2FOCA

Structure of porcine pancreatic elastase in 55% dimethylformamide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2focA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2focA01
3LKWA 2QV1A 1LVYA 2C90B 1SGNE 4BTTB 3LGVA 5E0GA 4CHAC 3VXEH 1F0RA 3SU4A 1EUFA 1HB0B 7GCHG 1SQAA 3F68H 1QURH 2FMJA 2K1QA 1K1MA 1ZRKA 1HIAB 2HNTE 1T7CA 1SGFG 5EGMA 4IC5A 1CT0E 2WV5A 2A7JA 4INKA 1AO5A 2BVRH 2FI4E 2HNTF 2RG3A 2XBWA 3KQCA 3QK1A 4AN7A 2I6QA 1O3IA 1TBZH 1FY4A 2C8WB 1O3EA 4WF8A 3MYWA 1MH0A 2Z9GA 5C1UA 3EQ0H 1WU1A 4GVUA 1S83A 1KY9A 1DM4B 3TJOA 1PPCE 2GGVB 4BTUB 5FPSA 4ASHA 2FP7B 4X2YA 4CRFA 1GMHF 1T8LA 2GTBA 4AB8A 3SU3A 3U9AH 2TGTA 2QGRA 5HXFA 3IWMA 1PQ7A 1P09A 1HAHH 2Y7ZA 1C4V2 5EXNA 3VB5A 2OC8A 1SI5H 3DFJA 4DVAU 1TFXA 3PMJA 1MTSA 3OU0A 3RXGA 3QLPH 1GBEA 1UVTH 1J16A 1ZTLA 1GG6B 2Y5HA 1XUFA 3ESTA 3B8JA 2ZQ2A 3A85A 3K65B 3A8AA 3LOXA 3Q76A 1KDQB 1GMCG 1YPHE 3HKIB 4I8GA 3P8NA 2RA0A 1IQNA 3SJ8A 3RXPA 1EAIA 3ZZ4A 1LQEA 3DHKH 1Z8RA 1CT4E 5EW2H 2UWLA 1SFIA 2WUCA 1GMHG 1BJUA 1OXGA 4Q2KA 2VWNA 1NRNH 1OWIA 3HK3B 1DS2E 3ZZ7A 1O2YA 3BTME 1LPKB 1O3FA 2KAIA 3C1KA 3MH7A 1BQYA 2XCFA 1O5AB 2R3YA 3STIA 1HAPH 3TK5A 1UO6A 3A7TA 1F5RA 4WJG2 3KN2A 2THFB 1K22H 1EPTB 1Y5UT 4DURA 1P2MA 1WBGB 1V2MT 3SN8A 1P2KA 3SV2H 1NPMA 2ZKSA 1SR5C 1LPZB 3LGYA 1MKWH 4E06H 2WPHS 1EZQA 4K1SA 5A8ZA 3T28A 4JYVH 1EZUC 1L1JA 1YPHC 4Y8YA 1P10A 2A5KA 5GJ4B 3A83A 1YP9A 1P3CA 1V2KT 2BY9X 4RN6A 1GI9B 4WXIA 4CH8B 1YCPH 3PLBA 2R0KA 1ZMNA 3MH5A 4H42U 2OQ5A 2FIRH 3K2UA 1A4WH 2JETC 3PMHB 2XC4A 3EAJA 1O2IA 2AGEX 3SU6A 1V2VT 2R2MB 1GJ7B 3STJA 1V2LT 1N6YA 1GBKA 1LTOA 1QTFA 1UVOA 3UNRA 2CF9H 3M37A 3LGUA 3MOCA 4AFQA 1IOEA 2BMGB 4U2WA 1DY9A 2IPHA 2VIPA 1PQ8A 1V2JT 2C93B 3BEFB 3E0PB 3ATLA 4X1SU 1UVSH 2ILNA 2Q6DA 3VB6A 1ARBA 3T26A 1QL8A 2GV6A 1KXFA 2ZFFH 4DJZB 1XKBC 2NWNA 1AUJA 3RLWH 1XUGA 3SGQE 2XC5A 4X1NU 1VGCB 2VVVA 1AKSB 2HVXA 2ZHEH 1Z6EA 1TNHA 5TCAA 4UFGH 1Y3UA 5EOKA 1OWEA 1O3LA 1OYTH 3OYPA 4AG1A 4GCHG 1G3EA 1L2EA 1AWHB 1GCTB 1GHAF 1N8OB 1O3DA 2IOTA 4TY6A 4Y6DA 6LPRA 4CRCA 5FHTA 3BEUA 3RXBA 2CV3A 2BY5X 2ESTE 3A84A 1F5LA 1GMDF 1MTUA 1F2SE 1Z8GA 3P70B 2BY8X 1GL0E 3V12A 5A0AE 4WY3A 1Z6JH 2ZFQH 3RXCA 1YLCA 2ZPQA 4OS4A 1JOUB 1GJCB 1GL1A 2LNCA 1O2HA 1GI2A 3L3TA 3LH1A 1EATA 1KTTB 4H6TA 4I8KA 1BRCE 3MHWU 4JZIA 2AGIX 4BAOB 3SUFA 1GCDA 3M7QA 2A7CA 3AVZA 4BAHB 1CA0B 1OYQA 3RMMH 5T6GA 1MTNC 1FY1A 1O3KA 1GI8B 2VIWA 2OUAA 4XBDA 3RXOA 3SNBA 4AOQA 2G4TA 1IQLA 1C5MD 4ZHLU 1DE7H 4WH8A 4TWWA 1O3MA 4TWYA 1XUIA 3HGNA 3RC4A 3E3TA 2XWAA 4ZAEA 2BLVA 3VXFH 4OS7A 1AN1E 2SGDE 3KL6A 1SVPA 2ZC9H 4AYYB 1C2GA 4PROA 2DUCA 3A7YA 1FN8A 4IMQA 5C5NA 1PYTD 3A80A 1QGFA 1HJ9A 1GBDA 1OWJA 1YPKH 3D65E 3ZVAA 2XCNA 5A8YA 2XRCA 1Y59T 3FZDA 3ZZCA 4JK6A 3T5FH 1V3XA 2ZFPH 1NN6A 3AAUA 1BTUA 1ZHMA 4JZDH 3SUEA 3GYMA 1SGIB 1A5HA 1Q2WA 4THNH 2OBOA 3E0NB 1LKBA 2ZIQH 3EYDA 4INHA 4BANB 4I31A 1BIOA 5FCRA 2V3OH 4A1VA 1SLVB 1QL7A 1NRRH 1SQOA 3VB7A 3FANA 1BB0B 2P8OB 2VNTA 3S7HB 3SUGA 1LPGB 2ZGHA 2NU1E 4UE7H 2SGFE 1FONA 2QXJA 3CS7A 2VWLA 1P03A 1NROH 2HPPH 2BOKA 5BPEA 1GDUA 2AS9A 5A0CA 1AVXA 4RSPA 1XUKA 3V3MA 3UNSA 3KQDA 2RA3A 5IYTA 2P3TB 1W0ZU 1GDQA 3DA9B 5JBTA 3RXRA 4TPIZ 2I6SA 2BHGA 1SHHB 1A7SA 2GZ9A 3BTEE 1CBWC 2FI5E 3UWIA 5FX5A 3SV8A 5FBEA 1BHXB 1LCYA 3SJOA 3EE0B 3LDXH 3PTNA 4DY7B 3GY3A 1O2ZA 2RCEA 2FOFA 1PPZA 1Z1JA 3RM0H 4FUHA 1O2JA 2BLOA 1ETSH 1T4VH 3V13A 1SC8U 1D3PB 1DOJA 1MAXA 4Q7ZA 1PYTC 4IS5A 3GY6A 1ELCA 1EAXA 1EJMA 1TPAE 1QJ7B 5DP9A 1O37A 1S82A 2OQUA 4O3UA 2WPIS 1GHYH 5GXPA 4JYTA 1KLJH 3QZQA 3UIRA 1XX9A 3BTDE 3ZZ5A 1K1IA 1GI5A 4XBCA 1GJ4H 4XDEA 5LPEA 3RXEA 1QRZA 1TRMA 1K1PA 1YPEH 2FX6A 3TGJE 1HAOH 1SSXA 3QGNB 2FS9A 1PPHE 1AWFH 3T29A 3U1JB 1C1UH 2ZCLP 1GG6C 2VVUA 4YTAA 4CR5A 2J2UA 3M7UA 1T8MA 4WH6A 1EASA 2GDEH 2PGQB 1YBWA 1TMUH 3PROA 4Y0ZE 4NIWA 2R3UA 3LC3A 1TMTH 4HTCH 3E6PH 2FOCA 4AFZA 1NS3A 4U01A 3BTWE 1MQ5A 4GPGA 1EJNA 3TH4H 2WV4A 7LPRA 1EZSC 2J95A 4B1TA 2O9QA 2G52A 1TPPA 1UTQA 2V0BA 1ZSKA 3RXDA 4KP0A 1MBMA 3E1XB 4GLYA 4BAQB 1UTMA 1C5XB 2OC7A 1EPTC 1K21H 4X8UH 3GDVA 1IQJA 2ZDMA 5HM9A 1AE8H 3I77A 3BTKE 1IQIA 4DIIH 3A8CA 3ZYDA 1CVWH 2F9UA 1H4WA 4Q7XA 4R8TB 1PPGE 3MH4A 1C1OA 3VEQB 4DW2U 1UTLM 4B74A 1K1LA 1GBIA 1V2WT 4SGBE 1ANDA 2ANWA 1J9CH 4NWLA 3PYHA 4ABAA 5BRRE 5CMXH 5IDKA 5JDUB 3FZZA 3RXSA 1ESTA 5DP8A 1GBBA 3P6ZB 3MU0A 4NIVA 2ZFSA 1LVOA 1YPLH 3QN7A 1D3QB 3RXJA 1ZPBA 1EP5A 5ESBA 2XW9A 1Y3YA 3G01A 4F4OC 1C5UA 1KTSB 4YOIA 1K1NA 1IHSH 1BOQA 1ZLRA 5FXLA 1O3GA 1EJAA 1S84A 2V35A 4ZHMU 3RXQA 4B2CA 1ZZZA 5JBAS 5EODA 3BF6H 5DGJA 1SGQE 1ZYOA 2XTTB 2ZZUH 1W7GH 4Y11E 1C2LA 1OWKA 1MU6B 1W7XH 9LPRA 3A7WA 4BXWA 1PPEE 1AQ7A 1ZPZA 1HNEE 2BDYA 2BD4A 3LC5A 4NA7A 1DUAA 1VGCC 3UR6A 1VJAU 1XUJA 4JMYA 3SV9A 3PO1B 3FFGA 1SGEE 1S6HA 2ZNKH 1LHEH 2KAIB 1C1SA 1L4DA 1GJ6A 2B7DH 3SGBE 2QC2A 3H5CB 2JH6D 3QTOH 5FX6A 3NKKA 1O3AA 1GCTC 1N8OC 4ZKRU 2EI8A 3P8OA 2SGPE 1CHOG 5C1XA 5LGOA 1BRAA 5C5OA 1QBNA 1J8AA 1O3OA 3GCOA 2PW8H 2ZGCA 1MD7A 1TBQH 5DJ7A 3OSYA 5GWZA 1P2IA 2FWWA 2FODA 1BTYA 1ELDE 1ARCA 2GVFA 2ZCHP 1P2OA 3DT0H 3SNCA 4ABEA 1ANCA 2A2XH 1MBQA 2BD8A 2OD3B 1MKWK 2GCTB 3ELAH 3SI3H 1MU8B 2BX4A 2FS8A 1CA0C 3BG4B 4MNWA 1GVKB 3B23B 4NZQA 4X1QU 2CHAB 2Z9IA 1TIOA 1O31A 2YNAA 3NZIA 4A92A 1YCPK 1B7XB 3UOPA 2B0FA 3SGAE 1QY6A 1WSSH 3BIVH 3K6ZA 3NXPA 3SW2B 1NT1A 4X2XA 3DFLA 2D26C 1GBLA 1O3BA 1AFQB 2ZU4A 2F9OA 1NFXA 4YT7H 2ALVA 4DCDA 1K28D 1RGQA 1P2QA 3C27B 1ZTJA 1TX7A 3SJIA 3UWJH 3GCNA 1NRPH 3SU1A 4CREA 4FUEA 1W2KH 1NTPA 3MWIU 2IJOB 1OWHA 1C5YB 3A86A 1TPSA 3BTGE 1RXPA 4MNVA 3UY9A 4ZH8A 1GI3A 4GUXA 1EXFA 2TGDA 1SLXB 2PKAA 6GCHG 1YPMH 4B71A 2WPMS 1ELGA 1Z7KA 3A7XA 1GJ9B 1TAWA 1GBCA 1UCYE 1O5BB 2PSYA 3AASA 5E8EH 1DWDH 1S5SA 4Y71A 5DKMA 2D2DA 3E16B 4BNRA 1GMCF 4KTCA 3P95A 2V6NA 3TVJB 4I32A 3BN9A 1Y3WA 1SGPE 1T8OA 2P8OC 1TPOA 2TIOA 3TJVA 1C1NA 4R0IA 1THRH 1ZGVA 2ZI2H 3TITA 2WPLS 1CQQA 1JIMA 1O30A 4UDWH 3ODFA 5E2OA 2HALA 1H9LB 3RXFA 4WXVA 2H6MA 4E05H 2BD2A 3ITIA 2ZTXA 3RLYH 2ZFRH 1AVGH 3TH2H 1UTJA 1GI4A 3H7OA 2HWLB 1OOKB 1O2KA 2A4GA 2ZHDA 1SGRE 1ZGIA 1KSNA 3PLPA 2OLGA 1ANBA 1TA6A 2H1UA 1S6FA 1KIGH 2BQ7B 2P3UB 4NG9H 4D7FA 3KIDU 3FP8E 2JH0D 4J2YB 5DO4H 1J14A 2VINA 3L6PA 3RXVA 3RC6A 2NU2E 4Q80A 3U69H 1G36A 4NIXA 1MTVA 4LZ1H 1NESE 5DP7A 4NSVA 1WCZA 1UK4A 2GMTB 2Y80A 1EZXC 3PWBA 1HXEH 2WYGA 3QUMP 1LHDH 2ZDAH 4AORA 4NIYA 1C4U2 1A0JA 2ZG0H 1HJAB 4NSYA 4RKJB 2QAAA 4TYDA 2HGTH 4LZ4B 1T31A 1GJAB 2G4UA 1HBTH 1OWDA 2ZDVH 2CGAA 1MTWA 2HOBA 3TPIZ 1PFXC 3S9CA 1BITA 1THPB 1ZR0A 2P95A 1DVAH 1GJDB 4ZKNU 2GD4B 4OS1A 1THSH 4CR9A 1O3NA 2B5TB 1FI8A 3ATMA 3GDUA 4YESB 2F91A 1FNIA 5JBCS 3SQHE 4CBNA 1C2HA 1EB2A 1O3HA 2ALPA 3VB3A 4GCHF 1TYNA 1DLKB 4YOJA 2J38A 2ZO3H 1A3BH 1SG8B 4AYVB 1J17T 1BRBE 2EI6A 1BJVA 1O2TA 1V2UT 3OTJE 1VITG 3EA9A 3HPTB 3SU0A 3NUMA 3W94A 1C5OH 1LHGH 1SPJA 1F0TA 1YYY1 4INLA 1D6WA 3S7KB 2PLXA 3MU5A 1P9UA 2UWPA 2PFEA 2VIVA 4I8JA 4AX9H 1CU1A 4UFFH 1BMNH 1TQ0B 1VJ9U 2NU3E 1WYKA 3W95A 1HAZB 1JBUH 3BSQA 3VPKA 5EQSA 1ABIH 1NU7B 8KME2 1DPOA 2B8OH 3ZVBA 1IHTH 2Z6BD 3M5MA 5CE1A 4Q7YA 3ZZ6A 2H5CA 1TOMH 1UCYK 2TBSA 1C5TA 1C4Y2 3T25A 2BDGA 1OP2A 3GCTG 1C1QA 3KF2A 1TGTA 2PSXA 1ESAA 3RC5A 2STBE 4D76A 1SL3A 2VIQA 1PQ5A 2SNVA 1CSOE 7ESTE 5I46H 1DT2A 1YM0A 4NGAH 5C67A 2FOHA 3KEEA 1PPBH 4F49A 2F9NA 2XBYA 2QA9E 3KHVA 5DP6A 2QCYA 1VCPA 2PHBA 2BY7X 2FOMB 1H8IH 1G30B 1L0ZA 3SJ9A 3WY8A 1KLTA 1NFUA 1QL9A 4AFUA 4UD9H 1HAVB 3LJJA 4A5TS 1CO7E 4WMFA 1A0HB 1WQVH 1AZ8A 3NWUA 3S9AA 1O39A 2GDDA 1KXBA 2XYAA 1DXWA 3CS0A 1P02A 2XBXA 1B0FA 3PO1C 4ZROA 1RIWC 4KKDA 1AFEH 1FQ3A 4HFPB 2G5VA 4FUGA 3MNSA 1BTXA 1O2RA 2BM2A 5FCKA 2J34A 5A8XA 2EI7A 3PWCA 3T27A 3AW1A 1ABJH 3AW0A 3U1IB 5B6OA 1C5RA 1KDQA 1TOCB 2W26A 3QO6A 4I33A 3FVFB 1UK3A 1MAYA 1TNGA 1W10U 1KXAA 5EXLA 4X1PU 3N7OA 2TGPZ 4VGCB 1DLEA 5HM2A 2BD9A 2WUBA 4YM9A 1QBOA 1O2VA 5K0HA 1KLIH 5F6MA 1O2UA 1C5SA 4CHAB 1TMBH 1CE5A 1FY8E 3RMNH 3GOVB 1QRWA 2A0QB 4B76A 1YGCH 1SMFE 4M7GA 2ODQA 2GCTC 3SU5A 3LIWA 1DUEA 3BG4C 2QF0A 2AYWA 5A2MH 2P93A 1FPCH 2W7UA 2CHAC 4Y10E 3PM3A 1ZHRA 2PWXA 2FYRA 4X8TH 3Q3XA 1OSSA 2G8TA 1DXPA 3IITA 1TNKA 1HAIH 2FPZA 8GCHG 3LGWA 1C1RA 4ZKOU 5LH8A 1ZSLA 1V6DA 1AFQC 2A32A 2BZAA 3QZRA 2H9EH 2QN5T 1E35B 1SGDE 2BXUH 3F9FA 1HFDA 1HGTH 1V2RT 2VB0A 2UUFB 1W8BH 3M35A 4WMEA 3B9FH 2EEKA 3MU8A 3O8BA 4NA9H 1P9SA 1JMOH 1RTKA 1N6XA 4BAKB 5TCCA 3L33A 4H6SB 3SU2A 3VFEA 1A0LA 2OTVA 2R2WU 4X0WU 1DSTA 1A3EH 2FZZA 4WWYA 1O2MA 2GT7A 8LPRA 2FTMA 1UCYH 2NU0E 3EDXB 2GCHF 1BTZA 2BDIA 1GJ5H 1NC6A 4I7YH 3PLKA 5DK1A 5EXMA 5C1YA 1MMJN 1UHBB 1FMGA 3ATIA 4K2YA 5SGAE 4FUJA 2W3IA 5DP5A 3F9EA 1BCUH 5FAHA 2OBQA 2OC1A 4JCNA 1S0QA 2A5IA 1S0RA 4YOGA 3PV4A 1D4PB 3MNCA 2BD7A 4ISOA 2FI3E 4AFSA 2FDAA 3RXHA 1E37B 1DSUA 2FOGA 2H2ZA 1BMAA 2BVXH 1HDTH 4Y8ZA 5G4BA 3ZVFA 5EQRA 1FJSA 1GJBB 4ISIH 2P16A 2PKSB 2FTLE 2Z9LA 2VIOA 2Q1JA 2M5TA 1BA8B 2G55A 3I29A 5PTPA 2GCHG 3RM2H 1AZZA 1SGYE 2CJIA 1ZJKA 4IN2A 4BOHA 3RXTA 4J1YA 4MPXA 1BMMH 1T8NA 1FLEE 2BD5A 3F1SB 2SGEE 3A89A 3ATWA 1BTHH 4D9QA 1BMLA 1G2LA 2AH4X 2SNWA 4BXSA 3GY2A 1O2WA 2B9LA 4FVBA 2CF8H 1NM6A 5C3NA 4XE4A 3M3VA 3OY6U 4CH2B 3EGKH 3TK9A 2A2QH 2O8UA 4LOYH 4FUDA 2JETB 1AB9B 1P01A 1ZPCA 2GMTC 1LHCH 1O32A 3SNEA 4XBBA 4FUFA 3RUOA 4U32A 1IQMA 1SLWB 1ELVA 1YCPM 1HLTH 1C1TA 4NFEA 2TRMA 4OS5A 4O9VA 4CRBA 3MNBA 1HJAC 3JZ2B 3TJUA 1Y5AT 2VWMA 2Y7XA 1O2NA 3TJNA 4FXGH 1P12E 1ZJDA 2AERH 3A8BA 1O0DH 2VVCA 3UR9A 1IQGA 3QDZB 1W11U 1CA8B 3OY5U 1SGFA 1GDNA 3RMLH 4ISHH 1O34A 1NRQH 5FPYA 3GISB 3S9BA 1EQ9A 1JRTA 1EP6A 5GIBA 1OX1A 2PTNA 1ZMLA 1RD3B 3PB1E 2GP9B 4TY7A 1W14U 1G3DA 2BY6X 4CBOA 1TALA 4X2VA 3ZYEA 1CHGA 1Y3XA 2ZTYA 1CHOF 3LPRA 1TABE 1KXEA 1KYNA 1QNJA 1UVUH 5AHGH 2ZHWH 1P11E 4K1EA 1IQFA 6CHAB 2ZF0H 1ZHPA 1ACBE 2R9PA 4ABFA 3RDZA 1TWXB 1YPJH 1GVZA 4SGAE 1SFQB 1BUIA 3A88A 2HRVA 3BTHE 2PV9B 1TQ7B 3TU7H 4JZEH 1GHBG 2ZA5A 5T6FA 1C2MA 2QY0B 1C5ZB 2ZCKP 1G32B 1W3CA 3LH3A 3S0NA 1HJ8A 1P04A 1VCQA 3D62A 3K6YA 3ZZAA 1JIRA 5JYIA 3A82A 4K8YA 2ANKH 1GGDB 1TNJA 1C9PA 1J15A 3ENSB 3GY7A 1C2IA 2AIPA 3Q3KA 2F83A 4LK4A 3RU4D 1FDPA 1D3TB 1FV9A 2O8LA 4UFDH 1P8VC 5E2PA 2G81E 3ZZDA 1M9UA 3SNAA 2VH6A 3CENA 1EOJA 1P3EA 1GHZA 4X8VH 1OP8A 2AMQA 5JPMH 1MQ6A 1HAGE 2ANYA 1GI0A 1TGNA 1PQAA 4K1TA 1FIZA 4DOQA 2F9PA 1O33A 1FAXA 2BDHA 2PTCE 3U98H 4H4FA 3HATH 3QGJA 5A09A 6GCHF 3MFJA 3ZVDA 2A1DB 1GBAA 1G9IE 3K9XB 1GBTA 1GJ8B 4ABDA 3O8DA 2A5AA 1PJPA 4FU9A 1P2JA 4KELA 5DP3A 1C5NH 1JXPA 3RU4E 3NCLA 4JYUH 3AAVA 4Z6AH 4ZMAH 5L2YH 1G3CA 1EAUA 1GBHA 2FESH 2O8TA 1Q31A 5L6NH 4OS2A 3F6UH 1BTWA 5FBIA 1QJ1B 2FM2A 1UMAH 3UNQA 1LHFH 2BVSH 1QQUA 1DX5M 1GVLA 1QA7A 1W13U 1X7AC 3U8TH 1QRXA 3MH6A 2NU4E 1QB9A 4K60A 4A1XA 5GDSH 1ORFA 2QIQA 1ELFA 2DE9A 4Y79A 1INCA 4NWKA 3TNSA 2XC0A 3KNXA 2ZP0H 2OXSA 1EAWA 2Z9KA 3I78A 1O5FH 1CBWB 5C2ZA 1BBRH 4UFEH 2BZ6H 2C8XB 1AHTH 1LQDB 3HKJB 1DWBH 2CXVA 3FAOA 3ATKA 1O36A 1BHXF 3V0XA 1WV7H 4MPUA 3VB4A 3O8CA 2QXHA 1FUJA 4E7RG 2BXTH 4BAMB 2C3SA 1NU9A 2FLBH 4MNYA 1VR1H 3URCA 4B2AA 2R0LA 3D23A 4ABJA 5HGGA 4D7GA 1NFYA 5L2ZH 3MO6A 3SV7A 1Z71A 1GBFA 1GHWH 5HYOA 5LPFA 3M7TA 2A4RA 4AGJA 4FU8A 3ZZ9A 1OKXA 3SV6A 1XUHA 2W5EA 1NY22 3RXKA 5AFZH 1V2PT 7KMEH 4HI3A 2ANMH 2ZU3A 1IQHA 4XSKU 4IBLH 3MO3A 1SQTA 1V2ST 1HUTH 2PUXB 1FXYA 2G5NA 2Y5FA 1BT7A 4FU7A 5FPTA 2H9TH 4ISNA 4K69A 4GAWA 1P05A 5DPAA 4Y7BA 1FN6A 3Q00A 2Y81A 4MPWA 2HNTC 1AIXH 1FPHH 3UQOA 2TGAA 2UWOA 1C9TA 1ETTH 2AIQA 2FLRH 3P17H 2P94A 4NCYA 3QWCH 1GPZA 2IN2A 1F0SA 1XMNB 1SBWA 1K9OE 1A5IA 1GHVH 2BTCE 1D3DB 1RTLA 1DY8A 2ULLA 3D49H 1LVBA 2W3KA 4IMZA 2SGAA 2XNIA 2XXLA 1HRTH 4TPYA 5CHAB 1C5LH 2WPJS 3R3GB 1AUTC 1SOTA 4B73A 3UQVA 4JZ1A 1VITF 3SI4H 4A7IB 1JWTA 1O2XA 1OPHB 3BEIB 2PKSC 5HMAA 1CGHA 3LONA 4DGJA 4AZ2B 3M36A 2XWBI 4Y8XA 5F8XA 9ESTA 2Z3EA 1KXCA 3SQEE 3KQEA 2VJ1A 1FZZA 2PR3A 1AE5A 1QIXB 1HYLA 5EU8A 2EC9H 1UTPA 2AMPA 4YLQH 5DP4A 5DG6A 1D9IA 2OINA 1Z8JB 2HLCA 1BRUP 1QA0A 2BLWA 3QX5H 5JB8S 1NO9H 1O5GH 5J4SA 2AMDA 2YNBA 5T6DA 3M5NA 1SOZA 4U30A 3GCTF 1QR3E 2GV7A 4B2BA 4FUCA 2D1JA 1LVMA 3GICB 4NFFA 1AB9C 3MTYA 2ZPRA 1T4UH 2FXRA 4ABHA 1L1NA 3SUDA 1TGSZ 1T32A 1C1VH 1A2CH 5AFYH 3VGCB 2QXIA 3ZV9A 1ETRH 1P0SH 2CMYA 2G51A 3NK8A 4KTSA 2F3CE 1TONA 3TH3H 1EX3A 3RXUA 5E0HA 1QQ4A 1W12U 1HCGA 2QF3A 1O3CA 1ELBA 2GT8A 1F7ZA 2YOLA 5J4QA 3ZZ3A 1ZOMA 1F5KU 1TGBA 3ZVCA 2O8MA 2Z94A 3LT3A 2ZU1A 5EW1H 4MTBA 1PPFE 3A87A 1AY6H 1F92A 1AI8H 2SFAA 3V7TA 1VZQH 1HIAA 1QB6A 3S69A 2ZHQH 2J9NA 2VGCB 1RS0A 1ELTA 2ZU2A 1UK2A 3O8RA 4A6LA 2FOEA 4IN1A 3IG6B 4Y7AA 4CRGA 4O3TA 1C2JA 3KGPA 1ID5H 4ABIA 3P92A 3E8LA 1S81A 3LU9B 2FOBA 1V2TT 2ODPA 1XM1A 5LPRA 1O2LA 1TLDA 4CRDA 1P2NA 2BX3A 2J92A 1TBRH 4FVDA 3HK6B 6CHAC 4IGDA 4UONA 2PUQH 4ISLA 1G3BA 1CT2E 4K3JA 3BTQE 3CP7A 5H4IB 3TLOA 3ZV8A 4DIHH 2FEQH 2A7HA 1A1RA 1ZSJA 1DWCH 3Q77A 2FO9A 1SB1H 2TPIZ 2Q6FA 1GGDC 1GHAG 2FOAA 3GCHB 1XVOA 4X6NA 3A7ZA 1O5CB 3R0FA 2ZGJA 3MU4A 8GCHF 1Z1IA 3KQBA 1GMDG 1MCTA 3A81A 3F9GA 3GDSA 4JK5A 3KCGH 1SGCA 2UUJB 1TX6A 3F9HA 3PMBB 2BB4A 2VIDA 3UUZA 1TE0A 5AVDA 2WPKS 2ZWLH 4AG2A 3ZVEA 2Y82A 2Q6GA 1O3JA 3MNXA 1ZMJA 3TGKE 1EB1H 2A31A 1O2OA 4MPVA 3ZVGA 1ZRBA 4X6OA 3RXLA 4ZUHA 1BBRE 1A46H 1EPTA 3DD2H 4LXBH 1V2OT 2Y5GA 1ANEA 3RXMA 1QHRB 1JRSA 3M5OA 2O8WA 2BDAA 1D6RA 1XVMA 1MZAA 2Y6TA 2C8YB 1O5DH 3BIUH 1C2KA 4IW4E 1RTFB 1UTOA 4X2WA 1TRYA 1L4ZA 1GBMA 1HAYB 1YC0A 3M3SA 3MO9A 2ASUB 1MKXK 3PMAB 4ABGA 3U8OH 5GPIB 3UFAA 1E36B 1ZTKA 2P3FH 2HPQH 2DE8A 2BDBA 2AFQB 2BLQA 1W0YH 5A0BA 3ODDA 1Q3XA 2Z3CA 2VWOA 3M5LA 1DICA 2GZ8A 3QTVH 1QB1A 1XXDA 2AEIH 2D8WA 1MZDA 1WTGH 4YLUA 5ESTE 4OS6A 1WOFA 1AGJA 1HV7A 5TJXA 3SHAH 3RU4T 1RFNA 5EQQA 8ESTE 1SHYA 1H9HE 1H1BA 1YF4A 2FYQA 5E0JA 3BV9B 1AD8H 3MI4A 2OP9A 1DITH 4HZHA 2BYAX 3MMGA 2A4QA 2WYJA 1GBJA 4NA8A 4WVPE 1AKSA 2A4OA 2JH5D 1DANH 1O2SA 1BDAA 1E34B 4BTIB 3A8DA 2Z9JA 4HGCA 4X8SH 1C5VA 4Z0KA 2AGGX 1C1WH 1VCWA 1MCVA 1TX8A 2UUKB 1NRSH 1GI1A 3GY5A 1LDTT 1IQKA 2GKVE 1O3PB 5GCHF 4MDSA 1DFPA 1TRNA 1UJ1A 2ZDNA 1V2QT 1AMHA 1CGIE 1GHXH 3BTFE 2ZPSA 2VH0A 4O97A 1O38A 1YLDA 1O2GH 1HXFH 2J4IA 3UPEA 1QFKH 1GI6A 2H9HA 1TGCA 1C5PA 1B0EA 3SHCH 4GHTA 4ZHAA 1A61H 1LO6A 3FP7E 3M3TA 3SBKA 2ZQ1A 1C5QA 1WQSA 3EA8A 3LGIA 1GI7B 2P59A 1Y5BT 1A5GH 5EPNA 2G00A 1TNIA 1UTNA 1HAVA 5F03A 4YT6H 2BQ6B 1VITH 3SOSA 2ZEBA 4ZKSU 5ETXA 3BG8A 4WMDA 2SGQE 1P57B 1O5EH 3GY4A 2CN0H 4IC6A 2C4FH 5GCHG 1TNLA 3ZZ8A 4XOJA 1DDJA 5CHAC 1C1MA 1Y3VA 1Z8IB 1CGJE 1C1PA 1FY5A 2PKAB 1S85A 3HGPA 5C20A 4OGYA 3P8FA 4GHQA 1YPGH 1AVWA 4RKOB 3UREA 5I25A 2ZDKA 3T2NA 1IQEA 1QCPA 1V2NT 2RDLA 4ESTE 4FUBA 3LGTA 3T62A 1Y8TA 2ZTZA 5AF9H 3A7VA 3MU1A 5K7RA 1MUEB 2ZGXH 4B75A 4AGKA 1BBRK 4DG4A 1GHBF 1G2MA 1BTPA 4FUIA 1G37A 3LJOA 1IAUA 1C5WB 1QJ6B 4K5ZA 3PTBA 2GX4A 1KXDA 3SZNA 1K1JA 1WTHD 1WUNH 2F9VA 4GSOA 1O2PA 1HAXB 1OP0A 2JKHA 4MNXA 1MKXH 3OX7U 4MVNA 1WAYB 4MQAA 1TA2A 2W7SA 4KGAA 3TGIE 1C2EA 3GY8A 2UUYA 1FAKH 3RMOH 4X1RU 1EKBB 1F0UA 2WINI 5L30H 1U6QA 2XBVA 5JBBS 4ZXYH 3JZ1B 3FP6E 1LMWB 2ZECA 3VGCC 1HPGA 1K2I1 2BD3A 3SORA 1SLUB 3Q3YA 2QYIA 3RXIA 1ESBA 3GYLB 3E90B 3TNTA 1YKTA 1NZQH 3U8RH 1O35A 2OCVB 5T3HA 2PGBB 2BOHB 2ZGBH 1MTNB 3TK6A 4JZFH 5EG4A 4D9RA 3RXAA 4A1TA 1LKAA 2ZU5A 2C8ZB 4KTUA 5F8ZA 4ABBA 1UVPA 1BZXE 1RRKA 3DUXH 1OS8A 2LPRA 1QBVH 4CRAA 3UOUA 2FX4A 2ZHFH 4YO9A 1SGTA 2J94A 1N1LA 1B5GH 2VGCC 2VU8E 1RIWB 1UTKA 6ESTA 1GWAA 4QT8C 4ZXXH 1C2DA 2GZ7A 4XFQA 2H5DA 1AU8A 3TIUA 2Z3DA 1UHBA 4X6PA 4O03A 4UEHH 3EA7A 3RP2A 5JB9S 1XKAC 1P06A 4K8BA 4AB9A 1E0FD 4MLFB 5ABWA 2OC0A 1MD8A 4X6MA 3E91A 1FY3A 2STAE 2ZDLA 2V3HH 2Z7FE 2EA3A 3BTTE 5F8TA 2ODYB 1H9IE 1EOLA 1H8DH 1K1OA 1O2QA 1DWEH 5EPYA 4I8LA 3URDA 1ELEE 3NPSA 4MG3A 1TB6H 4Y76A 2BQWB 7GCHF 2QXGA 1RJXB 2ZFTA 3P8GA 1NFWA 4D8NA 3SO3A 4OGXA 3SNDA 2A45B 3GCHC 4DT7B 4I8HA 2BDCA 2F9BH 4YZUA 1E38B 3UTUH 1ELAA 3M61U 1C2FA 4NZLA 4VGCC 1XXFA 3H7TA 1L1GA 3SJKA 4Y0YE 3ZZBA 1FIWA 4E7NA
chains in the Genus database with same CATH superfamily
3LKWA 2QV1A 1LVYA 2C90B 1SGNE 4BTTB 3LGVA 2V3MA 5E0GA 4CHAC 3VXEH 1F0RA 3SU4A 1EUFA 1HB0B 7GCHG 1SQAA 3F68H 1QURH 2FMJA 2K1QA 1K1MA 1ZRKA 1HIAB 2HNTE 1T7CA 1SGFG 5EGMA 4IC5A 1CT0E 2WV5A 2A7JA 4INKA 1AO5A 2BVRH 2FI4E 2HNTF 2RG3A 2XBWA 3KQCA 3QK1A 4RT1A 4AN7A 1VKYA 2I6QA 2PP6A 1O3IA 1TBZH 1FY4A 2C8WB 1O3EA 2K0QA 4WF8A 3MYWA 1MH0A 2Z9GA 3F3BA 2KCOA 5C1UA 3EQ0H 1WU1A 4GVUA 1S83A 1KY9A 1DM4B 3TJOA 1PPCE 2GGVB 3WWFA 4BTUB 5FPSA 4ASHA 2FP7B 4X2YA 4CRFA 1GMHF 1T8LA 2GTBA 4AB8A 3SU3A 3U9AH 2TGTA 2QGRA 3DSPA 5HXFA 3IWMA 1PQ7A 1P09A 1HAHH 2Y7ZA 1C4V2 4Q4LA 5EXNA 2OC8A 3VB5A 1SI5H 3DFJA 4DVAU 1TFXA 3PMJA 4DT4A 1MTSA 2HLDD 3OU0A 3RXGA 3QLPH 3OE7D 1GBEA 1UVTH 1J16A 1ZTLA 3NRLA 1GG6B 2VBCA 2Y5HA 1XUFA 3ESTA 3B8JA 2ZQ2A 3A85A 3K65B 3A8AA 3SZEA 3LOXA 3Q76A 1KDQB 1GMCG 1YPHE 3HKIB 4I8GA 3P8NA 2RA0A 1IQNA 3SJ8A 3RXPA 1EAIA 3ZZ4A 1LQEA 3DHKH 1Z8RA 1CT4E 5EW2H 2UWLA 1SFIA 2WUCA 1GMHG 1BJUA 1OXGA 4Q2KA 2VWNA 1NRNH 1OWIA 3HK3B 1DS2E 3ZZ7A 1O2YA 3BTME 1LPKB 1O3FA 2KAIA 3C1KA 3MH7A 1BQYA 2XCFA 1O5AB 2R3YA 3STIA 1HAPH 3TK5A 1UO6A 3A7TA 3FN8A 1F5RA 4WJG2 3KN2A 2THFB 1K22H 1EPTB 1Y5UT 4DURA 1P2MA 1WBGB 1V2MT 3SN8A 1P2KA 4ZCNA 3SV2H 1NPMA 2ZKSA 1SR5C 1LPZB 3LGYA 1MKWH 4E06H 2WPHS 1EZQA 4K1SA 5A8ZA 3T28A 4JYVH 1EZUC 1L1JA 1YPHC 4Y8YA 1P10A 2A5KA 5GJ4B 3A83A 1YP9A 1P3CA 1V2KT 2BY9X 4RN6A 1GI9B 4WXIA 4CH8B 1YCPH 3PLBA 2R0KA 1ZMNA 3MH5A 4H42U 2OQ5A 2FIRH 3K2UA 1A4WH 2JETC 3PMHB 2XC4A 3EAJA 1O2IA 2AGEX 3SU6A 1V2VT 2R2MB 1GJ7B 3STJA 1V2LT 1N6YA 4FETA 1GBKA 1LTOA 1QTFA 1UVOA 3UNRA 1YWUA 2CF9H 3M37A 3LGUA 3MOCA 4AFQA 1IOEA 2BMGB 4U2WA 1DY9A 2IPHA 2VIPA 1PQ8A 1V2JT 2C93B 3BEFB 5C0TA 3E0PB 3ATLA 4X1SU 1UVSH 2ILNA 2Q6DA 3VB6A 1ARBA 3OEED 3T26A 1QL8A 2GV6A 1KXFA 2ZFFH 4DJZB 1XKBC 2NWNA 1AUJA 3RLWH 1XUGA 3SGQE 4I86A 2XC5A 4X1NU 1VGCB 2VVVA 1AKSB 2HVXA 3OAAD 2ZHEH 1Z6EA 1TNHA 5TCAA 4UFGH 1Y3UA 2KZ4A 1OWEA 5EOKA 1O3LA 1OYTH 3OYPA 4AG1A 4GCHG 1G3EA 1L2EA 1AWHB 1GCTB 1GHAF 1N8OB 1O3DA 2IOTA 4TY6A 4Y6DA 6LPRA 4CRCA 5FHTA 3BEUA 3RXBA 2CV3A 2BY5X 5FL7D 2ESTE 3A84A 1F5LA 1GMDF 1MTUA 1F2SE 1Z8GA 3P70B 2BY8X 1GL0E 3V12A 5A0AE 4WY3A 1Z6JH 1OHHD 2ZFQH 3RXCA 1YLCA 2ZPQA 4OS4A 1JOUB 1GJCB 1GL1A 2LNCA 1O2HA 1GI2A 3L3TA 3LH1A 1EATA 1KTTB 3N99A 4H6TA 4I8KA 1BRCE 3MHWU 4JZIA 2AGIX 4BAOB 3SUFA 1GCDA 3M7QA 2A7CA 3AVZA 4BAHB 1CA0B 1OYQA 3RMMH 5T6GA 1MTNC 1FY1A 1O3KA 1GI8B 2VIWA 2OUAA 4XBDA 3RXOA 3SNBA 4AOQA 2G4TA 1IQLA 1C5MD 4ZHLU 1DE7H 4WH8A 4TWWA 1O3MA 4TWYA 1XUIA 3HGNA 5C17A 3RC4A 3E3TA 2XWAA 4ZAEA 2BLVA 2YMSD 3VXFH 1YY3A 1AN1E 2SGDE 3KL6A 4OS7A 1SVPA 2ZC9H 4AYYB 1C2GA 4PROA 2DUCA 3A7YA 1FN8A 2W6JD 4IMQA 5C5NA 1PYTD 3A80A 1QGFA 1HJ9A 1GBDA 1OWJA 1YPKH 3D65E 3ZVAA 2XCNA 5A8YA 2XRCA 1Y59T 3FZDA 3ZZCA 4JK6A 3T5FH 1V3XA 2ZFPH 1NN6A 3AAUA 1BTUA 1ZHMA 4JZDH 3SUEA 3GYMA 1SGIB 1A5HA 1Q2WA 4THNH 2OBOA 3E0NB 1LKBA 2ZIQH 3EYDA 4INHA 4BANB 4I31A 1BIOA 5FCRA 2V3OH 4A1VA 1SLVB 1QL7A 1NRRH 1SQOA 3VB7A 3FANA 1BB0B 2P8OB 2VNTA 4AC9A 3S7HB 3SUGA 1LPGB 2ZGHA 2NU1E 4UE7H 2SGFE 1FONA 1UW7A 2QXJA 5CHBA 2V7QD 3CS7A 2VWLA 1P03A 1NROH 2HPPH 2BOKA 5BPEA 1GDUA 2AS9A 5A0CA 1AVXA 4RSPA 1XUKA 3V3MA 3UNSA 3KQDA 2RA3A 5IYTA 2P3TB 1W0ZU 1GDQA 3DA9B 5JBTA 3RXRA 4TPIZ 2I6SA 2BHGA 1SHHB 1A7SA 2GZ9A 3BTEE 1CBWC 2FI5E 3UWIA 5FX5A 3SV8A 5FBEA 1BHXB 1LCYA 3SJOA 3EE0B 3LDXH 3PTNA 3H09A 4DY7B 3GY3A 3AK5A 1O2ZA 2RCEA 2FOFA 1PPZA 1WDIA 1Z1JA 2YMSC 3RM0H 4FUHA 1O2JA 2BLOA 1ETSH 1T4VH 2KCAA 3V13A 1SC8U 1D3PB 1DOJA 1MAXA 4Q7ZA 1PYTC 4IS5A 3GY6A 1ELCA 1EAXA 1EJMA 1TPAE 1QJ7B 5DP9A 1O37A 1S82A 2OQUA 4O3UA 2WPIS 4RT0A 1GHYH 5GXPA 2JIZD 1KLJH 4JYTA 3QZQA 3UIRA 5C94A 1XX9A 3BTDE 3ZZ5A 1K1IA 1GI5A 5EJ1A 4XBCA 1GJ4H 4XDEA 5LPEA 3RXEA 1QRZA 1TRMA 1K1PA 1YPEH 2FX6A 3TGJE 1HAOH 1SSXA 3QGNB 2FS9A 1PPHE 1AWFH 3T29A 3U1JB 1C1UH 3MQKC 2ZCLP 1GG6C 2VVUA 4YTAA 4CR5A 2J2UA 3M7UA 1T8MA 4WH6A 1EASA 2GDEH 2PGQB 1YBWA 1TMUH 3PROA 4Y0ZE 4NIWA 2R3UA 3LC3A 1TMTH 3PRBA 4HTCH 3E6PH 2FOCA 4AFZA 1NS3A 4U01A 3BTWE 1MQ5A 4GPGA 1EJNA 3TH4H 2WV4A 2W6ID 7LPRA 2WSSD 1EZSC 2J95A 4B1TA 2O9QA 3FOAA 2G52A 1TPPA 1UTQA 2V0BA 1ZSKA 3RXDA 4KP0A 1MBMA 3E1XB 4GLYA 4BAQB 1UTMA 1C5XB 2OC7A 1EPTC 3FO8D 1K21H 4X8UH 2J98A 3GDVA 1IQJA 2ZDMA 5HM9A 1AE8H 3I77A 3BTKE 1IQIA 4DIIH 3A8CA 3ZYDA 1CVWH 2F9UA 1H4WA 4Q7XA 4R8TB 1PPGE 2KCPA 3MH4A 1C1OA 3VEQB 4DW2U 1UTLM 4B74A 1K1LA 1GBIA 1V2WT 4SGBE 1ANDA 4XRNA 2ANWA 2IJD1 1J9CH 4NWLA 3PYHA 4ABAA 5BRRE 5CMXH 5IDKA 5JDUB 3FZZA 3RXSA 1ESTA 5DP8A 1GBBA 3P6ZB 3MU0A 4NIVA 2ZFSA 1LVOA 1YPLH 3QN7A 1D3QB 3RXJA 1ZPBA 1EP5A 5ESBA 2XW9A 1Y3YA 3G01A 4F4OC 1C5UA 1KTSB 4YOIA 1K1NA 1IHSH 1BOQA 1ZLRA 5FXLA 1O3GA 1EJAA 1S84A 2V35A 4ZHMU 3RXQA 4B2CA 1ZZZA 5JBAS 5EODA 3BF6H 5DGJA 1SGQE 1ZYOA 2XTTB 2ZZUH 1W7GH 4Y11E 1C2LA 1OWKA 1MU6B 1W7XH 9LPRA 3A7WA 4BXWA 1PPEE 1AQ7A 1ZPZA 1HNEE 2BDYA 2BD4A 3LC5A 4NA7A 1DUAA 1VGCC 3UR6A 1VJAU 1XUJA 4JMYA 3SV9A 3PO1B 3FFGA 1SGEE 1S6HA 2ZNKH 1LHEH 2KAIB 1C1SA 1L4DA 1GJ6A 2B7DH 3SGBE 5F53A 2QC2A 3H5CB 2JH6D 3QTOH 5FX6A 3NKKA 1O3AA 1GCTC 1N8OC 4ZKRU 2EI8A 3P8OA 2SGPE 1CHOG 5C1XA 5LGOA 1BRAA 5C5OA 1QBNA 1J8AA 1O3OA 3GCOA 3UB0A 2PW8H 2ZGCA 1MD7A 1TBQH 5DJ7A 3OSYA 5GWZA 1P2IA 2FWWA 2FODA 1BTYA 1ELDE 1ARCA 2GVFA 2ZCHP 1P2OA 3DT0H 3SNCA 4ABEA 1ANCA 2A2XH 1MBQA 3KQ5A 2BD8A 2OD3B 1MKWK 2GCTB 3ELAH 3SI3H 1MU8B 2BX4A 2FS8A 1CA0C 3BG4B 4MNWA 1GVKB 3B23B 4NZQA 4X1QU 2CHAB 2Z9IA 1TIOA 1O31A 2YNAA 3OEHD 3NZIA 4A92A 1YCPK 1B7XB 3UOPA 2B0FA 3SGAE 1QY6A 1WSSH 3BIVH 3K6ZA 4P02A 3NXPA 4Q63A 1NT1A 4X2XA 3DFLA 3SW2B 2D26C 1GBLA 1O3BA 1AFQB 2ZU4A 2F9OA 1NFXA 4TT3D 2ALVA 4YT7H 4DCDA 1K28D 1RGQA 1P2QA 3C27B 1ZTJA 1TX7A 3SJIA 3UWJH 3GCNA 1NRPH 3OTPA 3SU1A 4CREA 4FUEA 2WPDD 1W2KH 1NTPA 3MWIU 2IJOB 1OWHA 1C5YB 3A86A 1TPSA 3BTGE 1RXPA 4MNVA 3UY9A 4ZH8A 1GI3A 4GUXA 1EXFA 2TGDA 1SLXB 4B6EA 2PKAA 6GCHG 1YPMH 4B71A 2WPMS 1ELGA 1Z7KA 3A7XA 1GJ9B 1TAWA 1GBCA 1UCYE 1O5BB 2PSYA 3AASA 5E8EH 1DWDH 1S5SA 4Y71A 5DKMA 2D2DA 3E16B 4BNRA 1GMCF 4KTCA 3P95A 2V6NA 3TVJB 2WV9A 4I32A 3BN9A 1Y3WA 1SGPE 1T8OA 2P8OC 1TPOA 2TIOA 3TJVA 5DSFA 1C1NA 4R0IA 1THRH 3VG8A 1ZGVA 2ZI2H 3TITA 2WPLS 1CQQA 1JIMA 1O30A 4UDWH 3ODFA 5E2OA 2HALA 1H9LB 3RXFA 4WXVA 2H6MA 4E05H 2BD2A 3ITIA 3N7EA 2ZTXA 3RLYH 2WHXA 2ZFRH 1AVGH 3TH2H 1UTJA 1GI4A 3H7OA 2HWLB 1OOKB 1O2KA 2A4GA 2ZHDA 1SGRE 1ZGIA 1KSNA 3PLPA 2L74A 2OLGA 1ANBA 1TA6A 2H1UA 1S6FA 1KIGH 2BQ7B 2P3UB 4NG9H 4D7FA 3KIDU 3FP8E 2JH0D 4J2YB 5DO4H 5DN6D 1J14A 2VINA 3L6PA 3RXVA 3RC6A 2NU2E 4Q80A 3U69H 1G36A 4NIXA 1MTVA 4LZ1H 1NESE 5DP7A 4NSVA 1WCZA 1UK4A 2GMTB 2Y80A 1EZXC 3PWBA 1HXEH 2WYGA 3QUMP 1LHDH 2ZDAH 4AORA 4NIYA 5IK2D 1C4U2 1A0JA 2ZG0H 1HJAB 4NSYA 4RKJB 2QAAA 4TYDA 2HGTH 4LZ4B 1T31A 1GJAB 2G4UA 1HBTH 1OWDA 2ZDVH 2CGAA 1MTWA 2HOBA 3TPIZ 1PFXC 3S9CA 1BITA 1THPB 1H8HD 1ZR0A 2P95A 1DVAH 1GJDB 1EFRD 4ZKNU 2GD4B 4OS1A 1THSH 4CR9A 1O3NA 1W0JD 2B5TB 1FI8A 3ATMA 3GDUA 4YESB 2F91A 1FNIA 5JBCS 3SQHE 4CBNA 1C2HA 1EB2A 1O3HA 2ALPA 3VB3A 4GCHF 4RI0A 1TYNA 1DLKB 4YOJA 2J38A 2ZO3H 1A3BH 1SG8B 4AYVB 1J17T 1BRBE 2EI6A 1BJVA 1YLNA 1O2TA 1V2UT 3OTJE 1VITG 2KFWA 3EA9A 3HPTB 3SU0A 3NUMA 3W94A 1C5OH 1LHGH 1SPJA 1F0TA 2JJ2D 1YYY1 4INLA 1D6WA 3S7KB 2PLXA 3MU5A 1P9UA 2UWPA 2PFEA 2VIVA 4I8JA 4AX9H 1CU1A 4UFFH 1BMNH 1TQ0B 1VJ9U 2NU3E 1WYKA 3W95A 2EQNA 1HAZB 1JBUH 3BSQA 3VPKA 5HIYA 5EQSA 1ABIH 1NU7B 8KME2 1DPOA 2B8OH 3ZVBA 1IHTH 2Z6BD 3M5MA 4TSFD 5CE1A 4Q7YA 3ZZ6A 2H5CA 1TOMH 1UCYK 2TBSA 1C5TA 1C4Y2 2JJ1D 3T25A 1S6LA 1OP2A 2BDGA 3GCTG 1C1QA 2WZQA 3KF2A 1TGTA 2PSXA 1ESAA 3RC5A 2STBE 4D76A 1SL3A 2VIQA 1PQ5A 2SNVA 1CSOE 7ESTE 5I46H 3KYFA 1DT2A 1YM0A 4NGAH 5C67A 2FOHA 3KEEA 1PPBH 4F49A 2F9NA 2XBYA 2QA9E 3KHVA 5DP6A 2QCYA 1VCPA 2PHBA 2BY7X 2FOMB 1H8IH 1G30B 1L0ZA 3SJ9A 3WY8A 1KLTA 1NFUA 1QL9A 4AFUA 4UD9H 1HAVB 3LJJA 4M9FA 1CO7E 4A5TS 4WMFA 1A0HB 1WQVH 1AZ8A 2J5UA 3NWUA 3S9AA 1O39A 2GDDA 1KXBA 2XYAA 1DXWA 3CS0A 1P02A 2M2AA 2XBXA 1B0FA 3PO1C 4ZROA 1RIWC 4KKDA 1AFEH 1FQ3A 4HFPB 2G5VA 4FUGA 3MNSA 1BTXA 1O2RA 2BM2A 5FCKA 2J34A 2F43B 5A8XA 2EI7A 3PWCA 3T27A 3AW1A 1ABJH 3AW0A 3U1IB 5B6OA 1C5RA 1KDQA 1TOCB 2W26A 3QO6A 2J98B 4I33A 3FVFB 1UK3A 1MAYA 1TNGA 1W10U 1KXAA 5EXLA 4X1PU 3N7OA 2TGPZ 4VGCB 1DLEA 5HM2A 2BD9A 2WUBA 4YM9A 1QBOA 1O2VA 4P00A 5K0HA 1KLIH 5F6MA 1O2UA 1C5SA 4CHAB 1TMBH 1CE5A 1FY8E 3RMNH 3GOVB 1QRWA 2A0QB 4B76A 1YGCH 1SMFE 4M7GA 2ODQA 2GCTC 3SU5A 3LIWA 1DUEA 3GS9A 3BG4C 2QF0A 2AYWA 5A2MH 2P93A 1FPCH 2W7UA 2CHAC 4Y10E 3PM3A 1ZHRA 2PWXA 3W1EA 2FYRA 4X8TH 3Q3XA 1OSSA 2G8TA 1DXPA 3IITA 1TNKA 1HAIH 2FPZA 8GCHG 3LGWA 1KMHB 1C1RA 4ZKOU 5LH8A 1ZSLA 1V6DA 1AFQC 2A32A 2BZAA 3QZRA 2H9EH 2QN5T 1E35B 2KM0A 1SGDE 2BXUH 3F9FA 1HFDA 1HGTH 1V2RT 2VB0A 2UUFB 1E1QD 1W8BH 3M35A 4WMEA 3B9FH 5KGOA 2EEKA 5CDFE 3MU8A 3O8BA 5T1VA 4NA9H 1P9SA 1JMOH 1RTKA 1N6XA 4BAKB 3KYGA 5TCCA 3L33A 4H6SB 3SU2A 3VFEA 1A0LA 2OTVA 2R2WU 4X0WU 1DSTA 1A3EH 2FZZA 4WWYA 1O2MA 2GT7A 8LPRA 2FTMA 1UCYH 2NU0E 3EDXB 2GCHF 1BTZA 2BDIA 1GJ5H 1NC6A 4I7YH 3PLKA 5DK1A 5EXMA 5C1YA 1MMJN 1UHBB 1FMGA 3ATIA 2LELA 4K2YA 5SGAE 4FUJA 2W3IA 5DP5A 3F9EA 1BCUH 5FAHA 2OBQA 2OC1A 4JCNA 1S0QA 2A5IA 1S0RA 4YOGA 2K8IA 3PV4A 1D4PB 3MNCA 2BD7A 4ISOA 2FI3E 4AFSA 2FDAA 3RXHA 1E37B 1DSUA 2FOGA 2H2ZA 1BMAA 2BVXH 1HDTH 4Y8ZA 5B6LA 5G4BA 3ZVFA 5EQRA 1FJSA 1GJBB 4ISIH 2P16A 2PKSB 2FTLE 2Z9LA 2VIOA 2Q1JA 2M5TA 1BA8B 2G55A 3I29A 5PTPA 2GCHG 3RM2H 1AZZA 1SGYE 2CJIA 1ZJKA 4IN2A 4BOHA 3RXTA 4J1YA 4MPXA 1BMMH 1T8NA 1FLEE 3ZIAD 2BD5A 3F1SB 2SGEE 3A89A 3ATWA 1BTHH 4D9QA 1BMLA 1G2LA 2AH4X 2SNWA 4BXSA 3GY2A 1O2WA 2B9LA 4FVBA 2CF8H 1NM6A 5EIYA 5C3NA 4XE4A 3M3VA 3OY6U 4CH2B 3EGKH 3TK9A 4F48B 2A2QH 2O8UA 4LOYH 4FUDA 2JETB 1AB9B 1P01A 1ZPCA 2GMTC 1LHCH 1O32A 3SNEA 1W0KD 4XBBA 4FUFA 3RUOA 4U32A 1IQMA 1SLWB 1ELVA 1YCPM 1HLTH 1C1TA 4NFEA 2TRMA 4OS5A 4O9VA 4CRBA 3MNBA 1HJAC 3JZ2B 3TJUA 1Y5AT 2VWMA 2Y7XA 1O2NA 4XD7D 3TJNA 4FXGH 1P12E 1ZJDA 4Z1MD 2AERH 3A8BA 1O0DH 2VVCA 3UR9A 4B6FA 1IQGA 3QDZB 1W11U 1CA8B 3OY5U 1SGFA 1GDNA 3RMLH 4ISHH 1O34A 1NRQH 5FPYA 3GISB 3S9BA 1EQ9A 1JRTA 1EP6A 5GIBA 1OX1A 2PTNA 1ZMLA 1RD3B 3PB1E 2GP9B 4TY7A 1W14U 1G3DA 2BY6X 4CBOA 1TALA 4X2VA 3ZYEA 1CHGA 1Y3XA 2ZTYA 1CHOF 5HKKD 3LPRA 1TABE 1KXEA 1KYNA 1QNJA 1UVUH 5AHGH 2ZHWH 1P11E 4K1EA 1IQFA 6CHAB 2ZF0H 1ZHPA 1ACBE 2R9PA 4ABFA 3RDZA 1TWXB 5KEDA 1YPJH 1GVZA 2XNDD 4SGAE 1SFQB 1BUIA 3A88A 2HRVA 3BTHE 2PV9B 1TQ7B 3TU7H 4JZEH 1GHBG 2ZA5A 5T6FA 1C2MA 2QY0B 1C5ZB 2ZCKP 1G32B 1W3CA 3LH3A 3S0NA 1HJ8A 1P04A 1VCQA 3D62A 3K6YA 3ZZAA 1JIRA 5JYIA 3A82A 4K8YA 2ANKH 1GGDB 1TNJA 1C9PA 1J15A 3ENSB 3GY7A 1C2IA 2AIPA 3Q3KA 4HG6A 2F83A 4LK4A 3RU4D 1FDPA 1D3TB 1FV9A 2O8LA 4UFDH 1P8VC 5E2PA 2G81E 3ZZDA 1M9UA 3SNAA 5KECA 2VH6A 3CENA 1EOJA 1P3EA 1GHZA 4X8VH 1OP8A 2AMQA 5JPMH 1MQ6A 1HAGE 2ANYA 3N7DA 1GI0A 1TGNA 1PQAA 4K1TA 1FIZA 4DOQA 2F9PA 1O33A 1FAXA 2BDHA 1MABB 2PTCE 3U98H 4H4FA 3HATH 3QGJA 5A09A 6GCHF 3MFJA 1FX0B 3WW7A 3ZVDA 2A1DB 1GBAA 1G9IE 3K9XB 3EE7A 1GBTA 1GJ8B 4ABDA 3O8DA 2A5AA 1PJPA 4FU9A 1P2JA 4KELA 5DP3A 1C5NH 1JXPA 3RU4E 3NCLA 4JYUH 3AAVA 4Z6AH 4ZMAH 5L2YH 1G3CA 1EAUA 1GBHA 2FESH 2O8TA 1Q31A 2HVYB 5L6NH 4OS2A 3F6UH 1BTWA 5FBIA 1QJ1B 3FKSD 2FM2A 1UMAH 3UNQA 1LHFH 2BVSH 1QQUA 1DX5M 1GVLA 1QA7A 1W13U 1X7AC 3U8TH 1QRXA 3MH6A 2NU4E 1QB9A 4K60A 4A1XA 5GDSH 1ORFA 2QIQA 1ELFA 2DE9A 4Y79A 1INCA 4NWKA 3TNSA 2XC0A 3PV2A 3KNXA 2ZP0H 2OXSA 1EAWA 2Z9KA 3I78A 1O5FH 1CBWB 5C2ZA 1BBRH 4UFEH 2BZ6H 3DSOA 2C8XB 1AHTH 1LQDB 3HKJB 1DWBH 2CXVA 3FAOA 3ATKA 1O36A 1BHXF 3V0XA 1WV7H 2XOKD 4MPUA 3VB4A 3O8CA 2QXHA 1FUJA 4E7RG 2YMSB 2BXTH 4BAMB 2C3SA 1NU9A 2FLBH 4MNYA 1VR1H 1SQRA 3URCA 4B2AA 2R0LA 3D23A 4ABJA 5HGGA 4D7GA 1NFYA 5L2ZH 3MO6A 3SV7A 1Z71A 1GBFA 1GHWH 5HYOA 5LPFA 3M7TA 2A4RA 4AGJA 4FU8A 3ZZ9A 1OKXA 5HIZA 3OFND 3SV6A 1XUHA 2W5EA 1NY22 3RXKA 5AFZH 1V2PT 7KMEH 4HI3A 2ANMH 2ZU3A 1IQHA 4XSKU 4FOUC 4IBLH 3MO3A 2RFKC 1SQTA 1V2ST 1HUTH 2PUXB 1FXYA 2G5NA 2Y5FA 1BT7A 4FU7A 5FPTA 2OK5A 2H9TH 4ISNA 4K69A 4GAWA 1P05A 5DPAA 4Y7BA 1FN6A 3Q00A 2Y81A 4MPWA 2HNTC 1AIXH 1FPHH 3UQOA 2TGAA 2UWOA 1C9TA 1ETTH 2AIQA 2FLRH 4ACBA 3P17H 2P94A 4NCYA 3QWCH 1GPZA 2IN2A 1F0SA 1XMNB 1SBWA 1K9OE 1A5IA 1GHVH 2BTCE 1D3DB 1RTLA 1DY8A 2ULLA 3D49H 1LVBA 2W3KA 4IMZA 2SGAA 2XNIA 2XXLA 1HRTH 4TPYA 5CHAB 1C5LH 2WPJS 3R3GB 1AUTC 1SOTA 4B73A 3UQVA 4JZ1A 1VITF 3SI4H 4A7IB 1JWTA 1O2XA 1OPHB 3BEIB 2PKSC 5HMAA 1CGHA 3LONA 4DGJA 4AZ2B 3M36A 2XWBI 4Y8XA 5F8XA 9ESTA 2Z3EA 1KXCA 3SQEE 3KQEA 2VJ1A 1FZZA 5GNDA 2PR3A 1AE5A 1QIXB 1HYLA 5EU8A 2KCYA 2EC9H 1UTPA 2AMPA 1NBMD 4YLQH 5DP4A 5DG6A 1D9IA 2OINA 1Z8JB 2HLCA 1BRUP 1QA0A 2BLWA 3QX5H 5JB8S 1NO9H 1O5GH 5J4SA 2AMDA 2YNBA 5T6DA 3M5NA 1BMFD 1SOZA 4U30A 3GCTF 1QR3E 2GV7A 4B2BA 4FUCA 2D1JA 1LVMA 3GICB 1WXRA 4NFFA 1AB9C 3MTYA 2ZPRA 1T4UH 2FXRA 4ABHA 1L1NA 3SUDA 1TGSZ 1T32A 1C1VH 1A2CH 5AFYH 3VGCB 2QXIA 3ZV9A 1ETRH 1P0SH 2CMYA 2G51A 3NK8A 4KTSA 2F3CE 1TONA 3TH3H 1EX3A 3RXUA 5E0HA 1QQ4A 1W12U 1HCGA 2QF3A 1O3CA 1ELBA 2GT8A 1NBME 1F7ZA 2YOLA 5J4QA 3PV5A 1ZOMA 3ZZ3A 1F5KU 3SYJA 1TGBA 3ZVCA 2O8MA 2Z94A 1COWD 3LT3A 2ZU1A 5EW1H 1SKYE 4MTBA 1PPFE 3A87A 1AY6H 1F92A 1AI8H 2SFAA 3V7TA 1VZQH 1HIAA 1QB6A 3S69A 2ZHQH 3U28C 2J9NA 2VGCB 3DCLA 1RS0A 1ELTA 2ZU2A 1UK2A 3O8RA 4A6LA 2FOEA 4IN1A 3IG6B 4Y7AA 4CRGA 4O3TA 1C2JA 3F2GA 3KGPA 1ID5H 4ABIA 3P92A 3E8LA 1S81A 3LU9B 2FOBA 1V2TT 2ODPA 1XM1A 5LPRA 1O2LA 1TLDA 4CRDA 1P2NA 2BX3A 2J92A 1TBRH 4FVDA 3HK6B 6CHAC 4IGDA 4UONA 2PUQH 1K0HA 4ISLA 1G3BA 1CT2E 4K3JA 3BTQE 3CP7A 5H4IB 3TLOA 3ZV8A 4DIHH 2FEQH 2A7HA 1A1RA 1ZSJA 1DWCH 3Q77A 2FO9A 1SB1H 2TPIZ 2Q6FA 1GGDC 1GHAG 2FOAA 3GCHB 2KX4A 1XVOA 4X6NA 3A7ZA 1O5CB 3R0FA 2ZGJA 3MU4A 3DSGA 8GCHF 5C0UA 1Z1IA 3KQBA 1GMDG 1MCTA 3A81A 3F9GA 3GDSA 4YXWD 4JK5A 2J97A 3KCGH 1SGCA 2UUJB 1TX6A 3F9HA 3PMBB 2BB4A 2VIDA 3UUZA 1TE0A 5AVDA 2WPKS 2ZWLH 4AG2A 3ZVEA 2Y82A 2Q6GA 1O3JA 3MNXA 1ZMJA 3TGKE 1EB1H 2A31A 1O2OA 4MPVA 3ZVGA 1ZRBA 4X6OA 3RXLA 4ZUHA 1BBRE 1A46H 1EPTA 3DD2H 4LXBH 1V2OT 2Y5GA 1ANEA 3UAIC 3RXMA 1QHRB 1JRSA 3M5OA 2O8WA 2BDAA 1D6RA 1XVMA 1MZAA 2Y6TA 2C8YB 1O5DH 3BIUH 1C2KA 4IW4E 1RTFB 1UTOA 4X2WA 1TRYA 1L4ZA 1GBMA 1HAYB 1YC0A 3M3SA 3MO9A 2ASUB 1MKXK 3PMAB 4ABGA 3U8OH 5GPIB 3UFAA 4ASUD 1E36B 1ZTKA 2P3FH 2HPQH 2DE8A 2BDBA 2AFQB 2BLQA 1W0YH 2JDID 5A0BA 3ODDA 1Q3XA 2Z3CA 2VWOA 2RDEA 3M5LA 1DICA 2GZ8A 3QTVH 1QB1A 1XXDA 3WWBA 2AEIH 2D8WA 1MZDA 1WTGH 4YLUA 5ESTE 4OS6A 1WOFA 1AGJA 1HV7A 5TJXA 3SHAH 3RU4T 1RFNA 5EQQA 8ESTE 1SHYA 1H9HE 1H1BA 3F0PA 1YF4A 2FYQA 5E0JA 3BV9B 1AD8H 3MI4A 2OP9A 1DITH 4HZHA 2BYAX 3MMGA 2A4QA 5EJLA 2WYJA 1GBJA 4NA8A 4WVPE 1AKSA 2A4OA 2JH5D 1DANH 2EY4C 1O2SA 1BDAA 1E34B 4BTIB 3A8DA 2Z9JA 4HGCA 4X8SH 1C5VA 4Z0KA 2AGGX 1C1WH 1VCWA 1MCVA 1TX8A 2UUKB 1NRSH 1GI1A 3GY5A 1LDTT 1IQKA 2GKVE 1O3PB 5GCHF 4MDSA 1DFPA 1TRNA 1UJ1A 2ZDNA 1V2QT 1AMHA 1CGIE 1QZ8A 1GHXH 3BTFE 2ZPSA 2VH0A 4O97A 1O38A 3F0OA 1YLDA 1O2GH 1HXFH 2J4IA 2CK3D 3UPEA 1QFKH 1GI6A 2H9HA 1TGCA 1C5PA 1B0EA 3SHCH 4GHTA 4ZHAA 1A61H 1LO6A 3FP7E 3M3TA 3SBKA 2ZQ1A 2KR7A 1C5QA 1WQSA 3EA8A 3LGIA 1GI7B 2P59A 1Y5BT 1A5GH 5EPNA 2G00A 1TNIA 1UTNA 1HAVA 2L6OA 5F03A 4YT6H 2BQ6B 1VITH 3SOSA 2ZEBA 4ZKSU 5ETXA 3BG8A 1E1RD 4WMDA 2SGQE 1P57B 1O5EH 3GY4A 2CN0H 4IC6A 2C4FH 5GCHG 1TNLA 3ZZ8A 4XOJA 1DDJA 5CHAC 1C1MA 1Y3VA 1Z8IB 1CGJE 1C1PA 1FY5A 2PKAB 1S85A 3HGPA 5C20A 4OGYA 3P8FA 4GHQA 2QE7D 1YPGH 1AVWA 4RKOB 3UREA 5I25A 2ZDKA 2IPQX 1IQEA 3T2NA 1QCPA 1V2NT 2RDLA 4ESTE 4FUBA 3LGTA 3T62A 1Y8TA 2ZTZA 5AF9H 3A7VA 3MU1A 5K7RA 4ACAA 1MUEB 2ZGXH 4B75A 4AGKA 1BBRK 4DG4A 1GHBF 1G2MA 1BTPA 4FUIA 1G37A 3LJOA 1IAUA 1C5WB 1QJ6B 4K5ZA 3PTBA 2GX4A 1KXDA 3SZNA 1K1JA 1WTHD 1WUNH 2F9VA 4GSOA 1O2PA 1HAXB 1OP0A 2JKHA 4MNXA 1MKXH 3OX7U 4MVNA 1WAYB 4MQAA 1TA2A 2W7SA 4KGAA 3TGIE 1C2EA 3GY8A 2UUYA 1FAKH 2AHME 3RMOH 3CNRA 4X1RU 1EKBB 1F0UA 2WINI 5L30H 4OM9A 1U6QA 2XBVA 5JBBS 4ZXYH 3JZ1B 3FP6E 5EJZA 1LMWB 2ZECA 3VGCC 1HPGA 1K2I1 2BD3A 3SORA 2GJGA 1SLUB 3Q3YA 2QYIA 3RXIA 1ESBA 3GYLB 3E90B 3TNTA 1YKTA 1NZQH 3U8RH 1O35A 2OCVB 5T3HA 2PGBB 2BOHB 2ZGBH 1H8ED 1MTNB 3TK6A 4JZFH 5EG4A 4D9RA 4F55A 3RXAA 4A1TA 1LKAA 3F2FA 2ZU5A 3F2HA 2C8ZB 2QF5A 4KTUA 5F8ZA 4ABBA 1UVPA 1BZXE 1RRKA 2QF4A 3DUXH 1OS8A 2LPRA 1QBVH 4CRAA 3UOUA 2FX4A 2ZHFH 4YO9A 1SGTA 2J94A 1N1LA 1B5GH 2VGCC 2VU8E 1RIWB 1UTKA 6ESTA 1GWAA 4QT8C 4ZXXH 1C2DA 2GZ7A 4XFQA 2H5DA 1AU8A 3TIUA 2Z3DA 1UHBA 4X6PA 4O03A 4UEHH 3EA7A 3RP2A 5JB9S 1XKAC 1P06A 4K8BA 4AB9A 1E0FD 4MLFB 5ABWA 2OC0A 1MD8A 4X6MA 3E91A 1FY3A 2F4LA 2STAE 2ZDLA 2V3HH 2Z7FE 2EA3A 3BTTE 5F8TA 2ODYB 1H9IE 3PRDA 1EOLA 1H8DH 1K1OA 1O2QA 1DWEH 5EPYA 4I8LA 3URDA 1ELEE 3NPSA 1E79D 1TB6H 4MG3A 4Y76A 2BQWB 7GCHF 2QXGA 1RJXB 2ZFTA 3P8GA 1NFWA 4D8NA 3SO3A 4OGXA 3SNDA 2A45B 3GCHC 4DT7B 4I8HA 2BDCA 2F9BH 4YZUA 1E38B 3UTUH 1ELAA 3M61U 1C2FA 2LP6A 4NZLA 4VGCC 1XXFA 3H7TA 1L1GA 3SJKA 4Y0YE 3ZZBA 1FIWA 4E7NA
chains in the Genus database with same CATH topology
3LKWA 2QV1A 1LVYA 2C90B 1SGNE 4BTTB 3LGVA 5E0GA 4CHAC 3VXEH 1F0RA 3SU4A 1EUFA 1HB0B 7GCHG 1SQAA 3F68H 1QURH 2FMJA 2K1QA 1K1MA 1ZRKA 1HIAB 2HNTE 1T7CA 1SGFG 5EGMA 4IC5A 1CT0E 2WV5A 2A7JA 4INKA 1AO5A 2BVRH 2FI4E 2HNTF 2RG3A 2XBWA 3KQCA 3QK1A 4AN7A 2I6QA 1O3IA 1TBZH 1FY4A 2C8WB 1O3EA 4WF8A 3MYWA 1MH0A 2Z9GA 5C1UA 3EQ0H 1WU1A 4GVUA 1S83A 1KY9A 1DM4B 3TJOA 1PPCE 2GGVB 4BTUB 5FPSA 4ASHA 2FP7B 4X2YA 4CRFA 1GMHF 1T8LA 2GTBA 4AB8A 3SU3A 3U9AH 2TGTA 2QGRA 5HXFA 3IWMA 1PQ7A 1P09A 1HAHH 2Y7ZA 1C4V2 5EXNA 3VB5A 2OC8A 1SI5H 3DFJA 4DVAU 1TFXA 3PMJA 1MTSA 3OU0A 3RXGA 3QLPH 1GBEA 1UVTH 1J16A 1ZTLA 1GG6B 2Y5HA 1XUFA 3ESTA 3B8JA 2ZQ2A 3A85A 3K65B 3A8AA 3LOXA 3Q76A 1KDQB 1GMCG 1YPHE 3HKIB 4I8GA 3P8NA 2RA0A 1IQNA 3SJ8A 3RXPA 1EAIA 3ZZ4A 1LQEA 3DHKH 1Z8RA 1CT4E 5EW2H 2UWLA 1SFIA 2WUCA 1GMHG 1BJUA 1OXGA 4Q2KA 2VWNA 1NRNH 1OWIA 3HK3B 1DS2E 3ZZ7A 1O2YA 3BTME 1LPKB 1O3FA 2KAIA 3C1KA 3MH7A 1BQYA 2XCFA 1O5AB 2R3YA 3STIA 1HAPH 3TK5A 1UO6A 3A7TA 1F5RA 4WJG2 3KN2A 2THFB 1K22H 1EPTB 1Y5UT 4DURA 1P2MA 1WBGB 1V2MT 3SN8A 1P2KA 3SV2H 1NPMA 2ZKSA 1SR5C 1LPZB 3LGYA 1MKWH 4E06H 2WPHS 1EZQA 4K1SA 5A8ZA 3T28A 4JYVH 1EZUC 1L1JA 1YPHC 4Y8YA 1P10A 2A5KA 5GJ4B 3A83A 1YP9A 1P3CA 1V2KT 2BY9X 4RN6A 1GI9B 4WXIA 4CH8B 1YCPH 3PLBA 2R0KA 1ZMNA 3MH5A 4H42U 2OQ5A 2FIRH 3K2UA 1A4WH 2JETC 3PMHB 2XC4A 3EAJA 1O2IA 2AGEX 3SU6A 1V2VT 2R2MB 1GJ7B 3STJA 1V2LT 1N6YA 1GBKA 1LTOA 1QTFA 1UVOA 3UNRA 2CF9H 3M37A 3LGUA 3MOCA 4AFQA 1IOEA 2BMGB 4U2WA 1DY9A 2IPHA 2VIPA 1PQ8A 1V2JT 2C93B 3BEFB 3E0PB 3ATLA 4X1SU 1UVSH 2ILNA 2Q6DA 3VB6A 1ARBA 3T26A 1QL8A 2GV6A 1KXFA 2ZFFH 4DJZB 1XKBC 2NWNA 1AUJA 3RLWH 1XUGA 3SGQE 2XC5A 4X1NU 1VGCB 2VVVA 1AKSB 2HVXA 2ZHEH 1Z6EA 1TNHA 5TCAA 4UFGH 1Y3UA 5EOKA 1OWEA 1O3LA 1OYTH 3OYPA 4AG1A 4GCHG 1G3EA 1L2EA 1AWHB 1GCTB 1GHAF 1N8OB 1O3DA 2IOTA 4TY6A 4Y6DA 6LPRA 4CRCA 5FHTA 3BEUA 3RXBA 2CV3A 2BY5X 2ESTE 3A84A 1F5LA 1GMDF 1MTUA 1F2SE 1Z8GA 3P70B 2BY8X 1GL0E 3V12A 5A0AE 4WY3A 1Z6JH 2ZFQH 3RXCA 1YLCA 2ZPQA 4OS4A 1JOUB 1GJCB 1GL1A 2LNCA 1O2HA 1GI2A 3L3TA 3LH1A 1EATA 1KTTB 4H6TA 4I8KA 1BRCE 3MHWU 4JZIA 2AGIX 4BAOB 3SUFA 1GCDA 3M7QA 2A7CA 3AVZA 4BAHB 1CA0B 1OYQA 3RMMH 5T6GA 1MTNC 1FY1A 1O3KA 1GI8B 2VIWA 2OUAA 4XBDA 3RXOA 3SNBA 4AOQA 2G4TA 1IQLA 1C5MD 4ZHLU 1DE7H 4WH8A 4TWWA 1O3MA 4TWYA 1XUIA 3HGNA 3RC4A 3E3TA 2XWAA 4ZAEA 2BLVA 3VXFH 4OS7A 1AN1E 2SGDE 3KL6A 1SVPA 2ZC9H 4AYYB 1C2GA 4PROA 2DUCA 3A7YA 1FN8A 4IMQA 5C5NA 1PYTD 3A80A 1QGFA 1HJ9A 1GBDA 1OWJA 1YPKH 3D65E 3ZVAA 2XCNA 5A8YA 2XRCA 1Y59T 3FZDA 3ZZCA 4JK6A 3T5FH 1V3XA 2ZFPH 1NN6A 3AAUA 1BTUA 1ZHMA 4JZDH 3SUEA 3GYMA 1SGIB 1A5HA 1Q2WA 4THNH 2OBOA 3E0NB 1LKBA 2ZIQH 3EYDA 4INHA 4BANB 4I31A 1BIOA 5FCRA 2V3OH 4A1VA 1SLVB 1QL7A 1NRRH 1SQOA 3VB7A 3FANA 1BB0B 2P8OB 2VNTA 3S7HB 3SUGA 1LPGB 2ZGHA 2NU1E 4UE7H 2SGFE 1FONA 2QXJA 3CS7A 2VWLA 1P03A 1NROH 2HPPH 2BOKA 5BPEA 1GDUA 2AS9A 5A0CA 1AVXA 4RSPA 1XUKA 3V3MA 3UNSA 3KQDA 2RA3A 5IYTA 2P3TB 1W0ZU 1GDQA 3DA9B 5JBTA 3RXRA 4TPIZ 2I6SA 2BHGA 1SHHB 1A7SA 2GZ9A 3BTEE 1CBWC 2FI5E 3UWIA 5FX5A 3SV8A 5FBEA 1BHXB 1LCYA 3SJOA 3EE0B 3LDXH 3PTNA 4DY7B 3GY3A 1O2ZA 2RCEA 2FOFA 1PPZA 1Z1JA 3RM0H 4FUHA 1O2JA 2BLOA 1ETSH 1T4VH 3V13A 1SC8U 1D3PB 1DOJA 1MAXA 4Q7ZA 1PYTC 4IS5A 3GY6A 1ELCA 1EAXA 1EJMA 1TPAE 1QJ7B 5DP9A 1O37A 1S82A 2OQUA 4O3UA 2WPIS 1GHYH 5GXPA 4JYTA 1KLJH 3QZQA 3UIRA 1XX9A 3BTDE 3ZZ5A 1K1IA 1GI5A 4XBCA 1GJ4H 4XDEA 5LPEA 3RXEA 1QRZA 1TRMA 1K1PA 1YPEH 2FX6A 3TGJE 1HAOH 1SSXA 3QGNB 2FS9A 1PPHE 1AWFH 3T29A 3U1JB 1C1UH 2ZCLP 1GG6C 2VVUA 4YTAA 4CR5A 2J2UA 3M7UA 1T8MA 4WH6A 1EASA 2GDEH 2PGQB 1YBWA 1TMUH 3PROA 4Y0ZE 4NIWA 2R3UA 3LC3A 1TMTH 4HTCH 3E6PH 2FOCA 4AFZA 1NS3A 4U01A 3BTWE 1MQ5A 4GPGA 1EJNA 3TH4H 2WV4A 7LPRA 1EZSC 2J95A 4B1TA 2O9QA 2G52A 1TPPA 1UTQA 2V0BA 1ZSKA 3RXDA 4KP0A 1MBMA 3E1XB 4GLYA 4BAQB 1UTMA 1C5XB 2OC7A 1EPTC 1K21H 4X8UH 3GDVA 1IQJA 2ZDMA 5HM9A 1AE8H 3I77A 3BTKE 1IQIA 4DIIH 3A8CA 3ZYDA 1CVWH 2F9UA 1H4WA 4Q7XA 4R8TB 1PPGE 3MH4A 1C1OA 3VEQB 4DW2U 1UTLM 4B74A 1K1LA 1GBIA 1V2WT 4SGBE 1ANDA 2ANWA 1J9CH 4NWLA 3PYHA 4ABAA 5BRRE 5CMXH 5IDKA 5JDUB 3FZZA 3RXSA 1ESTA 5DP8A 1GBBA 3P6ZB 3MU0A 4NIVA 2ZFSA 1LVOA 1YPLH 3QN7A 1D3QB 3RXJA 1ZPBA 1EP5A 5ESBA 2XW9A 1Y3YA 3G01A 4F4OC 1C5UA 1KTSB 4YOIA 1K1NA 1IHSH 1BOQA 1ZLRA 5FXLA 1O3GA 1EJAA 1S84A 2V35A 4ZHMU 3RXQA 4B2CA 1ZZZA 5JBAS 5EODA 3BF6H 5DGJA 1SGQE 1ZYOA 2XTTB 2ZZUH 1W7GH 4Y11E 1C2LA 1OWKA 1MU6B 1W7XH 9LPRA 3A7WA 4BXWA 1PPEE 1AQ7A 1ZPZA 1HNEE 2BDYA 2BD4A 3LC5A 4NA7A 1DUAA 1VGCC 3UR6A 1VJAU 1XUJA 4JMYA 3SV9A 3PO1B 3FFGA 1SGEE 1S6HA 2ZNKH 1LHEH 2KAIB 1C1SA 1L4DA 1GJ6A 2B7DH 3SGBE 2QC2A 3H5CB 2JH6D 3QTOH 5FX6A 3NKKA 1O3AA 1GCTC 1N8OC 4ZKRU 2EI8A 3P8OA 2SGPE 1CHOG 5C1XA 5LGOA 1BRAA 5C5OA 1QBNA 1J8AA 1O3OA 3GCOA 2PW8H 2ZGCA 1MD7A 1TBQH 5DJ7A 3OSYA 5GWZA 1P2IA 2FWWA 2FODA 1BTYA 1ELDE 1ARCA 2GVFA 2ZCHP 1P2OA 3DT0H 3SNCA 4ABEA 1ANCA 2A2XH 1MBQA 2BD8A 2OD3B 1MKWK 2GCTB 3ELAH 3SI3H 1MU8B 2BX4A 2FS8A 1CA0C 3BG4B 4MNWA 1GVKB 3B23B 4NZQA 4X1QU 2CHAB 2Z9IA 1TIOA 1O31A 2YNAA 3NZIA 4A92A 1YCPK 1B7XB 3UOPA 2B0FA 3SGAE 1QY6A 1WSSH 3BIVH 3K6ZA 3NXPA 3SW2B 1NT1A 4X2XA 3DFLA 2D26C 1GBLA 1O3BA 1AFQB 2ZU4A 2F9OA 1NFXA 4YT7H 2ALVA 4DCDA 1K28D 1RGQA 1P2QA 3C27B 1ZTJA 1TX7A 3SJIA 3UWJH 3GCNA 1NRPH 3SU1A 4CREA 4FUEA 1W2KH 1NTPA 3MWIU 2IJOB 1OWHA 1C5YB 3A86A 1TPSA 3BTGE 1RXPA 4MNVA 3UY9A 4ZH8A 1GI3A 4GUXA 1EXFA 2TGDA 1SLXB 2PKAA 6GCHG 1YPMH 4B71A 2WPMS 1ELGA 1Z7KA 3A7XA 1GJ9B 1TAWA 1GBCA 1UCYE 1O5BB 2PSYA 3AASA 5E8EH 1DWDH 1S5SA 4Y71A 5DKMA 2D2DA 3E16B 4BNRA 1GMCF 4KTCA 3P95A 2V6NA 3TVJB 4I32A 3BN9A 1Y3WA 1SGPE 1T8OA 2P8OC 1TPOA 2TIOA 3TJVA 1C1NA 4R0IA 1THRH 1ZGVA 2ZI2H 3TITA 2WPLS 1CQQA 1JIMA 1O30A 4UDWH 3ODFA 5E2OA 2HALA 1H9LB 3RXFA 4WXVA 2H6MA 4E05H 2BD2A 3ITIA 2ZTXA 3RLYH 2ZFRH 1AVGH 3TH2H 1UTJA 1GI4A 3H7OA 2HWLB 1OOKB 1O2KA 2A4GA 2ZHDA 1SGRE 1ZGIA 1KSNA 3PLPA 2OLGA 1ANBA 1TA6A 2H1UA 1S6FA 1KIGH 2BQ7B 2P3UB 4NG9H 4D7FA 3KIDU 3FP8E 2JH0D 4J2YB 5DO4H 1J14A 2VINA 3L6PA 3RXVA 3RC6A 2NU2E 4Q80A 3U69H 1G36A 4NIXA 1MTVA 4LZ1H 1NESE 5DP7A 4NSVA 1WCZA 1UK4A 2GMTB 2Y80A 1EZXC 3PWBA 1HXEH 2WYGA 3QUMP 1LHDH 2ZDAH 4AORA 4NIYA 1C4U2 1A0JA 2ZG0H 1HJAB 4NSYA 4RKJB 2QAAA 4TYDA 2HGTH 4LZ4B 1T31A 1GJAB 2G4UA 1HBTH 1OWDA 2ZDVH 2CGAA 1MTWA 2HOBA 3TPIZ 1PFXC 3S9CA 1BITA 1THPB 1ZR0A 2P95A 1DVAH 1GJDB 4ZKNU 2GD4B 4OS1A 1THSH 4CR9A 1O3NA 2B5TB 1FI8A 3ATMA 3GDUA 4YESB 2F91A 1FNIA 5JBCS 3SQHE 4CBNA 1C2HA 1EB2A 1O3HA 2ALPA 3VB3A 4GCHF 1TYNA 1DLKB 4YOJA 2J38A 2ZO3H 1A3BH 1SG8B 4AYVB 1J17T 1BRBE 2EI6A 1BJVA 1O2TA 1V2UT 3OTJE 1VITG 3EA9A 3HPTB 3SU0A 3NUMA 3W94A 1C5OH 1LHGH 1SPJA 1F0TA 1YYY1 4INLA 1D6WA 3S7KB 2PLXA 3MU5A 1P9UA 2UWPA 2PFEA 2VIVA 4I8JA 4AX9H 1CU1A 4UFFH 1BMNH 1TQ0B 1VJ9U 2NU3E 1WYKA 3W95A 1HAZB 1JBUH 3BSQA 3VPKA 5EQSA 1ABIH 1NU7B 8KME2 1DPOA 2B8OH 3ZVBA 1IHTH 2Z6BD 3M5MA 5CE1A 4Q7YA 3ZZ6A 2H5CA 1TOMH 1UCYK 2TBSA 1C5TA 1C4Y2 3T25A 2BDGA 1OP2A 3GCTG 1C1QA 3KF2A 1TGTA 2PSXA 1ESAA 3RC5A 2STBE 4D76A 1SL3A 2VIQA 1PQ5A 2SNVA 1CSOE 7ESTE 5I46H 1DT2A 1YM0A 4NGAH 5C67A 2FOHA 3KEEA 1PPBH 4F49A 2F9NA 2XBYA 2QA9E 3KHVA 5DP6A 2QCYA 1VCPA 2PHBA 2BY7X 2FOMB 1H8IH 1G30B 1L0ZA 3SJ9A 3WY8A 1KLTA 1NFUA 1QL9A 4AFUA 4UD9H 1HAVB 3LJJA 4A5TS 1CO7E 4WMFA 1A0HB 1WQVH 1AZ8A 3NWUA 3S9AA 1O39A 2GDDA 1KXBA 2XYAA 1DXWA 3CS0A 1P02A 2XBXA 1B0FA 3PO1C 4ZROA 1RIWC 4KKDA 1AFEH 1FQ3A 4HFPB 2G5VA 4FUGA 3MNSA 1BTXA 1O2RA 2BM2A 5FCKA 2J34A 5A8XA 2EI7A 3PWCA 3T27A 3AW1A 1ABJH 3AW0A 3U1IB 5B6OA 1C5RA 1KDQA 1TOCB 2W26A 3QO6A 4I33A 3FVFB 1UK3A 1MAYA 1TNGA 1W10U 1KXAA 5EXLA 4X1PU 3N7OA 2TGPZ 4VGCB 1DLEA 5HM2A 2BD9A 2WUBA 4YM9A 1QBOA 1O2VA 5K0HA 1KLIH 5F6MA 1O2UA 1C5SA 4CHAB 1TMBH 1CE5A 1FY8E 3RMNH 3GOVB 1QRWA 2A0QB 4B76A 1YGCH 1SMFE 4M7GA 2ODQA 2GCTC 3SU5A 3LIWA 1DUEA 3BG4C 2QF0A 2AYWA 5A2MH 2P93A 1FPCH 2W7UA 2CHAC 4Y10E 3PM3A 1ZHRA 2PWXA 2FYRA 4X8TH 3Q3XA 1OSSA 2G8TA 1DXPA 3IITA 1TNKA 1HAIH 2FPZA 8GCHG 3LGWA 1C1RA 4ZKOU 5LH8A 1ZSLA 1V6DA 1AFQC 2A32A 2BZAA 3QZRA 2H9EH