1TGBA

Crystal structure of bovine trypsinogen at 1.8 angstroms resolution. ii. crystallographic refinement, refined crystal structure and comparison with bovine trypsin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title Crystal structure of bovine trypsinogen at 1-8 A resolution. II. Crystallographic refinement, refined crystal structure and comparison with bovine trypsin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase zymogen (serine proteinase)
total genus 46
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1979-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgbA02
3KL6A 5HGGA 1TX8A 1J16A 1XX9A 1CA0C 2ZU1A 3SHCH 4X1NU 3RXUA 1GMHG 2VWLA 4FXGH 5FPTA 1P8VC 1EP5A 1RTFB 2H9TH 1VITH 1TB6H 2PKSB 4AFQA 1SGTA 1SC8U 1TA2A 3S7KB 5EW1H 3EAJA 2GP9B 4ZH8A 2TPIZ 4NGAH 2O8UA 2PKSC 4B2AA 1FPHH 4GAWA 1O5FH 1UK2A 1C2DA 3SO3A 1TALA 1GMCG 2IOTA 1HDTH 1TA6A 1D3TB 1OYQA 1QHRB 1QB1A 2FOAA 3RXDA 4XSKU 3UY9A 4H6TA 4JZIA 1NFWA 1UVPA 4ISOA 4XFQA 3ZZCA 1EZUC 4D9QA 1Y3UA 1TBZH 4K3JA 2UUKB 2NU0E 1C1UH 3AAUA 1GHXH 1O3BA 2FTMA 3EGKH 4YT7H 2F3CE 3OSYA 2HNTC 4Y8ZA 1THPB 3U8OH 2PR3A 5BPEA 2YOLA 4UE7H 2M5TA 2CMYA 2OQUA 1FN8A 2ESTE 1QJ1B 1DLEA 1SOZA 3O8DA 2AMQA 1KXFA 1RD3B 1NU9A 4NSVA 5C20A 2QIQA 2FTLE 1Z8GA 3VGCB 1NM6A 3SU1A 1H9HE 3K6YA 3FP7E 5B6OA 3URDA 4GCHF 2ZPRA 1HAYB 5GDSH 3VGCC 2TBSA 2FEQH 1IHSH 4X1QU 8LPRA 2R9PA 3UTUH 3SZNA 1RTKA 3RDZA 3LONA 1YYY1 1BMAA 3FZDA 1O3OA 5EXNA 2H2ZA 3A7WA 3ZZDA 2XC0A 2FX4A 1GBBA 1HCGA 3MO6A 1EJNA 1TBQH 2G5NA 5DG6A 6GCHF 1C5PA 1SGDE 4GUXA 5I46H 1UCYH 3Q00A 4X8TH 1PPEE 2VNTA 4GSOA 3D65E 2Z9JA 3HATH 4BXWA 1C5RA 3SJIA 1QB6A 3HKJB 4DW2U 1C5MD 1C4V2 1LHFH 5F8TA 1Z1JA 6CHAB 1GL0E 1B5GH 4DOQA 2OC0A 1V2QT 2EEKA 1KTSB 4HI3A 3VB6A 1QY6A 1EXFA 2PHBA 4K1SA 2AFQB 4XDEA 4FU7A 1JIRA 1CSOE 2THFB 2BD4A 3V13A 5DKMA 1IOEA 1ELFA 1GI6A 1O37A 1VGCB 1ZLRA 1ZSJA 2ZTZA 2SGQE 1ZHPA 4CREA 3P8NA 4TWYA 1W0YH 1GPZA 2ZZUH 1TGNA 1UMAH 1HAPH 3R0FA 3LH1A 2QXGA 3KNXA 1Y3XA 4CRFA 1EASA 2Z6BD 4ABIA 3Q77A 1P04A 1WQSA 3MH4A 3BG4C 4INKA 3T27A 3UWJH 2GZ7A 2WPHS 1GBAA 5FXLA 3LJOA 2BXUH 1K21H 2GGVB 3TH4H 3UR9A 3SGBE 2CF9H 3T25A 1E37B 1FAKH 1BTXA 1DDJA 1IQEA 1O3FA 2R0KA 1UCYK 3F9GA 5TJXA 1MTUA 2JH6D 1OP0A 3ODFA 1WCZA 2J2UA 5DGJA 4Y7BA 1NRPH 1AVGH 1O2JA 1OPHB 2BD9A 2JETB 4K8BA 2AS9A 1GBTA 2UWPA 3GICB 2QYIA 2BB4A 3OYPA 4CRCA 3A88A 3TJOA 1UTNA 2F9PA 3VB7A 1ZPZA 4MPWA 2TRMA 3M5LA 3MOCA 2ZHEH 1ZMNA 3NUMA 1PPHE 4UFDH 1HGTH 3T2NA 1DLKB 2XCNA 1G3CA 2VB0A 2F9BH 1K2I1 3P8GA 1QBVH 2EA3A 1ZSKA 3Q3KA 2ZNKH 2AH4X 2QAAA 2BDIA 2GDDA 4X8VH 1CHOF 3Q3YA 1PYTC 3UPEA 4Y6DA 4JZDH 2ZCHP 1GBMA 4ABEA 5CHAB 5FCRA 5L6NH 2JKHA 4AB8A 3M37A 2G81E 5CHAC 2IN2A 2FP7B 4Y8YA 2XW9A 1GL1A 1GJ9B 5GCHF 2AMPA 2FOFA 1EJAA 2PKAB 1H1BA 1IAUA 4KP0A 5JBCS 4ISNA 3TNSA 1W7XH 3V7TA 3RMOH 1SBWA 3GOVB 4FUDA 3DFJA 4H6SB 1GWAA 2G55A 1KXBA 1C5LH 3VFEA 3E1XB 3GDUA 1E36B 3RXIA 4U01A 1P09A 1KYNA 5F8ZA 2ZHDA 4CBNA 2AGEX 3RXKA 1HBTH 4HFPB 2XBYA 4X6MA 2BX3A 1W0ZU 2YNAA 4KTUA 1EOJA 1O5AB 1A46H 1YP9A 1SFQB 5EQQA 1C1VH 1MTSA 4CHAC 4NIYA 2OINA 1BMLA 1Z8IB 1G30B 4LOYH 4FUFA 1F92A 3TVJB 8KME2 2BD5A 4ASHA 4YESB 1TMUH 4AN7A 1DS2E 3ZYEA 2ZFPH 1PPBH 1F2SE 4NIXA 3ZZBA 2SGPE 4XOJA 4X1SU 1FY4A 1TNHA 4DIHH 1MBMA 2BQ7B 1LVMA 1O2TA 1GGDC 3AAVA 3R3GB 1KY9A 1C2LA 3FP8E 3HK6B 1P03A 2G51A 3LGUA 2BQ6B 3UOUA 1YPHC 2BHGA 4AG1A 1NRNH 4A1TA 1AFQB 2ZGJA 2ZI2H 4FUJA 5E2OA 1O2SA 1HUTH 1GI5A 1MQ5A 2A4GA 3MU5A 3P6ZB 3GY3A 1MU8B 3GCOA 2GT7A 3TK9A 1O3AA 1K9OE 3SHAH 3U1JB 2J94A 5EQRA 1FNIA 4JMYA 3STIA 1L0ZA 3QWCH 4D9RA 2ZHQH 1JBUH 3TIUA 3N7OA 1Y59T 1K1JA 4TY7A 1AQ7A 1ZGVA 1MAXA 2FOMB 1IHTH 5GJ4B 1O3LA 3BTHE 1T8OA 1Y5AT 1K1IA 5FBEA 3STJA 1J15A 1SLUB 1C1SA 2I6QA 4Y79A 2ZFRH 4X8UH 4R0IA 1QB9A 2ZCKP 1ZJDA 5PTPA 1GBIA 2OTVA 1A2CH 2FOHA 1IQLA 4JZFH 5A09A 2Z3DA 1KLTA 2EI6A 1O34A 1Y8TA 3VXEH 3RC5A 1ESAA 4ZXYH 1QCPA 3ATLA 1C1MA 2ZECA 2HPPH 1YPEH 2VVVA 4LZ4B 5EGMA 1S82A 1FIZA 1ELBA 1QL8A 2GCHG 2Z9IA 1YC0A 1AMHA 2PKAA 2Z3EA 1XUIA 2A32A 3NKKA 1OOKB 3RXLA 2FIRH 4Z0KA 1LHGH 1H9IE 3SW2B 1DY9A 5AFZH 1CQQA 3M3TA 1OSSA 2BQWB 4DCDA 3BTGE 1P02A 4AZ2B 3NPSA 4F4OC 1O5EH 2ZU5A 5FX6A 1N8OB 4DJZB 4FVDA 3I77A 3NCLA 1INCA 4ABJA 1PQ8A 3ZZ4A 1EQ9A 4J2YB 3SNDA 1MUEB 1UVOA 5T6GA 3U9AH 4B71A 2TIOA 1O2HA 4NA8A 3TH2H 1RFNA 1AVXA 4A92A 5EU8A 5HXFA 1E38B 2VWMA 3PV4A 5EW2H 1G3BA 3A7ZA 2BD8A 3L6PA 3ESTA 5EXMA 5IDKA 1ARBA 4BANB 4O3TA 4I8HA 1UVTH 3KQDA 3SV8A 4DVAU 2Y7ZA 1TGCA 4O9VA 1YPJH 4KGAA 2J92A 5A8YA 1TQ7B 1ORFA 1O5CB 1X7AC 2FOEA 2VIQA 3QUMP 2H6MA 3ZV8A 2H5CA 1UK4A 1FAXA 1PPGE 4UFEH 2XC4A 2ZQ1A 3PMJA 1O3DA 1T32A 1TOCB 2CF8H 1DT2A 2Y5GA 4OS1A 1U6QA 4B2CA 2OC1A 1AWFH 2KAIB 4ESTE 3PTNA 1HB0B 3TNTA 1V2UT 2GKVE 3QDZB 1K1LA 2BD7A 1SLVB 3SV2H 1Z8JB 2ZP0H 1VCWA 3RU4E 2DE8A 4ZXXH 1SHYA 4J1YA 1AWHB 3MU0A 1C2GA 1GBLA 1O31A 4TPIZ 1FY8E 1C4Y2 4O97A 3ZVCA 2Z7FE 1WYKA 3SUGA 2FM2A 2XRCA 2XWBI 3GCHB 3CS7A 3E90B 5DO4H 2AYWA 1MTNB 1QFKH 2FYRA 3V12A 1QRZA 3PTBA 2V0BA 3ZVFA 2CXVA 2FS9A 1W3CA 2FLRH 3A8AA 4GCHG 1WQVH 2G52A 4E05H 2VVUA 4E7NA 2A5KA 1QBNA 1SI5H 2FLBH 2FI3E 4XBBA 1YF4A 3RM0H 1SB1H 2ZU2A 4OS2A 2Y5FA 2BLOA 1O30A 2ZF0H 4F49A 1AI8H 1QL7A 3NK8A 4MDSA 1C2MA 4ABDA 1O3CA 2QGRA 3PB1E 4GVUA 1ELCA 2ILNA 4WMDA 2BLWA 1V3XA 3E6PH 1O2OA 3ENSB 4ZUHA 1C9PA 5AVDA 3SU4A 1BIOA 4CRDA 1AUJA 3K9XB 4MVNA 1C5XB 2R2MB 3KCGH 5IYTA 3M5OA 4ZROA 1YGCH 4RN6A 1NFXA 4ABBA 1MTWA 5F8XA 4WF8A 1GCTB 1GHYH 5H4IB 2D26C 2H9EH 3SOSA 3UREA 2BDYA 1O2LA 2RDLA 3BG8A 1L2EA 1SMFE 3BTFE 3QLPH 4X6PA 1P9SA 4Y0YE 1EUFA 2VH0A 4GHTA 2STBE 3SU2A 5I25A 1EKBB 1H8DH 3M5MA 1GHZA 4BTTB 1GCDA 4X1RU 5CMXH 5DP6A 1MZAA 1O3IA 1AZ8A 2P3UB 4NSYA 2FYQA 1NZQH 1G2MA 2OUAA 1WBGB 3K6ZA 4WWYA 1THRH 2F9OA 3SUEA 4U32A 4KTSA 1FQ3A 1NY22 5E2PA 1MCVA 3NZIA 1P0SH 4Y11E 3U98H 4UFFH 1O2MA 2BVXH 4CH2B 1O2NA 2VINA 2VIWA 1LMWB 2FOGA 1Z1IA 3MMGA 1CA8B 1O3JA 2OCVB 5EODA 4Q7YA 5L2ZH 3GISB 4FU9A 3ZZ9A 1A5HA 2RG3A 1V2MT 4B73A 4Y0ZE 1FIWA 3A8CA 2TGDA 2Q1JA 2ZHFH 1C1TA 4BAHB 2KAIA 2O8WA 1HAOH 1KIGH 2ZCLP 3Q76A 1RIWB 2AERH 1D3PB 1V2KT 4CH8B 1RIWC 4WJG2 1GBHA 3CS0A 4K2YA 1EAIA 1BTYA 1DE7H 3T5FH 3UNRA 2HALA 2ZGBH 1AKSB 2FODA 3SGQE 1C2HA 3BEUA 2XCFA 5SGAE 1FONA 1P2KA 1EZXC 1T4UH 5AF9H 3ZZAA 3RXTA 2BVRH 1S85A 1CHOG 2P95A 4NFEA 4ZHAA 2HLCA 1A7SA 1L4ZA 3SJ9A 1O5BB 1TPOA 5K7RA 1O35A 3P92A 2Y6TA 4O3UA 1S6FA 4NFFA 4X0WU 1L1JA 1PJPA 4ZKRU 1LVYA 5GCHG 5AHGH 1JXPA 2G8TA 3VB4A 2WYGA 1PQAA 5BRRE 2ZDKA 2QY0B 3D23A 4LK4A 1EAWA 2BDAA 2D8WA 3PMAB 2OXSA 4WVPE 3LJJA 1AHTH 1BRUP 1ZOMA 5ABWA 1GJCB 4RKJB 1G3EA 2PTNA 2FMJA 2OD3B 1FXYA 4IN1A 1KXDA 2VVCA 1OWIA 2BYAX 5J4QA 2WUBA 2ANKH 3ZVBA 2ALPA 5LPFA 1J9CH 1RS0A 1ZTKA 1EX3A 4JK5A 1P57B 2ODYB 3E0NB 3ZVAA 2OBOA 4JZEH 1KDQB 1B0FA 1P11E 2W3KA 1IQFA 2XXLA 3P70B 1O2VA 2QA9E 5EQSA 1K1OA 4LZ1H 1HAIH 1C1OA 2BX4A 1Y3VA 1ZZZA 1O2ZA 5DP9A 6CHAC 2ZGCA 4X6OA 3KQBA 1NRQH 1DWBH 1L1NA 1XXFA 4THNH 5A0AE 1WU1A 5FPSA 1AIXH 3VXFH 1ESBA 1LPGB 1VGCC 4YT6H 2ZGHA 1Y3WA 2WUCA 2Y7XA 1TQ0B 2BM2A 1ABJH 4AFZA 2A5AA 3MNBA 1XKAC 1DITH 2ZU4A 3I78A 4MPUA 4CRGA 2XTTB 1MKXH 1BBRE 3BTTE 4IN2A 2G5VA 2P93A 4RSPA 5C3NA 1P05A 2C8ZB 2Z94A 2IJOB 5TCCA 3M36A 1DVAH 2A31A 2G00A 4I7YH 1TBRH 2VJ1A 2UWLA 4YOJA 3E91A 3TGJE 5C1XA 1VZQH 3E16B 3T62A 3BEIB 2FPZA 2WV5A 4BXSA 5E8EH 3OY6U 3MU8A 2HGTH 4NZQA 1V2PT 1NT1A 1ELAA 4BAKB 1P3EA 4DGJA 1QURH 1CGJE 1BHXF 2JETC 3MH5A 4I8GA 1XMNB 1CT2E 3HPTB 2G4TA 1EAUA 5LPRA 1ZTLA 1AKSA 3PLKA 1FY5A 1GJAB 5T3HA 1P2QA 2WV4A 3GDVA 1NFYA 4IS5A 1O2PA 4UDWH 3L33A 2PFEA 4ZKSU 1AD8H 4ABGA 2VIOA 1ZYOA 1D3DB 1FMGA 1AFEH 3GY5A 2J38A 3IWMA 4VGCB 1KXEA 2C4FH 4INLA 1MKXK 2AIQA 3RXJA 1A5GH 1HAGE 1WSSH 4VGCC 1Q31A 2QXIA 2PGBB 2W7SA 2B0FA 3TPIZ 2V6NA 3G01A 1TPSA 2P16A 2BTCE 3URCA 1O3HA 4CBOA 4CRBA 1GI2A 1OX1A 1TPAE 3LGWA 1HIAB 3SJ8A 2BOKA 2ZA5A 1NESE 7GCHF 3SV6A 3RXRA 3QTOH 2QF3A 4Q7XA 1ZJKA 1E0FD 1T7CA 2J4IA 1AE8H 1PPFE 2D1JA 4OS5A 1V2JT 3WY8A 2FESH 2FS8A 2ZDNA 5A0BA 1GJ7B 3RC4A 1UTPA 1BZXE 5L2YH 1KDQA 2AGGX 1CGHA 1GHAF 3SNEA 3UIRA 5FX5A 2O8LA 4XBDA 1JOUB 3A7TA 2ANMH 1LVOA 1VR1H 1TLDA 1O3EA 3MYWA 3RXHA 3S69A 1W7GH 1T4VH 1VITF 7LPRA 1A3EH 1IQJA 1BQYA 1PQ5A 3TJUA 2EC9H 5J4SA 2NWNA 2J95A 1BT7A 3U69H 5HYOA 4FUHA 1DM4B 3W94A 1EB2A 1ELVA 1HAHH 3ELAH 2TGAA 1ZTJA 4RKOB 1C4U2 4SGBE 1AVWA 8GCHG 3GCNA 3S9AA 3RU4D 4B76A 3SUFA 1LHCH 3QN7A 1DY8A 1E34B 5EG4A 4FUCA 1EOLA 1T31A 1LO6A 4MTBA 1AFQC 1TRMA 1WTHD 1O2UA 1ZPCA 1YBWA 1NFUA 1V2OT 4MNVA 3RMNH 2QC2A 1BUIA 3EQ0H 2O8TA 1DWEH 1BTUA 1ELEE 3EA9A 1S6HA 3ZZ7A 1K1MA 1OP2A 3PMHB 1O3MA 2J34A 1VCPA 3KQEA 3SUDA 1G2LA 2Y81A 3M7UA 1RJXB 1TRYA 1BTZA 2I6SA 1V2TT 2ZDMA 2PW8H 1IQKA 4BNRA 4JYTA 3DA9B 2Z9GA 1ZSLA 1CVWH 5DK1A 4AGKA 4JYUH 3JZ2B 2A4QA 1XUJA 1O3GA 1ZHRA 5JBBS 1OWHA 3A85A 1EJMA 5DP5A 1O5DH 3LKWA 4BAQB 3SV9A 1ANEA 1C5YB 2LPRA 3T26A 4ISLA 1FPCH 1G32B 4ABHA 3KGPA 1SGIB 1C5OH 4I32A 4YLQH 5LGOA 4IC6A 3S9CA 3BTDE 4HGCA 4D8NA 1HNEE 1ZGIA 1Y3YA 2QXJA 2BDBA 4MNWA 1TRNA 1W10U 4O03A 4ZKOU 2AEIH 1VJAU 2GZ9A 3BSQA 3SNBA 3AW1A 3EDXB 2W5EA 1TNKA 1ZPBA 1SPJA 6ESTA 1TGTA 3OY5U 2VGCB 3EA8A 1GVZA 1NS3A 1TOMH 1EP6A 2PSXA 2QF0A 2R3YA 2ZFFH 2Y82A 4ABAA 1F7ZA 1S83A 2VGCC 1HIAA 2GV7A 1GMDF 3RMMH 5JBTA 2NU3E 1TNIA 4I8KA 4GHQA 2R0LA 4A7IB 1TWXB 1OS8A 2A4RA 1GVLA 1WOFA 1K22H 1FV9A 4H4FA 2EI8A 3FZZA 2VIVA 1XXDA 1N8OC 2F9NA 1ELDE 1C5TA 2OBQA 5A0CA 1BOQA 2QN5T 2ZFSA 4BAOB 2P8OB 2OC8A 2GCTB 2Q6FA 1SGYE 1MD7A 1N6XA 5JB8S 1N1LA 3SQHE 2P8OC 1CT0E 2XBVA 1A0HB 2GCTC 2PTCE 1IQHA 2Y80A 3A80A 3SU3A 4AYYB 1UO6A 1XUFA 3DUXH 5C1UA 3MU1A 1BRAA 4NWKA 1AGJA 1TGSZ 2P3FH 1SGFG 1SGFA 1ZMJA 1WAYB 4UEHH 5T6DA 8GCHF 1QQ4A 2BY6X 1OKXA 2ZDVH 4NA9H 4PROA 4NG9H 1H4WA 1UHBB 1ABIH 3K65B 5JPMH 1MH0A 1TONA 3LH3A 5TCAA 4ISHH 3MNSA 1LCYA 1YLCA 3HGPA 1TX7A 1DSUA 2DE9A 1C5SA 3ZZ5A 3A7XA 1MKWK 1P10A 2YNBA 4E06H 3ZV9A 4D76A 1SQAA 3TJNA 2G4UA 4Q80A 1MU6B 1C2KA 3A87A 1BHXB 2FXRA 3S0NA 1OP8A 2C8YB 2FI4E 4YLUA 1W12U 3VB5A 1C1NA 3D62A 1BTHH 1S0QA 1HJ9A 4TY6A 1GJ5H 1DUEA 3RU4T 4BAMB 1WTGH 1C1QA 1CT4E 1GHWH 1SHHB 1W2KH 2PUXB 4IGDA 4INHA 3GY7A 2WINI 1ID5H 2PGQB 4Q2KA 4DURA 4AGJA 1HV7A 2ASUB 1SSXA 2ZDLA 1F5KU 3GCHC 2WPMS 4YOGA 1QR3E 5DP3A 1W14U 2LNCA 2C93B 2FDAA 2CJIA 4ZAEA 1MTNC 1GVKB 1Q3XA 4IBLH 5A2MH 2XWAA 3A84A 1RXPA 3KN2A 1LQEA 1T8LA 4ZHMU 2HOBA 2ULLA 4K1EA 4X2VA 3M7TA 1YPLH 1QTFA 1S0RA 2A5IA 3E0PB 4FUEA 2AMDA 3MTYA 4NZLA 3O8CA 3SU5A 1LHEH 3LPRA 3AASA 3BIUH 1WUNH 2BD2A 1CHGA 1V2ST 1BRBE 1IQNA 1AY6H 4IMZA 1AB9B 2H1UA 1ELGA 3IG6B 1TMBH 1YCPH 3C27B 1RRKA 3VEQB 3P17H 3OU0A 1NRSH 4D7GA 3DFLA 4A6LA 1V6DA 4U30A 1GJBB 4K69A 1C2IA 2PUQH 4YO9A 3FP6E 2BLQA 3LGVA 2K1QA 3UWIA 1UK3A 4K8YA 3PWBA 4D7FA 1GBJA 2FI5E 4IC5A 1OWEA 3SI4H 1GCTC 4GLYA 3TJVA 1BTWA 1HLTH 3BF6H 4Y76A 2RA3A 1B0EA 4BOHA 4TWWA 1O3NA 3I29A 1O33A 1GI8B 1MD8A 2ZC9H 2ZHWH 2PWXA 1AN1E 3GY6A 2FO9A 1MBQA 1RGQA 1W13U 1Y5UT 1C5QA 1O5GH 3PO1B 3ZZ3A 3GCTF 5LH8A 3LGTA 3DT0H 3ATWA 5AFYH 3RC6A 3M3SA 2HNTE 2BY8X 1MCTA 1NU7B 2RCEA 1H9LB 2F83A 3GYLB 3GDSA 3SGAE 5FCKA 1UCYE 4YM9A 1CA0B 1S81A 1D9IA 4I31A 4FVBA 1F0RA 4MQAA 2OQ5A 1YCPK 3H5CB 1J14A 3UR6A 2VIDA 1DSTA 1V2NT 5F6MA 3SV7A 1GI3A 4B74A 2RA0A 1GI7B 1PFXC 2HRVA 1SGEE 4AYVB 1C5ZB 3S7HB 2GDEH 1P3CA 2SGAA 4WMFA 1O2GH 2DUCA 2A2QH 1P2JA 4FUIA 1QGFA 1ARCA 1VJ9U 2ANWA 2BDHA 2A7JA 1OYTH 1MZDA 5FBIA 2ZTYA 3V0XA 4WXVA 1NTPA 1P9UA 3F9FA 3JZ1B 1EAXA 3P8FA 1GI4A 1AZZA 5DP7A 1A0LA 3O8RA 3SJOA 1A0JA 3U8RH 1O32A 3CP7A 1XKBC 2B7DH 5C5OA 1OXGA 3H7OA 3OX7U 2PLXA 1GI0A 3MO3A 2C8WB 1BMMH 1QBOA 4Y7AA 1GHBF 3QZRA 1BA8B 1A3BH 4X6NA 3NWUA 1O38A 2XBXA 3QO6A 3QK1A 4HZHA 1UVUH 1C2JA 3GY8A 7GCHG 3GY2A 3B9FH 3BTQE 3A89A 4WY3A 3TGIE 1NPMA 2ZU3A 1NRRH 2Q6GA 3SQEE 2FWWA 1FDPA 3EE0B 2BXTH 3RM2H 3TK5A 1K1PA 1UTLM 1HAXB 4OGXA 1H8IH 1E35B 3ZVGA 1SOTA 2F91A 1YPGH 1Z6EA 2UUFB 2GMTB 1V2VT 1GHAG 3RUOA 1QRWA 1ANBA 2GMTC 4K60A 2ZWLH 5JYIA 3LU9B 4A5TS 1K28D 1HAVB 3UFAA 1JIMA 1VITG 1O2QA 3SBKA 2CHAB 4X2YA 5GIBA 1O3PB 3P8OA 4SGAE 4OS6A 3KIDU 2H5DA 2A4OA 4TPYA 2C8XB 2CHAC 3KF2A 3LT3A 1GDUA 3VB3A 1CU1A 1GJ6A 1AUTC 1GBEA 4ZHLU 5T6FA 3A83A 2GV6A 1HXFH 4Z6AH 2WPIS 3SN8A 4DT7B 5A8XA 2V35A 3SU6A 1PQ7A 1T8NA 2V3OH 1FZZA 2NU4E 2ZQ2A 2V3HH 4UONA 2ODQA 1WV7H 1DFPA 1JMOH 2JH5D 2ZIQH 3LGYA 1KTTB 4YTAA 2XNIA 3BTME 1EZQA 3QGJA 3BG4B 3KQCA 1QL9A 1FLEE 4A1VA 1NO9H 2GD4B 3BTEE 1BTPA 3B23B 3L3TA 4AFUA 3K2UA 1GMHF 3P95A 1UVSH 5LPEA 3UQOA 3A8DA 2VH6A 2ZGXH 3A7YA 3F6UH 4KELA 4NA7A 3RLWH 3AW0A 1GBFA 1DICA 2CN0H 3MH6A 3UOPA 4DY7B 4ABFA 4Y71A 5FPYA 1D4PB 4BTIB 3RXBA 1ZRBA 5EOKA 1MAYA 3LC3A 4B2BA 1F0SA 4BTUB 1SFIA 1C5WB 5HM2A 2C3SA 4LXBH 5CE1A 1GMCF 2W7UA 1KLIH 5DP4A 1D6RA 4AG2A 3D49H 2ZEBA 4DG4A 1G3DA 1LPZB 1HRTH 1Z71A 3SNCA 2BDCA 4WH8A 4X2XA 2R2WU 1UJ1A 3BTKE 1K1NA 1QJ6B 1DWDH 3BTWE 4AFSA 1O36A 2GZ8A 1GBDA 2A0QB 3LOXA 3NXPA 1SLXB 1SVPA 1ESTA 3TH3H 9ESTA 3MO9A 5G4BA 1J17T 2ZO3H 1A5IA 3GYMA 3RXAA 2R3UA 1DX5M 1PPZA 1YPMH 2BMGB 4MG3A 2VWOA 1GG6B 2GX4A 2QV1A 1ZRKA 1XUHA 3RXPA 1DWCH 1GMDG 1GG6C 1NN6A 3MH7A 1TE0A 1YM0A 1YPHE 1ELTA 1L4DA 2O8MA 3ZYDA 3ZVDA 1BB0B 3PYHA 4KKDA 5L30H 1HJAB 1SQOA 3SNAA 1UTJA 3BV9B 1TNLA 2STAE 1W8BH 3ZZ6A 3RXGA 5JBAS 5FHTA 1HJAC 3RMLH 1EPTB 3IITA 2D2DA 1AE5A 1C5NH 4K1TA 1ZR0A 3RXSA 5ETXA 1C5UA 4B1TA 2BVSH 1EPTC 1FUJA 2NU1E 1BBRH 1EZSC 1TIOA 5DJ7A 5C67A 4Y8XA 2ZPQA 1GDNA 1P2IA 1HAVA 1SGPE 1THSH 2XC5A 3A86A 4CHAB 1C1PA 5GWZA 1GJ4H 2SGEE 1GBCA 3RXQA 3SU0A 1TABE 2IPHA 3MHWU 3A7VA 4WXIA 2AGIX 4MPVA 2OLGA 1DXWA 3T29A 1UTMA 3RXCA 1JWTA 1XVOA 1ANCA 1GBKA 2BDGA 3HKIB 1ETRH 5A8ZA 1GGDB 1AO5A 1QIXB 3QGNB 1LQDB 1QQUA 4FUGA 3F9HA 2VWNA 1HYLA 2AIPA 1P06A 1ETSH 1LKAA 3Q3XA 3AVZA 1P12E 4H42U 7ESTE 1AU8A 3ZVEA 4MLFB 1V2WT 1FN6A 5C2ZA 2HWLB 5E0HA 3LDXH 2F9UA 1LDTT 4R8TB 1A1RA 3GY4A 1ETTH 1P2MA 1SGCA 3M3VA 6LPRA 3PLBA 1BITA 3MNXA 2FZZA 1JRSA 4OGYA 1BJVA 1DOJA 2O9QA 1BBRK 1O39A 3ATIA 4ZKNU 3RXMA 4B75A 1YPKH 1NROH 2ALVA 1BCUH 1CE5A 1P01A 1T8MA 4WMEA 3MNCA 1GI9B 1TPPA 3ODDA 2F9VA 2W3IA 2BY9X 1SGQE 1C1RA 3H7TA 5JB9S 1GI1A 4U2WA 2Z9KA 3PLPA 5HM9A 1C5VA 1O2YA 2UUJB 3ZZ8A 1O2RA 3EA7A 4I8JA 5F03A 1TNGA 3ATMA 5GXPA 5DP8A 3SI3H 1BDAA 1IQMA 3EYDA 4OS4A 2FX6A 2WYJA 3BN9A 2ZFQH 1O2XA 2HNTF 5DPAA 3M7QA 1Y5BT 1DXPA 3A81A 3U8TH 2P94A 2SNVA 3PM3A 3V3MA 1C9TA 5C5NA 1DPOA 3UNSA 3E8LA 1F0UA 2BY7X 1HXEH 2ZKSA 4JYVH 1G36A 1XVMA 3F9EA 1OWDA 1TAWA 1SGRE 3F1SB 1QA0A 3QX5H 4MPXA 2OC7A 1GJDB 2OP9A 1C2FA 2B5TB 1YLDA 3RXVA 2ODPA 1F5LA 4XBCA 1MTVA 3PMBB 3LIWA 1NC6A 1QJ7B 1TNJA 2NU2E 2WPLS 5GPIB 1HPGA 2BZAA 1CO7E 4X8SH 3T28A 3BIVH 1ANDA 1ZHMA 2JH0D 4Q7ZA 3RXOA 1A4WH 1YKTA 4AORA 4ISIH 1S84A 2GVFA 1XUGA 1EB1H 3KEEA 4JZ1A 4OS7A 4WH6A 3U1IB 1MKWH 1V2RT 1G9IE 1FJSA 1LTOA 2QCYA 7KMEH 4JK6A 3LC5A 2P59A 1EPTA 2BD3A 4AB9A 3RXEA 1D3QB 1PPCE 1FY1A 1O3KA 5HMAA 2WPJS 1J8AA 3M61U 2SGFE 4NIWA 2Q6DA 4YZUA 2PSYA 1LPKB 4UD9H 3HGNA 5EXLA 1SL3A 1BRCE 3GCTG 4IMQA 4X1PU 4A1XA 4AOQA 4YOIA 3BEFB 3UQVA 1DANH 3FANA 1KSNA 3UUZA 2A45B 2VU8E 2BOHB 1MMJN 4M7GA 1KXAA 1Z6JH 1D6WA 1V2LT 3TGKE 1UTQA 1CGIE 2GTBA 1Z7KA 1A61H 5EPNA 1QNJA 2ZDAH 1C1WH 2HPQH 3RP2A 1G37A 3FFGA 3RXFA 3TK6A 8ESTE 5EPYA 1QRXA 3A82A 4Y10E 2A1DB 4FUBA 4QT8C 3MWIU 3M35A 1VCQA 3VPKA 1F0TA 5K0HA 1BMNH 1XM1A 3C1KA 2CGAA 3MU4A 1KXCA 1BJUA 1Z8RA 2B9LA 1IQIA 2Z3CA 4NWLA 3DHKH 1YCPM 2ANYA 3QTVH 1HAZB 4CR5A 4I8LA 2XBWA 4XE4A 2BZ6H 2TGPZ 1GHVH 4FU8A 4K5ZA 1P2OA 1OWJA 4JCNA 1SR5C 4I33A 3PROA 1KLJH 2FOBA 2UUYA 4X2WA 5ESBA 2BY5X 2TGTA 2WPKS 1B7XB 2CV3A 3SORA 1ACBE 1F5RA 1W11U 1SGNE 1UTKA 1O2WA 1GHBG 1CBWB 3A8BA 1L1GA 1FI8A 5FAHA 2QXHA 1DUAA 2SGDE 4E7RG 3OTJE 4CRAA 3RLYH 1TYNA 1CBWC 1HFDA 4UFGH 1O2IA 4MNXA 1GDQA 5C1YA 1LVBA 4CR9A 1HJ8A 2ZG0H 3B8JA 2ZTXA 3HK3B 3MI4A 2Y5HA 2PV9B 1Q2WA 2ZPSA 1LKBA 1C2EA 3LGIA 3M5NA 5E0GA 1EATA 2H9HA 1ZMLA 1N6YA 4MNYA 1TMTH 1MQ6A 3ITIA 2EI7A 3FAOA 3TU7H 1UTOA 2VIPA 3O8BA 1AB9C 3ATKA 4NCYA 2GCHF 3W95A 3SJKA 4KTCA 1QA7A 3KHVA 2ZFTA 2BLVA 5ESTE 3F68H 2SFAA 1O2KA 3PWCA 3DD2H 3MFJA 2A7CA 5E0JA 3UNQA 1M9UA 6GCHG 3QZQA 1XUKA 4DIIH 3FVFB 1PYTD 1TGBA 1P2NA 1SLWB 3TLOA 1SQTA 2UWOA 4ZMAH 1FY3A 2B8OH 4HTCH 1TFXA 2GT8A 1GJ8B 1LHDH 1RTLA 1SG8B 3TITA 2W26A 1OWKA 9LPRA 2P3TB 3CENA 1IQGA 2SNWA 4IW4E 5JDUB 2HVXA 4GPGA 1S5SA 2C90B 3PO1C 4AX9H 1TX6A 2A2XH 2FOCA 3E3TA 2J9NA 2Z9LA 2XYAA 4NIVA 4TYDA 2A7HA 3S9BA 1O0DH 1JRTA 1UHBA
chains in the Genus database with same CATH superfamily
3KL6A 5HGGA 1TX8A 1J16A 1XX9A 1CA0C 2ZU1A 3SHCH 4X1NU 1OHHD 1GMHG 3RXUA 2VWLA 4FXGH 5FPTA 1P8VC 1EP5A 1RTFB 2H9TH 1VITH 1TB6H 2PKSB 4AFQA 1SGTA 2JJ2D 1SC8U 1TA2A 3S7KB 5EW1H 3EAJA 2GP9B 4ZH8A 2TPIZ 4NGAH 2O8UA 2PKSC 2QF4A 4B2AA 1FPHH 4GAWA 1O5FH 1UK2A 1C2DA 3SO3A 1TALA 1GMCG 2IOTA 1HDTH 1TA6A 1D3TB 1OYQA 1QHRB 1QB1A 2FOAA 3RXDA 4XSKU 3UY9A 4H6TA 2W6ID 5IK2D 4JZIA 1NFWA 1UVPA 4ISOA 4XFQA 3ZZCA 1EZUC 1WDIA 4D9QA 1Y3UA 1TBZH 4K3JA 2UUKB 2NU0E 1C1UH 3AAUA 1GHXH 1O3BA 2FTMA 3EGKH 4AC9A 4YT7H 2F3CE 3OSYA 2HNTC 4Y8ZA 1THPB 3U8OH 2PR3A 5BPEA 2YOLA 4UE7H 2M5TA 2CMYA 2OQUA 1FN8A 2ESTE 3KYGA 1QJ1B 1DLEA 1SOZA 3O8DA 2AMQA 1KXFA 1RD3B 2VBCA 1W0KD 1NU9A 4NSVA 5C20A 2QIQA 2FTLE 1Z8GA 3VGCB 1NM6A 3SU1A 1H9HE 2QF5A 3K6YA 3FP7E 5B6OA 3URDA 4GCHF 2ZPRA 1HAYB 5GDSH 3VGCC 2TBSA 2FEQH 1IHSH 4X1QU 8LPRA 2R9PA 3UTUH 3SZNA 1RTKA 3RDZA 3LONA 1YYY1 1BMAA 3FZDA 1O3OA 5EXNA 2H2ZA 3A7WA 3ZZDA 2XC0A 2FX4A 1GBBA 1HCGA 3MO6A 1EJNA 1TBQH 2G5NA 5DG6A 6GCHF 1C5PA 1SGDE 4GUXA 5I46H 1UCYH 3Q00A 4X8TH 1PPEE 2VNTA 4GSOA 3D65E 2Z9JA 3HATH 4BXWA 1C5RA 3SJIA 1QB6A 3HKJB 3F2FA 4DW2U 1C5MD 1C4V2 1LHFH 5F8TA 1Z1JA 6CHAB 1GL0E 1B5GH 4DOQA 2OC0A 1V2QT 2EEKA 1KTSB 4HI3A 3VB6A 1QY6A 1EXFA 1YWUA 2PHBA 4K1SA 2AFQB 4XDEA 4FU7A 1JIRA 1CSOE 2THFB 2BD4A 3V13A 5DKMA 1IOEA 1ELFA 1GI6A 1O37A 1VGCB 1ZLRA 1ZSJA 2ZTZA 2SGQE 1ZHPA 4CREA 3P8NA 4TWYA 1W0YH 2V3MA 1GPZA 2ZZUH 3PRBA 1TGNA 1UMAH 1HAPH 3ZIAD 1FX0B 3R0FA 3LH1A 2QXGA 3KNXA 2RFKC 1Y3XA 4CRFA 1EASA 2Z6BD 4ABIA 3Q77A 1P04A 1WQSA 3MH4A 2LP6A 3BG4C 4INKA 3T27A 3UWJH 2GZ7A 2WPHS 1GBAA 5FXLA 3LJOA 2BXUH 1K21H 2GGVB 3TH4H 3UR9A 3SGBE 2CF9H 3T25A 1E37B 1FAKH 1BTXA 1DDJA 1IQEA 2JJ1D 1O3FA 2R0KA 1UCYK 3F9GA 5TJXA 1MTUA 2JH6D 1OP0A 3ODFA 1WCZA 2J2UA 5DGJA 4Y7BA 1NRPH 1AVGH 1O2JA 1OPHB 2BD9A 2JETB 4K8BA 2AS9A 1GBTA 2UWPA 3GICB 2QYIA 2BB4A 3OYPA 4CRCA 3A88A 3TJOA 1UTNA 2F9PA 4B6EA 3VB7A 1ZPZA 4MPWA 2TRMA 3M5LA 3MOCA 2ZHEH 1ZMNA 5HIYA 3WWBA 3NUMA 1PPHE 4UFDH 1HGTH 3T2NA 1DLKB 2XCNA 1G3CA 2VB0A 2F9BH 1K2I1 3P8GA 1QBVH 2EA3A 1ZSKA 3Q3KA 2ZNKH 2AH4X 2QAAA 2BDIA 2GDDA 4X8VH 1CHOF 3Q3YA 1PYTC 3UPEA 4Y6DA 4JZDH 2ZCHP 1GBMA 4ABEA 5CHAB 5FCRA 5L6NH 2JKHA 4AB8A 3M37A 2G81E 4OM9A 5CHAC 2IN2A 2FP7B 4Y8YA 2XW9A 1GL1A 1GJ9B 5GCHF 2AMPA 2FOFA 1EJAA 2PKAB 1H1BA 1IAUA 4KP0A 5JBCS 4ISNA 3TNSA 1W7XH 3V7TA 3RMOH 1SBWA 3GOVB 4FUDA 4M9FA 3DFJA 4H6SB 1GWAA 2G55A 1KXBA 1C5LH 3VFEA 3E1XB 3GDUA 4B6FA 1E36B 3RXIA 4U01A 1P09A 1KYNA 5F8ZA 2ZHDA 3UAIC 2AGEX 4CBNA 3RXKA 1HBTH 4HFPB 2XBYA 4X6MA 2BX3A 1W0ZU 2YNAA 4KTUA 1EOJA 1O5AB 1A46H 1YP9A 1SFQB 5EQQA 1C1VH 1MTSA 4CHAC 4NIYA 2OINA 1EFRD 1BMLA 1Z8IB 1G30B 3U28C 4LOYH 4FUFA 1F92A 3TVJB 8KME2 2BD5A 4ASHA 4YESB 1TMUH 4AN7A 1DS2E 3ZYEA 2ZFPH 1PPBH 1F2SE 4NIXA 3ZZBA 2SGPE 4XOJA 4X1SU 1FY4A 1TNHA 4DIHH 1MBMA 4P02A 2BQ7B 1LVMA 1O2TA 1GGDC 3AAVA 3R3GB 2EY4C 1KY9A 1C2LA 3FP8E 3HK6B 1P03A 2G51A 3LGUA 2BQ6B 3UOUA 1YPHC 2BHGA 4AG1A 1NRNH 4A1TA 1AFQB 2ZGJA 2ZI2H 4FUJA 5E2OA 1O2SA 1HUTH 1GI5A 1MQ5A 2A4GA 3MU5A 3P6ZB 3GY3A 1MU8B 3GCOA 2GT7A 3TK9A 1O3AA 1K9OE 3SHAH 3U1JB 2J94A 5EQRA 1FNIA 4JMYA 3STIA 1L0ZA 3QWCH 4D9RA 1NBME 2ZHQH 1JBUH 3TIUA 3N7OA 1Y59T 1K1JA 4TY7A 1AQ7A 1ZGVA 1MAXA 2FOMB 1IHTH 5GJ4B 1O3LA 3BTHE 1T8OA 1Y5AT 4TT3D 1K1IA 5FBEA 3STJA 1J15A 1SLUB 1C1SA 2I6QA 2J98B 4Y79A 2ZFRH 4X8UH 4R0IA 1QB9A 2ZCKP 1ZJDA 5PTPA 1GBIA 2OTVA 5C0UA 1A2CH 2FOHA 1IQLA 4JZFH 5A09A 2Z3DA 1KLTA 2EI6A 1O34A 1Y8TA 3VXEH 3RC5A 1ESAA 4ZXYH 1QCPA 3ATLA 1C1MA 2ZECA 2HPPH 1YPEH 2VVVA 4LZ4B 5EGMA 1S82A 1FIZA 1ELBA 1QL8A 2GCHG 2Z9IA 1YC0A 5EJLA 1AMHA 2PKAA 2Z3EA 1XUIA 2A32A 3NKKA 1OOKB 3RXLA 2FIRH 4Z0KA 1LHGH 1H9IE 3SW2B 1DY9A 5AFZH 1CQQA 3M3TA 1OSSA 2BQWB 4DCDA 3BTGE 1P02A 4AZ2B 3NPSA 4F4OC 1O5EH 2ZU5A 5FX6A 1N8OB 4DJZB 4FVDA 3I77A 3NCLA 1INCA 4ABJA 3FKSD 1PQ8A 3ZZ4A 1EQ9A 4J2YB 3SNDA 1MUEB 1UVOA 5T6GA 3U9AH 4B71A 2TIOA 1O2HA 4NA8A 3NRLA 3TH2H 1RFNA 1AVXA 4A92A 5EU8A 5HXFA 1E38B 2VWMA 3PV4A 5EW2H 1G3BA 3A7ZA 2BD8A 3L6PA 3ESTA 5EXMA 5IDKA 1ARBA 4BANB 4O3TA 4I8HA 1UVTH 2CK3D 3KQDA 3SV8A 4DVAU 2Y7ZA 1TGCA 4O9VA 1YPJH 4KGAA 2J92A 5A8YA 2OK5A 1TQ7B 1ORFA 1O5CB 1X7AC 2FOEA 2IPQX 2VIQA 3QUMP 2H6MA 3FOAA 3ZV8A 2H5CA 1UK4A 1FAXA 1PPGE 4UFEH 2XNDD 5C0TA 2XC4A 2ZQ1A 3PMJA 1O3DA 1T32A 1TOCB 2CF8H 1DT2A 2Y5GA 4OS1A 1U6QA 4B2CA 2OC1A 1AWFH 2KAIB 4ESTE 3PTNA 1HB0B 3TNTA 1V2UT 2GKVE 3QDZB 1K1LA 2BD7A 2K8IA 1SLVB 3SV2H 1Z8JB 4YXWD 2ZP0H 4Z1MD 1VCWA 3RU4E 2DE8A 5C17A 4ZXXH 1SHYA 4J1YA 1AWHB 1KMHB 3MU0A 1C2GA 1GBLA 1O31A 4TPIZ 1FY8E 1C4Y2 4O97A 3ZVCA 5KECA 2Z7FE 1WYKA 3SUGA 2FM2A 2XRCA 2XWBI 3GCHB 3N7DA 2J98A 3CS7A 3E90B 5DO4H 2AYWA 1MTNB 1QFKH 2FYRA 3V12A 1QRZA 3PTBA 2V0BA 3ZVFA 2CXVA 2FS9A 1W3CA 2FLRH 3A8AA 2QE7D 4GCHG 1WQVH 2G52A 4E05H 2VVUA 4E7NA 2A5KA 1QBNA 2GJGA 1SI5H 2FLBH 2FI3E 4XBBA 1YF4A 3RM0H 1SB1H 2ZU2A 4OS2A 2Y5FA 2BLOA 1O30A 2ZF0H 4F49A 1AI8H 1QL7A 3NK8A 4MDSA 1C2MA 4ABDA 1O3CA 2QGRA 3PB1E 4GVUA 1ELCA 2ILNA 4WMDA 2BLWA 5DN6D 1V3XA 3E6PH 1O2OA 3ENSB 4ZUHA 1C9PA 5AVDA 3SU4A 1BIOA 4CRDA 1AUJA 3K9XB 4MVNA 1C5XB 2R2MB 3KCGH 5IYTA 2HVYB 3M5OA 4ZROA 1YGCH 4RN6A 1NFXA 4ABBA 1MTWA 5F8XA 4WF8A 1GCTB 1GHYH 5H4IB 2D26C 2H9EH 3SOSA 3UREA 2BDYA 1O2LA 2RDLA 3BG8A 1L2EA 1SMFE 3BTFE 3QLPH 4X6PA 1P9SA 4Y0YE 1EUFA 2VH0A 4GHTA 2STBE 3DCLA 3SU2A 5I25A 1EKBB 1H8DH 3M5MA 1GHZA 4BTTB 1GCDA 4X1RU 5CMXH 5DP6A 1MZAA 1O3IA 1AZ8A 2P3UB 4NSYA 2FYQA 1NZQH 1G2MA 2OUAA 1WBGB 3K6ZA 4WWYA 1THRH 2F9OA 3SUEA 4U32A 4KTSA 1FQ3A 1NY22 5E2PA 1MCVA 3NZIA 1P0SH 4Y11E 3U98H 4UFFH 1O2MA 2BVXH 3KQ5A 4CH2B 1O2NA 2VINA 2VIWA 1LMWB 2FOGA 1Z1IA 3MMGA 1CA8B 1O3JA 2OCVB 5EODA 4Q7YA 5L2ZH 3GISB 4FU9A 3PV2A 3ZZ9A 1A5HA 2RG3A 1V2MT 4B73A 4Y0ZE 1FIWA 3A8CA 2TGDA 2Q1JA 2ZHFH 1C1TA 4TSFD 4BAHB 2KAIA 2O8WA 1HAOH 1KIGH 2ZCLP 3Q76A 1RIWB 2AERH 1D3PB 1V2KT 3PV5A 4CH8B 1RIWC 2W6JD 4WJG2 1GBHA 3CS0A 4K2YA 1EAIA 1BTYA 2PP6A 1DE7H 3T5FH 3UNRA 2HALA 2ZGBH 1AKSB 2FODA 3SGQE 1C2HA 3BEUA 2XCFA 5SGAE 1FONA 1P2KA 1EZXC 1T4UH 5AF9H 3ZZAA 3RXTA 2BVRH 1S85A 1CHOG 2P95A 4NFEA 2L74A 2HLCA 4ZHAA 1A7SA 1L4ZA 3SJ9A 1O5BB 2KR7A 1TPOA 5K7RA 1O35A 3P92A 2Y6TA 4O3UA 1S6FA 4NFFA 4X0WU 1L1JA 1PJPA 4ZKRU 1LVYA 5GCHG 5AHGH 1JXPA 2G8TA 3VB4A 2WYGA 1PQAA 5BRRE 2ZDKA 2QY0B 1WXRA 1W0JD 3D23A 4LK4A 1EAWA 2BDAA 2D8WA 3PMAB 2J97A 2OXSA 4WVPE 3LJJA 1AHTH 1BRUP 1ZOMA 5ABWA 1GJCB 4RKJB 1G3EA 2PTNA 2FMJA 1SKYE 2OD3B 1FXYA 2KCPA 4IN1A 1KXDA 2VVCA 1OWIA 2BYAX 5J4QA 2XOKD 1H8ED 2WUBA 2ANKH 3ZVBA 2ALPA 5LPFA 2M2AA 1J9CH 1RS0A 1ZTKA 1EX3A 4JK5A 1P57B 2ODYB 3E0NB 3ZVAA 2OBOA 4JZEH 1KDQB 1QZ8A 1B0FA 1P11E 2W3KA 1IQFA 2XXLA 3P70B 1O2VA 2QA9E 5EQSA 1K1OA 4LZ1H 1HAIH 2WPDD 1C1OA 2BX4A 1Y3VA 1ZZZA 1O2ZA 5DP9A 6CHAC 2ZGCA 4X6OA 3KQBA 1NRQH 1DWBH 1L1NA 1XXFA 4THNH 5A0AE 1WU1A 5FPSA 1AIXH 3VXFH 1ESBA 3VG8A 1NBMD 1LPGB 1VGCC 4YT6H 2ZGHA 1Y3WA 2WUCA 2Y7XA 1TQ0B 2BM2A 3OE7D 1ABJH 4AFZA 2A5AA 3MNBA 1XKAC 1DITH 2ZU4A 3I78A 4MPUA 4CRGA 2XTTB 1MKXH 1BBRE 3BTTE 4IN2A 2G5VA 2P93A 4RSPA 5C3NA 1P05A 2C8ZB 2Z94A 2IJOB 5TCCA 3M36A 1DVAH 2A31A 2G00A 4I7YH 1TBRH 2VJ1A 2UWLA 4YOJA 3E91A 3TGJE 5C1XA 1VZQH 3E16B 3T62A 3BEIB 2FPZA 2F43B 2WV5A 3EE7A 4BXSA 5E8EH 3OY6U 5FL7D 3AK5A 3MU8A 2HGTH 4NZQA 1V2PT 1NT1A 1ELAA 4BAKB 1P3EA 4DGJA 1QURH 3OEHD 1CGJE 1BHXF 2JETC 3MH5A 4I8GA 1XMNB 1CT2E 3HPTB 2G4TA 1EAUA 5LPRA 1ZTLA 1AKSA 3PLKA 1FY5A 1GJAB 5T3HA 1P2QA 2WV4A 3GDVA 1NFYA 4IS5A 1O2PA 2WV9A 4RT1A 3L33A 4UDWH 2PFEA 4ZKSU 1AD8H 4ABGA 2VIOA 1ZYOA 1D3DB 1FMGA 1AFEH 3GY5A 2J38A 3IWMA 4VGCB 1KXEA 2C4FH 4INLA 1MKXK 2AIQA 3RXJA 1A5GH 1HAGE 1WSSH 4VGCC 1Q31A 2QXIA 2PGBB 2W7SA 2B0FA 3TPIZ 2V6NA 3G01A 1TPSA 2P16A 2BTCE 3URCA 1O3HA 4CBOA 4CRBA 4ACBA 1GI2A 1OX1A 1TPAE 3LGWA 1HIAB 3SJ8A 3SZEA 2BOKA 2ZA5A 1NESE 7GCHF 3SV6A 3RXRA 3QTOH 2QF3A 4Q7XA 1ZJKA 1E0FD 5GNDA 1T7CA 2J4IA 1AE8H 1PPFE 2D1JA 4OS5A 1V2JT 3WY8A 2FESH 2FS8A 2ZDNA 5DSFA 5A0BA 1GJ7B 3RC4A 2JDID 1UTPA 1BZXE 5L2YH 1KDQA 2AGGX 1CGHA 1GHAF 3SNEA 3UIRA 4XD7D 5FX5A 2O8LA 4XBDA 1JOUB 3A7TA 2ANMH 1LVOA 2AHME 1VR1H 1TLDA 1O3EA 3MYWA 3RXHA 3S69A 1W7GH 1T4VH 1VITF 3F2GA 7LPRA 1A3EH 3F3BA 1IQJA 1BQYA 1PQ5A 3TJUA 3MQKC 2EC9H 5J4SA 2NWNA 2J95A 1BT7A 3U69H 5HYOA 4FUHA 3N7EA 1DM4B 3W94A 1EB2A 1ELVA 1HAHH 3ELAH 2TGAA 1ZTJA 4RKOB 1C4U2 4SGBE 1AVWA 8GCHG 3GCNA 3S9AA 3RU4D 4B76A 3SUFA 1LHCH 2V7QD 3QN7A 1DY8A 5KGOA 1E34B 5EG4A 4FUCA 1EOLA 1T31A 1LO6A 4MTBA 1AFQC 1TRMA 1WTHD 1O2UA 1ZPCA 1YBWA 1NFUA 1V2OT 4MNVA 3RMNH 2QC2A 1BUIA 3EQ0H 2O8TA 1DWEH 1BTUA 3UB0A 1ELEE 3EA9A 1S6HA 3ZZ7A 1K1MA 3W1EA 1OP2A 3PMHB 1O3MA 2J34A 2K0QA 1VCPA 3KQEA 3PRDA 3SUDA 1G2LA 2Y81A 3M7UA 1RJXB 1TRYA 1BTZA 2I6SA 1V2TT 2ZDMA 2PW8H 1IQKA 4BNRA 4JYTA 3DA9B 2Z9GA 4FETA 1ZSLA 1CVWH 5DK1A 4AGKA 4JYUH 3JZ2B 2A4QA 1XUJA 1O3GA 1ZHRA 5JBBS 1OWHA 3A85A 1EJMA 5DP5A 1O5DH 3LKWA 4BAQB 3SV9A 1ANEA 1C5YB 2LPRA 3FN8A 4ISLA 1FPCH 3T26A 1G32B 4ZCNA 4ABHA 3KGPA 1SGIB 1C5OH 4I32A 4YLQH 5LGOA 4IC6A 3S9CA 3BTDE 4HGCA 4D8NA 1HNEE 1ZGIA 1Y3YA 2QXJA 2BDBA 4MNWA 1TRNA 1W10U 4O03A 4ZKOU 2AEIH 1VJAU 2GZ9A 3BSQA 3SNBA 3AW1A 3EDXB 2W5EA 1TNKA 1ZPBA 1SPJA 6ESTA 1TGTA 3OY5U 2VGCB 3EA8A 1GVZA 1NS3A 1TOMH 1EP6A 2PSXA 2QF0A 2R3YA 2ZFFH 2Y82A 4ABAA 1F7ZA 1S83A 2VGCC 3DSGA 1HIAA 2GV7A 1GMDF 3RMMH 5JBTA 2NU3E 1TNIA 4I8KA 4Q63A 4GHQA 3WW7A 3OEED 2R0LA 4A7IB 1TWXB 1OS8A 2A4RA 1GVLA 1WOFA 1K22H 1FV9A 4H4FA 2EI8A 3FZZA 2VIVA 1XXDA 1N8OC 2F9NA 1ELDE 1K0HA 1C5TA 2OBQA 5A0CA 1BOQA 2QN5T 2ZFSA 4BAOB 2P8OB 2OC8A 2GCTB 2Q6FA 1SGYE 1MD7A 1N6XA 5JB8S 1N1LA 3SQHE 2P8OC 1CT0E 2XBVA 1A0HB 2GCTC 2PTCE 1IQHA 2Y80A 3A80A 3SU3A 4AYYB 1UO6A 1XUFA 3DUXH 5C1UA 3MU1A 1BRAA 4NWKA 1AGJA 1TGSZ 2P3FH 1SGFG 1SGFA 1ZMJA 4P00A 1WAYB 4UEHH 3GS9A 5T6DA 8GCHF 1QQ4A 2BY6X 1OKXA 2ZDVH 4NA9H 4PROA 4NG9H 1H4WA 1UHBB 1ABIH 3K65B 5JPMH 1MH0A 1TONA 3LH3A 5TCAA 4ISHH 3MNSA 1LCYA 1YLCA 3HGPA 1TX7A 1DSUA 2DE9A 1C5SA 3ZZ5A 3A7XA 1MKWK 1P10A 2YNBA 4E06H 3ZV9A 4D76A 1SQAA 3TJNA 2G4UA 4Q80A 1MU6B 1C2KA 3A87A 5C94A 1BHXB 3F0PA 2FXRA 3S0NA 1OP8A 2C8YB 2FI4E 4YLUA 1W12U 3VB5A 1C1NA 3D62A 1BTHH 1S0QA 1HJ9A 4TY6A 1GJ5H 1DUEA 3RU4T 4BAMB 1WTGH 1C1QA 1CT4E 1GHWH 1SHHB 1W2KH 2PUXB 4IGDA 4INHA 3GY7A 2WINI 1ID5H 2PGQB 4Q2KA 4DURA 4AGJA 1HV7A 2ASUB 1SSXA 2ZDLA 1F5KU 3GCHC 2WPMS 4YOGA 1QR3E 5DP3A 1W14U 2LNCA 2C93B 2FDAA 2CJIA 4ZAEA 1MTNC 1GVKB 1Q3XA 4IBLH 5A2MH 2XWAA 3A84A 1RXPA 3KN2A 1LQEA 1T8LA 5EIYA 4ZHMU 3F0OA 2HOBA 2ULLA 4K1EA 4X2VA 3M7TA 1YPLH 1QTFA 1S0RA 2A5IA 3E0PB 4FUEA 2AMDA 3MTYA 4NZLA 3O8CA 3SU5A 1LHEH 3LPRA 3AASA 3BIUH 1WUNH 2BD2A 1CHGA 1V2ST 1BRBE 1IQNA 4FOUC 1AY6H 4IMZA 1AB9B 2H1UA 1ELGA 3IG6B 1TMBH 1YCPH 3C27B 1RRKA 3VEQB 4ACAA 3P17H 3OU0A 1NRSH 4D7GA 5EJZA 3DFLA 4A6LA 1V6DA 4U30A 1GJBB 4K69A 1C2IA 2PUQH 4YO9A 3FP6E 2BLQA 3LGVA 4Q4LA 2K1QA 3UWIA 1UK3A 5HKKD 4K8YA 3PWBA 4D7FA 1GBJA 2FI5E 4IC5A 1OWEA 3SI4H 1GCTC 4GLYA 3TJVA 1BTWA 1HLTH 3BF6H 4Y76A 2RA3A 1B0EA 4BOHA 4TWWA 1O3NA 3I29A 1O33A 1GI8B 1MD8A 2ZC9H 2ZHWH 2PWXA 1AN1E 3GY6A 5EJ1A 2FO9A 1MBQA 1RGQA 1W13U 4F48B 1Y5UT 1C5QA 1O5GH 3PO1B 3ZZ3A 3GCTF 5LH8A 3LGTA 2JIZD 3DT0H 3OFND 3ATWA 5AFYH 3RC6A 3M3SA 2HNTE 2BY8X 1MCTA 1NU7B 2RCEA 1H9LB 2F83A 3F2HA 3GYLB 3GDSA 3SGAE 5FCKA 5KEDA 1UCYE 4YM9A 1CA0B 1S81A 1D9IA 4I31A 4FVBA 1F0RA 4MQAA 2KZ4A 2OQ5A 3WWFA 2EQNA 1YCPK 3DSPA 3H5CB 1J14A 3UR6A 2VIDA 1DSTA 1V2NT 2J5UA 5F6MA 3SV7A 1GI3A 4B74A 2RA0A 1GI7B 1PFXC 2HRVA 1E79D 1SGEE 4AYVB 1C5ZB 3S7HB 2GDEH 1P3CA 2SGAA 4WMFA 1O2GH 2DUCA 2A2QH 1P2JA 4FUIA 1QGFA 1ARCA 1VJ9U 2ANWA 2BDHA 2A7JA 1OYTH 1MZDA 5FBIA 2ZTYA 3V0XA 4WXVA 1NTPA 1P9UA 3F9FA 3JZ1B 1EAXA 3P8FA 1GI4A 1AZZA 5DP7A 1A0LA 3O8RA 3SJOA 1A0JA 3U8RH 1O32A 3CP7A 1XKBC 2B7DH 5C5OA 1OXGA 3H7OA 3OX7U 2PLXA 1GI0A 3MO3A 2C8WB 1BMMH 1QBOA 4Y7AA 1GHBF 3QZRA 1BA8B 1A3BH 4X6NA 3NWUA 1O38A 2XBXA 3QO6A 3QK1A 4HZHA 1UVUH 4F55A 1C2JA 3GY8A 7GCHG 3GY2A 3B9FH 3BTQE 3A89A 1BMFD 4WY3A 3TGIE 1NPMA 2ZU3A 1NRRH 1YLNA 2Q6GA 5CDFE 3SQEE 2FWWA 1FDPA 3EE0B 1YY3A 2BXTH 3RM2H 1K1PA 3TK5A 1UTLM 1HAXB 4OGXA 1H8IH 1E35B 3ZVGA 1SOTA 2F91A 1YPGH 1Z6EA 2KFWA 2UUFB 2GMTB 1V2VT 1GHAG 3RUOA 1SQRA 1QRWA 1ANBA 2KM0A 2GMTC 4K60A 2ZWLH 5JYIA 3LU9B 1S6LA 4A5TS 1K28D 1HAVB 3UFAA 1JIMA 1VITG 1O2QA 3SBKA 2CHAB 2KCOA 4X2YA 5GIBA 1O3PB 3P8OA 4SGAE 4OS6A 3KIDU 2H5DA 2A4OA 4TPYA 2C8XB 2CHAC 3KF2A 3LT3A 1GDUA 3VB3A 1CU1A 1GJ6A 1AUTC 1GBEA 4ZHLU 5T6FA 3A83A 2GV6A 1HXFH 4Z6AH 2WPIS 3SN8A 4DT7B 5A8XA 2V35A 3SU6A 5B6LA 1PQ7A 1T8NA 2V3OH 1FZZA 2NU4E 2ZQ2A 1H8HD 2V3HH 4ASUD 4UONA 2ODQA 1WV7H 1DFPA 1JMOH 2JH5D 2ZIQH 3LGYA 1KTTB 4YTAA 2XNIA 3BTME 1EZQA 3QGJA 3BG4B 3FO8D 3KQCA 1QL9A 1FLEE 4A1VA 1NO9H 2GD4B 3BTEE 1BTPA 3B23B 3L3TA 4AFUA 3K2UA 1GMHF 3P95A 1UVSH 5LPEA 3UQOA 3A8DA 2VH6A 2ZGXH 3A7YA 3F6UH 4KELA 4NA7A 3RLWH 3AW0A 1GBFA 1DICA 1E1RD 2CN0H 3MH6A 3UOPA 4DY7B 4ABFA 4Y71A 5FPYA 1D4PB 4BTIB 2IJD1 3RXBA 1ZRBA 5EOKA 1MAYA 3LC3A 4B2BA 1F0SA 4BTUB 1SFIA 1C5WB 5HM2A 2C3SA 4LXBH 5CE1A 2YMSD 1GMCF 2W7UA 1KLIH 5DP4A 1D6RA 4AG2A 3D49H 2ZEBA 4DG4A 1G3DA 1LPZB 1HRTH 1Z71A 3SNCA 2BDCA 4WH8A 4X2XA 2R2WU 1UJ1A 3BTKE 1K1NA 1QJ6B 1DWDH 3BTWE 4AFSA 1O36A 2GZ8A 1GBDA 2A0QB 3LOXA 3NXPA 1SLXB 1SVPA 1ESTA 3TH3H 9ESTA 3MO9A 5G4BA 1J17T 2ZO3H 1A5IA 3GYMA 3RXAA 2R3UA 1DX5M 1PPZA 1COWD 1YPMH 2BMGB 4MG3A 2VWOA 1GG6B 2GX4A 2QV1A 1ZRKA 1XUHA 3RXPA 1DWCH 1GMDG 1GG6C 1NN6A 3MH7A 1TE0A 1YM0A 1YPHE 1ELTA 1L4DA 2O8MA 3ZYDA 3ZVDA 1BB0B 3PYHA 4KKDA 5L30H 1HJAB 1SQOA 3SNAA 1UTJA 3BV9B 1TNLA 2STAE 1W8BH 3ZZ6A 3RXGA 5JBAS 5FHTA 1HJAC 3RMLH 1EPTB 3IITA 2D2DA 3KYFA 1AE5A 1C5NH 4K1TA 1ZR0A 3RXSA 5ETXA 3SYJA 1C5UA 4B1TA 2BVSH 1EPTC 1FUJA 2NU1E 1BBRH 1EZSC 1TIOA 5DJ7A 2WSSD 5C67A 4Y8XA 2ZPQA 1GDNA 1P2IA 2F4LA 1HAVA 1SGPE 1THSH 2XC5A 3A86A 5HIZA 4CHAB 1C1PA 5GWZA 1GJ4H 2SGEE 3OAAD 1GBCA 3H09A 3RXQA 3SU0A 1TABE 2IPHA 3MHWU 3A7VA 4WXIA 2AGIX 4MPVA 2OLGA 1DXWA 3T29A 1UTMA 3RXCA 1JWTA 1XVOA 1ANCA 1GBKA 2BDGA 3HKIB 1ETRH 5A8ZA 1GGDB 1AO5A 1QIXB 3QGNB 1LQDB 1QQUA 4DT4A 4FUGA 3F9HA 2VWNA 1HYLA 2AIPA 1P06A 1ETSH 1LKAA 3Q3XA 3AVZA 1P12E 4H42U 7ESTE 1AU8A 3ZVEA 4MLFB 1V2WT 1FN6A 5C2ZA 2HWLB 2WHXA 5E0HA 3LDXH 2F9UA 1LDTT 4R8TB 1A1RA 3GY4A 1ETTH 1P2MA 1SGCA 3M3VA 6LPRA 3PLBA 1BITA 3MNXA 2FZZA 1JRSA 4OGYA 1BJVA 1DOJA 2O9QA 1BBRK 1O39A 3ATIA 4ZKNU 3RXMA 4B75A 1YPKH 1NROH 2ALVA 2RDEA 1BCUH 1CE5A 1P01A 1T8MA 4WMEA 3MNCA 1GI9B 1TPPA 3ODDA 2F9VA 2W3IA 2BY9X 1SGQE 1C1RA 3H7TA 5JB9S 1GI1A 4U2WA 2Z9KA 3PLPA 5HM9A 1C5VA 1O2YA 2UUJB 3ZZ8A 1O2RA 3EA7A 4I8JA 5F03A 1TNGA 3ATMA 5GXPA 5CHBA 5DP8A 3SI3H 1BDAA 1IQMA 3EYDA 4OS4A 2FX6A 2WYJA 3BN9A 2ZFQH 1O2XA 2HNTF 5DPAA 3M7QA 1Y5BT 1DXPA 3A81A 1UW7A 3U8TH 2P94A 2SNVA 3PM3A 3V3MA 1C9TA 5C5NA 1DPOA 3UNSA 3E8LA 1F0UA 2HLDD 2BY7X 1HXEH 2ZKSA 4JYVH 1G36A 1XVMA 3F9EA 1OWDA 1TAWA 1SGRE 3F1SB 1QA0A 3QX5H 4MPXA 2OC7A 1GJDB 2OP9A 1C2FA 2B5TB 1YLDA 3RXVA 2ODPA 1F5LA 4XBCA 1MTVA 3PMBB 3LIWA 1NC6A 1QJ7B 1TNJA 2NU2E 2WPLS 5GPIB 1HPGA 2BZAA 1CO7E 4X8SH 3T28A 3BIVH 1ANDA 1ZHMA 2JH0D 4Q7ZA 3RXOA 1A4WH 1YKTA 4AORA 3CNRA 4ISIH 1S84A 2GVFA 1XUGA 1EB1H 3KEEA 4JZ1A 4OS7A 4WH6A 3U1IB 1MKWH 1V2RT 1G9IE 1FJSA 1LTOA 2QCYA 7KMEH 4JK6A 3LC5A 2P59A 1EPTA 2BD3A 4AB9A 3RXEA 1D3QB 1PPCE 1FY1A 1O3KA 5HMAA 2WPJS 1J8AA 3M61U 2SGFE 4NIWA 2Q6DA 1MABB 4YZUA 3N99A 2PSYA 1LPKB 4UD9H 3HGNA 5EXLA 1SL3A 1BRCE 3GCTG 4IMQA 4X1PU 4A1XA 4AOQA 4YOIA 3BEFB 2KX4A 3UQVA 1DANH 3FANA 4HG6A 2YMSB 1KSNA 3UUZA 2A45B 2VU8E 2BOHB 1MMJN 4M7GA 1KXAA 1Z6JH 2YMSC 1D6WA 1V2LT 4RT0A 3TGKE 1UTQA 1CGIE 2GTBA 1Z7KA 1A61H 2WZQA 1QNJA 2ZDAH 1C1WH 5EPNA 2HPQH 3RP2A 1G37A 3FFGA 3RXFA 3TK6A 8ESTE 5EPYA 1QRXA 3A82A 4Y10E 2A1DB 4FUBA 4QT8C 3MWIU 3M35A 1VCQA 3VPKA 1F0TA 5K0HA 1BMNH 1XM1A 3C1KA 2CGAA 5F53A 3MU4A 1KXCA 1BJUA 1Z8RA 2B9LA 1IQIA 2Z3CA 4NWLA 3DHKH 1YCPM 2ANYA 3QTVH 1HAZB 4CR5A 4I8LA 2XBWA 4XE4A 2BZ6H 5T1VA 2TGPZ 1GHVH 4FU8A 4K5ZA 1P2OA 1OWJA 4JCNA 1SR5C 4I33A 3PROA 1KLJH 2FOBA 2UUYA 4X2WA 5ESBA 2BY5X 2TGTA 2WPKS 1B7XB 2CV3A 3SORA 1ACBE 1F5RA 1W11U 1SGNE 1UTKA 1O2WA 1GHBG 1CBWB 4RI0A 3A8BA 1L1GA 1FI8A 5FAHA 2QXHA 1DUAA 2SGDE 4E7RG 3OTJE 4XRNA 4CRAA 3RLYH 1TYNA 1CBWC 1HFDA 2LELA 4UFGH 1O2IA 4MNXA 1GDQA 5C1YA 1LVBA 4CR9A 1HJ8A 2ZG0H 3B8JA 2ZTXA 3HK3B 3MI4A 2Y5HA 2PV9B 1Q2WA 4I86A 2ZPSA 1LKBA 1C2EA 1VKYA 3LGIA 3M5NA 5E0GA 1EATA 2H9HA 1ZMLA 1N6YA 4MNYA 1TMTH 1MQ6A 3ITIA 2EI7A 3FAOA 2KCYA 3TU7H 1UTOA 2VIPA 3O8BA 1AB9C 3ATKA 4NCYA 2GCHF 3W95A 3SJKA 4KTCA 1QA7A 3KHVA 2ZFTA 2BLVA 5ESTE 3F68H 3OTPA 2SFAA 1O2KA 3PWCA 3DD2H 3MFJA 2L6OA 2A7CA 5E0JA 3UNQA 1M9UA 6GCHG 3QZQA 1XUKA 4DIIH 3FVFB 1PYTD 1TGBA 1P2NA 1SLWB 3TLOA 1SQTA 2UWOA 4ZMAH 1FY3A 2B8OH 4HTCH 1TFXA 2GT8A 1GJ8B 1LHDH 1RTLA 1SG8B 3TITA 2W26A 1OWKA 9LPRA 2P3TB 3CENA 1IQGA 1E1QD 2SNWA 4IW4E 5JDUB 2HVXA 4GPGA 1S5SA 2C90B 3PO1C 2KCAA 4AX9H 1TX6A 2A2XH 2FOCA 3E3TA 2J9NA 2Z9LA 2XYAA 4NIVA 4TYDA 2A7HA 3S9BA 1O0DH 3DSOA 1JRTA 1UHBA
chains in the Genus database with same CATH topology
3KL6A 5HGGA 1TX8A 1J16A 1XX9A 1CA0C 2ZU1A 3SHCH 4X1NU 3RXUA 1GMHG 2VWLA 4FXGH 5FPTA 1P8VC 1EP5A 1RTFB 2H9TH 1VITH 1TB6H 2PKSB 4AFQA 1SGTA 1SC8U 1TA2A 3S7KB 5EW1H 3EAJA 2GP9B 4ZH8A 2TPIZ 4NGAH 2O8UA 2PKSC 4B2AA 1FPHH 4GAWA 1O5FH 1UK2A 1C2DA 3SO3A 1TALA 1GMCG 2IOTA 1HDTH 1TA6A 1D3TB 1OYQA 1QHRB 1QB1A 2FOAA 3RXDA 4XSKU 3UY9A 4H6TA 4JZIA 1NFWA 1UVPA 4ISOA 4XFQA 3ZZCA 1EZUC 4D9QA 1Y3UA 1TBZH 4K3JA 2UUKB 2NU0E 1C1UH 3AAUA 1GHXH 1O3BA 2FTMA 3EGKH 4YT7H 2F3CE 3OSYA 2HNTC 4Y8ZA 1THPB 3U8OH 2PR3A 5BPEA 2YOLA 4UE7H 2M5TA 2CMYA 2OQUA 1FN8A 2ESTE 1QJ1B 1DLEA 1SOZA 3O8DA 2AMQA 1KXFA 1RD3B 1NU9A 4NSVA 5C20A 2QIQA 2FTLE 1Z8GA 3VGCB 1NM6A 3SU1A 1H9HE 3K6YA 3FP7E 5B6OA 3URDA 4GCHF 2ZPRA 1HAYB 5GDSH 3VGCC 2TBSA 2FEQH 1IHSH 4X1QU 8LPRA 2R9PA 3UTUH 3SZNA 1RTKA 3RDZA 3LONA 1YYY1 1BMAA 3FZDA 1O3OA 5EXNA 2H2ZA 3A7WA 3ZZDA 2XC0A 2FX4A 1GBBA 1HCGA 3MO6A 1EJNA 1TBQH 2G5NA 5DG6A 6GCHF 1C5PA 1SGDE 4GUXA 5I46H 1UCYH 3Q00A 4X8TH 1PPEE 2VNTA 4GSOA 3D65E 2Z9JA 3HATH 4BXWA 1C5RA 3SJIA 1QB6A 3HKJB 4DW2U 1C5MD 1C4V2 1LHFH 5F8TA 1Z1JA 6CHAB 1GL0E 1B5GH 4DOQA 2OC0A 1V2QT 2EEKA 1KTSB 4HI3A 3VB6A 1QY6A 1EXFA 2PHBA 4K1SA 2AFQB 4XDEA 4FU7A 1JIRA 1CSOE 2THFB 2BD4A 3V13A 5DKMA 1IOEA 1ELFA 1GI6A 1O37A 1VGCB 1ZLRA 1ZSJA 2ZTZA 2SGQE 1ZHPA 4CREA 3P8NA 4TWYA 1W0YH 1GPZA 2ZZUH 1TGNA 1UMAH 1HAPH 3R0FA 3LH1A 2QXGA 3KNXA 1Y3XA 4CRFA 1EASA 2Z6BD 4ABIA 3Q77A 1P04A 1WQSA 3MH4A 3BG4C 4INKA 3T27A 3UWJH 2GZ7A 2WPHS 1GBAA 5FXLA 3LJOA 2BXUH 1K21H 2GGVB 3TH4H 3UR9A 3SGBE 2CF9H 3T25A 1E37B 1FAKH 1BTXA 1DDJA 1IQEA 1O3FA 2R0KA 1UCYK 3F9GA 5TJXA 1MTUA 2JH6D 1OP0A 3ODFA 1WCZA 2J2UA 5DGJA 4Y7BA 1NRPH 1AVGH 1O2JA 1OPHB 2BD9A 2JETB 4K8BA 2AS9A 1GBTA 2UWPA 3GICB 2QYIA 2BB4A 3OYPA 4CRCA 3A88A 3TJOA 1UTNA 2F9PA 3VB7A 1ZPZA 4MPWA 2TRMA 3M5LA 3MOCA 2ZHEH 1ZMNA 3NUMA 1PPHE 4UFDH 1HGTH 3T2NA 1DLKB 2XCNA 1G3CA 2VB0A 2F9BH 1K2I1 3P8GA 1QBVH 2EA3A 1ZSKA 3Q3KA 2ZNKH 2AH4X 2QAAA 2BDIA 2GDDA 4X8VH 1CHOF 3Q3YA 1PYTC 3UPEA 4Y6DA 4JZDH 2ZCHP 1GBMA 4ABEA 5CHAB 5FCRA 5L6NH 2JKHA 4AB8A 3M37A 2G81E 5CHAC 2IN2A 2FP7B 4Y8YA 2XW9A 1GL1A 1GJ9B 5GCHF 2AMPA 2FOFA 1EJAA 2PKAB 1H1BA 1IAUA 4KP0A 5JBCS 4ISNA 3TNSA 1W7XH 3V7TA 3RMOH 1SBWA 3GOVB 4FUDA 3DFJA 4H6SB 1GWAA 2G55A 1KXBA 1C5LH 3VFEA 3E1XB 3GDUA 1E36B 3RXIA 4U01A 1P09A 1KYNA 5F8ZA 2ZHDA 4CBNA 2AGEX 3RXKA 1HBTH 4HFPB 2XBYA 4X6MA 2BX3A 1W0ZU 2YNAA 4KTUA 1EOJA 1O5AB 1A46H 1YP9A 1SFQB 5EQQA 1C1VH 1MTSA 4CHAC 4NIYA 2OINA 1BMLA 1Z8IB 1G30B 4LOYH 4FUFA 1F92A 3TVJB 8KME2 2BD5A 4ASHA 4YESB 1TMUH 4AN7A 1DS2E 3ZYEA 2ZFPH 1PPBH 1F2SE 4NIXA 3ZZBA 2SGPE 4XOJA 4X1SU 1FY4A 1TNHA 4DIHH 1MBMA 2BQ7B 1LVMA 1O2TA 1GGDC 3AAVA 3R3GB 1KY9A 1C2LA 3FP8E 3HK6B 1P03A 2G51A 3LGUA 2BQ6B 3UOUA 1YPHC 2BHGA 4AG1A 1NRNH 4A1TA 1AFQB 2ZGJA 2ZI2H 4FUJA 5E2OA 1O2SA 1HUTH 1GI5A 1MQ5A 2A4GA 3MU5A 3P6ZB 3GY3A 1MU8B 3GCOA 2GT7A 3TK9A 1O3AA 1K9OE 3SHAH 3U1JB 2J94A 5EQRA 1FNIA 4JMYA 3STIA 1L0ZA 3QWCH 4D9RA 2ZHQH 1JBUH 3TIUA 3N7OA 1Y59T 1K1JA 4TY7A 1AQ7A 1ZGVA 1MAXA 2FOMB 1IHTH 5GJ4B 1O3LA 3BTHE 1T8OA 1Y5AT 1K1IA 5FBEA 3STJA 1J15A 1SLUB 1C1SA 2I6QA 4Y79A 2ZFRH 4X8UH 4R0IA 1QB9A 2ZCKP 1ZJDA 5PTPA 1GBIA 2OTVA 1A2CH 2FOHA 1IQLA 4JZFH 5A09A 2Z3DA 1KLTA 2EI6A 1O34A 1Y8TA 3VXEH 3RC5A 1ESAA 4ZXYH 1QCPA 3ATLA 1C1MA 2ZECA 2HPPH 1YPEH 2VVVA 4LZ4B 5EGMA 1S82A 1FIZA 1ELBA 1QL8A 2GCHG 2Z9IA 1YC0A 1AMHA 2PKAA 2Z3EA 1XUIA 2A32A 3NKKA 1OOKB 3RXLA 2FIRH 4Z0KA 1LHGH 1H9IE 3SW2B 1DY9A 5AFZH 1CQQA 3M3TA 1OSSA 2BQWB 4DCDA 3BTGE 1P02A 4AZ2B 3NPSA 4F4OC 1O5EH 2ZU5A 5FX6A 1N8OB 4DJZB 4FVDA 3I77A 3NCLA 1INCA 4ABJA 1PQ8A 3ZZ4A 1EQ9A 4J2YB 3SNDA 1MUEB 1UVOA 5T6GA 3U9AH 4B71A 2TIOA 1O2HA 4NA8A 3TH2H 1RFNA 1AVXA 4A92A 5EU8A 5HXFA 1E38B 2VWMA 3PV4A 5EW2H 1G3BA 3A7ZA 2BD8A 3L6PA 3ESTA 5EXMA 5IDKA 1ARBA 4BANB 4O3TA 4I8HA 1UVTH 3KQDA 3SV8A 4DVAU 2Y7ZA 1TGCA 4O9VA 1YPJH 4KGAA 2J92A 5A8YA 1TQ7B 1ORFA 1O5CB 1X7AC 2FOEA 2VIQA 3QUMP 2H6MA 3ZV8A 2H5CA 1UK4A 1FAXA 1PPGE 4UFEH 2XC4A 2ZQ1A 3PMJA 1O3DA 1T32A 1TOCB 2CF8H 1DT2A 2Y5GA 4OS1A 1U6QA 4B2CA 2OC1A 1AWFH 2KAIB 4ESTE 3PTNA 1HB0B 3TNTA 1V2UT 2GKVE 3QDZB 1K1LA 2BD7A 1SLVB 3SV2H 1Z8JB 2ZP0H 1VCWA 3RU4E 2DE8A 4ZXXH 1SHYA 4J1YA 1AWHB 3MU0A 1C2GA 1GBLA 1O31A 4TPIZ 1FY8E 1C4Y2 4O97A 3ZVCA 2Z7FE 1WYKA 3SUGA 2FM2A 2XRCA 2XWBI 3GCHB 3CS7A 3E90B 5DO4H 2AYWA 1MTNB 1QFKH 2FYRA 3V12A 1QRZA 3PTBA 2V0BA 3ZVFA 2CXVA 2FS9A 1W3CA 2FLRH 3A8AA 4GCHG 1WQVH 2G52A 4E05H 2VVUA 4E7NA 2A5KA 1QBNA 1SI5H 2FLBH 2FI3E 4XBBA 1YF4A 3RM0H 1SB1H 2ZU2A 4OS2A 2Y5FA 2BLOA 1O30A 2ZF0H 4F49A 1AI8H 1QL7A 3NK8A 4MDSA 1C2MA 4ABDA 1O3CA 2QGRA 3PB1E 4GVUA 1ELCA 2ILNA 4WMDA 2BLWA 1V3XA 3E6PH 1O2OA 3ENSB 4ZUHA 1C9PA 5AVDA 3SU4A 1BIOA 4CRDA 1AUJA 3K9XB 4MVNA 1C5XB 2R2MB 3KCGH 5IYTA 3M5OA 4ZROA 1YGCH 4RN6A 1NFXA 4ABBA 1MTWA 5F8XA 4WF8A 1GCTB 1GHYH 5H4IB 2D26C 2H9EH 3SOSA 3UREA 2BDYA 1O2LA 2RDLA 3BG8A 1L2EA 1SMFE 3BTFE 3QLPH 4X6PA 1P9SA 4Y0YE 1EUFA 2VH0A 4GHTA 2STBE 3SU2A 5I25A 1EKBB 1H8DH 3M5MA 1GHZA 4BTTB 1GCDA 4X1RU 5CMXH 5DP6A 1MZAA 1O3IA 1AZ8A 2P3UB 4NSYA 2FYQA 1NZQH 1G2MA 2OUAA 1WBGB 3K6ZA 4WWYA 1THRH 2F9OA 3SUEA 4U32A 4KTSA 1FQ3A 1NY22 5E2PA 1MCVA 3NZIA 1P0SH 4Y11E 3U98H 4UFFH 1O2MA 2BVXH 4CH2B 1O2NA 2VINA 2VIWA 1LMWB 2FOGA 1Z1IA 3MMGA 1CA8B 1O3JA 2OCVB 5EODA 4Q7YA 5L2ZH 3GISB 4FU9A 3ZZ9A 1A5HA 2RG3A 1V2MT 4B73A 4Y0ZE 1FIWA 3A8CA 2TGDA 2Q1JA 2ZHFH 1C1TA 4BAHB 2KAIA 2O8WA 1HAOH 1KIGH 2ZCLP 3Q76A 1RIWB 2AERH 1D3PB 1V2KT 4CH8B 1RIWC 4WJG2 1GBHA 3CS0A 4K2YA 1EAIA 1BTYA 1DE7H 3T5FH 3UNRA 2HALA 2ZGBH 1AKSB 2FODA 3SGQE 1C2HA 3BEUA 2XCFA 5SGAE 1FONA 1P2KA 1EZXC 1T4UH 5AF9H 3ZZAA 3RXTA 2BVRH 1S85A 1CHOG 2P95A 4NFEA 4ZHAA 2HLCA 1A7SA 1L4ZA 3SJ9A 1O5BB 1TPOA 5K7RA 1O35A 3P92A 2Y6TA 4O3UA 1S6FA 4NFFA 4X0WU 1L1JA 1PJPA 4ZKRU 1LVYA 5GCHG 5AHGH 1JXPA 2G8TA 3VB4A 2WYGA 1PQAA 5BRRE 2ZDKA 2QY0B 3D23A 4LK4A 1EAWA 2BDAA 2D8WA 3PMAB 2OXSA 4WVPE 3LJJA 1AHTH 1BRUP 1ZOMA 5ABWA 1GJCB 4RKJB 1G3EA 2PTNA 2FMJA 2OD3B 1FXYA 4IN1A 1KXDA 2VVCA 1OWIA 2BYAX 5J4QA 2WUBA 2ANKH 3ZVBA 2ALPA 5LPFA 1J9CH 1RS0A 1ZTKA 1EX3A 4JK5A 1P57B 2ODYB 3E0NB 3ZVAA 2OBOA 4JZEH 1KDQB 1B0FA 1P11E 2W3KA 1IQFA 2XXLA 3P70B 1O2VA 2QA9E 5EQSA 1K1OA 4LZ1H 1HAIH 1C1OA 2BX4A 1Y3VA 1ZZZA 1O2ZA 5DP9A 6CHAC 2ZGCA 4X6OA 3KQBA 1NRQH 1DWBH 1L1NA 1XXFA 4THNH 5A0AE 1WU1A 5FPSA 1AIXH 3VXFH 1ESBA 1LPGB 1VGCC 4YT6H 2ZGHA 1Y3WA 2WUCA 2Y7XA 1TQ0B 2BM2A 1ABJH 4AFZA 2A5AA 3MNBA 1XKAC 1DITH 2ZU4A 3I78A 4MPUA 4CRGA 2XTTB 1MKXH 1BBRE 3BTTE 4IN2A 2G5VA 2P93A 4RSPA 5C3NA 1P05A 2C8ZB 2Z94A 2IJOB 5TCCA 3M36A 1DVAH 2A31A 2G00A 4I7YH 1TBRH 2VJ1A 2UWLA 4YOJA 3E91A 3TGJE 5C1XA 1VZQH 3E16B 3T62A 3BEIB 2FPZA 2WV5A 4BXSA 5E8EH 3OY6U 3MU8A 2HGTH 4NZQA 1V2PT 1NT1A 1ELAA 4BAKB 1P3EA 4DGJA 1QURH 1CGJE 1BHXF 2JETC 3MH5A 4I8GA 1XMNB 1CT2E 3HPTB 2G4TA 1EAUA 5LPRA 1ZTLA 1AKSA 3PLKA 1FY5A 1GJAB 5T3HA 1P2QA 2WV4A 3GDVA 1NFYA 4IS5A 1O2PA 4UDWH 3L33A 2PFEA 4ZKSU 1AD8H 4ABGA 2VIOA 1ZYOA 1D3DB 1FMGA 1AFEH 3GY5A 2J38A 3IWMA 4VGCB 1KXEA 2C4FH 4INLA 1MKXK 2AIQA 3RXJA 1A5GH 1HAGE 1WSSH 4VGCC 1Q31A 2QXIA 2PGBB 2W7SA 2B0FA 3TPIZ 2V6NA 3G01A 1TPSA 2P16A 2BTCE 3URCA 1O3HA 4CBOA 4CRBA 1GI2A 1OX1A 1TPAE 3LGWA 1HIAB 3SJ8A 2BOKA 2ZA5A 1NESE 7GCHF 3SV6A 3RXRA 3QTOH 2QF3A 4Q7XA 1ZJKA 1E0FD 1T7CA 2J4IA 1AE8H 1PPFE 2D1JA 4OS5A 1V2JT 3WY8A 2FESH 2FS8A 2ZDNA 5A0BA 1GJ7B 3RC4A 1UTPA 1BZXE 5L2YH 1KDQA 2AGGX 1CGHA 1GHAF 3SNEA 3UIRA 5FX5A 2O8LA 4XBDA 1JOUB 3A7TA 2ANMH 1LVOA 1VR1H 1TLDA 1O3EA 3MYWA 3RXHA 3S69A 1W7GH 1T4VH 1VITF 7LPRA 1A3EH 1IQJA 1BQYA 1PQ5A 3TJUA 2EC9H 5J4SA 2NWNA 2J95A 1BT7A 3U69H 5HYOA 4FUHA 1DM4B 3W94A 1EB2A 1ELVA 1HAHH 3ELAH 2TGAA 1ZTJA 4RKOB 1C4U2 4SGBE 1AVWA 8GCHG 3GCNA 3S9AA 3RU4D 4B76A 3SUFA 1LHCH 3QN7A 1DY8A 1E34B 5EG4A 4FUCA 1EOLA 1T31A 1LO6A 4MTBA 1AFQC 1TRMA 1WTHD 1O2UA 1ZPCA 1YBWA 1NFUA 1V2OT 4MNVA 3RMNH 2QC2A 1BUIA 3EQ0H 2O8TA 1DWEH 1BTUA 1ELEE 3EA9A 1S6HA 3ZZ7A 1K1MA 1OP2A 3PMHB 1O3MA 2J34A 1VCPA 3KQEA 3SUDA 1G2LA 2Y81A 3M7UA 1RJXB 1TRYA 1BTZA 2I6SA