1GI7B

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
total genus 52
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi7B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi7B01
3UNSA 3SN8A 3QTVH 1DXWA 1UTQA 4ZMAH 1FPHH 1MD8A 1O36A 1BJVA 2ZU5A 4KKDA 4CHAC 4VGCC 1K1JA 1S85A 1XXDA 2GCTB 3LGUA 1O38A 5FPSA 4FUHA 1A2CH 3MO9A 1HAYB 1P09A 1ZYOA 3RXBA 4D7GA 4FUEA 1DY9A 3FZDA 1UTLM 1GBJA 2SNWA 2ZF0H 3RU4E 3ATLA 1AE8H 1MCTA 1D6RA 2NU4E 4XDEA 1IHSH 2BY6X 4AN7A 1GL0E 3P8GA 1OXGA 3HPTB 1C4V2 1DPOA 1KTTB 2VWMA 2WPIS 4I33A 4ZHMU 1P9SA 4MVNA 2VU8E 3U1IB 4OS1A 4WY3A 2XC4A 1PQ7A 1B7XB 1HCGA 4MPWA 1SLWB 1RD3B 4DURA 1CE5A 2A4GA 3NK8A 2FXRA 3NPSA 3ESTA 3M3TA 1GHVH 1MBQA 1VR1H 2ZGCA 3ZVDA 4ZXYH 4OS2A 1P03A 3SGQE 3M61U 3S7HB 1TOCB 1P2NA 2UWPA 3LH3A 2AH4X 1O2RA 2GZ8A 2QYIA 2FYQA 1Z8RA 1PPZA 4MNXA 1RIWB 6ESTA 2C8YB 5EOKA 2BLQA 3QGJA 2ZKSA 5T6FA 2ZTZA 1NU9A 1QY6A 1NU7B 3RXCA 1O2JA 2FOAA 2A4RA 2F9PA 2QV1A 1QCPA 3BEIB 2PLXA 1O3CA 3V13A 3ZVCA 3PLPA 1K22H 3MH7A 1KIGH 5GIBA 3SU4A 1O2PA 5FBEA 5FXLA 1ELEE 3F1SB 3A8AA 4X8TH 3HKJB 1C2GA 2XWBI 4YZUA 2ZG0H 1C4U2 1AD8H 1C5VA 1MTVA 4NWLA 3RXJA 2BDYA 2JH5D 3RDZA 1HB0B 4FUIA 1BBRE 2V6NA 3OX7U 1SOZA 1AVWA 3KCGH 4ZXXH 1IAUA 2GCHF 1Y5BT 2O8TA 1BMMH 1QBNA 1W8BH 2HVXA 2VNTA 2B9LA 5L6NH 3LDXH 1GI0A 1YPKH 3LGTA 3O8BA 3QDZB 1ETSH 4CR9A 4VGCB 4Y76A 1L1NA 1E36B 3VGCC 2PTNA 2ALVA 1BDAA 1GBCA 2W7SA 1A46H 2G00A 2IPHA 3DD2H 2GZ9A 4DVAU 3M5OA 1A3EH 1ZSLA 1OKXA 2B7DH 1LHDH 1EZXC 4NIVA 4Q7YA 1O3LA 4DOQA 4M7GA 1WV7H 4H4FA 1CGIE 1TNLA 1CBWB 2JH6D 3LGWA 2ZPRA 1NS3A 1E35B 2HPPH 4DW2U 2DE8A 1A4WH 2J9NA 3K6YA 2FPZA 3BTGE 1GCDA 2QA9E 5BPEA 4FVBA 1K1MA 1TMUH 2A4OA 3RXDA 1DM4B 3SJOA 1ABJH 2BY5X 1FLEE 1JMOH 4NA8A 2ZA5A 2FDAA 3A83A 4K69A 2R3UA 7ESTE 1DUAA 5EPNA 3SU6A 2A5IA 1DVAH 3RMNH 3ATMA 4Y0YE 2HNTF 1TA6A 3QK1A 5DKMA 1L0ZA 4CRDA 1SMFE 3E0PB 3HGNA 4IC6A 3P70B 1V2QT 4A5TS 1JBUH 1QB6A 4JYVH 2JETC 4Y10E 4YOGA 3PROA 5E2OA 2AIQA 2BD7A 4IMQA 5DP9A 1EJAA 1ELDE 3UQOA 2GT8A 2HRVA 3M7UA 1NRQH 1GI2A 3F68H 4O3UA 2A4QA 5DG6A 5C67A 5LH8A 4UDWH 5TCCA 1O3IA 4WH8A 1AI8H 2W3IA 4WMFA 1ESBA 1BBRK 3RMOH 1TRYA 2V35A 1FN8A 3SZNA 1XM1A 3UREA 1T31A 4IS5A 1HYLA 2WYJA 3SQHE 4NIXA 3MO3A 1P2MA 4Q2KA 1O2OA 4CR5A 1W14U 1T8NA 1W3CA 3ZZ3A 3GYLB 1QURH 3SU5A 5C1UA 1O5EH 3TJVA 4IMZA 1Y5AT 5K7RA 3OSYA 1AQ7A 1LHEH 1QR3E 4YESB 2P93A 3S9CA 1C1TA 5EQRA 2ANWA 2RCEA 4CH8B 4AFQA 2BZ6H 4I7YH 2ANYA 1VITH 1C5NH 3ZZ4A 4JZDH 1TALA 5L30H 4BAKB 3FANA 1NPMA 3ZVAA 1C1RA 1CO7E 1HV7A 1BOQA 1P3CA 3H7OA 5FHTA 4F4OC 1GI8B 3QLPH 3TJUA 3GY7A 4UONA 2GVFA 2BQ7B 3URCA 1THPB 3RXPA 4K3JA 3S0NA 3DA9B 4ISIH 1NROH 1A5GH 1MKWK 1GCTC 4CRBA 4FUBA 1J17T 2FS8A 1V2RT 2P3FH 2TIOA 4AG2A 1O2SA 1ZRBA 3VGCB 3VB4A 2BMGB 4SGAE 1BHXF 5JBAS 3I78A 1F0RA 2ZHQH 1QRWA 1ZPZA 1J9CH 1UCYE 2OC8A 5E0JA 1O2IA 1MH0A 2CJIA 3SJ8A 1ZHMA 1AFQC 7LPRA 1SHYA 3MH5A 3H5CB 1NO9H 5FAHA 1TA2A 2PSYA 4ESTE 2SGEE 2XNIA 3KQCA 1TNIA 2QXGA 8GCHG 5GJ4B 2BY8X 1IQKA 1GL1A 8KME2 2V3HH 1O2NA 1OWDA 1WTHD 1QL8A 1OX1A 2BD9A 4B2AA 4TY6A 2HNTC 1MKXH 4TWWA 1C2DA 1O2VA 1ELCA 3KIDU 3M7QA 1O3OA 1BMNH 1V3XA 3A84A 1SG8B 1HAZB 1P2JA 2VH6A 1GI7B 3FZZA 3EA8A 1UK2A 1FNIA 1LVMA 3SOSA 3SV7A 1P12E 4ZROA 1SFQB 3CP7A 2QAAA 4TWYA 2AGIX 1YLCA 1EAWA 2ASUB 3GY5A 1H4WA 4K1TA 1EPTB 3GCNA 1D3QB 1ZTLA 5C2ZA 2PKAA 2FI4E 1GBHA 3MYWA 1BRUP 1TQ0B 2TGPZ 2BLWA 5C1YA 2TBSA 4MPXA 1ZRKA 1XUJA 3GCTG 2PFEA 3R3GB 3GCHC 1L4ZA 1WOFA 1DLEA 1EXFA 1N1LA 2BB4A 1XXFA 3PLKA 4AFSA 2HWLB 1YBWA 4GCHF 2HOBA 5L2ZH 2G5NA 2WYGA 4U30A 3A88A 1N6XA 2SGFE 2NWNA 3MH6A 1GHAG 2OP9A 1ZJDA 2ZZUH 3ZZAA 1GBFA 1BIOA 2ZFRH 2GMTC 2Z3EA 4NIYA 3UNRA 3CS0A 1G2LA 4UFDH 1DXPA 1JIMA 3T5FH 1QHRB 4AG1A 4JCNA 3JZ2B 1AWHB 1FJSA 4LOYH 1WBGB 5AFZH 1QQ4A 4I31A 1T8OA 1K1LA 1BTUA 1LHGH 1GMDF 5FPTA 3M3VA 3MHWU 1AVXA 1ZTJA 1RFNA 1XKBC 3EYDA 2BD5A 2Z9KA 3VPKA 5FBIA 1O3FA 4AB9A 3E91A 1GJ8B 1QGFA 5E0GA 8ESTE 2G81E 2VINA 1GBLA 1GG6B 4BAQB 3RLYH 5CHAB 1ZSJA 3ODFA 1V6DA 1TIOA 3OY5U 2WUBA 4NZLA 1MQ5A 1P8VC 2F3CE 3V3MA 1CQQA 1FMGA 5DO4H 1TGSZ 2AMPA 2ZDLA 2O8MA 3OU0A 3MMGA 2FX4A 2CHAC 4DIIH 1GBIA 1OYQA 4DG4A 1GI3A 2Y5GA 2JKHA 3E16B 1ID5H 1FI8A 3V0XA 3LOXA 2THFB 4X0WU 1FAXA 1GHXH 4B76A 1NFWA 3BTME 2C8ZB 4RKOB 6GCHG 1ZPBA 2A7CA 2A2QH 3CS7A 2ZWLH 2HALA 2VIWA 1AKSA 1OYTH 3ZZDA 4X8SH 3BG4B 5ABWA 4OGXA 1SC8U 1NRSH 1V2MT 3LONA 2DE9A 1MU8B 1XUKA 2AFQB 4TY7A 2YNBA 3O8RA 2G4UA 3UQVA 3SUGA 1G3BA 3TVJB 2FIRH 2H9EH 2VVCA 2EI8A 1TGNA 1O0DH 1C2HA 4MNYA 1SB1H 3UTUH 3UY9A 3ENSB 4I8GA 1A5HA 2C8XB 2B0FA 5EQSA 3SI3H 4BTTB 4AFUA 1BT7A 4HFPB 1P2KA 2WPMS 2XBXA 2AIPA 2BVXH 1G37A 1F0SA 1AZ8A 3TJOA 1IQIA 5EG4A 1SGFA 3TK9A 4D8NA 3RXHA 2OXSA 1ZHRA 1IQLA 1TBZH 2Z9GA 1SOTA 2DUCA 1K1OA 4TYDA 3E6PH 1O5CB 1C1PA 1C1SA 1W0YH 2GDDA 2QF3A 1YPEH 1YGCH 2B8OH 3Q3KA 1O2XA 4Y8ZA 1KDQB 1EOLA 2ZEBA 5J4QA 3VXEH 1O5AB 3M5MA 1W12U 2QY0B 5A8XA 1FAKH 1WTGH 2HNTE 2P16A 1IQEA 2J92A 4YT7H 1C2LA 1KXBA 2BQWB 1HAPH 3RC4A 1GJDB 1JXPA 1KLIH 2ZDMA 4NA7A 2STAE 4FU7A 3BTTE 2C4FH 1GVLA 4YO9A 3SBKA 1C4Y2 1K9OE 2ZFSA 2A7JA 1C1OA 1Y3VA 4BTUB 1SGQE 1J16A 1S6FA 1TPPA 1HJAC 4AZ2B 5A09A 3HK6B 3NCLA 2A1DB 2O8LA 1QRXA 3ATKA 2YNAA 1QIXB 1HAVB 1UJ1A 1TOMH 1NFYA 1P05A 4FUDA 3W94A 3TJNA 2NU2E 3F9EA 1SGIB 1T8MA 2CHAB 1HLTH 1TMTH 4YOIA 1H8IH 1HJAB 1MD7A 4IBLH 4I8HA 4K5ZA 4CRGA 5AHGH 3BIUH 4KTSA 1OP0A 2Q1JA 5EW2H 2PTCE 2ZGBH 2BLOA 4X2YA 1C2KA 2TGDA 2XW9A 4CBNA 4ZKSU 1G36A 1NC6A 3TU7H 1GHZA 1HIAB 1XUFA 1PJPA 4Y79A 1LVOA 3ZVBA 3LJJA 1CHOG 3RMMH 5CE1A 1C1NA 4ZKNU 2ZDVH 1HIAA 3SW2B 3LGYA 5EODA 1THRH 1O2LA 2Y6TA 2J4IA 3KQBA 5I46H 1Q3XA 2VIPA 1GI5A 1LVBA 1TNJA 3PMBB 2Q6GA 1HUTH 1GBTA 3RXEA 1CHGA 1LMWB 1YM0A 4E05H 1UVUH 4PROA 2AMDA 3LGIA 4B2CA 4GLYA 3RXAA 2LNCA 4O03A 4JK5A 1MZDA 1BZXE 1EB1H 3TNSA 3LC5A 1VCWA 1G3EA 1HAVA 1TAWA 2Y81A 1F92A 1Y59T 1NN6A 2KAIB 4MG3A 2O8UA 4Q7XA 1OWJA 2EC9H 1MTSA 1QQUA 1GVZA 3HATH 3UWJH 4WF8A 1FY5A 1ESAA 2WPKS 3ZZ9A 1MUEB 3JZ1B 2OQUA 2H6MA 1K2I1 5FCRA 1NRRH 5EQQA 1P02A 3HGPA 1ESTA 3AW1A 2ANMH 5G4BA 2EEKA 3RU4D 3UIRA 2OD3B 3VB3A 1C5PA 2VWOA 5FPYA 3FP8E 4JMYA 3SO3A 2G52A 5B6OA 1HJ9A 1ZSKA 4THNH 1C1QA 1GHBG 1DSTA 4DT7B 1W11U 4ZHAA 4GPGA 1XMNB 2UWLA 1WU1A 1XX9A 3GISB 1GHAF 5DP7A 1J14A 3BTWE 8GCHF 2GP9B 1QJ1B 1TNKA 1GBEA 1UO6A 3ATWA 3GCOA 2J38A 5F8ZA 3PWBA 5GCHG 1K1PA 3F9HA 1UK4A 2WUCA 2STBE 2Y7XA 1DT2A 3RXLA 4B1TA 4JZFH 3SJ9A 1MU6B 2F9BH 3STJA 2WPLS 1DY8A 5EPYA 1YCPH 4X8UH 4DJZB 1D3PB 3PWCA 1D3DB 4ZKRU 1P2IA 1LCYA 1Q2WA 2BYAX 3B8JA 5ESTE 4LZ1H 1TONA 2ZFPH 3SGAE 1O3JA 3A7XA 1FY3A 4FUFA 1PQAA 2ODPA 4NG9H 3MU1A 2IOTA 3M36A 1UVOA 4WXIA 3P8FA 1ZLRA 2OTVA 1GMDG 2B5TB 5GXPA 1DWBH 3EA7A 1H9IE 3F9FA 1TBQH 4K2YA 1Z8IB 4NGAH 1G32B 2UUYA 2WINI 3RC5A 2W3KA 2OUAA 5JB9S 2FOGA 1P2QA 5LPFA 1ZMLA 2FTMA 2ZTXA 2ANKH 5AFYH 1Z6EA 4A7IB 3A7YA 1F5RA 1VGCB 1O30A 1SGTA 4YTAA 3RXMA 1ZGVA 1NY22 1ETRH 4MQAA 2BX3A 2VIVA 4A6LA 2AGGX 3TK5A 1EX3A 4X2WA 3T2NA 4X6PA 5JBBS 3FFGA 1YKTA 1O3DA 2O9QA 1GI1A 1BA8B 1B5GH 1TMBH 1YCPK 1XUIA 2ZPQA 3RXVA 4B75A 1ZPCA 2QC2A 1AUTC 1OP2A 1O35A 1HRTH 4NCYA 3BG4C 1QNJA 4X1SU 1QBOA 2ESTE 1A7SA 2Y80A 3RM0H 3G01A 2Z94A 3N7OA 1BUIA 1GJ5H 2XCFA 1SHHB 1NRNH 1G3CA 3T26A 1C5WB 1DWCH 1RS0A 1O33A 1LPKB 1W0ZU 1DITH 1XKAC 3KF2A 3KQDA 2LPRA 1C2MA 4ABIA 5DJ7A 1O3KA 1FIZA 3NUMA 2OBQA 4JK6A 3NXPA 1MTNB 2F9OA 3PMHB 3MWIU 2H9HA 2RA0A 4UFEH 2WV5A 1PPCE 5E8EH 1V2UT 4I32A 1ZR0A 4Y71A 5H4IB 2PUQH 1NESE 2GGVB 2OC1A 4OS4A 4Y6DA 1QFKH 4ABDA 9ESTA 1HBTH 1T4VH 1O2ZA 2VWLA 1K21H 1SGDE 1GHWH 1IQHA 1HAGE 3MU5A 2FLRH 1GBBA 3A7TA 1Q31A 2C8WB 1LQEA 3ZZ7A 3HK3B 1AVGH 1S5SA 1NM6A 1TGBA 1FXYA 1KXAA 1ANCA 2PKAB 3TH4H 1S84A 2W5EA 3A8BA 1DWDH 1O3PB 3H7TA 2VWNA 1O5DH 1O2TA 1AHTH 1DLKB 1OWHA 4X8VH 2QXJA 1EZSC 3K9XB 1ELAA 1RIWC 1L2EA 1V2VT 1SQOA 1EPTA 4E7RG 2ZGHA 3GY8A 2P8OB 3ZZ6A 1Z7KA 2K1QA 5TJXA 1E0FD 1UCYH 3TGJE 1B0EA 4X6OA 3NWUA 3GYMA 3AW0A 7GCHG 2A45B 3T28A 3ZVEA 1YPHE 2CN0H 1WCZA 1SI5H 1QB9A 1SQAA 3I77A 1LVYA 1CA0C 3ZV8A 2P59A 1NRPH 1O2WA 2FZZA 3QWCH 5CMXH 3HKIB 2OQ5A 2CV3A 6CHAB 3RXUA 1CVWH 3Q3XA 1CT2E 2D26C 3T62A 1P57B 3VB5A 4HI3A 2GD4B 1SGNE 4KTCA 1WAYB 3SV6A 4Y7BA 1FY4A 2XBWA 2GCTC 3BV9B 2H5CA 5EXMA 1IOEA 4X2XA 4KP0A 3C27B 5EW1H 1C2FA 1O3NA 1Z6JH 1SQTA 5A2MH 4KGAA 1MKWH 2ZQ2A 3D62A 5DP6A 3E8LA 1BTPA 3PYHA 3SNAA 1C5XB 1V2PT 3UOPA 1W7GH 4BXWA 2R9PA 1G3DA 1M9UA 2FODA 4IN1A 2UWOA 2R0KA 4GSOA 1BMAA 1C1UH 1Z71A 1LO6A 2AGEX 3BEFB 4B71A 2BDHA 4YM9A 2SGQE 2F9VA 1XUGA 1QL9A 1BTYA 1O3BA 2CF9H 1EAIA 1U6QA 2AERH 2OLGA 1CBWC 4UE7H 2O8WA 1S82A 1V2KT 5T3HA 8LPRA 1DSUA 1VZQH 3A7VA 3A7WA 3K65B 2BDIA 2I6SA 5JBTA 3EA9A 1BQYA 1TABE 1K28D 5F8TA 1TPOA 4ABFA 1YC0A 4INLA 1DE7H 1EJMA 5F6MA 4CH2B 1TRNA 1G9IE 3RXQA 1ZTKA 3TH2H 4MTBA 1MQ6A 3SV9A 3FP6E 3C1KA 1DWEH 1IQFA 2D8WA 3IWMA 2D1JA 2F9UA 1JRSA 2KAIA 2UUJB 5A0BA 2ZDAH 4BNRA 1E34B 2VIOA 2EI7A 1OWIA 1O3HA 1CGHA 3PMJA 3Q76A 2P8OC 2ZPSA 2CGAA 1KLTA 1QB1A 1RTLA 5AF9H 4BOHA 1TNHA 3TK6A 4O97A 1TNGA 2RG3A 2A31A 3MO6A 1KY9A 2BXUH 4X1NU 2ZC9H 3GDSA 1AKSB 5GCHF 3TITA 1Z8JB 3RXIA 5C5NA 1GGDC 1QA0A 2AMQA 4JZ1A 2FI3E 3RXTA 6GCHF 1HGTH 4WMEA 2GMTB 3V12A 4B2BA 2OBOA 5JPMH 1BBRH 4CRFA 1C5ZB 2BVSH 3E3TA 3EGKH 1GI6A 1D4PB 1QRZA 1O2QA 3SU2A 2XWAA 4A1TA 1TX7A 3O8DA 3FVFB 4RSPA 2VH0A 4WVPE 5T6GA 4BAHB 1J8AA 1VJAU 3QZRA 4GCHG 2ZI2H 1ELGA 1RGQA 3KNXA 3SHCH 2G55A 2FI5E 1CT0E 1DOJA 1HJ8A 4D9QA 1OWEA 1UVPA 1L1GA 1VITF 2ZP0H 4MNWA 1L4DA 3RXFA 2BD8A 4U32A 1A61H 1BRBE 1IQGA 1KXDA 4I8KA 1C2IA 3LT3A 2YOLA 3RLWH 3OYPA 1C1MA 4IW4E 3A8CA 3RUOA 3M35A 4Z6AH 2ALPA 2BY9X 3SNCA 2TGAA 4TPIZ 1W13U 1ZOMA 1GJ6A 2BXTH 2V0BA 1TFXA 2C93B 4ZHLU 1ELTA 4LXBH 1F2SE 1AE5A 1BHXB 1TPAE 2FESH 1SFIA 5EXLA 1SLUB 1TBRH 4Z0KA 2C90B 2QN5T 2J2UA 3RXOA 3KEEA 1WYKA 1KDQA 1C1VH 3K2UA 2PKSB 3PB1E 1T7CA 1LHFH 1O2MA 5EU8A 4FUCA 4AGJA 1W7XH 4BTIB 2Z6BD 3A89A 1HAHH 4AFZA 1YPHC 9LPRA 1HXFH 2PKSC 2FX6A 1LDTT 1Y5UT 3KL6A 3PLBA 1H9HE 4ZH8A 3S9AA 2A5AA 1UTKA 1UHBA 4UFGH 4IGDA 1GHYH 1AFEH 2PR3A 1EUFA 3SJIA 2JH0D 3SUFA 4Y0ZE 4ASHA 3STIA 3BTFE 4ABJA 1D6WA 4JZIA 3T27A 2PGQB 2P3UB 1EZUC 1O5BB 2BM2A 1QA7A 1O2GH 4INKA 3MI4A 1UVSH 3P6ZB 2W7UA 2ZU4A 1IHTH 1FDPA 2W26A 2ZU2A 2ZIQH 1CU1A 1TLDA 3Q00A 1XUHA 4F49A 1V2NT 1GDNA 2G5VA 4UD9H 3UOUA 1K1IA 4R8TB 2BX4A 1BTWA 3UFAA 1ELFA 3PO1C 7GCHF 4CRAA 3BTDE 2BQ6B 4X1PU 3U1JB 3S69A 4OGYA 3MNXA 1C9PA 1A1RA 3E0NB 5E0HA 2Y5FA 2GTBA 3QN7A 4H42U 4NSYA 4AX9H 1H8DH 1K1NA 1GJ4H 3PO1B 4X1RU 3TGIE 1WSSH 1SGYE 1ARBA 1JWTA 3RXGA 4OS7A 2QXIA 1EAXA 1JRTA 2BLVA 1SBWA 4J1YA 1S83A 2FWWA 1A0HB 1SLXB 1YP9A 1MAXA 2Y7ZA 1AWFH 1ANDA 1WQVH 1PPFE 3DFLA 3SNDA 1CGJE 1V2TT 3VXFH 2F83A 1V2JT 3RC6A 3SNEA 1G30B 2VIQA 1O2YA 2VB0A 2FP7B 4ISOA 4ZAEA 5A8ZA 1MBMA 1PPBH 3M5NA 2ZU3A 5EXNA 2G51A 1IQNA 1GJAB 3QO6A 4Q80A 2Z3CA 3BN9A 1TYNA 5GWZA 2GX4A 3GICB 3K6ZA 4UFFH 1P2OA 5T6DA 1HAOH 1GBKA 3GDVA 2QF0A 1UVTH 1PPEE 1GJCB 2AS9A 7KMEH 1W10U 3ZZBA 4J2YB 2FS9A 3U8OH 4K1EA 3PTNA 1GMHG 1E38B 1KYNA 1BCUH 3MH4A 2JETB 2IJOB 4JYUH 5LGOA 4BANB 2SGPE 1LTOA 1SL3A 1ZZZA 3BIVH 1O3GA 1V2ST 4NA9H 3RXRA 1GI4A 1KSNA 4H6TA 4GAWA 1UTMA 2FOEA 3DT0H 1GMHF 2Z9LA 4FUGA 2F91A 2BY7X 2A0QB 3A87A 1ORFA 2FOMB 2GV7A 1OPHB 3ELAH 1O3MA 3GY6A 2PSXA 3MFJA 5DP4A 2IN2A 2GT7A 1C5TA 1O3AA 5IDKA 3LH1A 3GCHB 5I25A 1V2LT 1HFDA 3A80A 1O2UA 5DP8A 1EB2A 2BTCE 3U9AH 1BJUA 3B23B 4AORA 2ZTYA 1UK3A 1EPTC 2AEIH 4ABAA 5DPAA 1PYTC 4I8LA 3NZIA 1FUJA 1ACBE 2XXLA 1T8LA 3RU4T 1DFPA 3I29A 1BTZA 2SGAA 1NTPA 3F6UH 4DY7B 1V2WT 3BTEE 1MCVA 3S7KB 4FVDA 4AGKA 4D9RA 1NT1A 3ZVFA 1O3EA 1QL7A 4K1SA 2GCHG 1A0JA 3SQEE 4A92A 1YPGH 3TGKE 3GDUA 4CRCA 5A8YA 2J95A 1S0RA 1J15A 2ZCHP 1UMAH 1VCQA 1EZQA 1GCTB 5C5OA 4XSKU 1AUJA 2PGBB 1GVKB 2ZECA 5ESBA 3U69H 2FEQH 2FTLE 2Y5HA 1TX8A 1UTNA 3RP2A 1C5MD 4FUJA 4IC5A 2ZFTA 3F9GA 5JDUB 1FY1A 2G4TA 4I8JA 1SVPA 3QGNB 1B0FA 1BITA 4DGJA 4GHQA 1UCYK 3SUDA 3AVZA 3LU9B 3KQEA 4DCDA 1N8OC 1SGFG 1Y3WA 3MNBA 1GPZA 2ZHWH 1S0QA 2H2ZA 2PWXA 1EAUA 2PW8H 5C3NA 1MKXK 1LKBA 1P0SH 2VVUA 1ETTH 2J94A 3URDA 4WMDA 3VFEA 2SGDE 5JBCS 1FQ3A 1EKBB 2CMYA 1DX5M 2EA3A 3ZZ8A 1AGJA 4AYVB 3NKKA 4DIHH 4YLUA 5HXFA 4U01A 2OC7A 4CREA 1Y3YA 3U8TH 3A81A 3UR9A 3VEQB 5CHAC 4XFQA 4MDSA 5HMAA 1FZZA 3T29A 1GWAA 3A8DA 1AB9C 1P3EA 4SGBE 3UUZA 2C3SA 2SNVA 1ABIH 4INHA 2XYAA 2RDLA 3ATIA 5PTPA 3M37A 2CXVA 5HGGA 1FV9A 1LKAA 1A3BH 2R3YA 3QUMP 2TRMA 1WUNH 2XBYA 3MU8A 1GDQA 1GJ9B 4AB8A 2GV6A 1AB9B 3D65E 3U8RH 1QJ6B 1TX6A 1Z1IA 1C2JA 1THSH 3U98H 4YT6H 3EQ0H 3BEUA 1SSXA 2BDCA 3BTKE 3MTYA 3P95A 4NFFA 4GUXA 3A85A 1TB6H 3SGBE 1FPCH 5A0CA 1Y8TA 5J4SA 1JIRA 2A5KA 3KHVA 2ULLA 3Q77A 3TIUA 2ZHEH 2A32A 5JYIA 1VITG 2M5TA 2FM2A 3TLOA 3SNBA 4XE4A 3SJKA 1UTPA 1ELVA 4Y8XA 3B9FH 1FY8E 1T4UH 1O2KA 1FONA 2G8TA 3R0FA 2J34A 1RRKA 1BRAA 4Y11E 5HYOA 3VB7A 1C5YB 5DK1A 3M7TA 1HDTH 1SR5C 2ZHFH 3DHKH 4HZHA 2SFAA 1MTWA 2HPQH 1N8OB 3L6PA 3ITIA 4WH6A 3SI4H 2BD3A 4Q7ZA 4R0IA 1EASA 1NFXA 2R2MB 3L33A 3SU3A 1DDJA 1HPGA 2RA3A 2ILNA 1O37A 1D9IA 2P94A 2TPIZ 3LIWA 5A0AE 4OS5A 4MLFB 5AVDA 1T32A 3MNSA 1ANBA 3ODDA 2XC5A 5GPIB 4NZQA 1TE0A 1TQ7B 2QCYA 3CENA 1DANH 1N6YA 3AAUA 2H1UA 2Z9IA 1O5FH 4MPUA 1EP6A 2XCNA 4BAMB 1O34A 1ARCA 3ZZCA 2GKVE 5IYTA 1YYY1 1MAYA 1HAIH 1QBVH 1GHBF 3DUXH 2HLCA 3P8NA 1GMCG 3ZV9A 2BZAA 2NU3E 1EJNA 1O5GH 4X1QU 1AFQB 1BMLA 2ZU1A 1Y3UA 3KGPA 4U2WA 1MZAA 2ZGJA 1AIXH 1PPHE 2FO9A 5K0HA 1UHBB 3KN2A 1ZHPA 1RJXB 4TPYA 4ISNA 3SORA 5F8XA 3BTQE 4FU9A 5C20A 3PM3A 2BDBA 3TNTA 1CHOF 3A86A 1SGCA 4B74A 1KLJH 3SV2H 4A1XA 1EOJA 1PFXC 3BF6H 1OP8A 3LJOA 4CBOA 3A82A 1UTJA 2FOHA 4JYTA 3WY8A 2Z7FE 4GHTA 2BOKA 4E7NA 2OINA 3QX5H 1IQMA 3M3SA 4X6NA 1NZQH 4JZEH 1AU8A 5L2YH 4KTUA 3DFJA 2I6QA 3SV8A 1GBDA 4RKJB 2VVVA 5F03A 1PQ8A 3L3TA 3GY4A 1PQ5A 1MTNC 2ODYB 4H6SB 4ISHH 1TGCA 4ABBA 1SGRE 3A7ZA 1EATA 4KELA 3D23A 3P17H 1ZMJA 1F5LA 2P3TB 3W95A 1A0LA 3M5LA 3MU4A 3UWIA 2XC0A 3IG6B 1AY6H 1V2OT 2FYRA 1C5QA 5DP3A 1C9TA 1Z1JA 1GMCF 1KXCA 1NFUA 1O32A 1VJ9U 1YLDA 3MU0A 4IN2A 1KXEA 3Q3YA 4ISLA 1LPGB 2OCVB 1XVMA 1OWKA 3PTBA 4B73A 1O39A 5FCKA 5TCAA 2H9TH 4K8BA 2BOHB 1HAXB 2R2WU 3EAJA 2FOBA 1P01A 3VB6A 2XBVA 1G2MA 2QXHA 4XBDA 1QTFA 4FXGH 1C5LH 2TGTA 2ZDNA 1D3TB 3E90B 3T25A 3SUEA 1RXPA 1S6HA 4YLQH 5LPRA 4X2VA 4NIWA 4MPVA 2ZQ1A 1GGDB 1H9LB 2XTTB 1LPZB 1X7AC 4LK4A 1HXEH 5SGAE 1GJBB 4UEHH 1O2HA 1Y3XA 3D49H 5LPEA 2XRCA 4ZUHA 2ZFQH 2VJ1A 1ZMNA 5C1XA 6CHAC 2ZCKP 3O8CA 1KTSB 1TGTA 1GG6C 4NWKA 1SGEE 1PYTD 3P92A 4MNVA 2A7HA 1GI9B 2Q6FA 4WWYA 2BD4A 2H5DA 1INCA 1DICA 3ZZ5A 3AASA 3IITA 1OOKB 1FIWA 1YPJH 1YF4A 1C5OH 2Q6DA 2FLBH 1CA8B 1P04A 2V3OH 1SLVB 2VGCB 1OSSA 4BXSA 2ZDKA 1YPLH 5FX6A 6LPRA 2ODQA 4CHAB 2A2XH 1CA0B 2BD2A 3FAOA 2UUKB 1E37B 3RM2H 4AOQA 4WXVA 1SPJA 3BSQA 2QIQA 4NSVA 2FOCA 2ZCLP 4ZKOU 2VGCC 2ZNKH 1DS2E 5DGJA 4HTCH 3TPIZ 2CF8H 2PHBA 2F9NA 3PV4A 3OY6U 2BDGA 4NFEA 1QJ7B 5DP5A 2ZHDA 3E1XB 1IQJA 3LGVA 5EGMA 1LHCH 3V7TA 1FN6A 4D7FA 3LPRA 1TRMA 2WV4A 1AN1E 2Y82A 2VIDA 4ABEA 1ELBA 4HGCA 1P06A 2PUXB 4E06H 4ABGA 1XVOA 3SHAH 1A5IA 1F5KU 1LQDB 1PPGE 2ZO3H 1GBAA 2WPJS 1JOUB 4XOJA 3RXSA 1AO5A 4O3TA 1BRCE 1O31A 4AYYB 1C5SA 5HM2A 4ABHA 2AYWA 1S81A 1W2KH 3GOVB 1SGPE 1F0UA 3SU0A 1P10A 4K60A 1C5RA 2PV9B 1F0TA 3AAVA 3MNCA 4O9VA 1Z8GA 4FU8A 3GCTF 5GDSH 3BG8A 1EP5A 2Z9JA 2D2DA 2FMJA 5E2PA 3PMAB 1DUEA 1GDUA 1TPSA 4QT8C 3UPEA 4D76A 4A1VA 3LC3A 2FOFA 2EI6A 1MTUA 1AZZA 3QZQA 4RN6A 4GVUA 2WPHS 4OS6A 1C2EA 1AMHA 1VCPA 5FX5A 1UTOA 3P8OA 3RMLH 1L1JA 1MMJN 1BTHH 4WJG2 1EQ9A 2HGTH 2ZGXH 1C1WH 2BVRH 1HNEE 3BTHE 1ZGIA 2P95A 1BB0B 1GJ7B 1VGCC 5HM9A 1GBMA 1P9UA 2OC0A 3EDXB 5ETXA 5BRRE 2NU0E 2NU1E 3QTOH 5JB8S 3UR6A 2Z3DA 2ZFFH 4XBCA 4X6MA 3ZYDA 2R0LA 4K8YA 3EE0B 1C5UA 2GDEH 1RTKA 3RXKA 1CT4E 2GZ7A 3LKWA 4XBBA 3ZVGA 4Y8YA 3OTJE 1ZJKA 3UNQA 1ANEA 2BDAA 3MOCA 1BTXA 4LZ4B 1KXFA 1YPMH 3ZYEA 1CSOE 1H1BA 1TWXB 3S9BA 1YCPM 3GY2A 1OS8A 2UUFB 1RTFB 4Y7AA 4BAOB 1WQSA 2BHGA 3SU1A 4YOJA 2QGRA 1F7ZA 3FP7E 3TH3H 1P11E 3GY3A
chains in the Genus database with same CATH superfamily
3UNSA 3SN8A 3QTVH 1DXWA 1UTQA 4ZMAH 1FPHH 1MD8A 1O36A 1BJVA 2ZU5A 4KKDA 4CHAC 4VGCC 1K1JA 1S85A 1XXDA 2GCTB 3LGUA 1O38A 5FPSA 4FUHA 1A2CH 3MO9A 1HAYB 1P09A 1ZYOA 3RXBA 4D7GA 4FUEA 1DY9A 3FZDA 1UTLM 1GBJA 2SNWA 2ZF0H 3RU4E 3ATLA 1AE8H 1MCTA 1D6RA 2NU4E 4XDEA 1IHSH 2BY6X 4AN7A 1GL0E 3P8GA 1OXGA 3HPTB 1C4V2 1DPOA 1KTTB 2VWMA 2WPIS 4I33A 4ZHMU 1P9SA 4MVNA 5EIYA 2VU8E 3U1IB 4OS1A 4WY3A 2XC4A 1PQ7A 1B7XB 1HCGA 4MPWA 1SLWB 3KQ5A 1RD3B 4DURA 1CE5A 2A4GA 3NK8A 2FXRA 3NPSA 3ESTA 3F2HA 3M3TA 1GHVH 1MBQA 1VR1H 2ZGCA 3ZVDA 4ZXYH 4OS2A 1P03A 3SGQE 3M61U 3S7HB 1TOCB 1P2NA 2UWPA 3LH3A 5CHBA 2AH4X 1O2RA 2GZ8A 2QYIA 2FYQA 1Z8RA 1PPZA 4MNXA 1RIWB 6ESTA 2C8YB 5EOKA 2F43B 2BLQA 3QGJA 2ZKSA 5T6FA 2ZTZA 1NU9A 1QY6A 1NU7B 3RXCA 1O2JA 2FOAA 2A4RA 2F9PA 2QV1A 1QCPA 3OAAD 3BEIB 2PLXA 1O3CA 3V13A 3ZVCA 3PLPA 1K22H 2WZQA 2KZ4A 3MH7A 1KIGH 5GIBA 3SU4A 4RI0A 1O2PA 3PRBA 5FBEA 1ELEE 5FXLA 3F1SB 3A8AA 4X8TH 3HKJB 1C2GA 2XWBI 4YZUA 2ZG0H 1C4U2 1AD8H 1C5VA 1MTVA 4NWLA 3RXJA 2BDYA 2JH5D 3RDZA 1HB0B 4FUIA 1BBRE 2V6NA 3OX7U 1SOZA 1AVWA 3KCGH 4ZXXH 1IAUA 2GCHF 5DSFA 1Y5BT 2O8TA 1BMMH 1QBNA 3KYGA 5HIYA 1W8BH 2HVXA 2VNTA 2B9LA 5L6NH 3LDXH 1GI0A 1YPKH 1W0JD 3LGTA 3O8BA 3QDZB 1ETSH 4CR9A 4VGCB 4Y76A 1L1NA 1E36B 3VGCC 2PTNA 2ALVA 1BDAA 1GBCA 4TT3D 1A46H 2W7SA 2G00A 2IPHA 3DD2H 2GZ9A 4DVAU 3M5OA 1A3EH 1ZSLA 1OKXA 2B7DH 1LHDH 1EZXC 4NIVA 4Q7YA 1O3LA 2L74A 4DOQA 4M7GA 1WV7H 4H4FA 1CGIE 1TNLA 1CBWB 2JH6D 3LGWA 2ZPRA 1NS3A 1E35B 2HPPH 4DW2U 2DE8A 1A4WH 2J9NA 3K6YA 2FPZA 3BTGE 1GCDA 3OE7D 2QA9E 5BPEA 4FVBA 1K1MA 1TMUH 2A4OA 3RXDA 1DM4B 3SJOA 2V7QD 1ABJH 2BY5X 1FLEE 1JMOH 4NA8A 2ZA5A 2FDAA 3A83A 4K69A 2R3UA 7ESTE 1DUAA 5EPNA 3SU6A 2A5IA 1DVAH 3RMNH 3ATMA 4Y0YE 2HNTF 1TA6A 3QK1A 5DKMA 1L0ZA 4CRDA 1SMFE 3E0PB 3HGNA 4IC6A 3P70B 1V2QT 4A5TS 1JBUH 1QB6A 4JYVH 2JETC 4Y10E 4YOGA 3PROA 5E2OA 2AIQA 2BD7A 4IMQA 5DP9A 1EJAA 1H8HD 1ELDE 3UQOA 2GT8A 2HRVA 3M7UA 1NRQH 1GI2A 3F68H 4O3UA 2A4QA 5DG6A 5C67A 5LH8A 4UDWH 5TCCA 1O3IA 4WH8A 1AI8H 2W3IA 4WMFA 1ESBA 1BBRK 3RMOH 1TRYA 2V35A 1FN8A 3SZNA 1XM1A 3UREA 1T31A 4IS5A 1HYLA 2WYJA 3SQHE 4NIXA 3MO3A 1P2MA 4Q2KA 1O2OA 4CR5A 1W14U 1T8NA 1W3CA 3ZZ3A 3GYLB 1QURH 3SU5A 5C1UA 1O5EH 3TJVA 2J97A 4IMZA 1Y5AT 5K7RA 3OSYA 1AQ7A 1LHEH 1QR3E 4YESB 2P93A 3WW7A 3S9CA 1C1TA 5EQRA 2ANWA 2RCEA 4CH8B 4AFQA 2BZ6H 4I7YH 2ANYA 1VITH 1C5NH 3ZZ4A 4JZDH 1TALA 1VKYA 5L30H 4BAKB 3FANA 1NPMA 3ZVAA 1C1RA 1CO7E 1HV7A 1BOQA 1P3CA 3H7OA 5FHTA 4F4OC 1GI8B 3QLPH 3TJUA 3GY7A 4UONA 2GVFA 5C0UA 2BQ7B 3URCA 5T1VA 1THPB 3RXPA 4K3JA 3S0NA 3DA9B 4ISIH 1NROH 1A5GH 1MKWK 1GCTC 4CRBA 2KCAA 3EE7A 4FUBA 1J17T 2FS8A 1V2RT 2P3FH 2TIOA 4AG2A 1O2SA 1ZRBA 3VGCB 3VB4A 2BMGB 4SGAE 1BHXF 5JBAS 3I78A 1F0RA 2ZHQH 1QRWA 1S6LA 1ZPZA 1J9CH 1UCYE 2OC8A 5E0JA 1O2IA 1MH0A 2CJIA 3SJ8A 1ZHMA 1AFQC 7LPRA 1SHYA 3FOAA 3MH5A 3H5CB 1NO9H 5FAHA 1TA2A 2PSYA 4ESTE 2SGEE 2XNIA 3KQCA 2L6OA 1TNIA 2QXGA 8GCHG 5GJ4B 2BY8X 1IQKA 1GL1A 8KME2 2V3HH 1O2NA 1OWDA 1WTHD 1QL8A 1OX1A 2BD9A 4B2AA 4TY6A 2HNTC 2M2AA 1MKXH 4TWWA 1C2DA 1O2VA 1ELCA 3KIDU 2WHXA 2JJ2D 3M7QA 1O3OA 1BMNH 1V3XA 5B6LA 3A84A 1SG8B 1HAZB 1P2JA 2VH6A 1GI7B 3FZZA 3EA8A 2XOKD 2HVYB 1UK2A 1FNIA 1LVMA 3SOSA 3SV7A 1P12E 4ZROA 1SFQB 3CP7A 2QAAA 4TWYA 2AGIX 1YLCA 1EAWA 2ASUB 3GY5A 1H4WA 4K1TA 1EPTB 3GCNA 1D3QB 1ZTLA 5C2ZA 2PKAA 2FI4E 1GBHA 3MYWA 1BRUP 1TQ0B 2TGPZ 2BLWA 5C1YA 2TBSA 4MPXA 1ZRKA 1XUJA 3GCTG 2PFEA 3R3GB 3GCHC 1L4ZA 1WOFA 1DLEA 1EXFA 1N1LA 2BB4A 1XXFA 3DSGA 3PLKA 4AFSA 2HWLB 1YBWA 3DCLA 4GCHF 2HOBA 5L2ZH 2G5NA 2WYGA 4U30A 3A88A 1N6XA 2SGFE 2NWNA 3MH6A 1GHAG 2OP9A 1ZJDA 2ZZUH 3ZZAA 1GBFA 1BIOA 2ZFRH 2GMTC 2Z3EA 4NIYA 3UNRA 5GNDA 2CK3D 3CS0A 1G2LA 4UFDH 1DXPA 1JIMA 3T5FH 1QHRB 4AG1A 4JCNA 3JZ2B 1AWHB 1FJSA 4LOYH 1WBGB 5AFZH 1QQ4A 4I31A 1T8OA 1K1LA 1BTUA 1LHGH 1GMDF 5FPTA 3M3VA 3MHWU 1AVXA 1ZTJA 1RFNA 1XKBC 3EYDA 2BD5A 2Z9KA 3F2FA 3VPKA 5FBIA 1O3FA 4AB9A 3E91A 1GJ8B 1QGFA 5E0GA 8ESTE 5KGOA 2G81E 2VINA 1GBLA 1GG6B 4BAQB 3RLYH 5CHAB 1ZSJA 3ODFA 1V6DA 1TIOA 3OY5U 2WUBA 4NZLA 1MQ5A 1P8VC 2F3CE 3V3MA 1CQQA 1FMGA 5DO4H 1TGSZ 2AMPA 2ZDLA 2O8MA 3FKSD 3MMGA 3OU0A 2FX4A 2CHAC 4DIIH 1GBIA 1OYQA 4DG4A 1GI3A 4ZCNA 2Y5GA 2JKHA 3E16B 1ID5H 1FI8A 3V0XA 3LOXA 2THFB 4X0WU 1FAXA 1GHXH 4B76A 1NFWA 3BTME 2C8ZB 4RKOB 6GCHG 1ZPBA 2A7CA 2A2QH 3CS7A 2ZWLH 2HALA 2VIWA 4M9FA 1AKSA 1OYTH 3ZZDA 4X8SH 3BG4B 5ABWA 4OGXA 1SC8U 1NRSH 1V2MT 3LONA 2DE9A 1MU8B 1XUKA 2AFQB 4TY7A 2YNBA 3O8RA 1KMHB 2G4UA 3UQVA 3SUGA 1G3BA 3TVJB 2FIRH 2H9EH 2VVCA 2EI8A 1TGNA 1O0DH 1C2HA 4MNYA 1SB1H 3UTUH 3UY9A 3ENSB 4I8GA 1A5HA 2C8XB 2B0FA 5EQSA 3SI3H 4BTTB 4AFUA 1BT7A 4HFPB 1P2KA 1OHHD 2WPMS 2XBXA 2AIPA 2BVXH 1G37A 1F0SA 1AZ8A 3TJOA 1IQIA 5EG4A 1SGFA 3TK9A 4D8NA 3RXHA 2OXSA 1ZHRA 1IQLA 1TBZH 2Z9GA 1SOTA 2DUCA 2KFWA 1K1OA 4TYDA 3E6PH 1O5CB 1C1PA 1C1SA 1W0YH 2GDDA 2QF3A 1YPEH 1YGCH 2B8OH 3Q3KA 1O2XA 4Y8ZA 1KDQB 2KCOA 1EOLA 2ZEBA 5J4QA 3VXEH 1O5AB 3M5MA 1W12U 2QY0B 5A8XA 1FAKH 1WTGH 2HNTE 2P16A 1IQEA 2J92A 4YT7H 1C2LA 1KXBA 2BQWB 1HAPH 3RC4A 1GJDB 1JXPA 1KLIH 2ZDMA 3OTPA 4NA7A 2STAE 4FU7A 3BTTE 2C4FH 1GVLA 4YO9A 3SBKA 1C4Y2 1K9OE 2ZFSA 2A7JA 1C1OA 1Y3VA 4BTUB 1SGQE 1J16A 1S6FA 1TPPA 1HJAC 4AZ2B 5A09A 3HK6B 3NCLA 2A1DB 2O8LA 1QRXA 3ATKA 2YNAA 1QIXB 1HAVB 1UJ1A 1TOMH 1NFYA 1P05A 2RDEA 4FUDA 3W94A 3TJNA 2NU2E 3F9EA 1SGIB 1T8MA 2CHAB 1HLTH 1TMTH 4YOIA 1H8IH 1HJAB 1MD7A 4IBLH 4I8HA 4K5ZA 4CRGA 5AHGH 3BIUH 4KTSA 1OP0A 2Q1JA 5EW2H 2PTCE 2ZGBH 2BLOA 4X2YA 1C2KA 2TGDA 2XW9A 4CBNA 4ZKSU 1G36A 1NC6A 3TU7H 1GHZA 1HIAB 1XUFA 1PJPA 3PRDA 4Y79A 1LVOA 3ZVBA 3LJJA 1CHOG 3RMMH 5CE1A 1C1NA 4ZKNU 2ZDVH 1HIAA 3SW2B 3LGYA 5EODA 1THRH 1O2LA 2Y6TA 2J4IA 3KQBA 5I46H 1Q3XA 2VIPA 1GI5A 1LVBA 1TNJA 3PMBB 2Q6GA 1HUTH 1GBTA 3RXEA 1CHGA 1LMWB 1YM0A 4E05H 1UVUH 4PROA 2AMDA 3LGIA 4B2CA 4GLYA 3RXAA 2LNCA 4O03A 4JK5A 1MZDA 1BZXE 1EB1H 3TNSA 2YMSB 3LC5A 3DSOA 1VCWA 1G3EA 1HAVA 1TAWA 2Y81A 1F92A 1Y59T 1NN6A 2KAIB 4MG3A 2O8UA 4Q7XA 1OWJA 2EC9H 4HG6A 1MTSA 1QQUA 1GVZA 3HATH 3UWJH 4WF8A 5EJ1A 1FY5A 1ESAA 2WPKS 3ZZ9A 4XRNA 1MUEB 3JZ1B 2OQUA 2H6MA 1K2I1 5FCRA 1NRRH 5EQQA 1P02A 3HGPA 1ESTA 3AW1A 2ANMH 5G4BA 2EEKA 3RU4D 3UIRA 2OD3B 3VB3A 1C5PA 2VWOA 5FPYA 3FP8E 4JMYA 3SO3A 2G52A 5B6OA 1HJ9A 1ZSKA 4THNH 1C1QA 4Z1MD 1GHBG 1DSTA 4DT7B 1W11U 2RFKC 4ZHAA 4GPGA 1XMNB 2UWLA 3UB0A 1WU1A 1XX9A 3GISB 1GHAF 1YY3A 5DP7A 1J14A 3BTWE 8GCHF 1FX0B 2GP9B 1QJ1B 1TNKA 1UW7A 1GBEA 1UO6A 3ATWA 3GCOA 2J38A 5F8ZA 3PWBA 5GCHG 1K1PA 3F9HA 1UK4A 2WUCA 2STBE 2Y7XA 2AHME 1DT2A 3RXLA 4B1TA 4JZFH 3SJ9A 1MU6B 2F9BH 3STJA 2WPLS 1DY8A 5EPYA 1YCPH 4X8UH 4DJZB 1D3PB 3PWCA 1D3DB 2WSSD 1P2IA 4ZKRU 1LCYA 1Q2WA 2BYAX 3B8JA 5ESTE 4LZ1H 1TONA 2ZFPH 3SGAE 3F3BA 1O3JA 3A7XA 1FY3A 4FUFA 1PQAA 2ODPA 4NG9H 3MU1A 2IOTA 3M36A 1UVOA 4WXIA 3P8FA 1ZLRA 2OTVA 1GMDG 2B5TB 5GXPA 1DWBH 3EA7A 1H9IE 3F9FA 1TBQH 4K2YA 1Z8IB 4NGAH 1G32B 2UUYA 2WINI 3RC5A 2W3KA 2OUAA 5JB9S 2FOGA 1P2QA 5LPFA 1ZMLA 2FTMA 2ZTXA 2ANKH 5AFYH 1Z6EA 4A7IB 3A7YA 1F5RA 1VGCB 1O30A 1SGTA 4YTAA 3RXMA 5IK2D 3N7EA 1ZGVA 1NY22 3OEHD 1ETRH 4MQAA 2BX3A 2VIVA 4FOUC 4A6LA 2AGGX 3TK5A 1EX3A 4X2WA 3T2NA 3N7DA 4TSFD 2KCYA 4X6PA 5JBBS 3FFGA 1YKTA 1O3DA 2O9QA 1BA8B 1GI1A 1B5GH 1TMBH 1YWUA 1YCPK 1XUIA 3AK5A 2ZPQA 3RXVA 4B75A 1ZPCA 2QC2A 1AUTC 1OP2A 1O35A 1HRTH 4NCYA 3BG4C 1QNJA 4X1SU 1QBOA 2ESTE 1A7SA 2Y80A 3DSPA 3RM0H 3G01A 2Z94A 3N7OA 1BUIA 1GJ5H 2XCFA 1SHHB 1NRNH 1G3CA 3T26A 1C5WB 1DWCH 1RS0A 1O33A 2JJ1D 1LPKB 1W0ZU 1DITH 1XKAC 3KF2A 3KQDA 2LPRA 3KYFA 1C2MA 4ABIA 5DJ7A 1O3KA 1FIZA 1QZ8A 3NUMA 2GJGA 2OBQA 4JK6A 3NXPA 1MTNB 2F9OA 3PMHB 3MWIU 2H9HA 2RA0A 4UFEH 2WV5A 1PPCE 5E8EH 1V2UT 4I32A 5C0TA 1ZR0A 4Y71A 5H4IB 2PUQH 1NESE 2GGVB 2OC1A 4OS4A 4Y6DA 1QFKH 4ABDA 9ESTA 1HBTH 1T4VH 1O2ZA 2VWLA 5HKKD 1K21H 1SGDE 1GHWH 1IQHA 1HAGE 3MU5A 2FLRH 1GBBA 3A7TA 1Q31A 2C8WB 1LQEA 3ZZ7A 4YXWD 3HK3B 1AVGH 1S5SA 1NM6A 1TGBA 1FXYA 1KXAA 1ANCA 2PKAB 3TH4H 1S84A 2W5EA 3A8BA 1DWDH 1O3PB 2J5UA 3H7TA 2VWNA 1O5DH 1O2TA 1AHTH 1DLKB 1OWHA 4X8VH 2QXJA 1EZSC 3K9XB 1ELAA 1RIWC 1L2EA 1V2VT 1SQOA 1EPTA 4E7RG 2ZGHA 3GY8A 2P8OB 3ZZ6A 1Z7KA 2K1QA 5TJXA 1E0FD 1UCYH 3TGJE 1B0EA 4X6OA 3NWUA 2V3MA 3GYMA 3AW0A 7GCHG 2XNDD 2A45B 3T28A 3ZVEA 1YPHE 2CN0H 1WCZA 1SI5H 1QB9A 1SQAA 3I77A 1LVYA 1CA0C 3ZV8A 2P59A 1NRPH 1O2WA 2FZZA 3QWCH 5CMXH 1K0HA 3HKIB 2OQ5A 2CV3A 6CHAB 3RXUA 1CVWH 3Q3XA 1CT2E 2D26C 3T62A 1P57B 3VB5A 4HI3A 2GD4B 1SGNE 4KTCA 1WAYB 3SV6A 4Y7BA 1FY4A 2XBWA 2GCTC 3BV9B 2H5CA 5EXMA 4Q63A 1IOEA 4X2XA 4KP0A 3C27B 5EW1H 1C2FA 1O3NA 1Z6JH 1SQTA 5A2MH 4KGAA 1MKWH 2ZQ2A 3D62A 5DP6A 3E8LA 1BTPA 3PYHA 3SNAA 1C5XB 1V2PT 3UOPA 1W7GH 4BXWA 2R9PA 1G3DA 1M9UA 2FODA 4IN1A 2UWOA 2YMSC 2R0KA 4GSOA 1BMAA 1C1UH 1Z71A 1LO6A 2AGEX 3BEFB 4B71A 2BDHA 4YM9A 2SGQE 2F9VA 1XUGA 1COWD 1QL9A 1BTYA 1O3BA 2CF9H 1EAIA 1U6QA 2AERH 2OLGA 1CBWC 4UE7H 2O8WA 1S82A 1V2KT 5T3HA 8LPRA 1DSUA 1VZQH 3A7VA 3A7WA 3K65B 2BDIA 2I6SA 5JBTA 3EA9A 3W1EA 1BQYA 1TABE 1K28D 5F8TA 1TPOA 4ABFA 1YC0A 4INLA 1DE7H 1EJMA 5F6MA 5KECA 4CH2B 1TRNA 1G9IE 3RXQA 1ZTKA 3TH2H 4MTBA 2JIZD 1MQ6A 3SV9A 3FP6E 3C1KA 1DWEH 3UAIC 1IQFA 2D8WA 3IWMA 2D1JA 2F9UA 1JRSA 2KAIA 5DN6D 2UUJB 5A0BA 2ZDAH 4BNRA 1E34B 2VIOA 2EI7A 3ZIAD 1OWIA 1O3HA 1CGHA 3PMJA 3Q76A 2P8OC 2ZPSA 2CGAA 1KLTA 1QB1A 1E1QD 1RTLA 5AF9H 4BOHA 1TNHA 3TK6A 2LP6A 4O97A 1TNGA 2RG3A 2A31A 4Q4LA 3MO6A 1KY9A 2BXUH 4X1NU 3U28C 2ZC9H 3GDSA 1AKSB 2KR7A 5GCHF 3TITA 1Z8JB 3RXIA 5C5NA 1GGDC 1QA0A 2AMQA 4JZ1A 2FI3E 3RXTA 6GCHF 1HGTH 4WMEA 2GMTB 3CNRA 3V12A 4B2BA 2OBOA 5JPMH 1BBRH 4CRFA 4ACBA 1C5ZB 2BVSH 1H8ED 3E3TA 1BMFD 3EGKH 3GS9A 1GI6A 1D4PB 1QRZA 4ACAA 1O2QA 3SU2A 2XWAA 4A1TA 1TX7A 3O8DA 3FVFB 2F4LA 4RSPA 2VH0A 4WVPE 3F0OA 5T6GA 4BAHB 1J8AA 1VJAU 3QZRA 4GCHG 2ZI2H 1ELGA 1RGQA 1E1RD 3KNXA 3SHCH 2G55A 2FI5E 1CT0E 1DOJA 1HJ8A 4D9QA 1OWEA 1UVPA 1L1GA 4FETA 1VITF 2ZP0H 4MNWA 1L4DA 3RXFA 2BD8A 3SYJA 4U32A 1A61H 1BRBE 1IQGA 3H09A 1KXDA 4I8KA 1C2IA 3LT3A 2YOLA 3RLWH 3OYPA 1C1MA 4IW4E 3A8CA 3RUOA 3M35A 4Z6AH 2ALPA 2BY9X 3SNCA 2TGAA 4TPIZ 1W13U 1ZOMA 1GJ6A 2BXTH 2V0BA 1TFXA 2C93B 4ZHLU 1ELTA 4LXBH 1F2SE 1AE5A 1BHXB 1TPAE 2FESH 1SFIA 5EXLA 1SLUB 1TBRH 4Z0KA 2C90B 2QN5T 2J2UA 3RXOA 3KEEA 1WYKA 1KDQA 5C17A 1C1VH 3K2UA 2PKSB 3PB1E 1T7CA 1LHFH 1O2MA 5EU8A 4FUCA 4AGJA 1W7XH 3FN8A 4BTIB 2Z6BD 3A89A 1HAHH 4AFZA 1YPHC 9LPRA 1HXFH 2PKSC 2FX6A 1LDTT 1Y5UT 3KL6A 3PLBA 1H9HE 4ZH8A 2WPDD 3S9AA 2A5AA 1UTKA 1UHBA 4UFGH 4IGDA 1GHYH 1AFEH 2PR3A 1EUFA 3SJIA 2JH0D 4DT4A 3SUFA 4Y0ZE 4ASHA 3STIA 3BTFE 4ABJA 1D6WA 4JZIA 3T27A 2PGQB 2P3UB 1EZUC 1O5BB 2BM2A 1QA7A 1O2GH 4INKA 3MI4A 1UVSH 3P6ZB 2W7UA 2ZU4A 1IHTH 1FDPA 2W26A 2ZU2A 2ZIQH 1CU1A 1TLDA 3Q00A 1XUHA 4F49A 1V2NT 1GDNA 2G5VA 4UD9H 3F2GA 3UOUA 1K1IA 4R8TB 2BX4A 1BTWA 3UFAA 1ELFA 3PO1C 3WWBA 2EQNA 2QE7D 7GCHF 4CRAA 3BTDE 3F0PA 2BQ6B 4X1PU 3U1JB 3S69A 4OGYA 3MNXA 1C9PA 1A1RA 3E0NB 5E0HA 2Y5FA 2GTBA 3QN7A 1SQRA 4H42U 4NSYA 4AX9H 1H8DH 1K1NA 1GJ4H 3PO1B 4RT0A 4X1RU 3TGIE 1WSSH 1SGYE 1ARBA 1JWTA 3RXGA 4OS7A 2QXIA 1EAXA 2K0QA 1JRTA 2BLVA 1SBWA 1S83A 4J1YA 2FWWA 1A0HB 1SLXB 1YP9A 1MAXA 2KCPA 2Y7ZA 1AWFH 1ANDA 1WQVH 1PPFE 3DFLA 3SNDA 1CGJE 1V2TT 4I86A 3VXFH 2F83A 1V2JT 3RC6A 3SNEA 1G30B 1O2YA 2VIQA 2VB0A 2FP7B 4ISOA 4ZAEA 5A8ZA 1MBMA 1PPBH 3M5NA 2ZU3A 5EXNA 1WXRA 2G51A 1IQNA 1GJAB 3QO6A 4Q80A 2Z3CA 3BN9A 1TYNA 5GWZA 2GX4A 3GICB 3K6ZA 4UFFH 1P2OA 5T6DA 1HAOH 1GBKA 3GDVA 2QF0A 1UVTH 1PPEE 1GJCB 2AS9A 7KMEH 1W10U 3ZZBA 4J2YB 2FS9A 3U8OH 4K1EA 3PTNA 1GMHG 1E38B 1KYNA 1BCUH 3MH4A 2OK5A 2JETB 2IJOB 4JYUH 5LGOA 4BANB 2SGPE 1LTOA 1SL3A 1ZZZA 3BIVH 1O3GA 1V2ST 4NA9H 3RXRA 1GI4A 1KSNA 4H6TA 4GAWA 1UTMA 2FOEA 3DT0H 1GMHF 2Z9LA 4FUGA 2F91A 2BY7X 2A0QB 3A87A 1ORFA 2FOMB 2GV7A 1OPHB 3ELAH 1O3MA 3GY6A 2PSXA 3MFJA 5DP4A 2IN2A 2GT7A 1C5TA 1O3AA 5IDKA 3LH1A 3GCHB 2PP6A 5I25A 1V2LT 1HFDA 2EY4C 3A80A 1O2UA 5DP8A 3OFND 1EB2A 2BTCE 1W0KD 3U9AH 1BJUA 3B23B 4AORA 2ZTYA 1UK3A 1EPTC 2AEIH 4ABAA 5DPAA 1PYTC 4I8LA 3NZIA 1FUJA 1ACBE 1T8LA 2XXLA 3RU4T 1DFPA 3I29A 1BTZA 2SGAA 1NTPA 3F6UH 4DY7B 1V2WT 3BTEE 1MCVA 3S7KB 4FVDA 4AGKA 4D9RA 1NT1A 3ZVFA 1O3EA 1QL7A 4K1SA 2GCHG 1A0JA 3SQEE 4A92A 1YPGH 3TGKE 3GDUA 4CRCA 5A8YA 2J95A 1S0RA 1J15A 2ZCHP 1UMAH 1VCQA 1EZQA 1GCTB 5C5OA 4XSKU 1AUJA 2PGBB 3PV2A 1GVKB 2ZECA 5ESBA 3U69H 1MABB 2FEQH 2FTLE 2Y5HA 1TX8A 1UTNA 3RP2A 1C5MD 4FUJA 4IC5A 2ZFTA 3F9GA 5JDUB 1FY1A 2G4TA 4I8JA 1SVPA 2HLDD 3QGNB 1B0FA 1BITA 4DGJA 4GHQA 1UCYK 3SUDA 3AVZA 3LU9B 3KQEA 4DCDA 1N8OC 1SGFG 1Y3WA 3MNBA 4P02A 1GPZA 2ZHWH 1S0QA 2H2ZA 2PWXA 1EAUA 2PW8H 5C3NA 1MKXK 1LKBA 1P0SH 2VVUA 1ETTH 2J94A 3URDA 4WMDA 3VFEA 2SGDE 5JBCS 1FQ3A 1EKBB 2CMYA 1DX5M 2EA3A 3ZZ8A 1AGJA 4AYVB 3NKKA 2IPQX 5C94A 2J98A 4F55A 4DIHH 4YLUA 5HXFA 4U01A 2OC7A 4CREA 1Y3YA 3U8TH 3A81A 3UR9A 3VEQB 5CHAC 5FL7D 4XFQA 4MDSA 5HMAA 1FZZA 3T29A 1GWAA 3A8DA 1AB9C 1P3EA 4SGBE 3UUZA 2C3SA 2SNVA 5EJLA 1ABIH 4INHA 2XYAA 2RDLA 3ATIA 5PTPA 3M37A 2CXVA 5HGGA 1FV9A 1LKAA 1A3BH 2R3YA 3QUMP 2TRMA 1WUNH 2XBYA 3MU8A 1GDQA 1GJ9B 4AB8A 2GV6A 1AB9B 3D65E 3U8RH 1QJ6B 1TX6A 1Z1IA 1C2JA 1THSH 3U98H 4YT6H 3EQ0H 3BEUA 2VBCA 1SSXA 2BDCA 3MQKC 3BTKE 3MTYA 3P95A 4NFFA 4GUXA 3A85A 1TB6H 3SGBE 5F53A 1FPCH 5A0CA 1Y8TA 5J4SA 1JIRA 2A5KA 3KHVA 2ULLA 3Q77A 3TIUA 2ZHEH 2A32A 5JYIA 1VITG 2M5TA 2FM2A 3TLOA 3SNBA 4XE4A 3SJKA 1UTPA 1ELVA 4Y8XA 3B9FH 1FY8E 1T4UH 1O2KA 1FONA 2G8TA 3R0FA 2J34A 1RRKA 1BRAA 4Y11E 5HYOA 3VB7A 1C5YB 5DK1A 3M7TA 1HDTH 1SR5C 2ZHFH 2YMSD 3DHKH 4HZHA 2SFAA 1MTWA 2HPQH 3N99A 1N8OB 3L6PA 3ITIA 4WH6A 3SI4H 2BD3A 4Q7ZA 4R0IA 1EASA 4XD7D 1NFXA 2R2MB 3L33A 3SU3A 1DDJA 1HPGA 2RA3A 2ILNA 1O37A 1D9IA 2P94A 2TPIZ 3LIWA 5A0AE 4OS5A 4MLFB 5AVDA 1T32A 1NBMD 3MNSA 1ANBA 3ODDA 2XC5A 5GPIB 4NZQA 1TE0A 1TQ7B 2QCYA 3CENA 1DANH 1N6YA 3AAUA 2H1UA 2Z9IA 5KEDA 1O5FH 4MPUA 1EP6A 2XCNA 4BAMB 1O34A 1ARCA 3ZZCA 2GKVE 5IYTA 1YYY1 1MAYA 1HAIH 1QBVH 1GHBF 3DUXH 2HLCA 3P8NA 5CDFE 1GMCG 3ZV9A 2BZAA 2NU3E 1EJNA 1O5GH 4X1QU 1AFQB 1BMLA 2ZU1A 1Y3UA 3KGPA 4U2WA 1MZAA 2ZGJA 1AIXH 1PPHE 2FO9A 5K0HA 1UHBB 3KN2A 1ZHPA 1RJXB 4TPYA 4ISNA 3SORA 1SKYE 5F8XA 3BTQE 4FU9A 5C20A 3PM3A 2BDBA 4P00A 3TNTA 2QF5A 1WDIA 1CHOF 3A86A 1SGCA 4B74A 1KLJH 3SV2H 4A1XA 1EOJA 1PFXC 3BF6H 4RT1A 1OP8A 3LJOA 4CBOA 4B6EA 3A82A 1UTJA 2FOHA 4JYTA 3WY8A 2Z7FE 4GHTA 2BOKA 4E7NA 4F48B 2OINA 3QX5H 1IQMA 3M3SA 4X6NA 1NZQH 4JZEH 1AU8A 5L2YH 4KTUA 3DFJA 2I6QA 3SV8A 1GBDA 1YLNA 4RKJB 2VVVA 5F03A 1PQ8A 3L3TA 3GY4A 1PQ5A 1MTNC 2ODYB 4H6SB 4ISHH 1TGCA 4ABBA 1SGRE 3A7ZA 2W6ID 1EATA 4KELA 3D23A 3P17H 1ZMJA 1F5LA 2P3TB 3W95A 1A0LA 3M5LA 3MU4A 2KM0A 2QF4A 3UWIA 2XC0A 3IG6B 1AY6H 1V2OT 2FYRA 1C5QA 5DP3A 1C9TA 1Z1JA 4AC9A 1GMCF 1KXCA 1NFUA 1O32A 1VJ9U 1YLDA 3MU0A 4IN2A 1KXEA 3Q3YA 4ISLA 1LPGB 2OCVB 3VG8A 1XVMA 1OWKA 3PTBA 4B73A 1O39A 5FCKA 5TCAA 2H9TH 4K8BA 2BOHB 1HAXB 2R2WU 3EAJA 2FOBA 1P01A 3VB6A 2XBVA 1G2MA 2QXHA 4XBDA 1QTFA 4FXGH 1C5LH 2TGTA 2ZDNA 1D3TB 4B6FA 3E90B 1NBME 3T25A 3SUEA 1RXPA 1S6HA 2JDID 4YLQH 5LPRA 4X2VA 4NIWA 4MPVA 2ZQ1A 1GGDB 1H9LB 2XTTB 1LPZB 4OM9A 1X7AC 4LK4A 1HXEH 5SGAE 1GJBB 4UEHH 1O2HA 1Y3XA 3D49H 5LPEA 2XRCA 4ZUHA 2ZFQH 2IJD1 2VJ1A 1ZMNA 4ASUD 5C1XA 2ZCKP 6CHAC 3O8CA 1KTSB 1TGTA 1GG6C 5EJZA 1EFRD 4NWKA 1SGEE 1PYTD 2KX4A 3P92A 4MNVA 2A7HA 1GI9B 2Q6FA 4WWYA 2BD4A 2H5DA 1INCA 1DICA 3ZZ5A 3AASA 3IITA 1OOKB 1FIWA 1YPJH 1YF4A 1C5OH 2Q6DA 3FO8D 2FLBH 1CA8B 1P04A 2V3OH 1SLVB 2VGCB 1OSSA 4BXSA 2J98B 2ZDKA 1YPLH 5FX6A 6LPRA 2ODQA 4CHAB 2A2XH 1CA0B 2BD2A 3FAOA 2UUKB 1E37B 3RM2H 4AOQA 4WXVA 1SPJA 3BSQA 2QIQA 4NSVA 2FOCA 2ZCLP 4ZKOU 2VGCC 2ZNKH 1DS2E 5DGJA 4HTCH 3TPIZ 2CF8H 2PHBA 2F9NA 3PV4A 2LELA 3OY6U 2BDGA 4NFEA 1QJ7B 5DP5A 2ZHDA 3E1XB 1IQJA 3LGVA 5EGMA 1LHCH 3WWFA 3V7TA 1FN6A 4D7FA 3LPRA 1TRMA 2WV4A 1AN1E 2Y82A 2VIDA 4ABEA 1ELBA 4HGCA 1P06A 2PUXB 4E06H 4ABGA 1XVOA 3SHAH 1A5IA 1F5KU 1LQDB 1PPGE 2ZO3H 1GBAA 2WPJS 1JOUB 4XOJA 3RXSA 1AO5A 4O3TA 1BRCE 1O31A 2W6JD 4AYYB 3NRLA 1C5SA 5HM2A 4ABHA 2AYWA 1S81A 1W2KH 3GOVB 1SGPE 1F0UA 3SU0A 1P10A 4K60A 1C5RA 2PV9B 1F0TA 3AAVA 3MNCA 4O9VA 1Z8GA 4FU8A 3GCTF 5GDSH 3BG8A 1EP5A 2Z9JA 2D2DA 2FMJA 5E2PA 3PMAB 1DUEA 1GDUA 1TPSA 4QT8C 3UPEA 4D76A 4A1VA 3LC3A 2FOFA 2EI6A 1MTUA 1AZZA 3QZQA 4RN6A 4GVUA 2WPHS 4OS6A 1C2EA 1AMHA 5HIZA 1VCPA 5FX5A 1UTOA 3P8OA 3RMLH 1L1JA 1MMJN 1BTHH 4WJG2 1EQ9A 2HGTH 2ZGXH 3PV5A 1C1WH 2BVRH 1HNEE 3BTHE 1ZGIA 2P95A 3OEED 1BB0B 1GJ7B 1VGCC 5HM9A 1GBMA 2K8IA 1P9UA 2OC0A 3EDXB 5ETXA 5BRRE 2NU0E 2NU1E 3QTOH 5JB8S 3UR6A 2Z3DA 2ZFFH 4XBCA 4X6MA 3ZYDA 2R0LA 4K8YA 3EE0B 1C5UA 2GDEH 1RTKA 3RXKA 1CT4E 2GZ7A 3LKWA 4XBBA 3ZVGA 4Y8YA 3OTJE 1ZJKA 3UNQA 2WV9A 1ANEA 2BDAA 3MOCA 1BTXA 3SZEA 4LZ4B 1KXFA 1YPMH 3ZYEA 1CSOE 1H1BA 1TWXB 3S9BA 1YCPM 3GY2A 1E79D 1OS8A 1RTFB 2UUFB 4Y7AA 4BAOB 1WQSA 2BHGA 3SU1A 4YOJA 2QGRA 1F7ZA 3FP7E 3TH3H 1P11E 3GY3A
chains in the Genus database with same CATH topology
3UNSA 3SN8A 3QTVH 1DXWA 1UTQA 4ZMAH 1FPHH 1MD8A 1O36A 1BJVA 2ZU5A 4KKDA 4CHAC 4VGCC 1K1JA 1S85A 1XXDA 2GCTB 3LGUA 1O38A 5FPSA 4FUHA 1A2CH 3MO9A 1HAYB 1P09A 1ZYOA 3RXBA 4D7GA 4FUEA 1DY9A 3FZDA 1UTLM 1GBJA 2SNWA 2ZF0H 3RU4E 3ATLA 1AE8H 1MCTA 1D6RA 2NU4E 4XDEA 1IHSH 2BY6X 4AN7A 1GL0E 3P8GA 1OXGA 3HPTB 1C4V2 1DPOA 1KTTB 2VWMA 2WPIS 4I33A 4ZHMU 1P9SA 4MVNA 2VU8E 3U1IB 4OS1A 4WY3A 2XC4A 1PQ7A 1B7XB 1HCGA 4MPWA 1SLWB 1RD3B 4DURA 1CE5A 2A4GA 3NK8A 2FXRA 3NPSA 3ESTA 3M3TA 1GHVH 1MBQA 1VR1H 2ZGCA 3ZVDA 4ZXYH 4OS2A 1P03A 3SGQE 3M61U 3S7HB 1TOCB 1P2NA 2UWPA 3LH3A 2AH4X 1O2RA 2GZ8A 2QYIA 2FYQA 1Z8RA 1PPZA 4MNXA 1RIWB 6ESTA 2C8YB 5EOKA 2BLQA 3QGJA 2ZKSA 5T6FA 2ZTZA 1NU9A 1QY6A 1NU7B 3RXCA 1O2JA 2FOAA 2A4RA 2F9PA 2QV1A 1QCPA 3BEIB 2PLXA 1O3CA 3V13A 3ZVCA 3PLPA 1K22H 3MH7A 1KIGH 5GIBA 3SU4A 1O2PA 5FBEA 5FXLA 1ELEE 3F1SB 3A8AA 4X8TH 3HKJB 1C2GA 2XWBI 4YZUA 2ZG0H 1C4U2 1AD8H 1C5VA 1MTVA 4NWLA 3RXJA 2BDYA 2JH5D 3RDZA 1HB0B 4FUIA 1BBRE 2V6NA 3OX7U 1SOZA 1AVWA 3KCGH 4ZXXH 1IAUA 2GCHF 1Y5BT 2O8TA 1BMMH 1QBNA 1W8BH 2HVXA 2VNTA 2B9LA 5L6NH 3LDXH 1GI0A 1YPKH 3LGTA 3O8BA 3QDZB 1ETSH 4CR9A 4VGCB 4Y76A 1L1NA 1E36B 3VGCC 2PTNA 2ALVA 1BDAA 1GBCA 2W7SA 1A46H 2G00A 2IPHA 3DD2H 2GZ9A 4DVAU 3M5OA 1A3EH 1ZSLA 1OKXA 2B7DH 1LHDH 1EZXC 4NIVA 4Q7YA 1O3LA 4DOQA 4M7GA 1WV7H 4H4FA 1CGIE 1TNLA 1CBWB 2JH6D 3LGWA 2ZPRA 1NS3A 1E35B 2HPPH 4DW2U 2DE8A 1A4WH 2J9NA 3K6YA 2FPZA 3BTGE 1GCDA 2QA9E 5BPEA 4FVBA 1K1MA 1TMUH 2A4OA 3RXDA 1DM4B 3SJOA 1ABJH 2BY5X 1FLEE 1JMOH 4NA8A 2ZA5A 2FDAA 3A83A 4K69A 2R3UA 7ESTE 1DUAA 5EPNA 3SU6A 2A5IA 1DVAH 3RMNH 3ATMA 4Y0YE 2HNTF 1TA6A 3QK1A 5DKMA 1L0ZA 4CRDA 1SMFE 3E0PB 3HGNA 4IC6A 3P70B 1V2QT 4A5TS 1JBUH 1QB6A 4JYVH 2JETC 4Y10E 4YOGA 3PROA 5E2OA 2AIQA 2BD7A 4IMQA 5DP9A 1EJAA 1ELDE 3UQOA 2GT8A 2HRVA 3M7UA 1NRQH 1GI2A 3F68H 4O3UA 2A4QA 5DG6A 5C67A 5LH8A 4UDWH 5TCCA 1O3IA 4WH8A 1AI8H 2W3IA 4WMFA 1ESBA 1BBRK 3RMOH 1TRYA 2V35A 1FN8A 3SZNA 1XM1A 3UREA 1T31A 4IS5A 1HYLA 2WYJA 3SQHE 4NIXA 3MO3A 1P2MA 4Q2KA 1O2OA 4CR5A 1W14U 1T8NA 1W3CA 3ZZ3A 3GYLB 1QURH 3SU5A 5C1UA 1O5EH 3TJVA 4IMZA 1Y5AT 5K7RA 3OSYA 1AQ7A 1LHEH 1QR3E 4YESB 2P93A 3S9CA 1C1TA 5EQRA 2ANWA 2RCEA 4CH8B 4AFQA 2BZ6H 4I7YH 2ANYA 1VITH 1C5NH 3ZZ4A 4JZDH 1TALA 5L30H 4BAKB 3FANA 1NPMA 3ZVAA 1C1RA 1CO7E 1HV7A 1BOQA 1P3CA 3H7OA 5FHTA 4F4OC 1GI8B 3QLPH 3TJUA 3GY7A 4UONA 2GVFA 2BQ7B 3URCA 1THPB 3RXPA 4K3JA 3S0NA 3DA9B 4ISIH 1NROH 1A5GH 1MKWK 1GCTC 4CRBA 4FUBA 1J17T 2FS8A 1V2RT 2P3FH 2TIOA 4AG2A 1O2SA 1ZRBA 3VGCB 3VB4A 2BMGB 4SGAE 1BHXF 5JBAS 3I78A 1F0RA 2ZHQH 1QRWA 1ZPZA 1J9CH 1UCYE 2OC8A 5E0JA 1O2IA 1MH0A 2CJIA 3SJ8A 1ZHMA 1AFQC 7LPRA 1SHYA 3MH5A 3H5CB 1NO9H 5FAHA 1TA2A 2PSYA 4ESTE 2SGEE 2XNIA 3KQCA 1TNIA 2QXGA 8GCHG 5GJ4B 2BY8X 1IQKA 1GL1A 8KME2 2V3HH 1O2NA 1OWDA 1WTHD 1QL8A 1OX1A 2BD9A 4B2AA 4TY6A 2HNTC 1MKXH 4TWWA 1C2DA 1O2VA 1ELCA 3KIDU 3M7QA 1O3OA 1BMNH 1V3XA 3A84A 1SG8B 1HAZB 1P2JA 2VH6A 1GI7B 3FZZA 3EA8A 1UK2A 1FNIA 1LVMA 3SOSA 3SV7A 1P12E 4ZROA 1SFQB 3CP7A 2QAAA 4TWYA 2AGIX 1YLCA 1EAWA 2ASUB 3GY5A 1H4WA 4K1TA 1EPTB 3GCNA 1D3QB 1ZTLA 5C2ZA 2PKAA 2FI4E 1GBHA 3MYWA 1BRUP 1TQ0B 2TGPZ 2BLWA 5C1YA 2TBSA 4MPXA 1ZRKA 1XUJA 3GCTG 2PFEA 3R3GB 3GCHC 1L4ZA 1WOFA 1DLEA 1EXFA 1N1LA 2BB4A 1XXFA 3PLKA 4AFSA 2HWLB 1YBWA 4GCHF 2HOBA 5L2ZH 2G5NA 2WYGA 4U30A 3A88A 1N6XA 2SGFE 2NWNA 3MH6A 1GHAG 2OP9A 1ZJDA 2ZZUH 3ZZAA 1GBFA 1BIOA 2ZFRH 2GMTC 2Z3EA 4NIYA 3UNRA 3CS0A 1G2LA 4UFDH 1DXPA 1JIMA 3T5FH 1QHRB 4AG1A 4JCNA 3JZ2B 1AWHB 1FJSA 4LOYH 1WBGB 5AFZH 1QQ4A 4I31A 1T8OA 1K1LA 1BTUA 1LHGH 1GMDF 5FPTA 3M3VA 3MHWU 1AVXA 1ZTJA 1RFNA 1XKBC 3EYDA 2BD5A 2Z9KA 3VPKA 5FBIA 1O3FA 4AB9A 3E91A 1GJ8B 1QGFA 5E0GA 8ESTE 2G81E 2VINA 1GBLA 1GG6B 4BAQB 3RLYH 5CHAB 1ZSJA 3ODFA 1V6DA 1TIOA 3OY5U 2WUBA 4NZLA 1MQ5A 1P8VC 2F3CE 3V3MA 1CQQA 1FMGA 5DO4H 1TGSZ 2AMPA 2ZDLA 2O8MA 3OU0A 3MMGA 2FX4A 2CHAC 4DIIH 1GBIA 1OYQA 4DG4A 1GI3A 2Y5GA 2JKHA 3E16B 1ID5H 1FI8A 3V0XA 3LOXA 2THFB 4X0WU 1FAXA 1GHXH 4B76A 1NFWA 3BTME 2C8ZB 4RKOB 6GCHG 1ZPBA 2A7CA 2A2QH 3CS7A 2ZWLH 2HALA 2VIWA 1AKSA 1OYTH 3ZZDA 4X8SH 3BG4B 5ABWA 4OGXA 1SC8U 1NRSH 1V2MT 3LONA 2DE9A 1MU8B 1XUKA 2AFQB 4TY7A 2YNBA 3O8RA 2G4UA 3UQVA 3SUGA 1G3BA 3TVJB 2FIRH 2H9EH 2VVCA 2EI8A 1TGNA 1O0DH 1C2HA 4MNYA 1SB1H 3UTUH 3UY9A 3ENSB 4I8GA 1A5HA 2C8XB 2B0FA 5EQSA 3SI3H 4BTTB 4AFUA 1BT7A 4HFPB 1P2KA 2WPMS 2XBXA 2AIPA 2BVXH 1G37A 1F0SA 1AZ8A 3TJOA 1IQIA 5EG4A 1SGFA 3TK9A 4D8NA 3RXHA 2OXSA 1ZHRA 1IQLA 1TBZH 2Z9GA 1SOTA 2DUCA 1K1OA 4TYDA 3E6PH 1O5CB 1C1PA 1C1SA 1W0YH 2GDDA 2QF3A 1YPEH 1YGCH 2B8OH 3Q3KA 1O2XA 4Y8ZA 1KDQB 1EOLA 2ZEBA 5J4QA 3VXEH 1O5AB 3M5MA 1W12U 2QY0B 5A8XA 1FAKH 1WTGH 2HNTE 2P16A 1IQEA 2J92A 4YT7H 1C2LA 1KXBA 2BQWB 1HAPH 3RC4A 1GJDB 1JXPA 1KLIH 2ZDMA 4NA7A 2STAE 4FU7A 3BTTE 2C4FH 1GVLA 4YO9A 3SBKA 1C4Y2 1K9OE 2ZFSA 2A7JA 1C1OA 1Y3VA 4BTUB 1SGQE 1J16A 1S6FA 1TPPA 1HJAC 4AZ2B 5A09A 3HK6B 3NCLA 2A1DB 2O8LA 1QRXA 3ATKA 2YNAA 1QIXB 1HAVB 1UJ1A 1TOMH 1NFYA 1P05A 4FUDA 3W94A 3TJNA 2NU2E 3F9EA 1SGIB 1T8MA 2CHAB 1HLTH 1TMTH 4YOIA 1H8IH 1HJAB 1MD7A 4IBLH 4I8HA 4K5ZA 4CRGA 5AHGH 3BIUH 4KTSA 1OP0A 2Q1JA 5EW2H 2PTCE 2ZGBH 2BLOA 4X2YA 1C2KA 2TGDA 2XW9A 4CBNA 4ZKSU 1G36A 1NC6A 3TU7H 1GHZA 1HIAB 1XUFA 1PJPA 4Y79A 1LVOA 3ZVBA 3LJJA 1CHOG 3RMMH 5CE1A 1C1NA 4ZKNU 2ZDVH 1HIAA 3SW2B 3LGYA 5EODA 1THRH 1O2LA 2Y6TA 2J4IA 3KQBA 5I46H 1Q3XA 2VIPA 1GI5A 1LVBA 1TNJA 3PMBB 2Q6GA 1HUTH 1GBTA 3RXEA 1CHGA 1LMWB 1YM0A 4E05H 1UVUH 4PROA 2AMDA 3LGIA 4B2CA 4GLYA 3RXAA 2LNCA 4O03A 4JK5A 1MZDA 1BZXE 1EB1H 3TNSA 3LC5A 1VCWA 1G3EA 1HAVA 1TAWA 2Y81A 1F92A 1Y59T 1NN6A 2KAIB 4MG3A 2O8UA 4Q7XA 1OWJA 2EC9H 1MTSA 1QQUA 1GVZA 3HATH 3UWJH 4WF8A 1FY5A 1ESAA 2WPKS 3ZZ9A 1MUEB 3JZ1B 2OQUA 2H6MA 1K2I1 5FCRA 1NRRH 5EQQA 1P02A 3HGPA 1ESTA 3AW1A 2ANMH 5G4BA 2EEKA 3RU4D 3UIRA 2OD3B 3VB3A 1C5PA 2VWOA 5FPYA 3FP8E 4JMYA 3SO3A 2G52A 5B6OA 1HJ9A 1ZSKA 4THNH 1C1QA 1GHBG 1DSTA 4DT7B 1W11U 4ZHAA 4GPGA 1XMNB 2UWLA 1WU1A 1XX9A 3GISB 1GHAF 5DP7A 1J14A 3BTWE 8GCHF 2GP9B 1QJ1B 1TNKA 1GBEA 1UO6A 3ATWA 3GCOA 2J38A 5F8ZA 3PWBA 5GCHG 1K1PA 3F9HA 1UK4A 2WUCA 2STBE 2Y7XA 1DT2A 3RXLA 4B1TA 4JZFH 3SJ9A 1MU6B 2F9BH 3STJA 2WPLS 1DY8A 5EPYA 1YCPH 4X8UH 4DJZB 1D3PB 3PWCA 1D3DB 4ZKRU 1P2IA 1LCYA 1Q2WA 2BYAX 3B8JA 5ESTE 4LZ1H 1TONA 2ZFPH 3SGAE 1O3JA 3A7XA 1FY3A 4FUFA 1PQAA 2ODPA 4NG9H 3MU1A 2IOTA 3M36A 1UVOA 4WXIA 3P8FA 1ZLRA 2OTVA 1GMDG 2B5TB 5GXPA 1DWBH 3EA7A 1H9IE 3F9FA 1TBQH 4K2YA 1Z8IB 4NGAH 1G32B 2UUYA 2WINI 3RC5A 2W3KA 2OUAA 5JB9S 2FOGA 1P2QA 5LPFA 1ZMLA 2FTMA 2ZTXA 2ANKH 5AFYH 1Z6EA 4A7IB 3A7YA 1F5RA 1VGCB 1O30A 1SGTA 4YTAA 3RXMA 1ZGVA 1NY22 1ETRH 4MQAA 2BX3A 2VIVA 4A6LA 2AGGX 3TK5A 1EX3A 4X2WA 3T2NA 4X6PA 5JBBS 3FFGA 1YKTA 1O3DA 2O9QA 1GI1A 1BA8B 1B5GH 1TMBH 1YCPK 1XUIA 2ZPQA 3RXVA 4B75A 1ZPCA 2QC2A 1AUTC 1OP2A 1O35A 1HRTH 4NCYA 3BG4C 1QNJA 4X1SU 1QBOA 2ESTE 1A7SA 2Y80A 3RM0H 3G01A 2Z94A 3N7OA 1BUIA 1GJ5H 2XCFA 1SHHB 1NRNH 1G3CA 3T26A 1C5WB 1DWCH 1RS0A 1O33A 1LPKB 1W0ZU 1DITH 1XKAC 3KF2A 3KQDA 2LPRA 1C2MA 4ABIA 5DJ7A 1O3KA 1FIZA 3NUMA 2OBQA 4JK6A 3NXPA 1MTNB 2F9OA 3PMHB 3MWIU 2H9HA 2RA0A 4UFEH 2WV5A 1PPCE 5E8EH 1V2UT 4I32A 1ZR0A 4Y71A 5H4IB 2PUQH 1NESE 2GGVB 2OC1A 4OS4A 4Y6DA 1QFKH 4ABDA 9ESTA 1HBTH 1T4VH 1O2ZA 2VWLA 1K21H 1SGDE 1GHWH 1IQHA 1HAGE 3MU5A 2FLRH 1GBBA 3A7TA 1Q31A 2C8WB 1LQEA 3ZZ7A 3HK3B 1AVGH 1S5SA 1NM6A 1TGBA 1FXYA 1KXAA 1ANCA 2PKAB 3TH4H 1S84A 2W5EA 3A8BA 1DWDH 1O3PB 3H7TA 2VWNA 1O5DH 1O2TA 1AHTH 1DLKB 1OWHA 4X8VH 2QXJA 1EZSC 3K9XB 1ELAA 1RIWC 1L2EA 1V2VT 1SQOA 1EPTA 4E7RG 2ZGHA 3GY8A 2P8OB 3ZZ6A 1Z7KA 2K1QA 5TJXA 1E0FD 1UCYH 3TGJE 1B0EA 4X6OA 3NWUA 3GYMA 3AW0A 7GCHG 2A45B 3T28A 3ZVEA 1YPHE 2CN0H 1WCZA 1SI5H 1QB9A 1SQAA 3I77A 1LVYA 1CA0C 3ZV8A 2P59A 1NRPH 1O2WA 2FZZA 3QWCH 5CMXH 3HKIB 2OQ5A 2CV3A 6CHAB 3RXUA 1CVWH 3Q3XA 1CT2E 2D26C 3T62A 1P57B 3VB5A 4HI3A 2GD4B 1SGNE 4KTCA 1WAYB 3SV6A 4Y7BA 1FY4A 2XBWA 2GCTC 3BV9B 2H5CA 5EXMA 1IOEA 4X2XA 4KP0A 3C27B 5EW1H 1C2FA