1GI7B

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 52
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi7B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi7B01
1TBZH 2C8YB 1XKBC 1KTTB 1EOLA 1CGHA 5ETXA 4X1PU 4HZHA 4XDEA 1A4WH 5PTPA 4AG2A 1RTKA 1O3LA 2BDIA 1O39A 4ABDA 2XBWA 1UTPA 1W2KH 1BT7A 1IAUA 3DHKH 1QL8A 1LQEA 3RUOA 3DD2H 2H9TH 1RXPA 2R9PA 1SG8B 1ZJKA 1TMUH 1O2IA 1O3HA 3ENSB 1NS3A 2BDBA 1THPB 1C2FA 3QK1A 3QDZB 1K1OA 1LVBA 1QIXB 1QTFA 2Z7FE 1CA0C 2RG3A 3LPRA 1MQ5A 4O97A 1WAYB 3PM3A 1YBWA 1EPTC 1K21H 4NFEA 1O3GA 1EZUC 2WYJA 4ZKOU 3MH6A 4MQAA 1C1WH 3ZZDA 2ZHDA 4NA8A 1O33A 1RJXB 4XSKU 2Z9LA 1XUFA 3TJUA 1C5QA 1GL0E 3UUZA 1T32A 2BLVA 1PYTC 2ODPA 3RC6A 5HM2A 3RC4A 3PTNA 1SLXB 5T6FA 3GY3A 1AVWA 3PMBB 4WMFA 1SLUB 2WV5A 2ZGBH 1Z8IB 4U01A 2ZU5A 1QQ4A 2FTLE 2QF0A 1PPGE 3PMAB 5GCHF 4ZHAA 1PPEE 1SOZA 1T4UH 3KGPA 2F9NA 1VCPA 1O2WA 3T5FH 5CE1A 3Q77A 4GLYA 4NWLA 3SI3H 2PKSC 1DXPA 1ZHRA 1H1BA 2VIWA 1AWHB 1TNJA 1C5XB 1SFIA 3MFJA 1BTPA 2I6QA 1EB1H 4NFFA 5DG6A 4F49A 1MH0A 4WF8A 1F0TA 1HB0B 1BB0B 4IGDA 1CA0B 3SHCH 2Q6FA 1FMGA 3SUGA 5GXPA 2OXSA 1GVZA 3M7TA 2QIQA 1DXWA 1NESE 2PSYA 1F5RA 4K8BA 1Y5UT 3A7WA 2F9BH 1TPOA 1TA6A 1FY5A 2P3UB 2Z94A 1O3NA 1MTNB 3RC5A 2VWNA 3RMMH 1DDJA 1CU1A 2VB0A 1EQ9A 1W0ZU 1V2VT 4JK6A 4ZHMU 1SGFG 1CVWH 2BX4A 8LPRA 4AFQA 1TABE 3EE0B 5E8EH 4JZDH 4ABJA 4OS6A 1DSUA 1MKXH 2Y7ZA 1YGCH 3RMOH 1O5FH 1KDQB 1PPBH 1X7AC 2O8MA 1DLEA 1SGTA 2CN0H 2OC8A 1EAUA 1C5RA 3TJVA 2F3CE 2GCTC 1BQYA 2SFAA 3T28A 3SU4A 2ZGCA 2J94A 1INCA 1IQNA 5J4SA 2BHGA 1GCTC 1P10A 1V2UT 2ZF0H 4AOQA 1JIRA 2H6MA 2PKSB 4MNYA 4IN1A 1AWFH 1AZ8A 2Q6GA 1FZZA 3VEQB 3PLBA 2ZPSA 1SOTA 1MZAA 5JB8S 1O3DA 3RXSA 3NKKA 3FP7E 2J92A 2BVXH 3GCTG 3NUMA 2GDEH 3RLYH 4AFUA 1K1NA 2BQ7B 1MBQA 2TGTA 2F9OA 1BTZA 1O5CB 1NU7B 1SL3A 2WV4A 2BDCA 1C9PA 4NSYA 1O3PB 3KQBA 1P01A 3A84A 2FEQH 1AN1E 2H2ZA 3SV2H 5EPYA 1IQGA 1SC8U 1O2TA 2OBQA 1O2MA 1D3TB 3P6ZB 4X8SH 3I29A 3SU2A 3CS7A 4Y0ZE 1NFWA 1O5BB 1A2CH 3O8CA 1SQTA 2A31A 1LKBA 1QBVH 2P8OC 1GHBG 4ZXXH 2GCTB 1THSH 1GJ9B 1E37B 3EGKH 3F1SB 1XVMA 1TGSZ 1YCPK 3EYDA 3FP6E 1OP2A 2JETC 3ATIA 1KDQA 3A83A 1GBJA 1GCTB 1SGNE 2C3SA 3Q3XA 1S0RA 3TIUA 2XRCA 1EJNA 3VB3A 4I8JA 1O3JA 4BAQB 1UVOA 3HGNA 1LHFH 2CF8H 2VIPA 1QJ6B 1QBOA 4E7NA 4H6SB 3TGIE 2PTNA 1BRAA 5DO4H 1ABIH 5GJ4B 1ZRKA 2Y7XA 3C27B 1H8IH 4MG3A 1SGDE 1O2JA 1N6XA 2QGRA 4X2VA 1C1TA 4MNWA 9LPRA 5FXLA 1EAWA 1G30B 4MNVA 3U98H 1GHVH 1SGEE 1EZQA 3VXEH 5E0GA 2HVXA 2BXUH 2G5NA 1EJAA 1J9CH 5EXMA 1AHTH 2PGQB 3MU1A 1P09A 4H6TA 1SPJA 4AG1A 1P11E 2PHBA 1FV9A 3QZRA 1DUAA 5A0AE 1P2OA 3RMLH 1XUJA 4OS2A 3ZVBA 2XBXA 5TCCA 3CP7A 1ELDE 4INKA 2A7JA 3PO1B 3UTUH 1SLWB 3MI4A 1ANBA 2XBYA 2P8OB 1BHXB 4CRFA 5JBAS 2WPMS 3ATWA 1GI4A 2VWMA 2C8XB 3SGQE 2JETB 3BTME 1BIOA 4TWWA 2EI8A 3UPEA 2H1UA 4NGAH 2CXVA 1J8AA 1UK3A 2PSXA 4GUXA 2HGTH 2NU1E 3URCA 2BD4A 4E7RG 2BY9X 1TX6A 2R0LA 3UOUA 1DICA 1Y3WA 3BTTE 4IBLH 1TPSA 2YNAA 2BY6X 1TIOA 2ZQ2A 5EPNA 2ZC9H 1ELEE 2O8TA 1SQAA 7GCHF 4DG4A 1C1VH 1H4WA 1BOQA 3E3TA 1XUGA 3MNCA 3V13A 3ZVFA 1TONA 1MAYA 3ATMA 2A4RA 2JH0D 1FI8A 1UO6A 2BTCE 2ZDVH 3ATLA 3QGNB 3MH7A 1TGNA 1EAIA 1QB6A 2UUKB 2ZO3H 4MPXA 3LT3A 1Y3YA 1YPMH 2GX4A 4I8GA 4Q7XA 2UUJB 1OWEA 1LPKB 1FIWA 1JMOH 1ANDA 1GJBB 1KLJH 4CH2B 1GHXH 2W7UA 1O3OA 3F9FA 1TFXA 1HUTH 1ELCA 3RXEA 5FCKA 4JMYA 2RCEA 2XNIA 2Y5GA 4JZEH 1GHAG 5SGAE 4QT8C 2J38A 2SGFE 5ESBA 3SJIA 4A1VA 3TJNA 3KEEA 1BUIA 1ELVA 2HNTF 4UFDH 2ZNKH 1GMCF 1J14A 1YCPH 3HK6B 3TVJB 1YPKH 4HFPB 1ACBE 3M37A 5HM9A 1ZPCA 3N7OA 4K8YA 2GT7A 1LPGB 4K5ZA 3GISB 2BD3A 3RXGA 1GBKA 3KNXA 1LPZB 2UUFB 1GL1A 1FDPA 1LTOA 1UVPA 1AFQC 2TGDA 1GBFA 4X0WU 3HKIB 1XUHA 1AB9C 4I8KA 1ZJDA 3MTYA 4MVNA 2PWXA 2P3FH 5EXNA 3PYHA 1UCYK 2FI3E 3ZZCA 3QZQA 1NRRH 3LONA 4B73A 3QLPH 2G55A 5DGJA 5GDSH 3SUFA 2STAE 1O3CA 1KIGH 4X8UH 2WPKS 1GDUA 3FFGA 2PV9B 1YC0A 1QJ1B 3M5MA 1C2KA 1HAYB 1ZR0A 3TGKE 1K1LA 3GCNA 5J4QA 4K60A 2Z9IA 3RXIA 4NWKA 4X2XA 2BMGB 1ID5H 2HNTE 5A2MH 1MBMA 3SJOA 2WUBA 2ZCKP 1UTJA 5A0BA 1NFXA 1AE8H 3MU0A 3DFLA 1ESBA 1AZZA 4A6LA 2EA3A 2A1DB 4Y8ZA 1PPCE 1P3EA 1N8OC 4AYYB 1W10U 1RRKA 1D3PB 3TPIZ 2Y81A 2THFB 3A81A 1HNEE 4AGJA 1THRH 2FP7B 3LH3A 1K1IA 1LVYA 2FI5E 1OPHB 5HGGA 1QBNA 5JBBS 5ESTE 2A5AA 1T8LA 3BF6H 3P17H 4CRBA 4D76A 1Y59T 2QXHA 5AF9H 1L2EA 2SGPE 3O8DA 2B7DH 1AFQB 2UWPA 5FX5A 2NU4E 4I8HA 1GI2A 2GD4B 1QFKH 1OOKB 1L1GA 1KXEA 1YLCA 5DPAA 4A92A 1A5GH 1LVMA 3BTHE 3SN8A 3LC3A 3EA9A 1AQ7A 3L33A 3D62A 3DUXH 4AFSA 3RXBA 4Y76A 3PLPA 1QURH 1YP9A 2D1JA 1NPMA 3NPSA 5CHAC 5E0JA 3H5CB 1WTGH 2QV1A 3P8GA 1D4PB 4Y7BA 4Z0KA 4X1QU 1V2ST 1J16A 1MCTA 5TJXA 3E1XB 3U8OH 2FS8A 6GCHG 1WV7H 4ABFA 3TH2H 1PYTD 1N8OB 1D3QB 1FONA 2QYIA 2GMTC 2CMYA 3UQVA 1NTPA 1WQSA 1F7ZA 3LU9B 4GHTA 1W14U 2AYWA 2OBOA 2WPJS 4GCHF 2WPLS 1V2MT 4ABIA 5LGOA 1JBUH 1SFQB 1O31A 5AFYH 3SU3A 1ZHMA 3U1IB 3T25A 2ZFRH 4J2YB 2CV3A 1O2YA 1S0QA 3NK8A 6CHAB 1HBTH 3Q00A 1O3FA 2J4IA 2V0BA 3GCHC 1ANEA 1P05A 2Y6TA 1C1QA 2SNVA 1TLDA 4Q7ZA 1TRNA 1IQEA 2A2QH 4KTCA 1O2NA 3RMNH 3BIUH 1C2MA 3BV9B 3UR6A 1YF4A 3ZZ9A 1CHOG 5CHAB 1HV7A 3TLOA 2Z9GA 4KTUA 1S81A 4JZFH 1UCYE 3TH3H 4K69A 1T31A 1G37A 3W94A 1O5AB 1A7SA 2VH6A 3TJOA 8GCHF 4YLQH 1HLTH 1T8MA 1C1MA 3NXPA 2F91A 2GMTB 3L6PA 4Y6DA 2OC7A 2STBE 1C2EA 1ESAA 2ZA5A 3UREA 1OS8A 1G32B 3RU4E 1M9UA 1IQIA 4BOHA 2FZZA 1TGTA 2FYRA 2P94A 1EJMA 1W8BH 3AW1A 5F8ZA 3D23A 1DS2E 1GI1A 2YNBA 1QNJA 3FAOA 1BMNH 3A89A 3STIA 1KYNA 1O5GH 1C1SA 3BTWE 2EC9H 2FWWA 1FY8E 2W3IA 1CT2E 1FXYA 1CSOE 6ESTA 5A8YA 4I32A 2H9EH 3GCHB 3DFJA 2FDAA 4UDWH 2YOLA 2GT8A 4MLFB 4CHAB 1MTNC 2PTCE 3BTKE 2FO9A 3B23B 1D9IA 3D65E 2PR3A 1UK4A 5AVDA 3V3MA 3DA9B 4AORA 3U8TH 1TOMH 2ZU4A 1O2SA 2R2WU 3FZZA 2CHAB 3HK3B 1RTFB 2OLGA 2GZ8A 1RGQA 1SR5C 4A7IB 2XXLA 1DWBH 1QJ7B 2VWOA 3ATKA 3Q3KA 3Q76A 2ZP0H 1OYTH 1EXFA 3M3TA 1Y5AT 4RKJB 1B0EA 3MYWA 1ESTA 3F6UH 2ZU2A 5GIBA 1SLVB 2TPIZ 4Y0YE 2PFEA 1HXFH 1KXAA 2VVCA 3W95A 1GCDA 3A7TA 1K28D 4ABEA 1AGJA 4WVPE 1V2QT 1G3BA 4E06H 1ARBA 3AW0A 3VFEA 4D8NA 3SNCA 4X8TH 1UVUH 2XC5A 5F8TA 2AIQA 2AEIH 1DY8A 3C1KA 2HPQH 2A7HA 3SV6A 1Z1IA 1FIZA 2G4UA 2SGDE 2Y5HA 3A8AA 3E90B 3O8BA 3GICB 1H8DH 1NN6A 4GAWA 3O8RA 2WYGA 1P8VC 7KMEH 2GP9B 1P2JA 3MOCA 1P2MA 7ESTE 3BTQE 1HJAC 1OWHA 3QTOH 3LDXH 1O3KA 1BRBE 4Y7AA 4HGCA 1JRTA 5CMXH 3SU0A 3RDZA 3ZZ7A 3SNEA 1DT2A 5EODA 1DVAH 3PB1E 2GCHG 3V12A 3SZNA 3F9EA 2H9HA 1XXFA 3RP2A 3MWIU 1IQJA 1T8NA 5LPEA 4X6PA 1Z7KA 3PMJA 4MTBA 1MUEB 1Z8JB 1DM4B 1FAKH 5EXLA 5A09A 2OINA 3BSQA 2FOFA 4FUHA 1NROH 1ZOMA 1QCPA 1O2UA 4FU7A 4WMDA 5K7RA 4X6NA 1FPCH 2AMDA 4YT7H 3ZYDA 1O2LA 3HKJB 1A3BH 1TNGA 1MQ6A 2ZFTA 3VB4A 2ASUB 3GOVB 4AB9A 1PQ7A 2FS9A 5L2ZH 1ARCA 1N1LA 1AKSB 1F5KU 1C1PA 1TE0A 3SOSA 4ABHA 4BXSA 1V2JT 1CT0E 2F9PA 3M7UA 2VINA 4VGCC 2W7SA 3RM2H 1ZMJA 2ZKSA 1UTKA 2BD8A 1IQHA 3S7KB 1QB9A 4KP0A 1HPGA 2OTVA 1ABJH 1HAIH 4X2YA 1VGCB 1QL9A 2ZECA 3ZZ3A 4F4OC 5FPTA 1C2HA 5I46H 1HJAB 1BMMH 1T8OA 3MO6A 1N6YA 5G4BA 1P12E 4RSPA 1O2HA 1PJPA 1AY6H 2V6NA 4TPIZ 5DP4A 1C1UH 2J9NA 3RXKA 4B2AA 1W3CA 1O30A 1LHGH 2BQWB 2PGBB 1AU8A 1SHYA 1DUEA 3PO1C 4DVAU 5DP7A 3SU5A 1WYKA 1LQDB 5DP3A 2AMPA 1GJ5H 4WY3A 1LMWB 3E8LA 1IQFA 4ZAEA 3RXJA 2ANYA 2ZPRA 1UTMA 1Y8TA 4NA7A 3T26A 1E35B 3VXFH 1V2NT 3I77A 1KLIH 5A8XA 1KXBA 1HIAB 2ZEBA 1GMDF 1YPJH 1GJ6A 2ZGJA 5LPRA 2RA3A 3ZVEA 4DJZB 4XBCA 3SNDA 3U69H 1C5NH 3VB7A 2BDHA 2KAIB 2O8UA 4WMEA 3EDXB 5E2OA 3RXQA 3ITIA 4VGCB 3UIRA 2WPHS 2HWLB 4FUEA 1O35A 2XWBI 1P2QA 5C5OA 1YPEH 3SW2B 2SNWA 1P0SH 1C4U2 3SJ8A 1AVGH 1AKSA 1DITH 2ANWA 2ZPQA 1C5UA 1O3AA 4AYVB 4YESB 2AIPA 4XBBA 1OWIA 1MKWK 5L30H 3TK6A 3ZV8A 4ABAA 1ANCA 3FVFB 4WH8A 1CHGA 3SNAA 4B1TA 2BB4A 3PROA 1VITG 4NZQA 3SI4H 1HGTH 1O36A 1Y5BT 1HFDA 3SGBE 1GI5A 4K1EA 1RTLA 1GHZA 3IITA 3RXPA 1UTLM 3EQ0H 3UNRA 2ZDNA 2V35A 2BD7A 4DOQA 1GMHG 1BRUP 1ELAA 1ZLRA 1QB1A 1LVOA 4ZUHA 4AB8A 3P95A 1VCWA 1QQUA 1QRWA 3ZZ5A 3P8FA 2FLBH 4BANB 2ZDLA 3TNSA 1GJ4H 4JYUH 3U8RH 5T3HA 2DE9A 4BTTB 1B7XB 1XMNB 2FX4A 1TRYA 1BTWA 3T27A 4CRDA 3QO6A 2ZFFH 1NT1A 1NU9A 3SBKA 1K9OE 4BAKB 2BM2A 3RXMA 2PLXA 2EI7A 1S84A 2BD5A 4KELA 2WINI 4U30A 1T4VH 3SQEE 3ZZAA 1NRQH 3MU4A 2K1QA 2KAIA 3M3VA 1TPAE 1GBTA 1BJUA 4X2WA 2QY0B 2C90B 2G5VA 2J34A 1EAXA 1O32A 2SGAA 1ZMNA 1P9UA 1FN8A 1SGYE 4XBDA 1O2ZA 2BLQA 3TH4H 1K1PA 1GBIA 3S69A 2P59A 1EOJA 1ZTJA 4CR9A 1WSSH 1AFEH 2AMQA 2TIOA 2FOGA 2HRVA 4ESTE 2ZI2H 3K9XB 5C5NA 4O3UA 1O0DH 4E05H 4UD9H 3SJKA 5DP6A 3R3GB 4ZH8A 2A2XH 2HNTC 4K3JA 2J95A 3B9FH 2QN5T 1O2GH 2AH4X 2Z3EA 2ZDKA 2GVFA 3GY4A 3B8JA 1PPFE 1C5PA 4DURA 1KY9A 3A80A 1O3IA 1C2DA 1RD3B 4ISNA 1CA8B 3CENA 2LPRA 4BAHB 1LO6A 1Q3XA 2A5KA 3BIVH 3PMHB 3GCTF 1C2LA 2XWAA 5EG4A 1O38A 1H9LB 2W5EA 1V3XA 2Z9JA 4D7FA 1A0LA 1BTUA 1YKTA 1HAPH 1LDTT 3MNXA 1A0HB 4FUIA 3EA7A 1YYY1 1HAXB 1GI6A 3E0NB 2VNTA 4OS5A 2XBVA 4Y71A 1GPZA 1S82A 1HAVB 2F9UA 3WY8A 5EQSA 1C4Y2 1HJ9A 2B8OH 3RXFA 1C2IA 1EP6A 3MH5A 2GTBA 4U2WA 4ZROA 2EEKA 3IWMA 1CE5A 1C4V2 3FANA 1WCZA 2BQ6B 5HXFA 1MKWH 2BDAA 2ZG0H 3LJJA 1GHBF 3K6ZA 4O9VA 1BBRK 1ZPBA 1NFUA 1F5LA 3UR9A 1DX5M 2V3OH 4D9QA 1C5VA 3M7QA 4R8TB 1CT4E 2XCFA 1P2IA 3V7TA 3ZZBA 2FMJA 3A88A 1FY1A 2QXIA 4K1SA 4BTUB 4INLA 1AI8H 4B2CA 2Q6DA 1OX1A 6LPRA 5HYOA 1V2LT 4HTCH 1C9TA 2GV7A 2AS9A 1Z1JA 1SSXA 1DPOA 2GGVB 4XOJA 5LH8A 2AGEX 2ZHQH 2RA0A 5DP9A 1GI9B 2GZ7A 1C1NA 4NCYA 1S6FA 5HMAA 3RXAA 2ZTYA 4JZ1A 3RXOA 3K6YA 4Q80A 6CHAC 5GCHG 1D6RA 3UNQA 4UFEH 3T62A 3TU7H 3LGIA 2F9VA 3GDUA 5EGMA 4X1NU 1MCVA 1MU6B 3P70B 3UNSA 3RXLA 1O3BA 4IMQA 1O3MA 3ZVGA 3ZVCA 5DKMA 3SNBA 3RXUA 1MD7A 4I7YH 1YPHE 2ANMH 1EZSC 2BOHB 1T7CA 1GI0A 2ZFPH 1KXFA 1PQ8A 5JDUB 4OS7A 4DY7B 2WUCA 4OGYA 3OYPA 2Z3DA 5JBTA 1OP8A 1U6QA 3LJOA 4B75A 1ZMLA 1ZHPA 2OP9A 1GJDB 4A5TS 4BAMB 2G4TA 5FPSA 2ULLA 1DLKB 2DE8A 2OQUA 4LZ1H 3RXDA 1ZTLA 2C4FH 3F9GA 3TNTA 1XXDA 4X1RU 1ZTKA 3TITA 1Y3XA 2VVVA 2WPIS 2AGGX 3LH1A 1SQOA 1PPZA 2P95A 1HAHH 5FCRA 2Z3CA 2FOAA 4MPVA 1VITH 1JXPA 4Y10E 4Y8YA 3ZZ4A 2TGAA 2J2UA 1VR1H 2ZU3A 2BX3A 3RXCA 1Z8RA 2BDGA 2GZ9A 1BTHH 1O37A 1FN6A 1BCUH 3M5OA 4JZIA 2IPHA 1DSTA 4I33A 1P57B 5DK1A 3E16B 2BD2A 2PKAB 1GJ7B 1S83A 4B76A 2P3TB 3PLKA 1O3EA 5C1YA 2O9QA 3AAVA 1Z71A 3Q3YA 3MU5A 3UWIA 1ZGVA 5T6GA 1F0UA 2PUQH 3SJ9A 3H7OA 1MD8A 4CHAC 5L6NH 2C8WB 3SV9A 1OYQA 5BRRE 2CHAC 3KIDU 1XKAC 1F92A 1Y3UA 5T6DA 4UONA 1F0SA 1GHAF 4MNXA 1AMHA 1H9HE 3R0FA 2TRMA 1BA8B 2O8WA 3OY5U 4ISHH 4NIVA 4TY7A 3P8NA 3NWUA 3UFAA 1E38B 1AUJA 4FVBA 1S5SA 1EASA 2FESH 1A46H 4FUBA 1BBRH 8KME2 2D8WA 1IQLA 1W7XH 2ZHFH 1P06A 1GHYH 3OX7U 1WOFA 2H5CA 2ZFQH 3TGJE 1BMLA 2FOMB 3M61U 2VIDA 1MMJN 2OUAA 2D2DA 3QGJA 1W0YH 4FVDA 2VIQA 3EAJA 1JOUB 2A0QB 2VIOA 1TAWA 5C2ZA 1O5DH 1PQAA 4IN2A 3BTFE 1TQ7B 2BY8X 1C5ZB 5C1UA 5JYIA 1NY22 1BJVA 1UJ1A 5JB9S 1WBGB 5FPYA 4CBNA 1NRPH 4ASHA 4NIXA 8ESTE 1K22H 3LIWA 3QTVH 1EP5A 2R3UA 3E91A 1K1MA 2Y80A 2HALA 4D9RA 3MNBA 1G3EA 2PKAA 1IOEA 1KTSB 4A1XA 1GBDA 1C5SA 1GMDG 2I6SA 3E0PB 2XC4A 3GY6A 3UWJH 3RM0H 2TBSA 1GBAA 4BXWA 2CF9H 1TWXB 1ZYOA 2B9LA 2PUXB 3A7YA 1PPHE 2AFQB 1ETRH 2SGQE 2D26C 4TWYA 2ZIQH 1GI7B 1AE5A 4H4FA 4CR5A 3ZVDA 3BEIB 5A8ZA 1C5WB 1KXDA 3VGCC 3GDSA 2QCYA 1HAZB 4MPWA 1EKBB 4B2BA 2IJOB 3MO3A 4UFGH 4YT6H 1P02A 2BDYA 3QUMP 1KLTA 4BAOB 1DWCH 1UVSH 4KKDA 4WJG2 2BZAA 1E0FD 5EQRA 1V6DA 4AX9H 4OGXA 1AUTC 4DIHH 4UFFH 1HCGA 2G81E 4LK4A 1JWTA 2G8TA 1L0ZA 1DOJA 1SGCA 2ZDAH 1WU1A 2DUCA 4JK5A 2P16A 1WTHD 1BMAA 3M5NA 1G2LA 1VGCC 5JBCS 4GPGA 3SU1A 3BG4C 3LGYA 1ZZZA 1GI3A 9ESTA 4ISLA 3I78A 1HDTH 3PV4A 1MU8B 3BEFB 1HXEH 4JCNA 5EW1H 1EPTB 4K2YA 2QC2A 3A86A 3MU8A 1BDAA 6GCHF 4I8LA 3PTBA 4MPUA 7LPRA 2XYAA 1SGIB 4NZLA 1F2SE 4U32A 1NM6A 3VB5A 1NRNH 7GCHG 3NCLA 4B74A 1UVTH 2CGAA 1QA0A 3VGCB 5C67A 1V2OT 3M35A 2H5DA 5TCAA 5FBEA 1YCPM 1TNHA 4YZUA 4FUJA 4B71A 4FXGH 3F68H 1D3DB 1J15A 1GJCB 1TNIA 2R2MB 4X8VH 3ZV9A 4XE4A 4GSOA 3LOXA 3P92A 2VH0A 4IMZA 1CO7E 1FY4A 1TGCA 4DIIH 2UWLA 3UQOA 1C1RA 1ZRBA 1GGDC 2A45B 1G3CA 2O8LA 3GCOA 4PROA 2G52A 4YTAA 4TPYA 1KXCA 4OS4A 3RXHA 2XCNA 1P04A 2R3YA 1EX3A 3IG6B 1QL7A 1GWAA 2RDLA 3MMGA 3UOPA 1IHSH 3QN7A 1MTSA 3BG4B 3RXRA 2GKVE 4BNRA 1CHOF 1ZPZA 2ZHEH 1GMCG 3MNSA 1RIWC 3M5LA 1GBEA 3CS0A 5BPEA 1QRXA 1MAXA 4M7GA 1O5EH 1Q31A 1ELFA 1V2WT 4LOYH 2M5TA 4LZ4B 2BY7X 5H4IB 2FI4E 1HYLA 4X6OA 3OU0A 5DP8A 3S9CA 5EW2H 3SORA 1GJAB 2B5TB 1EPTA 1TOCB 1FQ3A 1IQMA 2XW9A 1NC6A 4NIYA 5L2YH 3TK5A 1OWJA 4ZKRU 1FPHH 3KL6A 3A7XA 2NWNA 2BYAX 1Z6JH 2XC0A 4MDSA 1V2KT 2FOCA 1LHEH 1Q2WA 4UE7H 4FUCA 3SGAE 1B0FA 1TPPA 4IC5A 2BVSH 1FUJA 1SGRE 2BVRH 1HRTH 1W7GH 2C93B 4CREA 2JH5D 1GGDB 3KN2A 1L1JA 1A3EH 3LKWA 1BITA 4ZKNU 4X6MA 3LGTA 3SHAH 1F0RA 1DANH 1JIMA 1C2JA 1BHXF 1JRSA 2HOBA 1O2KA 3S7HB 4AZ2B 3QX5H 2A7CA 1WUNH 3FZDA 5C20A 1VZQH 1V2RT 1P9SA 1ZGIA 4IW4E 4ZHLU 1ELGA 1C5YB 5E0HA 3A7ZA 1W11U 1RIWB 1GG6C 1XUIA 1NO9H 2P93A 3K65B 3RXTA 1TX8A 5B6OA 1GBMA 1V2TT 4XFQA 2ZDMA 2R0KA 3A7VA 1BTYA 1O34A 1GHWH 1GDNA 4NG9H 4WXIA 1UK2A 1GVKB 5IDKA 4TYDA 2XTTB 1P2KA 5IYTA 1PFXC 4Y8XA 3QWCH 1OKXA 2Z6BD 2G51A 3BTEE 3LGWA 3GY8A 4BTIB 1YPLH 3A87A 2OD3B 5GWZA 1VJ9U 3ZYEA 3URDA 3HATH 2F83A 3JZ1B 4Y11E 1YLDA 1AO5A 2BZ6H 1A61H 2AGIX 5K0HA 1MZDA 1YM0A 1ORFA 4UEHH 4YOIA 3GDVA 3SO3A 3STJA 1W12U 4IS5A 1K1JA 1HIAA 1W13U 2OCVB 2ZCLP 4RN6A 1LKAA 3AVZA 4IC6A 1Z8GA 2ODYB 1XX9A 2FOBA 1CGIE 1D6WA 3HPTB 4NIWA 1TALA 1B5GH 3GY2A 4DCDA 2BD9A 1P2NA 1IHTH 1SB1H 3H7TA 2GCHF 1QY6A 1CBWC 1LHCH 4JYTA 2ZGHA 1GG6B 2FPZA 1HAOH 1P03A 2FIRH 2HLCA 4Q2KA 1A0JA 3GY5A 1TBQH 2PW8H 4GCHG 1RS0A 1SMFE 5GPIB 2JH6D 1EZXC 1J17T 2LNCA 2ODQA 5FAHA 4WWYA 3A8DA 3DT0H 3M36A 2ILNA 3BTGE 1GBBA 3ODFA 1HJ8A 2QXJA 2FXRA 5ABWA 4ABBA 4NA9H 1RFNA 1UTNA 3S9BA 1SVPA 3ZZ6A 2FTMA 1BRCE 3SUEA 3S9AA 3KF2A 3EA8A 1MTWA 3KQDA 1CGJE 5EQQA 4Y79A 3BTDE 3SV8A 5F6MA 4J1YA 2VU8E 2VGCC 5FBIA 3ESTA 2FX6A 1GI8B 1SHHB 4NSVA 3GYMA 1QR3E 1VCQA 2Y82A 4LXBH 4WXVA 2A4OA 4YOGA 1C1OA 1SGQE 5DP5A 1GVLA 1NRSH 3RU4T 8GCHG 2BXTH 1QA7A 1YPGH 2VJ1A 2ZTXA 1PQ5A 3SV7A 1A5HA 1AIXH 1O2OA 3RU4D 4I31A 1E34B 4ISIH 1CBWB 4DGJA 4YOJA 5A0CA 3VB6A 2OQ5A 1TNLA 2BY5X 1E36B 1OWDA 2EI6A 1FLEE 1XM1A 2SGEE 1YPHC 2UUYA 3VPKA 4X1SU 3T29A 1DE7H 1Z6EA 1TGBA 1NFYA 3LGVA 2FYQA 4K1TA 3P8OA 1ETTH 1SBWA 2VIVA 3GYLB 3KHVA 1K2I1 1DFPA 1TBRH 1ELBA 5I25A 2V3HH 4FUFA 1O2XA 4CH8B 1WQVH 3S0NA 1P3CA 1ELTA 5LPFA 4AN7A 4A1TA 1UTOA 3AAUA 1FNIA 2ZFSA 2BLOA 4YM9A 2CJIA 3JZ2B 1C2GA 3KQEA 1FJSA 4TY6A 4ZXYH 4HI3A 3D49H 4FUGA 5FHTA 3BEUA 2W3KA 3SU6A 3NZIA 3L3TA 2VVUA 4CRAA 5C3NA 1TNKA 1G3DA 4R0IA 1H9IE 1OWKA 4ZMAH 2ZCHP 1AD8H 1TYNA 1MTVA 1TRMA 4ZKSU 2VGCB 3BN9A 1ZSLA 1ZSJA 1GBLA 2A4GA 4JYVH 2FOHA 2NU3E 2ZQ1A 4FUDA 1C5LH 1L4DA 2IN2A 1KSNA 3F9HA 1O2VA 3ODDA 1UMAH 4Z6AH 1HAGE 1UHBB 1VITF 1TMBH 2A32A 5DJ7A 2HPPH 1SGFA 1EB2A 1O2PA 1OP0A 3KQCA 1UTQA 2VWLA 1G9IE 2BOKA 2FODA 1TMTH 2NU0E 2ZU1A 2ZGXH 3LC5A 4FU8A 2FOEA 1QHRB 5F8XA 1L4ZA 1G2MA 3RXVA 4CRCA 1GMHF 1HAVA 2GV6A 4GVUA 3RLWH 1AB9B 3TK9A 1CQQA 2Y5FA 3KCGH 4ABGA 4D7GA 3PWBA 3A85A 2JKHA 2FLRH 1O2QA 4ISOA 3SUDA 1ETSH 3OY6U 1EATA 4KTSA 3MH4A 3V0XA 2W26A 2Z9KA 5C1XA 1QGFA 1A1RA 3OSYA 4GHQA 4FU9A 1DY9A 1DWDH 4RKOB 3FP8E 4O03A 1SGPE 5FX6A 3ZZ8A 4AGKA 3A8CA 3MO9A 2A4QA 1XVOA 3LGUA 4KGAA 2IOTA 1L1NA 3A82A 3G01A 1XUKA 1FAXA 2QAAA 3AASA 3PWCA 1LCYA 2TGPZ 1DWEH 1IQKA 4O3TA 1A5IA 5EU8A 2Q1JA 1C5TA 4THNH 3UY9A 2ESTE 2FM2A 4YO9A 2B0FA 1GBCA 2G00A 3K2UA 2AERH 1S85A 4AFZA 5EOKA 1C5MD 1ZSKA 4CRGA 1EUFA 2ZWLH 3M3SA 3MHWU 3T2NA 3U1JB 4YLUA 3BG8A 2ZHWH 1BTXA 4WH6A 1GJ8B 2ANKH 1S6HA 1VJAU 5F03A 3E6PH 1AVXA 1O2RA 1MTUA 1V2PT 4OS1A 2OC1A 2QA9E 1G36A 1SI5H 1TX7A 5JPMH 1FY3A 1UHBA 2ZTZA 3HGPA 1C5OH 4INHA 4DW2U 1LHDH 5E2PA 1GDQA 1QRZA 1TA2A 1OXGA 1BZXE 2A5IA 2QF3A 4SGBE 1Y3VA 2ZZUH 1OSSA 3ELAH 3ZVAA 5AFZH 2GDDA 3A8BA 3GY7A 3OTJE 1GBHA 1MKXK 1UCYH 2ALVA 3U9AH 3SQHE 4CBOA 2OC0A 2BLWA 1TB6H 2C8ZB 2QXGA 1BBRE 1TQ0B 2UWOA 2NU2E 2ALPA 4SGAE 4H42U 4Q7YA 4DT7B 5AHGH 1NZQH
chains in the Genus database with same CATH superfamily
1TBZH 2C8YB 1XKBC 1KTTB 1EOLA 1CGHA 5ETXA 4X1PU 4HZHA 4XDEA 2L6OA 1A4WH 5PTPA 4AG2A 1RTKA 1O3LA 2BDIA 1O39A 4ABDA 2XBWA 1UTPA 1W2KH 1BT7A 1IAUA 3DHKH 2KCYA 1QL8A 1LQEA 3RUOA 3DD2H 2H9TH 1RXPA 2R9PA 1SG8B 1ZJKA 1TMUH 1O2IA 1O3HA 3ENSB 1NS3A 2BDBA 1THPB 3UB0A 1C2FA 5KGOA 3QK1A 3QDZB 1K1OA 3SYJA 1LVBA 1QIXB 1QTFA 2Z7FE 1CA0C 2RG3A 3LPRA 2L74A 1MQ5A 4O97A 1WAYB 3PM3A 1YBWA 1EPTC 1K21H 4TSFD 4NFEA 1O3GA 1EZUC 2WYJA 4ZKOU 3MH6A 4MQAA 1C1WH 3ZZDA 2ZHDA 4NA8A 1O33A 1RJXB 4XSKU 2Z9LA 1XUFA 3TJUA 1C5QA 1GL0E 3UUZA 1T32A 2BLVA 1PYTC 2ODPA 3RC6A 5HM2A 5HKKD 3RC4A 3PTNA 1SLXB 5T6FA 3GY3A 1AVWA 4OM9A 3PMBB 4WMFA 1SLUB 2WV5A 2ZGBH 1Z8IB 4U01A 2ZU5A 1QQ4A 2FTLE 2QF0A 1PPGE 3PMAB 5GCHF 4ZHAA 1PPEE 1SOZA 2YMSC 1T4UH 1NBMD 2F9NA 1VCPA 3KGPA 1O2WA 3T5FH 5CE1A 3Q77A 4GLYA 1E1QD 4NWLA 3SI3H 2PKSC 3KYGA 1DXPA 1ZHRA 1H1BA 2VIWA 1AWHB 3F0OA 1TNJA 1C5XB 1SFIA 2XNDD 1BTPA 3MFJA 2I6QA 1EB1H 4NFFA 5DG6A 4F49A 1MH0A 4WF8A 1F0TA 1HB0B 1BB0B 4IGDA 1CA0B 3SHCH 3MQKC 2Q6FA 1FMGA 5GNDA 4TT3D 3SUGA 5GXPA 2OXSA 1GVZA 3M7TA 2QIQA 3F2GA 1NESE 2PSYA 1DXWA 1F5RA 2JJ2D 1Y5UT 4K8BA 3A7WA 2F9BH 1TPOA 1TA6A 1FY5A 2P3UB 2Z94A 1O3NA 1MTNB 3RC5A 2VWNA 3RMMH 1DDJA 1CU1A 2VB0A 1EQ9A 1W0ZU 1V2VT 4JK6A 4ZHMU 1SGFG 1CVWH 2BX4A 8LPRA 4AFQA 1TABE 3EE0B 1WDIA 5E8EH 4JZDH 4ABJA 4OS6A 1DSUA 1MKXH 2Y7ZA 1YGCH 3RMOH 1O5FH 1KDQB 1PPBH 1X7AC 2O8MA 1DLEA 1SGTA 2CN0H 2OC8A 1EAUA 1C5RA 2JDID 3TJVA 2F3CE 2GCTC 1BQYA 2SFAA 3T28A 3SU4A 2YMSB 2ZGCA 5CHBA 2J94A 2HLDD 1INCA 1IQNA 5J4SA 2BHGA 1GCTC 1P10A 1V2UT 2ZF0H 4AOQA 2KFWA 1JIRA 2H6MA 2PKSB 4MNYA 1H8ED 4IN1A 1AWFH 1AZ8A 1W0KD 3WWBA 2Q6GA 1FZZA 3VEQB 3PLBA 2ZPSA 1SOTA 1MZAA 5JB8S 2KCAA 1O3DA 3RXSA 3NKKA 3FP7E 2J92A 2BVXH 3GCTG 3NUMA 2GDEH 3RLYH 4AFUA 1K1NA 2BQ7B 1MBQA 2TGTA 2F9OA 1BTZA 1O5CB 1NU7B 1SL3A 2WV4A 2BDCA 1C9PA 4NSYA 1O3PB 3KQBA 1P01A 3A84A 2FEQH 1AN1E 2H2ZA 3SV2H 5EPYA 1IQGA 1SC8U 1O2TA 2OBQA 1O2MA 1D3TB 3P6ZB 4X8SH 3I29A 3SU2A 3CS7A 4Y0ZE 1NFWA 1O5BB 1A2CH 3O8CA 1SQTA 2A31A 1LKBA 1QBVH 2P8OC 1GHBG 4ZXXH 2GCTB 1THSH 1GJ9B 1E37B 3EGKH 3F1SB 1XVMA 1TGSZ 1YCPK 3EYDA 3FP6E 1OP2A 2JETC 3ATIA 1KDQA 3A83A 1GBJA 1GCTB 1SGNE 1SQRA 2C3SA 3Q3XA 1S0RA 3TIUA 2XRCA 1EJNA 3VB3A 4I8JA 1O3JA 4BAQB 1UVOA 3HGNA 1LHFH 2CF8H 2VIPA 1QJ6B 1QBOA 4E7NA 4H6SB 3TGIE 2PTNA 1BRAA 5DO4H 1ABIH 5GJ4B 2HVYB 1ZRKA 2LP6A 2Y7XA 3C27B 1H8IH 4MG3A 1SGDE 1O2JA 1N6XA 2QGRA 4X2VA 1C1TA 4MNWA 9LPRA 5FXLA 1EAWA 1G30B 4MNVA 5F53A 3U98H 1GHVH 1SGEE 1EZQA 3VXEH 3F3BA 5E0GA 2HVXA 2BXUH 2G5NA 1EJAA 1J9CH 5EXMA 1AHTH 2PGQB 3MU1A 1P09A 4H6TA 1SPJA 4AG1A 1P11E 2PHBA 1FV9A 3QZRA 1DUAA 5A0AE 1P2OA 3RMLH 1XUJA 4OS2A 3ZVBA 2XBXA 5TCCA 3CP7A 1ELDE 4INKA 2A7JA 3PO1B 3UTUH 1SLWB 3MI4A 1ANBA 2XBYA 2P8OB 1BHXB 4CRFA 5JBAS 2WPMS 3ATWA 1GI4A 2VWMA 2C8XB 3SGQE 2JETB 3BTME 1VKYA 1BIOA 4TWWA 2EI8A 3UPEA 2H1UA 4NGAH 4DT4A 2CXVA 4P02A 1J8AA 1UK3A 3FN8A 2PSXA 4GUXA 2HGTH 2NU1E 3URCA 2BD4A 4E7RG 2BY9X 1TX6A 2R0LA 3UOUA 1DICA 1Y3WA 3N7DA 3BTTE 1YLNA 4IBLH 1TPSA 2YNAA 2BY6X 1TIOA 2ZQ2A 5EPNA 2ZC9H 1ELEE 2O8TA 1SQAA 7GCHF 4DG4A 2WZQA 1C1VH 1H4WA 1BOQA 3E3TA 1XUGA 3MNCA 3V13A 3ZVFA 4F55A 1TONA 1MAYA 3ATMA 2A4RA 2JH0D 1FI8A 1UO6A 2BTCE 2ZDVH 3ATLA 3QGNB 3MH7A 1TGNA 1EAIA 1QB6A 2UUKB 2ZO3H 2V7QD 4MPXA 3LT3A 1Y3YA 1YPMH 2GX4A 4I8GA 4Q7XA 2UUJB 4P00A 1OWEA 1LPKB 1FIWA 1JMOH 1ANDA 1GJBB 1KLJH 4CH2B 1GHXH 2W7UA 1O3OA 3F9FA 1TFXA 1HUTH 1ELCA 3RXEA 5FCKA 5HIYA 4JMYA 2RCEA 2XNIA 2Y5GA 4JZEH 1GHAG 5SGAE 4QT8C 2J38A 2SGFE 5ESBA 3SJIA 4A1VA 3TJNA 3KEEA 1BUIA 1ELVA 2HNTF 4UFDH 2ZNKH 1GMCF 4FOUC 1J14A 1YCPH 3HK6B 3TVJB 1YPKH 4HFPB 1ACBE 2W6ID 3M37A 5HM9A 1ZPCA 3N7OA 4K8YA 2GT7A 1LPGB 4K5ZA 3GISB 2BD3A 3RXGA 1GBKA 3KNXA 1LPZB 2UUFB 1GL1A 1FDPA 1LTOA 2F43B 1UVPA 1AFQC 2TGDA 1GBFA 4X0WU 3HKIB 1XUHA 1AB9C 4I8KA 1ZJDA 3MTYA 4MVNA 2PWXA 2P3FH 5EXNA 3PYHA 1UCYK 2FI3E 3ZZCA 3QZQA 1NRRH 3LONA 4B73A 3QLPH 2G55A 5DGJA 5GDSH 3SUFA 2STAE 1O3CA 1KIGH 4X8UH 2WPKS 1GDUA 3FFGA 2PV9B 1YC0A 3DSPA 1QJ1B 3M5MA 2J5UA 1C2KA 1HAYB 1ZR0A 3TGKE 1K1LA 3GCNA 5J4QA 4K60A 2Z9IA 3RXIA 4NWKA 4X2XA 2BMGB 1ID5H 2HNTE 5A2MH 1MBMA 3SJOA 2WUBA 2ZCKP 1UTJA 5A0BA 1NFXA 1AE8H 3MU0A 3DFLA 1ESBA 1AZZA 4A6LA 2EA3A 3OAAD 2A1DB 4Y8ZA 1FX0B 1PPCE 1P3EA 1N8OC 4AYYB 1W10U 1RRKA 1D3PB 3TPIZ 2Y81A 2THFB 1UW7A 3DSGA 3A81A 1HNEE 4AGJA 1THRH 2FP7B 3LH3A 1K1IA 1LVYA 3FOAA 2FI5E 1OPHB 5HGGA 1QBNA 5JBBS 5ESTE 2A5AA 1T8LA 3BF6H 3P17H 4CRBA 4D76A 1Y59T 2QXHA 5AF9H 1L2EA 2SGPE 3O8DA 2B7DH 1AFQB 2UWPA 5FX5A 2NU4E 4I8HA 1GI2A 2GD4B 3H09A 1QFKH 1OOKB 1L1GA 1KXEA 1YLCA 5DPAA 4A92A 1A5GH 5KECA 1LVMA 3BTHE 3SN8A 3LC3A 3EA9A 1AQ7A 3L33A 3D62A 3DUXH 4AFSA 3RXBA 4Y76A 3PLPA 1QURH 1YP9A 2D1JA 1NPMA 3NPSA 5CHAC 5E0JA 3H5CB 1WTGH 1MABB 2QV1A 3P8GA 1D4PB 4Y7BA 1S6LA 2XOKD 4Z0KA 4Q4LA 4RT1A 4X1QU 1V2ST 1J16A 1MCTA 5TJXA 3E1XB 3U8OH 2FS8A 6GCHG 1WV7H 4ABFA 3TH2H 1PYTD 1N8OB 1D3QB 1FONA 2QYIA 2GMTC 2CMYA 3UQVA 1NTPA 4F48B 1WQSA 1F7ZA 3LU9B 4GHTA 1W14U 2AYWA 2OBOA 2WPJS 2KCOA 4GCHF 2WPLS 1V2MT 4ABIA 5LGOA 1JBUH 1SFQB 1O31A 5AFYH 2PP6A 2YMSD 3SU3A 1ZHMA 3U1IB 3T25A 2ZFRH 4J2YB 2CV3A 1O2YA 1S0QA 3NK8A 6CHAB 4B6FA 1HBTH 3Q00A 1O3FA 2J4IA 2V0BA 3GCHC 1ANEA 1P05A 2Y6TA 1C1QA 2SNVA 1TLDA 4Q7ZA 1TRNA 1IQEA 2A2QH 4KTCA 1O2NA 3RMNH 3BIUH 3PRDA 1C2MA 3BV9B 3UR6A 1YF4A 3ZZ9A 1CHOG 5CHAB 2RFKC 1HV7A 3TLOA 2Z9GA 4KTUA 1S81A 4JZFH 1UCYE 3TH3H 4K69A 1T31A 1G37A 3W94A 1O5AB 1A7SA 2VH6A 3TJOA 8GCHF 4YLQH 1HLTH 1T8MA 1C1MA 3NXPA 2F91A 2GMTB 3L6PA 4Y6DA 2OC7A 2STBE 5C17A 1C2EA 1ESAA 2ZA5A 3OEED 3UREA 2QE7D 3DSOA 1OS8A 1G32B 3RU4E 1M9UA 1IQIA 4BOHA 2FZZA 1TGTA 2FYRA 2P94A 1EJMA 1W8BH 3AW1A 5F8ZA 3D23A 2RDEA 1DS2E 1GI1A 2YNBA 1QNJA 3FAOA 1BMNH 3A89A 3STIA 1KYNA 1O5GH 1C1SA 3BTWE 2EC9H 5EJ1A 2FWWA 1FY8E 2W3IA 1CT2E 1FXYA 1CSOE 6ESTA 5A8YA 4I32A 2H9EH 3GCHB 3DFJA 2FDAA 4UDWH 2YOLA 2GT8A 4MLFB 4CHAB 1MTNC 2PTCE 3BTKE 2FO9A 3VG8A 3B23B 1D9IA 3D65E 2PR3A 1UK4A 5AVDA 3V3MA 3DA9B 4AORA 3U8TH 1TOMH 2ZU4A 1O2SA 2R2WU 3FZZA 2CHAB 3HK3B 1RTFB 2OLGA 2GZ8A 1RGQA 1SR5C 4A7IB 2XXLA 1DWBH 1QJ7B 2VWOA 3ATKA 3Q3KA 3Q76A 2ZP0H 1OYTH 1EXFA 3M3TA 1Y5AT 4RKJB 1B0EA 3MYWA 1ESTA 3F6UH 2ZU2A 5GIBA 4ASUD 1SLVB 2TPIZ 4Y0YE 2PFEA 1HXFH 4RI0A 1KXAA 2VVCA 3W95A 1GCDA 3A7TA 1W0JD 1K28D 4ABEA 1AGJA 3GS9A 1V2QT 3N99A 4WVPE 1G3BA 5C94A 4E06H 1ARBA 3AW0A 3VFEA 4D8NA 3SNCA 4X8TH 1UVUH 2XC5A 5F8TA 2AIQA 2AEIH 1DY8A 3C1KA 2HPQH 2A7HA 3SV6A 1Z1IA 1FIZA 2G4UA 2SGDE 2Y5HA 3A8AA 3E90B 3O8BA 3GICB 1H8DH 1NN6A 4GAWA 3O8RA 2WYGA 2WPDD 1P8VC 7KMEH 2GP9B 1P2JA 3MOCA 1P2MA 7ESTE 3BTQE 1HJAC 1OWHA 3QTOH 4XD7D 3LDXH 1O3KA 1BRBE 4Y7AA 4HGCA 1JRTA 5CMXH 3SU0A 3RDZA 3ZZ7A 3SNEA 1DT2A 5EODA 1DVAH 3PB1E 2GCHG 3V12A 3SZNA 4HG6A 3F9EA 2H9HA 1XXFA 3RP2A 3MWIU 1IQJA 1T8NA 5LPEA 4X6PA 1Z7KA 3PMJA 4MTBA 1MUEB 1Z8JB 1DM4B 1FAKH 5EXLA 5A09A 2OINA 3BSQA 4YXWD 2FOFA 4FUHA 1NROH 1ZOMA 2QF4A 1QCPA 1O2UA 4FU7A 4WMDA 5K7RA 4X6NA 2WSSD 2J97A 1FPCH 2AMDA 4YT7H 3ZYDA 1O2LA 3HKJB 1A3BH 1TNGA 1MQ6A 2ZFTA 3VB4A 2ASUB 3GOVB 4AB9A 1PQ7A 2FS9A 5L2ZH 1ARCA 1N1LA 1AKSB 1F5KU 1C1PA 1TE0A 1COWD 3OFND 3SOSA 4ABHA 4BXSA 1V2JT 1CT0E 5DSFA 2F9PA 3M7UA 2VINA 4VGCC 2W7SA 3RM2H 1ZMJA 2ZKSA 5T1VA 1UTKA 2BD8A 1IQHA 3S7KB 1QB9A 4KP0A 1HPGA 2OTVA 1ABJH 1HAIH 4X2YA 1VGCB 1QL9A 2ZECA 3ZZ3A 4F4OC 5FPTA 1C2HA 5I46H 1HJAB 1BMMH 1T8OA 3MO6A 1N6YA 4Q63A 5G4BA 1P12E 4RSPA 1O2HA 1PJPA 1AY6H 2V6NA 4TPIZ 5DP4A 1C1UH 2J9NA 3RXKA 4B2AA 1W3CA 1KMHB 1LHGH 1O30A 2BQWB 2PGBB 1AU8A 1SHYA 1DUEA 3PO1C 4DVAU 5DP7A 3SU5A 3N7EA 2J98B 1WYKA 1LQDB 5EJZA 5DP3A 2AMPA 1GJ5H 4WY3A 1LMWB 3E8LA 1IQFA 4ZAEA 3RXJA 2ANYA 2ZPRA 1UTMA 1Y8TA 4NA7A 3T26A 1E35B 3VXFH 1V2NT 3I77A 1KLIH 5A8XA 1KXBA 1HIAB 2ZEBA 1GMDF 1YPJH 1GJ6A 2ZGJA 5LPRA 2RA3A 3ZVEA 4DJZB 4XBCA 3SNDA 3U69H 1C5NH 3VB7A 2BDHA 2KAIB 2O8UA 4WMEA 3EDXB 5E2OA 3RXQA 3ITIA 4VGCB 3UIRA 2WPHS 2HWLB 2EQNA 4FUEA 1O35A 2XWBI 1P2QA 5C5OA 1YPEH 3SW2B 2SNWA 1P0SH 1C4U2 3SJ8A 1AVGH 1AKSA 1DITH 2ANWA 2ZPQA 1C5UA 1O3AA 3PRBA 4AYVB 4YESB 2AIPA 4XBBA 1OWIA 1MKWK 5L30H 3TK6A 3ZV8A 4ABAA 1ANCA 3FVFB 4WH8A 1CHGA 3SNAA 4B1TA 2BB4A 3PROA 1VITG 4NZQA 3SI4H 1HGTH 1O36A 1Y5BT 1HFDA 3SGBE 1GI5A 4K1EA 1RTLA 1GHZA 3IITA 3RXPA 1UTLM 3EQ0H 3UNRA 2ZDNA 2V35A 4ACBA 2BD7A 4DOQA 1NBME 1GMHG 1BRUP 1ELAA 1ZLRA 1QB1A 1LVOA 4ZUHA 4AB8A 2QF5A 3P95A 1VCWA 1QQUA 1QRWA 3ZZ5A 3P8FA 2FLBH 4BANB 2ZDLA 3TNSA 1GJ4H 4JYUH 3U8RH 5T3HA 3NRLA 2DE9A 3OEHD 4BTTB 1B7XB 1XMNB 2FX4A 1TRYA 1BTWA 3T27A 4CRDA 3QO6A 2ZFFH 1NT1A 1NU9A 3SBKA 1K9OE 4BAKB 2BM2A 3RXMA 2PLXA 2EI7A 4M9FA 1S84A 2BD5A 4KELA 2WINI 4U30A 1T4VH 3SQEE 3ZZAA 1NRQH 3MU4A 2F4LA 2K1QA 2KAIA 3M3VA 1TPAE 1GBTA 1BJUA 4X2WA 2QY0B 2C90B 2G5VA 2J34A 1EAXA 1O32A 2SGAA 1ZMNA 1P9UA 1FN8A 1SGYE 4XBDA 1O2ZA 2BLQA 3TH4H 1K1PA 1GBIA 3S69A 2P59A 1EOJA 1ZTJA 4CR9A 1WSSH 1AFEH 2AMQA 2TIOA 2FOGA 2HRVA 4ESTE 2ZI2H 3K9XB 5C5NA 4O3UA 1O0DH 4E05H 4UD9H 3SJKA 5DP6A 3R3GB 4ZH8A 2A2XH 2HNTC 4K3JA 2J95A 3B9FH 2QN5T 1O2GH 2AH4X 2Z3EA 2ZDKA 2GVFA 3GY4A 3B8JA 1PPFE 1C5PA 4DURA 1KY9A 3A80A 5C0UA 1O3IA 1C2DA 1RD3B 4ISNA 4AC9A 1CA8B 3CENA 2LPRA 3PV5A 4BAHB 1LO6A 1Q3XA 2A5KA 3BIVH 3PMHB 3GCTF 1C2LA 2XWAA 5EG4A 1O38A 1H9LB 2W5EA 1V3XA 2Z9JA 4D7FA 1A0LA 1BTUA 1YKTA 1HAPH 1LDTT 2M2AA 3MNXA 1A0HB 4FUIA 3EA7A 3EE7A 1YYY1 1HAXB 1GI6A 3E0NB 2VNTA 4OS5A 2XBVA 4Y71A 1GPZA 1S82A 1HAVB 2F9UA 3WY8A 5EQSA 1C4Y2 1HJ9A 2B8OH 3RXFA 1C2IA 1EP6A 2K0QA 3MH5A 2GTBA 4U2WA 4ZROA 2EEKA 3IWMA 1CE5A 1C4V2 3FANA 1WCZA 2BQ6B 3FO8D 5HXFA 1MKWH 2BDAA 2ZG0H 3LJJA 1GHBF 3K6ZA 4O9VA 1BBRK 1ZPBA 1NFUA 1F5LA 3UR9A 1DX5M 5FL7D 2V3OH 4D9QA 1C5VA 3M7QA 4R8TB 1CT4E 2XCFA 3PV2A 1P2IA 3V7TA 3ZZBA 4ACAA 2FMJA 3A88A 1FY1A 2QXIA 4K1SA 4BTUB 4INLA 1AI8H 4B2CA 2Q6DA 1OX1A 6LPRA 5HYOA 1V2LT 4HTCH 1C9TA 2GV7A 2AS9A 1Z1JA 1SSXA 1DPOA 2GGVB 4XOJA 5LH8A 2AGEX 2ZHQH 2RA0A 5DP9A 1GI9B 2GZ7A 1C1NA 4NCYA 1S6FA 5HMAA 3RXAA 2ZTYA 4JZ1A 5EIYA 3RXOA 3K6YA 4Q80A 6CHAC 5GCHG 1D6RA 3UNQA 4UFEH 3T62A 3TU7H 3LGIA 2F9VA 3GDUA 5EGMA 4X1NU 1MCVA 1MU6B 3P70B 3UNSA 3RXLA 1O3BA 4IMQA 1O3MA 3ZVGA 3ZVCA 5DKMA 3SNBA 3RXUA 3KYFA 1MD7A 4I7YH 1YPHE 2ANMH 1EZSC 2BOHB 1T7CA 1GI0A 2ZFPH 1KXFA 1PQ8A 5JDUB 4OS7A 4DY7B 2WUCA 4OGYA 3OYPA 2Z3DA 5JBTA 1OP8A 1U6QA 3LJOA 4B75A 1ZMLA 1ZHPA 2OP9A 1GJDB 4A5TS 4BAMB 2G4TA 5FPSA 2ULLA 1DLKB 2DE8A 2OQUA 4LZ1H 3RXDA 1ZTLA 2C4FH 3F9GA 3TNTA 1XXDA 4X1RU 1ZTKA 3TITA 1Y3XA 2VVVA 2WPIS 2AGGX 3LH1A 1SQOA 1PPZA 1K0HA 2P95A 1HAHH 2GJGA 5FCRA 2Z3CA 2FOAA 4MPVA 1VITH 1JXPA 4Y10E 4Y8YA 3ZZ4A 2TGAA 2J2UA 1VR1H 2ZU3A 3WW7A 2BX3A 3RXCA 1Z8RA 2BDGA 2GZ9A 1BTHH 1O37A 1FN6A 1BCUH 3M5OA 4JZIA 2IPHA 1DSTA 4I33A 1P57B 5DK1A 3E16B 2BD2A 1S83A 1GJ7B 2PKAB 4B76A 2P3TB 3PLKA 1O3EA 5C1YA 2O9QA 3AAVA 1Z71A 3Q3YA 4I86A 3MU5A 3UWIA 1ZGVA 5T6GA 1F0UA 2PUQH 3F2FA 3SJ9A 3H7OA 1MD8A 5EJLA 4CHAC 5L6NH 2C8WB 3SV9A 1OYQA 5BRRE 2CHAC 3KIDU 1XKAC 1F92A 1Y3UA 5T6DA 4UONA 1F0SA 1GHAF 4MNXA 1AMHA 1H9HE 3R0FA 2TRMA 1BA8B 2O8WA 3OY5U 4ISHH 4NIVA 4TY7A 3P8NA 1SKYE 3NWUA 3UFAA 1E38B 1AUJA 4FVBA 1S5SA 1EASA 2FESH 1A46H 4FUBA 1BBRH 8KME2 2KZ4A 2D8WA 4B6EA 1IQLA 1W7XH 5DN6D 1WXRA 2ZHFH 1E79D 1P06A 3WWFA 1GHYH 3OX7U 1WOFA 2H5CA 2ZFQH 2LELA 3TGJE 1BMLA 2FOMB 3M61U 2VIDA 1MMJN 2OUAA 2D2DA 3QGJA 1BMFD 1W0YH 5IK2D 1OHHD 4FVDA 2VIQA 3EAJA 1JOUB 2A0QB 2VIOA 1TAWA 5C2ZA 1O5DH 1PQAA 4IN2A 3BTFE 1TQ7B 2BY8X 1C5ZB 5C1UA 1YWUA 5JYIA 1NY22 1BJVA 1UJ1A 5JB9S 1WBGB 5FPYA 4CBNA 1NRPH 2JIZD 4ASHA 4NIXA 8ESTE 1K22H 3LIWA 2V3MA 3QTVH 1EP5A 2R3UA 3E91A 1K1MA 2KM0A 2Y80A 2HALA 4D9RA 3MNBA 1G3EA 2PKAA 1IOEA 1KTSB 4A1XA 1GBDA 1C5SA 1GMDG 2I6SA 3E0PB 2XC4A 3GY6A 3UWJH 3RM0H 2TBSA 1GBAA 4BXWA 2CF9H 1TWXB 1ZYOA 2B9LA 2PUXB 3A7YA 1PPHE 2AFQB 1ETRH 2SGQE 2D26C 4TWYA 2ZIQH 1GI7B 1AE5A 4H4FA 2IPQX 4CR5A 3ZVDA 3BEIB 5A8ZA 1C5WB 1KXDA 3VGCC 3GDSA 3SZEA 2QCYA 1HAZB 4MPWA 1EKBB 4B2BA 2IJOB 3MO3A 4UFGH 4YT6H 1P02A 2BDYA 3QUMP 1KLTA 4BAOB 1DWCH 1UVSH 4KKDA 4WJG2 2BZAA 1E0FD 5EQRA 1V6DA 4AX9H 3DCLA 4OGXA 1AUTC 4DIHH 4UFFH 1HCGA 2G81E 4LK4A 1JWTA 2G8TA 1L0ZA 1DOJA 1SGCA 2ZDAH 1WU1A 2DUCA 4JK5A 2P16A 1WTHD 1BMAA 3M5NA 1G2LA 1VGCC 5JBCS 4GPGA 2KCPA 3BG4C 3SU1A 3LGYA 1ZZZA 1GI3A 9ESTA 4ISLA 3I78A 1HDTH 3PV4A 1MU8B 3BEFB 1HXEH 4JCNA 5EW1H 1EPTB 4K2YA 2QC2A 3A86A 3MU8A 1BDAA 6GCHF 4I8LA 3PTBA 4MPUA 7LPRA 2XYAA 1SGIB 4NZLA 1F2SE 4FETA 4U32A 1NM6A 3VB5A 1NRNH 7GCHG 3NCLA 4B74A 1UVTH 2CGAA 1QA0A 3VGCB 5C67A 1V2OT 2WV9A 2H5DA 3M35A 5TCAA 5FBEA 1YCPM 1TNHA 4YZUA 4FUJA 4B71A 5C0TA 4FXGH 3F68H 1D3DB 1J15A 1GJCB 1TNIA 2R2MB 4X8VH 3ZV9A 4XE4A 4GSOA 3LOXA 3P92A 2VH0A 4IMZA 1CO7E 1FY4A 1TGCA 4DIIH 2UWLA 3UQOA 1C1RA 1ZRBA 1GGDC 2A45B 1G3CA 2O8LA 3GCOA 4PROA 2G52A 4YTAA 4TPYA 1KXCA 4OS4A 3RXHA 2XCNA 1P04A 2R3YA 1EX3A 3IG6B 1QL7A 1GWAA 2RDLA 3MMGA 3UOPA 1IHSH 3KQ5A 3QN7A 1MTSA 3BG4B 3RXRA 2GKVE 4BNRA 1CHOF 1ZPZA 2ZHEH 1GMCG 3MNSA 1RIWC 3M5LA 1GBEA 3CS0A 5BPEA 1QRXA 1MAXA 4M7GA 1O5EH 1Q31A 1ELFA 1V2WT 4LOYH 2M5TA 4LZ4B 2BY7X 5H4IB 2FI4E 1HYLA 4X6OA 3OU0A 5DP8A 3S9CA 5EW2H 3SORA 1GJAB 2B5TB 1EPTA 1TOCB 1FQ3A 1IQMA 2VBCA 2XW9A 1NC6A 4NIYA 5L2YH 3TK5A 1OWJA 4ZKRU 1FPHH 3KL6A 3A7XA 2NWNA 2BYAX 1Z6JH 2XC0A 4MDSA 1V2KT 2FOCA 1LHEH 1Q2WA 1EFRD 4UE7H 4FUCA 3SGAE 1B0FA 1TPPA 4IC5A 2BVSH 1FUJA 1SGRE 2BVRH 1HRTH 1W7GH 2C93B 4CREA 3U28C 2JH5D 1GGDB 3KN2A 1L1JA 1A3EH 3LKWA 1BITA 4ZKNU 4X6MA 3LGTA 3FKSD 3SHAH 1F0RA 1DANH 3UAIC 1JIMA 1C2JA 1BHXF 1JRSA 2HOBA 1O2KA 1YY3A 4AZ2B 3S7HB 3QX5H 2A7CA 1WUNH 3FZDA 4ZCNA 5C20A 1VZQH 1V2RT 1P9SA 1ZGIA 4IW4E 4ZHLU 1ELGA 1C5YB 5E0HA 3A7ZA 1W11U 1RIWB 1GG6C 1XUIA 1NO9H 2P93A 3K65B 3RXTA 1TX8A 5B6OA 1GBMA 1V2TT 4XFQA 2ZDMA 2R0KA 3A7VA 2JJ1D 1BTYA 2EY4C 1O34A 1GHWH 3OE7D 1GDNA 4NG9H 4WXIA 1UK2A 1GVKB 5IDKA 4TYDA 2W6JD 2XTTB 1P2KA 5IYTA 1PFXC 4Y8XA 3QWCH 1OKXA 2Z6BD 2G51A 3BTEE 3LGWA 3GY8A 4BTIB 1YPLH 3A87A 2OD3B 5GWZA 1VJ9U 3ZYEA 3URDA 2J98A 3HATH 2F83A 3JZ1B 2KR7A 1YLDA 1AO5A 4Y11E 2BZ6H 1A61H 2AGIX 5K0HA 1MZDA 1YM0A 1ORFA 4UEHH 4YOIA 3GDVA 3SO3A 3STJA 1W12U 4IS5A 1K1JA 1HIAA 1W13U 2OCVB 2ZCLP 4RN6A 1LKAA 3AVZA 4IC6A 1Z8GA 2ODYB 1XX9A 2FOBA 1CGIE 1D6WA 3HPTB 4NIWA 1TALA 1B5GH 3GY2A 4DCDA 2BD9A 1P2NA 1IHTH 1SB1H 3H7TA 2GCHF 1E1RD 1QY6A 1CBWC 1LHCH 4JYTA 2ZGHA 1GG6B 2FPZA 1HAOH 1P03A 3OTPA 3F0PA 2FIRH 2HLCA 4Q2KA 1A0JA 3GY5A 1TBQH 2PW8H 4GCHG 1RS0A 1SMFE 3F2HA 5GPIB 2JH6D 1EZXC 1J17T 2LNCA 2ODQA 5FAHA 4WWYA 3A8DA 3DT0H 3M36A 2ILNA 2K8IA 3BTGE 1GBBA 3ODFA 1HJ8A 2QXJA 2FXRA 5ABWA 4ABBA 4NA9H 1RFNA 1UTNA 3S9BA 1SVPA 3ZZ6A 2FTMA 1BRCE 3SUEA 2AHME 3S9AA 1H8HD 3KF2A 3EA8A 1MTWA 3KQDA 1CGJE 3ZIAD 5EQQA 4Y79A 3BTDE 3SV8A 5F6MA 4J1YA 2VU8E 2VGCC 5FBIA 3ESTA 2FX6A 1GI8B 1SHHB 4NSVA 3GYMA 1QR3E 1VCQA 2Y82A 4LXBH 4WXVA 2A4OA 4YOGA 1C1OA 1SGQE 5DP5A 1GVLA 1NRSH 3RU4T 8GCHG 2BXTH 1QA7A 1YPGH 2VJ1A 2ZTXA 1PQ5A 5HIZA 3SV7A 1A5HA 1AIXH 1O2OA 3RU4D 4I31A 1E34B 4ISIH 1CBWB 4DGJA 4YOJA 5A0CA 3VB6A 2CK3D 1QZ8A 2OQ5A 1TNLA 2BY5X 1E36B 1OWDA 2EI6A 1FLEE 1XM1A 5B6LA 2SGEE 1YPHC 2UUYA 3VPKA 4X1SU 3T29A 5KEDA 1DE7H 1Z6EA 1TGBA 1NFYA 3LGVA 2FYQA 4K1TA 3P8OA 1ETTH 1SBWA 2VIVA 3GYLB 3KHVA 1K2I1 1DFPA 1TBRH 1ELBA 5I25A 2V3HH 4FUFA 1O2XA 4CH8B 1WQVH 3S0NA 1P3CA 1ELTA 5LPFA 4AN7A 4A1TA 1UTOA 3AAUA 1FNIA 2ZFSA 2BLOA 4YM9A 2CJIA 3JZ2B 1C2GA 3KQEA 1FJSA 4TY6A 4ZXYH 4HI3A 3D49H 4FUGA 5FHTA 3BEUA 2W3KA 3SU6A 3NZIA 3L3TA 2VVUA 4CRAA 5C3NA 1TNKA 1G3DA 4R0IA 1H9IE 1OWKA 4ZMAH 2ZCHP 1AD8H 1TYNA 1MTVA 1TRMA 4ZKSU 2VGCB 3BN9A 1ZSLA 1ZSJA 1GBLA 2A4GA 4JYVH 2FOHA 2NU3E 2ZQ1A 4FUDA 1C5LH 1L4DA 2IN2A 1KSNA 3F9HA 1O2VA 3ODDA 1UMAH 4Z6AH 1HAGE 1UHBB 1VITF 1TMBH 2A32A 5DJ7A 2HPPH 1SGFA 1EB2A 4RT0A 1O2PA 1OP0A 3KQCA 1UTQA 2VWLA 1G9IE 2BOKA 2FODA 1TMTH 2NU0E 2ZU1A 2ZGXH 3LC5A 4FU8A 2FOEA 1QHRB 5F8XA 1L4ZA 1G2MA 3RXVA 4CRCA 1GMHF 1HAVA 2GV6A 4GVUA 4XRNA 3RLWH 1AB9B 3TK9A 1CQQA 2Y5FA 3KCGH 3W1EA 4ABGA 3PWBA 4D7GA 3A85A 2JKHA 2FLRH 1O2QA 4ISOA 3SUDA 1ETSH 3OY6U 1EATA 4KTSA 3MH4A 3V0XA 2W26A 2Z9KA 5C1XA 1QGFA 1A1RA 2KX4A 3OSYA 4GHQA 4FU9A 1DY9A 1DWDH 4RKOB 3FP8E 4O03A 1SGPE 5FX6A 2OK5A 3ZZ8A 4AGKA 3A8CA 3MO9A 2A4QA 1XVOA 3LGUA 3CNRA 4KGAA 2IOTA 1L1NA 3A82A 3G01A 1XUKA 1FAXA 2QAAA 3AASA 3PWCA 1LCYA 2TGPZ 1DWEH 3AK5A 1IQKA 4O3TA 1A5IA 5EU8A 2IJD1 2Q1JA 1C5TA 4THNH 3UY9A 2ESTE 2FM2A 4YO9A 2B0FA 1GBCA 2G00A 3K2UA 2AERH 1S85A 4AFZA 5EOKA 1C5MD 1ZSKA 4CRGA 1EUFA 2ZWLH 3M3SA 3MHWU 3T2NA 3U1JB 4YLUA 3BG8A 2ZHWH 1BTXA 4WH6A 1GJ8B 2ANKH 1S6HA 1VJAU 5F03A 5CDFE 3E6PH 1AVXA 1O2RA 1MTUA 1V2PT 4OS1A 2OC1A 2QA9E 1G36A 1SI5H 1TX7A 5JPMH 1FY3A 1UHBA 2ZTZA 3HGPA 1C5OH 4INHA 4DW2U 2WHXA 1LHDH 5E2PA 1GDQA 1QRZA 1TA2A 1OXGA 1BZXE 2A5IA 2QF3A 4SGBE 1Y3VA 2ZZUH 1OSSA 3ELAH 3ZVAA 5AFZH 2GDDA 3A8BA 3GY7A 3OTJE 1GBHA 1MKXK 1UCYH 2ALVA 3U9AH 3SQHE 4CBOA 2OC0A 2BLWA 1TB6H 2C8ZB 2QXGA 1BBRE 1TQ0B 2UWOA 2NU2E 2ALPA 4SGAE 4H42U 4Z1MD 4Q7YA 4DT7B 5AHGH 1NZQH
chains in the Genus database with same CATH topology
1TBZH 2C8YB 1XKBC 1KTTB 1EOLA 1CGHA 5ETXA 4X1PU 4HZHA 4XDEA 1A4WH 5PTPA 4AG2A 1RTKA 1O3LA 2BDIA 1O39A 4ABDA 2XBWA 1UTPA 1W2KH 1BT7A 1IAUA 3DHKH 1QL8A 1LQEA 3RUOA 3DD2H 2H9TH 1RXPA 2R9PA 1SG8B 1ZJKA 1TMUH 1O2IA 1O3HA 3ENSB 1NS3A 2BDBA 1THPB 1C2FA 3QK1A 3QDZB 1K1OA 1LVBA 1QIXB 1QTFA 2Z7FE 1CA0C 2RG3A 3LPRA 1MQ5A 4O97A 1WAYB 3PM3A 1YBWA 1EPTC 1K21H 4NFEA 1O3GA 1EZUC 2WYJA 4ZKOU 3MH6A 4MQAA 1C1WH 3ZZDA 2ZHDA 4NA8A 1O33A 1RJXB 4XSKU 2Z9LA 1XUFA 3TJUA 1C5QA 1GL0E 3UUZA 1T32A 2BLVA 1PYTC 2ODPA 3RC6A 5HM2A 3RC4A 3PTNA 1SLXB 5T6FA 3GY3A 1AVWA 3PMBB 4WMFA 1SLUB 2WV5A 2ZGBH 1Z8IB 4U01A 2ZU5A 1QQ4A 2FTLE 2QF0A 1PPGE 3PMAB 5GCHF 4ZHAA 1PPEE 1SOZA 1T4UH 3KGPA 2F9NA 1VCPA 1O2WA 3T5FH 5CE1A 3Q77A 4GLYA 4NWLA 3SI3H 2PKSC 1DXPA 1ZHRA 1H1BA 2VIWA 1AWHB 1TNJA 1C5XB 1SFIA 3MFJA 1BTPA 2I6QA 1EB1H 4NFFA 5DG6A 4F49A 1MH0A 4WF8A 1F0TA 1HB0B 1BB0B 4IGDA 1CA0B 3SHCH 2Q6FA 1FMGA 3SUGA 5GXPA 2OXSA 1GVZA 3M7TA 2QIQA 1DXWA 1NESE 2PSYA 1F5RA 4K8BA 1Y5UT 3A7WA 2F9BH 1TPOA 1TA6A 1FY5A 2P3UB 2Z94A 1O3NA 1MTNB 3RC5A 2VWNA 3RMMH 1DDJA 1CU1A 2VB0A 1EQ9A 1W0ZU 1V2VT 4JK6A 4ZHMU 1SGFG 1CVWH 2BX4A 8LPRA 4AFQA 1TABE 3EE0B 5E8EH 4JZDH 4ABJA 4OS6A 1DSUA 1MKXH 2Y7ZA 1YGCH 3RMOH 1O5FH 1KDQB 1PPBH 1X7AC 2O8MA 1DLEA 1SGTA 2CN0H 2OC8A 1EAUA 1C5RA 3TJVA 2F3CE 2GCTC 1BQYA 2SFAA 3T28A 3SU4A 2ZGCA 2J94A 1INCA 1IQNA 5J4SA 2BHGA 1GCTC 1P10A 1V2UT 2ZF0H 4AOQA 1JIRA 2H6MA 2PKSB 4MNYA 4IN1A 1AWFH 1AZ8A 2Q6GA 1FZZA 3VEQB 3PLBA 2ZPSA 1SOTA 1MZAA 5JB8S 1O3DA 3RXSA 3NKKA 3FP7E 2J92A 2BVXH 3GCTG 3NUMA 2GDEH 3RLYH 4AFUA 1K1NA 2BQ7B 1MBQA 2TGTA 2F9OA 1BTZA 1O5CB 1NU7B 1SL3A 2WV4A 2BDCA 1C9PA 4NSYA 1O3PB 3KQBA 1P01A 3A84A 2FEQH 1AN1E 2H2ZA 3SV2H 5EPYA 1IQGA 1SC8U 1O2TA 2OBQA 1O2MA 1D3TB 3P6ZB 4X8SH 3I29A 3SU2A 3CS7A 4Y0ZE 1NFWA 1O5BB 1A2CH 3O8CA 1SQTA 2A31A 1LKBA 1QBVH 2P8OC 1GHBG 4ZXXH 2GCTB 1THSH 1GJ9B 1E37B 3EGKH 3F1SB 1XVMA 1TGSZ 1YCPK 3EYDA 3FP6E 1OP2A 2JETC 3ATIA 1KDQA 3A83A 1GBJA 1GCTB 1SGNE 2C3SA 3Q3XA 1S0RA 3TIUA 2XRCA 1EJNA 3VB3A 4I8JA 1O3JA 4BAQB 1UVOA 3HGNA 1LHFH 2CF8H 2VIPA 1QJ6B 1QBOA 4E7NA 4H6SB 3TGIE 2PTNA 1BRAA 5DO4H 1ABIH 5GJ4B 1ZRKA 2Y7XA 3C27B 1H8IH 4MG3A 1SGDE 1O2JA 1N6XA 2QGRA 4X2VA 1C1TA 4MNWA 9LPRA 5FXLA 1EAWA 1G30B 4MNVA 3U98H 1GHVH 1SGEE 1EZQA 3VXEH 5E0GA 2HVXA 2BXUH 2G5NA 1EJAA 1J9CH 5EXMA 1AHTH 2PGQB 3MU1A 1P09A 4H6TA 1SPJA 4AG1A 1P11E 2PHBA 1FV9A 3QZRA 1DUAA 5A0AE 1P2OA 3RMLH 1XUJA 4OS2A 3ZVBA 2XBXA 5TCCA 3CP7A 1ELDE 4INKA 2A7JA 3PO1B 3UTUH 1SLWB 3MI4A 1ANBA 2XBYA 2P8OB 1BHXB 4CRFA 5JBAS 2WPMS 3ATWA 1GI4A 2VWMA 2C8XB 3SGQE 2JETB 3BTME 1BIOA 4TWWA 2EI8A 3UPEA 2H1UA 4NGAH 2CXVA 1J8AA 1UK3A 2PSXA 4GUXA 2HGTH 2NU1E 3URCA 2BD4A 4E7RG 2BY9X 1TX6A 2R0LA 3UOUA 1DICA 1Y3WA 3BTTE 4IBLH 1TPSA 2YNAA 2BY6X 1TIOA 2ZQ2A 5EPNA 2ZC9H 1ELEE 2O8TA 1SQAA 7GCHF 4DG4A 1C1VH 1H4WA 1BOQA 3E3TA 1XUGA 3MNCA 3V13A 3ZVFA 1TONA 1MAYA 3ATMA 2A4RA 2JH0D 1FI8A 1UO6A 2BTCE 2ZDVH 3ATLA 3QGNB 3MH7A 1TGNA 1EAIA 1QB6A 2UUKB 2ZO3H 4MPXA 3LT3A 1Y3YA 1YPMH 2GX4A 4I8GA 4Q7XA 2UUJB 1OWEA 1LPKB 1FIWA 1JMOH 1ANDA 1GJBB 1KLJH 4CH2B 1GHXH 2W7UA 1O3OA 3F9FA 1TFXA 1HUTH 1ELCA 3RXEA 5FCKA 4JMYA 2RCEA 2XNIA 2Y5GA 4JZEH 1GHAG 5SGAE 4QT8C 2J38A 2SGFE 5ESBA 3SJIA 4A1VA 3TJNA 3KEEA 1BUIA 1ELVA 2HNTF 4UFDH 2ZNKH 1GMCF 1J14A 1YCPH 3HK6B 3TVJB 1YPKH 4HFPB 1ACBE 3M37A 5HM9A 1ZPCA 3N7OA 4K8YA 2GT7A 1LPGB 4K5ZA 3GISB 2BD3A 3RXGA 1GBKA 3KNXA 1LPZB 2UUFB 1GL1A 1FDPA 1LTOA 1UVPA 1AFQC 2TGDA 1GBFA 4X0WU 3HKIB 1XUHA 1AB9C 4I8KA 1ZJDA 3MTYA 4MVNA 2PWXA 2P3FH 5EXNA 3PYHA 1UCYK 2FI3E 3ZZCA 3QZQA 1NRRH 3LONA 4B73A 3QLPH 2G55A 5DGJA 5GDSH 3SUFA 2STAE 1O3CA 1KIGH 4X8UH 2WPKS 1GDUA 3FFGA 2PV9B 1YC0A 1QJ1B 3M5MA 1C2KA 1HAYB 1ZR0A 3TGKE 1K1LA 3GCNA 5J4QA 4K60A 2Z9IA 3RXIA 4NWKA 4X2XA 2BMGB 1ID5H 2HNTE 5A2MH 1MBMA 3SJOA 2WUBA 2ZCKP 1UTJA 5A0BA 1NFXA 1AE8H 3MU0A 3DFLA 1ESBA 1AZZA 4A6LA 2EA3A 2A1DB 4Y8ZA 1PPCE 1P3EA 1N8OC 4AYYB 1W10U 1RRKA 1D3PB 3TPIZ 2Y81A 2THFB 3A81A 1HNEE 4AGJA 1THRH 2FP7B 3LH3A 1K1IA 1LVYA 2FI5E 1OPHB 5HGGA 1QBNA 5JBBS 5ESTE 2A5AA 1T8LA 3BF6H 3P17H 4CRBA 4D76A 1Y59T 2QXHA 5AF9H 1L2EA 2SGPE 3O8DA 2B7DH 1AFQB 2UWPA 5FX5A 2NU4E 4I8HA 1GI2A 2GD4B 1QFKH 1OOKB 1L1GA 1KXEA 1YLCA 5DPAA 4A92A 1A5GH 1LVMA 3BTHE 3SN8A 3LC3A 3EA9A 1AQ7A 3L33A 3D62A 3DUXH 4AFSA 3RXBA 4Y76A 3PLPA 1QURH 1YP9A 2D1JA 1NPMA 3NPSA 5CHAC 5E0JA 3H5CB 1WTGH 2QV1A 3P8GA 1D4PB 4Y7BA 4Z0KA 4X1QU 1V2ST 1J16A 1MCTA 5TJXA 3E1XB 3U8OH 2FS8A 6GCHG 1WV7H 4ABFA 3TH2H 1PYTD 1N8OB 1D3QB 1FONA 2QYIA 2GMTC 2CMYA 3UQVA 1NTPA 1WQSA 1F7ZA 3LU9B 4GHTA 1W14U 2AYWA 2OBOA 2WPJS 4GCHF 2WPLS 1V2MT 4ABIA 5LGOA 1JBUH 1SFQB 1O31A 5AFYH 3SU3A 1ZHMA 3U1IB 3T25A 2ZFRH 4J2YB 2CV3A 1O2YA 1S0QA 3NK8A 6CHAB 1HBTH 3Q00A 1O3FA 2J4IA 2V0BA 3GCHC 1ANEA 1P05A 2Y6TA 1C1QA 2SNVA 1TLDA 4Q7ZA 1TRNA 1IQEA 2A2QH 4KTCA 1O2NA 3RMNH 3BIUH 1C2MA 3BV9B 3UR6A 1YF4A 3ZZ9A 1CHOG 5CHAB 1HV7A 3TLOA 2Z9GA 4KTUA 1S81A 4JZFH 1UCYE 3TH3H 4K69A 1T31A 1G37A 3W94A 1O5AB 1A7SA 2VH6A 3TJOA 8GCHF 4YLQH 1HLTH 1T8MA 1C1MA 3NXPA 2F91A 2GMTB 3L6PA 4Y6DA 2OC7A 2STBE 1C2EA 1ESAA 2ZA5A 3UREA 1OS8A 1G32B 3RU4E 1M9UA 1IQIA 4BOHA 2FZZA 1TGTA 2FYRA 2P94A 1EJMA 1W8BH 3AW1A 5F8ZA 3D23A 1DS2E 1GI1A 2YNBA 1QNJA 3FAOA 1BMNH 3A89A 3STIA 1KYNA 1O5GH 1C1SA 3BTWE 2EC9H 2FWWA 1FY8E 2W3IA 1CT2E 1FXYA 1CSOE 6ESTA 5A8YA 4I32A 2H9EH 3GCHB 3DFJA 2FDAA 4UDWH 2YOLA 2GT8A 4MLFB 4CHAB 1MTNC 2PTCE 3BTKE 2FO9A 3B23B 1D9IA 3D65E 2PR3A 1UK4A 5AVDA 3V3MA 3DA9B 4AORA 3U8TH 1TOMH 2ZU4A 1O2SA 2R2WU 3FZZA 2CHAB 3HK3B 1RTFB 2OLGA 2GZ8A 1RGQA 1SR5C 4A7IB 2XXLA 1DWBH 1QJ7B 2VWOA 3ATKA 3Q3KA 3Q76A 2ZP0H 1OYTH 1EXFA 3M3TA 1Y5AT 4RKJB 1B0EA 3MYWA 1ESTA 3F6UH 2ZU2A 5GIBA 1SLVB 2TPIZ 4Y0YE 2PFEA 1HXFH 1KXAA 2VVCA 3W95A 1GCDA 3A7TA 1K28D 4ABEA 1AGJA 4WVPE 1V2QT 1G3BA 4E06H 1ARBA 3AW0A 3VFEA 4D8NA 3SNCA 4X8TH 1UVUH 2XC5A 5F8TA 2AIQA 2AEIH 1DY8A 3C1KA 2HPQH 2A7HA 3SV6A 1Z1IA 1FIZA 2G4UA 2SGDE 2Y5HA 3A8AA 3E90B 3O8BA 3GICB 1H8DH 1NN6A 4GAWA 3O8RA 2WYGA 1P8VC 7KMEH 2GP9B 1P2JA 3MOCA 1P2MA 7ESTE 3BTQE 1HJAC 1OWHA 3QTOH 3LDXH 1O3KA 1BRBE 4Y7AA 4HGCA 1JRTA 5CMXH 3SU0A 3RDZA 3ZZ7A 3SNEA 1DT2A 5EODA 1DVAH 3PB1E 2GCHG 3V12A 3SZNA 3F9EA 2H9HA 1XXFA 3RP2A 3MWIU 1IQJA 1T8NA 5LPEA 4X6PA 1Z7KA 3PMJA 4MTBA 1MUEB 1Z8JB 1DM4B 1FAKH 5EXLA 5A09A 2OINA 3BSQA 2FOFA 4FUHA 1NROH 1ZOMA 1QCPA 1O2UA 4FU7A 4WMDA 5K7RA 4X6NA 1FPCH 2AMDA 4YT7H 3ZYDA 1O2LA 3HKJB 1A3BH 1TNGA 1MQ6A 2ZFTA 3VB4A 2ASUB 3GOVB 4AB9A 1PQ7A 2FS9A 5L2ZH 1ARCA 1N1LA 1AKSB 1F5KU 1C1PA 1TE0A 3SOSA 4ABHA 4BXSA 1V2JT 1CT0E 2F9PA 3M7UA 2VINA 4VGCC 2W7SA 3RM2H 1ZMJA 2ZKSA 1UTKA 2BD8A 1IQHA 3S7KB 1QB9A 4KP0A 1HPGA 2OTVA 1ABJH 1HAIH 4X2YA 1VGCB 1QL9A 2ZECA 3ZZ3A 4F4OC 5FPTA 1C2HA 5I46H 1HJAB 1BMMH 1T8OA 3MO6A 1N6YA 5G4BA 1P12E 4RSPA 1O2HA 1PJPA 1AY6H 2V6NA 4TPIZ 5DP4A 1C1UH 2J9NA 3RXKA 4B2AA 1W3CA 1O30A 1LHGH 2BQWB 2PGBB 1AU8A 1SHYA 1DUEA 3PO1C 4DVAU 5DP7A 3SU5A 1WYKA 1LQDB 5DP3A 2AMPA 1GJ5H 4WY3A 1LMWB 3E8LA 1IQFA 4ZAEA 3RXJA 2ANYA 2ZPRA 1UTMA 1Y8TA 4NA7A 3T26A 1E35B 3VXFH 1V2NT 3I77A 1KLIH 5A8XA 1KXBA 1HIAB 2ZEBA 1GMDF 1YPJH 1GJ6A 2ZGJA 5LPRA 2RA3A 3ZVEA 4DJZB 4XBCA 3SNDA 3U69H 1C5NH 3VB7A 2BDHA 2KAIB 2O8UA 4WMEA 3EDXB 5E2OA 3RXQA 3ITIA 4VGCB 3UIRA 2WPHS 2HWLB 4FUEA 1O35A 2XWBI 1P2QA 5C5OA 1YPEH 3SW2B 2SNWA 1P0SH 1C4U2 3SJ8A 1AVGH 1AKSA 1DITH 2ANWA 2ZPQA 1C5UA 1O3AA 4AYVB 4YESB 2AIPA 4XBBA 1OWIA 1MKWK 5L30H 3TK6A 3ZV8A 4ABAA 1ANCA 3FVFB 4WH8A 1CHGA 3SNAA 4B1TA 2BB4A 3PROA 1VITG 4NZQA 3SI4H 1HGTH 1O36A 1Y5BT 1HFDA 3SGBE 1GI5A 4K1EA 1RTLA 1GHZA 3IITA 3RXPA 1UTLM 3EQ0H 3UNRA 2ZDNA 2V35A 2BD7A 4DOQA 1GMHG 1BRUP 1ELAA 1ZLRA 1QB1A 1LVOA 4ZUHA 4AB8A 3P95A 1VCWA 1QQUA 1QRWA 3ZZ5A 3P8FA 2FLBH 4BANB 2ZDLA 3TNSA 1GJ4H 4JYUH 3U8RH 5T3HA 2DE9A 4BTTB 1B7XB 1XMNB 2FX4A 1TRYA 1BTWA 3T27A 4CRDA 3QO6A 2ZFFH 1NT1A 1NU9A 3SBKA 1K9OE 4BAKB 2BM2A 3RXMA 2PLXA 2EI7A 1S84A 2BD5A 4KELA 2WINI 4U30A 1T4VH 3SQEE 3ZZAA 1NRQH 3MU4A 2K1QA 2KAIA 3M3VA 1TPAE 1GBTA 1BJUA 4X2WA 2QY0B </