1TGBA

Crystal structure of bovine trypsinogen at 1.8 angstroms resolution. ii. crystallographic refinement, refined crystal structure and comparison with bovine trypsin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase zymogen (serine proteinase)
molecule keywords TRYPSINOGEN
publication title Crystal structure of bovine trypsinogen at 1-8 A resolution. II. Crystallographic refinement, refined crystal structure and comparison with bovine trypsin.
pubmed doi rcsb
source organism Bos taurus
total genus 46
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1979-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgbA02
2GZ9A 2UWLA 1SLWB 1J17T 1DWBH 3A8AA 3SNAA 3ATLA 1G3EA 1FY5A 4I8HA 2VVVA 2AMPA 1EZUC 3MI4A 1O3LA 2EA3A 2FOGA 1C5WB 3NK8A 1SBWA 2O9QA 1TB6H 1K22H 3K9XB 5FXLA 4BTUB 8LPRA 1O3KA 2ZDMA 1WAYB 2PR3A 3RM2H 2ZA5A 1QRZA 4RKOB 1LVOA 1TRMA 1WTHD 1DDJA 3PWBA 1LHCH 3RXGA 1BTPA 2GV7A 4WXIA 1MTUA 1O3NA 1GHZA 3HK3B 2QY0B 1SLUB 1JBUH 1CGIE 3VGCB 1S6FA 3M37A 2F3CE 1O2IA 4E7NA 4CREA 3RXQA 1O2UA 1NO9H 3UREA 1Z71A 5GDSH 4K8YA 1AD8H 4KGAA 1OWKA 2ANMH 2BDHA 1F92A 3PWCA 3ZZ9A 2HWLB 3EQ0H 3BTTE 2A4GA 1FI8A 2Q1JA 3U98H 2J94A 1SQOA 5EGMA 3ZYEA 2FYQA 3MTYA 4K1SA 4AX9H 3LT3A 2OUAA 3RLWH 1AN1E 2ALPA 3RC4A 3RM0H 5T3HA 1H9IE 4MPWA 1ZSJA 1JOUB 1UTLM 1IOEA 4BAMB 4ZXXH 1QL7A 3QTVH 1THPB 4WWYA 1LVMA 2GGVB 2DE9A 1K2I1 4B75A 1O2QA 4AFQA 3B9FH 1TRNA 1GI1A 2PLXA 4MTBA 3VXFH 4DY7B 1ANCA 4BXSA 1TGCA 1A2CH 2D8WA 1UMAH 1DITH 3M7UA 3U9AH 4DJZB 2W3KA 5PTPA 1GCDA 3SUEA 1P9SA 4TPIZ 4U32A 1KSNA 3OX7U 3R3GB 2O8TA 2ZU3A 3FANA 4MNWA 4WMFA 1GBCA 2P3TB 2BYAX 1ZZZA 2Y80A 1Z6EA 4X1QU 3OTJE 2FMJA 3MWIU 1XKBC 3QTOH 4JZFH 3ZZBA 1IQMA 2BM2A 1O3JA 1J14A 4JYVH 1NRPH 1HJAC 1UVSH 3P6ZB 4NWLA 1GL1A 2AIQA 1O5AB 1O2MA 2PTCE 3EGKH 4YESB 2FIRH 3A7VA 4IBLH 4AYYB 1TBZH 1V2VT 4MPVA 1FAKH 4X8VH 2BY9X 4VGCB 2BHGA 4ZROA 2PKAA 2NU4E 3NCLA 1Z7KA 2ZU1A 1MU8B 1XX9A 2FOFA 1C1VH 3F6UH 5EOKA 5J4SA 2Z9LA 3E91A 5GCHF 4X6NA 4ABDA 3BTHE 2ZECA 5DP6A 2Z94A 3TH2H 2FS8A 2VU8E 3FAOA 2PWXA 3BF6H 4DW2U 1DWDH 1L1NA 3VB3A 1AFEH 3CS0A 4FUDA 2P59A 3MOCA 4Y0YE 3PTBA 1TNIA 3OSYA 1GHAF 2SGQE 1XVOA 2B9LA 4VGCC 5EXMA 4YTAA 5JBTA 1UHBA 2ANKH 2O8LA 1PQ8A 2ZIQH 3BG4B 3LDXH 3P95A 1KY9A 3UNSA 3MHWU 1KXEA 3W95A 3Q3KA 1Z8GA 4NGAH 2FESH 5EXNA 3BTME 3A8BA 2FOAA 3N7OA 2OC0A 1Q3XA 3T29A 1Z8RA 1YPMH 3GDUA 3OYPA 4A7IB 1VJ9U 5JBAS 2BZ6H 3ZZ4A 2ZPRA 1QBOA 2ZFQH 1RTLA 1O37A 1FQ3A 3F9GA 3PTNA 3IG6B 3UWJH 1OP2A 1CO7E 1KXAA 3UNQA 1UTKA 2ALVA 1ZSKA 3SBKA 1Z6JH 1GBEA 1HAYB 2TRMA 1GBKA 1P2OA 2NU0E 1IHSH 1HPGA 1C2JA 1HB0B 1MQ5A 3I29A 1HDTH 1V2ST 1GVKB 5FCKA 1G30B 1W12U 3T26A 2VH6A 3A8CA 5A2MH 1L4DA 2D26C 1SGDE 1O2OA 3BG4C 1P02A 4I33A 3QZRA 1J15A 2FI4E 1QIXB 3SU6A 3F9FA 3OY5U 4B74A 1QL9A 3ZVEA 5LPEA 1HNEE 1LKAA 2ULLA 4MDSA 2KAIB 3RXVA 2BY6X 3ZZCA 2ZG0H 4O9VA 4H42U 1NU7B 1P01A 3KCGH 1O31A 1AHTH 1H4WA 2YOLA 1VITH 2LNCA 3ODFA 5TCCA 3VB7A 2OQ5A 2W3IA 3GCOA 2PUQH 1LO6A 2J38A 2OCVB 1JXPA 3A86A 2BD4A 3BEUA 3RU4D 4INKA 2AERH 1O3IA 4NIXA 3ZYDA 3FZDA 4TWYA 4J1YA 2FOMB 2THFB 1P2MA 1Y3UA 2STBE 4JZEH 4I8LA 1W10U 1G9IE 4AGKA 1OWEA 1EZXC 3MH6A 2BDBA 1CSOE 4UFFH 2Q6GA 3ZVDA 2R2MB 1ELBA 2HPQH 1JMOH 2Q6FA 2WPLS 1HJ8A 1ZTJA 2WPKS 4NWKA 2OLGA 1TX7A 1GI9B 2ZU5A 3EYDA 5B6OA 1VZQH 2ZHDA 3GICB 1UTNA 3F9EA 2J34A 1UO6A 3PB1E 2XBYA 1SGPE 4FUBA 3TIUA 1YBWA 1QTFA 3KNXA 1BMAA 3RXMA 2F9PA 2Z6BD 2Z9IA 2A0QB 2P93A 1KTTB 1NM6A 2A5AA 1ACBE 1IQLA 2H2ZA 9ESTA 3H5CB 1HUTH 4GAWA 2ODYB 1GCTC 1LPZB 1O2VA 1FPHH 3UY9A 3DFLA 1AB9C 1YCPK 2Z9JA 1P06A 1BBRE 2VB0A 1GI3A 3MU4A 3SGBE 2AYWA 5I25A 2P95A 3QUMP 3S9AA 3L3TA 3P70B 2ODPA 4FUFA 1GDQA 4XSKU 1AMHA 1BA8B 1E35B 4FVBA 3CS7A 2PSYA 1B5GH 2G51A 3HGNA 1MZDA 1MTWA 4UFDH 2ZNKH 1GJ5H 1GG6C 1AY6H 2CXVA 3UUZA 2GDEH 4KTCA 1O3MA 3E16B 2PKSC 2XW9A 3UIRA 1EP6A 2BY5X 3KL6A 1MKWK 1P2NA 1LHEH 2BDCA 2GCTC 2RA0A 2ZGXH 5A8XA 1Q2WA 1K1NA 2EI8A 2IPHA 6LPRA 4X2XA 3QK1A 1BUIA 1DUEA 1CHOF 3RMLH 2FLBH 1TA6A 2VGCB 4CR9A 1F0RA 1TX8A 1NS3A 3ZZ3A 2AGIX 2GT8A 1S84A 3SU5A 1J8AA 3SO3A 2RDLA 1SOZA 2UUFB 3A87A 1TQ0B 1DUAA 3A7ZA 4JCNA 1VCWA 1ZHPA 1SGIB 4RN6A 5GXPA 2BVSH 3F68H 1GHXH 1CQQA 4U01A 1MH0A 3KIDU 1SQTA 1AZZA 4BAOB 3SNBA 1O5FH 4DURA 3GCHB 1E34B 1KLTA 1DOJA 1UVOA 5F6MA 4Y7BA 1EQ9A 3TH4H 3KEEA 1SGYE 1BZXE 1TBQH 1MTVA 4UDWH 1OP8A 1PJPA 2HRVA 2OD3B 1VGCC 5C67A 4WY3A 2C8YB 1SGNE 1ELGA 4GHTA 2WV5A 4UFGH 2AIPA 4Q7ZA 1GVZA 2B5TB 2PHBA 2Y5FA 1N6XA 1O32A 3E6PH 5FPSA 2C8XB 4Y10E 2ZDAH 3QX5H 1QL8A 1BTYA 3TVJB 3GDSA 1GMDG 1LHDH 2TGTA 2CV3A 1DX5M 3M35A 4NIVA 4B2AA 1ESTA 2NU3E 2TIOA 1HFDA 1P9UA 2BLVA 2OXSA 1BTHH 4BNRA 1HXEH 1PPGE 2WPMS 1XUFA 1F7ZA 4F49A 1AVWA 4GUXA 1BMMH 1K1LA 2TPIZ 4D7FA 1GI6A 2ZQ1A 2QAAA 1O39A 3LPRA 1OXGA 1QFKH 2ZFSA 1GI8B 1TGNA 4K69A 1A61H 4XBDA 3P92A 3URCA 5T6DA 2BX3A 2BQ6B 2ANYA 1FY4A 1EPTA 1ORFA 1O33A 5JB8S 2A7JA 3FP8E 1O30A 3T5FH 4B2BA 3STIA 4TY6A 2H6MA 1NFYA 3PMHB 2FLRH 5FX5A 3MMGA 2R9PA 4OS6A 1D4PB 5JPMH 4CRGA 1O3GA 1AWFH 1ZLRA 1VITF 1AUJA 1O2NA 3SUGA 1Z8JB 3QWCH 2BD8A 1BOQA 3LGYA 1YPHC 1V2QT 2W26A 1C5SA 4UD9H 3SJIA 4YO9A 5DO4H 4DIIH 3RXJA 1C2DA 4YT7H 1S82A 3LGVA 1GWAA 1C1QA 4GVUA 2FOEA 2M5TA 4HZHA 1UK3A 1P3CA 1ANEA 3FZZA 1MBMA 1T8MA 1TPPA 2H9HA 1EZSC 2R0KA 1VJAU 1UCYH 3BTEE 4AG1A 3DT0H 3TK6A 3TGKE 1C5XB 3M7QA 3EA7A 4CH8B 1N8OB 3TPIZ 1PPZA 4IC6A 1MAXA 2UWOA 5EQSA 2ZO3H 1HJ9A 1XUIA 2BX4A 1G3BA 1TBRH 1C2EA 1C2KA 3LJOA 4D9QA 1V2JT 3WY8A 1BITA 4Y71A 1GI7B 1GBJA 2B8OH 3V3MA 4NFFA 2Y7XA 2FXRA 1TE0A 2QXGA 2FOHA 1ZTLA 1GGDB 1TNGA 1FNIA 3ZVBA 4IS5A 1ZOMA 5HXFA 4FUGA 1SGTA 1ZTKA 1G2LA 3P8NA 3Q77A 3ZVGA 1TMBH 3LH1A 1P57B 1LPGB 2JH6D 3U1JB 4KELA 1D3DB 1N8OC 1EB2A 1XVMA 2F9OA 2GTBA 3A82A 1C9TA 3RXRA 1CT2E 3AAUA 5CMXH 4MLFB 1G32B 4HGCA 3NPSA 5L6NH 3RXFA 3LJJA 3SU1A 1CHOG 4XOJA 1THRH 5EXLA 1GL0E 2WYJA 1FPCH 5DGJA 4NA7A 2OC7A 5T6GA 2BD7A 5EQRA 1AUTC 2AMDA 1K1MA 1D6WA 1WU1A 1OYQA 6GCHF 1MTNB 2VJ1A 1O38A 3D49H 4FUIA 2XBXA 3IITA 1DT2A 1F0TA 1LVBA 3BTQE 2UWPA 2SGPE 1FY8E 1V2WT 1KTSB 3SORA 1H8IH 1UHBB 1AQ7A 4FU7A 3LGIA 1TMUH 5FAHA 4A1XA 3SNDA 3DD2H 4JYTA 1Y3WA 1YPKH 2F83A 2QCYA 1QBVH 1S0RA 3BIUH 8GCHG 2FX4A 3S9CA 2D2DA 1FN8A 4X8UH 5EPNA 3E3TA 1V6DA 1P03A 2A5IA 4CR5A 1DANH 2G00A 2I6QA 3D62A 2C8WB 3I77A 3ZZAA 3KQBA 1HBTH 3UOPA 1ELFA 4KTSA 2PFEA 1K28D 3MU1A 4DVAU 1OWJA 4NSVA 1BRUP 1GHBF 5C1UA 1NT1A 3HATH 1T8LA 1GDUA 2A31A 4CHAB 4DGJA 1O2YA 2VWMA 1GBTA 5C20A 3TNSA 3RDZA 2GMTB 1OPHB 1N1LA 2W7UA 1HRTH 3GCTG 3RXCA 1BTUA 3MU8A 1E37B 1K9OE 1EAWA 3OY6U 1K1IA 4AGJA 1DWEH 4K60A 1ZHMA 3VGCC 5LH8A 4J2YB 2ZHEH 3NZIA 4IW4E 1LPKB 1EX3A 3A89A 3K6YA 4Y79A 5F8TA 5L30H 2BLQA 4TPYA 3A84A 3E1XB 4UE7H 1CT0E 2B0FA 2QYIA 1Y3VA 2Y82A 3A8DA 1G2MA 1XXDA 2BZAA 2AMQA 2ZHFH 1EUFA 3M5NA 2BY7X 3L6PA 1W14U 2ZFFH 2PSXA 2UUJB 1O0DH 4AG2A 2TGDA 5T6FA 5DG6A 5GIBA 1Y8TA 3RU4E 2GX4A 1HAZB 4OGYA 1VITG 2QA9E 4JZDH 3T25A 4Q7XA 2XWAA 2Y6TA 4I31A 1B7XB 4O03A 1N6YA 1V2TT 2R3YA 4A1VA 6CHAB 4E7RG 2ZPSA 1RJXB 1F2SE 2ZU2A 3MU5A 1HIAA 4ASHA 4INHA 1SGRE 1KDQB 2AGGX 4FVDA 5FBEA 2QXJA 1NN6A 1ZRBA 1AKSB 3LC5A 1C5TA 3AW1A 1CA8B 2H5DA 2G52A 2WUBA 1QHRB 2GV6A 4HFPB 2FODA 4YOJA 1GBHA 1TGTA 1YPJH 1ZHRA 3EA9A 4FUJA 4NA9H 5EW1H 3NUMA 4IC5A 2RCEA 3R0FA 4K1TA 5HGGA 3GCNA 2A2QH 2SNWA 1HAVA 4X1PU 4NA8A 4INLA 4Q80A 1HAPH 1SGQE 1C2HA 5JBBS 3SJOA 1ZPBA 4I8JA 2XC4A 6CHAC 1HAXB 1SOTA 3KHVA 3RXLA 4FXGH 1OKXA 4OS7A 4ABGA 1J9CH 3UNRA 1M9UA 2STAE 4K1EA 3KN2A 3MNSA 1MCVA 4TWWA 1IQFA 3U8RH 3DUXH 2WPHS 1V2MT 2OBOA 2Z3CA 1ZJKA 2F91A 1BJUA 1HAIH 3DA9B 5A09A 1LQDB 1OP0A 3ATIA 4KKDA 2PGQB 1A5HA 1KXDA 1P11E 2ZDLA 2EEKA 1O3AA 1W13U 1O3DA 2QXIA 4Y8XA 6GCHG 1P8VC 2ZPQA 2FEQH 1TYNA 2PGBB 1O2WA 1UTPA 1QJ6B 1WYKA 5GPIB 3PLBA 1ABJH 4FUCA 1HYLA 1SHHB 3RP2A 3RXDA 2XNIA 4RKJB 1D3TB 1W7XH 2ZHWH 1YP9A 2BDGA 3MNXA 3PROA 1ELAA 3RXKA 1SQAA 1BHXB 2ZZUH 1DLEA 3TK5A 1O35A 3L33A 3OU0A 2A7CA 3SJ9A 3V13A 3RXBA 3KF2A 2ZDVH 5GWZA 1H8DH 2XRCA 1O3PB 4H6TA 3SV8A 5A8ZA 2D1JA 3P17H 1EJAA 3M3VA 1DE7H 1JWTA 5CHAB 1T4UH 1GHBG 2HVXA 4I7YH 3M5LA 4ZKRU 3FP6E 1GMDF 4FUEA 1CU1A 2ZHQH 2J4IA 4BAQB 2HPPH 1THSH 1O5BB 4ZHMU 7ESTE 2BVRH 2P8OB 1EXFA 2FPZA 1AFQB 3ZZ7A 4LZ1H 1ZJDA 2VIOA 1IQKA 1ELDE 1Y5BT 3SV9A 1MKXH 1NFUA 4U2WA 4BAHB 1FZZA 1X7AC 1O3EA 2BDYA 5AF9H 4WH8A 1S83A 4ZKSU 3JZ2B 1P0SH 3RU4T 3RMMH 1QBNA 3GY6A 1DFPA 1C1SA 4Q7YA 1TFXA 2WV4A 3AAVA 1FONA 3HGPA 4ABAA 1F0SA 2FI5E 4PROA 4D9RA 5C1XA 2A5KA 1FIZA 3AW0A 1TNHA 5L2ZH 3BSQA 4B73A 1AU8A 5DP3A 3E0PB 4NFEA 3PLPA 4LXBH 3UOUA 1L1JA 4ABEA 5ABWA 1YGCH 5EPYA 2ZTZA 1K1OA 1AFQC 5G4BA 1O2GH 1PYTC 1YM0A 2CMYA 4WVPE 3VXEH 2BTCE 1H1BA 4E05H 3SQHE 5CE1A 1IQHA 1SLVB 3MNBA 4NIYA 2JETB 1ZPCA 1MZAA 2SNVA 1NESE 1YLCA 1V2NT 1D3QB 2V6NA 1HLTH 1T8NA 1UJ1A 3TGJE 4X1SU 1FIWA 2BOKA 4WMEA 1MBQA 3ZVFA 2A4OA 2J9NA 1O5GH 2ZKSA 1O2PA 2C3SA 1NY22 2ZCKP 2ZEBA 1SB1H 2ZQ2A 3RXSA 2O8UA 4NG9H 3SGAE 2Z9KA 1BIOA 2FX6A 2VNTA 1BBRH 2IN2A 3PYHA 4SGAE 1RIWB 1ETRH 4JK5A 4THNH 3SUFA 2HLCA 5EODA 1UK2A 5BPEA 3P8GA 2CGAA 1NTPA 2Z9GA 3SV6A 2F9NA 1TABE 1C1NA 3CP7A 1O3BA 1GJDB 1P10A 2QF0A 1T7CA 1D9IA 1RGQA 2GD4B 4WXVA 2XC0A 3S7HB 1CHGA 3LU9B 3O8BA 3UQOA 3EE0B 4Y8YA 1V3XA 3GY3A 1BTZA 1NRSH 4ISHH 1OOKB 3SJ8A 3RXHA 3TJNA 4YLUA 1DY8A 2VWNA 1QR3E 1TRYA 1RD3B 1XM1A 5HYOA 1BHXF 1CBWB 3SN8A 1Y3XA 1QGFA 1O5EH 2VIWA 4OGXA 2JH0D 3QGJA 2WPIS 1C5MD 4MG3A 1HAGE 1Y59T 1O2RA 1A0JA 1L2EA 3MNCA 4LK4A 3GOVB 4AORA 2XXLA 5C5NA 1P05A 1AGJA 4ABIA 4XBBA 3T27A 2ASUB 2OP9A 5A8YA 1QURH 1SGCA 1W8BH 1XKAC 1SGFA 3TJUA 4DT7B 5IYTA 1C5LH 1CT4E 1O3CA 1ESAA 1P2IA 1PYTD 2H5CA 4X2WA 4YLQH 2ZGBH 1C5RA 3M5OA 1IAUA 2ZGCA 4B71A 3H7TA 2BD3A 4X1NU 1BT7A 4XFQA 3SOSA 1EZQA 5DKMA 2Q6DA 4YOIA 1G3CA 1ETTH 3S69A 5FHTA 1TGBA 8GCHF 3MYWA 5FX6A 4I8KA 3KQEA 1SFQB 3O8DA 2VGCC 4DOQA 1YPHE 5DP9A 3U8TH 2RG3A 1MQ6A 3RC6A 4A5TS 4IN2A 1NFWA 5EU8A 1Y5AT 2BXUH 2A4RA 1PQAA 1TIOA 1C4V2 1C5PA 4D76A 1SI5H 2NU1E 1C5ZB 2C93B 2A45B 4M7GA 1QRXA 2CHAB 3EAJA 2C90B 1TPAE 1AVXA 2TBSA 4GHQA 3GCTF 1F5LA 2GZ8A 3GCHC 1OSSA 1LHFH 2C8ZB 1BDAA 3W94A 1MU6B 5TJXA 2AS9A 1LTOA 3ELAH 4R8TB 1QCPA 2OC1A 2PW8H 1PPCE 5FBIA 1PFXC 1BMNH 1YYY1 2VIPA 1W2KH 1BMLA 1XUHA 5C3NA 2H1UA 1EATA 2SGEE 3ZVAA 1IQJA 3FVFB 4X8SH 5BRRE 2BVXH 1JRSA 3IWMA 2RA3A 2FZZA 3NKKA 3HPTB 1C2IA 4H4FA 1HAOH 3PMJA 1LHGH 1WCZA 1QQUA 1B0FA 1DLKB 1XUGA 5F8ZA 1BTWA 2HNTF 1HGTH 2VWLA 1NRRH 4BTIB 1OWDA 2G4UA 1GVLA 2XYAA 2JKHA 2PUXB 3A7YA 4CRFA 1PPFE 3BEIB 4YOGA 3BN9A 2FOBA 5E2OA 1EP5A 1Z1JA 1F5RA 1O34A 2UUKB 4KP0A 2AGEX 3BTKE 4ISNA 7KMEH 2VWOA 1TPOA 2VIDA 3V0XA 5AFYH 1TWXB 3K6ZA 2NU2E 5JYIA 4Q2KA 3QGNB 1E38B 4X6PA 3M36A 1DPOA 3RXOA 4BXWA 1S0QA 1YKTA 3LKWA 5F8XA 1MKWH 2A32A 5C1YA 3PMAB 3U69H 2ZFRH 1O2LA 1ARCA 1IQNA 1F0UA 3PO1B 3SV7A 1VCQA 4Y76A 2FS9A 2G5VA 1QQ4A 3SI4H 4CRAA 3G01A 1OX1A 5AVDA 3TJVA 1KLJH 1TNLA 3S7KB 2K1QA 1SLXB 7GCHF 2ZTYA 2HOBA 4Y6DA 4IMZA 1IQGA 2W5EA 1GJ9B 2XBWA 2PKAB 1HAVB 1KIGH 4FU9A 3ZV8A 1AIXH 5LPFA 4QT8C 3ZZ8A 1GMCF 2YNBA 3M3SA 1BB0B 3LH3A 1SG8B 3TNTA 3TK9A 4Y8ZA 8KME2 1AE5A 2CF8H 2Z7FE 5DPAA 3UPEA 3T28A 4NIWA 3EDXB 3I78A 4NSYA 1ANBA 1C4U2 4K5ZA 4JYUH 3HKIB 3LONA 1QA0A 2ZCLP 1D6RA 2ZU4A 5FPYA 2Y5GA 1MUEB 1TALA 1AE8H 1FY3A 4GLYA 1RTFB 1ETSH 2WUCA 3D65E 1GGDC 3QDZB 1GI0A 2ZI2H 4YT6H 1VR1H 3SGQE 4AFZA 4YZUA 2ZF0H 1YF4A 1NZQH 3RLYH 4AOQA 1A4WH 3UTUH 1EB1H 4CBNA 4Y0ZE 1QB6A 1QB9A 2WPJS 1K21H 1L4ZA 1DS2E 1EAIA 1SVPA 1WOFA 2EI6A 1T4VH 2A1DB 4CRCA 3RXUA 1U6QA 1WV7H 1BRBE 1P12E 3NXPA 1L0ZA 2HALA 1C1UH 3GY2A 2FI3E 4OS2A 2DUCA 4O97A 1VCPA 3A81A 3DFJA 1GJ6A 1O5CB 1AI8H 1GBLA 2P94A 4AB9A 2XC5A 5FPTA 1UTQA 4TYDA 4UFEH 1MTNC 2DE8A 3A7WA 1P04A 2ZFPH 3ATKA 3GY8A 3A85A 6ESTA 1C2LA 1ELEE 5H4IB 3T2NA 4YM9A 1GI5A 3MH7A 4KTUA 1DVAH 1OWIA 1QY6A 1S85A 4OS1A 2QV1A 1C1OA 3Q76A 3VB5A 2G8TA 4CRBA 1ESBA 1SSXA 2AH4X 3A7XA 1FMGA 1V2OT 1RRKA 1XUJA 3GYMA 1SL3A 1J16A 1YPLH 3A80A 3LIWA 1C1RA 1QJ7B 1G3DA 2JH5D 1MMJN 5DP8A 2ILNA 3GY4A 1FN6A 1TLDA 2QF3A 3D23A 3BTWE 2OTVA 3GY7A 4IGDA 1S5SA 4UONA 4Z0KA 3QZQA 4K2YA 1K1JA 1DWCH 3LGUA 1WUNH 4X2YA 2VVUA 5K0HA 4CHAC 1KYNA 1MTSA 2XCFA 3DHKH 1O3FA 4MQAA 1E36B 1V2KT 2J92A 2A7HA 3VEQB 1TOMH 1LVYA 2GMTC 3U1IB 1QNJA 5F03A 5A0CA 2A2XH 1B0EA 1HJAB 1DSUA 2G55A 3LC3A 2GVFA 2F9BH 1ELTA 2AFQB 3K65B 1GJCB 4UEHH 5IDKA 1SR5C 4GSOA 1INCA 4X6MA 3RXTA 3PV4A 4CH2B 2ANWA 3E90B 2ZGHA 3SU2A 4X2VA 1CGJE 4BAKB 4LOYH 3GDVA 1PPHE 2FM2A 3SJKA 3BEFB 2ZP0H 3HK6B 2GT7A 1T31A 1MKXK 5E2PA 3M3TA 5C5OA 1UVUH 3M7TA 1YLDA 4U30A 1TGSZ 1PQ5A 2ZCHP 1HCGA 1TMTH 2SGAA 1KXFA 3ZZ6A 1SMFE 1WQSA 4DCDA 4ESTE 1ZMNA 1C1PA 2O8WA 4K8BA 7GCHG 2BQWB 4NZQA 1YC0A 3UWIA 1PPEE 4XBCA 1W0YH 1O3OA 3QO6A 1ARBA 2NWNA 5EW2H 4GPGA 2HGTH 2QC2A 3RXAA 1Z1IA 1HAHH 2OQUA 4X6OA 1GMCG 1NFXA 2ODQA 2J2UA 4B1TA 1O2JA 1GHYH 1V2PT 2Z3EA 1C5NH 1GI2A 4ZAEA 1HXFH 1V2RT 2H9EH 1FUJA 4GCHG 4ABFA 1LCYA 3PLKA 1WTGH 2GCHF 4ISIH 2VH0A 1O2HA 3UFAA 1O2SA 3ZVCA 1QJ1B 3TJOA 1BBRK 3V12A 2VIVA 4Y7AA 1K1PA 2R3UA 3P8OA 5A0BA 3PM3A 5DK1A 1SC8U 5FCRA 5J4QA 1AZ8A 5DP5A 1P09A 2QXHA 4ZHLU 7LPRA 4A92A 1FDPA 1TPSA 1TQ7B 2CF9H 1DSTA 1A5GH 4I8GA 2ZFTA 2OC8A 1UTJA 1GJAB 3ENSB 2Y5HA 3F1SB 1D3PB 9LPRA 3M61U 3GYLB 1CGHA 1ELCA 1SHYA 4D8NA 3KQDA 3JZ1B 2GKVE 5DJ7A 3SU4A 3P8FA 2FTMA 2GZ7A 3Q3YA 2C4FH 4AB8A 4DG4A 2V3OH 3MFJA 2F9UA 1UTMA 3ITIA 1EAXA 1FV9A 1W0ZU 1OWHA 1F5KU 4MNVA 4JZIA 2G4TA 4DIHH 3KGPA 1IHTH 2LPRA 3C27B 5JB9S 2OBQA 2VVCA 3UR9A 4BOHA 4ABJA 1JIRA 1GMHF 2CN0H 4F4OC 1DICA 3O8RA 3HKJB 3RXEA 1L1GA 1NU9A 1YPEH 1GBMA 5E0GA 4WMDA 1A46H 2SFAA 4WF8A 1AWHB 3ZV9A 3SV2H 5AFZH 4JZ1A 1JRTA 1ZYOA 2ZDKA 2BQ7B 4TY7A 2FOCA 2TGPZ 1FXYA 5CHAC 3T62A 1NRQH 3ZZ5A 1C9PA 1TX6A 1C1TA 1C2MA 4Y11E 3NWUA 2ZWLH 2XCNA 2BD9A 4MNXA 1O2XA 1ZGVA 1C1WH 1GBDA 1UVTH 2P8OC 1EPTB 4AN7A 2A4QA 1KLIH 3TU7H 1A3EH 1OS8A 2VINA 4XDEA 3VPKA 2HNTE 1SGEE 4CRDA 3URDA 5ETXA 1ZPZA 1KXBA 1S81A 3RC5A 1GCTB 1GI4A 3A83A 2V35A 1HV7A 3ATMA 1FAXA 1KDQA 1AB9B 3TH3H 1AKSA 1A0LA 4BTTB 2YNAA 1ZMJA 2EI7A 2IJOB 1GHWH 1Y5UT 3SZNA 1UVPA 5TCAA 4X0WU 1TOCB 3C1KA 3BTDE 3ZZDA 1JIMA 2QN5T 1Q31A 1C1MA 1EPTC 2W7SA 1ZGIA 4MNYA 3B8JA 1DM4B 4HTCH 3S0NA 1GG6B 3MH5A 1WQVH 2JETC 1MD8A 4I32A 4SGBE 3U8OH 1XMNB 2PKSB 3E8LA 1TNKA 4K3JA 1UTOA 3SQEE 1GBIA 2BOHB 3LGWA 3AASA 4H6SB 4ZKNU 1EASA 1A7SA 8ESTE 2GCTB 3VFEA 2V3HH 1G37A 1Y3YA 2WYGA 5EQQA 1P3EA 1NC6A 3VB6A 2FWWA 3SNEA 1GBAA 4ZHAA 2VIQA 1RIWC 2P3FH 3TGIE 2FP7B 3EA8A 5GCHG 1O36A 4A6LA 1DXPA 2XTTB 5I46H 3O8CA 3BTGE 5ESBA 3SI3H 5L2YH 2HNTC 2BDIA 3B23B 1MD7A 4AYVB 1NPMA 3UR6A 4Z6AH 1V2LT 1BRAA 2GCHG 1LQEA 3RMOH 3V7TA 5SGAE 1EKBB 1UCYK 1Z8IB 2SGDE 3ESTA 1C5OH 3MO3A 4XE4A 2FTLE 1GHAG 1O3HA 5LGOA 1XXFA 3S9BA 1C2GA 1RS0A 1ZRKA 2R0LA 2FO9A 1VGCB 5DP7A 4ISOA 1EOJA 3RXIA 3UQVA 3LGTA 2UUYA 4AFSA 2XWBI 2G81E 2GDDA 3F9HA 4B2CA 1CBWC 3FP7E 2H9TH 2ZGJA 1GPZA 5HM9A 1O5DH 2CJIA 4ZXYH 3CENA 2TGAA 3ODDA 2XBVA 3BIVH 1AVGH 3FFGA 1W11U 2EC9H 1W7GH 1T32A 1P2KA 4FU8A 4WH6A 2BD5A 2BD2A 1YPGH 2IOTA 3BV9B 5LPRA 4MVNA 3MH4A 4D7GA 2QGRA 1ID5H 4IMQA 3SUDA 1ZMLA 2P16A 1IQEA 1H9LB 3AVZA 1T8OA 1A3BH 1EOLA 3MO9A 5EG4A 1CA0B 2B7DH 1C5YB 3KQCA 2KAIA 2FDAA 5GJ4B 2P3UB 1GHVH 1GMHG 3SU3A 1C5QA 4E06H 1IQIA 3A7TA 4MPUA 1ELVA 4LZ4B 1A0HB 1BJVA 5E0JA 3TITA 2OINA 1P2QA 4NZLA 1WBGB 2BY8X 4OS4A 1LDTT 4O3UA 5K7RA 1CE5A 2BLWA 2SGFE 4JMYA 1TNJA 3RUOA 1EJMA 1XUKA 3RXPA 1UK4A 4X1RU 4WJG2 4A1TA 2ZTXA 2BDAA 1LKBA 4AZ2B 4AFUA 1GJ8B 2Y81A 4ISLA 1FY1A 1KXCA 3GISB 1C2FA 3PMBB 4ZH8A 1EJNA 2BB4A 2R2WU 5HMAA 3BTFE 2CHAC 3Q00A 1O2KA 1CA0C 4ABBA 1YCPH 2ZC9H 3SHCH 5HM2A 1GBBA 2PTNA 5C2ZA 4ZKOU 2WINI 2BLOA 1ZSLA 3Q3XA 1RTKA 4FUHA 1LMWB 4MPXA 1GJBB 1RFNA 3SNCA 1TA2A 1ABIH 3GY5A 1ANDA 4X8TH 5AHGH 2Z3DA 3M5MA 5ESTE 3MU0A 2PV9B 2I6SA 1CVWH 4BANB 1C5VA 1QRWA 1TAWA 2GP9B 1QA7A 4ABHA 1WSSH 1G36A 4R0IA 1NROH 4ZMAH 1QB1A 1NRNH 2V0BA 3E0NB 1HIAB 4JK6A 1C5UA 1E0FD 3SU0A 5JDUB 3VB4A 2J95A 1SFIA 1MAYA 3K2UA 4CBOA 3STJA 4HI3A 5A0AE 4OS5A 1GBFA 4NCYA 1A5IA 1MCTA 1EAUA 1TONA 2BXTH 1FLEE 1OYTH 5DP4A 1H9HE 3RMNH 4B76A 2QIQA 1C4Y2 3QN7A 1DXWA 1UCYE 3ATWA 1FJSA 2G5NA 1YCPM 4RSPA 1BRCE 2F9VA 3SW2B 1GJ4H 3H7OA 1SPJA 2BMGB 3TLOA 2FYRA 4O3TA 4IN1A 1P2JA 1PQ7A 1AO5A 3QLPH 1W3CA 2O8MA 1BTXA 1SGFG 1GJ7B 3PO1C 1A1RA 1PPBH 1RXPA 3A88A 3LOXA 3MO6A 4ZUHA 4GCHF 1BCUH 1O2ZA 5E0HA 2Y7ZA 2ZDNA 5JBCS 3BG8A 2ESTE 2AEIH 3SHAH 1S6HA 1ZR0A 1GDNA 1DY9A 1BQYA 5E8EH 1V2UT 1O2TA
chains in the Genus database with same CATH superfamily
2GZ9A 2UWLA 1SLWB 1J17T 1DWBH 3A8AA 3SNAA 3ATLA 1G3EA 1FY5A 4I8HA 2VVVA 2AMPA 5KEDA 1EZUC 2HLDD 3MI4A 1O3LA 2EA3A 2FOGA 1C5WB 3NK8A 1SBWA 2O9QA 1TB6H 1K22H 3K9XB 2QF5A 5FXLA 4BTUB 8LPRA 1O3KA 2ZDMA 1WAYB 2PR3A 5KGOA 3RM2H 2ZA5A 1QRZA 4RKOB 1LVOA 1TRMA 1WTHD 1DDJA 3PWBA 1LHCH 3RXGA 1BTPA 2GV7A 4WXIA 1MTUA 1O3NA 1GHZA 3HK3B 3F0OA 2QY0B 1SLUB 1WXRA 1JBUH 1CGIE 3VGCB 1S6FA 3M37A 1W0KD 2F3CE 1O2IA 4E7NA 4CREA 3RXQA 1O2UA 1NO9H 3UREA 3PV2A 1Z71A 5GDSH 4K8YA 1AD8H 4KGAA 1OWKA 2ANMH 2BDHA 1F92A 3PWCA 3ZZ9A 2HWLB 3EQ0H 3BTTE 2A4GA 1FI8A 2Q1JA 3U98H 2J94A 1SQOA 5EGMA 3ZYEA 2FYQA 3FO8D 3MTYA 4K1SA 4AX9H 3LT3A 2OUAA 3RLWH 1AN1E 2ALPA 3RC4A 3RM0H 5T3HA 1H9IE 4MPWA 1ZSJA 1JOUB 1UTLM 1IOEA 4BAMB 4ZXXH 1QL7A 3QTVH 1THPB 4WWYA 1LVMA 2GGVB 2DE9A 1K2I1 4B75A 1O2QA 4AFQA 3B9FH 1TRNA 1GI1A 2PLXA 4MTBA 3VXFH 2F4LA 4DY7B 1ANCA 4BXSA 1TGCA 1A2CH 2D8WA 2WPDD 1UMAH 1DITH 3M7UA 3U9AH 4DJZB 2W3KA 5PTPA 1GCDA 3SUEA 1P9SA 4TPIZ 4U32A 1KSNA 3OX7U 3R3GB 2O8TA 2ZU3A 3FANA 4MNWA 4WMFA 1GBCA 2P3TB 2BYAX 1ZZZA 2Y80A 1Z6EA 4X1QU 3OTJE 2FMJA 3MWIU 1XKBC 3QTOH 4JZFH 3ZZBA 3GS9A 1IQMA 2BM2A 1O3JA 1J14A 4JYVH 1NRPH 1HJAC 1UVSH 3P6ZB 4NWLA 2AIQA 1GL1A 1O5AB 1O2MA 1KMHB 2PTCE 3EGKH 4YESB 2FIRH 3A7VA 4IBLH 4AYYB 1TBZH 1V2VT 4MPVA 1FAKH 4X8VH 2BY9X 1W0JD 2BHGA 4VGCB 4ZROA 2PKAA 2NU4E 2KX4A 3NCLA 1SKYE 1Z7KA 2ZU1A 1MU8B 1XX9A 2FOFA 1C1VH 3F6UH 5EOKA 5J4SA 2Z9LA 3E91A 4XRNA 5GCHF 4X6NA 4ABDA 3BTHE 2ZECA 5DP6A 2Z94A 3TH2H 2FS8A 2JIZD 2VU8E 3FAOA 2PWXA 3BF6H 4DW2U 1DWDH 1L1NA 2IPQX 3VB3A 1AFEH 3CS0A 4FUDA 2P59A 3MOCA 4Y0YE 3PTBA 1TNIA 3OSYA 1GHAF 3PV5A 2KZ4A 4FOUC 2SGQE 1XVOA 2B9LA 4VGCC 5EXMA 4YTAA 5JBTA 1UHBA 2ANKH 2O8LA 1PQ8A 2ZIQH 3BG4B 3LDXH 3P95A 1KY9A 3UNSA 3MHWU 2WV9A 1KXEA 3W95A 3Q3KA 3ZIAD 1Z8GA 4NGAH 2FESH 5EXNA 3BTME 3A8BA 2FOAA 3N7OA 2OC0A 1Q3XA 3T29A 1Z8RA 1YPMH 3GDUA 3OYPA 4A7IB 4ASUD 1VJ9U 5JBAS 2BZ6H 3ZZ4A 2ZPRA 1QBOA 2ZFQH 1RTLA 1O37A 1FQ3A 3F9GA 3PTNA 3IG6B 3UWJH 1OP2A 1CO7E 1KXAA 3UNQA 1UTKA 2ALVA 1ZSKA 3SBKA 1Z6JH 1GBEA 1HAYB 2TRMA 1GBKA 1P2OA 2NU0E 1IHSH 1HPGA 1C2JA 1HB0B 1MQ5A 3I29A 1HDTH 1V2ST 1GVKB 5FCKA 1G30B 1W12U 3T26A 2VH6A 3A8CA 5A2MH 1L4DA 2D26C 1SGDE 1O2OA 3BG4C 1P02A 5DSFA 4I33A 3QZRA 1J15A 2FI4E 1QIXB 3SU6A 3F9FA 3OY5U 4B74A 1QL9A 5HKKD 2W6JD 3ZVEA 5T1VA 5LPEA 5C17A 1HNEE 1LKAA 2ULLA 4MDSA 2KAIB 3RXVA 2BY6X 3ZZCA 2ZG0H 4O9VA 4H42U 1NU7B 1P01A 3KCGH 1O31A 1AHTH 1H4WA 2YOLA 1VITH 2LNCA 3ODFA 5TCCA 3VB7A 2OQ5A 2W3IA 3GCOA 2PUQH 1LO6A 2J38A 2OCVB 1JXPA 3A86A 2JJ2D 1COWD 2BD4A 3BEUA 3RU4D 4INKA 2AERH 1O3IA 4NIXA 3ZYDA 3FZDA 3WWFA 4TWYA 4J1YA 2FOMB 2THFB 1P2MA 1Y3UA 2STBE 4JZEH 4I8LA 1W10U 1G9IE 4AGKA 1OWEA 1EZXC 3MH6A 2BDBA 1CSOE 4UFFH 2Q6GA 3ZVDA 2R2MB 1ELBA 2HPQH 1JMOH 2Q6FA 2WPLS 1HJ8A 1ZTJA 2WPKS 5IK2D 4NWKA 2OLGA 1EFRD 1TX7A 1GI9B 2ZU5A 3EYDA 5B6OA 1VZQH 2ZHDA 3GICB 1UTNA 3F9EA 2J34A 1UO6A 3PB1E 2XBYA 1SGPE 4FUBA 3TIUA 1YBWA 1QTFA 3KNXA 1BMAA 3RXMA 2F9PA 2Z6BD 2Z9IA 2J5UA 2A0QB 2P93A 1KTTB 1NM6A 2A5AA 1ACBE 1IQLA 2QF4A 2H2ZA 9ESTA 3H5CB 1HUTH 4GAWA 1S6LA 2ODYB 1GCTC 1LPZB 1O2VA 1FPHH 2K0QA 3UY9A 3DFLA 2KCAA 1AB9C 1YCPK 2Z9JA 1P06A 3OE7D 1BBRE 2VB0A 1GI3A 3MU4A 3SGBE 2AYWA 2WSSD 5I25A 2P95A 3QUMP 3S9AA 3L3TA 3P70B 2ODPA 4FUFA 1GDQA 4XSKU 1AMHA 1BA8B 1E35B 4FVBA 3CS7A 2PSYA 1B5GH 2G51A 3HGNA 1MZDA 1MTWA 4UFDH 2ZNKH 1GJ5H 1GG6C 1AY6H 2CXVA 3UUZA 2GDEH 4KTCA 3VG8A 1O3MA 3E16B 2PKSC 2XW9A 3UIRA 1EP6A 2BY5X 3KL6A 1MKWK 1P2NA 1LHEH 2BDCA 2GCTC 2RA0A 2ZGXH 5A8XA 1Q2WA 1K1NA 2EI8A 2IPHA 6LPRA 4X2XA 4Z1MD 3QK1A 1BUIA 1DUEA 1CHOF 3RMLH 2FLBH 1TA6A 2VGCB 4CR9A 1F0RA 1TX8A 1NS3A 3ZZ3A 2AGIX 2GT8A 1S84A 3SU5A 1J8AA 3SO3A 2RDLA 1SOZA 2UUFB 3A87A 1TQ0B 1DUAA 1H8HD 3A7ZA 4JCNA 1VCWA 1ZHPA 1SGIB 4RN6A 5GXPA 2BVSH 3F68H 1GHXH 1CQQA 4U01A 1BMFD 1MH0A 3KIDU 1SQTA 1AZZA 4BAOB 3SNBA 1O5FH 4DURA 3GCHB 1E34B 1KLTA 4XD7D 1DOJA 1UVOA 5F6MA 4Y7BA 1EQ9A 3TH4H 3KEEA 1SGYE 1BZXE 1TBQH 1MTVA 4UDWH 1OP8A 1PJPA 2HRVA 2OD3B 1VGCC 5C67A 4WY3A 2C8YB 1SGNE 1ELGA 4GHTA 2WV5A 4UFGH 2AIPA 4Q7ZA 1GVZA 2B5TB 2PHBA 2Y5FA 1N6XA 1O32A 3E6PH 5FPSA 2C8XB 4Y10E 2ZDAH 3QX5H 1QL8A 1BTYA 3TVJB 3GDSA 1GMDG 1LHDH 2TGTA 2CV3A 1DX5M 3M35A 4NIVA 4B2AA 1ESTA 2NU3E 2TIOA 1HFDA 1P9UA 2BLVA 2OXSA 1BTHH 4BNRA 1HXEH 1PPGE 2WPMS 1XUFA 1F7ZA 4F49A 4Q63A 4RI0A 1AVWA 4GUXA 1BMMH 1K1LA 2TPIZ 4D7FA 1GI6A 2ZQ1A 2QAAA 4I86A 1O39A 3LPRA 1OXGA 1QFKH 2ZFSA 1GI8B 1TGNA 4K69A 1A61H 4XBDA 3P92A 3URCA 5T6DA 2BX3A 2BQ6B 2ANYA 1FY4A 1EPTA 1ORFA 1O33A 5JB8S 2A7JA 3PRBA 3FP8E 1O30A 3T5FH 4B2BA 3DSGA 3STIA 4TY6A 2H6MA 1NFYA 3PMHB 2FLRH 5FX5A 3MMGA 4Q4LA 2R9PA 4OS6A 1D4PB 5JPMH 4CRGA 1O3GA 1AWFH 1ZLRA 1VITF 3H09A 1AUJA 1O2NA 3SUGA 1Z8JB 3QWCH 2BD8A 1BOQA 3LGYA 1YPHC 1V2QT 2W26A 1C5SA 4UD9H 3SJIA 4YO9A 3F2HA 5DO4H 4DIIH 3RXJA 1C2DA 4YT7H 1S82A 3LGVA 1GWAA 1C1QA 3KQ5A 2FOEA 4GVUA 2M5TA 4HZHA 1UK3A 1P3CA 1ANEA 3FZZA 1MBMA 1T8MA 1TPPA 2H9HA 1EZSC 2R0KA 1VJAU 1UCYH 3BTEE 4AG1A 3DT0H 3TK6A 3SYJA 3TGKE 1C5XB 3M7QA 3EA7A 4CH8B 1N8OB 3TPIZ 1PPZA 4IC6A 1MAXA 2UWOA 5EJZA 5EQSA 2ZO3H 1HJ9A 3NRLA 1XUIA 2BX4A 1G3BA 1TBRH 1C2EA 1C2KA 3LJOA 4D9QA 1V2JT 3WY8A 1BITA 4Y71A 1GI7B 1GBJA 2B8OH 3V3MA 4NFFA 2Y7XA 2FXRA 1TE0A 2QXGA 2FOHA 3UAIC 1ZTLA 1GGDB 1TNGA 1FNIA 3ZVBA 4IS5A 1ZOMA 5HXFA 4FUGA 4ZCNA 1SGTA 1ZTKA 1G2LA 3P8NA 3Q77A 3ZVGA 1TMBH 1WDIA 3LH1A 1P57B 1LPGB 4TSFD 2JH6D 5EJ1A 3U1JB 1OHHD 4KELA 1UW7A 1D3DB 1N8OC 1EB2A 1XVMA 2F9OA 2GTBA 3A82A 1C9TA 3RXRA 1CT2E 3AAUA 5CMXH 4MLFB 1G32B 4HGCA 3NPSA 5L6NH 3RXFA 3LJJA 3SU1A 1CHOG 4XOJA 1THRH 5EXLA 1GL0E 2WYJA 1FPCH 2F43B 5DGJA 4NA7A 2OC7A 5T6GA 2BD7A 5EQRA 1AUTC 2AMDA 1K1MA 1D6WA 1WU1A 2V7QD 1OYQA 6GCHF 1MTNB 2VJ1A 1O38A 3D49H 4FUIA 2XBXA 3IITA 1DT2A 1F0TA 1LVBA 4RT1A 3BTQE 2UWPA 2SGPE 1FY8E 1V2WT 1KTSB 3SORA 1H8IH 1UHBB 1AQ7A 4FU7A 3LGIA 1TMUH 5FAHA 4A1XA 3SNDA 3DD2H 4JYTA 1Y3WA 1YPKH 2F83A 5B6LA 2QCYA 1QBVH 1S0RA 2XNDD 3BIUH 2FX4A 8GCHG 3S9CA 2D2DA 1FN8A 3OFND 4X8UH 5EPNA 3E3TA 1V6DA 1P03A 2A5IA 4CR5A 1DANH 2G00A 2I6QA 3D62A 2C8WB 3I77A 3ZZAA 3KQBA 1HBTH 3UOPA 1ELFA 4KTSA 2PFEA 1K28D 3MU1A 4DVAU 1OWJA 2J98A 4NSVA 1BRUP 1GHBF 5C1UA 1NT1A 3HATH 1T8LA 1GDUA 2A31A 4CHAB 4DGJA 1O2YA 2VWMA 1GBTA 5C20A 3TNSA 3RDZA 2GMTB 1OPHB 1N1LA 2W7UA 1HRTH 3GCTG 3RXCA 1BTUA 3MU8A 1E37B 1K9OE 1EAWA 3OY6U 1K1IA 4AGJA 1DWEH 4K60A 1ZHMA 3VGCC 5LH8A 4J2YB 2ZHEH 3NZIA 4IW4E 1LPKB 1EX3A 3A89A 3K6YA 3N7DA 1FX0B 4Y79A 5F8TA 2XOKD 5L30H 2BLQA 4TPYA 3A84A 3E1XB 4UE7H 1CT0E 2B0FA 2QYIA 1Y3VA 2Y82A 3A8DA 4F48B 1G2MA 1XXDA 2BZAA 2AMQA 2ZHFH 1EUFA 3M5NA 2BY7X 3L6PA 1W14U 2RFKC 2ZFFH 2PSXA 2UUJB 1O0DH 2HVYB 4AG2A 2TGDA 5T6FA 5DG6A 5GIBA 1Y8TA 3RU4E 2GX4A 1HAZB 4OGYA 1VITG 2QA9E 4JZDH 2V3MA 3T25A 4Q7XA 2XWAA 2Y6TA 4I31A 1B7XB 3FOAA 4O03A 1N6YA 1V2TT 2R3YA 4A1VA 6CHAB 4E7RG 2ZPSA 1RJXB 1F2SE 1K0HA 2ZU2A 3MU5A 1HIAA 4ASHA 4INHA 1SGRE 1KDQB 2AGGX 4FVDA 4HG6A 5FBEA 2QXJA 1NN6A 1ZRBA 1AKSB 5HIZA 3LC5A 1C5TA 3AW1A 1CA8B 2H5DA 2G52A 2WUBA 1QHRB 2GV6A 4HFPB 2FODA 4YOJA 1GBHA 1TGTA 1YPJH 1ZHRA 3EA9A 4FUJA 4NA9H 5EW1H 3NUMA 4IC5A 2RCEA 3R0FA 2L74A 4K1TA 5HGGA 3GCNA 2A2QH 4OM9A 2SNWA 1HAVA 4X1PU 4NA8A 4INLA 4Q80A 1HAPH 1SGQE 1C2HA 5JBBS 3SJOA 1ZPBA 4I8JA 2XC4A 6CHAC 1HAXB 1SOTA 3KHVA 3RXLA 4FXGH 1OKXA 4OS7A 4ABGA 1J9CH 3UNRA 1M9UA 2STAE 4K1EA 3KN2A 3MNSA 1MCVA 4TWWA 1IQFA 3U8RH 3DUXH 2WPHS 1V2MT 2OBOA 2Z3CA 1ZJKA 2F91A 1BJUA 3F2GA 5CDFE 1HAIH 3DA9B 5A09A 1LQDB 1OP0A 3ATIA 4KKDA 2PGQB 1A5HA 1KXDA 1P11E 2ZDLA 2EEKA 1O3AA 1W13U 1O3DA 2QXIA 4Y8XA 6GCHG 1P8VC 2ZPQA 2FEQH 1TYNA 2CK3D 2PGBB 1O2WA 1UTPA 1QJ6B 1WYKA 5GPIB 3PLBA 1ABJH 4FUCA 1HYLA 1SHHB 3RP2A 3RXDA 2XNIA 4RKJB 1D3TB 1W7XH 2ZHWH 1YP9A 2RDEA 2BDGA 3MNXA 3PROA 1ELAA 4FETA 3RXKA 1SQAA 1BHXB 2ZZUH 1DLEA 3TK5A 1O35A 3L33A 3OU0A 2A7CA 3SJ9A 3V13A 3RXBA 3KF2A 2ZDVH 5GWZA 1H8DH 2XRCA 1O3PB 4H6TA 3SV8A 5A8ZA 2D1JA 3P17H 1EJAA 3M3VA 1DE7H 1JWTA 5CHAB 1T4UH 1GHBG 2HVXA 4I7YH 3M5LA 4ZKRU 3FP6E 1GMDF 4FUEA 1CU1A 2ZHQH 2J4IA 4BAQB 2HPPH 1THSH 1O5BB 4ZHMU 5GNDA 2BVRH 7ESTE 2P8OB 1EXFA 2FPZA 1AFQB 3ZZ7A 4LZ1H 1ZJDA 2VIOA 1IQKA 1ELDE 1Y5BT 3SV9A 1MKXH 1NFUA 4U2WA 4BAHB 1FZZA 1X7AC 1O3EA 2BDYA 5AF9H 4WH8A 1S83A 4ZKSU 3JZ2B 1P0SH 3RU4T 3RMMH 1QBNA 3GY6A 1DFPA 1C1SA 2JDID 4Q7YA 1TFXA 2WV4A 1QZ8A 3AAVA 1FONA 4M9FA 3HGPA 4ABAA 1F0SA 2FI5E 4PROA 4D9RA 5C1XA 2A5KA 1FIZA 3AW0A 2KCPA 1TNHA 5L2ZH 3BSQA 4B73A 1AU8A 5DP3A 3E0PB 4NFEA 3PLPA 4LXBH 3UOUA 1L1JA 2VBCA 4ABEA 5ABWA 1YGCH 5EPYA 2ZTZA 1K1OA 1AFQC 5G4BA 1O2GH 1PYTC 1YM0A 2CMYA 4WVPE 3VXEH 2BTCE 1H1BA 4E05H 3SQHE 5CE1A 1IQHA 1SLVB 3MNBA 4NIYA 2JETB 1ZPCA 1MZAA 2SNVA 1NESE 1YLCA 1V2NT 1D3QB 2V6NA 1HLTH 1T8NA 1UJ1A 3TGJE 4X1SU 1FIWA 2BOKA 4WMEA 1MBQA 3ZVFA 2A4OA 2J9NA 1O5GH 2ZKSA 1O2PA 2C3SA 1NY22 2ZCKP 2ZEBA 1SB1H 2ZQ2A 3RXSA 2O8UA 4NG9H 3SGAE 2Z9KA 1BIOA 2EQNA 2FX6A 2VNTA 1BBRH 2IN2A 3PYHA 4SGAE 1RIWB 1ETRH 4JK5A 4THNH 3SUFA 2HLCA 5EODA 1UK2A 5BPEA 3P8GA 2CGAA 1NTPA 2Z9GA 3SV6A 2F9NA 1TABE 1C1NA 3CP7A 1O3BA 1GJDB 1P10A 2QF0A 4AC9A 1T7CA 1D9IA 1RGQA 2GD4B 4WXVA 2XC0A 3S7HB 1CHGA 3LU9B 3O8BA 3UQOA 3EE0B 4Y8YA 1V3XA 3GY3A 1BTZA 1NRSH 4ISHH 1OOKB 3SJ8A 3RXHA 3TJNA 4YLUA 1DY8A 2VWNA 1QR3E 1TRYA 1RD3B 1XM1A 5HYOA 1BHXF 1CBWB 3SN8A 1Y3XA 1QGFA 1O5EH 2VIWA 4OGXA 2JH0D 3QGJA 2WPIS 1C5MD 4MG3A 1HAGE 1Y59T 1O2RA 1A0JA 1L2EA 3MNCA 4LK4A 3GOVB 4AORA 2XXLA 5C5NA 1P05A 2KR7A 1AGJA 4DT4A 4ABIA 4XBBA 3T27A 2ASUB 2OP9A 5A8YA 1QURH 1SGCA 1W8BH 1XKAC 1SGFA 3TJUA 4DT7B 5IYTA 1C5LH 1CT4E 1O3CA 1ESAA 1P2IA 1PYTD 2H5CA 4X2WA 4YLQH 3DCLA 2ZGBH 1C5RA 3M5OA 1IAUA 2KCOA 2ZGCA 4B71A 3H7TA 2BD3A 4X1NU 1BT7A 4XFQA 3SOSA 1EZQA 5DKMA 2Q6DA 4YOIA 1G3CA 1ETTH 3S69A 3UB0A 5FHTA 1TGBA 8GCHF 3MYWA 5FX6A 4I8KA 3KQEA 1SFQB 3O8DA 2VGCC 4DOQA 1YPHE 5DP9A 3U8TH 2RG3A 1MQ6A 2LELA 3RC6A 4A5TS 1YWUA 4IN2A 1NFWA 5EU8A 1Y5AT 2BXUH 2M2AA 3FKSD 2A4RA 1PQAA 1TIOA 1C4V2 1C5PA 4D76A 1SI5H 3SZEA 2NU1E 1C5ZB 2C93B 2A45B 4M7GA 1QRXA 2CHAB 3EAJA 2C90B 1TPAE 1AVXA 2TBSA 4GHQA 3GCTF 1F5LA 2GZ8A 3GCHC 3W1EA 1OSSA 1LHFH 2C8ZB 1BDAA 3W94A 1MU6B 5TJXA 2AS9A 1LTOA 3ELAH 2J98B 4R8TB 1QCPA 2OC1A 2PW8H 1PPCE 1E1RD 1PFXC 3OTPA 5FBIA 1BMNH 1YYY1 2VIPA 1W2KH 1BMLA 1XUHA 5C3NA 2H1UA 1EATA 2SGEE 3ZVAA 3N7EA 1IQJA 3FVFB 4X8SH 5BRRE 2BVXH 1JRSA 2AHME 3IWMA 2RA3A 2FZZA 3NKKA 3HPTB 1C2IA 4H4FA 1HAOH 3PMJA 1LHGH 1WCZA 1QQUA 1B0FA 1DLKB 1XUGA 5F8ZA 1BTWA 2HNTF 1HGTH 2VWLA 3OEHD 1NRRH 4BTIB 1OWDA 2G4UA 1GVLA 2XYAA 2JKHA 2PUXB 3A7YA 4CRFA 1PPFE 3BEIB 4YOGA 3BN9A 2FOBA 5E2OA 1EP5A 4TT3D 2YMSB 1Z1JA 1F5RA 1O34A 2UUKB 4KP0A 2AGEX 3BTKE 4ISNA 7KMEH 2VWOA 1TPOA 2VIDA 3V0XA 5AFYH 1TWXB 3K6ZA 2NU2E 5JYIA 4Q2KA 3QGNB 1E38B 4X6PA 1H8ED 3M36A 1DPOA 3RXOA 4BXWA 1S0QA 1YKTA 3LKWA 5F8XA 1MKWH 2A32A 5C1YA 3PMAB 3U69H 2ZFRH 1O2LA 1ARCA 1IQNA 1F0UA 3PO1B 3SV7A 2WZQA 1VCQA 4Y76A 2FS9A 2G5VA 1QQ4A 3SI4H 4CRAA 3G01A 1OX1A 5AVDA 3TJVA 1KLJH 1TNLA 3S7KB 2K1QA 1SLXB 3N99A 2YMSC 7GCHF 2ZTYA 2HOBA 4Y6DA 4IMZA 1IQGA 2W5EA 1GJ9B 2XBWA 2PKAB 1HAVB 1KIGH 4FU9A 3ZV8A 1AIXH 5LPFA 4QT8C 3ZZ8A 1GMCF 5DN6D 2YNBA 3M3SA 1BB0B 3LH3A 1SG8B 3TNTA 3TK9A 4Y8ZA 8KME2 1AE5A 2CF8H 2Z7FE 5DPAA 3CNRA 3UPEA 1NBMD 3T28A 4NIWA 3EDXB 3I78A 4NSYA 1ANBA 1C4U2 4K5ZA 5C0UA 4JYUH 3HKIB 3LONA 1QA0A 2ZCLP 1D6RA 2ZU4A 5FPYA 2Y5GA 1MUEB 1TALA 1AE8H 1FY3A 4GLYA 1RTFB 1ETSH 2WUCA 3D65E 1GGDC 3QDZB 1GI0A 5F53A 2ZI2H 4YT6H 1VR1H 2QE7D 3SGQE 4AFZA 4YZUA 2ZF0H 1YF4A 1NZQH 3RLYH 4AOQA 1A4WH 3UTUH 1EB1H 4CBNA 4Y0ZE 1QB6A 1QB9A 2WPJS 1K21H 1L4ZA 1DS2E 1EAIA 1SVPA 1YLNA 1WOFA 2EI6A 1T4VH 2A1DB 4CRCA 3RXUA 1U6QA 1WV7H 1BRBE 1P12E 3NXPA 1L0ZA 2HALA 1C1UH 3GY2A 2FI3E 4OS2A 2DUCA 4O97A 1VCPA 3A81A 3DFJA 1GJ6A 1O5CB 1AI8H 1GBLA 1VKYA 2P94A 4ACBA 2PP6A 4AB9A 2XC5A 4RT0A 5FPTA 1UTQA 4TYDA 4UFEH 1MTNC 2DE8A 3A7WA 1P04A 2ZFPH 3ATKA 3GY8A 3A85A 6ESTA 1C2LA 1ELEE 5H4IB 3T2NA 4YM9A 1GI5A 3MH7A 4KTUA 1DVAH 1OWIA 1QY6A 2WHXA 1S85A 4OS1A 2QV1A 1C1OA 3Q76A 4P00A 3VB5A 2G8TA 2YMSD 3OEED 4CRBA 1ESBA 1SSXA 2AH4X 3A7XA 1FMGA 1V2OT 1RRKA 1XUJA 3GYMA 1SL3A 1J16A 1YPLH 3A80A 3LIWA 1C1RA 1SQRA 1QJ7B 1G3DA 2JH5D 1MMJN 5DP8A 2ILNA 3GY4A 1FN6A 1TLDA 2QF3A 3D23A 3BTWE 2OTVA 3GY7A 4IGDA 1S5SA 2EY4C 4UONA 4Z0KA 3QZQA 4K2YA 1K1JA 1DWCH 3LGUA 1WUNH 4X2YA 2VVUA 5K0HA 4CHAC 1KYNA 1MTSA 2XCFA 3DHKH 1O3FA 4MQAA 1E36B 1V2KT 2J92A 2A7HA 3VEQB 1TOMH 1LVYA 2GMTC 3U1IB 1QNJA 5F03A 5A0CA 2A2XH 1B0EA 1HJAB 1DSUA 2G55A 3LC3A 2GVFA 2F9BH 1ELTA 2AFQB 3K65B 3OAAD 5C0TA 1GJCB 4UEHH 5IDKA 1SR5C 4GSOA 1INCA 4X6MA 2JJ1D 4F55A 3DSPA 3RXTA 3PV4A 4CH2B 2ANWA 3E90B 2ZGHA 3SU2A 4X2VA 1CGJE 4BAKB 4LOYH 3GDVA 1PPHE 2FM2A 3SJKA 3BEFB 2ZP0H 3HK6B 2GT7A 1T31A 1MKXK 5E2PA 3M3TA 5C5OA 1UVUH 3M7TA 1YLDA 4U30A 1TGSZ 1PQ5A 2ZCHP 1HCGA 1TMTH 2SGAA 1KXFA 3ZZ6A 1SMFE 1WQSA 4DCDA 4ESTE 1ZMNA 1C1PA 2O8WA 4K8BA 7GCHG 2BQWB 4NZQA 1YC0A 3UWIA 1PPEE 4XBCA 1W0YH 1O3OA 3QO6A 1ARBA 2NWNA 5EW2H 4GPGA 2HGTH 2QC2A 3RXAA 1Z1IA 1HAHH 2OQUA 4X6OA 1GMCG 1NFXA 2ODQA 2J2UA 4B1TA 1O2JA 1GHYH 1V2PT 2Z3EA 1C5NH 1GI2A 4ZAEA 1HXFH 1V2RT 2H9EH 1FUJA 4GCHG 4ABFA 1LCYA 3PLKA 1WTGH 2GCHF 4ISIH 2VH0A 1O2HA 3UFAA 1O2SA 3ZVCA 3MQKC 1QJ1B 3TJOA 1BBRK 3V12A 2VIVA 4Y7AA 1K1PA 2R3UA 3P8OA 5A0BA 3PM3A 5DK1A 1SC8U 5FCRA 5J4QA 2K8IA 1AZ8A 5DP5A 1P09A 2QXHA 4ZHLU 7LPRA 1YY3A 4A92A 1FDPA 5EIYA 1TPSA 1TQ7B 2CF9H 1DSTA 1A5GH 4I8GA 2ZFTA 2OC8A 1UTJA 1GJAB 3ENSB 2Y5HA 3F1SB 1D3PB 3KYFA 4ACAA 9LPRA 3M61U 2KCYA 5KECA 3GYLB 1CGHA 1ELCA 1SHYA 4D8NA 3KQDA 3JZ1B 2GKVE 5DJ7A 3SU4A 3P8FA 2FTMA 2GZ7A 2OK5A 3Q3YA 2C4FH 4AB8A 4DG4A 2V3OH 3MFJA 2F9UA 4B6EA 1UTMA 3ITIA 1EAXA 1FV9A 1W0ZU 3WW7A 1OWHA 1F5KU 4MNVA 4JZIA 2G4TA 4DIHH 3KGPA 1IHTH 2LPRA 3C27B 5JB9S 2OBQA 2VVCA 3UR9A 4BOHA 4ABJA 1JIRA 1GMHF 3F2FA 2CN0H 4F4OC 1DICA 3O8RA 3HKJB 3RXEA 1L1GA 1NU9A 1YPEH 1GBMA 5E0GA 4WMDA 1A46H 2SFAA 4WF8A 1AWHB 3ZV9A 1E1QD 5AFZH 4JZ1A 3SV2H 1JRTA 1ZYOA 3EE7A 2ZDKA 2BQ7B 4TY7A 2FOCA 2TGPZ 1FXYA 5CHAC 3T62A 1NRQH 2W6ID 3ZZ5A 1MABB 1C9PA 1TX6A 1C1TA 1C2MA 4Y11E 3NWUA 2ZWLH 2XCNA 2BD9A 4MNXA 1O2XA 1ZGVA 1C1WH 1GBDA 1UVTH 2P8OC 1EPTB 4AN7A 2A4QA 1KLIH 5HIYA 3TU7H 1A3EH 1OS8A 2VINA 4XDEA 3VPKA 2HNTE 1SGEE 4CRDA 3URDA 5ETXA 1ZPZA 1KXBA 1S81A 3RC5A 1GCTB 5FL7D 1GI4A 3A83A 2V35A 1HV7A 3ATMA 1FAXA 1KDQA 2J97A 1AB9B 3TH3H 1AKSA 1A0LA 4BTTB 2YNAA 1ZMJA 2EI7A 2IJOB 1GHWH 1Y5UT 3SZNA 1UVPA 5TCAA 4X0WU 1TOCB 3C1KA 3BTDE 4B6FA 3ZZDA 1JIMA 2QN5T 1Q31A 1C1MA 1EPTC 2W7SA 3AK5A 1ZGIA 4MNYA 3B8JA 1DM4B 4HTCH 3S0NA 1GG6B 3MH5A 3F0PA 1WQVH 2JETC 4YXWD 1MD8A 4I32A 4SGBE 3U8OH 1XMNB 2PKSB 3E8LA 1TNKA 4K3JA 1UTOA 3SQEE 1GBIA 2BOHB 3LGWA 3AASA 4H6SB 4ZKNU 1EASA 1A7SA 8ESTE 2GCTB 3VFEA 2V3HH 1G37A 1Y3YA 2WYGA 5EQQA 1P3EA 1NC6A 3VB6A 2LP6A 2FWWA 3SNEA 1GBAA 4ZHAA 2VIQA 1RIWC 2P3FH 3TGIE 2FP7B 3EA8A 5GCHG 1O36A 4A6LA 1DXPA 2XTTB 5I46H 3O8CA 3BTGE 5ESBA 3SI3H 2KM0A 5L2YH 2HNTC 2BDIA 3B23B 1MD7A 4AYVB 1NPMA 3UR6A 4Z6AH 1V2LT 1BRAA 2GCHG 1LQEA 2GJGA 3RMOH 3V7TA 5SGAE 1EKBB 1UCYK 1Z8IB 2SGDE 3ESTA 1C5OH 3MO3A 4XE4A 2FTLE 1GHAG 1NBME 1O3HA 5LGOA 1XXFA 3S9BA 1C2GA 1RS0A 1ZRKA 2R0LA 2FO9A 5CHBA 1VGCB 5DP7A 4ISOA 1EOJA 3RXIA 3UQVA 3DSOA 2UUYA 3LGTA 4AFSA 2XWBI 2G81E 2GDDA 3F9HA 4B2CA 1CBWC 3FP7E 2H9TH 2ZGJA 1GPZA 5HM9A 1O5DH 2CJIA 4ZXYH 3CENA 2TGAA 3ODDA 3PRDA 2XBVA 3BIVH 1AVGH 3FFGA 1W11U 2EC9H 1W7GH 1T32A 1P2KA 4FU8A 4WH6A 2BD5A 2BD2A 1YPGH 3KYGA 2IOTA 3BV9B 5LPRA 4MVNA 3MH4A 4D7GA 2QGRA 1ID5H 4IMQA 2KFWA 3SUDA 1ZMLA 2P16A 1IQEA 1H9LB 3AVZA 1T8OA 1A3BH 1EOLA 3MO9A 5EG4A 1CA0B 2B7DH 1C5YB 3KQCA 2KAIA 2FDAA 5GJ4B 2P3UB 1GHVH 1GMHG 3SU3A 1C5QA 4E06H 1IQIA 3A7TA 4MPUA 1ELVA 4LZ4B 1A0HB 1BJVA 5E0JA 3TITA 2OINA 1P2QA 4NZLA 1WBGB 2BY8X 4OS4A 1LDTT 4O3UA 5K7RA 1CE5A 2BLWA 2SGFE 4JMYA 1TNJA 3RUOA 1EJMA 2L6OA 1XUKA 3RXPA 1UK4A 4X1RU 4WJG2 4A1TA 2ZTXA 2BDAA 1LKBA 4AZ2B 4AFUA 1GJ8B 1E79D 2Y81A 4ISLA 1FY1A 1KXCA 3GISB 1C2FA 3PMBB 3WWBA 4ZH8A 1EJNA 2BB4A 2R2WU 5HMAA 3BTFE 2CHAC 3Q00A 1O2KA 1CA0C 4ABBA 1YCPH 2ZC9H 3SHCH 5HM2A 1GBBA 2PTNA 5C2ZA 4ZKOU 2WINI 2BLOA 3FN8A 1ZSLA 3Q3XA 1RTKA 4FUHA 1LMWB 4MPXA 1GJBB 1RFNA 3SNCA 1TA2A 1ABIH 3GY5A 1ANDA 4X8TH 5AHGH 2Z3DA 3M5MA 5ESTE 3MU0A 2PV9B 2I6SA 1CVWH 4BANB 1C5VA 1QRWA 1TAWA 2GP9B 1QA7A 4ABHA 1WSSH 1G36A 4R0IA 1NROH 4ZMAH 1QB1A 1NRNH 2V0BA 3E0NB 1HIAB 4JK6A 5EJLA 1C5UA 1E0FD 3SU0A 5JDUB 3VB4A 2J95A 1SFIA 1MAYA 3K2UA 4CBOA 3STJA 4HI3A 5A0AE 4OS5A 1GBFA 4NCYA 1A5IA 1MCTA 1EAUA 1TONA 2BXTH 1FLEE 1OYTH 5DP4A 1H9HE 3RMNH 4B76A 2QIQA 1C4Y2 3QN7A 1DXWA 1UCYE 3ATWA 1FJSA 2G5NA 1YCPM 4RSPA 1BRCE 2F9VA 3SW2B 1GJ4H 3H7OA 1SPJA 2BMGB 3TLOA 2FYRA 4O3TA 4IN1A 1P2JA 1PQ7A 1AO5A 3QLPH 1W3CA 2O8MA 1BTXA 1SGFG 1GJ7B 3PO1C 1A1RA 1PPBH 1RXPA 3A88A 3LOXA 3MO6A 4ZUHA 3F3BA 4GCHF 3U28C 1BCUH 1O2ZA 5E0HA 2Y7ZA 2ZDNA 5C94A 5JBCS 4P02A 3BG8A 2IJD1 2ESTE 2AEIH 3SHAH 1S6HA 1ZR0A 1GDNA 1DY9A 1BQYA 5E8EH 1V2UT 1O2TA
chains in the Genus database with same CATH topology
2GZ9A 2UWLA 1SLWB 1J17T 1DWBH 3A8AA 3SNAA 3ATLA 1G3EA 1FY5A 4I8HA 2VVVA 2AMPA 1EZUC 3MI4A 1O3LA 2EA3A 2FOGA 1C5WB 3NK8A 1SBWA 2O9QA 1TB6H 1K22H 3K9XB 5FXLA 4BTUB 8LPRA 1O3KA 2ZDMA 1WAYB 2PR3A 3RM2H 2ZA5A 1QRZA 4RKOB 1LVOA 1TRMA 1WTHD 1DDJA 3PWBA 1LHCH 3RXGA 1BTPA 2GV7A 4WXIA 1MTUA 1O3NA 1GHZA 3HK3B 2QY0B 1SLUB 1JBUH 1CGIE 3VGCB 1S6FA 3M37A 2F3CE 1O2IA 4E7NA 4CREA 3RXQA 1O2UA 1NO9H 3UREA 1Z71A 5GDSH 4K8YA 1AD8H 4KGAA 1OWKA 2ANMH 2BDHA 1F92A 3PWCA 3ZZ9A 2HWLB 3EQ0H 3BTTE 2A4GA 1FI8A 2Q1JA 3U98H 2J94A 1SQOA 5EGMA 3ZYEA 2FYQA 3MTYA 4K1SA 4AX9H 3LT3A 2OUAA 3RLWH 1AN1E 2ALPA 3RC4A 3RM0H 5T3HA 1H9IE 4MPWA 1ZSJA 1JOUB 1UTLM 1IOEA 4BAMB 4ZXXH 1QL7A 3QTVH 1THPB 4WWYA 1LVMA 2GGVB 2DE9A 1K2I1 4B75A 1O2QA 4AFQA 3B9FH 1TRNA 1GI1A 2PLXA 4MTBA 3VXFH 4DY7B 1ANCA 4BXSA 1TGCA 1A2CH 2D8WA 1UMAH 1DITH 3M7UA 3U9AH 4DJZB 2W3KA 5PTPA 1GCDA 3SUEA 1P9SA 4TPIZ 4U32A 1KSNA 3OX7U 3R3GB 2O8TA 2ZU3A 3FANA 4MNWA 4WMFA 1GBCA 2P3TB 2BYAX 1ZZZA 2Y80A 1Z6EA 4X1QU 3OTJE 2FMJA 3MWIU 1XKBC 3QTOH 4JZFH 3ZZBA 1IQMA 2BM2A 1O3JA 1J14A 4JYVH 1NRPH 1HJAC 1UVSH 3P6ZB 4NWLA 1GL1A 2AIQA 1O5AB 1O2MA 2PTCE 3EGKH 4YESB 2FIRH 3A7VA 4IBLH 4AYYB 1TBZH 1V2VT 4MPVA 1FAKH 4X8VH 2BY9X 4VGCB 2BHGA 4ZROA 2PKAA 2NU4E 3NCLA 1Z7KA 2ZU1A 1MU8B 1XX9A 2FOFA 1C1VH 3F6UH 5EOKA 5J4SA 2Z9LA 3E91A 5GCHF 4X6NA 4ABDA 3BTHE 2ZECA 5DP6A 2Z94A 3TH2H 2FS8A 2VU8E 3FAOA 2PWXA 3BF6H 4DW2U 1DWDH 1L1NA 3VB3A 1AFEH 3CS0A 4FUDA 2P59A 3MOCA 4Y0YE 3PTBA 1TNIA 3OSYA 1GHAF 2SGQE 1XVOA 2B9LA 4VGCC 5EXMA 4YTAA 5JBTA 1UHBA 2ANKH 2O8LA 1PQ8A 2ZIQH 3BG4B 3LDXH 3P95A 1KY9A 3UNSA 3MHWU 1KXEA 3W95A 3Q3KA 1Z8GA 4NGAH 2FESH 5EXNA 3BTME 3A8BA 2FOAA 3N7OA 2OC0A 1Q3XA 3T29A 1Z8RA 1YPMH 3GDUA 3OYPA 4A7IB 1VJ9U 5JBAS 2BZ6H 3ZZ4A 2ZPRA 1QBOA 2ZFQH 1RTLA 1O37A 1FQ3A 3F9GA 3PTNA 3IG6B 3UWJH 1OP2A 1CO7E 1KXAA 3UNQA 1UTKA 2ALVA 1ZSKA 3SBKA 1Z6JH 1GBEA 1HAYB 2TRMA 1GBKA 1P2OA 2NU0E 1IHSH 1HPGA 1C2JA 1HB0B 1MQ5A 3I29A 1HDTH 1V2ST 1GVKB 5FCKA 1G30B 1W12U 3T26A 2VH6A 3A8CA 5A2MH 1L4DA 2D26C 1SGDE 1O2OA 3BG4C 1P02A 4I33A 3QZRA 1J15A 2FI4E 1QIXB 3SU6A 3F9FA 3OY5U 4B74A 1QL9A 3ZVEA 5LPEA 1HNEE 1LKAA 2ULLA 4MDSA 2KAIB 3RXVA 2BY6X 3ZZCA 2ZG0H 4O9VA 4H42U 1NU7B 1P01A 3KCGH 1O31A 1AHTH 1H4WA 2YOLA 1VITH 2LNCA 3ODFA 5TCCA 3VB7A 2OQ5A 2W3IA 3GCOA 2PUQH 1LO6A 2J38A 2OCVB 1JXPA 3A86A 2BD4A 3BEUA 3RU4D 4INKA 2AERH 1O3IA 4NIXA 3ZYDA 3FZDA 4TWYA 4J1YA 2FOMB 2THFB 1P2MA 1Y3UA 2STBE 4JZEH 4I8LA 1W10U 1G9IE 4AGKA 1OWEA 1EZXC 3MH6A 2BDBA 1CSOE 4UFFH 2Q6GA 3ZVDA 2R2MB 1ELBA 2HPQH 1JMOH 2Q6FA 2WPLS 1HJ8A 1ZTJA 2WPKS 4NWKA 2OLGA 1TX7A 1GI9B 2ZU5A 3EYDA 5B6OA 1VZQH 2ZHDA 3GICB 1UTNA 3F9EA 2J34A 1UO6A 3PB1E 2XBYA 1SGPE 4FUBA 3TIUA 1YBWA 1QTFA 3KNXA 1BMAA 3RXMA 2F9PA 2Z6BD 2Z9IA 2A0QB 2P93A 1KTTB 1NM6A 2A5AA 1ACBE 1IQLA 2H2ZA 9ESTA 3H5CB 1HUTH 4GAWA 2ODYB 1GCTC 1LPZB 1O2VA 1FPHH 3UY9A 3DFLA 1AB9C 1YCPK 2Z9JA 1P06A 1BBRE 2VB0A 1GI3A 3MU4A 3SGBE 2AYWA 5I25A 2P95A 3QUMP 3S9AA 3L3TA 3P70B 2ODPA 4FUFA 1GDQA 4XSKU 1AMHA 1BA8B 1E35B 4FVBA 3CS7A 2PSYA 1B5GH 2G51A 3HGNA 1MZDA 1MTWA 4UFDH 2ZNKH 1GJ5H 1GG6C 1AY6H 2CXVA 3UUZA 2GDEH 4KTCA 1O3MA 3E16B 2PKSC 2XW9A 3UIRA 1EP6A 2BY5X 3KL6A 1MKWK 1P2NA 1LHEH 2BDCA 2GCTC 2RA0A 2ZGXH 5A8XA 1Q2WA 1K1NA 2EI8A 2IPHA 6LPRA 4X2XA 3QK1A 1BUIA 1DUEA 1CHOF 3RMLH 2FLBH 1TA6A 2VGCB 4CR9A 1F0RA 1TX8A 1NS3A 3ZZ3A 2AGIX 2GT8A 1S84A 3SU5A 1J8AA 3SO3A 2RDLA 1SOZA 2UUFB 3A87A 1TQ0B 1DUAA 3A7ZA 4JCNA 1VCWA 1ZHPA 1SGIB 4RN6A 5GXPA 2BVSH 3F68H 1GHXH 1CQQA 4U01A 1MH0A 3KIDU 1SQTA 1AZZA 4BAOB 3SNBA 1O5FH 4DURA 3GCHB 1E34B 1KLTA 1DOJA 1UVOA 5F6MA 4Y7BA 1EQ9A 3TH4H 3KEEA 1SGYE 1BZXE 1TBQH 1MTVA 4UDWH 1OP8A 1PJPA 2HRVA 2OD3B 1VGCC 5C67A 4WY3A 2C8YB 1SGNE 1ELGA 4GHTA 2WV5A 4UFGH 2AIPA 4Q7ZA 1GVZA 2B5TB 2PHBA 2Y5FA 1N6XA 1O32A 3E6PH 5FPSA 2C8XB 4Y10E 2ZDAH 3QX5H 1QL8A 1BTYA 3TVJB 3GDSA 1GMDG 1LHDH 2TGTA 2CV3A 1DX5M 3M35A 4NIVA 4B2AA 1ESTA 2NU3E 2TIOA 1HFDA 1P9UA 2BLVA 2OXSA 1BTHH 4BNRA 1HXEH 1PPGE 2WPMS 1XUFA 1F7ZA 4F49A 1AVWA 4GUXA 1BMMH 1K1LA 2TPIZ 4D7FA 1GI6A 2ZQ1A 2QAAA 1O39A 3LPRA 1OXGA 1QFKH 2ZFSA 1GI8B 1TGNA 4K69A 1A61H 4XBDA 3P92A 3URCA 5T6DA 2BX3A 2BQ6B 2ANYA 1FY4A 1EPTA 1ORFA 1O33A 5JB8S 2A7JA 3FP8E 1O30A 3T5FH 4B2BA 3STIA 4TY6A 2H6MA 1NFYA 3PMHB 2FLRH 5FX5A 3MMGA 2R9PA 4OS6A 1D4PB 5JPMH 4CRGA 1O3GA 1AWFH 1ZLRA 1VITF 1AUJA 1O2NA 3SUGA 1Z8JB 3QWCH 2BD8A 1BOQA 3LGYA 1YPHC 1V2QT 2W26A 1C5SA 4UD9H 3SJIA 4YO9A 5DO4H 4DIIH 3RXJA 1C2DA 4YT7H 1S82A 3LGVA 1GWAA 1C1QA 4GVUA 2FOEA 2M5TA 4HZHA 1UK3A 1P3CA 1ANEA 3FZZA 1MBMA 1T8MA 1TPPA 2H9HA 1EZSC 2R0KA 1VJAU 1UCYH 3BTEE 4AG1A 3DT0H 3TK6A 3TGKE 1C5XB 3M7QA 3EA7A 4CH8B 1N8OB 3TPIZ 1PPZA 4IC6A 1MAXA 2UWOA 5EQSA 2ZO3H 1HJ9A 1XUIA 2BX4A 1G3BA 1TBRH 1C2EA 1C2KA 3LJOA 4D9QA 1V2JT 3WY8A 1BITA 4Y71A 1GI7B 1GBJA 2B8OH 3V3MA 4NFFA 2Y7XA 2FXRA 1TE0A 2QXGA 2FOHA 1ZTLA 1GGDB 1TNGA 1FNIA 3ZVBA 4IS5A 1ZOMA 5HXFA 4FUGA 1SGTA 1ZTKA 1G2LA 3P8NA 3Q77A 3ZVGA 1TMBH 3LH1A 1P57B 1LPGB 2JH6D 3U1JB 4KELA 1D3DB 1N8OC 1EB2A 1XVMA 2F9OA 2GTBA 3A82A 1C9TA 3RXRA 1CT2E 3AAUA 5CMXH 4MLFB 1G32B 4HGCA 3NPSA 5L6NH 3RXFA 3LJJA 3SU1A 1CHOG 4XOJA 1THRH 5EXLA 1GL0E 2WYJA 1FPCH 5DGJA 4NA7A 2OC7A 5T6GA 2BD7A 5EQRA 1AUTC 2AMDA 1K1MA 1D6WA 1WU1A 1OYQA 6GCHF 1MTNB 2VJ1A 1O38A 3D49H 4FUIA 2XBXA 3IITA 1DT2A 1F0TA 1LVBA 3BTQE 2UWPA 2SGPE 1FY8E 1V2WT 1KTSB 3SORA 1H8IH 1UHBB 1AQ7A 4FU7A 3LGIA 1TMUH 5FAHA 4A1XA 3SNDA 3DD2H 4JYTA 1Y3WA 1YPKH 2F83A 2QCYA 1QBVH 1S0RA 3BIUH 8GCHG 2FX4A 3S9CA 2D2DA 1FN8A 4X8UH 5EPNA 3E3TA 1V6DA 1P03A 2A5IA 4CR5A 1DANH 2G00A 2I6QA 3D62A 2C8WB 3I77A 3ZZAA 3KQBA 1HBTH 3UOPA 1ELFA 4KTSA 2PFEA 1K28D 3MU1A 4DVAU 1OWJA 4NSVA 1BRUP 1GHBF 5C1UA 1NT1A 3HATH 1T8LA 1GDUA 2A31A 4CHAB 4DGJA 1O2YA 2VWMA 1GBTA 5C20A 3TNSA 3RDZA 2GMTB 1OPHB 1N1LA 2W7UA 1HRTH 3GCTG 3RXCA 1BTUA 3MU8A 1E37B 1K9OE 1EAWA 3OY6U 1K1IA 4AGJA 1DWEH 4K60A 1ZHMA 3VGCC 5LH8A 4J2YB 2ZHEH 3NZIA 4IW4E 1LPKB 1EX3A 3A89A 3K6YA 4Y79A 5F8TA 5L30H 2BLQA 4TPYA 3A84A 3E1XB 4UE7H 1CT0E 2B0FA 2QYIA 1Y3VA 2Y82A 3A8DA 1G2MA 1XXDA 2BZAA 2AMQA 2ZHFH 1EUFA 3M5NA 2BY7X 3L6PA 1W14U 2ZFFH 2PSXA 2UUJB 1O0DH 4AG2A 2TGDA 5T6FA 5DG6A 5GIBA 1Y8TA 3RU4E 2GX4A 1HAZB 4OGYA 1VITG 2QA9E 4JZDH 3T25A 4Q7XA 2XWAA 2Y6TA 4I31A 1B7XB 4O03A 1N6YA 1V2TT 2R3YA 4A1VA 6CHAB 4E7RG 2ZPSA 1RJXB 1F2SE 2ZU2A 3MU5A 1HIAA 4ASHA 4INHA 1SGRE 1KDQB 2AGGX 4FVDA 5FBEA 2QXJA 1NN6A 1ZRBA 1AKSB 3LC5A 1C5TA 3AW1A 1CA8B 2H5DA 2G52A 2WUBA 1QHRB 2GV6A 4HFPB 2FODA 4YOJA 1GBHA 1TGTA 1YPJH 1ZHRA 3EA9A 4FUJA 4NA9H 5EW1H 3NUMA 4IC5A 2RCEA 3R0FA 4K1TA 5HGGA 3GCNA 2A2QH 2SNWA 1HAVA 4X1PU 4NA8A 4INLA 4Q80A 1HAPH 1SGQE 1C2HA 5JBBS 3SJOA 1ZPBA 4I8JA 2XC4A 6CHAC 1HAXB 1SOTA 3KHVA 3RXLA 4FXGH 1OKXA 4OS7A 4ABGA 1J9CH 3UNRA 1M9UA 2STAE 4K1EA 3KN2A 3MNSA 1MCVA 4TWWA 1IQFA 3U8RH 3DUXH 2WPHS 1V2MT 2OBOA 2Z3CA 1ZJKA 2F91A 1BJUA 1HAIH 3DA9B 5A09A 1LQDB 1OP0A 3ATIA 4KKDA 2PGQB 1A5HA 1KXDA 1P11E 2ZDLA 2EEKA 1O3AA 1W13U 1O3DA 2QXIA 4Y8XA 6GCHG 1P8VC 2ZPQA 2FEQH 1TYNA 2PGBB 1O2WA 1UTPA 1QJ6B 1WYKA 5GPIB 3PLBA 1ABJH 4FUCA 1HYLA 1SHHB 3RP2A 3RXDA 2XNIA 4RKJB 1D3TB 1W7XH 2ZHWH 1YP9A 2BDGA 3MNXA 3PROA 1ELAA 3RXKA 1SQAA 1BHXB 2ZZUH 1DLEA 3TK5A 1O35A 3L33A 3OU0A 2A7CA 3SJ9A 3V13A 3RXBA 3KF2A 2ZDVH 5GWZA 1H8DH 2XRCA 1O3PB 4H6TA 3SV8A 5A8ZA 2D1JA 3P17H 1EJAA 3M3VA 1DE7H 1JWTA 5CHAB 1T4UH 1GHBG 2HVXA 4I7YH 3M5LA 4ZKRU 3FP6E 1GMDF 4FUEA 1CU1A 2ZHQH 2J4IA 4BAQB 2HPPH 1THSH 1O5BB 4ZHMU 7ESTE 2BVRH 2P8OB 1EXFA 2FPZA 1AFQB 3ZZ7A 4LZ1H 1ZJDA 2VIOA 1IQKA 1ELDE 1Y5BT 3SV9A 1MKXH 1NFUA 4U2WA 4BAHB 1FZZA 1X7AC 1O3EA 2BDYA 5AF9H 4WH8A 1S83A 4ZKSU 3JZ2B 1P0SH 3RU4T 3RMMH 1QBNA 3GY6A 1DFPA 1C1SA 4Q7YA 1TFXA 2WV4A 3AAVA 1FONA 3HGPA 4ABAA 1F0SA 2FI5E 4PROA 4D9RA 5C1XA 2A5KA 1FIZA 3AW0A 1TNHA 5L2ZH 3BSQA 4B73A 1AU8A 5DP3A 3E0PB 4NFEA 3PLPA 4LXBH 3UOUA 1L1JA 4ABEA 5ABWA 1YGCH 5EPYA 2ZTZA 1K1OA 1AFQC 5G4BA 1O2GH 1PYTC 1YM0A 2CMYA 4WVPE 3VXEH 2BTCE 1H1BA 4E05H 3SQHE 5CE1A 1IQHA 1SLVB 3MNBA 4NIYA