42U 2B8OH 1OWDA 1QRZA 1LHGH 1GHYH 4TPYA 1SPJA 1PFXC 2O8LA 1O2RA 2ZDNA 4CBOA 2JH0D 1SQAA 4Q80A 1OWIA 1KXDA 1QJ6B 1ZPCA 3ATMA 3ZZAA 1O36A 5HGGA 2HNTE 2P16A 1MTUA 1P0SH 4OS2A 1GL0E 1AB9C 1K28D 1FMGA 3RMLH 1SI5H 1RXPA 2PFEA 1EATA 3U8TH 1C1WH 1O3MA 1C5VA 1ZR0A 2SGFE 1Q2WA 4UFGH 4A1TA 1SOTA 2ZPSA 2PGQB 2VH0A 3ZVDA 2BQ6B 1RIWC 3GCTG 3ZYDA 1EB1H 1UTPA 3SGQE 1TRNA 1JXPA 1MAYA 1EJMA 3U1IB 1CGIE 4NIXA 4BTIB 3SJ8A 4X6MA 2OTVA 4UONA 1OP0A 5E8EH 2WPIS 1OYTH 3E91A 2F9VA 1TA2A 4H6TA 4AG2A 4NFFA 1DFPA 3KCGH 1C2EA 1TB6H 4D9QA 5IYTA 1O2TA 4NGAH 1GI9B 1O32A 3LC5A 1V2LT 1Q31A 1ZJKA 2CN0H 2VNTA 1Z8IB 3M7UA 4INLA 2QAAA 3ZV9A 4ZXXH 3MH4A 1EZUC 3BTFE 3MO6A 1D6RA 1V2KT 1W14U 4FU9A 3D23A 4CH2B 2CXVA 2A4OA 1C5MD 3A82A 1WV7H 2GZ8A 1JIRA 4WF8A 1PQ8A 2AMPA 1SGCA 2WYJA 4DIHH 4FUDA 5EPYA 1W7XH 1IQEA 4K2YA 1UK3A 1S81A 1L2EA 1O2VA 1ZHRA 2ODYB 2DE8A 2CF8H 1V2PT 1EB2A 3KQBA 4Y8YA 2VIDA 2GGVB 1Z71A 2TRMA 1ELAA 1MTNB 1PPBH 3LT3A 4XFQA 4TWWA 1O3FA 2Z3CA 1CGHA 2QV1A 5T6GA 1Y5UT 1XVOA 2AYWA 2OXSA 2QXGA 3KQCA 3SNBA 3SV2H 1G37A 3LJJA 2OBOA 3D49H 1S82A 1EXFA 3BG4C 1ESBA 3BTME 3KIDU 1FY3A 1MKWH 3S9BA 4ZAEA 4X2YA 3BTHE 3O8RA 3RXBA 4FUFA 4A1XA 2Y6TA 2AIQA 1YC0A 5EGMA 1GBFA 5E2PA 3PO1C 2OC8A 1SLXB 4I31A 2V0BA 4FUGA 1C4V2 3MNCA 5LH8A 1S0QA 1DWDH 5CE1A 4XSKU 3ATWA 1XMNB 2G81E 1TRMA 4YTAA 1IQGA 1GBHA 2QIQA 4YESB 1P05A 1GVKB 3SUGA 4O03A 4FUJA 1YP9A 1K9OE 1UHBB 1GJ8B 4JZFH 4B76A 1BRUP 5EXNA 4FVDA 5GPIB 2HGTH 1HGTH 3LH1A 2OUAA 3H7OA 3IITA 3BTEE 4Y0ZE 3UTUH 4E06H 3SJOA 2PHBA 1HJAB 1O2YA 3MH5A 3ZVFA 1CT4E 1QFKH 4K1EA 4YZUA 1SVPA 4CRAA 4FU8A 5IDKA 4RSPA 4KP0A 1UTQA 2VIVA 3A7ZA 1LO6A 2ZGCA 2WUCA 5BPEA 4FUBA 3MO3A 1B7XB 4B74A 4I8KA 2FODA 2C93B 2OINA 3RXCA 2FX6A 1KXAA 2ZTYA 4CRCA 4UDWH 3B8JA 2ZDVH 1FNIA 1W2KH 1LPKB 5I25A 1DVAH 1ELVA 3T26A 1K22H 1QTFA 1C2LA 1GMCG 2EA3A 2V6NA 3BIVH 1UCYK 3STIA 1TNKA 1UTLM 5CHAB 3UPEA 2BD9A 1V2WT 3PM3A 2FDAA 1CBWC 2FYRA 1DXPA 3LKWA 1TRYA 5JBTA 3MFJA 1ZSJA 2DE9A 2Z7FE 4YOGA 1FAXA 2PKSC 2QF0A 1P2KA 2V3OH 2XYAA 4UFDH 2VWNA 1Z6EA 4O9VA 1KXCA 2BZAA 1K1OA 2YNAA 1UVUH 3RLYH 1O3CA 1EOLA 1SGFG 1TBZH 1GHWH 2G55A 2PTCE 1BTZA 5TCCA 2ALPA 3TU7H 1C5OH 1FZZA 4YLUA 1HV7A 2QC2A 1AFQC 3A85A 3EQ0H 3GY2A 3E16B 1C5WB 1GI6A 1AKSB 1TYNA 1GGDC 3A88A 1SLUB 3Q3YA 1THSH 5FPYA 4JYVH 1RGQA 1TOCB 1YBWA 1YPKH 3TPIZ 3M3VA 1GG6B 2ZU5A 3A7YA 2C4FH 1GDQA 5J4QA 3I77A 2XWBI 2GV6A 5DP5A 1A3EH 4GPGA 2NU4E 3OTJE 1V2OT 4JMYA 1S6FA 3V13A 1A5GH 1GBCA 1GMHG 3UOPA 1NROH 2EI6A 3ZZ5A 4ZHLU 3F9EA 5JBCS 1IOEA 1ZTLA 3HPTB 2OC7A 3GYMA 1ANCA 2ZG0H 4ZH8A 2OP9A 3KL6A 4U30A 1JRTA 3ZZ9A 1LVMA 1O2OA 1TMBH 1TQ7B 1W10U 4E7NA 1BTXA 1GBBA 1XXDA 2ULLA 4YOJA 2WUBA 3DUXH 1NTPA 3VB4A 2UWOA 3ENSB 4NSYA 2VWOA 3U8OH 1HJ9A 1K1MA 1EX3A 3VEQB 2SNVA 1TONA 1RJXB 2G5VA 1P3CA 2GCTC 3RXUA 1ZMNA 5JB8S 3M5NA 4Y7BA 3LGUA 3ZVCA 1WQVH 1C1UH 5FX6A 3V3MA 5EQQA 5JYIA 1AB9B 1ZMLA 1ETTH 2BD4A 3GYLB 1HAGE 2XCNA 2NWNA 3M5MA 5T6DA 1AI8H 1TX6A 1GHVH 1RIWB 3PV4A 3RXVA 4AYYB 2GVFA 2BDGA 2ZIQH 1FPCH 1W12U 2ZU3A 3ZZ8A 2OQ5A 1DLEA 3HGNA 4JZEH 1Z8RA 4ZXYH 3MWIU 1OXGA 1GMHF 2BD3A 2P3TB 1OWHA 2PKAA 2JH5D 5AFZH 2QF3A 1P04A 4NA9H 3HK3B 1FPHH 1TBRH 3HATH 2XW9A 1KIGH 4YT6H 7LPRA 2GP9B 1G32B 1XXFA 2RA0A 2H9TH 1CHOF 1BJVA 3DFJA 1GI3A 1IQJA 1TGSZ 1Y3XA 2Q1JA 3TVJB 1E36B 5B6OA 1XVMA 2H1UA 1BMAA 1C4Y2 2THFB 4WWYA 1KXFA 1JMOH 1HDTH 2HPPH 2FEQH 2VJ1A 4Y71A 5K0HA 1LKAA 1F5KU 1QA7A 2D2DA 1DITH 4MG3A 5A0BA 1XM1A 2F9NA 3SO3A 3RXIA 4LK4A 3K65B 2XBVA 2JH6D 1BBRE 2ASUB 1GBEA 3KEEA 5DP7A 1LCYA 1C5UA 1IHSH 4YO9A 1BRBE 1ELTA 3ATIA 3PLPA 1BRCE 4I8GA 4MPXA 2WV4A 2C8XB 5EU8A 1EOJA 1Z1IA 5I46H 2OC0A 1G3EA 1BTHH 2C8ZB 3SV6A 4FUHA 2BLWA 1PPHE 1MQ5A 4CRDA 2NU1E 3NPSA 2K1QA 4I8HA 1JOUB 2VGCB 2M5TA 4UE7H 1PYTD 5E0JA 1ZTJA 3PMAB 4WJG2 1GBJA 1QJ7B 1GJAB 5A2MH 2A7CA 1FY1A 1C5YB 1TNLA 3A7VA 4IN1A 1OS8A 1O5AB 8GCHG 1C2IA 3TH3H 3LIWA 1G3BA 4GAWA 4U01A 4K69A 3RC5A 3T2NA 4GVUA 3BG4B 1LVBA 4X2VA 2ZPRA 3BTGE 4ABHA 1O2ZA 1O39A 1CGJE 1JBUH 4B75A 5FXLA 3AW1A 4A5TS 3DT0H 1C2HA 3PO1B 1HJAC 3NK8A 3PB1E 5AHGH 3ZZDA 2BX3A 3UNRA 1SGFA 4AZ2B 1D3TB 2NU0E 4DW2U 1O31A 1HXEH 1X7AC 3SGAE 3RXEA 1AWHB 1O5BB 5C3NA 4ZHMU 3FAOA 1C4U2 1YPJH 4AGJA 2FM2A 4X8SH 6GCHG 1NZQH 3UQOA 1C2JA 1HAXB 1C5LH 5F8ZA 2ZZUH 2ZKSA 3E6PH 3RXFA 2VB0A 4XDEA 3F6UH 5EQRA 3GY7A 1L0ZA 3CENA 4JYTA 1SFIA 1HXFH 1YPGH 3BN9A 2Q6DA 1K1IA 2I6QA 1C2FA 2C8YB 1QL7A 1Y3WA 1QL9A 2AMDA 3UQVA 1O2GH 9ESTA 3TITA 1VGCC 1U6QA 1QQUA 1QY6A 2BXUH 1RTLA 5H4IB 1W0ZU 1P8VC 2UWLA 1P02A 1J14A 5DP8A 1NRPH 1NO9H 2YOLA 1HNEE 5E2OA 4K8YA 8GCHF 5GCHG 1G2MA 1QJ1B 2D8WA 4IW4E 4KTUA 1GPZA 4IMQA 4GCHG 3VB3A 1UVOA 1ZTKA 5K7RA 3AVZA 2BY9X 4TYDA 3TNSA 3GISB 2R2MB 2VWMA 3RC6A 3TGJE 2A4RA 1A0LA 3KN2A 2GMTC 6CHAC 3GDVA 3N7OA 1CBWB 1NT1A 4YT7H 4X6PA 4ABAA 1S0RA 6LPRA 1DANH 6GCHF 1FN6A 1HAVA 2PKSB 2ZFRH 2B7DH 3D65E 3SNCA 3W95A 1HFDA 2F9OA 1PPCE 4FUCA 3PLBA 2R0LA 1J9CH 4ISLA 1ARBA 1BTPA 3MU0A 4BTUB 3EA8A 3TK6A 4YOIA 1O3BA 1ZHMA 3S69A 1RFNA 1GI7B 2ZECA 1O38A 4JZDH 1Y59T 1LVOA 1AFQB 2SGQE 1TNHA 5AFYH 1GGDB 3L33A 4B2AA 1UVTH 1P2OA 3GDUA 1CT2E 5GCHF 4NWLA 3BTDE 1ANBA 4AYVB 1DS2E 3ZZ7A 1A0HB 1THRH 1A5HA 3LDXH 1G30B 4F4OC 3DHKH 1L1NA 1BMLA 3U1JB 1DXWA 1FUJA 2Z9JA 2RG3A 4UFEH 2VIPA 2BTCE 1LDTT 1TLDA 1PPFE 1NS3A 3ZZ4A 1MZDA 4NZQA 3ZVAA 1GI4A 1BUIA 1MBMA 3QGNB 1GVZA 1LQDB 3EE0B 1QB9A 4FUIA 3S7KB 1P10A 2GKVE 1PPZA 2EI7A 3SUFA 1C1QA 4MVNA 1AE8H 5L30H 5DJ7A 2A32A 3M36A 5C20A 3SW2B 3BTTE 4CR5A 5ABWA 1O2UA 4X8TH 2A2XH 3OSYA 4NG9H 4DOQA 1XUIA 1VCQA 1DSUA 1VITG 1GBTA 4OS1A 1TWXB 3LC3A 1P09A 5A8ZA 1W3CA 1DSTA 1RS0A 4CREA 1DUAA 4NIVA 2FI4E 1VJAU 3RXMA 2FOAA 1C5NH 3RXSA 4I8JA 1MTVA 5EQSA 2GCTB 1SMFE 4FXGH 2AGIX 3A83A 5JB9S 1F5LA 2ANKH 4CRFA 1GI8B 3BEFB 2WPJS 2Y80A 2D1JA 4MNYA 3EAJA 4MQAA 2J34A 1Z1JA 3RMNH 1PPGE 1EZQA 3UOUA 1SL3A 1ZRBA 3URCA 1FJSA 1O30A 2AGGX 1T8LA 1V2JT 1DY9A 1SGEE 3UREA 2QY0B 1SBWA 3Q3KA 5E0GA 1KXBA 4YM9A 4K1SA 2BMGB 2W26A 3A81A 1NRRH 4MDSA 1TA6A 1DLKB 3SNEA 3ZVEA 4K60A 1ELGA 3MMGA 2R3UA 5HMAA 3RXPA 1ELFA 1K1NA 1D3DB 2J38A 4RKJB 1T31A 1D9IA 5T3HA 1GI1A 5C5NA 2FESH 2BD8A 5T6FA 5DPAA 3MTYA 1BJUA 2XC5A 3M3TA 1O3PB 2H9EH 2VGCC 3MH7A 4AGKA 1C1OA 3GCTF 5HM2A 1IHTH 3EA9A 3TJVA 4B1TA 1GMDG 2QGRA 2A7JA 3UWJH 1G3CA 1GBAA 2ZI2H 1UCYH 1BMMH 1OX1A 4A92A 1ACBE 4CRGA 1PPEE 4KKDA 2SGEE 1UMAH 3A8DA 1OSSA 1SB1H 1O2QA 2XTTB 1GCDA 1FAKH 4TWYA 1EP6A 4AB8A 1MD8A 2OQUA 1T8OA 1IAUA 3A80A 1BT7A 2PTNA 1V2ST 2VIOA 1TBQH 3F68H 1ANDA 1O2NA 1E37B 2H6MA 1O2LA 1CU1A 5ESBA 3GY8A 1WYKA 3VB7A 1LHDH 4X0WU 2ZNKH 4XBDA 5SGAE 1SG8B 2UUKB 3ODFA 1UVPA 2LPRA 1AVWA 2FTMA 1O5EH 3FANA 1S83A 3KNXA 3TH4H 1MMJN 4BTTB 1XX9A 1WSSH 1AO5A 4K8BA 2ZU4A 1HAPH 2PW8H 1O3AA 2XBWA 1SGPE 1FIZA 1EZSC 3CP7A 4GHTA 1O2WA 4X1PU 3TK5A 2FOGA 1EKBB 1Y3UA 3ZYEA 2A45B 2ZC9H 3M5LA 2B5TB 3RP2A 3T29A 4LOYH 1Y3VA 4Q7YA 2BDAA 1Z8GA 1MD7A 3Q00A 2Z9KA 2O8WA 4OGXA 2FS8A 1N6XA 3KHVA 3CS0A 1EAIA 1S85A 3OY5U 1IQFA 5DKMA 4Y0YE 1ZGVA 1KDQA 1ZSKA 1VGCB 2CGAA 2ZA5A 2Y7ZA 4GHQA 1FY4A 1A46H 2FPZA 4AB9A 1E34B 1LHEH 2HOBA 2Y82A 3RXOA 2GT8A 1QIXB 2FI5E 3P92A 1Y5BT 1LVYA 1SGNE 5DP9A 3BSQA 4BOHA 1WCZA 3LGYA 2BDIA 3SU1A 4WH6A 1LKBA 3MYWA 4X8UH 5ESTE 1GBMA 1GHBG 3UNSA 3UIRA 4Q2KA 1TNIA 4TY6A 5A0CA 1TABE 2ZF0H 3JZ1B 2VIWA 1HLTH 1O5DH 2FIRH 2WPLS 4GLYA 4UD9H 5GXPA 1SHYA 4INHA 1F5RA 4X6OA 4O3UA 2A5KA 4AX9H 1MBQA 4R0IA 2GMTB 1SQTA 3A89A 3QK1A 2PUXB 2GTBA 2Z94A 3K2UA 3HGPA 3SV8A 1LHFH 6CHAB 1ZLRA 1BQYA 1T4VH 1PQAA 5FAHA 2PR3A 4D7FA 3GY4A 3SOSA 2XRCA 2AGEX 2P3UB 1ETSH 1WOFA 3VXEH 1AZ8A 3SU6A 1CA8B 1IQMA 4Z0KA 2SGDE 4ZROA 2C8WB 3P6ZB 2WPHS 1J17T 3BIUH 9LPRA 1XKAC 4X1SU 1UTMA 1C1SA 1C5XB 1GMCF 3OU0A 3BF6H 4TY7A 1KLIH 1ZRKA 1O5FH 1RTKA 2Y5HA 1P11E 1BHXF 3LGTA 2RDLA 2XWAA 3PWCA 2BVXH 1NRSH 3LGVA 5L2YH 3L6PA 1KYNA 1FN8A 1F0TA 4UEHH 1F92A 1AMHA 3M35A 1SR5C 3ZVGA 1GHBF 1ELDE 1O2HA 3QUMP 1NFWA 2FLBH 1H4WA 2ANMH 2WYGA 5L6NH 4ZKNU 3QO6A 1C1RA 2O8TA 1N6YA 1XUKA 4X2WA 2F91A 1TX8A 5BRRE 1SGIB 2W5EA 4DGJA 3NKKA 1GHXH 5JBBS 3IWMA 1BZXE 1EUFA 1EZXC 2Z9IA 1EPTA 4RKOB 1C5TA 3ODDA 5EW2H 2ZFTA 1SQOA 4D76A 3BV9B 5CMXH 4X1RU 5LPEA 3BTQE 3O8BA 4AG1A 1TGBA 4B71A 4TPIZ 3F9GA 1UVSH 4ABIA 2PV9B 1NFXA 2ZDLA 3HKJB 1OWJA 2FWWA 1Z8JB 1V2UT 1DY8A 2CMYA 3E0PB 1K2I1 3DD2H 1ZMJA 1E35B 1C9PA 4BXWA 4DVAU 1ZYOA 1JIMA 1QRXA 3IG6B 2J95A 3P70B 2PSXA 2AFQB 1G3DA 4HTCH 1TE0A 1SLWB 2HALA 2P8OC 3RXGA 4BAQB 2TGAA 1ZGIA 2Y7XA 2F3CE 1O2JA 2Z6BD 4FUEA 3P8GA 3UR9A 4ISIH 1TIOA 1TPSA 3A84A 2F9UA 1B0FA 4DY7B 4K1TA 3RC4A 1J15A 3QLPH 2CV3A 1C5ZB 1P3EA 1IQLA 1QHRB 2ZHFH 1FLEE 3TLOA 4MNVA 3SU4A 4I7YH 1H1BA 3I29A 1XKBC 1OOKB 2AEIH 2D26C 3K9XB 4PROA 3MNSA 1EAWA 1EP5A 1ANEA 2TGDA 1FIWA 3GCNA 4OS4A 1BBRK 3NCLA 4DJZB 2ZDKA 1HAYB 2FOMB 1GVLA 1TFXA 2AH4X 1P06A 1HB0B 2WPMS 4Y10E 1AHTH 1HUTH 2FX4A 3AASA 4KGAA 3ZZCA 2B0FA 4BANB 1SOZA 5DO4H 2BDBA 2BLQA 1QB6A 1ID5H 3UWIA 2BQWB 2BLVA 1QB1A 1A4WH 4J1YA 1ZPZA 5F8XA 3F9HA 1D3QB 4B2BA 3FZZA 4SGAE 3TGKE 4LXBH 1E0FD 1C1MA 3BTKE 1GI0A 3H5CB 4THNH 8ESTE 2UUYA 3RU4E 4OS5A 1BTYA 2ZHDA 4U32A 1OP2A 1J8AA 3MNBA 4FVBA 5EODA 1UTKA 1YLCA 2TGPZ 2ZQ2A 2V3HH 2IOTA 5HM9A 1DUEA 3CS7A 2JETB 3SU5A 1MKXK 1HPGA 1GJ5H 4AOQA 1YPMH 1Y3YA 2P95A 3E8LA 1OWEA 1NU7B 5C1UA 3JZ2B 3S9AA 1D6WA 4JK6A 2SGPE 3BTWE 1A2CH 1AWFH 1PQ5A 2TGTA 4K3JA 2EC9H 2TBSA 1AZZA 1O3KA 1UJ1A 2J92A 5FX5A 4CHAC 1O3DA 1P01A 3M7TA 2FXRA 3RXKA 5FPSA 4A1VA 1NFYA 2W3IA 1C9TA 3A87A 4XOJA 2HWLB 2ZPQA 1RRKA 1BMNH 2G4UA 1D3PB 3KQDA 3PWBA 2BVRH 1DICA 4Y6DA 4NA7A 3S9CA 3EGKH 2G00A 4AFQA 8KME2 1C1PA 1F0RA 1OPHB 2Y5GA 3Q77A 1CT0E 4H4FA 1YPLH 1OYQA 2PUQH 3ZZBA 2F83A 3SUEA 1UTJA 4BNRA 2BM2A 3A8CA 4MTBA 2AS9A 3RXLA 1FY8E 1TOMH 4ZKRU 1JRSA 2FLRH 3Q3XA 3FVFB 1YPEH 4ISNA 2BQ7B 1MZAA 4M7GA 3ZVBA 3TJNA 2BZ6H 3PMHB 3RUOA 1EJAA 1A7SA 3A8AA 3QDZB 1GBKA 1VCPA 1LPZB 3RXJA 2EEKA 3SUDA
chains in the Genus database with same CATH superfamily
2BD5A 3GCHC 1K1JA 5EXLA 4IGDA 1W7GH 1HRTH 1O35A 1AIXH 4AFZA 1L1JA 3PMJA 5HYOA 1KY9A 3RXRA 2SNWA 7KMEH 3V7TA 1QBOA 1O2SA 1TGNA 5JBAS 1WQSA 1KTTB 4K5ZA 1SC8U 3UUZA 1KXEA 3NXPA 4Y7AA 3QTOH 4Y8XA 1E38B 4JCNA 1QQ4A 5EXMA 3T25A 1CA0C 4Y76A 2L6OA 5J4SA 4AORA 2IJOB 2PP6A 5F03A 1ELEE 3PRDA 3V12A 3RLWH 4MPUA 4BXSA 1HAIH 3SI4H 1L4DA 2PLXA 1VCWA 1P9SA 2OBQA 5EPNA 4ABDA 1DDJA 3S0NA 1WBGB 5PTPA 2JDID 2HVXA 3QZRA 3STJA 4GUXA 4LZ1H 1C5RA 3HK6B 1MUEB 1W0YH 2FOEA 3F2FA 1AGJA 4H6SB 1YKTA 5C1XA 3NRLA 1BTUA 1QBNA 2PGBB 3R3GB 1O5GH 1BA8B 2A7HA 2PKAB 2VU8E 1DM4B 1QL8A 4GCHF 5C67A 4JZIA 1O2XA 4D7GA 3OTPA 5GIBA 2HLCA 3UFAA 1GWAA 1O3HA 2FOHA 2WPKS 5ETXA 4B73A 3N99A 1KTSB 3E0NB 5A8YA 1EAUA 2ILNA 5JPMH 3SU2A 4VGCC 2BX4A 1SGYE 3ESTA 3D62A 2PWXA 1H8IH 1AE5A 1ZOMA 2ZGBH 3M3SA 1NRNH 1O2PA 5E0HA 1GI5A 1ABJH 1AU8A 1D4PB 1NM6A 4Y79A 4WMDA 3GCOA 4NIYA 3LU9B 1GJ6A 1TAWA 3B9FH 1YYY1 1MCVA 2WINI 1CO7E 4ISOA 1GBDA 2JKHA 3H09A 4MPWA 4NFEA 3BEIB 4FU7A 1TPPA 1DPOA 1YCPK 1WAYB 1MU8B 4X1QU 3VGCC 3LJOA 4RN6A 4IC5A 5IK2D 4DIIH 1GJ7B 1W11U 2ZGHA 4ZKOU 1O33A 1EJNA 1THPB 2W6JD 1FXYA 1C5SA 3P8OA 2UWPA 1A3BH 2FOCA 2A2QH 1AKSA 5GNDA 1MAXA 1V3XA 1ABIH 2STBE 1ZHPA 3NZIA 2BOHB 3MQKC 1AQ7A 4J2YB 3RM0H 2BY8X 1TPAE 1FDPA 3V0XA 2QXHA 8LPRA 3P95A 3U8RH 1H9LB 1LPGB 2GZ7A 3SZNA 3TJOA 2STAE 2Q6FA 2ZTXA 1XUJA 2C90B 2OC1A 3SBKA 1GDNA 1LQEA 1BHXB 1FY5A 2WPDD 4KELA 2J4IA 3GY5A 5FCKA 3UNQA 1Z6JH 2KZ4A 1H8ED 1ELCA 1P2NA 4KTCA 1DT2A 1H8DH 1XUGA 2Z3DA 3MU1A 4F49A 2P8OB 5EG4A 1AD8H 1LHCH 1TQ0B 1DWBH 3O8DA 1GCTB 1CSOE 2PSYA 1C2GA 2ALVA 3SJKA 3GY3A 1V2TT 2P3FH 3Q76A 4NZLA 3ZIAD 1DOJA 3SI3H 3VPKA 2ZGJA 3C1KA 1RD3B 1SHHB 1PQ7A 1VITF 2Y81A 4AFUA 2W7SA 5TJXA 1A1RA 1ORFA 1YPHC 2BHGA 3MO9A 2I6SA 4FOUC 2QXIA 1NN6A 1UTOA 1GBLA 2F9PA 4IS5A 1AVGH 5LGOA 3WW7A 4O3TA 4ESTE 4JYUH 1OP8A 5HXFA 1FV9A 2IPHA 2OK5A 2VWLA 1ELBA 4P00A 3UB0A 2JETC 1QCPA 1Y5AT 2BXTH 1C5QA 3M7QA 3T27A 1HIAA 1N1LA 2ZU2A 1EQ9A 2AERH 2H5DA 3B23B 4XRNA 5DK1A 4X8VH 1AN1E 2HNTF 2FOBA 2BD2A 3ATKA 2ZQ1A 4DT7B 1OKXA 1CQQA 3E90B 1L4ZA 3QN7A 1EAXA 4BAKB 2O8UA 3F0PA 1P03A 5GJ4B 4ISHH 2CHAC 1TNGA 1O3IA 3SNDA 2QYIA 4WVPE 1YLDA 4WXIA 5C0TA 3TK9A 3BG8A 2R0KA 2RA3A 2NU3E 3K6YA 4O97A 1ZSLA 2SFAA 2HRVA 4DG4A 1HAZB 2O8MA 3DCLA 5DP3A 2ODPA 1PYTC 1NPMA 1LTOA 4IN2A 2BVSH 1HAVB 1HJ8A 1MTSA 4E7RG 1AFEH 3PROA 2GZ9A 3W1EA 3SU0A 2B9LA 1C2MA 3O8CA 2ZDAH 4MLFB 3DSGA 1GMDF 3MU4A 2A5IA 1YWUA 3SU3A 4CHAB 2Z9LA 4ASHA 2HNTC 3TJUA 3AAUA 1IQNA 2A0QB 2UUJB 4HZHA 1NESE 3P8NA 1W8BH 1V2QT 3MNXA 1TX7A 1O0DH 2ZFPH 1V2NT 2XNIA 3AAVA 5DG6A 1SFQB 2M2AA 3U69H 1BB0B 1BOQA 1T8NA 1K1PA 1C1NA 4Q7ZA 1N8OC 2J98A 1AUTC 2GDEH 2FTLE 3T62A 2J2UA 4NWKA 1DE7H 2FOFA 1TALA 1P2JA 4AFSA 1GBIA 4NIWA 5A0AE 1Y8TA 1WTHD 4HFPB 4ZCNA 3FN8A 3GDSA 5DP6A 4XBBA 3QZQA 3SORA 4BAMB 3SQEE 1TGTA 3KF2A 3P8FA 1UCYE 3DA9B 1EPTC 4MNXA 4HI3A 1ARCA 1DWCH 3A7WA 1HYLA 2H5CA 3OX7U 4IBLH 1GDUA 3TGIE 1YY3A 4D8NA 1GL1A 1SQRA 1MKWK 1O3LA 4GSOA 2ZFQH 3GCHB 1GJDB 4CH8B 1UO6A 2QXJA 5C5OA 1BTWA 5GDSH 3VFEA 2FZZA 1GJ9B 2BDCA 4Q4LA 5TCAA 1A61H 2IPQX 4JZ1A 2QCYA 3OYPA 2KAIA 2O9QA 4D9RA 2OLGA 1ETRH 3PRBA 2Z3EA 3RU4D 1C2KA 1YGCH 1CA0B 3RMMH 2ZWLH 4NA8A 2BB4A 2ZU1A 3AW0A 3ZZ6A 3RXDA 2HVYB 5FBIA 1UK4A 7GCHG 2R3YA 1JWTA 2GJGA 1UTNA 4ZKSU 4CR9A 3PLKA 3G01A 2VINA 4BAHB 3WY8A 1EASA 3SN8A 2QA9E 3QGJA 1L1GA 2CK3D 1ESAA 1P2QA 2FO9A 2EI8A 1GJCB 4I86A 1QNJA 3E3TA 2VVCA 1S84A 2XBYA 3KGPA 1A5IA 5FCRA 3RXTA 3UR6A 4WMFA 3MU8A 3SV9A 2ZP0H 2H2ZA 3PMBB 1BBRH 1WU1A 1O3EA 1O3OA 3FFGA 1SGDE 2A4GA 1G9IE 4KTSA 2ZO3H 1C1TA 3VB6A 2A1DB 2ZTZA 2ZGXH 1RTFB 1S5SA 1CHOG 1O3JA 1VJ9U 1C5PA 2XBXA 2W7UA 3URDA 3SJ9A 3TH2H 2GCHG 5A09A 4U2WA 1UK2A 5FPTA 1BCUH 4VGCB 1O2IA 1Z7KA 4IC6A 4NCYA 3M37A 2P94A 4ZMAH 1T7CA 3SGBE 4BAOB 3U9AH 1FQ3A 3K6ZA 3TNTA 3UY9A 2ODQA 3SQHE 1H8HD 2ZCHP 4ZHAA 3QTVH 3HKIB 1MTWA 1P9UA 2BLOA 3LOXA 4ZUHA 2V35A 1O37A 4CBNA 2BDYA 4OGYA 2G51A 7GCHF 3EA7A 1C2DA 4ABBA 1XUFA 3VGCB 2BD7A 1MKXH 1F2SE 1W13U 1H9IE 1V2MT 4XE4A 1HIAB 3FP6E 2R2WU 1QRWA 3RXHA 2FI3E 2XC0A 2BY5X 1K21H 3I78A 5L2ZH 1ZZZA 1GCTC 2GX4A 4B2CA 1HAHH 3RXAA 1INCA 3ITIA 4WH8A 5GWZA 1NC6A 2H9HA 2FP7B 1TMUH 4HGCA 4I32A 3ELAH 2R9PA 2A5AA 2DUCA 3MHWU 1NU9A 6ESTA 1MH0A 4WMEA 3F9FA 3GY6A 4F55A 2HPQH 5LPRA 2OCVB 1GJ4H 3H7TA 1O3GA 1YM0A 3RMOH 3T28A 1CVWH 3M5OA 3MU5A 3A7XA 3RU4T 2ANWA 4Z6AH 2GCHF 1SGQE 2J94A 5FBEA 1FI8A 3KQEA 2FYQA 1MQ6A 1HAOH 3NUMA 4AN7A 1VZQH 2UUFB 1B0EA 4SGBE 3UAIC 1QBVH 1SSXA 5EJLA 3PV5A 1MTNC 1HCGA 2BYAX 2BY7X 3PYHA 2FMJA 3MI4A 1S6HA 1F7ZA 2G4TA 3QWCH 1HBTH 2VVVA 2Z9GA 5G4BA 1M9UA 1YCPM 3RM2H 2CJIA 2Y5FA 3ZV8A 2QN5T 4CRBA 2P59A 4MNWA 3SHAH 2ZFSA 2XCFA 2TIOA 1YF4A 3FKSD 1V6DA 3LH3A 1KDQB 1P12E 3R0FA 1AY6H 4LZ4B 2ESTE 1IQIA 4WXVA 3GOVB 2J98B 3C27B 4QT8C 2QE7D 4A7IB 3NWUA 4ABJA 5EW1H 1Q3XA 1BITA 4I33A 5DP4A 5C2ZA 1IQKA 3W94A 1A0JA 5DGJA 1TMTH 3RXQA 5HIZA 3S7HB 3RDZA 4X6NA 4NSVA 1P2IA 1ESTA 4I8LA 2XXLA 3A86A 1T4UH 4B6EA 1GI2A 1QGFA 2CHAB 5B6LA 1GHZA 3A7TA 7ESTE 5F6MA 2AMQA 2ZDMA 1NFUA 1QR3E 4ABEA 1V2RT 1H9HE 2LNCA 2TPIZ 1V2VT 5A8XA 3PTBA 1TGCA 1GJBB 3E1XB 1T32A 3LONA 3EDXB 5EOKA 1B5GH 2SGAA 2ZHQH 1VITH 1F0SA 1LMWB 3GICB 1BIOA 5AVDA 2ZCKP 3T5FH 2KAIB 1FONA 4E05H 1IQHA 3MH6A 1SGRE 2C3SA 1QA0A 1DWEH 4YLQH 5AF9H 2BDHA 4A6LA 2G5NA 1W0JD 4X1NU 2J5UA 3ATLA 4INKA 1WUNH 2OD3B 1OWKA 3TIUA 2J9NA 1G2LA 4DCDA 1WTGH 4UFFH 1ZPBA 2FS9A 2YNBA 1AUJA 1MCTA 1SGTA 2GDDA 3L3TA 1AVXA 5CHAC 1C1VH 4Q7XA 3EYDA 2BY6X 2NU2E 2VVUA 2F4LA 3FZDA 1N8OB 5F8TA 5C1YA 3SHCH 1BDAA 4X2XA 3M61U 1CHGA 2WV5A 2GT7A 2IN2A 3F1SB 2A31A 2VIQA 2P93A 1YCPH 2Q6GA 1MU6B 1MABB 2ANYA 1TPOA 1KLJH 2ZFFH 1P57B 1KSNA 1ZJDA 4MPVA 2L74A 4R8TB 1GHAG 2RCEA 2BOKA 1UHBA 1EPTB 2GD4B 2V3MA 1PJPA 1O34A 1T8MA 3LGWA 1YPHE 2A4QA 2W3KA 4ABGA 2KR7A 4WY3A 1G36A 3P17H 2ZHEH 4IMZA 5FHTA 3OY6U 1NY22 3U98H 3MOCA 1NRQH 2G8TA 1K1LA 4DURA 1P2MA 4JK5A 1GG6C 4Y11E 5JDUB 2CF9H 4XBCA 1UW7A 1QURH 1O5CB 3FP8E 4OS6A 3LPRA 3SNAA 1F0UA 5LPFA 1CE5A 1XUHA 4F48B 2VH6A 2G52A 2ZEBA 3A8BA 2AIPA 3DFLA 4OS7A 2KX4A 1BRAA 2F9BH 4ABFA 1J16A 1O3NA 2GV7A 1O2KA 3VB5A 3BEUA 3VXFH 1KLTA 1VR1H 4Y8ZA 3LGIA 3SJIA 3ZZ3A 2ZHWH 2ZCLP 3FP7E 1SLVB 3SV7A 2XC4A 1O2MA 3QX5H 3PTNA 1TNJA 1DX5M 3F0OA 1GHAF 2WZQA 4H42U 2B8OH 1OWDA 1QRZA 1LHGH 1GHYH 4TPYA 1SPJA 1PFXC 2O8LA 1O2RA 2ZDNA 4CBOA 2JH0D 1SQAA 4Q80A 1OWIA 1KXDA 1QJ6B 1ZPCA 3ATMA 3ZZAA 1O36A 5HGGA 2HNTE 2P16A 3OFND 1MTUA 1P0SH 4OS2A 1GL0E 1AB9C 1K28D 1FMGA 3RMLH 1SI5H 1RXPA 2PFEA 1EATA 3U8TH 1C1WH 1O3MA 1C5VA 1ZR0A 2SGFE 1Q2WA 4UFGH 4A1TA 1SOTA 2ZPSA 2PGQB 2VH0A 3ZVDA 2BQ6B 1RIWC 3GCTG 3ZYDA 1EB1H 1UTPA 3SGQE 1TRNA 1JXPA 1MAYA 1EJMA 3U1IB 1CGIE 4NIXA 4BTIB 3SJ8A 4X6MA 1NBMD 2OTVA 4UONA 1OP0A 2IJD1 5E8EH 2WPIS 1OYTH 3E91A 2F9VA 1TA2A 4H6TA 4AG2A 4NFFA 1DFPA 3KCGH 1C2EA 1TB6H 4D9QA 5IYTA 1O2TA 4NGAH 1GI9B 2WSSD 1O32A 3LC5A 2LP6A 1V2LT 2JJ1D 3N7EA 5DSFA 1Q31A 1ZJKA 2CN0H 2VNTA 1Z8IB 3M7UA 4INLA 2QAAA 3ZV9A 4ZXXH 3MH4A 1EZUC 3BTFE 3MO6A 1D6RA 1V2KT 1W14U 2YMSD 4FU9A 3D23A 4CH2B 2CXVA 2A4OA 1C5MD 3A82A 1WV7H 2GZ8A 1JIRA 4WF8A 1PQ8A 2AMPA 1SGCA 2WYJA 4DIHH 4FUDA 5EPYA 1W7XH 1IQEA 4K2YA 1UK3A 1S81A 1L2EA 1O2VA 1ZHRA 2ODYB 2DE8A 2CF8H 1V2PT 1EB2A 3KQBA 4Y8YA 2VIDA 2GGVB 1Z71A 2TRMA 1ELAA 1MTNB 1PPBH 3LT3A 4XFQA 4TWWA 1O3FA 2Z3CA 1CGHA 2QV1A 5T6GA 1Y5UT 1XVOA 2AYWA 2OXSA 2QXGA 3KQCA 3SNBA 3SV2H 1G37A 2JIZD 3LJJA 2OBOA 3D49H 1S82A 1EXFA 3BG4C 1ESBA 3BTME 3KIDU 1FY3A 1MKWH 3S9BA 4ZAEA 4X2YA 3BTHE 3O8RA 3RXBA 4FUFA 4A1XA 2Y6TA 2AIQA 1YC0A 5EGMA 1GBFA 5E2PA 3PO1C 2OC8A 1SLXB 4I31A 2V0BA 4FUGA 1C4V2 3MNCA 5LH8A 1S0QA 1DWDH 5CE1A 4XSKU 3ATWA 1XMNB 2G81E 1TRMA 4YTAA 1IQGA 1GBHA 2QIQA 4YESB 5HIYA 1P05A 1GVKB 3SUGA 4O03A 4FUJA 1YP9A 1K9OE 1UHBB 1GJ8B 2RDEA 4JZFH 4B76A 4ACBA 1BRUP 5EXNA 4FVDA 5GPIB 2HGTH 1HGTH 3LH1A 3U28C 2OUAA 3H7OA 3IITA 3BTEE 4Y0ZE 3UTUH 4E06H 3SJOA 2PHBA 1HJAB 1O2YA 3MH5A 3ZVFA 1CT4E 2WHXA 1QFKH 4RT1A 4TSFD 4K1EA 4YZUA 1SVPA 4CRAA 4FU8A 5IDKA 4RSPA 4KP0A 1UTQA 2VIVA 3DSPA 3A7ZA 1LO6A 2ZGCA 2WUCA 5BPEA 4FUBA 3MO3A 1B7XB 4B74A 4I8KA 2FODA 2C93B 2OINA 3RXCA 2LELA 2FX6A 1KXAA 2ZTYA 4CRCA 4UDWH 3B8JA 2ZDVH 1FNIA 1W2KH 1LPKB 5I25A 1DVAH 1ELVA 3T26A 1K22H 1QTFA 1NBME 1C2LA 1GMCG 2EA3A 2V6NA 1EFRD 3BIVH 2K0QA 1UCYK 3STIA 1TNKA 1UTLM 5CHAB 3UPEA 2BD9A 1V2WT 3PM3A 4ACAA 2FDAA 5EJZA 1CBWC 2FYRA 2KCAA 1DXPA 3LKWA 1TRYA 5JBTA 3MFJA 3AK5A 1ZSJA 2DE9A 2Z7FE 4YOGA 1FAXA 2PKSC 2QF0A 1P2KA 2V3OH 2XYAA 4UFDH 2VWNA 1Z6EA 4O9VA 1KXCA 2BZAA 1K1OA 2YNAA 1UVUH 3RLYH 1O3CA 1EOLA 1SGFG 1TBZH 1E1RD 1GHWH 2G55A 2PTCE 1BTZA 5TCCA 2ALPA 3TU7H 1C5OH 1FZZA 4YLUA 1HV7A 2QC2A 1AFQC 3A85A 3EQ0H 3F2GA 3E16B 3GY2A 1C5WB 1GI6A 1AKSB 1TYNA 1GGDC 3A88A 1SLUB 3Q3YA 1THSH 5FPYA 4JYVH 1RGQA 1TOCB 1YBWA 1YPKH 3OEHD 3M3VA 3TPIZ 2JJ2D 4RT0A 1GG6B 2ZU5A 3A7YA 2C4FH 1GDQA 2KM0A 5J4QA 3I77A 2XWBI 2GV6A 5DP5A 1A3EH 4GPGA 2NU4E 3OTJE 1V2OT 4JMYA 1S6FA 3V13A 1A5GH 2KFWA 1GBCA 2QF4A 1GMHG 3UOPA 1NROH 2EI6A 3ZZ5A 4ZHLU 3F9EA 5F53A 5JBCS 1IOEA 1ZTLA 3HPTB 2OC7A 3GYMA 1ANCA 2ZG0H 4ZH8A 2OP9A 5T1VA 3KL6A 4U30A 1JRTA 3ZZ9A 1LVMA 1O2OA 1TMBH 1TQ7B 1W10U 3VG8A 1BTXA 4E7NA 1GBBA 1XXDA 2ULLA 4YOJA 2WUBA 3DUXH 1NTPA 3VB4A 2UWOA 3ENSB 4NSYA 2VWOA 3U8OH 1HJ9A 1K1MA 1EX3A 3VEQB 2SNVA 1TONA 1RJXB 2G5VA 1P3CA 2GCTC 2KCOA 3RXUA 1KMHB 1ZMNA 5JB8S 3M5NA 4Y7BA 3LGUA 3ZVCA 1WQVH 1C1UH 5FX6A 3V3MA 5EQQA 3N7DA 5JYIA 1AB9B 1ZMLA 1ETTH 2BD4A 3GYLB 1HAGE 2XCNA 2NWNA 3M5MA 3F3BA 5T6DA 1AI8H 1TX6A 4OM9A 1GHVH 1RIWB 3PV4A 3RXVA 4AYYB 2GVFA 2BDGA 2ZIQH 1FPCH 1W12U 2ZU3A 3GS9A 2OQ5A 1DLEA 3HGNA 4JZEH 1Z8RA 4ZXYH 3ZZ8A 3KYFA 3MWIU 1OXGA 1GMHF 2BD3A 2P3TB 1OWHA 2PKAA 2JH5D 5AFZH 2QF3A 1P04A 4NA9H 3HK3B 1FPHH 1TBRH 3HATH 2XW9A 1KIGH 4YT6H 7LPRA 2GP9B 1G32B 4P02A 1XXFA 2RA0A 2H9TH 1CHOF 1BJVA 3DFJA 1GI3A 1IQJA 1TGSZ 1Y3XA 2Q1JA 3TVJB 1E36B 5B6OA 1XVMA 2H1UA 1BMAA 1C4Y2 5C0UA 2THFB 2XOKD 4WWYA 1KXFA 1JMOH 1HDTH 2HPPH 2FEQH 2VJ1A 4Y71A 5K0HA 1LKAA 1F5KU 1QA7A 2D2DA 1DITH 4MG3A 5A0BA 1XM1A 2F9NA 3SO3A 3RXIA 4LK4A 3K65B 2XBVA 2JH6D 1BBRE 2ASUB 1GBEA 3KEEA 5DP7A 1LCYA 1C5UA 1IHSH 3OE7D 4YO9A 3OAAD 1BRBE 1ELTA 3ATIA 3PLPA 1BRCE 4I8GA 4MPXA 2WV4A 2C8XB 5EU8A 2VBCA 1EOJA 1Z1IA 5I46H 2OC0A 1G3EA 1BTHH 2C8ZB 3SV6A 4FUHA 2BLWA 1PPHE 1MQ5A 4CRDA 2NU1E 1COWD 3NPSA 2K1QA 4I8HA 1JOUB 2VGCB 2M5TA 4UE7H 4Z1MD 1PYTD 5E0JA 1ZTJA 3PMAB 4WJG2 1GBJA 1QJ7B 1GJAB 5A2MH 2A7CA 1FY1A 1C5YB 1TNLA 3A7VA 4IN1A 1OS8A 1O5AB 8GCHG 1C2IA 3TH3H 3LIWA 1G3BA 4GAWA 4U01A 4K69A 3RC5A 3T2NA 4GVUA 2WV9A 3BG4B 1LVBA 4X2VA 2ZPRA 3BTGE 4ABHA 1O2ZA 1O39A 1CGJE 1JBUH 1W0KD 4B75A 5FXLA 3AW1A 4A5TS 3DT0H 1C2HA 3PO1B 1HJAC 3NK8A 3PB1E 5AHGH 3ZZDA 2BX3A 3UNRA 1SGFA 4AZ2B 1D3TB 2NU0E 4DW2U 1O31A 1HXEH 1X7AC 3SGAE 3RXEA 1AWHB 1O5BB 5C3NA 4ZHMU 3FAOA 1C4U2 1YPJH 4AGJA 3FOAA 2FM2A 4X8SH 6GCHG 4M9FA 1NZQH 3UQOA 1C2JA 1HAXB 1C5LH 3CNRA 5F8ZA 2ZZUH 2ZKSA 3E6PH 4HG6A 3RXFA 2VB0A 4XDEA 3F6UH 5EQRA 3GY7A 1L0ZA 3CENA 4JYTA 1SFIA 1HXFH 1YPGH 3BN9A 2Q6DA 1K1IA 3KQ5A 2I6QA 1C2FA 2C8YB 1QL7A 1Y3WA 1QL9A 2AMDA 3UQVA 1O2GH 9ESTA 3TITA 1VGCC 1U6QA 1QQUA 4AC9A 1QY6A 2BXUH 1RTLA 5H4IB 1W0ZU 1P8VC 2UWLA 1P02A 1J14A 5DP8A 1NRPH 1NO9H 2YOLA 1HNEE 5E2OA 4K8YA 3F2HA 8GCHF 5GCHG 1G2MA 1QJ1B 2D8WA 4IW4E 4KTUA 1GPZA 4IMQA 4GCHG 3VB3A 1UVOA 1ZTKA 3WWFA 5K7RA 3AVZA 2BY9X 4TYDA 3TNSA 3GISB 2R2MB 2VWMA 3RC6A 3TGJE 2A4RA 1A0LA 3KN2A 2GMTC 6CHAC 3GDVA 3N7OA 1CBWB 1NT1A 4YT7H 5CDFE 4X6PA 4ABAA 1S0RA 6LPRA 1DANH 6GCHF 1FN6A 1HAVA 2PKSB 2ZFRH 2B7DH 3D65E 3SNCA 3W95A 1HFDA 2F9OA 1PPCE 4FUCA 3PLBA 2R0LA 1J9CH 4ISLA 4B6FA 1ARBA 1BTPA 3MU0A 4BTUB 5KEDA 3EA8A 3TK6A 4YOIA 1O3BA 1ZHMA 3S69A 1RFNA 1GI7B 2ZECA 1O38A 4JZDH 1Y59T 1LVOA 1AFQB 2SGQE 1TNHA 5AFYH 1GGDB 3L33A 4B2AA 1UVTH 1P2OA 3GDUA 1CT2E 5GCHF 4NWLA 3BTDE 1ANBA 4AYVB 1DS2E 3ZZ7A 1A0HB 1THRH 1A5HA 3LDXH 1G30B 4F4OC 3DHKH 1L1NA 1BMLA 3U1JB 1DXWA 1BMFD 1FUJA 2Z9JA 2RG3A 4UFEH 2VIPA 2BTCE 1LDTT 1TLDA 1PPFE 1NS3A 3ZZ4A 1MZDA 4NZQA 3ZVAA 1GI4A 1BUIA 1MBMA 3QGNB 1GVZA 1LQDB 2KCYA 3EE0B 1QB9A 4FUIA 3S7KB 1P10A 2GKVE 5HKKD 1PPZA 2EI7A 3SUFA 1C1QA 4MVNA 1AE8H 5L30H 5DJ7A 2A32A 3M36A 5C20A 3SW2B 3BTTE 4CR5A 5ABWA 1O2UA 4X8TH 2A2XH 3OSYA 4NG9H 4DOQA 4FETA 1XUIA 1VCQA 1DSUA 1VITG 1GBTA 4OS1A 1TWXB 3LC3A 1P09A 5A8ZA 3DSOA 3OEED 1W3CA 1DSTA 1RS0A 4CREA 1DUAA 4NIVA 2FI4E 1VJAU 3RXMA 2FOAA 1C5NH 3RXSA 4I8JA 1MTVA 5EQSA 2GCTB 1SMFE 4FXGH 2AGIX 3A83A 5JB9S 1F5LA 2ANKH 4CRFA 1GI8B 3BEFB 2WPJS 2Y80A 2D1JA 4MNYA 3EAJA 4MQAA 2J34A 1Z1JA 3RMNH 1PPGE 3SZEA 1EZQA 3UOUA 1SL3A 1ZRBA 3URCA 1FJSA 1O30A 2AGGX 1T8LA 1V2JT 1DY9A 3WWBA 1SGEE 3UREA 2QY0B 1SBWA 3Q3KA 5E0GA 1KXBA 4YM9A 4K1SA 2BMGB 2W26A 3A81A 1NRRH 4MDSA 1TA6A 1DLKB 3SNEA 3ZVEA 4K60A 1ELGA 3MMGA 2R3UA 5HMAA 3RXPA 1ELFA 2RFKC 1K1NA 1D3DB 2J38A 4RKJB 1T31A 1D9IA 5T3HA 1GI1A 5C5NA 2FESH 2BD8A 5T6FA 5DPAA 3MTYA 1BJUA 2XC5A 3M3TA 1O3PB 2H9EH 2VGCC 3MH7A 4AGKA 1C1OA 3GCTF 5HM2A 1IHTH 2KCPA 3EA9A 3TJVA 4B1TA 1GMDG 2QGRA 2A7JA 3UWJH 1G3CA 1GBAA 2ZI2H 1UCYH 1BMMH 4Q63A 1OX1A 4A92A 1ACBE 4CRGA 1PPEE 4KKDA 2SGEE 1UMAH 3A8DA 1OSSA 1SB1H 1O2QA 4RI0A 2XTTB 1GCDA 1FAKH 4TWYA 1EP6A 4AB8A 1MD8A 2OQUA 1T8OA 1IAUA 3A80A 1BT7A 2YMSB 2PTNA 1V2ST 2VIOA 1TBQH 3F68H 1ANDA 1O2NA 1E37B 2H6MA 1O2LA 1CU1A 5ESBA 3GY8A 1WYKA 3VB7A 1LHDH 4X0WU 2ZNKH 4XBDA 5SGAE 1SG8B 2UUKB 3ODFA 1UVPA 2LPRA 1AVWA 2V7QD 2FTMA 1O5EH 3FANA 1S83A 3KNXA 3TH4H 1MMJN 1SKYE 4BTTB 1XX9A 3EE7A 1WSSH 1AO5A 1FX0B 1VKYA 4K8BA 2ZU4A 1HAPH 2PW8H 1O3AA 2XBWA 1SGPE 1FIZA 1EZSC 3CP7A 4GHTA 1O2WA 4X1PU 2W6ID 3TK5A 2FOGA 1WDIA 1EKBB 1Y3UA 3ZYEA 2A45B 2ZC9H 3M5LA 2F43B 2B5TB 5EIYA 3RP2A 3T29A 4LOYH 1Y3VA 4Q7YA 2BDAA 1Z8GA 1MD7A 3Q00A 2Z9KA 2O8WA 2AHME 4OGXA 2FS8A 1N6XA 3KHVA 3CS0A 1EAIA 1S85A 3OY5U 1IQFA 5DKMA 4Y0YE 1ZGVA 1KDQA 1ZSKA 1VGCB 2CGAA 5KECA 2ZA5A 2Y7ZA 4GHQA 1FY4A 1A46H 2FPZA 4AB9A 1E34B 1LHEH 2HOBA 2Y82A 3RXOA 2GT8A 1QIXB 2FI5E 3P92A 1Y5BT 1LVYA 1SGNE 5DP9A 3BSQA 4BOHA 1WCZA 3LGYA 2BDIA 3SU1A 4WH6A 1LKBA 3MYWA 4X8UH 5ESTE 1GBMA 1GHBG 3UNSA 5DN6D 3UIRA 1S6LA 4Q2KA 1TNIA 4TY6A 5A0CA 1TABE 2ZF0H 3JZ1B 2VIWA 1HLTH 1O5DH 2FIRH 2WPLS 4GLYA 4UD9H 5GXPA 1SHYA 4INHA 1F5RA 4X6OA 5C17A 4O3UA 2A5KA 4AX9H 2EY4C 1MBQA 4R0IA 2GMTB 1SQTA 3A89A 3QK1A 2PUXB 2GTBA 2Z94A 3K2UA 3HGPA 3PV2A 3SV8A 1LHFH 6CHAB 1ZLRA 1BQYA 1T4VH 1PQAA 5FAHA 2EQNA 2PR3A 4D7FA 3GY4A 3SOSA 2XRCA 2AGEX 2P3UB 4DT4A 1ETSH 1WOFA 3VXEH 1AZ8A 3SU6A 1CA8B 1IQMA 4Z0KA 2SGDE 4ZROA 2C8WB 3P6ZB 2WPHS 1J17T 3BIUH 9LPRA 1XKAC 3KYGA 4X1SU 1UTMA 1C1SA 1C5XB 1GMCF 3OU0A 3BF6H 4TY7A 1KLIH 1ZRKA 1O5FH 4ASUD 1RTKA 2Y5HA 1K0HA 1P11E 1BHXF 3LGTA 2RDLA 2XWAA 3PWCA 2BVXH 1NRSH 3LGVA 5L2YH 3L6PA 1KYNA 1FN8A 1F0TA 4UEHH 1F92A 1AMHA 3M35A 1SR5C 3ZVGA 1GHBF 1ELDE 1O2HA 3QUMP 1NFWA 2FLBH 1H4WA 2ANMH 2WYGA 5L6NH 4ZKNU 3SYJA 3QO6A 1C1RA 2O8TA 1N6YA 1XUKA 4X2WA 2F91A 1TX8A 5BRRE 1SGIB 2W5EA 4DGJA 3NKKA 1GHXH 5JBBS 3IWMA 1BZXE 3FO8D 1EUFA 5CHBA 1EZXC 2Z9IA 1EPTA 4RKOB 1C5TA 3ODDA 5EW2H 2ZFTA 1SQOA 4D76A 3BV9B 5CMXH 4X1RU 5LPEA 3BTQE 3O8BA 4AG1A 1TGBA 4B71A 4TPIZ 2XNDD 3F9GA 1UVSH 4ABIA 2PV9B 2J97A 1NFXA 2ZDLA 1E1QD 3HKJB 1OWJA 2FWWA 1Z8JB 1V2UT 1DY8A 2CMYA 5FL7D 3E0PB 1K2I1 4TT3D 3DD2H 1ZMJA 1E35B 1C9PA 4BXWA 4DVAU 1ZYOA 1JIMA 1QRXA 3IG6B 2J95A 3P70B 2PSXA 2AFQB 1G3DA 4HTCH 1TE0A 1SLWB 2HALA 2P8OC 3RXGA 4BAQB 2TGAA 1ZGIA 2Y7XA 2F3CE 1O2JA 2Z6BD 4FUEA 3P8GA 3UR9A 4ISIH 1TIOA 1TPSA 3A84A 2F9UA 1B0FA 4DY7B 4K1TA 3RC4A 1J15A 3QLPH 1E79D 2CV3A 1C5ZB 1P3EA 1IQLA 1QHRB 5C94A 2ZHFH 1FLEE 3TLOA 4MNVA 3SU4A 4I7YH 1H1BA 3I29A 1XKBC 1OOKB 2AEIH 2D26C 3K9XB 4PROA 3MNSA 1EAWA 1EP5A 1ANEA 1WXRA 2TGDA 1FIWA 3GCNA 4OS4A 1BBRK 3NCLA 4DJZB 2ZDKA 1HAYB 2FOMB 5KGOA 1GVLA 1TFXA 2AH4X 1P06A 1HB0B 2WPMS 4Y10E 1AHTH 1HUTH 2FX4A 3AASA 4KGAA 3ZZCA 2B0FA 4BANB 1SOZA 5DO4H 2BDBA 2BLQA 1QB6A 1ID5H 3UWIA 2BQWB 2BLVA 2YMSC 1QB1A 1A4WH 4J1YA 1ZPZA 5F8XA 3F9HA 1D3QB 4B2BA 3FZZA 4SGAE 4YXWD 3TGKE 4LXBH 1E0FD 1C1MA 3BTKE 1GI0A 3H5CB 4THNH 8ESTE 2UUYA 3RU4E 4OS5A 1BTYA 2ZHDA 4U32A 1OP2A 1J8AA 3MNBA 4FVBA 5EODA 1UTKA 1YLCA 2TGPZ 2ZQ2A 2V3HH 2IOTA 5HM9A 1DUEA 3CS7A 2JETB 3SU5A 1MKXK 1HPGA 1OHHD 1GJ5H 4AOQA 1YPMH 1QZ8A 1Y3YA 2P95A 3E8LA 1OWEA 1NU7B 5C1UA 3JZ2B 3S9AA 1D6WA 4JK6A 2SGPE 3BTWE 1A2CH 1AWFH 1PQ5A 2TGTA 4K3JA 2EC9H 2TBSA 1AZZA 1O3KA 1UJ1A 2J92A 5FX5A 4CHAC 2K8IA 1O3DA 1P01A 3M7TA 2FXRA 3RXKA 5FPSA 2QF5A 4A1VA 2HLDD 1NFYA 2W3IA 1C9TA 3A87A 4XOJA 2HWLB 2ZPQA 1RRKA 1BMNH 2G4UA 1D3PB 3KQDA 3PWBA 2BVRH 1DICA 4Y6DA 4NA7A 3S9CA 3EGKH 2G00A 4AFQA 8KME2 1C1PA 1F0RA 1OPHB 2Y5GA 3Q77A 1CT0E 4H4FA 1YPLH 1OYQA 2PUQH 3ZZBA 2F83A 3SUEA 1UTJA 4BNRA 2BM2A 3A8CA 4MTBA 2AS9A 3RXLA 1FY8E 1TOMH 4ZKRU 1JRSA 1YLNA 2FLRH 3Q3XA 3FVFB 1YPEH 4ISNA 2BQ7B 1MZAA 4M7GA 3ZVBA 3TJNA 2BZ6H 3PMHB 3RUOA 1EJAA 1A7SA 3A8AA 3QDZB 1GBKA 1VCPA 1LPZB 3RXJA 4XD7D 5EJ1A 2EEKA 3SUDA
chains in the Genus database with same CATH topology
2BD5A 3GCHC 1K1JA 5EXLA 4IGDA 1W7GH 1HRTH 1O35A 1AIXH 4AFZA 1L1JA 3PMJA 5HYOA 1KY9A 3RXRA 2SNWA 7KMEH 3V7TA 1QBOA 1O2SA 1TGNA 5JBAS 1WQSA 1KTTB 4K5ZA 1SC8U 3UUZA 1KXEA 3NXPA 4Y7AA 3QTOH 4Y8XA 1E38B 4JCNA 1QQ4A 5EXMA 3T25A 1CA0C 4Y76A 5J4SA 4AORA 2IJOB 5F03A 1ELEE 3V12A 3RLWH 4MPUA 4BXSA 1HAIH 3SI4H 1L4DA 2PLXA 1VCWA 1P9SA 2OBQA 5EPNA 4ABDA 1DDJA 3S0NA 1WBGB 5PTPA 2HVXA 3QZRA 3STJA 4GUXA 4LZ1H 1C5RA 3HK6B 1MUEB 1W0YH 2FOEA 4H6SB 1AGJA 1YKTA 5C1XA 1BTUA 1QBNA 2PGBB 3R3GB 1O5GH 1BA8B 2A7HA 2PKAB 2VU8E 1DM4B 1QL8A 4GCHF 5C67A 4JZIA 1O2XA 4D7GA 5GIBA 2HLCA 3UFAA 1GWAA 1O3HA 2FOHA 2WPKS 5ETXA 4B73A 1KTSB 3E0NB 5A8YA 1EAUA 2ILNA 5JPMH 3SU2A 4VGCC 2BX4A 1SGYE 3ESTA 3D62A 2PWXA 1H8IH 1AE5A 1ZOMA 2ZGBH 3M3SA 1NRNH 1O2PA 5E0HA 1GI5A 1ABJH 1AU8A 1D4PB 1NM6A 4Y79A 4WMDA 3GCOA 4NIYA 3LU9B 1GJ6A 1TAWA 3B9FH 1YYY1 1MCVA 2WINI 1CO7E 4ISOA 1GBDA 2JKHA 4MPWA 4NFEA 3BEIB 4FU7A 1TPPA 1DPOA 1YCPK 1WAYB 1MU8B 4X1QU 3VGCC 3LJOA 4RN6A 4IC5A 4DIIH 1GJ7B 1W11U 2ZGHA 4ZKOU 1O33A 1EJNA 1THPB 1FXYA 1C5SA 3P8OA 2UWPA 1A3BH 2FOCA 2A2QH 1AKSA 1MAXA 1V3XA 1ABIH 2STBE 1ZHPA 3NZIA 2BOHB 1AQ7A 4J2YB 3RM0H 2BY8X 1TPAE 1FDPA 3V0XA 2QXHA 8LPRA 3P95A 3U8RH 1H9LB 1LPGB 2GZ7A 3SZNA 3TJOA 2STAE 2Q6FA 2ZTXA 1XUJA 2C90B 2OC1A 3SBKA 1GDNA 1LQEA 1BHXB 1FY5A 4KELA 2J4IA 3GY5A 5FCKA 3UNQA 1Z6JH 1ELCA 1P2NA 4KTCA 1DT2A 1H8DH 1XUGA 2Z3DA 3MU1A 4F49A 2P8OB 5EG4A 1AD8H 1LHCH 1TQ0B 1DWBH 3O8DA 1GCTB 1CSOE 2PSYA 1C2GA 2ALVA 3SJKA 3GY3A 1V2TT 2P3FH 3Q76A 4NZLA 1DOJA 3SI3H 3VPKA 2ZGJA 3C1KA 1RD3B 1SHHB 1PQ7A 1VITF 2Y81A 4AFUA 2W7SA 5TJXA 1A1RA 1ORFA 1YPHC 2BHGA 3MO9A 2I6SA 2QXIA 1NN6A 1UTOA 1GBLA 2F9PA 4IS5A 1AVGH 5LGOA 4O3TA 4ESTE 4JYUH 1OP8A 5HXFA 1FV9A 2IPHA 2VWLA 1ELBA 2JETC 1QCPA 1Y5AT 2BXTH 1C5QA 3M7QA 3T27A 1HIAA 1N1LA 2ZU2A 1EQ9A 2AERH 2H5DA 3B23B 5DK1A 4X8VH 1AN1E 2HNTF 2FOBA 2BD2A 3ATKA 2ZQ1A 4DT7B 1OKXA 1CQQA 3E90B 1L4ZA 3QN7A 1EAXA 4BAKB 2O8UA 1P03A 5GJ4B 4ISHH 2CHAC 1TNGA 1O3IA 3SNDA 2QYIA 4WVPE 1YLDA 4WXIA 3TK9A 3BG8A 2R0KA 2RA3A 2NU3E 3K6YA 4O97A 1ZSLA 2SFAA 2HRVA 4DG4A 1HAZB 2O8MA 5DP3A 2ODPA 1PYTC 1NPMA 1LTOA 4IN2A 2BVSH 1HAVB 1HJ8A 1MTSA 4E7RG 1AFEH 3PROA 2GZ9A 3SU0A 2B9LA 1C2MA 3O8CA 2ZDAH 4MLFB 1GMDF 3MU4A 2A5IA 3SU3A 4CHAB 2Z9LA 4ASHA 2HNTC 3TJUA 3AAUA 1IQNA 2A0QB 2UUJB 4HZHA 1NESE 3P8NA 1W8BH 1V2QT 3MNXA 1TX7A 1O0DH 2ZFPH 1V2NT 2XNIA 3AAVA 5DG6A 1SFQB 3U69H 1BB0B 1BOQA 1T8NA 1K1PA 1C1NA 4Q7ZA 1N8OC 1AUTC 2GDEH 2FTLE 3T62A 2J2UA 4NWKA 1DE7H 2FOFA 1TALA 1P2JA 4AFSA 1GBIA 4NIWA 5A0AE 1Y8TA 1WTHD 4HFPB 3GDSA 5DP6A 4XBBA 3QZQA 3SORA 4BAMB 3SQEE 1TGTA 3KF2A 3P8FA 1UCYE 3DA9B 1EPTC 4MNXA 4HI3A 1ARCA 1DWCH 3A7WA 1HYLA 2H5CA 3OX7U 4IBLH 1GDUA 3TGIE 4D8NA 1GL1A 1MKWK 1O3LA 4GSOA 2ZFQH 3GCHB 1GJDB 4CH8B 1UO6A 2QXJA 5C5OA 1BTWA 5GDSH 3VFEA 2FZZA 1GJ9B 2BDCA 5TCAA 1A61H 4JZ1A 2QCYA 3OYPA 2KAIA 2O9QA 4D9RA 2OLGA 1ETRH 2Z3EA 3RU4D 1C2KA 1YGCH 1CA0B 3RMMH 2ZWLH 4NA8A 2BB4A 2ZU1A 3AW0A 3ZZ6A 3RXDA 5FBIA 1UK4A 7GCHG 2R3YA 1JWTA 1UTNA 4ZKSU 4CR9A 3PLKA 3G01A 2VINA 4BAHB 3WY8A 1EASA 3SN8A 2QA9E 3QGJA 1L1GA 1ESAA 1P2QA 2FO9A 2EI8A 1GJCB 1QNJA 3E3TA 2VVCA 1S84A 2XBYA 3KGPA 1A5IA 5FCRA 3RXTA 3UR6A 4WMFA 3MU8A 3SV9A 2ZP0H 2H2ZA 3PMBB 1BBRH 1WU1A 1O3EA 1O3OA 3FFGA 1SGDE 2A4GA 1G9IE 4KTSA 2ZO3H 1C1TA 3VB6A 2A1DB 2ZTZA 2ZGXH 1RTFB 1S5SA 1CHOG 1O3JA 1VJ9U 1C5PA 2XBXA 2W7UA 3URDA 3SJ9A 3TH2H 2GCHG 5A09A 4U2WA 1UK2A 5FPTA 1BCUH 4VGCB 1O2IA 1Z7KA 4IC6A 4NCYA 3M37A 2P94A 4ZMAH 1T7CA 3SGBE 4BAOB 3U9AH 1FQ3A 3K6ZA 3TNTA 3UY9A 2ODQA 3SQHE 2ZCHP 4ZHAA 3QTVH 3HKIB 1MTWA 1P9UA 2BLOA 3LOXA 4ZUHA 2V35A 1O37A 4CBNA 2BDYA 4OGYA 2G51A 7GCHF 3EA7A 1C2DA 4ABBA 1XUFA 3VGCB 2BD7A 1MKXH 1F2SE 1W13U 1H9IE 1V2MT 4XE4A 1HIAB 3FP6E 2R2WU 1QRWA 3RXHA 2FI3E 2XC0A 2BY5X 1K21H 3I78A 5L2ZH 1ZZZA 1GCTC 2GX4A 4B2CA 1HAHH 3RXAA 1INCA 3ITIA 4WH8A 5GWZA 1NC6A 2H9HA 2FP7B 1TMUH 4HGCA 4I32A 3ELAH 2R9PA 2A5AA 2DUCA 3MHWU 1NU9A 6ESTA 1MH0A 4WMEA 3F9FA 3GY6A 2HPQH 5LPRA 2OCVB 1GJ4H 3H7TA 1O3GA 1YM0A 3RMOH 3T28A 1CVWH 3M5OA 3MU5A 3A7XA 3RU4T 2ANWA 4Z6AH 2GCHF 1SGQE 2J94A 5FBEA 1FI8A 3KQEA 2FYQA 1MQ6A 1HAOH 3NUMA 4AN7A 1VZQH 2UUFB 1B0EA 4SGBE 1QBVH 1SSXA 1MTNC 1HCGA 2BYAX 2BY7X 3PYHA 2FMJA 3MI4A 1S6HA 1F7ZA 2G4TA 3QWCH 1HBTH 2VVVA 2Z9GA 5G4BA 1M9UA 1YCPM 3RM2H 2CJIA 2Y5FA 3ZV8A 2QN5T 4CRBA 2P59A 4MNWA 3SHAH 2ZFSA 2XCFA 2TIOA 1YF4A 1V6DA 3LH3A 1KDQB 1P12E 3R0FA 1AY6H 4LZ4B 2ESTE 1IQIA 4WXVA 3GOVB 3C27B 4QT8C 4A7IB 3NWUA 4ABJA 5EW1H 1Q3XA 1BITA 4I33A 5DP4A 5C2ZA 1IQKA 3W94A 1A0JA 5DGJA 1TMTH 3RXQA 3S7HB 3RDZA 4X6NA 4NSVA 1P2IA 1ESTA 4I8LA 2XXLA 3A86A 1T4UH 1GI2A 1QGFA 2CHAB 1GHZA 3A7TA 7ESTE 5F6MA 2AMQA 2ZDMA 1NFUA 1QR3E 4ABEA 1V2RT 1H9HE 2LNCA 2TPIZ 1V2VT 5A8XA 3PTBA 1TGCA 1GJBB 3E1XB 1T32A 3LONA 3EDXB 5EOKA 1B5GH 2SGAA 2ZHQH 1VITH 1F0SA 1LMWB 3GICB 1BIOA 5AVDA 2ZCKP 3T5FH 2KAIB 1FONA 4E05H 1IQHA 3MH6A 1SGRE 2C3SA 1QA0A 1DWEH 4YLQH 5AF9H 2BDHA 4A6LA 2G5NA 4X1NU 3ATLA 4INKA 1WUNH 2OD3B 1OWKA 3TIUA 2J9NA 1G2LA 4DCDA 1WTGH 4UFFH 1ZPBA 2FS9A 2YNBA 1AUJA 1MCTA 1SGTA 2GDDA 3L3TA 1AVXA 5CHAC 1C1VH 4Q7XA 3EYDA 2BY6X 2NU2E 2VVUA 3FZDA 1N8OB 5F8TA 5C1YA 3SHCH 1BDAA 4X2XA 3M61U 1CHGA 2WV5A 2GT7A 2IN2A 3F1SB 2A31A 2VIQA 2P93A 1YCPH 2Q6GA 1MU6B 2ANYA 1TPOA 1KLJH 2ZFFH 1P57B 1KSNA 1ZJDA 4MPVA 4R8TB 1GHAG 2RCEA 2BOKA 1UHBA 1EPTB 2GD4B 1PJPA 1O34A 1T8MA 3LGWA 1YPHE 2A4QA 2W3KA 4ABGA 4WY3A 1G36A 3P17H 2ZHEH 4IMZA 5FHTA 3OY6U 1NY22 3U98H 3MOCA 1NRQH 2G8TA 1K1LA 4DURA 1P2MA 4JK5A 1GG6C 4Y11E 5JDUB 2CF9H 4XBCA 1QURH 1O5CB 3FP8E 4OS6A 3LPRA 3SNAA 1F0UA 5LPFA 1CE5A 1XUHA 2VH6A 2G52A 2ZEBA 3A8BA 2AIPA 3DFLA 4OS7A 1BRAA 2F9BH 4ABFA 1J16A 1O3NA 2GV7A 1O2KA 3VB5A 3BEUA 3VXFH 1KLTA 1VR1H 4Y8ZA 3LGIA 3SJIA 3ZZ3A 2ZHWH 2ZCLP 3FP7E 1SLVB 3SV7A 2XC4A 1O2MA 3QX5H 3PTNA 1TNJA 1DX5M 1GHAF 4H42U 2B8OH 1OWDA 1QRZA 1LHGH 1GHYH 4TPYA 1SPJA 1PFXC 2O8LA 1O2RA 2ZDNA 4CBOA 2JH0D 1SQAA 4Q80A 1OWIA 1KXDA 1QJ6B 1ZPCA 3ATMA 3ZZAA 1O36A 5HGGA 2HNTE 2P16A 1MTUA 1P0SH 4OS2A 1GL0E 1AB9C 1K28D 1FMGA 3RMLH 1SI5H 1RXPA 2PFEA 1EATA 3U8TH 1C1WH 1O3MA 1C5VA 1ZR0A 2SGFE 1Q2WA 4UFGH 4A1TA 1SOTA 2ZPSA 2PGQB 2VH0A 3ZVDA 2BQ6B 1RIWC 3GCTG 3ZYDA 1EB1H 1UTPA 3SGQE 1TRNA 1JXPA 1MAYA 1EJMA 3U1IB 1CGIE 4NIXA 4BTIB 3SJ8A 4X6MA 2OTVA 4UONA 1OP0A 5E8EH 2WPIS 1OYTH 3E91A 2F9VA 1TA2A 4H6TA 4AG2A 4NFFA 1DFPA 3KCGH 1C2EA 1TB6H 4D9QA 5IYTA 1O2TA 4NGAH 1GI9B 1O32A 3LC5A 1V2LT 1Q31A 1ZJKA 2CN0H 2VNTA 1Z8IB 3M7UA 4INLA 2QAAA 3ZV9A 4ZXXH 3MH4A 1EZUC 3BTFE 3MO6A 1D6RA 1V2KT 1W14U 4FU9A 3D23A 4CH2B 2CXVA 2A4OA 1C5MD 3A82A 1WV7H 2GZ8A 1JIRA 4WF8A 1PQ8A 2AMPA 1SGCA 2WYJA 4DIHH 4FUDA 5EPYA 1W7XH 1IQEA 4K2YA 1UK3A 1S81A 1L2EA 1O2VA 1ZHRA 2ODYB 2DE8A 2CF8H 1V2PT 1EB2A 3KQBA 4Y8YA 2VIDA 2GGVB 1Z71A 2TRMA 1ELAA 1MTNB 1PPBH 3LT3A 4XFQA 4TWWA 1O3FA 2Z3CA 1CGHA 2QV1A 5T6GA 1Y5UT 1XVOA 2AYWA 2OXSA 2QXGA 3KQCA 3SNBA 3SV2H 1G37A 3LJJA 2OBOA 3D49H 1S82A 1EXFA 3BG4C 1ESBA 3BTME 3KIDU 1FY3A 1MKWH 3S9BA 4ZAEA 4X2YA 3BTHE 3O8RA 3RXBA 4FUFA 4A1XA 2Y6TA 2AIQA 1YC0A 5EGMA 1GBFA 5E2PA 3PO1C 2OC8A 1SLXB 4I31A 2V0BA 4FUGA 1C4V2 3MNCA 5LH8A 1S0QA 1DWDH 5CE1A 4XSKU 3ATWA 1XMNB 2G81E 1TRMA 4YTAA 1IQGA 1GBHA 2QIQA 4YESB 1P05A 1GVKB 3SUGA 4O03A 4FUJA 1YP9A 1K9OE 1UHBB 1GJ8B 4JZFH 4B76A 1BRUP 5EXNA 4FVDA 5GPIB 2HGTH 1HGTH 3LH1A 2OUAA 3H7OA 3IITA 3BTEE 4Y0ZE 3UTUH 4E06H 3SJOA 2PHBA 1HJAB 1O2YA 3MH5A 3ZVFA 1CT4E 1QFKH 4K1EA 4YZUA 1SVPA 4CRAA 4FU8A 5IDKA 4RSPA 4KP0A 1UTQA 2VIVA 3A7ZA 1LO6A 2ZGCA 2WUCA 5BPEA 4FUBA 3MO3A 1B7XB 4B74A 4I8KA 2FODA 2C93B 2OINA 3RXCA 2FX6A 1KXAA 2ZTYA 4CRCA 4UDWH 3B8JA 2ZDVH 1FNIA 1W2KH 1LPKB 5I25A 1DVAH 1ELVA 3T26A 1K22H 1QTFA 1C2LA 1GMCG 2EA3A 2V6NA 3BIVH 1UCYK 3STIA 1TNKA 1UTLM 5CHAB 3UPEA 2BD9A 1V2WT 3PM3A 2FDAA 1CBWC 2FYRA 1DXPA 3LKWA 1TRYA 5JBTA 3MFJA 1ZSJA 2DE9A 2Z7FE 4YOGA 1FAXA 2PKSC 2QF0A 1P2KA 2V3OH 2XYAA 4UFDH 2VWNA 1Z6EA 4O9VA 1KXCA 2BZAA 1K1OA 2YNAA 1UVUH 3RLYH 1O3CA 1EOLA 1SGFG 1TBZH 1GHWH 2G55A 2PTCE 1BTZA 5TCCA 2ALPA