2FOCA

Structure of porcine pancreatic elastase in 55% dimethylformamide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase-1
publication title Multiple solvent crystal structures: Probing binding sites, plasticity and hydration
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2focA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2focA01
3F9FA 2Y6TA 5A09A 1RS0A 2O9QA 2Y7ZA 1MTSA 2KAIA 1ABIH 3SGBE 3TK5A 3RXVA 2BVXH 1E38B 3RXCA 4FUGA 1WU1A 2EA3A 1C1RA 2G52A 1H8DH 4ISLA 1DWDH 1AE5A 1EJAA 1JMOH 1ANCA 2VWNA 2ODQA 4H42U 5DP4A 2AGGX 2XNIA 4GVUA 3K2UA 1GI8B 4WH8A 3MU5A 4GHTA 1LHCH 2HGTH 1C1SA 1QNJA 1OP8A 1TRYA 1LPZB 2B9LA 3UOPA 1HRTH 1ZHMA 1O3JA 1NPMA 1OS8A 3A8DA 5A8YA 4R8TB 1J14A 1O2GH 3FP8E 1THPB 1RIWB 1DVAH 3PMBB 1TX8A 2ALVA 3UNRA 2GT7A 5I25A 2XWAA 5DPAA 4FUCA 2ODYB 1C4V2 1TNLA 1ETRH 1YPEH 1PQ8A 2ZECA 1MAYA 1YPMH 4CREA 4K1EA 1LKBA 1SHHB 4TYDA 4Q7XA 3SU3A 7KMEH 3KQEA 2ZGBH 1AWFH 1CT0E 1O3GA 2XXLA 1XM1A 2BD9A 1TOMH 1E0FD 2J4IA 2GVFA 1RGQA 3EGKH 2OINA 4AG2A 2SGFE 1DY9A 2BLQA 3QUMP 2P94A 1XVMA 1QBVH 1YYY1 2BD8A 3AW0A 3BSQA 2J94A 1EZSC 1K28D 3UUZA 1KXFA 1EATA 1TX6A 3GY5A 3OU0A 4JYUH 3PTBA 1V2WT 2ZDAH 5GIBA 1T4UH 2QF3A 5FPSA 4CBNA 3GICB 3ZYDA 5AF9H 3LH1A 1ELAA 3JZ2B 2BXUH 6CHAB 2GMTC 1BRUP 1EKBB 3EDXB 1G2MA 1D3DB 3BEUA 3EA7A 5F8TA 5E0HA 4CR9A 1AO5A 2BD4A 1WAYB 1Y8TA 3VGCB 3KEEA 1QRWA 3V0XA 3SV6A 1DITH 3RXSA 1WSSH 4MPWA 1HAVB 1UTJA 1A5IA 1C1NA 1EASA 2QXJA 2ZFTA 5C5OA 2FODA 4H6TA 2FLRH 3QZRA 2TGDA 1HFDA 1XKAC 2SGDE 3R3GB 5IDKA 4FU9A 2AS9A 2FM2A 1T8MA 4YO9A 1PQAA 1C5NH 1NFXA 2GGVB 2FYQA 3Q3KA 1SGNE 4AB9A 4FUIA 3PROA 1S6FA 1LHFH 7GCHF 1X7AC 3BTFE 3ZZ8A 2FLBH 3P6ZB 2OUAA 1DY8A 3LPRA 3EQ0H 5A0CA 1Z8JB 2RCEA 3KL6A 1GDUA 1SVPA 8ESTE 3MHWU 2G5VA 2BDBA 1BRAA 3DD2H 4GCHF 1E36B 4IMQA 1T4VH 1W0YH 1SGIB 1MCVA 2FO9A 3KIDU 2ZDVH 2G81E 2W7SA 3UWJH 4UFGH 4ZHAA 4IC6A 4LZ1H 3L3TA 4K5ZA 1FIZA 4O3TA 1NN6A 3FP7E 2CN0H 2PGBB 4Y11E 4MNXA 3RC5A 2A4OA 2M5TA 2WPJS 3A84A 3A8CA 2ZPQA 1IAUA 4NCYA 3I77A 1TNIA 3SBKA 1KSNA 2ILNA 2GCTC 1H1BA 1Z8GA 2Y5HA 4Y7AA 2D26C 4KTCA 1AD8H 1P2KA 1RTKA 4U2WA 3TNTA 1UJ1A 2J34A 1H8IH 2OP9A 1YM0A 1O2MA 2IN2A 3U69H 1NU9A 1GBIA 5IYTA 2BD2A 8GCHF 1P10A 3HGPA 1F5KU 2WPIS 1GJ9B 1LCYA 3E1XB 1A0JA 1F5LA 2ZHFH 1TFXA 3URDA 1O5FH 3PM3A 2XC4A 2FXRA 4KELA 3M3SA 1GMHF 2OQUA 3SGAE 1SQAA 1GI9B 1CA0B 4E7RG 1BZXE 4DCDA 5E2PA 3ATMA 1YLDA 1TNKA 1IHSH 3BEIB 3GDVA 1TQ7B 3ATWA 4OS4A 1ZHRA 1PJPA 3FFGA 1NRSH 1MTWA 1RIWC 1KDQA 1TBZH 7GCHG 2D2DA 1UTLM 5F8XA 2GDDA 1QBNA 4E06H 3NXPA 3S69A 1KLJH 3LIWA 3MH4A 5DP3A 4ZXYH 1V2JT 5K7RA 1T8OA 2XRCA 3U1JB 2ZTXA 2Z9GA 1ETTH 4M7GA 1BCUH 1LPGB 3RM2H 4I8KA 1XUJA 2HPPH 2BD7A 3MI4A 1K1MA 1ZJDA 1NFUA 4AYVB 2FDAA 5C3NA 2WUBA 4WY3A 3L6PA 5T3HA 5FBEA 1YPGH 4DURA 1F92A 2PKSB 4ZH8A 2ZEBA 1C5ZB 1VGCC 2Z94A 3WY8A 1K22H 2Z9IA 3A82A 5DKMA 4CRAA 2FOHA 1BRBE 5A0BA 2FOEA 1PPFE 5E2OA 3UTUH 3UY9A 3O8RA 4FUJA 2C8YB 2QN5T 1O3LA 1ZHPA 5FX6A 1TRMA 1GG6C 3LC5A 4WXVA 3NK8A 4K1TA 3A8AA 1AFEH 2A4QA 4I31A 1SOTA 2BYAX 1N8OB 2HNTC 1A61H 1DLEA 4YTAA 2CXVA 2W26A 5LPFA 3A80A 4X2XA 3HKIB 2CJIA 1Y5BT 2F9PA 2JETB 2VIPA 1NFYA 1FAXA 1A0LA 3DA9B 5FCRA 2FEQH 2ZHDA 5C20A 1AB9C 5FAHA 1LMWB 4YOGA 1ANEA 1MAXA 1FN6A 2P59A 4UE7H 1YGCH 1FONA 3IITA 4I8JA 1ZPCA 3F9GA 1ESTA 1GI0A 4F49A 3RXPA 1P9UA 2PSYA 1FDPA 1RJXB 4NIXA 2QV1A 1QRZA 1CSOE 1Z7KA 1EAUA 1A3BH 2F9OA 1HDTH 1GBLA 4WXIA 1JRSA 4AFZA 1O5CB 1SPJA 1W12U 2A4RA 3ZZ4A 1FUJA 3F68H 1IHTH 3LC3A 4MDSA 5FPYA 1SFQB 1DT2A 4RKJB 2F83A 3SNEA 1SGTA 3OYPA 2BX4A 2BDHA 3TJNA 2BZ6H 2XC5A 3SU0A 4TPYA 2BM2A 5C67A 3Q00A 3KCGH 1NC6A 5ETXA 4AORA 1ZSLA 2OBOA 1DFPA 1AFQB 3SNBA 3ATKA 1ANDA 2QC2A 1NESE 2SGAA 4CRBA 1O2JA 2H9HA 4B76A 1BHXF 3SGQE 2H2ZA 3HATH 3DFJA 1CGJE 1O2PA 3UQOA 5AHGH 5E0GA 4CBOA 2VIOA 1GJ5H 4NGAH 3A7ZA 1ZTLA 2PWXA 5EPYA 1FY3A 1Z8IB 2BD3A 1BDAA 3SHCH 3V12A 1DDJA 3U8OH 3VEQB 4AOQA 2V0BA 4MPVA 2A2QH 4CRCA 1A1RA 1QA7A 1PPHE 3L33A 1UCYH 4FU7A 3RXTA 3DUXH 4ZHLU 5A0AE 1V2OT 2AMQA 3GCTG 4MTBA 1AHTH 2P3UB 1TALA 1AQ7A 1TLDA 3FANA 2NU3E 2P8OC 1KXCA 4KTSA 1O0DH 4UEHH 1FPCH 1OOKB 1Z6JH 2W3KA 3DT0H 1MBQA 2GKVE 4B75A 5F6MA 3M36A 1KTSB 1P11E 2ZWLH 1BT7A 2ZZUH 1OYTH 1HAPH 2QGRA 2R3UA 3SV7A 3MWIU 2OQ5A 1UHBB 3SJ8A 4B2CA 1UK3A 1RRKA 2VU8E 4CRDA 1IQGA 1F0TA 2VINA 1J15A 1QB9A 4INLA 3HPTB 1CGIE 2ZGJA 2TPIZ 1XUGA 1GBBA 3SUGA 5CE1A 1N6XA 3GY3A 2J92A 3KNXA 1ELFA 1A5GH 1V3XA 1OWKA 1Y5UT 4KTUA 1C5WB 4B2BA 1GGDC 1SMFE 1DICA 3V13A 1O38A 2WPKS 1VCQA 2F3CE 3MNSA 1A4WH 1P3EA 2O8WA 1E35B 1NY22 1O3OA 2C93B 5AFYH 1EJNA 5EXNA 2AGIX 1QA0A 1W7XH 3RXBA 4YLUA 1ELEE 2Y80A 3CENA 1GBHA 2BB4A 1SGFG 1O3BA 5DP7A 2ZU5A 1L0ZA 3DHKH 4K8BA 1DXPA 2ZHEH 4WMDA 1P57B 1DE7H 5ABWA 1JBUH 1N8OC 1K1NA 1AE8H 1KTTB 4RN6A 1J8AA 4AGKA 1CQQA 1DWCH 4NA7A 2BY9X 1O3PB 1SC8U 2GD4B 2ZFPH 3T5FH 1O2OA 2AIPA 1CT2E 1HGTH 1G3BA 2GMTB 2F9UA 5DP5A 2XWBI 3I29A 4X8TH 1ZOMA 4J2YB 3SJIA 1A0HB 1TYNA 1TGBA 1O33A 3P8GA 1OSSA 3NZIA 4E05H 1SGQE 3A7XA 4FXGH 1QRXA 1CHOG 2A31A 3T28A 1GHVH 5EU8A 3URCA 2PFEA 4DW2U 3P8FA 4BAQB 5ESTE 1P2OA 1GL0E 2BY7X 1VR1H 2ZCLP 4Y0YE 3ENSB 3K6YA 1BTUA 4WWYA 3FVFB 4ZXXH 3A83A 1O5EH 1S0RA 5FXLA 1K1PA 1FI8A 4O3UA 3LJOA 4I8LA 3EYDA 3BTTE 1MD7A 1BTZA 5F8ZA 1TPPA 1XUHA 1ZMLA 1ZYOA 2VH6A 2OXSA 2CHAC 1ARBA 2R2WU 1O35A 4JK5A 4Y71A 1AKSB 1C4U2 1E37B 3SUEA 2FOCA 3M5LA 3HKJB 5JBTA 1W14U 1C2MA 1GHYH 2C3SA 1ACBE 2PUXB 2PW8H 2UWOA 4Y6DA 3P92A 3Q77A 5HGGA 4DOQA 1S84A 1SLXB 1DUAA 1WYKA 4YM9A 1GVKB 1BBRH 3RXGA 4A5TS 1QURH 2DUCA 1Z6EA 1QBOA 2WV4A 2TRMA 1A5HA 1UTOA 3UPEA 2CMYA 3D23A 1TIOA 2NU4E 1FN8A 1TNHA 4H6SB 1P3CA 1KXDA 1CGHA 2FOMB 2FOFA 4IN1A 4A1XA 2R9PA 1H9LB 3E0NB 1B0EA 3RXQA 1C5LH 4DIIH 4KKDA 5GCHG 1EZXC 2GCTB 3SU6A 4HGCA 1GJ6A 1K21H 1ANBA 3A88A 1WTGH 3K65B 2ZPSA 3ELAH 4I33A 1B7XB 3B9FH 3MU8A 1O3FA 1YKTA 2BVRH 4INHA 1MUEB 1A3EH 4SGBE 2SGQE 2A5AA 3RXLA 5JBAS 1O3HA 2BOHB 4GPGA 1TGNA 3M7QA 2QYIA 1TNJA 2A5KA 1V2RT 1INCA 4MPUA 3A7TA 1KXBA 1Y5AT 1Z8RA 4B71A 4UFFH 1N1LA 2NWNA 3W94A 1FY1A 1C4Y2 5EQRA 3FZDA 3SQHE 1L4DA 1DANH 2STAE 1GDNA 1V2TT 3SNCA 1SGDE 1P8VC 1UCYE 1YPHC 1AVWA 2P95A 3PLKA 1ZGIA 3VPKA 3ZZ3A 3TU7H 1ZGVA 2HLCA 1AUTC 1C2HA 2B5TB 3SJOA 2Z9KA 4ABBA 1MQ5A 1HCGA 1CO7E 4BAKB 2FWWA 3SN8A 3RMOH 2PR3A 1EAWA 4NFFA 4LZ4B 5C2ZA 4KP0A 2FOAA 2V3HH 5DP9A 2TGAA 4OS7A 5E8EH 1F2SE 1C5PA 1DSUA 2ASUB 5GPIB 2CGAA 1V2UT 1G3DA 1QB1A 2G4TA 2NU2E 1V2QT 1OKXA 1IQFA 1P9SA 3FZZA 2ANMH 3SI4H 1S85A 3QZQA 4LXBH 1VGCB 3U9AH 3C27B 2ESTE 4X2WA 3PYHA 2H9EH 4I8HA 2ZTZA 1QR3E 4WMEA 3AAVA 2VIQA 1K9OE 1L2EA 4U01A 3U8TH 2SGPE 2UWLA 2K1QA 3P70B 3VXEH 1GG6B 2J38A 4FVBA 4NZQA 4Y0ZE 1UK4A 3TH4H 2GZ9A 2FX6A 2ZFQH 1W2KH 4XE4A 2GZ8A 1Y3XA 3BN9A 1UHBA 2FI3E 3MH7A 4JZDH 1N6YA 3T25A 4ESTE 5K0HA 4CHAC 3M7TA 5LPRA 1TNGA 1YCPH 2BQ7B 5L2ZH 4DG4A 2VWLA 1DOJA 1IQHA 3M5NA 5CHAC 4X1PU 4FVDA 4AFSA 1AB9B 1IQMA 2XW9A 3TK6A 4NZLA 4ABIA 1Z71A 2Y82A 3ZYEA 1S81A 1F7ZA 2TGPZ 3SU4A 2Y7XA 1HAIH 3MNBA 4X1SU 4DVAU 4AYYB 5C1XA 5GDSH 2BLOA 2W3IA 2BY5X 3RXUA 1O2XA 5AVDA 3D65E 1FMGA 1GBEA 5EGMA 1VITF 1O3CA 2YNBA 2UUYA 1J17T 2C8WB 4CRGA 1O2QA 3SI3H 1OP0A 1C1UH 2D1JA 3SV2H 4FUFA 4IGDA 4B74A 3T26A 1MTVA 1PPCE 3ZV8A 2C90B 3SHAH 4AN7A 1LPKB 1D3QB 4OGYA 4UD9H 2Q1JA 1GWAA 3MO9A 1GVZA 3MMGA 3MNCA 4MLFB 2ODPA 4HZHA 1OX1A 1GDQA 4WVPE 4MNYA 1PPZA 3ZZ5A 1TABE 4A92A 1YCPK 2XC0A 3M61U 1JRTA 1PQ5A 5FHTA 1C2LA 3E6PH 1G32B 2PV9B 1NRPH 3E90B 1E34B 3RXEA 1DM4B 1QL9A 1O37A 1BB0B 3ZZ9A 1XUIA 2VB0A 5EW2H 1ID5H 3QGJA 2F9BH 3BIUH 7LPRA 3DFLA 1TWXB 1UVSH 1BBRE 3RXRA 3TGIE 1SL3A 1YPLH 4ZKRU 2P8OB 1HXEH 1IQEA 1MZDA 4K69A 1ELDE 1EP6A 2ZG0H 1GBJA 2HRVA 2FOBA 1LTOA 2F9VA 4ZAEA 2LNCA 5DG6A 3NKKA 1AKSA 2J95A 3SV8A 3RXAA 9ESTA 3GY4A 1O2HA 1ZZZA 2VIDA 2ZPRA 2A32A 1BITA 3KHVA 2AERH 2GT8A 1K1JA 1ELVA 3A85A 4NIWA 1W7GH 2STBE 1GHBF 1KXAA 2FS9A 3TH3H 4AZ2B 2PGQB 3JZ1B 2G8TA 4HTCH 1PFXC 3GYLB 4U32A 3F6UH 1BMMH 4JMYA 2XBVA 1G2LA 2PHBA 1O34A 2HOBA 1BTWA 2CF9H 1FV9A 1SGYE 4NWKA 1GMCF 1O36A 9LPRA 1TA2A 2ZU3A 3GY7A 3RXIA 4GCHG 1G3CA 2EI6A 3LJJA 2XCNA 1GGDB 1KXEA 1QCPA 1SGRE 1MKXH 4ABAA 3SORA 2BX3A 2ZO3H 1C5VA 3M37A 3K6ZA 4JZEH 3BTQE 4LK4A 1C2FA 1QJ7B 1A7SA 6ESTA 1W10U 2GDEH 2QAAA 1KY9A 3QWCH 3KQDA 1JIRA 1YC0A 3SJ9A 1C9PA 1EB1H 3OY5U 2SFAA 2AFQB 2Z9JA 2FS8A 3PB1E 1P01A 2ZDKA 3RM0H 1SSXA 5H4IB 3PLPA 1HAOH 4IC5A 1C2EA 2G55A 3PO1C 1Y3VA 5EQSA 1O3KA 3TVJB 2GTBA 2QIQA 1LVOA 2C4FH 8GCHG 4K3JA 1ELBA 1V2NT 2ZQ1A 5SGAE 1EAXA 4CRFA 2HALA 1JXPA 1PPEE 2OC8A 2V3OH 1C5OH 1GMHG 2VVCA 5A8XA 3KQCA 3QTOH 5JPMH 1RFNA 1GI5A 1UTMA 4MG3A 1UVUH 1HAGE 5EXLA 1SB1H 4D9RA 3LOXA 1B0FA 3BTME 1H9IE 3M35A 4K1SA 3LONA 4UFEH 3SOSA 1GHAF 3ZV9A 8LPRA 3LKWA 1ZPZA 4MNWA 4UDWH 2VGCC 3RXDA 2WPMS 2JH6D 1MKXK 3RMNH 1P2IA 2I6QA 1ESAA 1C1VH 4THNH 3EA9A 3S0NA 1SLWB 2CHAB 2OC7A 3O8DA 3QLPH 1O3IA 1BQYA 4GHQA 2AH4X 4QT8C 3GY6A 1YBWA 2BQ6B 4ZROA 5C1YA 4AX9H 4VGCC 3MFJA 3V3MA 2ZU2A 1IQJA 1FPHH 1HJAC 2JH0D 4IBLH 1ZPBA 1D3TB 3TK9A 1O2WA 2D8WA 4FUEA 3HGNA 3VB4A 1P12E 1YPJH 4Q7YA 4BXSA 1FQ3A 2A45B 1Z1JA 3TGJE 3TLOA 4FUBA 1S0QA 2OC1A 3QK1A 2G51A 4DJZB 3P95A 3TJOA 1JWTA 1S83A 3OX7U 1L1NA 1FIWA 1HV7A 1NO9H 2ZTYA 3MYWA 4X1QU 1JOUB 1OPHB 3HK6B 3BG4C 5FPTA 4PROA 2XBXA 2FTLE 1GMDF 1FLEE 2PSXA 1GI4A 1XXDA 1GCDA 2A0QB 2BOKA 4XBCA 1HPGA 3A86A 1ETSH 1XKBC 1Y3UA 1TMBH 4BAMB 3GCHC 4FUHA 1C9TA 4CR5A 1OWHA 1MKWH 4TWYA 1SHYA 3I78A 4K8YA 1BMNH 1IQNA 1QJ1B 1NS3A 3RUOA 3TITA 1SG8B 2WINI 2ZHQH 5TJXA 1ABJH 2QXGA 1CT4E 2ZGXH 4JZ1A 2ZDNA 1CBWC 2Q6DA 1ZRBA 4ABJA 1O5DH 1B5GH 3VB6A 1O5GH 4ISIH 4X6PA 1MQ6A 2BY6X 1QTFA 3SJKA 1O3AA 2G00A 1DXWA 2ZNKH 1HNEE 3D49H 4WMFA 3KF2A 5JB8S 4DGJA 2HWLB 2JH5D 1C1MA 4IS5A 1AGJA 1HAHH 5JBCS 1YLCA 1MZAA 1UCYK 1GBKA 1C5RA 1P03A 1UTNA 4MQAA 1O2VA 3TNSA 3RU4E 1D4PB 1F0RA 2BMGB 5DP6A 4NSYA 4CH2B 1KLTA 1EZQA 2XBWA 3SNDA 3UNSA 3SU1A 1GVLA 1LQEA 1O3MA 3FP6E 3S7KB 1OYQA 1BMLA 6LPRA 1L4ZA 2FI5E 4IW4E 1DUEA 1YF4A 4OGXA 2Z6BD 1F0SA 1MKWK 3TH2H 1W3CA 3A81A 2P3FH 2A7JA 4CHAB 1SGFA 4X8UH 5TCAA 1LHGH 1T32A 5EODA 1AY6H 1CU1A 4UONA 1TOCB 2UUFB 3VB7A 2VIWA 5CHAB 1FY8E 3RLYH 4X6NA 2PKAB 1AMHA 4YOIA 1P05A 1M9UA 2AIQA 2ZU1A 1J16A 1Q31A 4X8VH 1GHWH 1BRCE 1SBWA 2ZDMA 1K1LA 3RU4T 4BTTB 3GY2A 4XFQA 1ESBA 3G01A 2SNVA 2GZ7A 1NZQH 1TB6H 2EI8A 4JYTA 5PTPA 2P3TB 1GBCA 1TGTA 1NTPA 4X2YA 4Q2KA 2GV7A 3Q76A 1GI7B 3LGTA 3IWMA 3A7YA 3QO6A 4D7FA 1W8BH 3A8BA 2BDAA 4DY7B 1GHXH 4NA9H 1EPTB 3GDUA 4K2YA 2PTCE 5G4BA 3PTNA 3B8JA 3QDZB 1G37A 2BZAA 1UMAH 4MVNA 1TBRH 4K60A 2WYJA 1UK2A 4Q7ZA 1MTNC 1BIOA 2V35A 2Y5FA 3NUMA 2SGEE 3E8LA 1AZZA 1OWJA 3M3TA 1IQLA 2VJ1A 1GI1A 1IQKA 1NU7B 2P16A 4A7IB 1EZUC 4BTUB 2OBQA 4E7NA 1GCTC 2I6SA 5J4SA 4CH8B 2VVUA 2LPRA 1FAKH 1FY4A 5HXFA 1RTFB 1C5QA 4AB8A 4RSPA 4Y7BA 5EPNA 1KLIH 1QY6A 2TIOA 1WTHD 3TIUA 1HJ8A 3BTEE 2WPHS 4Y10E 3UIRA 5C5NA 1VJAU 3B23B 1P2NA 2ANWA 2H5DA 2R3YA 1O32A 4MNVA 1O3EA 4O97A 3PMHB 1ZTJA 1MD8A 4F4OC 5B6OA 3FAOA 4MPXA 3RXMA 1EAIA 1O5AB 3TJVA 1TBQH 3AVZA 3SO3A 1DS2E 2XCFA 1OWIA 1LVYA 3LGWA 3ODDA 1W0ZU 1Q3XA 4FUDA 2VH0A 3V7TA 3U8RH 1QJ6B 1K2I1 3RLWH 3GY8A 5L30H 4A6LA 5DO4H 3RXFA 3VB5A 1FJSA 1IQIA 1GJAB 1SR5C 2RDLA 2B7DH 5LPEA 4Y8XA 2JKHA 1C5XB 2PUQH 3VB3A 5DGJA 1BBRK 3NPSA 3STIA 4X1RU 1HBTH 1SI5H 1P04A 1BUIA 1WCZA 5C1UA 3D62A 2XBYA 2XYAA 1P2MA 2FI4E 3Q3XA 2VVVA 4JYVH 2H9TH 4TPIZ 3A87A 1O2UA 1V2MT 1XXFA 3LH3A 1C5UA 4Y8ZA 1GJ8B 1T8LA 3M3VA 3NWUA 6GCHF 1ELCA 3UOUA 1GI2A 1LQDB 1AVXA 2XTTB 4YZUA 5E0JA 3Q3YA 1RXPA 2BHGA 4I8GA 3LU9B 5DK1A 1V6DA 2VWOA 5CMXH 1Y3WA 1ORFA 4AFQA 1PYTC 3SZNA 4ABEA 4XSKU 2O8UA 3UNQA 3T62A 1ZRKA 2BY8X 2ZIQH 1VJ9U 1HAXB 3STJA 4BOHA 1V2ST 3PO1B 4INKA 1QIXB 2GV6A 2HNTE 1P02A 2G4UA 2FZZA 1S5SA 5HM2A 3RMMH 2WUCA 1F0UA 1P09A 1MU6B 3AAUA 5GXPA 2Z7FE 2VNTA 1WUNH 5A2MH 3ZZAA 4D9QA 1WV7H 1GJDB 1AZ8A 4BNRA 4B2AA 4GAWA 1CA8B 1QHRB 4X8SH 2IPHA 4ISNA 1QL7A 3P8NA 3LGUA 4XOJA 1TA6A 5T6FA 1C5SA 3W95A 3ZZDA 4AFUA 3SU2A 1LVMA 1V2VT 3MU4A 1FZZA 1SFIA 1QFKH 2VGCB 4Z0KA 4HI3A 3MU0A 3GOVB 2UUJB 1MBMA 1ZSKA 1EP5A 1EPTC 2ZHWH 2Q6GA 1TE0A 1GL1A 1GBDA 3K9XB 1V2PT 1YP9A 4OS5A 3CP7A 1HYLA 2FYRA 3GYMA 2SNWA 4H4FA 6GCHG 3ATIA 3ZZBA 1AIXH 1ZJKA 1O2YA 2PLXA 3E3TA 2QCYA 2R0KA 4VGCB 5DJ7A 1BTXA 1V2KT 1CE5A 1DWBH 1DPOA 1HJAB 3BV9B 2F9NA 2BDCA 1BA8B 4X6MA 1NRNH 2THFB 5JDUB 5BPEA 5L6NH 5FCKA 2GX4A 3MTYA 3RU4D 1MU8B 2C8XB 1THSH 4HFPB 1TMTH 2PKAA 1G3EA 4ABFA 2ZDLA 1PYTD 2ZGHA 2BLVA 5T6GA 2R0LA 3RXOA 3TJUA 2ZF0H 4XBBA 1MTUA 2VWMA 1MH0A 2J9NA 2O8LA 2Q6FA 1W11U 1P0SH 1AU8A 3BTKE 3SW2B 2BLWA 3BG4B 2WYGA 1H9HE 2HPQH 3IG6B 3SQEE 1HIAA 4LOYH 1LO6A 2Z3DA 4A1VA 2ZU4A 1BHXB 4XBDA 1SLVB 1O3DA 2EC9H 1PQ7A 2GCHF 4YESB 3GCHB 1GBTA 2ZFRH 1EPTA 2HVXA 2NU0E 1GBAA 2Z3EA 4WF8A 1DLKB 3LGIA 3CS7A 3BG8A 4B1TA 5J4QA 1VITG 4R0IA 2QF0A 3HK3B 1BTHH 1DSTA 1WQSA 4DIHH 3VFEA 1TONA 2BXTH 4OS1A 1CHGA 4OS2A 1C1QA 4D8NA 1TPSA 3BTDE 2VIVA 1CBWB 4IMZA 1O2RA 5GJ4B 3PLBA 2A7HA 1EX3A 4D76A 3SU5A 1XUFA 4U30A 2ULLA 1J9CH 5EXMA 3A7VA 2H6MA 2TBSA 2AYWA 1D9IA 4ZKNU 3RC4A 2HNTF 1C2KA 3VXFH 3SV9A 1MMJN 2RA3A 1FXYA 4YT7H 2ZI2H 1SQTA 2B0FA 1EOLA 1O3NA 3O8CA 4O03A 2A4GA 2AGEX 4BXWA 1EXFA 4BANB 1F5RA 1C2DA 2GP9B 1U6QA 2RA0A 1EB2A 3F1SB 3ZVCA 3ZZ6A 4ZKOU 4OS6A 1C2JA 1P2JA 3PWBA 1C1PA 4B73A 1YCPM 4AGJA 4Y76A 2ANKH 2WPLS 4ZHMU 4WH6A 2EEKA 3A7WA 1EUFA 4NFEA 4AG1A 5A8ZA 2ZGCA 3ZZCA 5FX5A 1VCPA 3ZVDA 1PPBH 4Z6AH 1O2ZA 1A2CH 1THRH 1ELTA 1HJ9A 2OLGA 3M7UA 4I7YH 4TY7A 1O39A 2ZA5A 1H4WA 4NIVA 1GJ4H 7ESTE 1TAWA 6CHAC 5FBIA 4JK6A 2GCHG 3A89A 2ZCHP 1LVBA 1GJCB 1A46H 2RG3A 3H7OA 5F03A 4ISHH 5TCCA 5HM9A 2YOLA 2YNAA 1DX5M 1FY5A 2B8OH 3MH5A 4JZIA 3ITIA 1TQ0B 3GCTF 1HLTH 2DE9A 1ELGA 1GHBG 3OSYA 3PMAB 3VGCC 1KIGH 5LGOA 2AMDA 3P8OA 8KME2 1ZTKA 4NSVA 1G36A 3GDSA 2QY0B 3ZVAA 1UTPA 4UFDH 3KN2A 2BD5A 1SGCA 3OY6U 2KAIB 1MCTA 2H1UA 1C2GA 1UVTH 1GMCG 4NA8A 3UQVA 3TGKE 1UO6A 1OXGA 3GISB 1VITH 1ZMNA 1W13U 4I32A 1SQOA 2QXIA 3BIVH 3F9EA 3UWIA 2A7CA 1EJMA 1O2KA 2TGTA 2ANYA 3ZZ7A 2IJOB 2UUKB 1QL8A 4BAHB 1O2TA 3MO6A 3E0PB 1MTNB 3N7OA 2ZC9H 1Y3YA 1WOFA 3ZVGA 1V2LT 2UWPA 2ZQ2A 5EQQA 2FOGA 1AN1E 1AWHB 1AUJA 3EA8A 2W5EA 5JYIA 1OWEA 3MOCA 5EOKA 4KGAA 1GCTB 1C1WH 1O31A 1TPAE 1BJUA 1OWDA 1T31A 1LHDH 1GBMA 5L2YH 4BAOB 2AMPA 5BRRE 1KYNA 4O9VA 1EOJA 4YT6H 1ZLRA 1TPOA 1XMNB 1P2QA 4WJG2 3UFAA 1K1IA 2WV5A 1HAVA 1HAYB 2AEIH 4ASHA 4ZKSU 1QQUA 4GUXA 2Y5GA 1G30B 2Z9LA 3UR9A 1GHAG 1WQVH 2G5NA 5T6DA 2BDIA 4DT7B 1QGFA 2IOTA 1C5YB 1AI8H 2BDYA 4RKOB 4TY6A 5LH8A 3O8BA 2R2MB 1NRRH 5HMAA 1T7CA 3RXKA 1GI3A 1CA0C 3BF6H 3ZVBA 1LDTT 1BOQA 2FPZA 2BTCE 5AFZH 1YPHE 2O8TA 1CHOF 3QTVH 1D6WA 2A1DB 2OC0A 1DWEH 4YLQH 4ABGA 5DP8A 1JIMA 1QQ4A 1GBFA 4JZFH 2A2XH 3AW1A 3RC6A 3U98H 3SNAA 1D6RA 1TGSZ 1BTYA 4Y8YA 4ABDA 1HUTH 4GSOA 3NCLA 1G9IE 1UTKA 3AASA 3CS0A 3MH6A 3PWCA 3T2NA 1WBGB 2EI7A 2QA9E 2Z3CA 4NIYA 2DE8A 3OTJE 2O8MA 3LGVA 2F91A 3H7TA 1Q2WA 1TX7A 4X1NU 3S7HB 3MU1A 1HAZB 2PKSC 4XDEA 4D7GA 1C2IA 3EAJA 3U1IB 1Z1IA 1NROH 3ESTA 1L1GA 3T29A 3QGNB 1GMDG 1SGEE 3PV4A 2FIRH 5ESBA 3PMJA 1QB6A 2FMJA 1S6HA 1RTLA 1O5BB 2ZKSA 2ZP0H 4NWLA 2J2UA 4X0WU 1XUKA 2OTVA 2FTMA 3P17H 2QXHA 3RDZA 3UR6A 1SLUB 2ZCKP 4ABHA 5EW1H 2JETC 1L1JA 1NRQH 5I46H 5JBBS 2BQWB 2FESH 4SGAE 1HB0B 1YPKH 1D3PB 1BJVA 5GCHF 1GI6A 2V6NA 3BTWE 2NU1E 4ZUHA 2FX4A 3RXHA 3BTHE 1O2LA 3QN7A 1GJBB 2CF8H 3GCOA 1O30A 1NT1A 2ZFSA 3GCNA 3ODFA 4A1TA 2C8ZB 1NFWA 3UREA 3BEFB 2P93A 1UVOA 1HIAB 4GLYA 3ATLA 1NM6A 1ZSJA 1AVGH 2BVSH 4FU8A 2PTNA 3MNXA 4IN2A 1Y59T 1GPZA 1PPGE 1EQ9A 1O2IA 3SUDA 4ZMAH 1BMAA 3KQBA 3R0FA 1SOZA 3RMLH 3EE0B 5GWZA 4X2VA 2CV3A 3KGPA 1BTPA 4NG9H 3E16B 3S9AA 3S9CA 1ZMJA 5JB9S 2ZFFH 4JCNA 4YOJA 3C1KA 3QX5H 1TRNA 1C1OA 1VCWA 3TPIZ 1P06A 1SGPE 3BTGE 3F9HA 1HXFH 1OP2A 2OCVB 1O2NA 1FNIA 1UTQA 2H5CA 3LT3A 1AFQC 1C1TA 1GJ7B 1TGCA 3LGYA 5HYOA 4X6OA 3T27A 3LDXH 3ZVEA 1ARCA 4ISOA 1ZR0A 1K1OA 1T8NA 1IOEA 1S82A 1KDQB 3RP2A 2ALPA 2Y81A 3RXJA 4Y79A 2FP7B 3H5CB 3M5OA 1C5MD 1UVPA 1RD3B 3M5MA 1CVWH 1C5TA 1XVOA 2A5IA 3ZVFA 5EG4A 4BTIB 4TWWA 1TMUH 3SUFA 4Q80A 3E91A 1LKAA 1O2SA 1VZQH 3S9BA 2W7UA 2OD3B 1LHEH 3MO3A 1GHZA 2BDGA 1XX9A 4J1YA
chains in the Genus database with same CATH superfamily
3F9FA 2Y6TA 5A09A 1RS0A 2O9QA 2Y7ZA 1MTSA 2KAIA 1ABIH 3SGBE 3TK5A 3RXVA 2BVXH 1E38B 3RXCA 4FUGA 1WU1A 2EA3A 1C1RA 2G52A 1H8DH 4ISLA 1DWDH 1AE5A 1EJAA 1JMOH 1ANCA 2VWNA 2ODQA 4H42U 5DP4A 2AGGX 2XNIA 4GVUA 3K2UA 1GI8B 4WH8A 3MU5A 4GHTA 1LHCH 2HGTH 3NRLA 1C1SA 1QNJA 1OP8A 5HIZA 1TRYA 1LPZB 2B9LA 3UOPA 1HRTH 1ZHMA 1O3JA 1NPMA 1OS8A 3A8DA 5A8YA 4R8TB 1J14A 1YWUA 1O2GH 3FP8E 1THPB 1RIWB 1DVAH 3PMBB 1TX8A 2ALVA 3UNRA 2GT7A 5I25A 2XWAA 5DPAA 4FUCA 2ODYB 1C4V2 1TNLA 1ETRH 1YPEH 1PQ8A 2ZECA 1MAYA 1YPMH 4CREA 4K1EA 1LKBA 1SHHB 3F0PA 4Q7XA 4TYDA 3SU3A 7KMEH 3KQEA 2ZGBH 1AWFH 3SYJA 1CT0E 1O3GA 2XXLA 3KYGA 1XM1A 2BD9A 1TOMH 1E0FD 2J4IA 2GVFA 2J5UA 1RGQA 3EGKH 5GNDA 2OINA 4AG2A 2KZ4A 2SGFE 1DY9A 2BLQA 3QUMP 2P94A 1XVMA 1QBVH 1YYY1 2BD8A 3AW0A 3BSQA 2J94A 1EZSC 1K28D 3UUZA 4FETA 1KXFA 1EATA 1TX6A 3GY5A 3OU0A 4JYUH 3PTBA 1V2WT 2ZDAH 5GIBA 1T4UH 2QF3A 5FPSA 4CBNA 1SKYE 3GICB 3ZYDA 5AF9H 3LH1A 1ELAA 3JZ2B 2BXUH 6CHAB 2GMTC 1BRUP 1EKBB 3EDXB 1G2MA 1D3DB 3BEUA 3EA7A 5F8TA 5E0HA 4CR9A 1AO5A 2BD4A 1WAYB 3DSOA 1Y8TA 3VGCB 3KEEA 1QRWA 3V0XA 3SV6A 1DITH 3RXSA 1WSSH 4MPWA 1HAVB 1UTJA 1A5IA 1C1NA 1EASA 2QXJA 2ZFTA 5C5OA 4ACAA 2FODA 4H6TA 2FLRH 3QZRA 2RDEA 2TGDA 1HFDA 1XKAC 2SGDE 2KCOA 3R3GB 5IDKA 4FU9A 2AS9A 2FM2A 1T8MA 4YO9A 1PQAA 1C5NH 1NFXA 2GGVB 2FYQA 3Q3KA 1SGNE 4AB9A 4FUIA 3PROA 1S6FA 1LHFH 7GCHF 1X7AC 3BTFE 3ZZ8A 2FLBH 3P6ZB 2OUAA 1DY8A 3LPRA 3EQ0H 5KEDA 3F2FA 2WSSD 5A0CA 1Z8JB 2RCEA 1FX0B 1E79D 3KL6A 1GDUA 1SVPA 8ESTE 3MHWU 2G5VA 2BDBA 1BRAA 3DD2H 4GCHF 1E36B 4IMQA 1T4VH 1W0YH 1SGIB 1MCVA 2FO9A 3KIDU 2ZDVH 2G81E 2W7SA 2V7QD 3UWJH 2QE7D 4UFGH 4ZHAA 4IC6A 4LZ1H 3L3TA 4K5ZA 1FIZA 4O3TA 1NN6A 3FP7E 2CN0H 2PGBB 4Y11E 4MNXA 3RC5A 2A4OA 2M5TA 2WPJS 3A84A 3A8CA 2ZPQA 3N99A 1IAUA 4NCYA 3I77A 1TNIA 3SBKA 1KSNA 2ILNA 2GCTC 1H1BA 1Z8GA 2Y5HA 4Y7AA 2D26C 4KTCA 1AD8H 1P2KA 1RTKA 4U2WA 3TNTA 1UJ1A 2J34A 1H8IH 2OP9A 1YM0A 4TT3D 1O2MA 2IN2A 3U69H 1NU9A 1GBIA 5IYTA 2BD2A 8GCHF 1P10A 3HGPA 1F5KU 2WPIS 1GJ9B 1LCYA 3E1XB 1A0JA 1F5LA 2ZHFH 1TFXA 3URDA 1O5FH 3PM3A 2XC4A 2FXRA 4KELA 1KMHB 3M3SA 1GMHF 2OQUA 3SGAE 1SQAA 1GI9B 1CA0B 5CDFE 4E7RG 1BZXE 2QF4A 4DCDA 5E2PA 1SQRA 3ATMA 1YLDA 1TNKA 1IHSH 3BEIB 3GDVA 1TQ7B 3ATWA 4OS4A 1ZHRA 1PJPA 3FFGA 1NRSH 3FN8A 1MTWA 1RIWC 2AHME 1KDQA 1TBZH 7GCHG 2D2DA 1UTLM 5F8XA 2GDDA 1QBNA 4E06H 3NXPA 3S69A 1KLJH 3LIWA 3MH4A 5DP3A 4ZXYH 2XOKD 1V2JT 5K7RA 1T8OA 2XRCA 3U1JB 2ZTXA 2Z9GA 1ETTH 4M7GA 1BCUH 1LPGB 3RM2H 4I8KA 1XUJA 2HPPH 2BD7A 3MI4A 5HKKD 1K1MA 1ZJDA 1NFUA 4AYVB 2CK3D 2FDAA 5C3NA 2WUBA 4WY3A 3L6PA 5T3HA 3N7DA 5FBEA 1YPGH 4DURA 1F92A 2PKSB 4ZH8A 2ZEBA 1C5ZB 1VGCC 2Z94A 3WY8A 1K22H 2Z9IA 3A82A 5DKMA 4CRAA 2FOHA 1BRBE 5A0BA 2FOEA 1PPFE 5E2OA 3UTUH 3UY9A 3O8RA 4FUJA 2C8YB 2QN5T 1O3LA 1ZHPA 5FX6A 1TRMA 1GG6C 3LC5A 4WXVA 3NK8A 4K1TA 3A8AA 1AFEH 2A4QA 4I31A 1SOTA 2BYAX 1N8OB 2HNTC 1A61H 1DLEA 4YTAA 2CXVA 2W26A 5LPFA 3A80A 4X2XA 3HKIB 2CJIA 1Y5BT 4ASUD 2F9PA 1E1RD 2JETB 2VIPA 4XD7D 1NFYA 1FAXA 1A0LA 3DA9B 5FCRA 2FEQH 2ZHDA 5C20A 1AB9C 1COWD 5FAHA 1LMWB 4YOGA 1ANEA 1MAXA 1FN6A 2P59A 4UE7H 1YGCH 1FONA 3IITA 4I8JA 1ZPCA 3F9GA 1ESTA 1GI0A 4F49A 3RXPA 1P9UA 2PSYA 2L74A 1FDPA 1RJXB 4NIXA 1UW7A 2QV1A 1QRZA 1CSOE 1Z7KA 1EAUA 1A3BH 2F9OA 1HDTH 1GBLA 4WXIA 1QZ8A 1JRSA 4AFZA 1O5CB 1SPJA 1W12U 2A4RA 3ZZ4A 1FUJA 3F68H 1IHTH 3LC3A 4MDSA 5FPYA 1SFQB 2PP6A 1DT2A 4RKJB 2F83A 3SNEA 1SGTA 3OYPA 2BX4A 2BDHA 3TJNA 2BZ6H 2XC5A 3SU0A 4TPYA 2BM2A 5C67A 2VBCA 3Q00A 3KCGH 1NC6A 5ETXA 4AORA 1ZSLA 1DFPA 2OBOA 1AFQB 3SNBA 3ATKA 1ANDA 2QC2A 1NESE 2SGAA 4CRBA 1O2JA 2H9HA 4B76A 1YLNA 1BHXF 3SGQE 2H2ZA 3HATH 3DFJA 1CGJE 1O2PA 3UQOA 5AHGH 5E0GA 4CBOA 2VIOA 1GJ5H 4NGAH 3A7ZA 1ZTLA 2PWXA 5EPYA 1FY3A 1Z8IB 2BD3A 1BDAA 3SHCH 3V12A 3SZEA 1DDJA 3U8OH 3VEQB 4AOQA 2V0BA 4MPVA 2A2QH 4CRCA 1A1RA 1QA7A 1PPHE 3L33A 1UCYH 4FU7A 3RXTA 3DUXH 4ZHLU 4XRNA 5A0AE 1V2OT 2AMQA 3GCTG 4MTBA 1AHTH 2P3UB 1TALA 1AQ7A 1TLDA 3FANA 2NU3E 2P8OC 1KXCA 4KTSA 1O0DH 4UEHH 1FPCH 1OOKB 1Z6JH 2W3KA 2JIZD 3DT0H 1MBQA 2KFWA 2GKVE 4B75A 5F6MA 3M36A 1KTSB 1P11E 4AC9A 2ZWLH 1BT7A 2ZZUH 1OYTH 1HAPH 2QGRA 2R3UA 3SV7A 3MWIU 2OQ5A 1UHBB 3SJ8A 4B2CA 1UK3A 1RRKA 2VU8E 4CRDA 1IQGA 1F0TA 2VINA 1J15A 1QB9A 3DCLA 4INLA 3HPTB 1CGIE 2ZGJA 2TPIZ 1XUGA 2IPQX 1GBBA 3SUGA 5CE1A 1N6XA 3GY3A 2J92A 3KNXA 1ELFA 1A5GH 4TSFD 1V3XA 1OWKA 1Y5UT 4KTUA 1C5WB 4B2BA 1GGDC 1SMFE 1DICA 3V13A 1O38A 2WPKS 1VCQA 2F3CE 3MNSA 3WW7A 1A4WH 1P3EA 2O8WA 1E35B 1NY22 1O3OA 2C93B 4F55A 5AFYH 1EJNA 2YMSB 2AGIX 1QA0A 1W7XH 5EXNA 3RXBA 4YLUA 1ELEE 2Y80A 3CENA 1GBHA 2BB4A 1SGFG 1O3BA 5DP7A 2ZU5A 1L0ZA 3DHKH 4K8BA 1DXPA 2ZHEH 4WMDA 1P57B 1DE7H 5ABWA 1JBUH 1N8OC 1K1NA 1AE8H 2K8IA 1KTTB 4RN6A 3N7EA 1J8AA 4AGKA 1CQQA 1DWCH 4NA7A 2BY9X 1O3PB 1SC8U 2GD4B 2ZFPH 3T5FH 1O2OA 2AIPA 1CT2E 1HGTH 1G3BA 2GMTB 2F9UA 5DP5A 2XWBI 3I29A 4X8TH 1ZOMA 4J2YB 3SJIA 2K0QA 1A0HB 1TYNA 1TGBA 1O33A 3P8GA 1OSSA 3NZIA 4E05H 1SGQE 3A7XA 2F4LA 4FXGH 1QRXA 1CHOG 2A31A 3T28A 1GHVH 5EU8A 3URCA 2PFEA 4DW2U 3P8FA 4BAQB 5ESTE 1P2OA 1GL0E 2BY7X 1VR1H 2ZCLP 4Y0YE 2WV9A 3ENSB 3K6YA 1BTUA 4WWYA 3FVFB 4ZXXH 3A83A 1O5EH 1S0RA 5FXLA 1K1PA 1FI8A 4O3UA 3FKSD 3LJOA 4I8LA 3EYDA 2J97A 3BTTE 1MD7A 1WDIA 1BTZA 5F8ZA 1E1QD 4Q63A 1TPPA 1XUHA 1ZMLA 1ZYOA 2VH6A 2OXSA 2CHAC 1ARBA 2R2WU 1O35A 2KM0A 4JK5A 4RI0A 4Y71A 1AKSB 1C4U2 1E37B 3SUEA 2FOCA 3M5LA 3HKJB 5JBTA 1W14U 1C2MA 1GHYH 2C3SA 1ACBE 3FOAA 4M9FA 2PUXB 2PW8H 2UWOA 1VKYA 3CNRA 4Y6DA 3P92A 3Q77A 5HGGA 4DOQA 1S84A 1SLXB 1DUAA 1WYKA 4YM9A 1GVKB 1BBRH 2L6OA 3RXGA 4A5TS 1QURH 2DUCA 1Z6EA 1QBOA 2WV4A 2TRMA 1A5HA 1UTOA 3UPEA 2CMYA 3D23A 1TIOA 2NU4E 1FN8A 1TNHA 4H6SB 1P3CA 1KXDA 1CGHA 2FOMB 2FOFA 4IN1A 4A1XA 3PRDA 2R9PA 1H9LB 3MQKC 3E0NB 1B0EA 3RXQA 1C5LH 4DIIH 4KKDA 5GCHG 1EZXC 2GCTB 3SU6A 4HGCA 1GJ6A 1K21H 1ANBA 3A88A 1WTGH 3K65B 2ZPSA 3ELAH 4I33A 1B7XB 3B9FH 3MU8A 1O3FA 1YKTA 2BVRH 4INHA 1MUEB 5C17A 1A3EH 4SGBE 2SGQE 2A5AA 3RXLA 5JBAS 1O3HA 2BOHB 4GPGA 1TGNA 3M7QA 2QYIA 1TNJA 2A5KA 1V2RT 1INCA 4MPUA 5KECA 3A7TA 1KXBA 1Y5AT 1Z8RA 4B71A 4UFFH 1N1LA 2NWNA 3W94A 1FY1A 1C4Y2 5EQRA 3FZDA 3SQHE 1L4DA 1DANH 2STAE 1GDNA 1V2TT 3SNCA 1SGDE 1P8VC 1UCYE 1YPHC 1AVWA 2P95A 3PLKA 1ZGIA 3VPKA 3ZZ3A 3TU7H 1ZGVA 2HLCA 1AUTC 1C2HA 2B5TB 3SJOA 2Z9KA 4ABBA 1MQ5A 1HCGA 1CO7E 4BAKB 2FWWA 3SN8A 3RMOH 2PR3A 1EAWA 3U28C 4NFFA 4LZ4B 5C2ZA 4KP0A 2FOAA 2V3HH 5DP9A 2TGAA 4OS7A 5E8EH 1F2SE 1C5PA 1DSUA 2ASUB 5GPIB 2CGAA 1V2UT 2YMSC 1G3DA 1QB1A 2G4TA 1V2QT 2NU2E 1OKXA 1IQFA 1P9SA 3FZZA 2ANMH 3SI4H 1S85A 3QZQA 4LXBH 1VGCB 3U9AH 3C27B 2ESTE 4X2WA 3PYHA 2H9EH 4I8HA 2ZTZA 1QR3E 4WMEA 2RFKC 3AAVA 2VIQA 1K9OE 1L2EA 4U01A 3U8TH 2SGPE 2UWLA 2K1QA 3P70B 3VXEH 1GG6B 2J38A 4FVBA 4NZQA 4Y0ZE 1UK4A 3TH4H 2GZ9A 2FX6A 2ZFQH 1W2KH 4XE4A 2GZ8A 1Y3XA 3BN9A 1UHBA 2FI3E 3MH7A 4JZDH 1N6YA 3T25A 4ESTE 5K0HA 3OTPA 3M7TA 4CHAC 5LPRA 1W0JD 1TNGA 1YCPH 2BQ7B 5L2ZH 4DG4A 2VWLA 1DOJA 1IQHA 3M5NA 5CHAC 4X1PU 4FVDA 4AFSA 1AB9B 1IQMA 2XW9A 3TK6A 4NZLA 4ABIA 1Z71A 1WXRA 2Y82A 3ZYEA 1S81A 1F7ZA 2TGPZ 3SU4A 3ZIAD 2Y7XA 1HAIH 3MNBA 3AK5A 4X1SU 4DVAU 4AYYB 5C1XA 5GDSH 2BLOA 2W3IA 2BY5X 3RXUA 1O2XA 5AVDA 3D65E 1FMGA 1GBEA 5EGMA 1VITF 2JJ2D 1O3CA 2YNBA 2UUYA 1J17T 2C8WB 4CRGA 1O2QA 3SI3H 1OP0A 1C1UH 2D1JA 3SV2H 4FUFA 4IGDA 4B74A 3T26A 1MTVA 1PPCE 5DSFA 3ZV8A 2C90B 3SHAH 4AN7A 1LPKB 1D3QB 4OGYA 4UD9H 2Q1JA 1GWAA 3MO9A 1GVZA 3MMGA 3MNCA 2WPDD 4MLFB 2ODPA 4HZHA 1OX1A 1GDQA 4WVPE 2YMSD 4MNYA 1PPZA 3ZZ5A 1TABE 4A92A 1YCPK 2XC0A 3M61U 1JRTA 1PQ5A 5FHTA 1C2LA 3E6PH 1G32B 2PV9B 1NRPH 3E90B 1E34B 3RXEA 1DM4B 1QL9A 1O37A 1BB0B 2EQNA 3ZZ9A 1XUIA 2VB0A 5EW2H 1ID5H 3QGJA 3VG8A 2F9BH 1MABB 3BIUH 7LPRA 3DFLA 1TWXB 1UVSH 1BBRE 3RXRA 3TGIE 1SL3A 1YPLH 4ZKRU 2P8OB 1HXEH 4B6FA 1IQEA 1MZDA 4K69A 1ELDE 1EP6A 2ZG0H 1GBJA 2HRVA 2FOBA 1LTOA 2F9VA 4ZAEA 2LNCA 5DG6A 3NKKA 1AKSA 2J95A 3SV8A 3RXAA 9ESTA 3GY4A 1O2HA 1ZZZA 2VIDA 2ZPRA 2A32A 1BITA 3KHVA 2AERH 2GT8A 1K1JA 1ELVA 3A85A 4NIWA 1W7GH 2STBE 1GHBF 1KXAA 2FS9A 3TH3H 4AZ2B 2PGQB 3JZ1B 2G8TA 4HTCH 1PFXC 3GYLB 4U32A 3F6UH 1BMMH 4JMYA 2XBVA 1G2LA 2PHBA 1O34A 2HOBA 1BTWA 2CF9H 1FV9A 1SGYE 4NWKA 1GMCF 1O36A 9LPRA 1TA2A 2ZU3A 3GY7A 3RXIA 2WHXA 4GCHG 1G3CA 2EI6A 3LJJA 2XCNA 1GGDB 1KXEA 1QCPA 1SGRE 1W0KD 1MKXH 4ABAA 3SORA 2BX3A 2ZO3H 1C5VA 3M37A 3K6ZA 4JZEH 3BTQE 4LK4A 1C2FA 1QJ7B 1A7SA 6ESTA 2J98B 1W10U 2GDEH 2QAAA 1KY9A 3QWCH 3KQDA 1JIRA 2QF5A 1YC0A 3SJ9A 1C9PA 1EB1H 3OY5U 2SFAA 2AFQB 2Z9JA 2FS8A 3PB1E 1P01A 2ZDKA 3RM0H 1SSXA 5H4IB 3PLPA 1HAOH 4IC5A 1C2EA 2G55A 3PO1C 1Y3VA 5FL7D 5EQSA 1O3KA 3TVJB 2GTBA 2QIQA 1LVOA 2C4FH 8GCHG 4K3JA 1ELBA 1V2NT 2ZQ1A 5SGAE 1EAXA 4CRFA 2HALA 1JXPA 1PPEE 2OC8A 2V3OH 1C5OH 1GMHG 2VVCA 5A8XA 3KQCA 3QTOH 5JPMH 1RFNA 1GI5A 1UTMA 4MG3A 1UVUH 1HAGE 5EXLA 1SB1H 4D9RA 3LOXA 1B0FA 3BTME 1K0HA 1H9IE 3M35A 4K1SA 3LONA 4UFEH 3SOSA 1GHAF 3ZV9A 8LPRA 3LKWA 1ZPZA 4MNWA 4UDWH 2VGCC 3RXDA 2WPMS 4DT4A 2JH6D 1MKXK 3RMNH 3EE7A 1P2IA 2I6QA 1ESAA 1C1VH 4THNH 3DSPA 3EA9A 3S0NA 1SLWB 2CHAB 2OC7A 3O8DA 3QLPH 1O3IA 1BQYA 4GHQA 2AH4X 4B6EA 4QT8C 3GY6A 1YBWA 2BQ6B 4ZROA 5C1YA 4AX9H 2EY4C 4VGCC 3OEHD 3MFJA 3V3MA 2ZU2A 3W1EA 1IQJA 1FPHH 1HJAC 2JH0D 4IBLH 1ZPBA 1D3TB 3TK9A 1O2WA 2D8WA 4FUEA 3HGNA 3OE7D 3VB4A 1P12E 1YPJH 4Q7YA 4BXSA 1FQ3A 2A45B 1Z1JA 3TGJE 3TLOA 4FUBA 1S0QA 2OC1A 3QK1A 2G51A 4DJZB 3P95A 3TJOA 1JWTA 1S83A 3OX7U 1L1NA 1FIWA 1HV7A 1NO9H 2ZTYA 3MYWA 4X1QU 1JOUB 1OPHB 3HK6B 3BG4C 5FPTA 4PROA 2W6ID 2XBXA 2FTLE 1GMDF 1FLEE 2PSXA 1GI4A 1XXDA 1H8HD 1GCDA 2A0QB 2BOKA 4XBCA 1HPGA 3A86A 1ETSH 1XKBC 1Y3UA 1TMBH 4BAMB 3GCHC 4FUHA 1C9TA 4CR5A 1OWHA 1MKWH 4TWYA 1SHYA 3I78A 4K8YA 4I86A 1BMNH 1IQNA 1QJ1B 1NS3A 3RUOA 3TITA 1SG8B 2WINI 2ZHQH 5TJXA 1ABJH 2QXGA 1CT4E 2ZGXH 4JZ1A 2ZDNA 1CBWC 2Q6DA 1ZRBA 4ABJA 1O5DH 1B5GH 3VB6A 1O5GH 4ISIH 4X6PA 1MQ6A 2BY6X 1QTFA 3SJKA 1O3AA 2G00A 1DXWA 2ZNKH 1HNEE 3D49H 4WMFA 3KF2A 5JB8S 4DGJA 2HWLB 2JH5D 1C1MA 4IS5A 1AGJA 1HAHH 5JBCS 1YLCA 1MZAA 1UCYK 1GBKA 1C5RA 1P03A 1UTNA 4MQAA 5C94A 1O2VA 3TNSA 3RU4E 1D4PB 1F0RA 2BMGB 5DP6A 4NSYA 4CH2B 1KLTA 1EZQA 2XBWA 3SNDA 3UNSA 3SU1A 1GVLA 1LQEA 1O3MA 3FP6E 3H09A 3S7KB 1OYQA 1BMLA 6LPRA 1L4ZA 2FI5E 4IW4E 1DUEA 1YF4A 4OGXA 2Z6BD 1F0SA 1MKWK 3TH2H 1W3CA 3A81A 2P3FH 2A7JA 4CHAB 1SGFA 4X8UH 5TCAA 1LHGH 1T32A 5EODA 1AY6H 1CU1A 4UONA 1TOCB 2UUFB 3VB7A 2VIWA 5CHAB 1FY8E 3RLYH 4X6NA 2PKAB 1AMHA 4YOIA 1P05A 1M9UA 2AIQA 2ZU1A 1J16A 1Q31A 4X8VH 1GHWH 2WZQA 1BRCE 1SBWA 2ZDMA 1K1LA 3RU4T 3WWFA 4BTTB 3GY2A 4XFQA 1ESBA 3G01A 2SNVA 2GZ7A 1NZQH 1TB6H 2EI8A 4JYTA 5PTPA 2P3TB 1GBCA 1TGTA 1NTPA 4X2YA 2J98A 4Q2KA 2GV7A 3Q76A 4FOUC 1GI7B 3LGTA 3IWMA 3A7YA 3QO6A 4D7FA 1W8BH 3A8BA 2BDAA 4DY7B 1GHXH 4NA9H 1EPTB 2XNDD 3GDUA 4K2YA 2PTCE 5G4BA 3PTNA 3B8JA 3QDZB 1G37A 2BZAA 1UMAH 4MVNA 1TBRH 4K60A 2WYJA 1UK2A 4Q7ZA 1MTNC 1BIOA 2V35A 2Y5FA 3NUMA 2SGEE 3E8LA 1AZZA 1OWJA 3M3TA 1IQLA 2VJ1A 1GI1A 1IQKA 1NU7B 2P16A 4A7IB 1EZUC 4BTUB 5HIYA 2OBQA 4E7NA 1GCTC 2I6SA 5J4SA 4CH8B 2VVUA 3PRBA 2LPRA 1FAKH 1FY4A 5HXFA 1RTFB 1C5QA 4AB8A 4RSPA 4Y7BA 5EPNA 1KLIH 1QY6A 2TIOA 1WTHD 3TIUA 1HJ8A 3BTEE 2WPHS 4Y10E 3UIRA 5C5NA 3OAAD 5EIYA 3UAIC 1VJAU 3B23B 1P2NA 2ANWA 2H5DA 2R3YA 1O32A 4MNVA 3GS9A 1O3EA 4O97A 3PMHB 1ZTJA 2GJGA 1MD8A 4F4OC 5B6OA 1YY3A 3FAOA 4MPXA 3RXMA 1EAIA 1O5AB 3TJVA 1TBQH 3AVZA 3SO3A 1DS2E 2XCFA 1OWIA 1LVYA 3LGWA 5DN6D 3ODDA 1W0ZU 1Q3XA 4FUDA 2VH0A 3V7TA 3U8RH 1QJ6B 1K2I1 3RLWH 3GY8A 5L30H 4A6LA 5DO4H 3RXFA 3VB5A 1FJSA 1IQIA 1GJAB 1SR5C 2RDLA 2B7DH 5CHBA 5LPEA 4Y8XA 2JKHA 1C5XB 2PUQH 3VB3A 5DGJA 1BBRK 3NPSA 3STIA 4X1RU 1HBTH 1SI5H 1P04A 1BUIA 1WCZA 5C1UA 3D62A 3WWBA 2XBYA 2XYAA 1P2MA 2FI4E 3Q3XA 2VVVA 4JYVH 2H9TH 4TPIZ 3A87A 1O2UA 1V2MT 1XXFA 3LH3A 1C5UA 4Y8ZA 1GJ8B 1T8LA 3M3VA 3NWUA 6GCHF 4YXWD 1ELCA 3UOUA 1GI2A 1LQDB 1AVXA 2XTTB 4YZUA 5E0JA 3Q3YA 1RXPA 2BHGA 4I8GA 3LU9B 5DK1A 1V6DA 2VWOA 5CMXH 1Y3WA 1ORFA 4AFQA 1PYTC 3SZNA 4ABEA 4XSKU 2O8UA 3UNQA 3T62A 1ZRKA 3PV5A 2BY8X 2ZIQH 1VJ9U 1HAXB 3DSGA 3STJA 4BOHA 1V2ST 4ZCNA 3PO1B 4INKA 1QIXB 2GV6A 2HNTE 1P02A 2G4UA 2FZZA 1S5SA 5HM2A 3RMMH 2WUCA 1F0UA 1P09A 1MU6B 3AAUA 5GXPA 2Z7FE 2VNTA 2KCPA 1WUNH 5A2MH 3ZZAA 4D9QA 1WV7H 1GJDB 4P02A 1AZ8A 4BNRA 4B2AA 4GAWA 1CA8B 1QHRB 4X8SH 5IK2D 2IPHA 4ISNA 1QL7A 3P8NA 3LGUA 4XOJA 1TA6A 4RT0A 5T6FA 1C5SA 3W95A 3ZZDA 4AFUA 5C0UA 2LP6A 3SU2A 1LVMA 1V2VT 3MU4A 1FZZA 1SFIA 1QFKH 2VGCB 4Z0KA 4HI3A 4ACBA 3MU0A 3GOVB 2UUJB 1MBMA 1ZSKA 4Q4LA 1EP5A 1EPTC 2ZHWH 2Q6GA 1TE0A 1GL1A 1GBDA 3K9XB 1V2PT 1YP9A 2W6JD 4OS5A 3CP7A 1HYLA 2FYRA 3GYMA 2SNWA 2F43B 4H4FA 6GCHG 3ATIA 3ZZBA 1AIXH 5T1VA 1ZJKA 1O2YA 2PLXA 3E3TA 2QCYA 2R0KA 4VGCB 5DJ7A 1BTXA 1V2KT 4F48B 1CE5A 1DWBH 1DPOA 1HJAB 3PV2A 3BV9B 2F9NA 2BDCA 1BA8B 4X6MA 2HVYB 1NRNH 2THFB 5JDUB 5BPEA 5L6NH 5FCKA 2GX4A 3MTYA 3RU4D 1MU8B 2C8XB 1THSH 4HFPB 1TMTH 2PKAA 1G3EA 4ABFA 2ZDLA 1PYTD 2ZGHA 2BLVA 5T6GA 2R0LA 3RXOA 3TJUA 2ZF0H 4XBBA 1MTUA 5B6LA 2VWMA 1MH0A 2J9NA 2O8LA 2Q6FA 1W11U 1P0SH 1AU8A 3BTKE 3SW2B 2BLWA 2M2AA 2JDID 3BG4B 2WYGA 1H9HE 2HPQH 3IG6B 3SQEE 1HIAA 4LOYH 1LO6A 2Z3DA 4A1VA 2ZU4A 1BHXB 4XBDA 1SLVB 1O3DA 2EC9H 2JJ1D 1PQ7A 2GCHF 4YESB 3GCHB 1GBTA 2IJD1 2ZFRH 1EPTA 2HVXA 2NU0E 1GBAA 2Z3EA 1NBMD 4WF8A 1DLKB 3LGIA 3CS7A 3BG8A 4B1TA 5J4QA 1VITG 4R0IA 2QF0A 3HK3B 1BTHH 1DSTA 1WQSA 4DIHH 3VFEA 1TONA 3OFND 2BXTH 4OS1A 1CHGA 4OS2A 1C1QA 4D8NA 1TPSA 3BTDE 3F2HA 2VIVA 1CBWB 4IMZA 1O2RA 5GJ4B 3PLBA 4Z1MD 2A7HA 1EX3A 4D76A 3SU5A 1XUFA 4U30A 2ULLA 1J9CH 5EXMA 3A7VA 2H6MA 2TBSA 2AYWA 1D9IA 4ZKNU 3RC4A 2HNTF 1C2KA 2V3MA 3VXFH 3SV9A 1MMJN 2RA3A 1FXYA 4YT7H 2ZI2H 1SQTA 2B0FA 1EOLA 1O3NA 3O8CA 4O03A 2A4GA 2AGEX 4BXWA 1EXFA 4BANB 1F5RA 1C2DA 2GP9B 1U6QA 2RA0A 1EB2A 3F1SB 3ZVCA 3ZZ6A 4ZKOU 2KCAA 4OS6A 1C2JA 1P2JA 3PWBA 1C1PA 4B73A 1YCPM 4AGJA 4Y76A 2ANKH 2WPLS 4ZHMU 4WH6A 2EEKA 3A7WA 1EUFA 4NFEA 4AG1A 5A8ZA 2ZGCA 3ZZCA 5FX5A 1VCPA 3ZVDA 1PPBH 4Z6AH 1O2ZA 1A2CH 1THRH 5C0TA 1ELTA 1HJ9A 2OLGA 3M7UA 5F53A 4I7YH 4TY7A 1O39A 2ZA5A 1H4WA 4NIVA 1GJ4H 7ESTE 1TAWA 6CHAC 5FBIA 4JK6A 3OEED 2GCHG 3A89A 1H8ED 2ZCHP 1LVBA 1GJCB 1A46H 2RG3A 3H7OA 3FO8D 5F03A 4ISHH 5TCCA 5HM9A 2YOLA 2YNAA 1DX5M 1FY5A 2B8OH 3MH5A 4JZIA 2KR7A 3ITIA 1TQ0B 3GCTF 1HLTH 2DE9A 1ELGA 1GHBG 3OSYA 3PMAB 3VGCC 1KIGH 5LGOA 2AMDA 3P8OA 8KME2 3UB0A 1ZTKA 4NSVA 1G36A 3GDSA 2QY0B 3ZVAA 1UTPA 4UFDH 3KN2A 2BD5A 1SGCA 3OY6U 2KAIB 1MCTA 2H1UA 1C2GA 1UVTH 1GMCG 4NA8A 1BMFD 3UQVA 3TGKE 1UO6A 1OXGA 3GISB 1VITH 1ZMNA 1W13U 4I32A 1SQOA 2QXIA 3BIVH 3F9EA 3UWIA 2A7CA 1EJMA 1O2KA 2TGTA 2ANYA 3ZZ7A 2IJOB 2UUKB 1QL8A 4BAHB 1O2TA 3MO6A 3E0PB 3F0OA 1MTNB 3N7OA 2ZC9H 1Y3YA 1WOFA 3ZVGA 1V2LT 2UWPA 2ZQ2A 5EQQA 2FOGA 1AN1E 1AWHB 1AUJA 3EA8A 2W5EA 5JYIA 1OWEA 3MOCA 5EOKA 4KGAA 1GCTB 1C1WH 4HG6A 1O31A 1TPAE 5EJZA 1BJUA 1OWDA 1T31A 4OM9A 1LHDH 1GBMA 5L2YH 4BAOB 1EFRD 2AMPA 5BRRE 1KYNA 4O9VA 1EOJA 4YT6H 1ZLRA 1TPOA 1XMNB 1P2QA 4WJG2 1S6LA 3UFAA 1K1IA 2WV5A 1HAVA 1HAYB 2AEIH 4ASHA 4ZKSU 1QQUA 4GUXA 2Y5GA 1G30B 2Z9LA 3UR9A 1GHAG 1WQVH 2G5NA 5T6DA 2BDIA 4DT7B 1QGFA 2IOTA 1C5YB 1AI8H 2BDYA 4RKOB 4TY6A 5LH8A 3O8BA 2R2MB 1NRRH 5HMAA 1T7CA 3RXKA 1GI3A 1CA0C 3BF6H 3ZVBA 1LDTT 1BOQA 2FPZA 2BTCE 5AFZH 1YPHE 2O8TA 1CHOF 3QTVH 1D6WA 2LELA 2A1DB 2OC0A 1DWEH 4YLQH 3F3BA 4ABGA 5DP8A 1JIMA 1QQ4A 5KGOA 1GBFA 4JZFH 2A2XH 3AW1A 3RC6A 3U98H 3SNAA 1D6RA 1TGSZ 1BTYA 4Y8YA 4ABDA 1HUTH 4GSOA 3NCLA 1G9IE 1UTKA 3AASA 3CS0A 3MH6A 3PWCA 3KYFA 5EJ1A 3T2NA 1WBGB 2EI7A 2QA9E 3KQ5A 2Z3CA 4NIYA 2DE8A 3OTJE 2O8MA 3LGVA 2F91A 3H7TA 1Q2WA 1TX7A 4X1NU 3S7HB 3MU1A 1HAZB 2PKSC 4XDEA 4D7GA 1C2IA 3EAJA 3U1IB 1Z1IA 2KCYA 1NROH 3ESTA 1L1GA 3T29A 3QGNB 1GMDG 1SGEE 3PV4A 2FIRH 5ESBA 3PMJA 1QB6A 2FMJA 1S6HA 1RTLA 1O5BB 2ZKSA 2ZP0H 4NWLA 2J2UA 4X0WU 1XUKA 5EJLA 4P00A 2OTVA 2FTMA 3P17H 2QXHA 3RDZA 3UR6A 1SLUB 2ZCKP 4ABHA 5EW1H 2JETC 1L1JA 1NRQH 5I46H 5JBBS 2BQWB 2FESH 4SGAE 1HB0B 1YPKH 1D3PB 1NBME 1BJVA 5GCHF 1GI6A 2V6NA 3BTWE 2NU1E 4ZUHA 2FX4A 3RXHA 3BTHE 1O2LA 3QN7A 1GJBB 2CF8H 3GCOA 1O30A 1NT1A 2ZFSA 3GCNA 3ODFA 4A1TA 2C8ZB 1NFWA 3UREA 3BEFB 2P93A 1UVOA 1HIAB 4GLYA 3ATLA 1NM6A 1ZSJA 1AVGH 2BVSH 1OHHD 4FU8A 2PTNA 3MNXA 4IN2A 1Y59T 1GPZA 1PPGE 1EQ9A 1O2IA 3SUDA 4ZMAH 1BMAA 3KQBA 3R0FA 1SOZA 3RMLH 3EE0B 5GWZA 4X2VA 2CV3A 3KGPA 1BTPA 4NG9H 3E16B 3S9AA 3S9CA 1ZMJA 5JB9S 2ZFFH 4JCNA 4YOJA 3C1KA 3QX5H 1TRNA 1C1OA 1VCWA 3TPIZ 1P06A 1SGPE 3BTGE 3F9HA 1HXFH 1OP2A 2OCVB 1O2NA 1FNIA 4RT1A 1UTQA 2H5CA 3LT3A 1AFQC 1C1TA 1GJ7B 1TGCA 3F2GA 3LGYA 5HYOA 4X6OA 3T27A 3LDXH 3ZVEA 1ARCA 4ISOA 1ZR0A 1K1OA 1T8NA 1IOEA 1S82A 1KDQB 2KX4A 3RP2A 2ALPA 2Y81A 3RXJA 2HLDD 2OK5A 4Y79A 2FP7B 3H5CB 3M5OA 1C5MD 1UVPA 1RD3B 3M5MA 1CVWH 1C5TA 1XVOA 2A5IA 3ZVFA 5EG4A 4BTIB 4TWWA 1TMUH 3SUFA 4Q80A 3E91A 1LKAA 1O2SA 1VZQH 3S9BA 2W7UA 2OD3B 1LHEH 3MO3A 1GHZA 2BDGA 1XX9A 4J1YA
chains in the Genus database with same CATH topology
3F9FA 2Y6TA 5A09A 1RS0A 2O9QA 2Y7ZA 1MTSA 2KAIA 1ABIH 3SGBE 3TK5A 3RXVA 2BVXH 1E38B 3RXCA 4FUGA 1WU1A 2EA3A 1C1RA 2G52A 1H8DH 4ISLA 1DWDH 1AE5A 1EJAA 1JMOH 1ANCA 2VWNA 2ODQA 4H42U 5DP4A 2AGGX 2XNIA 4GVUA 3K2UA 1GI8B 4WH8A 3MU5A 4GHTA 1LHCH 2HGTH 1C1SA 1QNJA 1OP8A 1TRYA 1LPZB 2B9LA 3UOPA 1HRTH 1ZHMA 1O3JA 1NPMA 1OS8A 3A8DA 5A8YA 4R8TB 1J14A 1O2GH 3FP8E 1THPB 1RIWB 1DVAH 3PMBB 1TX8A 2ALVA 3UNRA 2GT7A 5I25A 2XWAA 5DPAA 4FUCA 2ODYB 1C4V2 1TNLA 1ETRH 1YPEH 1PQ8A 2ZECA 1MAYA 1YPMH 4CREA 4K1EA 1LKBA 1SHHB 4TYDA 4Q7XA 3SU3A 7KMEH 3KQEA 2ZGBH 1AWFH 1CT0E 1O3GA 2XXLA 1XM1A 2BD9A 1TOMH 1E0FD 2J4IA 2GVFA 1RGQA 3EGKH 2OINA 4AG2A 2SGFE 1DY9A 2BLQA 3QUMP 2P94A 1XVMA 1QBVH 1YYY1 2BD8A 3AW0A 3BSQA 2J94A 1EZSC 1K28D 3UUZA 1KXFA 1EATA 1TX6A 3GY5A 3OU0A 4JYUH 3PTBA 1V2WT 2ZDAH 5GIBA 1T4UH 2QF3A 5FPSA 4CBNA 3GICB 3ZYDA 5AF9H 3LH1A 1ELAA 3JZ2B 2BXUH 6CHAB 2GMTC 1BRUP 1EKBB 3EDXB 1G2MA 1D3DB 3BEUA 3EA7A 5F8TA 5E0HA 4CR9A 1AO5A 2BD4A 1WAYB 1Y8TA 3VGCB 3KEEA 1QRWA 3V0XA 3SV6A 1DITH 3RXSA 1WSSH 4MPWA 1HAVB 1UTJA 1A5IA 1C1NA 1EASA 2QXJA 2ZFTA 5C5OA 2FODA 4H6TA 2FLRH 3QZRA 2TGDA 1HFDA 1XKAC 2SGDE 3R3GB 5IDKA 4FU9A 2AS9A 2FM2A 1T8MA 4YO9A 1PQAA 1C5NH 1NFXA 2GGVB 2FYQA 3Q3KA 1SGNE 4AB9A 4FUIA 3PROA 1S6FA 1LHFH 7GCHF 1X7AC 3BTFE 3ZZ8A 2FLBH 3P6ZB 2OUAA 1DY8A 3LPRA 3EQ0H 5A0CA 1Z8JB 2RCEA 3KL6A 1GDUA 1SVPA 8ESTE 3MHWU 2G5VA 2BDBA 1BRAA 3DD2H 4GCHF 1E36B 4IMQA 1T4VH 1W0YH 1SGIB 1MCVA 2FO9A 3KIDU 2ZDVH 2G81E 2W7SA 3UWJH 4UFGH 4ZHAA 4IC6A 4LZ1H 3L3TA 4K5ZA 1FIZA 4O3TA 1NN6A 3FP7E 2CN0H 2PGBB 4Y11E 4MNXA 3RC5A 2A4OA 2M5TA 2WPJS 3A84A 3A8CA 2ZPQA 1IAUA 4NCYA 3I77A 1TNIA 3SBKA 1KSNA 2ILNA 2GCTC 1H1BA 1Z8GA 2Y5HA 4Y7AA 2D26C 4KTCA 1AD8H 1P2KA 1RTKA 4U2WA 3TNTA 1UJ1A 2J34A 1H8IH 2OP9A 1YM0A 1O2MA 2IN2A 3U69H 1NU9A 1GBIA 5IYTA 2BD2A 8GCHF 1P10A 3HGPA 1F5KU 2WPIS 1GJ9B 1LCYA 3E1XB 1A0JA 1F5LA 2ZHFH 1TFXA 3URDA 1O5FH 3PM3A 2XC4A 2FXRA 4KELA 3M3SA 1GMHF 2OQUA 3SGAE 1SQAA 1GI9B 1CA0B 4E7RG 1BZXE 4DCDA 5E2PA 3ATMA 1YLDA 1TNKA 1IHSH 3BEIB 3GDVA 1TQ7B 3ATWA 4OS4A 1ZHRA 1PJPA 3FFGA 1NRSH 1MTWA 1RIWC 1KDQA 1TBZH 7GCHG 2D2DA 1UTLM 5F8XA 2GDDA 1QBNA 4E06H 3NXPA 3S69A 1KLJH 3LIWA 3MH4A 5DP3A 4ZXYH 1V2JT 5K7RA 1T8OA 2XRCA 3U1JB 2ZTXA 2Z9GA 1ETTH 4M7GA 1BCUH 1LPGB 3RM2H 4I8KA 1XUJA 2HPPH 2BD7A 3MI4A 1K1MA 1ZJDA 1NFUA 4AYVB 2FDAA 5C3NA 2WUBA 4WY3A 3L6PA 5T3HA 5FBEA 1YPGH 4DURA 1F92A 2PKSB 4ZH8A 2ZEBA 1C5ZB 1VGCC 2Z94A 3WY8A 1K22H 2Z9IA 3A82A 5DKMA 4CRAA 2FOHA 1BRBE 5A0BA 2FOEA 1PPFE 5E2OA 3UTUH 3UY9A 3O8RA 4FUJA 2C8YB 2QN5T 1O3LA 1ZHPA 5FX6A 1TRMA 1GG6C 3LC5A 4WXVA 3NK8A 4K1TA 3A8AA 1AFEH 2A4QA 4I31A 1SOTA 2BYAX 1N8OB 2HNTC 1A61H 1DLEA 4YTAA 2CXVA 2W26A 5LPFA 3A80A 4X2XA 3HKIB 2CJIA 1Y5BT 2F9PA 2JETB 2VIPA 1NFYA 1FAXA 1A0LA 3DA9B 5FCRA 2FEQH 2ZHDA 5C20A 1AB9C 5FAHA 1LMWB 4YOGA 1ANEA 1MAXA 1FN6A 2P59A 4UE7H 1YGCH 1FONA 3IITA 4I8JA 1ZPCA 3F9GA 1ESTA 1GI0A 4F49A 3RXPA 1P9UA 2PSYA 1FDPA 1RJXB 4NIXA 2QV1A 1QRZA 1CSOE 1Z7KA 1EAUA 1A3BH 2F9OA 1HDTH 1GBLA 4WXIA 1JRSA 4AFZA 1O5CB 1SPJA 1W12U 2A4RA 3ZZ4A 1FUJA 3F68H 1IHTH 3LC3A 4MDSA 5FPYA 1SFQB 1DT2A 4RKJB 2F83A 3SNEA 1SGTA 3OYPA 2BX4A 2BDHA 3TJNA 2BZ6H 2XC5A 3SU0A 4TPYA 2BM2A 5C67A 3Q00A 3KCGH 1NC6A 5ETXA 4AORA 1ZSLA 2OBOA 1DFPA 1AFQB 3SNBA 3ATKA 1ANDA 2QC2A 1NESE 2SGAA 4CRBA 1O2JA 2H9HA 4B76A 1BHXF 3SGQE 2H2ZA 3HATH 3DFJA 1CGJE 1O2PA 3UQOA 5AHGH 5E0GA 4CBOA 2VIOA 1GJ5H 4NGAH 3A7ZA 1ZTLA 2PWXA 5EPYA 1FY3A 1Z8IB 2BD3A 1BDAA 3SHCH 3V12A 1DDJA 3U8OH 3VEQB 4AOQA 2V0BA 4MPVA 2A2QH 4CRCA 1A1RA 1QA7A 1PPHE 3L33A 1UCYH 4FU7A 3RXTA 3DUXH 4ZHLU 5A0AE 1V2OT 2AMQA 3GCTG 4MTBA 1AHTH 2P3UB 1TALA 1AQ7A 1TLDA 3FANA 2NU3E 2P8OC 1KXCA 4KTSA 1O0DH 4UEHH 1FPCH 1OOKB 1Z6JH 2W3KA 3DT0H 1MBQA 2GKVE 4B75A 5F6MA 3M36A 1KTSB 1P11E 2ZWLH 1BT7A 2ZZUH 1OYTH 1HAPH 2QGRA 2R3UA 3SV7A 3MWIU 2OQ5A 1UHBB 3SJ8A 4B2CA 1UK3A 1RRKA 2VU8E 4CRDA 1IQGA 1F0TA 2VINA 1J15A 1QB9A 4INLA 3HPTB 1CGIE 2ZGJA 2TPIZ 1XUGA 1GBBA 3SUGA 5CE1A 1N6XA 3GY3A 2J92A 3KNXA 1ELFA 1A5GH 1V3XA 1OWKA 1Y5UT 4KTUA 1C5WB 4B2BA 1GGDC 1SMFE 1DICA 3V13A 1O38A 2WPKS 1VCQA 2F3CE 3MNSA 1A4WH 1P3EA 2O8WA 1E35B 1NY22 1O3OA 2C93B 5AFYH 1EJNA 5EXNA 2AGIX 1QA0A 1W7XH 3RXBA 4YLUA 1ELEE 2Y80A 3CENA 1GBHA 2BB4A 1SGFG 1O3BA 5DP7A 2ZU5A 1L0ZA 3DHKH 4K8BA 1DXPA 2ZHEH 4WMDA 1P57B 1DE7H 5ABWA 1JBUH 1N8OC 1K1NA 1AE8H 1KTTB 4RN6A 1J8AA 4AGKA 1CQQA 1DWCH 4NA7A 2BY9X 1O3PB 1SC8U 2GD4B 2ZFPH 3T5FH 1O2OA 2AIPA 1CT2E 1HGTH 1G3BA 2GMTB 2F9UA 5DP5A 2XWBI 3I29A 4X8TH 1ZOMA 4J2YB 3SJIA 1A0HB 1TYNA 1TGBA 1O33A 3P8GA 1OSSA 3NZIA 4E05H 1SGQE 3A7XA 4FXGH 1QRXA 1CHOG 2A31A 3T28A 1GHVH 5EU8A 3URCA 2PFEA 4DW2U 3P8FA 4BAQB 5ESTE 1P2OA 1GL0E 2BY7X 1VR1H 2ZCLP 4Y0YE 3ENSB 3K6YA 1BTUA 4WWYA 3FVFB 4ZXXH 3A83A 1O5EH 1S0RA 5FXLA 1K1PA 1FI8A 4O3UA 3LJOA 4I8LA 3EYDA 3BTTE 1MD7A 1BTZA 5F8ZA 1TPPA 1XUHA 1ZMLA 1ZYOA 2VH6A 2OXSA 2CHAC 1ARBA 2R2WU 1O35A 4JK5A 4Y71A 1AKSB 1C4U2 1E37B 3SUEA 2FOCA 3M5LA 3HKJB 5JBTA 1W14U 1C2MA 1GHYH 2C3SA 1ACBE 2PUXB 2PW8H 2UWOA 4Y6DA 3P92A 3Q77A 5HGGA 4DOQA 1S84A 1SLXB 1DUAA 1WYKA 4YM9A 1GVKB 1BBRH 3RXGA 4A5TS 1QURH 2DUCA 1Z6EA 1QBOA 2WV4A 2TRMA 1A5HA 1UTOA 3UPEA 2CMYA 3D23A 1TIOA 2NU4E 1FN8A 1TNHA 4H6SB 1P3CA 1KXDA 1CGHA 2FOMB 2FOFA 4IN1A 4A1XA 2R9PA 1H9LB 3E0NB 1B0EA 3RXQA 1C5LH 4DIIH 4KKDA 5GCHG 1EZXC 2GCTB 3SU6A 4HGCA 1GJ6A 1K21H 1ANBA 3A88A 1WTGH 3K65B 2ZPSA 3ELAH 4I33A 1B7XB 3B9FH 3MU8A 1O3FA 1YKTA 2BVRH 4INHA 1MUEB 1A3EH 4SGBE 2SGQE 2A5AA 3RXLA 5JBAS 1O3HA 2BOHB 4GPGA 1TGNA 3M7QA 2QYIA 1TNJA 2A5KA 1V2RT 1INCA 4MPUA 3A7TA 1KXBA 1Y5AT 1Z8RA 4B71A 4UFFH 1N1LA 2NWNA 3W94A 1FY1A 1C4Y2 5EQRA 3FZDA 3SQHE 1L4DA 1DANH 2STAE 1GDNA 1V2TT 3SNCA 1SGDE 1P8VC 1UCYE 1YPHC 1AVWA 2P95A 3PLKA 1ZGIA 3VPKA 3ZZ3A 3TU7H 1ZGVA 2HLCA 1AUTC 1C2HA 2B5TB 3SJOA 2Z9KA 4ABBA 1MQ5A 1HCGA 1CO7E 4BAKB 2FWWA 3SN8A 3RMOH 2PR3A 1EAWA 4NFFA 4LZ4B 5C2ZA 4KP0A 2FOAA 2V3HH 5DP9A 2TGAA 4OS7A 5E8EH 1F2SE 1C5PA 1DSUA 2ASUB 5GPIB 2CGAA 1V2UT 1G3DA 1QB1A 2G4TA 2NU2E 1V2QT 1OKXA 1IQFA 1P9SA 3FZZA 2ANMH 3SI4H 1S85A 3QZQA 4LXBH 1VGCB 3U9AH 3C27B 2ESTE 4X2WA 3PYHA 2H9EH 4I8HA 2ZTZA 1QR3E 4WMEA 3AAVA 2VIQA 1K9OE 1L2EA 4U01A 3U8TH 2SGPE 2UWLA 2K1QA 3P70B 3VXEH 1GG6B 2J38A 4FVBA 4NZQA 4Y0ZE 1UK4A 3TH4H 2GZ9A 2FX6A 2ZFQH 1W2KH 4XE4A 2GZ8A 1Y3XA 3BN9A 1UHBA 2FI3E 3MH7A 4JZDH 1N6YA 3T25A 4ESTE 5K0HA 4CHAC 3M7TA 5LPRA 1TNGA 1YCPH 2BQ7B 5L2ZH 4DG4A 2VWLA 1DOJA 1IQHA 3M5NA 5CHAC 4X1PU 4FVDA 4AFSA 1AB9B 1IQMA 2XW9A 3TK6A 4NZLA 4ABIA 1Z71A 2Y82A 3ZYEA 1S81A 1F7ZA 2TGPZ 3SU4A 2Y7XA 1HAIH 3MNBA 4X1SU 4DVAU 4AYYB 5C1XA 5GDSH 2BLOA 2W3IA 2BY5X 3RXUA 1O2XA 5AVDA 3D65E 1FMGA 1GBEA 5EGMA 1VITF 1O3CA 2YNBA 2UUYA 1J17T 2C8WB 4CRGA 1O2QA 3SI3H 1OP0A 1C1UH 2D1JA 3SV2H 4FUFA 4IGDA 4B74A 3T26A 1MTVA 1PPCE 3ZV8A 2C90B 3SHAH 4AN7A 1LPKB 1D3QB 4OGYA 4UD9H 2Q1JA 1GWAA 3MO9A 1GVZA 3MMGA 3MNCA 4MLFB 2ODPA 4HZHA 1OX1A 1GDQA 4WVPE 4MNYA 1PPZA 3ZZ5A 1TABE 4A92A 1YCPK 2XC0A 3M61U 1JRTA 1PQ5A 5FHTA 1C2LA 3E6PH 1G32B 2PV9B 1NRPH 3E90B 1E34B 3RXEA 1DM4B 1QL9A 1O37A 1BB0B 3ZZ9A 1XUIA 2VB0A 5EW2H 1ID5H 3QGJA 2F9BH 3BIUH 7LPRA 3DFLA 1TWXB 1UVSH 1BBRE 3RXRA 3TGIE 1SL3A 1YPLH 4ZKRU 2P8OB 1HXEH 1IQEA 1MZDA 4K69A 1ELDE 1EP6A 2ZG0H 1GBJA 2HRVA 2FOBA 1LTOA 2F9VA 4ZAEA 2LNCA 5DG6A 3NKKA 1AKSA 2J95A 3SV8A 3RXAA 9ESTA 3GY4A 1O2HA 1ZZZA 2VIDA 2ZPRA 2A32A 1BITA 3KHVA 2AERH 2GT8A 1K1JA 1ELVA 3A85A 4NIWA 1W7GH 2STBE 1GHBF 1KXAA 2FS9A 3TH3H 4AZ2B 2PGQB 3JZ1B 2G8TA 4HTCH 1PFXC 3GYLB 4U32A 3F6UH 1BMMH 4JMYA 2XBVA 1G2LA 2PHBA 1O34A 2HOBA 1BTWA 2CF9H 1FV9A 1SGYE 4NWKA 1GMCF 1O36A 9LPRA 1TA2A 2ZU3A 3GY7A 3RXIA 4GCHG 1G3CA 2EI6A 3LJJA 2XCNA 1GGDB 1KXEA 1QCPA 1SGRE 1MKXH 4ABAA 3SORA 2BX3A 2ZO3H 1C5VA 3M37A 3K6ZA 4JZEH 3BTQE 4LK4A 1C2FA 1QJ7B 1A7SA 6ESTA 1W10U 2GDEH 2QAAA 1KY9A 3QWCH 3KQDA 1JIRA 1YC0A 3SJ9A 1C9PA 1EB1H 3OY5U 2SFAA 2AFQB 2Z9JA 2FS8A 3PB1E 1P01A 2ZDKA 3RM0H 1SSXA 5H4IB 3PLPA 1HAOH 4IC5A 1C2EA 2G55A 3PO1C 1Y3VA 5EQSA 1O3KA 3TVJB 2GTBA 2QIQA 1LVOA 2C4FH