2FOCA

Structure of porcine pancreatic elastase in 55% dimethylformamide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2focA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2focA01
1UHBB 1QBOA 2DE8A 3MFJA 1V2QT 1BTPA 2ZI2H 1A3EH 4CR9A 1CA0B 1TYNA 2BDHA 1RFNA 4B2AA 4ABFA 4WVPE 3Q3KA 3VB3A 2BDCA 2Y5GA 2ZU2A 2Z9IA 1YPHC 3LT3A 8LPRA 1B5GH 2H9EH 3GY2A 3RM2H 2BD5A 5FAHA 3SJIA 4I7YH 4OS4A 4INHA 3OSYA 5LH8A 2OUAA 4MNYA 1O3PB 4CRGA 4HTCH 2W5EA 1C1VH 1EX3A 2PR3A 1O5CB 4H42U 1LO6A 1AGJA 1LHGH 1O2GH 3MMGA 5DP6A 1KSNA 3V3MA 4Y8ZA 4E05H 2ZGBH 1TMTH 3M5OA 1BCUH 2YNBA 2CN0H 1JXPA 1O2KA 3P6ZB 1TA6A 3SJ8A 1DXWA 4MLFB 2VIDA 1V2KT 3SNEA 3NKKA 3SU1A 1ZHPA 5DP7A 1DPOA 3SUEA 2BB4A 2OLGA 3ZZDA 4NA9H 2I6QA 5JBBS 2J94A 4AGJA 2G81E 1RJXB 1H9IE 1VITH 1ELAA 4KKDA 1T8MA 1SGTA 3A8CA 2STBE 1P2JA 3EE0B 2FOFA 1A5HA 3DT0H 4BANB 5FPYA 2PUQH 1XX9A 5CHAC 3C1KA 3PLBA 3T28A 2G4UA 1AMHA 1MUEB 2ZFRH 3LGTA 1GJ9B 3ODDA 1DM4B 4Z0KA 2STAE 2BM2A 2HPPH 4PROA 3A81A 5DG6A 1V2WT 1T4VH 1UCYE 2WUBA 1QIXB 3FANA 2A4RA 2PSYA 4E06H 1O3HA 4B2BA 4MPVA 4D9QA 2BLOA 2XBWA 3BTME 3ATIA 4I31A 1FLEE 2JH5D 3BTDE 1Y3YA 4ISIH 1SQTA 1L4ZA 4YT6H 4ZXYH 3SV9A 1Z6EA 1FIZA 3ZVEA 5AVDA 4NWKA 3MU0A 4UE7H 1E0FD 3ZZAA 2BD7A 5FX5A 1NRPH 1F5LA 1AZZA 2VU8E 5A0CA 1GVZA 4RKOB 1Z1IA 1JRSA 2VIVA 1C1OA 3MH7A 3PROA 1TGCA 1V2ST 2KAIA 4AFQA 1FUJA 1JOUB 1TE0A 2SGAA 1HFDA 1K9OE 1O2UA 1K1PA 3P95A 5JPMH 1C5LH 1ELGA 1PFXC 1O38A 3PTBA 1DUEA 2BX4A 3K9XB 3RC4A 3SU4A 2ZDAH 3U8RH 3BTKE 1MQ6A 4KELA 3QGNB 1GHBF 3PM3A 2GKVE 2A0QB 8GCHG 1O2PA 3I29A 1AN1E 1WBGB 1GHAF 3AW0A 5JDUB 3SOSA 1F2SE 5T3HA 5C1XA 4M7GA 2ZGCA 1C1PA 1C5YB 3ZZ5A 1PYTC 3VB5A 4YO9A 1GBCA 2ZHEH 1GHYH 3BF6H 4K5ZA 1Z8RA 3H5CB 1E38B 3SNAA 5HM2A 4JZIA 4BAOB 4Q80A 1EOJA 2Z3DA 4AB8A 2Z7FE 4GSOA 1E34B 1CGHA 3S9CA 1MBQA 2BOHB 3TJVA 1DS2E 1G3BA 4DOQA 1SL3A 4K1TA 2BQ6B 1GMHG 2C8ZB 4U30A 5HM9A 1QNJA 4MNVA 3BIVH 1TBRH 1NS3A 4ZHMU 1C2MA 4AFSA 1QJ1B 2V3OH 2Z9KA 1J8AA 1NROH 2BDAA 4I33A 1GBJA 1RS0A 4UFEH 1AE8H 1BT7A 1AO5A 3I77A 1H1BA 2J95A 5DP4A 5FXLA 4ISNA 3TLOA 3PTNA 1C5SA 1UJ1A 4Y10E 3NUMA 5GJ4B 2WPLS 5ESBA 3ENSB 2XBXA 1K1LA 1C5NH 4ASHA 2R9PA 4R0IA 3A8DA 1BMLA 3IWMA 1SC8U 1YBWA 1UTQA 2GCTC 2ILNA 2ZDMA 2F83A 2VVUA 2CHAC 4K60A 3LC5A 3M61U 4X8VH 2A4QA 1AU8A 3P70B 5EPYA 5TCAA 1JMOH 1FN8A 1DWBH 3M7UA 2OC8A 4JZFH 2QIQA 3KQCA 4LK4A 1DDJA 1SFIA 1RRKA 3LGUA 3S7KB 3ATKA 2ZDKA 1RTLA 4VGCB 3A87A 1GHVH 2PHBA 1YP9A 1O2LA 1NY22 4ZH8A 4UDWH 3SNBA 3ZZ8A 1P2MA 2AYWA 3MH4A 3ZVDA 3ATLA 3GISB 3U1IB 1A1RA 2BY9X 1ELDE 5DP5A 4MDSA 2J2UA 1MTWA 3SU0A 1O36A 2G8TA 2R3YA 4JMYA 6ESTA 2FOEA 1C2GA 1YLDA 3ESTA 3PWCA 1UTPA 2AIPA 1MU8B 4A5TS 1YF4A 2VVCA 3A83A 2GDDA 4WH8A 1ZGVA 1AY6H 2NU2E 1XM1A 1P9SA 1YPLH 4GLYA 1C5QA 3P8FA 1D3TB 1YM0A 3BSQA 2Q6DA 2PGQB 4ABGA 1RGQA 3V12A 1F5KU 1AZ8A 2FX4A 4Y7BA 3MNXA 1K1MA 2BHGA 1W10U 1BTUA 1K28D 3ZVAA 3UWIA 3UNQA 2BDIA 3H7TA 4BTTB 1A2CH 2VH6A 3SI4H 5LPEA 3A7XA 4LZ1H 3LDXH 1EZUC 5HMAA 4DW2U 2HNTE 2BMGB 2BY6X 4FXGH 3UNSA 2OD3B 4AG2A 4UEHH 2QF0A 1DWDH 3SZNA 1BTXA 7GCHF 1N8OB 3A88A 2TRMA 1B0EA 2TPIZ 3ZVCA 4FUJA 1ELVA 2XYAA 5ETXA 1S82A 2F9NA 2HPQH 3SU3A 1HV7A 4Y6DA 1W7XH 2P94A 4ABAA 2F91A 3BTGE 4O3TA 1N6XA 2D1JA 4DCDA 1F5RA 3W94A 5JB9S 1MTUA 3MH6A 4DT7B 1NU9A 3V7TA 1DSTA 1NRRH 1SG8B 1WV7H 3SJ9A 3B9FH 2ZDLA 2XWAA 4GVUA 3K6YA 3TNSA 2A7CA 1G30B 4IMZA 3UWJH 1K1JA 1DWCH 2Q6FA 1CA0C 1CQQA 4K8YA 1SLWB 2FDAA 1O32A 3A7WA 4CRBA 4E7RG 2FTLE 1CE5A 4NA7A 1ZPZA 1SR5C 5BPEA 3SGBE 4IC5A 3STIA 1O2VA 1ID5H 1Z7KA 4XSKU 1A61H 1ABIH 1MMJN 2ZQ2A 2IN2A 1UK3A 5T6FA 1EAUA 4MPXA 4DJZB 2XBYA 1AVXA 1PPHE 1S5SA 2WYJA 1FPCH 1TX6A 3U1JB 3URCA 2HLCA 1A0HB 1HLTH 4Q7XA 5EQRA 4B71A 2Z9LA 3MHWU 4Y0YE 4D7FA 3RXEA 1KTTB 1GL1A 5ABWA 2F9BH 3M37A 2AERH 3T25A 4ABIA 3HKIB 5LGOA 1TMBH 1DE7H 1YPMH 2ZF0H 1LQDB 1S6FA 4NA8A 1FAKH 3GCHC 4AX9H 3O8RA 4INKA 3AVZA 4I8HA 5CMXH 1LPZB 3TIUA 1XKAC 2EI6A 3SUDA 4DG4A 4ABBA 3HATH 4RKJB 2ZTXA 5G4BA 2H5CA 3WY8A 2FPZA 1V2TT 5EQQA 2O9QA 4Z6AH 1P02A 1W7GH 3QLPH 4NSVA 1HIAB 1GBHA 4X6MA 1V2UT 5C2ZA 1TNHA 1FY4A 1G9IE 2XCNA 1SGQE 4OGYA 3DFJA 5LPRA 1ZMJA 1IQMA 1FJSA 1INCA 2BDBA 3V13A 1UVSH 3GCOA 1AUJA 2HWLB 2P59A 1GMCG 2H6MA 3RDZA 1ETRH 3RXMA 1SGIB 3K65B 3TH4H 3BEFB 5EXNA 4CBNA 1GMDG 1GWAA 1IQKA 1YGCH 3LGYA 3P92A 4UONA 5GCHF 3RP2A 3LGVA 3BTFE 1TPPA 1IQIA 1XUGA 1O3BA 1O2XA 4I32A 1SGRE 3FZZA 2V0BA 3MNSA 2GCHF 2J9NA 1UTMA 1FY8E 3SU6A 1P09A 4XOJA 1O2SA 1BMMH 1Z8JB 1MCTA 3RMOH 3HK3B 2ODQA 3RXUA 4NIXA 1OOKB 2ZTYA 4WJG2 1GBMA 3AW1A 2C8XB 3EDXB 2PKSC 4FUEA 1TALA 2ZFPH 3MO9A 2WPIS 3RXJA 3LH1A 3UQOA 1VITG 4X6NA 1S0QA 4GAWA 1TNGA 4H4FA 1TRNA 1O3IA 6CHAC 1O3KA 1TONA 1PQAA 1TPAE 1O2TA 4LXBH 3KQEA 2Z94A 2QXGA 4H6SB 3TJUA 1MTNB 1SGEE 1AHTH 3A7VA 3UR9A 1IQFA 1NO9H 2UWLA 5A09A 1P04A 4AOQA 1QTFA 4UFDH 2ZO3H 1O3EA 4BOHA 2G51A 3O8BA 1J9CH 2VWMA 3RXPA 1TNKA 2Y80A 3E6PH 1O33A 1C1NA 3F9FA 3VGCC 2XTTB 2ZGXH 4TPIZ 2FLRH 2ZHQH 4MQAA 1WSSH 1SQOA 2Q6GA 2THFB 3TU7H 1C1TA 1DITH 2D2DA 1EP5A 1BRCE 4I8JA 1FZZA 1C2JA 4YESB 3BEIB 1BJUA 1VJ9U 1WAYB 3AAUA 3BIUH 1QRWA 2O8UA 1SGYE 3SW2B 1N6YA 2C4FH 3SU5A 3VXEH 1XMNB 2BX3A 9LPRA 1LCYA 1RIWB 1GHXH 2A7HA 4THNH 1BTHH 3BTHE 2A5AA 2NU0E 4FUFA 5FBIA 3QK1A 1HAGE 2TGDA 5EGMA 5L6NH 3SU2A 5C67A 5TCCA 1EOLA 3U8OH 2ZCHP 1Q31A 1PPGE 1TQ0B 2Y6TA 3TH3H 1XKBC 1P2QA 3ZZ9A 1TABE 2EEKA 4NIVA 1OSSA 3S69A 5L2ZH 2GV7A 1GG6C 4K3JA 1L4DA 2B9LA 1P10A 3RXLA 2R0KA 1THPB 3PLPA 1OWIA 1NFWA 3TK5A 2PKAA 1LQEA 2P8OB 2AH4X 4TWYA 2AMDA 2ZA5A 1QA0A 4IS5A 3MH5A 5PTPA 1SVPA 1P06A 4SGBE 1P2OA 1RXPA 1DXPA 1T7CA 1MKXH 2PW8H 1G2LA 1TQ7B 4K1SA 4SGAE 3Q76A 1O39A 2PWXA 2ZQ1A 3GICB 3A84A 3IG6B 3RXGA 2AFQB 1AB9B 1AE5A 1HIAA 1VCQA 2NWNA 3RXQA 4YZUA 1EPTB 1ESBA 6LPRA 4MNWA 1SBWA 2GZ7A 1QQ4A 1ZHMA 1GGDB 1GI2A 5AHGH 2QGRA 4TPYA 1IQGA 2BY7X 1HAHH 3L6PA 1ZZZA 2BD9A 1ZRKA 1MZDA 3RXFA 4OS1A 1MQ5A 1ANCA 4D7GA 5E2PA 3RXTA 1MKXK 3QX5H 2FYRA 3PO1C 1GBFA 1AWFH 2FOAA 1KXBA 3ODFA 1EXFA 1C1RA 2W7SA 1GVKB 1UTKA 2PTCE 5F8TA 2QAAA 1SSXA 2BVXH 2EC9H 1T4UH 1GHWH 1HDTH 1AFQB 5EQSA 3OY5U 3K6ZA 2G5NA 2BDYA 1WQSA 3DA9B 3U98H 3FP7E 4NGAH 4Y8YA 3S9BA 4ISHH 1T8NA 1ZYOA 5EOKA 1Y5BT 2NU4E 2SGPE 1BDAA 1V2RT 1ACBE 2BDGA 3RMLH 4CHAC 1A3BH 1S84A 3FFGA 4CRDA 2RDLA 3RXAA 3EYDA 3TGKE 1GJDB 1ZTKA 3OY6U 4NIYA 2HALA 1ETSH 4A7IB 3RXSA 2FLBH 2A1DB 4WF8A 1BRAA 1C1WH 3QO6A 4INLA 1TRYA 5DP9A 4CH8B 5EW1H 1EZXC 1QRXA 1TGNA 4MVNA 2ANMH 2XCFA 1VGCC 3HKJB 1LHFH 1HXEH 3PV4A 2OP9A 2EI7A 1GI8B 1UVTH 2VIOA 3EAJA 1C1SA 1GBLA 2AGGX 1QRZA 1OP2A 3SNCA 1C2KA 3Q77A 2QY0B 2VIQA 3SN8A 3UTUH 1DUAA 1IOEA 1V2VT 4ZKOU 1XVOA 1C9PA 2GMTB 1LVBA 1B7XB 1D6WA 1MD7A 1GI1A 1OYTH 2BLWA 4ZMAH 1K1NA 1C4U2 1ZLRA 4D8NA 4TYDA 2GT8A 2NU1E 2SGEE 1KDQB 2Z6BD 3BG8A 4K2YA 1UTOA 4DGJA 1XVMA 4J1YA 1C5ZB 2CV3A 3VB6A 4OS6A 1GI9B 1DWEH 2V3HH 5DPAA 1BOQA 2P3TB 1WUNH 4ISLA 3SHAH 2P95A 2JETC 2VIPA 1QL9A 3EA9A 1UTLM 2BY5X 2VH0A 1S83A 4CBOA 1THSH 1Z6JH 3GYMA 3M5NA 4Q7YA 1KYNA 3E90B 3NWUA 1CBWB 4AYYB 1MZAA 5LPFA 3BV9B 3SO3A 1O5GH 4GHQA 3LGIA 1BITA 1C2IA 4X8TH 1BIOA 1FDPA 4FUCA 3U8TH 1UMAH 3UNRA 5SGAE 1A0LA 1W8BH 1EZQA 3QTVH 4AFZA 4X2VA 2F3CE 1UO6A 1QURH 3BG4B 4JZDH 1HAIH 4X1QU 1K1IA 8GCHF 3D23A 2UUJB 3Q3YA 3F6UH 1F0UA 1DX5M 1Q2WA 1QY6A 2A2QH 2Y7XA 1HPGA 1O2ZA 1QBVH 2UUYA 1OWDA 1GJ8B 1TBZH 3GDSA 1BMAA 2UWOA 1FIWA 3PB1E 2ZWLH 1O2RA 1GI6A 1O0DH 1H9HE 1AUTC 1PPEE 1IQHA 4UFFH 1CHGA 1RD3B 3M3SA 1OKXA 1HUTH 1GMHF 1EPTA 1EB1H 4B73A 3VEQB 1W14U 4FVDA 3LU9B 4XFQA 1P2NA 4HI3A 1DLKB 1PYTD 1J14A 1QB1A 1HCGA 1ZMLA 2J38A 8KME2 1GCTC 5TJXA 5A8YA 2WYGA 1TOMH 1Y3VA 2BD4A 2W3IA 4J2YB 2HOBA 2ZPSA 5JBTA 5BRRE 2AS9A 2FEQH 4QT8C 3ZZ3A 1FXYA 3OU0A 4Y0ZE 3BEUA 3TNTA 3M3TA 1CHOG 1C5PA 2OC0A 2J4IA 2OBOA 2A31A 1GVLA 1NPMA 1KLIH 2FI5E 2ESTE 1MTNC 2BTCE 5FCKA 3NK8A 4ZKSU 4ABHA 3SQHE 5DKMA 2PGBB 1SI5H 4ZKRU 1A7SA 1P11E 2W26A 2HNTC 4Y7AA 1P2IA 3DFLA 1W12U 1QHRB 3U9AH 2BZ6H 3CS7A 3A89A 1T8LA 3KF2A 1GI7B 3B23B 4DY7B 2PFEA 2RCEA 4JCNA 3RM0H 1G3EA 1O3AA 1C5OH 1QFKH 2WPMS 1ZSKA 2FWWA 1F92A 3ZVFA 1O2MA 1H9LB 3KCGH 4OS2A 1TBQH 4DURA 1AIXH 3M36A 1P8VC 4NWLA 2OTVA 5IDKA 1O3CA 1BTZA 1A0JA 2P16A 2BYAX 1EJMA 2HVXA 3A8AA 3VXFH 2GZ9A 1BHXB 4BAMB 4WMDA 1KDQA 2QC2A 4AG1A 1EJNA 1HBTH 1L1JA 1FONA 4YLUA 4CREA 4B74A 2ZIQH 1C2DA 3D65E 1ZSLA 2ASUB 4AB9A 1UK2A 1OWJA 7LPRA 3EA7A 4WH6A 2K1QA 3MI4A 1O34A 1SOZA 2ZCLP 1O37A 2ODPA 1AFEH 3MTYA 5FBEA 4Q7ZA 3SV8A 1LPGB 4U2WA 5DGJA 5C1YA 2ZDVH 2P8OC 2HRVA 2G4TA 2AGIX 2HGTH 2W3KA 1SLUB 4X2YA 2O8LA 1HRTH 6GCHG 1UK4A 1SGDE 5EG4A 1BTWA 3O8DA 1CT4E 1QJ6B 1C1QA 2G52A 3GDUA 5DP3A 5I46H 1E37B 3QZRA 1OWHA 3Q00A 3CP7A 2F9VA 2ZG0H 1GBBA 2RA0A 3ELAH 4YLQH 2A5IA 3RMMH 1AB9C 4WMFA 1NFXA 2H9HA 3B8JA 1J15A 3NZIA 1GBTA 4Q2KA 1HJAB 1GI0A 1T31A 3RU4D 4A1VA 2BD3A 3A7ZA 2XC5A 1C2EA 1SLVB 2GD4B 1OP0A 1L0ZA 3P8GA 3UFAA 1LDTT 5F8ZA 1F7ZA 1HGTH 2TIOA 2QXHA 1HXFH 2PKAB 1Z8IB 4WY3A 5EW2H 1NM6A 1ZMNA 5T6DA 3ZZ4A 2ZHWH 1O5EH 3RXVA 3W95A 1RTFB 3S9AA 1TX7A 5AFZH 5GXPA 3TGIE 4XBBA 3OTJE 1AFQC 4KTUA 3BN9A 4BAHB 5J4QA 2A5KA 3K2UA 1Y3XA 2J34A 1KXDA 4BAKB 2GP9B 1O3MA 2OQUA 4AFUA 4AORA 1AKSA 3P8OA 3RUOA 2FXRA 1EKBB 3GY4A 2BY8X 4KTSA 4K8BA 1NFUA 1LMWB 2BVRH 1DOJA 2XRCA 4KP0A 4YTAA 1QL8A 4MTBA 1G36A 4GCHG 1O5BB 1ZRBA 2ZGJA 4YT7H 1WCZA 1TPSA 4Y79A 1XUHA 1Y5UT 2C93B 4MNXA 3KQBA 1FQ3A 2BD2A 1A4WH 3VB7A 3E0PB 1LKBA 3T26A 2TGAA 1C5WB 5FCRA 2FOGA 1C2LA 1EAXA 1TGSZ 1AVGH 3STJA 5H4IB 1AWHB 5E0JA 2F9OA 1O2HA 2BQ7B 4YOIA 1VJAU 2FOMB 1GMCF 3GY6A 3GY5A 1DVAH 4YOJA 2ANYA 1PPBH 3UY9A 2FM2A 1THRH 3LJOA 4F49A 1CVWH 1EUFA 5AFYH 3BTWE 2A4OA 2QF3A 1KXEA 2G5VA 2WPHS 3QGJA 2CHAB 4IC6A 1FY5A 2AMQA 3ITIA 4Y8XA 1C1UH 2DUCA 3ZZBA 2AEIH 1KLTA 5A8ZA 1AVWA 3MOCA 3M7QA 1HAVB 1ANDA 5C1UA 1CBWC 1OX1A 1V2MT 2A7JA 3VFEA 2XXLA 4ZROA 5DO4H 1IQNA 3T29A 2EA3A 4K1EA 3S7HB 2YOLA 1O3OA 1VCPA 5JYIA 1P12E 1K22H 2P93A 4LOYH 4CRCA 3LJJA 3MNCA 5B6OA 1O2NA 2Y7ZA 3G01A 1VITF 4NCYA 1SFQB 2V35A 2VWLA 3MWIU 2TBSA 2Y82A 2OC7A 1YPGH 2Z3EA 3RU4T 2HNTF 1SGNE 2IJOB 1SOTA 2BLQA 3HGPA 2Y5HA 3M7TA 4CRAA 1W0YH 1KLJH 1LVOA 1ELFA 2UUKB 3GY8A 4XBDA 4CR5A 3EGKH 2FI4E 4O03A 1FY1A 3PLKA 3LC3A 4NFFA 5C20A 1GL0E 1W3CA 4ZUHA 1UVPA 3RXKA 4AZ2B 2BD8A 4BNRA 3TGJE 2CJIA 2GV6A 4AN7A 1P3EA 3QUMP 3SHCH 4F4OC 1D6RA 1GBEA 2OQ5A 2LPRA 1O5AB 3AAVA 1W11U 1V2JT 2ZHFH 3GCTG 2CXVA 2ZP0H 1G37A 1EB2A 1AD8H 3VPKA 2SFAA 3TH2H 2EI8A 4XDEA 3BTTE 2F9UA 1YLCA 1EQ9A 1O2JA 3LH3A 1UTNA 2FOBA 1O5DH 2FTMA 4VGCC 1BBRE 1HJ8A 1C5RA 4K69A 2VINA 3GYLB 3E91A 2CMYA 1KIGH 1TX8A 2OXSA 1ELBA 3Q3XA 4TWWA 1P01A 3QDZB 2Z9JA 4OS5A 2CF8H 4U01A 1O3LA 4WXVA 3T27A 1O5FH 3E3TA 4NFEA 3MU8A 2ZTZA 4TY6A 3KHVA 1P05A 1ZTLA 3HK6B 4NG9H 1SGPE 1UTJA 2Q1JA 1QL7A 1S81A 2ZECA 1O30A 1TNLA 4FUDA 3OX7U 1CA8B 1O2YA 5L30H 1ELTA 3PMHB 1A46H 1OPHB 1IHSH 1SQAA 9ESTA 1EASA 2ZFSA 4RSPA 4A1XA 3D49H 1ABJH 1P2KA 2VIWA 1A5GH 5DK1A 2XNIA 5EPNA 5HGGA 1EAIA 1EJAA 2FESH 3A80A 1D9IA 1L1GA 1Z8GA 3UUZA 1ESTA 1BRBE 1HAYB 4FU7A 2C8YB 1GJ7B 1C5TA 1JWTA 3MNBA 4AYVB 2ALVA 1NU7B 1ZOMA 1DICA 1ETTH 1LKAA 3RXOA 3VB4A 1HNEE 4BAQB 3NCLA 1T32A 4HFPB 1GJBB 1HAOH 1N8OC 3GY7A 4B2CA 1YPHE 3KL6A 1FY3A 1Y3WA 2ZU5A 3QWCH 1GBDA 2PV9B 1GJ4H 5A8XA 1TIOA 3M5LA 1ZTJA 3GCHB 3ZZ6A 1OWEA 2FODA 3F68H 3O8CA 3PMBB 4GPGA 3SUGA 2R0LA 1J17T 5DJ7A 4X1NU 5C5NA 1O2OA 4BTIB 1LHEH 1G3CA 4O97A 4IBLH 1HAVA 3TK9A 1PPCE 4B76A 2VGCB 2OCVB 1O3GA 3UOUA 4NSYA 1F0TA 3LKWA 1GI3A 5EODA 1G2MA 5AF9H 1NTPA 1LHDH 5A2MH 3RMNH 2D8WA 3A7YA 2ZFFH 3EQ0H 3M5MA 4RN6A 3TPIZ 3PYHA 1C5UA 1TGBA 1V6DA 1C9TA 2SGFE 1YPKH 1GI4A 3LONA 2XW9A 1C4Y2 1C5VA 2H2ZA 1OYQA 1S6HA 3A86A 1TRMA 4FUGA 1OXGA 4R8TB 2YNAA 3P8NA 1YCPH 3ZZCA 5E0GA 4ZHAA 1SGFG 1Z71A 3E16B 5GPIB 4O3UA 4JYUH 2LNCA 1KXCA 1HJAC 1GJ6A 3SV6A 1JBUH 1LVYA 1LTOA 2WV4A 2ZNKH 1XUJA 8ESTE 3F9GA 1OS8A 5E0HA 1SHHB 3DHKH 1GHBG 1WQVH 4O9VA 1TFXA 3P17H 2OC1A 4NZQA 2AGEX 3LOXA 1GJCB 1XXDA 2G55A 4B75A 1TAWA 3UPEA 1M9UA 2XC0A 1AQ7A 1CO7E 1GBIA 1GHAG 5JBCS 2FYQA 1FI8A 4Y71A 3SI3H 2PKSB 1YCPK 1EATA 1MAXA 1TNJA 5JBAS 3A82A 2G00A 5FPSA 4IN1A 3KEEA 2FI3E 6CHAB 1ANEA 2FMJA 3R3GB 2VB0A 3RXIA 3GOVB 4YM9A 2FO9A 4FVBA 3RXDA 3PMJA 1CGJE 3HPTB 3SBKA 1HYLA 2R3UA 1NRSH 2WPJS 2H5DA 3D62A 3FP8E 2XWBI 1XXFA 3RLWH 2B5TB 4XBCA 2C90B 1DY8A 2BZAA 3F9HA 4MG3A 4Y76A 1GJ5H 3ATWA 3M3VA 2FIRH 1O31A 1ZSJA 7ESTE 4BXSA 2GX4A 1YCPM 4IN2A 4UD9H 3UIRA 2QV1A 1FAXA 5F03A 1QJ7B 4OS7A 5ESTE 3SV2H 3VGCB 2XBVA 1W2KH 1UHBA 3RXCA 2ZFQH 5EXMA 2H9TH 1E35B 1F0RA 2WINI 4IGDA 1ORFA 1HAXB 1DT2A 1HAZB 4X6OA 1PQ7A 4UFGH 4DVAU 1TB6H 2IOTA 4X8SH 1O35A 4ABJA 1GBAA 1Y3UA 2BQWB 1BTYA 1SB1H 1AKSB 4WXIA 1ZJDA 3RLYH 1VR1H 4JZ1A 4X2WA 1CU1A 3MU1A 2SNVA 2NU3E 2PTNA 1LPKB 2GZ8A 2FZZA 1K21H 1GDQA 1D3PB 1CSOE 1LVMA 2GTBA 3DUXH 3LGWA 2Z9GA 4X2XA 3AASA 1OP8A 2GGVB 3SJOA 2A2XH 2QA9E 1FN6A 1V2OT 1ANBA 2FOHA 1GG6B 3BTQE 1ZR0A 3BTEE 3TVJB 2GT7A 3U69H 4B1TA 2ULLA 5EXLA 1IQEA 2ZPRA 1GJAB 4BTUB 5EU8A 2UWPA 2D26C 3L3TA 1YKTA 1PPFE 1GDUA 3C27B 3NPSA 5DP8A 1CHOF 5F6MA 3ZZ7A 1Z1JA 3LIWA 3MU4A 1QB9A 2A32A 1G3DA 1SGCA 3M35A 1WTGH 4X1SU 1MTVA 1SMFE 4A6LA 4ZXXH 2ANWA 4H6TA 1JIRA 4I8LA 1TMUH 1UVUH 4JK6A 1QA7A 2AMPA 1TOCB 1MTSA 5C5OA 2J92A 5C3NA 1QBNA 3FVFB 3EA8A 3RC5A 1XUIA 5L2YH 1MD8A 1BRUP 2WPKS 4ZAEA 2O8WA 1GPZA 1NESE 3FAOA 2ALPA 2Z3CA 1RIWC 4JYVH 4NZLA 2BOKA 7GCHG 3JZ1B 3F9EA 2UUFB 3PO1B 2OINA 1BUIA 3ZYDA 4A1TA 3N7OA 1O2WA 1NRQH 1SLXB 4NIWA 3KN2A 4FUHA 1BHXF 4I8KA 1XUKA 3SJKA 3SUFA 3URDA 5J4SA 1QGFA 1XUFA 2QN5T 1RTKA 2AIQA 1SGFA 2P3UB 4FU8A 4OGXA 1CT0E 4X0WU 2OBQA 2JH6D 1L2EA 1C1MA 3GCNA 5CHAB 3RXBA 4CHAB 1GBKA 3KNXA 4YOGA 2BXUH 1QR3E 1H8IH 3GDVA 1BBRH 1TGTA 2ZHDA 1U6QA 4CRFA 5FHTA 5GWZA 2BLVA 4FUIA 5FX6A 4IW4E 2SGQE 1T8OA 1O3FA 1WTHD 1DY9A 1VGCB 1YC0A 3MO6A 1PJPA 1FNIA 1EAWA 1ELEE 1ESAA 4ABDA 4KTCA 1EPTC 2A4GA 3SNDA 2F9PA 2VNTA 1GHZA 3PWBA 3NXPA 5JB8S 2ANKH 3ZV9A 3E8LA 6GCHF 1DLEA 3S0NA 1GGDC 4D76A 1H4WA 2CGAA 4ZHLU 4FU9A 2C8WB 1ZPCA 2CF9H 1NC6A 2FOCA 1GDNA 1WYKA 1ARBA 1BBRK 3A8BA 1HB0B 2BXTH 1TLDA 5I25A 4X6PA 3RU4E 1W0ZU 4IMQA 2C3SA 3F1SB 3SORA 1NRNH 3ZYEA 1FMGA 1C2HA 2QYIA 1F0SA 1P57B 3RC6A 2FS8A 1FV9A 1ZHRA 3FZDA 2TGTA 3CS0A 4KGAA 1B0FA 3SV7A 1TNIA 4HZHA 2JETB 2BVSH 3V0XA 4X1PU 3UOPA 3QTOH 1V2NT 5GIBA 1MKWH 1CGIE 1DSUA 2RA3A 1PQ5A 4DIHH 1WU1A 2ZU4A 3KIDU 1P03A 4XE4A 1PPZA 2ZU3A 1MH0A 2QXIA 2ZCKP 1K2I1 4WWYA 4E7NA 3A85A 3QN7A 2SGDE 3SQEE 1O3NA 1BJVA 1MAYA 2VVVA 1KY9A 2V6NA 1GI5A 2B0FA 3H7OA 1C2FA 1O2IA 2VGCC 3PMAB 3OYPA 5GCHG 3E0NB 2A45B 3KQDA 1P9UA 1MKWK 2O8TA 3T62A 1W13U 1KXAA 2PLXA 2GCHG 1C5XB 2GVFA 3FP6E 1X7AC 5A0BA 2VWNA 2B8OH 4I8GA 2GMTC 2RG3A 1JIMA 1ELCA 1MCVA 2QXJA 4GCHF 5F8XA 2QCYA 1UCYH 1YPEH 2PUXB 4LZ4B 3LPRA 2Y81A 1KXFA 4GHTA 2JH0D 1GMDF 1IAUA 2ZPQA 4X1RU 1IQJA 1BMNH 3HGNA 2ZKSA 1O3DA 3TK6A 1L1NA 1EP6A 1CT2E 2GDEH 2GCTB 4TY7A 2FP7B 1BA8B 4JZEH 1QB6A 3ATMA 4U32A 2PSXA 2DE9A 1KTSB 7KMEH 3GY3A 4AGKA 4BXWA 5K7RA 1O3JA 1P0SH 1TPOA 4FUBA 1ZPBA 3T5FH 1S85A 3KGPA 1DFPA 3ZV8A 2Y5FA 1GCTB 3R0FA 4A92A 1O2QA 1UCYK 3A7TA 4ZKNU 2ZU1A 4MPWA 2WV5A 1D4PB 3IITA 3E1XB 3I78A 1NZQH 1E36B 2JKHA 4ABEA 4MPUA 1BB0B 4JYTA 1Q3XA 5IYTA 2FX6A 5E2OA 1AI8H 1SPJA 3ZVGA 1C5MD 1Y5AT 1JRTA 2IPHA 1V2LT 2O8MA 5A0AE 1UVOA 3UREA 2TGPZ 4D9RA 2ZGHA 3BG4C 1A5IA 1V2PT 2P3FH 1D3DB 1D3QB 2H1UA 2VWOA 3DD2H 1P3CA 1QCPA 3SGAE 1BQYA 1IHTH 3QZQA 1HAPH 5K0HA 1WOFA 5HXFA 2WUCA 1PQ8A 2ZZUH 3ZVBA 4X8UH 1NT1A 1HJ9A 2XC4A 3RXHA 2KAIB 1TWXB 3UR6A 1Y59T 4ISOA 3TJNA 1ZJKA 1IQLA 4GUXA 3TITA 5FPTA 2ODYB 3JZ2B 1G32B 1N1LA 4ESTE 1VZQH 5CE1A 4WMEA 2B7DH 3T2NA 3TJOA 3SGQE 1SHYA 1DANH 2W7UA 1NFYA 2ZDNA 1V3XA 1MU6B 3MU5A 1YPJH 2M5TA 5E8EH 1MBMA 1Y8TA 5GDSH 4CH2B 1J16A 4Y11E 1ARCA 2I6SA 1K1OA 2VJ1A 3MYWA 3UQVA 3CENA 2FS9A 1EZSC 4HGCA 1S0RA 1TA2A 1BZXE 2ZC9H 3L33A 4JK5A 1OWKA 2ZFTA 3RXRA 2R2WU 4DIIH 1YYY1 5T6GA 3GCTF 1ZGIA 2R2MB 2ZEBA 1C4V2 1QQUA 1VCWA 1FPHH 1LHCH 5HYOA 2SNWA 1GCDA 3MO3A 1H8DH 1NN6A
chains in the Genus database with same CATH superfamily
1UHBB 1QBOA 2DE8A 3MFJA 1V2QT 1BTPA 2ZI2H 1A3EH 4CR9A 1CA0B 1TYNA 2BDHA 1RFNA 4B2AA 3KYGA 4WVPE 4ABFA 3Q3KA 3VB3A 2BDCA 2Y5GA 2ZU2A 2Z9IA 1YPHC 2KX4A 3LT3A 8LPRA 1B5GH 2H9EH 3GY2A 3RM2H 2BD5A 5FAHA 2L74A 5HIZA 3SJIA 4I7YH 2AHME 4INHA 4OS4A 3OSYA 5LH8A 2OUAA 4MNYA 1O3PB 4CRGA 4HTCH 2W5EA 1C1VH 1EX3A 2PR3A 1O5CB 4H42U 1LO6A 1AGJA 1LHGH 1O2GH 3MMGA 5DP6A 1KSNA 3V3MA 4Y8ZA 4E05H 2ZGBH 1TMTH 3M5OA 1BCUH 2YNBA 2CN0H 1JXPA 1O2KA 4YXWD 3P6ZB 1TA6A 3SJ8A 1DXWA 4MLFB 2VIDA 1V2KT 3SNEA 3NKKA 3SU1A 2J5UA 1ZHPA 5DP7A 1DPOA 3SUEA 2BB4A 2OLGA 3ZZDA 4NA9H 2I6QA 5JBBS 2J94A 4AGJA 2G81E 1RJXB 1H9IE 1VITH 1ELAA 4KKDA 1T8MA 1SGTA 3A8CA 2STBE 1P2JA 3EE0B 2FOFA 1A5HA 3DT0H 4BANB 5FPYA 4ZCNA 2PUQH 1XX9A 5CHAC 3C1KA 3PLBA 3T28A 2G4UA 1AMHA 1MUEB 2ZFRH 3LGTA 1GJ9B 3ODDA 1DM4B 4Z0KA 2STAE 2BM2A 2HPPH 4PROA 3A81A 5DG6A 1V2WT 1T4VH 1UCYE 2WUBA 1QIXB 3FANA 2A4RA 2PSYA 4E06H 1NBMD 1O3HA 4B2BA 4MPVA 4D9QA 1UW7A 2BLOA 2XBWA 3BTME 3ATIA 4I31A 1FLEE 2JH5D 3BTDE 1Y3YA 4ISIH 1SQTA 1L4ZA 4YT6H 4ZXYH 3SV9A 1Z6EA 1FIZA 3OFND 5AVDA 3ZVEA 4NWKA 3MU0A 4UE7H 1E0FD 3ZZAA 2BD7A 5FX5A 1NRPH 1F5LA 1AZZA 2VU8E 5A0CA 1GVZA 4RKOB 1Z1IA 1JRSA 2VIVA 1C1OA 4OM9A 3MH7A 3PROA 3PRDA 1TGCA 1V2ST 2KAIA 4AFQA 1FUJA 1JOUB 1TE0A 2SGAA 1HFDA 1K9OE 1O2UA 1K1PA 3P95A 5JPMH 1C5LH 1ELGA 1PFXC 1O38A 3PTBA 1DUEA 2BX4A 3K9XB 3RC4A 3SU4A 2ZDAH 3U8RH 3BTKE 1MQ6A 4KELA 3QGNB 4HG6A 2JJ1D 1GHBF 3PM3A 2GKVE 2A0QB 8GCHG 1O2PA 3I29A 1AN1E 1WBGB 1GHAF 3AW0A 5JDUB 3SOSA 1F2SE 5T3HA 5C1XA 4M7GA 2ZGCA 1C1PA 1C5YB 3ZZ5A 1PYTC 3VB5A 4YO9A 1GBCA 2ZHEH 1GHYH 3BF6H 4K5ZA 1Z8RA 3H5CB 1E38B 3SNAA 5HM2A 4JZIA 4BAOB 4Q80A 1EOJA 2Z3DA 4AB8A 2Z7FE 4GSOA 1E34B 1CGHA 3S9CA 1MBQA 3DSPA 2BOHB 3TJVA 1DS2E 1G3BA 4DOQA 1SL3A 4K1TA 1MABB 2BQ6B 1GMHG 2C8ZB 4U30A 5HM9A 1QNJA 4MNVA 3BIVH 1TBRH 1NS3A 4ZHMU 1C2MA 4AFSA 1QJ1B 2V3OH 2Z9KA 1J8AA 1NROH 2BDAA 4I33A 1GBJA 1RS0A 4UFEH 1AE8H 1BT7A 1AO5A 3I77A 3UB0A 1H1BA 2J95A 5DP4A 5FXLA 4ISNA 3TLOA 3PTNA 1C5SA 2EY4C 1E1RD 1UJ1A 4Y10E 4ASUD 3NUMA 5GJ4B 2WPLS 5ESBA 3ENSB 2XBXA 1K1LA 1C5NH 2QF5A 4RT1A 4ASHA 2R9PA 4R0IA 3A8DA 1BMLA 3IWMA 1SC8U 1YBWA 1UTQA 2GCTC 2ILNA 2ZDMA 1YY3A 2F83A 2VVUA 2CHAC 4K60A 2J98B 3LC5A 3M61U 4X8VH 2A4QA 1AU8A 4Q4LA 3P70B 5EPYA 5TCAA 3NRLA 1JMOH 1FN8A 1DWBH 3M7UA 2OC8A 4JZFH 2QIQA 3KQCA 4LK4A 1DDJA 1SFIA 1RRKA 3LGUA 3S7KB 3ATKA 2ZDKA 1RTLA 4VGCB 3A87A 1GHVH 2PHBA 1YP9A 1O2LA 1NY22 4ZH8A 4UDWH 3SNBA 3ZZ8A 1P2MA 1OHHD 2AYWA 3MH4A 3ZVDA 3ATLA 3GISB 3U1IB 1A1RA 2BY9X 1ELDE 5DP5A 4MDSA 2J2UA 3F2HA 1MTWA 3SU0A 1O36A 2G8TA 2R3YA 4JMYA 6ESTA 2FOEA 1C2GA 1YLDA 3ESTA 3PWCA 1UTPA 2AIPA 1MU8B 4A5TS 1YF4A 2VVCA 3A83A 2GDDA 4WH8A 1ZGVA 1AY6H 2NU2E 1XM1A 1P9SA 1YPLH 4GLYA 1H8ED 1C5QA 3P8FA 1D3TB 1YM0A 3BSQA 2Q6DA 2PGQB 4ABGA 1RGQA 3V12A 4XD7D 1F5KU 1AZ8A 2FX4A 1YLNA 4Y7BA 3MNXA 1K1MA 2BHGA 1W10U 1BTUA 1K28D 3ZVAA 3UWIA 3UNQA 2BDIA 3H7TA 4BTTB 1A2CH 2VH6A 3SI4H 5LPEA 3A7XA 4LZ1H 3LDXH 1EZUC 5HMAA 4DW2U 2HNTE 2BMGB 2BY6X 4FXGH 3UNSA 2OD3B 4AG2A 4UEHH 2QF0A 1DWDH 3SZNA 4FOUC 1BTXA 7GCHF 1N8OB 3A88A 2TRMA 1B0EA 2TPIZ 3ZVCA 4FUJA 1ELVA 2XYAA 5ETXA 1S82A 2F9NA 2HPQH 3SU3A 1HV7A 4Y6DA 1W7XH 2P94A 4ABAA 2F91A 3BTGE 2WPDD 4O3TA 1N6XA 2D1JA 4DCDA 1F5RA 1FX0B 3W94A 5JB9S 1MTUA 3MH6A 4TSFD 4DT7B 1NU9A 3V7TA 1DSTA 1NRRH 1SG8B 1WV7H 3SJ9A 3B9FH 2ZDLA 2XWAA 4GVUA 3K6YA 3TNSA 2A7CA 1G30B 4IMZA 3UWJH 1K1JA 1DWCH 2Q6FA 1CA0C 1CQQA 4K8YA 1SLWB 2FDAA 1O32A 3OEHD 3A7WA 4CRBA 4E7RG 2FTLE 1CE5A 4NA7A 1ZPZA 1SR5C 5BPEA 3SGBE 4IC5A 3STIA 1O2VA 1ID5H 3F2GA 1Z7KA 4XSKU 1A61H 2WZQA 1ABIH 1QZ8A 1MMJN 2ZQ2A 2IN2A 1UK3A 5T6FA 1EAUA 4MPXA 4DJZB 2XBYA 1AVXA 1PPHE 1S5SA 2WYJA 1FPCH 1TX6A 3U1JB 3URCA 2HLCA 1A0HB 1HLTH 4Q7XA 5EQRA 4B71A 4P02A 2Z9LA 3MHWU 4Y0YE 4D7FA 3RXEA 1KTTB 1GL1A 5ABWA 5EIYA 2F9BH 3M37A 2AERH 3T25A 4ABIA 3HKIB 5LGOA 1TMBH 2RDEA 1DE7H 1YPMH 2ZF0H 1LQDB 1S6FA 4NA8A 3KQ5A 1FAKH 3GCHC 4AX9H 3O8RA 4INKA 3AVZA 4I8HA 5CMXH 1LPZB 3TIUA 3MQKC 1XKAC 2EI6A 3SUDA 4DG4A 4ABBA 3HATH 4RKJB 2ZTXA 5G4BA 2H5CA 3CNRA 3WY8A 2FPZA 1V2TT 5EQQA 2O9QA 4Z6AH 1P02A 5C94A 1W7GH 3QLPH 4NSVA 1HIAB 1GBHA 4X6MA 1V2UT 5C2ZA 1TNHA 1FY4A 1G9IE 3WWBA 2XCNA 1SGQE 4OGYA 3DFJA 5LPRA 1ZMJA 1IQMA 1FJSA 1INCA 2BDBA 3V13A 1UVSH 3GCOA 1AUJA 2HWLB 2P59A 1GMCG 2H6MA 3RDZA 1ETRH 3RXMA 1SGIB 3K65B 3TH4H 3BEFB 5EXNA 4CBNA 1GMDG 1GWAA 1IQKA 2YMSB 1YGCH 3LGYA 3P92A 4UONA 2KCAA 4RT0A 5GCHF 3RP2A 3LGVA 3BTFE 1TPPA 2JJ2D 1IQIA 1XUGA 1O3BA 3ZIAD 1O2XA 4I32A 1SGRE 3FZZA 2V0BA 3MNSA 2GCHF 2J9NA 1UTMA 1FY8E 3SU6A 1P09A 4XOJA 2PP6A 1O2SA 5B6LA 1BMMH 1Z8JB 1MCTA 3RMOH 3HK3B 2ODQA 3RXUA 4FETA 4NIXA 1OOKB 3OAAD 2ZTYA 4WJG2 4B6FA 1GBMA 3AW1A 2C8XB 3EDXB 2PKSC 4FUEA 1TALA 2ZFPH 3MO9A 2WPIS 3RXJA 2W6JD 3LH1A 3UQOA 1VITG 4X6NA 1S0QA 4GAWA 1TNGA 4H4FA 1TRNA 1O3IA 3SYJA 6CHAC 1O3KA 1TONA 1PQAA 5IK2D 1TPAE 2XNDD 1O2TA 4LXBH 3KQEA 2Z94A 2QXGA 4H6SB 3TJUA 1MTNB 1SGEE 1AHTH 3A7VA 3UR9A 1IQFA 3U28C 1NO9H 2UWLA 5A09A 1P04A 4AOQA 1QTFA 4UFDH 2ZO3H 1O3EA 4BOHA 2G51A 3O8BA 1J9CH 2VWMA 3RXPA 1TNKA 5DSFA 2Y80A 3E6PH 1O33A 1C1NA 3F9FA 1E79D 2XTTB 2ZGXH 4TPIZ 2FLRH 2ZHQH 3VGCC 4MQAA 1WSSH 1SQOA 3UAIC 2Q6GA 2THFB 3TU7H 1H8HD 1C1TA 1DITH 2D2DA 1EP5A 1BRCE 4I8JA 1FZZA 1C2JA 4YESB 3BEIB 1BJUA 1VJ9U 1WAYB 3AAUA 3BIUH 1QRWA 2O8UA 1SGYE 3SW2B 1N6YA 2C4FH 3SU5A 3VXEH 1XMNB 2BX3A 9LPRA 1LCYA 1RIWB 1GHXH 2HVYB 2A7HA 2L6OA 4THNH 1BTHH 3BTHE 2A5AA 2J97A 2NU0E 4FUFA 5FBIA 3QK1A 1HAGE 2TGDA 5EGMA 5L6NH 4XRNA 3SU2A 5C67A 5TCCA 1EOLA 3U8OH 2ZCHP 1Q31A 2W6ID 1PPGE 5DN6D 1TQ0B 2Y6TA 3TH3H 1S6LA 1XKBC 1P2QA 2WHXA 1TABE 3ZZ9A 2EEKA 4NIVA 1OSSA 3S69A 2CK3D 5L2ZH 2GV7A 1GG6C 4K3JA 3WW7A 1L4DA 2B9LA 1P10A 3RXLA 2R0KA 1THPB 3PLPA 1OWIA 1NFWA 3TK5A 2PKAA 1LQEA 2P8OB 2AH4X 4TWYA 2AMDA 2ZA5A 1QA0A 4IS5A 3MH5A 5PTPA 1SVPA 1P06A 4SGBE 1P2OA 1RXPA 1DXPA 1T7CA 1MKXH 2PW8H 1G2LA 1TQ7B 4K1SA 4SGAE 3Q76A 1O39A 2PWXA 2ZQ1A 3GICB 3A84A 3IG6B 3RXGA 2AFQB 1AB9B 1AE5A 1HIAA 1VCQA 2NWNA 3RXQA 4YZUA 1EPTB 1ESBA 6LPRA 4MNWA 1SBWA 2GZ7A 1QQ4A 1ZHMA 1GGDB 1GI2A 5AHGH 2QGRA 4TPYA 1IQGA 2BY7X 1HAHH 3L6PA 3EE7A 1ZZZA 2BD9A 1ZRKA 1MZDA 3RXFA 4OS1A 1MQ5A 1ANCA 4D7GA 5E2PA 3RXTA 1MKXK 3QX5H 2FYRA 3PO1C 1GBFA 5EJ1A 1AWFH 2FOAA 1KXBA 3ODFA 1EXFA 1C1RA 2W7SA 1GVKB 1UTKA 2PTCE 5F8TA 2RFKC 4ACBA 2F43B 2QAAA 1SSXA 2BVXH 2EC9H 1T4UH 1GHWH 1HDTH 2QF4A 1AFQB 5EQSA 3OY5U 3K6ZA 2G5NA 2BDYA 1WQSA 3DA9B 3U98H 3FP7E 4NGAH 4Y8YA 3S9BA 4ISHH 1T8NA 1ZYOA 5EOKA 3F0OA 1Y5BT 2NU4E 2SGPE 1BDAA 1V2RT 1ACBE 2BDGA 3RMLH 4CHAC 1A3BH 1S84A 3FFGA 4CRDA 2RDLA 3RXAA 3EYDA 3TGKE 1GJDB 1ZTKA 3OY6U 4NIYA 2HALA 1ETSH 4A7IB 3RXSA 2FLBH 2A1DB 4WF8A 1BRAA 1C1WH 2WSSD 3QO6A 4INLA 3FOAA 1TRYA 5DP9A 4CH8B 5EW1H 1EZXC 1QRXA 1TGNA 3OEED 4MVNA 1W0KD 2WV9A 2ANMH 2XCFA 1VGCC 3HKJB 1LHFH 1HXEH 3PV4A 2OP9A 2EI7A 1GI8B 1UVTH 2VIOA 3EAJA 3FN8A 1C1SA 1GBLA 2AGGX 2V7QD 1NBME 1QRZA 1OP2A 3SNCA 1C2KA 3Q77A 2QY0B 2VIQA 3SN8A 3UTUH 1DUAA 1IOEA 1V2VT 4ZKOU 1XVOA 1C9PA 2GMTB 1LVBA 1B7XB 1D6WA 1MD7A 1GI1A 1OYTH 2BLWA 4ZMAH 1K1NA 1C4U2 1ZLRA 4D8NA 4TYDA 2GT8A 2NU1E 2SGEE 1KDQB 2Z6BD 3BG8A 4K2YA 1UTOA 1YWUA 4DGJA 1XVMA 4J1YA 1C5ZB 2CV3A 3VB6A 4OS6A 1GI9B 1DWEH 2V3HH 5DPAA 1BOQA 2P3TB 1WUNH 4ISLA 3SHAH 2P95A 2JETC 3KYFA 2VIPA 1QL9A 3EA9A 1UTLM 2BY5X 2VH0A 1S83A 4CBOA 1THSH 1Z6JH 3GYMA 3M5NA 4ACAA 4Q7YA 1KYNA 3E90B 3NWUA 1CBWB 4AYYB 1MZAA 3F3BA 3FO8D 5LPFA 3BV9B 3SO3A 1O5GH 4GHQA 3LGIA 1BITA 1C2IA 4X8TH 1BIOA 1FDPA 4FUCA 1EFRD 3U8TH 1WDIA 1UMAH 3UNRA 5SGAE 1A0LA 1W8BH 1EZQA 3QTVH 4AFZA 4X2VA 2F3CE 1UO6A 1QURH 3BG4B 4JZDH 1HAIH 4RI0A 4X1QU 1K1IA 8GCHF 3D23A 2UUJB 3N99A 3Q3YA 3F6UH 1F0UA 1DX5M 1Q2WA 1QY6A 2A2QH 2Y7XA 2KR7A 5C0UA 1HPGA 1O2ZA 1QBVH 2UUYA 4F48B 1OWDA 1GJ8B 1TBZH 3GDSA 1BMAA 2UWOA 1FIWA 3PB1E 2ZWLH 1O2RA 1SQRA 1GI6A 1O0DH 2IPQX 1H9HE 1AUTC 1PPEE 1IQHA 4UFFH 1CHGA 1RD3B 3M3SA 1OKXA 1HUTH 1GMHF 1EPTA 1EB1H 4B73A 3VEQB 1W14U 4FVDA 3LU9B 4XFQA 1P2NA 2KZ4A 4HI3A 1DLKB 1PYTD 1J14A 1QB1A 1HCGA 1ZMLA 2J38A 8KME2 1GCTC 5TJXA 5A8YA 2WYGA 1TOMH 1Y3VA 2BD4A 2W3IA 4J2YB 2HOBA 2ZPSA 1VKYA 5JBTA 5BRRE 2AS9A 2FEQH 4QT8C 3ZZ3A 1FXYA 3OU0A 4Y0ZE 3BEUA 3TNTA 1KMHB 3M3TA 1CHOG 1C5PA 2OC0A 2J4IA 2OBOA 2A31A 1GVLA 1NPMA 1KLIH 2FI5E 2ESTE 1MTNC 2BTCE 5FCKA 3NK8A 4ZKSU 4ABHA 3SQHE 5DKMA 2PGBB 1SI5H 4ZKRU 1A7SA 1P11E 2W26A 2HNTC 4Y7AA 1P2IA 3DFLA 1W12U 1QHRB 3U9AH 1BMFD 1K0HA 2BZ6H 3CS7A 3A89A 1T8LA 3KF2A 1GI7B 3B23B 4DY7B 2PFEA 2RCEA 4JCNA 3RM0H 1G3EA 1O3AA 1C5OH 1QFKH 2WPMS 1ZSKA 2FWWA 1F92A 3ZVFA 1O2MA 1H9LB 3KCGH 4OS2A 1TBQH 4DURA 1AIXH 3M36A 1P8VC 4NWLA 2OTVA 5IDKA 3WWFA 1O3CA 1BTZA 1A0JA 2P16A 2BYAX 1EJMA 2HVXA 3A8AA 5C0TA 3VXFH 2GZ9A 1BHXB 4BAMB 4WMDA 1KDQA 2QC2A 4AG1A 5HIYA 1EJNA 1HBTH 1L1JA 1FONA 4YLUA 4CREA 4B74A 2ZIQH 1C2DA 3D65E 1ZSLA 2ASUB 4AB9A 1UK2A 1OWJA 7LPRA 3EA7A 4WH6A 2K1QA 3MI4A 1O34A 1SOZA 2ZCLP 1O37A 2ODPA 1AFEH 3MTYA 5EJZA 5FBEA 4Q7ZA 3SV8A 1LPGB 4U2WA 5DGJA 4AC9A 5C1YA 2ZDVH 2P8OC 2HRVA 2G4TA 2AGIX 2HGTH 2W3KA 1SLUB 4X2YA 2M2AA 2O8LA 1HRTH 4Z1MD 1UK4A 6GCHG 1SGDE 3DSOA 5EG4A 1BTWA 3O8DA 1CT4E 1QJ6B 1C1QA 2G52A 3GDUA 5DP3A 5C17A 5I46H 1E37B 3QZRA 1OWHA 3Q00A 2HLDD 2F9VA 2ZG0H 1GBBA 3CP7A 3F0PA 2RA0A 3ELAH 4YLQH 2A5IA 3RMMH 1AB9C 4WMFA 1NFXA 2H9HA 3B8JA 1J15A 3NZIA 1GBTA 4Q2KA 1HJAB 1GI0A 1T31A 3RU4D 4A1VA 2BD3A 3A7ZA 2XC5A 1C2EA 3F2FA 1SLVB 2GD4B 1OP0A 1L0ZA 3P8GA 3UFAA 1LDTT 5F8ZA 1F7ZA 1HGTH 2TIOA 2QXHA 1HXFH 2PKAB 1Z8IB 4WY3A 5EW2H 1NM6A 1ZMNA 5T6DA 3ZZ4A 2ZHWH 1O5EH 3RXVA 3W95A 1RTFB 3S9AA 1TX7A 5AFZH 5GXPA 3TGIE 4XBBA 3H09A 3OTJE 1AFQC 4KTUA 3BN9A 4BAHB 5J4QA 2A5KA 3K2UA 1Y3XA 2J34A 1KXDA 4BAKB 2GP9B 1O3MA 2OQUA 2IJD1 4AFUA 4AORA 1AKSA 3P8OA 3RUOA 2FXRA 1EKBB 2KFWA 3GY4A 2BY8X 4KTSA 4K8BA 1NFUA 1LMWB 2BVRH 1DOJA 2XRCA 4KP0A 1E1QD 4YTAA 1QL8A 4DT4A 4MTBA 1G36A 4GCHG 1O5BB 1ZRBA 2ZGJA 4YT7H 1WCZA 1TPSA 4Y79A 1XUHA 1Y5UT 2C93B 4MNXA 3KQBA 1FQ3A 2BD2A 1A4WH 1W0JD 3VB7A 3E0PB 1LKBA 3T26A 5F53A 2TGAA 1C5WB 5FCRA 2FOGA 3OTPA 1C2LA 1EAXA 1TGSZ 1AVGH 3STJA 5H4IB 1AWHB 5E0JA 2F9OA 1O2HA 2BQ7B 4YOIA 1VJAU 2FOMB 1GMCF 3GY6A 2QE7D 3GY5A 1DVAH 4YOJA 2ANYA 1PPBH 3UY9A 2FM2A 1THRH 3LJOA 4F49A 1CVWH 1EUFA 5AFYH 3BTWE 2A4OA 2QF3A 1KXEA 2G5VA 2WPHS 3QGJA 2CHAB 4IC6A 1FY5A 2AMQA 3ITIA 4Y8XA 1C1UH 2DUCA 3ZZBA 2AEIH 1KLTA 5A8ZA 2KCOA 1AVWA 3MOCA 1COWD 3M7QA 1HAVB 1ANDA 5C1UA 1CBWC 1OX1A 1V2MT 2A7JA 3VFEA 2XXLA 4ZROA 5DO4H 1IQNA 3T29A 2EA3A 4K1EA 3S7HB 2YOLA 1O3OA 1VCPA 5JYIA 1P12E 1K22H 2P93A 4LOYH 4CRCA 3LJJA 3MNCA 5B6OA 1O2NA 2Y7ZA 3G01A 1VITF 4NCYA 1SFQB 2V35A 2VWLA 3MWIU 2TBSA 2Y82A 2OC7A 1YPGH 2Z3EA 3RU4T 2HNTF 1SGNE 2IJOB 1SOTA 2BLQA 3HGPA 2Y5HA 3M7TA 4CRAA 1W0YH 1KLJH 1LVOA 1ELFA 2UUKB 3GY8A 4XBDA 3VG8A 3EGKH 2FI4E 4O03A 4CR5A 1FY1A 3PLKA 3LC3A 4NFFA 5C20A 1GL0E 1W3CA 4ZUHA 1UVPA 3RXKA 4AZ2B 2BD8A 4F55A 4BNRA 3TGJE 2CJIA 2GV6A 4AN7A 1P3EA 3QUMP 3SHCH 4F4OC 1D6RA 1GBEA 2OQ5A 2LPRA 1O5AB 3AAVA 1W11U 1V2JT 2ZHFH 3GCTG 2CXVA 2ZP0H 5KEDA 1G37A 1EB2A 1AD8H 3VPKA 2SFAA 3TH2H 2EI8A 4XDEA 3BTTE 5FL7D 5HKKD 2F9UA 1YLCA 1EQ9A 1O2JA 2K8IA 3LH3A 1UTNA 2FOBA 1O5DH 2FTMA 4VGCC 1BBRE 1HJ8A 1C5RA 4K69A 2VINA 3GYLB 3E91A 2CMYA 1KIGH 1TX8A 2OXSA 1ELBA 3Q3XA 4TWWA 3AK5A 2JIZD 1P01A 3QDZB 2Z9JA 4OS5A 2CF8H 4U01A 1O3LA 4WXVA 3T27A 1O5FH 3E3TA 4NFEA 3MU8A 2ZTZA 4TY6A 2GJGA 3KHVA 1P05A 1ZTLA 3HK6B 4NG9H 1SGPE 1UTJA 2Q1JA 1QL7A 3FKSD 1S81A 2ZECA 1O30A 1TNLA 4FUDA 3OX7U 1CA8B 1O2YA 5L30H 2KCPA 1ELTA 3PMHB 1A46H 1OPHB 1IHSH 1SQAA 9ESTA 1EASA 2ZFSA 4RSPA 4A1XA 3D49H 1ABJH 1P2KA 2VIWA 1A5GH 5DK1A 2XNIA 5EPNA 5HGGA 1EAIA 1EJAA 2FESH 3A80A 1D9IA 1L1GA 1Z8GA 3UUZA 1ESTA 1BRBE 1HAYB 4FU7A 2C8YB 1GJ7B 1C5TA 1JWTA 3MNBA 4AYVB 2ALVA 1NU7B 1ZOMA 1DICA 1ETTH 1LKAA 3RXOA 3VB4A 1HNEE 4BAQB 3NCLA 1T32A 4HFPB 1GJBB 1HAOH 1N8OC 3GY7A 4B2CA 3PV5A 1YPHE 3KL6A 5T1VA 1FY3A 1Y3WA 2ZU5A 3QWCH 1GBDA 2PV9B 1GJ4H 5A8XA 1TIOA 3N7DA 3M5LA 1ZTJA 3GCHB 3ZZ6A 1OWEA 2XOKD 2VBCA 2FODA 3F68H 3O8CA 3PMBB 4GPGA 3SUGA 2R0LA 1J17T 5DJ7A 4X1NU 5C5NA 1O2OA 4BTIB 1LHEH 1G3CA 4O97A 4IBLH 1HAVA 3TK9A 1PPCE 5GNDA 4B76A 2VGCB 2OCVB 1O3GA 3UOUA 4NSYA 1F0TA 3LKWA 1GI3A 5EODA 1G2MA 5AF9H 1NTPA 1LHDH 5A2MH 3RMNH 2D8WA 3A7YA 2ZFFH 3EQ0H 2KCYA 3M5MA 4RN6A 3TPIZ 3PYHA 1C5UA 1TGBA 1V6DA 1C9TA 2SGFE 1YPKH 1GI4A 3LONA 2V3MA 2XW9A 1C4Y2 1C5VA 2H2ZA 5CDFE 1OYQA 1S6HA 3A86A 1TRMA 4FUGA 1OXGA 4R8TB 2YNAA 3P8NA 1YCPH 3ZZCA 5E0GA 4ZHAA 1SGFG 1Z71A 3E16B 5GPIB 4O3UA 4JYUH 2LNCA 1KXCA 1HJAC 1GJ6A 3SV6A 1JBUH 1LVYA 1LTOA 2WV4A 2ZNKH 1XUJA 8ESTE 3F9GA 1OS8A 5E0HA 1SHHB 3DHKH 1GHBG 1WQVH 4O9VA 1TFXA 3P17H 2OC1A 4NZQA 2AGEX 3LOXA 1GJCB 1XXDA 2G55A 4B75A 1TAWA 3DSGA 3UPEA 1M9UA 2XC0A 1AQ7A 1CO7E 1GBIA 1GHAG 5JBCS 2FYQA 1FI8A 4Y71A 3SI3H 2PKSB 1YCPK 1EATA 1MAXA 1TNJA 5JBAS 3A82A 2G00A 5FPSA 4IN1A 3KEEA 2FI3E 6CHAB 1ANEA 2FMJA 3R3GB 2VB0A 3RXIA 3GOVB 4YM9A 2FO9A 4FVBA 3RXDA 3PMJA 1CGJE 3HPTB 3SBKA 1HYLA 2R3UA 1NRSH 2WPJS 2H5DA 3D62A 3FP8E 2XWBI 1XXFA 3RLWH 2B5TB 3GS9A 4XBCA 2C90B 1DY8A 2BZAA 3F9HA 4MG3A 4Y76A 1GJ5H 3ATWA 3M3VA 2FIRH 1O31A 1ZSJA 7ESTE 4BXSA 2GX4A 1YCPM 4IN2A 4UD9H 3UIRA 2QV1A 1FAXA 2YMSC 5F03A 1QJ7B 4OS7A 5ESTE 3SV2H 3VGCB 2XBVA 1W2KH 1UHBA 3RXCA 2EQNA 2ZFQH 5EXMA 2H9TH 1E35B 1F0RA 2WINI 4IGDA 1ORFA 1HAXB 3PRBA 2K0QA 1DT2A 1HAZB 4X6OA 1PQ7A 4UFGH 4DVAU 1TB6H 2IOTA 4X8SH 1O35A 4ABJA 1GBAA 1Y3UA 2BQWB 1BTYA 1SB1H 1AKSB 4WXIA 1ZJDA 3RLYH 1VR1H 4JZ1A 4X2WA 1CU1A 3MU1A 2SNVA 2NU3E 2PTNA 1LPKB 2GZ8A 2FZZA 1K21H 1GDQA 1D3PB 1CSOE 1LVMA 2GTBA 3DUXH 3LGWA 2Z9GA 4X2XA 3AASA 1OP8A 2GGVB 2YMSD 2A2XH 3SJOA 2QA9E 1FN6A 1V2OT 1ANBA 2FOHA 1GG6B 3BTQE 1ZR0A 3BTEE 3TVJB 2GT7A 4M9FA 3U69H 4B1TA 2ULLA 5EXLA 1IQEA 2ZPRA 1GJAB 4BTUB 5EU8A 2UWPA 2D26C 3L3TA 1YKTA 1PPFE 1GDUA 3C27B 3NPSA 5DP8A 1CHOF 5F6MA 3ZZ7A 1Z1JA 3LIWA 3MU4A 1QB9A 2A32A 3OE7D 1G3DA 1SGCA 3M35A 1WTGH 4X1SU 1MTVA 1SMFE 4A6LA 4ZXXH 2ANWA 4H6TA 1JIRA 4I8LA 3W1EA 1TMUH 1UVUH 4JK6A 1QA7A 2AMPA 1TOCB 1MTSA 5C5OA 2J92A 5C3NA 1QBNA 3FVFB 3EA8A 3RC5A 1XUIA 5L2YH 1MD8A 1BRUP 2WPKS 4ZAEA 2O8WA 1GPZA 1NESE 3FAOA 2ALPA 2Z3CA 1RIWC 4JYVH 4NZLA 2BOKA 7GCHG 3JZ1B 3F9EA 2UUFB 3PO1B 2OINA 1BUIA 3ZYDA 4A1TA 3N7OA 1O2WA 1NRQH 1SLXB 4NIWA 3KN2A 4FUHA 1BHXF 4I8KA 1XUKA 3SJKA 3SUFA 3URDA 5J4SA 1QGFA 1XUFA 2QN5T 1RTKA 2AIQA 1SGFA 2P3UB 4FU8A 4OGXA 1CT0E 4X0WU 2OBQA 2JH6D 1L2EA 1C1MA 3GCNA 5CHAB 3RXBA 4CHAB 1GBKA 3KNXA 4YOGA 2BXUH 1QR3E 1H8IH 3GDVA 1BBRH 1TGTA 2ZHDA 1U6QA 4CRFA 3N7EA 5FHTA 5GWZA 2BLVA 4FUIA 5FX6A 4IW4E 5CHBA 2F4LA 2SGQE 1T8OA 1O3FA 1WTHD 1DY9A 1VGCB 1YC0A 3MO6A 1PJPA 1FNIA 1EAWA 1ELEE 1ESAA 4ABDA 4KTCA 1EPTC 2A4GA 3SNDA 2F9PA 2VNTA 1GHZA 3PWBA 3NXPA 5JB8S 2ANKH 3ZV9A 3E8LA 6GCHF 1DLEA 3S0NA 1GGDC 4D76A 1H4WA 2CGAA 4ZHLU 4FU9A 2C8WB 1ZPCA 2CF9H 1NC6A 2FOCA 1GDNA 1WYKA 1ARBA 1BBRK 3A8BA 2OK5A 1HB0B 2BXTH 1TLDA 5I25A 4X6PA 3RU4E 3SZEA 1W0ZU 4IMQA 2C3SA 3F1SB 3SORA 1NRNH 3ZYEA 1FMGA 1C2HA 2QYIA 1F0SA 1P57B 3RC6A 2FS8A 1FV9A 1ZHRA 3FZDA 4TT3D 3PV2A 2TGTA 3CS0A 4KGAA 1B0FA 3SV7A 1TNIA 4HZHA 2JETB 2BVSH 3V0XA 4X1PU 3UOPA 3QTOH 1V2NT 5GIBA 1MKWH 1CGIE 1DSUA 2RA3A 1PQ5A 4DIHH 1WU1A 2ZU4A 3KIDU 1P03A 4XE4A 2JDID 4P00A 1PPZA 2ZU3A 5KECA 1MH0A 2QXIA 2ZCKP 1WXRA 1K2I1 4WWYA 4E7NA 4B6EA 2J98A 3A85A 3QN7A 2SGDE 3SQEE 1O3NA 1BJVA 1MAYA 2VVVA 1KY9A 2V6NA 1GI5A 2B0FA 3H7OA 1C2FA 1O2IA 2VGCC 3PMAB 3OYPA 5GCHG 3E0NB 2A45B 3KQDA 1P9UA 1MKWK 2O8TA 3T62A 1W13U 1KXAA 2PLXA 2GCHG 1C5XB 2GVFA 3FP6E 1X7AC 5A0BA 2VWNA 2B8OH 4I8GA 2GMTC 2RG3A 1JIMA 1ELCA 1MCVA 2QXJA 4GCHF 5F8XA 2QCYA 1UCYH 1YPEH 2PUXB 4LZ4B 3LPRA 2Y81A 1KXFA 4GHTA 2JH0D 1GMDF 1IAUA 2ZPQA 4X1RU 1IQJA 1BMNH 3HGNA 2ZKSA 1O3DA 3TK6A 1L1NA 1EP6A 1CT2E 2GDEH 2GCTB 4TY7A 2LELA 2FP7B 1BA8B 4JZEH 1QB6A 3ATMA 4U32A 2PSXA 2DE9A 1KTSB 7KMEH 3GY3A 4AGKA 4BXWA 5K7RA 1O3JA 1P0SH 1TPOA 4FUBA 2LP6A 1ZPBA 3T5FH 1S85A 1SKYE 1DFPA 3KGPA 3ZV8A 2Y5FA 1GCTB 3R0FA 4A92A 1O2QA 1UCYK 3A7TA 4ZKNU 2ZU1A 4MPWA 2WV5A 1D4PB 3IITA 3E1XB 3I78A 1NZQH 1E36B 2JKHA 4ABEA 4MPUA 1BB0B 4JYTA 1Q3XA 5IYTA 2FX6A 5E2OA 1AI8H 1SPJA 3ZVGA 1C5MD 1Y5AT 1JRTA 2IPHA 1V2LT 4I86A 2O8MA 5A0AE 1UVOA 3DCLA 2TGPZ 3UREA 4D9RA 2ZGHA 3BG4C 1A5IA 1V2PT 2P3FH 1D3DB 1D3QB 2H1UA 2VWOA 3DD2H 1P3CA 1QCPA 3SGAE 1BQYA 1IHTH 3QZQA 1HAPH 5K0HA 1WOFA 5HXFA 2WUCA 1PQ8A 2ZZUH 3ZVBA 4Q63A 4X8UH 1NT1A 1HJ9A 2XC4A 3RXHA 2KAIB 1TWXB 3UR6A 1Y59T 4ISOA 3TJNA 1ZJKA 5EJLA 1IQLA 4GUXA 3TITA 5FPTA 2ODYB 3JZ2B 2KM0A 1G32B 1N1LA 4ESTE 1VZQH 5CE1A 4WMEA 2B7DH 3T2NA 3TJOA 3SGQE 1SHYA 1DANH 2W7UA 1NFYA 2ZDNA 1V3XA 1MU6B 3MU5A 1YPJH 2M5TA 5E8EH 1MBMA 1Y8TA 5GDSH 4CH2B 1J16A 5KGOA 4Y11E 1ARCA 2I6SA 1K1OA 2VJ1A 3MYWA 3UQVA 3CENA 2FS9A 1EZSC 4HGCA 1S0RA 1TA2A 1BZXE 2ZC9H 3L33A 4JK5A 1OWKA 2ZFTA 3RXRA 2R2WU 4DIIH 1YYY1 5T6GA 3GCTF 1ZGIA 2R2MB 2ZEBA 1C4V2 1QQUA 1VCWA 1FPHH 1LHCH 5HYOA 2SNWA 1GCDA 3MO3A 1H8DH 1NN6A
chains in the Genus database with same CATH topology
1UHBB 1QBOA 2DE8A 3MFJA 1V2QT 1BTPA 2ZI2H 1A3EH 4CR9A 1CA0B 1TYNA 2BDHA 1RFNA 4B2AA 4ABFA 4WVPE 3Q3KA 3VB3A 2BDCA 2Y5GA 2ZU2A 2Z9IA 1YPHC 3LT3A 8LPRA 1B5GH 2H9EH 3GY2A 3RM2H 2BD5A 5FAHA 3SJIA 4I7YH 4OS4A 4INHA 3OSYA 5LH8A 2OUAA 4MNYA 1O3PB 4CRGA 4HTCH 2W5EA 1C1VH 1EX3A 2PR3A 1O5CB 4H42U 1LO6A 1AGJA 1LHGH 1O2GH 3MMGA 5DP6A 1KSNA 3V3MA 4Y8ZA 4E05H 2ZGBH 1TMTH 3M5OA 1BCUH 2YNBA 2CN0H 1JXPA 1O2KA 3P6ZB 1TA6A 3SJ8A 1DXWA 4MLFB 2VIDA 1V2KT 3SNEA 3NKKA 3SU1A 1ZHPA 5DP7A 1DPOA 3SUEA 2BB4A 2OLGA 3ZZDA 4NA9H 2I6QA 5JBBS 2J94A 4AGJA 2G81E 1RJXB 1H9IE 1VITH 1ELAA 4KKDA 1T8MA 1SGTA 3A8CA 2STBE 1P2JA 3EE0B 2FOFA 1A5HA 3DT0H 4BANB 5FPYA 2PUQH 1XX9A 5CHAC 3C1KA 3PLBA 3T28A 2G4UA 1AMHA 1MUEB 2ZFRH 3LGTA 1GJ9B 3ODDA 1DM4B 4Z0KA 2STAE 2BM2A 2HPPH 4PROA 3A81A 5DG6A 1V2WT 1T4VH 1UCYE 2WUBA 1QIXB 3FANA 2A4RA 2PSYA 4E06H 1O3HA 4B2BA 4MPVA 4D9QA 2BLOA 2XBWA 3BTME 3ATIA 4I31A 1FLEE 2JH5D 3BTDE 1Y3YA 4ISIH 1SQTA 1L4ZA 4YT6H 4ZXYH 3SV9A 1Z6EA 1FIZA 3ZVEA 5AVDA 4NWKA 3MU0A 4UE7H 1E0FD 3ZZAA 2BD7A 5FX5A 1NRPH 1F5LA 1AZZA 2VU8E 5A0CA 1GVZA 4RKOB 1Z1IA 1JRSA 2VIVA 1C1OA 3MH7A 3PROA 1TGCA 1V2ST 2KAIA 4AFQA 1FUJA 1JOUB 1TE0A 2SGAA 1HFDA 1K9OE 1O2UA 1K1PA 3P95A 5JPMH 1C5LH 1ELGA 1PFXC 1O38A 3PTBA 1DUEA 2BX4A 3K9XB 3RC4A 3SU4A 2ZDAH 3U8RH 3BTKE 1MQ6A 4KELA 3QGNB 1GHBF 3PM3A 2GKVE 2A0QB 8GCHG 1O2PA 3I29A 1AN1E 1WBGB 1GHAF 3AW0A 5JDUB 3SOSA 1F2SE 5T3HA 5C1XA 4M7GA 2ZGCA 1C1PA 1C5YB 3ZZ5A 1PYTC 3VB5A 4YO9A 1GBCA 2ZHEH 1GHYH 3BF6H 4K5ZA 1Z8RA 3H5CB 1E38B 3SNAA 5HM2A 4JZIA 4BAOB 4Q80A 1EOJA 2Z3DA 4AB8A 2Z7FE 4GSOA 1E34B 1CGHA 3S9CA 1MBQA 2BOHB 3TJVA 1DS2E 1G3BA 4DOQA 1SL3A 4K1TA 2BQ6B 1GMHG 2C8ZB 4U30A 5HM9A 1QNJA 4MNVA 3BIVH 1TBRH 1NS3A 4ZHMU 1C2MA 4AFSA 1QJ1B 2V3OH 2Z9KA 1J8AA 1NROH 2BDAA 4I33A 1GBJA 1RS0A 4UFEH 1AE8H 1BT7A 1AO5A 3I77A 1H1BA 2J95A 5DP4A 5FXLA 4ISNA 3TLOA 3PTNA 1C5SA 1UJ1A 4Y10E 3NUMA 5GJ4B 2WPLS 5ESBA 3ENSB 2XBXA 1K1LA 1C5NH 4ASHA 2R9PA 4R0IA 3A8DA 1BMLA 3IWMA 1SC8U 1YBWA 1UTQA 2GCTC 2ILNA 2ZDMA 2F83A 2VVUA 2CHAC 4K60A 3LC5A 3M61U 4X8VH 2A4QA 1AU8A 3P70B 5EPYA 5TCAA 1JMOH 1FN8A 1DWBH 3M7UA 2OC8A 4JZFH 2QIQA 3KQCA 4LK4A 1DDJA 1SFIA 1RRKA 3LGUA 3S7KB 3ATKA 2ZDKA 1RTLA 4VGCB 3A87A 1GHVH 2PHBA 1YP9A 1O2LA 1NY22 4ZH8A 4UDWH 3SNBA 3ZZ8A 1P2MA 2AYWA 3MH4A 3ZVDA 3ATLA 3GISB 3U1IB 1A1RA 2BY9X 1ELDE 5DP5A 4MDSA 2J2UA 1MTWA 3SU0A 1O36A 2G8TA 2R3YA 4JMYA 6ESTA 2FOEA 1C2GA 1YLDA 3ESTA 3PWCA 1UTPA 2AIPA 1MU8B 4A5TS 1YF4A 2VVCA 3A83A 2GDDA 4WH8A 1ZGVA 1AY6H 2NU2E 1XM1A 1P9SA 1YPLH 4GLYA 1C5QA 3P8FA 1D3TB 1YM0A 3BSQA 2Q6DA 2PGQB 4ABGA 1RGQA 3V12A 1F5KU 1AZ8A 2FX4A 4Y7BA 3MNXA 1K1MA 2BHGA 1W10U 1BTUA 1K28D 3ZVAA 3UWIA 3UNQA 2BDIA 3H7TA 4BTTB 1A2CH 2VH6A 3SI4H 5LPEA 3A7XA 4LZ1H 3LDXH 1EZUC 5HMAA 4DW2U 2HNTE 2BMGB 2BY6X 4FXGH 3UNSA 2OD3B 4AG2A 4UEHH 2QF0A 1DWDH 3SZNA 1BTXA 7GCHF 1N8OB 3A88A 2TRMA 1B0EA 2TPIZ 3ZVCA 4FUJA 1ELVA 2XYAA 5ETXA 1S82A 2F9NA 2HPQH 3SU3A 1HV7A 4Y6DA 1W7XH 2P94A 4ABAA 2F91A 3BTGE 4O3TA 1N6XA 2D1JA 4DCDA 1F5RA 3W94A 5JB9S 1MTUA 3MH6A 4DT7B 1NU9A 3V7TA 1DSTA 1NRRH 1SG8B 1WV7H 3SJ9A 3B9FH 2ZDLA 2XWAA 4GVUA 3K6YA 3TNSA 2A7CA 1G30B 4IMZA 3UWJH 1K1JA 1DWCH 2Q6FA 1CA0C 1CQQA 4K8YA 1SLWB 2FDAA 1O32A 3A7WA 4CRBA 4E7RG 2FTLE 1CE5A 4NA7A 1ZPZA 1SR5C 5BPEA 3SGBE 4IC5A 3STIA 1O2VA 1ID5H 1Z7KA 4XSKU 1A61H 1ABIH 1MMJN 2ZQ2A 2IN2A 1UK3A 5T6FA 1EAUA 4MPXA 4DJZB 2XBYA 1AVXA 1PPHE 1S5SA 2WYJA 1FPCH 1TX6A 3U1JB 3URCA 2HLCA 1A0HB 1HLTH 4Q7XA 5EQRA 4B71A 2Z9LA 3MHWU 4Y0YE 4D7FA 3RXEA 1KTTB 1GL1A 5ABWA 2F9BH 3M37A 2AERH 3T25A 4ABIA 3HKIB 5LGOA 1TMBH 1DE7H 1YPMH 2ZF0H 1LQDB 1S6FA 4NA8A 1FAKH 3GCHC 4AX9H 3O8RA 4INKA 3AVZA 4I8HA 5CMXH 1LPZB 3TIUA 1XKAC 2EI6A 3SUDA 4DG4A 4ABBA 3HATH 4RKJB 2ZTXA 5G4BA 2H5CA 3WY8A 2FPZA 1V2TT 5EQQA 2O9QA 4Z6AH 1P02A 1W7GH 3QLPH 4NSVA 1HIAB 1GBHA 4X6MA 1V2UT 5C2ZA 1TNHA 1FY4A 1G9IE 2XCNA 1SGQE 4OGYA 3DFJA 5LPRA 1ZMJA 1IQMA 1FJSA 1INCA 2BDBA 3V13A 1UVSH 3GCOA 1AUJA 2HWLB 2P59A 1GMCG 2H6MA 3RDZA 1ETRH 3RXMA 1SGIB 3K65B 3TH4H 3BEFB 5EXNA 4CBNA 1GMDG 1GWAA 1IQKA 1YGCH 3LGYA 3P92A 4UONA 5GCHF 3RP2A 3LGVA 3BTFE 1TPPA 1IQIA 1XUGA 1O3BA 1O2XA 4I32A 1SGRE 3FZZA 2V0BA 3MNSA 2GCHF 2J9NA 1UTMA 1FY8E 3SU6A 1P09A 4XOJA 1O2SA 1BMMH 1Z8JB 1MCTA 3RMOH 3HK3B 2ODQA 3RXUA 4NIXA 1OOKB 2ZTYA 4WJG2 1GBMA 3AW1A 2C8XB 3EDXB 2PKSC 4FUEA 1TALA 2ZFPH 3MO9A 2WPIS 3RXJA 3LH1A 3UQOA 1VITG 4X6NA 1S0QA 4GAWA 1TNGA 4H4FA 1TRNA 1O3IA 6CHAC 1O3KA 1TONA 1PQAA 1TPAE 1O2TA 4LXBH 3KQEA 2Z94A 2QXGA 4H6SB 3TJUA 1MTNB 1SGEE 1AHTH 3A7VA 3UR9A 1IQFA 1NO9H 2UWLA 5A09A 1P04A 4AOQA 1QTFA 4UFDH 2ZO3H 1O3EA 4BOHA 2G51A 3O8BA 1J9CH 2VWMA 3RXPA 1TNKA 2Y80A 3E6PH 1O33A 1C1NA 3F9FA 3VGCC 2XTTB 2ZGXH 4TPIZ 2FLRH 2ZHQH 4MQAA 1WSSH 1SQOA 2Q6GA 2THFB 3TU7H 1C1TA 1DITH 2D2DA 1EP5A 1BRCE 4I8JA 1FZZA 1C2JA 4YESB 3BEIB 1BJUA 1VJ9U 1WAYB 3AAUA 3BIUH 1QRWA 2O8UA 1SGYE 3SW2B 1N6YA 2C4FH 3SU5A 3VXEH 1XMNB 2BX3A 9LPRA 1LCYA 1RIWB 1GHXH 2A7HA 4THNH 1BTHH 3BTHE 2A5AA 2NU0E 4FUFA 5FBIA 3QK1A 1HAGE 2TGDA 5EGMA 5L6NH 3SU2A 5C67A 5TCCA 1EOLA 3U8OH 2ZCHP 1Q31A 1PPGE 1TQ0B 2Y6TA 3TH3H 1XKBC 1P2QA 3ZZ9A 1TABE 2EEKA 4NIVA 1OSSA 3S69A 5L2ZH 2GV7A 1GG6C 4K3JA 1L4DA 2B9LA 1P10A 3RXLA 2R0KA 1THPB 3PLPA 1OWIA 1NFWA 3TK5A 2PKAA 1LQEA 2P8OB 2AH4X 4TWYA 2AMDA 2ZA5A 1QA0A 4IS5A 3MH5A 5PTPA 1SVPA 1P06A 4SGBE 1P2OA 1RXPA 1DXPA 1T7CA 1MKXH 2PW8H 1G2LA 1TQ7B 4K1SA 4SGAE 3Q76A 1O39A 2PWXA 2ZQ1A 3GICB 3A84A 3IG6B 3RXGA 2AFQB 1AB9B 1AE5A 1HIAA 1VCQA 2NWNA 3RXQA 4YZUA 1EPTB 1ESBA 6LPRA 4MNWA 1SBWA 2GZ7A 1QQ4A 1ZHMA 1GGDB 1GI2A 5AHGH 2QGRA 4TPYA 1IQGA 2BY7X 1HAHH 3L6PA 1ZZZA 2BD9A 1ZRKA 1MZDA 3RXFA 4OS1A 1MQ5A 1ANCA 4D7GA 5E2PA 3RXTA 1MKXK 3QX5H 2FYRA 3PO1C 1GBFA 1AWFH 2FOAA 1KXBA 3ODFA 1EXFA 1C1RA 2W7SA 1GVKB 1UTKA 2PTCE 5F8TA 2QAAA 1SSXA 2BVXH 2EC9H 1T4UH 1GHWH 1HDTH 1AFQB 5EQSA 3OY5U 3K6ZA 2G5NA 2BDYA 1WQSA 3DA9B 3U98H 3FP7E 4NGAH 4Y8YA 3S9BA 4ISHH 1T8NA 1ZYOA 5EOKA 1Y5BT 2NU4E 2SGPE 1BDAA 1V2RT 1ACBE 2BDGA 3RMLH 4CHAC 1A3BH 1S84A 3FFGA 4CRDA 2RDLA 3RXAA 3EYDA 3TGKE 1GJDB 1ZTKA 3OY6U 4NIYA 2HALA 1ETSH 4A7IB 3RXSA 2FLBH 2A1DB 4WF8A 1BRAA 1C1WH 3QO6A 4INLA 1TRYA 5DP9A 4CH8B 5EW1H 1EZXC 1QRXA 1TGNA 4MVNA 2ANMH 2XCFA 1VGCC 3HKJB 1LHFH 1HXEH 3PV4A 2OP9A 2EI7A 1GI8B 1UVTH 2VIOA 3EAJA 1C1SA 1GBLA 2AGGX 1QRZA 1OP2A 3SNCA 1C2KA 3Q77A 2QY0B 2VIQA 3SN8A 3UTUH 1DUAA 1IOEA 1V2VT 4ZKOU 1XVOA 1C9PA 2GMTB 1LVBA 1B7XB 1D6WA 1MD7A 1GI1A 1OYTH 2BLWA 4ZMAH 1K1NA 1C4U2 1ZLRA 4D8NA 4TYDA 2GT8A 2NU1E 2SGEE 1KDQB 2Z6BD 3BG8A 4K2YA 1UTOA 4DGJA 1XVMA 4J1YA 1C5ZB 2CV3A 3VB6A 4OS6A 1GI9B 1DWEH 2V3HH 5DPAA 1BOQA 2P3TB 1WUNH 4ISLA 3SHAH 2P95A 2JETC 2VIPA 1QL9A 3EA9A 1UTLM 2BY5X 2VH0A 1S83A 4CBOA 1THSH 1Z6JH 3GYMA 3M5NA 4Q7YA 1KYNA 3E90B 3NWUA 1CBWB 4AYYB 1MZAA 5LPFA 3BV9B 3SO3A 1O5GH 4GHQA 3LGIA 1BITA 1C2IA 4X8TH 1BIOA 1FDPA 4FUCA 3U8TH 1UMAH 3UNRA 5SGAE 1A0LA 1W8BH 1EZQA 3QTVH 4AFZA 4X2VA 2F3CE 1UO6A 1QURH 3BG4B 4JZDH 1HAIH 4X1QU 1K1IA 8GCHF 3D23A 2UUJB 3Q3YA 3F6UH 1F0UA 1DX5M 1Q2WA 1QY6A 2A2QH 2Y7XA 1HPGA 1O2ZA 1QBVH 2UUYA 1OWDA 1GJ8B 1TBZH 3GDSA 1BMAA 2UWOA 1FIWA 3PB1E 2ZWLH 1O2RA 1GI6A 1O0DH 1H9HE 1AUTC 1PPEE 1IQHA 4UFFH 1CHGA 1RD3B 3M3SA 1OKXA 1HUTH 1GMHF 1EPTA 1EB1H 4B73A 3VEQB 1W14U 4FVDA 3LU9B 4XFQA 1P2NA 4HI3A 1DLKB 1PYTD 1J14A 1QB1A 1HCGA 1ZMLA 2J38A 8KME2 1GCTC 5TJXA 5A8YA 2WYGA 1TOMH 1Y3VA 2BD4A 2W3IA 4J2YB 2HOBA 2ZPSA 5JBTA 5BRRE 2AS9A 2FEQH 4QT8C 3ZZ3A 1FXYA 3OU0A 4Y0ZE 3BEUA 3TNTA 3M3TA 1CHOG 1C5PA 2OC0A 2J4IA 2OBOA 2A31A 1GVLA 1NPMA 1KLIH 2FI5E 2ESTE 1MTNC 2BTCE 5FCKA 3NK8A 4ZKSU 4ABHA 3SQHE 5DKMA 2PGBB 1SI5H 4ZKRU 1A7SA 1P11E 2W26A 2HNTC 4Y7AA 1P2IA 3DFLA 1W12U 1QHRB 3U9AH 2BZ6H 3CS7A 3A89A 1T8LA 3KF2A 1GI7B 3B23B 4DY7B 2PFEA 2RCEA 4JCNA 3RM0H 1G3EA 1O3AA 1C5OH 1QFKH 2WPMS 1ZSKA 2FWWA 1F92A 3ZVFA 1O2MA 1H9LB 3KCGH 4OS2A 1TBQH 4DURA 1AIXH 3M36A 1P8VC 4NWLA 2OTVA 5IDKA 1O3CA 1BTZA 1A0JA 2P16A 2BYAX 1EJMA 2HVXA 3A8AA 3VXFH 2GZ9A 1BHXB 4BAMB 4WMDA 1KDQA 2QC2A 4AG1A 1EJNA 1HBTH 1L1JA