2XTTB

Bovine trypsin in complex with evolutionary enhanced schistocerca gregaria protease inhibitor 1 (sgpi-1-p02)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEASE INHIBITOR SGPI-1
publication title The Catalytic Aspartate is Protonated in the Michaelis Complex Formed between Trypsin and an in Vitro Evolved Substrate-Like Inhibitor: A Refined Mechanism of Serine Protease Action.
pubmed rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xttB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xttB02
1WUNH 9LPRA 3BG4C 1B7XB 1SGDE 1VJAU 2GCTC 4XE4A 3RXLA 3DD2H 1E34B 3B9FH 3U1JB 1DS2E 1SGIB 4D9QA 1ZSKA 3RC4A 2BZAA 5LH8A 4JCNA 1NO9H 3T29A 3NWUA 1ZRBA 1L4DA 3DUXH 5L2YH 1U6QA 2BXUH 1D6RA 1TABE 4ABAA 1LKBA 2O8LA 3A84A 3NXPA 3ZZ3A 4GPGA 1TX8A 1BMNH 4IBLH 5CE1A 2FOHA 5C67A 5HXFA 2UUFB 1P2MA 4FUFA 1OSSA 3PTBA 1ZR0A 1K1LA 2ZGJA 3PMBB 3U69H 3SGAE 2PWXA 4WY3A 3MO3A 2FZZA 1N1LA 2Y5GA 2G8TA 4DG4A 1E0FD 1O32A 1HV7A 1N8OC 1MU8B 2ZHEH 1EXFA 5HM2A 2QYIA 4CH2B 3GDSA 1O5EH 1W10U 3PV4A 3QDZB 5EW1H 3VXFH 1MMJN 3ZVAA 2IJOB 2ODPA 1ELVA 1YCPK 2ZDAH 1AMHA 2ZKSA 2BDCA 1O2PA 3GYMA 4ZUHA 2VWNA 1DFPA 1V2VT 1T4VH 4MNXA 3ZVDA 4IMQA 2DE9A 4H42U 1XX9A 1NM6A 2AIPA 1C5QA 1EZXC 5GCHF 4X1QU 3MFJA 2FIRH 2GZ9A 4E7RG 4WWYA 3UWJH 1UHBA 3JZ2B 4XFQA 1ZJDA 1B0EA 3SJIA 3RXMA 1ZPBA 2ZPQA 4X6NA 2A2QH 4ABGA 3MNSA 1OOKB 3RXVA 1LCYA 1P01A 3BSQA 4YOIA 3RXTA 3TH4H 1XVOA 1GL1A 1YC0A 5FBEA 2BLQA 1P06A 2TGPZ 3RXJA 5J4QA 1IOEA 4MPXA 2VIQA 4A7IB 2FX4A 2BLWA 1O5AB 3M35A 3M36A 1FIWA 3SHCH 1G32B 1CE5A 2ZDLA 2FLRH 1Y3YA 2R0LA 1GBAA 1P2KA 4YLQH 3FFGA 1C5XB 1RIWC 1TRNA 3T28A 2TGAA 3A80A 2ULLA 5JYIA 1AY6H 2GZ7A 5C1UA 4X2WA 4BANB 5F8TA 1UVTH 1FJSA 2JH0D 1C2JA 8LPRA 2O8MA 1QIXB 4I8LA 4ABBA 1A5HA 1CO7E 4JYUH 2GCHF 2WV5A 2XW9A 3PLPA 4XOJA 4ESTE 3DT0H 1SMFE 1ZOMA 1IQGA 1O5GH 5H4IB 2FWWA 3UR6A 1JIMA 3FP7E 1WCZA 1VITH 1Y3XA 3HKJB 1ZZZA 4D9RA 2QAAA 3SNAA 3HKIB 5C5NA 1PYTD 1YLCA 1H9IE 1C1UH 2ESTE 3SU3A 2BTCE 4K1SA 1FPCH 2A7JA 1O31A 3U98H 1P3CA 1EP6A 2FPZA 2I6SA 5GPIB 3IITA 4Y11E 2DE8A 1O5FH 1MKWK 2Z9LA 1MTWA 3RLYH 1C5NH 1WV7H 4UFEH 4FU8A 1RTKA 2FI4E 1YM0A 3LT3A 2BD9A 4U30A 1JWTA 1O39A 1ACBE 1KSNA 3UOUA 1P09A 2ZHWH 3BIUH 5TCAA 1GI9B 4GLYA 2AGIX 1F5LA 1EQ9A 2SGFE 3ZVCA 2G5NA 3L6PA 2OINA 3ZZAA 3LH1A 1ZHRA 3PMJA 3SU0A 5B6OA 1A0HB 2GVFA 2XWAA 1MUEB 2HNTF 4U2WA 4UDWH 1GBTA 1SHHB 2WPHS 3RM2H 3SV8A 2V6NA 1MKXH 1ANBA 4GCHG 2Z9GA 3M5OA 8ESTE 2Y7XA 4RKOB 1TBQH 1ETTH 2OUAA 3KGPA 1HAVA 3SJ9A 2Q6FA 3EAJA 2V35A 3E90B 1KDQB 3BF6H 1WYKA 1TRYA 4I32A 3UFAA 1D9IA 1A5GH 4MVNA 3SGBE 1GI0A 1EASA 2ZCHP 1YPKH 4Q7YA 4YOJA 2BZ6H 3RU4E 5K7RA 2R3YA 1ZPCA 3KHVA 1MQ6A 5EXNA 2ZGXH 1PPHE 2BQWB 2ZU2A 1K1OA 3UQOA 1GG6B 4CRGA 4GUXA 1NPMA 3M7QA 1GJ4H 3LGVA 1SOTA 3ZZBA 3TH2H 3F9GA 2BOHB 2Y7ZA 1J9CH 2SGEE 3SORA 1C5TA 3FZDA 1NFYA 1YBWA 2BD5A 3RMOH 3SJKA 4IGDA 2ZDNA 1WQVH 1K1IA 1LHFH 4GHTA 2J34A 1PQ8A 3IG6B 3RXUA 1AFQC 1O2WA 2GT7A 4I8HA 1SGTA 5HGGA 3R3GB 1F0TA 3L33A 2WUBA 1L2EA 5FPTA 2HGTH 1KLIH 1DXWA 4VGCC 1NS3A 3T2NA 2SNVA 1P11E 2BY9X 1OYQA 3ZZ7A 3E6PH 1GHVH 4NGAH 1F7ZA 1TAWA 3BIVH 3GCOA 1S0RA 1O5BB 1ELCA 1A3EH 4OS6A 3AASA 5T3HA 4FUGA 3A86A 1OS8A 3MNXA 4Y8YA 2BDGA 1ETSH 1CA0C 4INKA 5G4BA 2THFB 4ZHMU 1ETRH 1EJAA 3W95A 1HXEH 5FXLA 3M5LA 1EZUC 1SGFA 3T62A 2BVXH 2GZ8A 3RU4D 4BTTB 5C3NA 3NKKA 2XCNA 1G36A 3SNBA 4X1SU 3PMAB 4MDSA 1C5SA 2BX4A 1O2ZA 2VIOA 2ZZUH 1QL8A 1FMGA 4AFUA 3ZV8A 4DGJA 2PSXA 2QV1A 5GDSH 2OC7A 2ZP0H 5A09A 1ELFA 4MLFB 4MPWA 4I31A 1O2SA 1DWBH 1M9UA 1O3FA 5DGJA 2ALPA 2F9OA 1AVXA 2BQ7B 2GDEH 4BAOB 4YZUA 1UCYK 2ZG0H 1AFEH 2BLOA 4FVBA 3ZVGA 5EW2H 1GVZA 5AVDA 3V12A 1A0JA 5DP8A 3E91A 1H8DH 3TLOA 2FTMA 2QY0B 4PROA 1ZYOA 1MQ5A 1QURH 5AFZH 2OQ5A 1DSUA 1E37B 3QUMP 2QXGA 4IC5A 1C4V2 2P16A 2VVCA 4HTCH 1J15A 3URCA 1O2XA 4E05H 4Y8ZA 3NPSA 5FAHA 3GCNA 3HGPA 2CJIA 1WQSA 5EQSA 1F0UA 1E36B 1FN8A 1QJ6B 4Y0YE 8GCHG 1D3TB 2RA0A 1PQ5A 1V2WT 4I33A 1HAGE 1K28D 4ISLA 5F8XA 2GTBA 2XXLA 4WJG2 1CBWB 2GV7A 5E0HA 4DCDA 1NT1A 1C2EA 1TPPA 3DFJA 4B2AA 3KIDU 1V2NT 2CGAA 4YESB 4ZHLU 3P8GA 1HBTH 4B71A 2J9NA 1AI8H 1TNHA 1JRTA 4Y10E 2AEIH 1EOJA 2NWNA 1GJCB 3MOCA 3VB6A 1BBRH 2FOFA 2VJ1A 1C1RA 1AZZA 5DKMA 1BHXF 2H9TH 3P6ZB 1A61H 1C5YB 1TBRH 3S7HB 3ZVFA 1NZQH 1MTSA 1ESBA 1LQDB 1V2PT 2A32A 2FO9A 1GBHA 2PR3A 2QIQA 2FOBA 3EA8A 2J38A 1XXFA 2ZWLH 3TGIE 2AFQB 1BBRE 1CHGA 1PPZA 1FY5A 4DVAU 3TJOA 5JBCS 2R3UA 2LPRA 2VU8E 1MH0A 3A7TA 1F0SA 5C1YA 4AOQA 4X8TH 4X2YA 5DO4H 2ZHDA 4CHAB 3KF2A 2IPHA 4XSKU 1UJ1A 3S9AA 5JPMH 3RXBA 1O2JA 1JMOH 4B73A 4I8KA 1ELEE 3R0FA 3SI4H 3QLPH 2ZU5A 2FOCA 1UTLM 1P2OA 4ZH8A 5BRRE 3RLWH 4FUHA 3A8BA 1MAYA 3U1IB 2AH4X 1TPOA 2O8TA 2OBQA 1AVGH 1OWJA 4X8VH 1NRNH 3TK9A 4B2CA 1TWXB 4MTBA 1WBGB 1DITH 1BTUA 1KXEA 1KXAA 1GJ7B 1FAXA 1F0RA 1WAYB 4LK4A 4MNVA 1T7CA 3RP2A 2HRVA 3RXDA 2F9BH 3MHWU 8GCHF 3B8JA 1BRCE 2VWOA 3RMNH 1LPKB 4HGCA 4X6PA 4F49A 1ZPZA 1FN6A 2VIVA 1ORFA 4CR5A 3SV9A 5C5OA 2CF8H 3KQEA 4NIYA 3S7KB 1RRKA 1A3BH 1MBMA 2STAE 4MQAA 4WH6A 1O2NA 3UIRA 1TNIA 2QA9E 2V3OH 1UO6A 3ZZ8A 4RSPA 1G3CA 3SV2H 4AYVB 1LVYA 3MH5A 2ZFSA 4CBOA 1AIXH 4JZIA 5FBIA 4BXWA 4Y76A 1NRRH 1O37A 1EZQA 5EG4A 2BDYA 1A1RA 1UHBB 5E0JA 2B9LA 2W3KA 3ZYDA 3S0NA 1N6XA 2ANMH 2FOMB 3MU4A 1KXBA 4AB9A 1SSXA 1MAXA 1HJ8A 2ZFPH 3SNDA 3ZYEA 1S6FA 3ODFA 3D23A 1WOFA 1VGCC 4NZQA 2A5IA 1C5UA 1NROH 3STIA 4MNWA 1JRSA 1T8MA 3RXFA 4NIWA 2UWLA 2QF3A 1ZMJA 3SI3H 1TIOA 3KNXA 1MTUA 5GCHG 2AS9A 2TIOA 5T6GA 1BTWA 1C2DA 1MBQA 1GVLA 1HAYB 3VB5A 4ISOA 2G4TA 1W8BH 1YPLH 2SGPE 1NY22 1A46H 2OTVA 1VCPA 3UWIA 1QBNA 4IW4E 9ESTA 1SQAA 1GI3A 2VH6A 3SN8A 2P8OC 1GMDF 3BV9B 1SLUB 1QJ1B 1GHAG 4MG3A 3ESTA 5JBBS 3PLBA 5K0HA 2M5TA 5T6FA 4A1XA 2VIWA 1RD3B 4K5ZA 2VVUA 4GAWA 1BTYA 1UVSH 1Y3WA 1KXCA 1E38B 2PTCE 4KP0A 2A1DB 4D8NA 5FX5A 1BZXE 2BXTH 2RA3A 1ELGA 1YPHC 2NU4E 1O3GA 4A1VA 3T5FH 2C90B 2Z3CA 3SW2B 1TGNA 1TE0A 3GYLB 1IAUA 1SC8U 5EQQA 1YLDA 4TY7A 1PJPA 3A82A 1G3BA 3E0PB 1O3NA 3F9HA 3LPRA 1MTNC 3TGJE 1C4Y2 1EAIA 1VITF 1GWAA 4NA9H 4FU9A 1BRBE 2GCHG 3A87A 1W7GH 1RJXB 3RXQA 1UVOA 3GY4A 4FUDA 2PKSC 1AGJA 3LGIA 2WPJS 7LPRA 2ZGCA 1YPMH 2Y80A 3RXAA 3LU9B 2ZF0H 2BD8A 1EX3A 5E0GA 1PPGE 1A4WH 1BMLA 1GBKA 5DK1A 2FM2A 3F1SB 1WTGH 1TX6A 2VH0A 2UUKB 1NTPA 3ELAH 3U8OH 3EE0B 3TGKE 2ZFFH 1V2ST 2JKHA 1W13U 4CRDA 1TNLA 1C2FA 3OU0A 1ESAA 3GDUA 1WTHD 2W26A 5SGAE 5IYTA 5L30H 1HAVB 1IQLA 2PGQB 1HB0B 1AWFH 1P12E 2Y5FA 3BG4B 7ESTE 1QRZA 5FX6A 3EA9A 3MO6A 2GCTB 5E2OA 1H9HE 4AFZA 2XBXA 1Q3XA 1BOQA 4ZXYH 2RG3A 2A7CA 3BN9A 5PTPA 3E1XB 2EEKA 3UOPA 4UE7H 4UONA 1IQMA 1TMBH 3HK3B 1GI2A 1GHAF 2ANKH 3HATH 3K2UA 2GD4B 3ZZ4A 3K6ZA 3ENSB 1X7AC 2GMTC 2JH6D 2D8WA 4WF8A 1FV9A 4THNH 3SUEA 2B8OH 3LGYA 2G51A 2PUXB 4FXGH 1CHOF 1EB1H 1HLTH 4AB8A 1FIZA 1GBBA 3BTDE 2BLVA 1YF4A 2GV6A 2UWOA 4Y6DA 1UTJA 1S84A 1RXPA 2CV3A 1N8OB 4A5TS 1QB6A 3ZVEA 4NCYA 2XWBI 1KTTB 2ZHQH 5IDKA 4WVPE 1ELAA 2VWMA 5JDUB 1FXYA 1QJ7B 4HZHA 2DUCA 4U01A 1OKXA 2G81E 1F92A 1DWDH 1XUIA 3PWCA 2FOGA 3SBKA 1TRMA 1DUAA 2ODYB 2BY8X 3URDA 1GBLA 4GSOA 3SU2A 2NU3E 1QTFA 4DW2U 1QB9A 1GJBB 2CHAC 2OLGA 1BTXA 4E7NA 3BEFB 1TB6H 1HAIH 4SGAE 1EB2A 1CQQA 2Z94A 4SGBE 3F6UH 5A0AE 4O3UA 6CHAC 3E0NB 1ZJKA 4GVUA 1VJ9U 3O8RA 1BTZA 2ZGHA 1GCTC 3OY5U 3SU4A 5J4SA 3MU1A 1FZZA 1KLJH 1LPGB 1TA6A 4ASHA 2C8ZB 4DY7B 1LHEH 3SOSA 1QL7A 3AAUA 1TALA 3LGTA 2A4QA 3LIWA 2RDLA 4D7FA 2OC1A 1RIWB 2ZU3A 1HRTH 3QGNB 2A7HA 1MTVA 1BBRK 1LO6A 2FI3E 2BDBA 4YO9A 2Y6TA 3E3TA 1KXDA 3V13A 3GICB 3BTKE 5AHGH 3HPTB 4K2YA 1DM4B 1AZ8A 2GDDA 3Q3XA 5EPNA 2W3IA 4JMYA 3Q3KA 5EXLA 3VGCC 1HJAC 4WMDA 2XYAA 4FUIA 2TBSA 1SLVB 4X6MA 1S81A 1C2HA 1K21H 1QNJA 4JK6A 3MNBA 1UTPA 2SGQE 1DLKB 1BMMH 2FI5E 3BEUA 1J8AA 2JETC 1BIOA 1LQEA 1XUGA 7GCHF 2H5CA 2Q6DA 4Y7BA 1AN1E 2Y81A 1XM1A 3MU8A 1SR5C 3GOVB 1IQNA 1SGFG 1QA7A 1V2TT 1GDQA 1O2QA 1DANH 1K1JA 1KY9A 1SLXB 1QL9A 3DA9B 1JOUB 1Q2WA 2ZECA 3M37A 4CRBA 2W5EA 1DSTA 1YCPM 2FS8A 1Y5BT 1TYNA 1Q31A 1B5GH 2A4RA 1DLEA 3TJUA 3PTNA 1Y3VA 1VR1H 2OXSA 1C5RA 3RXHA 1EUFA 1DDJA 1G3DA 3FAOA 1CU1A 3LJOA 2BB4A 1NRPH 1TX7A 2PHBA 1C2LA 3MI4A 1NESE 3D62A 1GGDC 1PYTC 1EPTC 1ZHMA 4A6LA 1SGNE 1LVOA 1QRXA 4LZ4B 5FHTA 4IMZA 1GJAB 3FP6E 1O3PB 8KME2 3BG8A 5ESBA 1AWHB 3QO6A 4OS5A 5TCCA 1AB9C 3EDXB 4HFPB 2F9NA 3GCHC 1JXPA 2QXIA 5DP5A 1UVPA 1AE5A 1XKAC 3T25A 3HGNA 1P03A 5GJ4B 1TQ0B 5A8YA 2HWLB 4Y0ZE 5EGMA 1GHYH 2SNWA 2P3UB 3V0XA 2A4GA 2YNAA 3FZZA 1ZGVA 3SZNA 4AZ2B 1FNIA 1F5RA 2ZDMA 4NA8A 2ASUB 1G2LA 3BTGE 3S9BA 1A5IA 4Y8XA 3MMGA 3F68H 2PUQH 2OD3B 1ZSLA 3MH7A 1T4UH 2BDHA 1SPJA 2R0KA 3BTFE 4KTSA 1O2VA 2BD4A 2BY6X 4X2VA 2A45B 2WYGA 4D76A 4ZMAH 1DXPA 1GHWH 1PPCE 3ATWA 3HK6B 3UQVA 1GMCG 3VXEH 1DX5M 5DP6A 4ZKRU 1AFQB 2ZQ2A 1GHZA 2A31A 3DHKH 5I46H 1TLDA 4WMFA 6GCHF 4VGCB 2ANYA 1O3OA 4Q7XA 4Q7ZA 1HAOH 4X1PU 2XNIA 1Y5AT 2BVSH 4RKJB 2F9PA 5A0BA 2F9UA 3ZZ9A 1NFUA 1CA0B 1A7SA 5CMXH 2BM2A 2J2UA 1A0LA 2Y82A 4MPUA 3A89A 1AKSA 1O3BA 1S5SA 3A81A 5CHAC 1D3PB 3PMHB 1O3MA 1Z71A 4CRAA 1GHXH 3E8LA 1CGHA 1V2RT 1TBZH 1H8IH 1GJ5H 2P93A 4AN7A 3OTJE 4Q2KA 1BUIA 1Z8JB 1BCUH 1C9PA 2QGRA 3QZRA 1AU8A 3PO1C 3P95A 1GHBF 3NK8A 3D65E 1YPHE 3H7OA 4HI3A 4Y71A 1C2GA 4JYVH 4X8UH 2UUYA 3PWBA 1YYY1 1Z8IB 3UNRA 1FONA 2FYQA 4INLA 1HCGA 4OGXA 1V2JT 3SUGA 3QX5H 1FI8A 1FQ3A 3P92A 3EA7A 4J1YA 5T6DA 3A8AA 1CT2E 1HIAA 1NU9A 3SU6A 1O2GH 4DOQA 1OWIA 2JH5D 3TK5A 4AG1A 2BD2A 1QGFA 2YNBA 3O8CA 1K1PA 1L1GA 1ZSJA 1RFNA 4ZKNU 3VB3A 1C1QA 3A7ZA 4H6TA 2VIDA 4I7YH 2CMYA 1G9IE 4X0WU 3RM0H 1O5CB 1GMDG 3RXKA 3ZZ6A 1SG8B 3K9XB 1GJ9B 1QA0A 1O2TA 1GMCF 2QN5T 1HAPH 4FUJA 5DG6A 3FVFB 3ZV9A 2Z3EA 2ZPRA 5AF9H 2C8WB 1HJ9A 4TWWA 1KTSB 4YM9A 3AVZA 1O2IA 1J17T 2VGCC 4O9VA 2EA3A 4B74A 1PPBH 1GBFA 2PSYA 3A83A 1EAUA 1K1MA 3GY5A 1UTQA 1XUHA 4LXBH 3CENA 1Z6EA 4K1EA 3RMMH 6LPRA 1P9SA 2BD3A 3LJJA 4NSYA 1IQKA 3SU5A 3QZQA 1Y5UT 2BVRH 1XXDA 4TWYA 3SNCA 3GY2A 1Z8RA 2XC5A 2Z9JA 3GISB 1YGCH 5L6NH 4JZDH 1VITG 2FODA 2P59A 3ITIA 3VB4A 4ABHA 1BTPA 1YPJH 3PYHA 2TGTA 1AQ7A 3MH4A 4B75A 1OWHA 1XUJA 2VNTA 2AGGX 4X6OA 1UK4A 2HALA 2VVVA 4DIHH 2ZI2H 4NIXA 2FP7B 1O3KA 1LVBA 4RN6A 1TMUH 2GX4A 3LH3A 2G52A 3L3TA 1K1NA 4BTIB 1MZDA 3ZVBA 3Q77A 1W0ZU 2OC8A 2Q1JA 3F9FA 4CBNA 2Z9KA 5HM9A 1XMNB 3LONA 1O2UA 3LOXA 2A0QB 3P8FA 1HNEE 2XTTB 4O3TA 1P2JA 3BTQE 3SV6A 1QY6A 1V2LT 1ELTA 3P8OA 3IWMA 2ZU1A 3UTUH 4ZHAA 3OY6U 2F3CE 1ANDA 1K9OE 2P95A 5ETXA 1DVAH 3SJOA 2HNTC 4AGJA 1P05A 4JYTA 4CR9A 1Z1IA 1EJNA 2C8YB 2G55A 1OP0A 2C8XB 2HPPH 3TVJB 2CF9H 1BT7A 5A8ZA 1XUFA 1TOMH 3TIUA 2R2MB 4UFGH 1ZTJA 3K65B 1Y59T 4NA7A 2LNCA 2P3FH 2ZO3H 1FY4A 1O3JA 3PROA 1UCYH 3QN7A 4ABDA 1DOJA 3FANA 4YTAA 4ABEA 1AUJA 2NU0E 3GDVA 3M61U 3F9EA 1EAXA 1F2SE 5I25A 4AX9H 4FUEA 4X1NU 4YOGA 3BEIB 1CT4E 4AG2A 4UFFH 1SVPA 1P57B 1G37A 4R0IA 2IOTA 1MKXK 1UCYE 3C27B 1DICA 1CHOG 2A5AA 5C2ZA 1L4ZA 1ARCA 1C5PA 3MTYA 3PLKA 1XKBC 3FP8E 3AW1A 2ZTYA 3QTVH 1TQ7B 4CRCA 7KMEH 1TMTH 5E8EH 1ZMLA 1V3XA 2ZGBH 3RUOA 1SGQE 3O8DA 5FPYA 1W11U 4K60A 3DFLA 4X2XA 2BYAX 4A1TA 1L1JA 1V2KT 2OP9A 3A85A 1UK3A 1VGCB 2TRMA 4K8BA 1O3IA 1ZHPA 1BRAA 4ABFA 3RC6A 1CVWH 2W7SA 2XBVA 2EI7A 1LMWB 3A7XA 3TNTA 1LKAA 2A2XH 3A8CA 2ILNA 2QCYA 1ABIH 5DPAA 5C20A 3PB1E 4WXIA 2I6QA 1C1WH 2WPLS 1C4U2 2G4UA 1OWDA 4I8GA 4TPYA 3SJ8A 2AMDA 1GI8B 1YP9A 2R9PA 2A5KA 1C2IA 2ZFQH 2P8OB 2CXVA 4O97A 4D7GA 1K22H 1LHDH 4B76A 3CS7A 2ZFTA 1LHGH 1Z6JH 2D26C 2KAIA 2QXHA 2XC0A 3A7WA 4Y7AA 5FCRA 4BAQB 1GI1A 4M7GA 4XBCA 1L0ZA 1GDUA 2Z7FE 1SGRE 2F9VA 4XBDA 1IHTH 1TGCA 3GCTF 3KEEA 1O3HA 1DE7H 1SHYA 1YPGH 3GY3A 1BB0B 3MYWA 1NFXA 1H4WA 3EGKH 1LDTT 1GPZA 1TONA 4BXSA 1QQUA 4CRFA 5EQRA 4ABIA 2QC2A 1MTNB 2UWPA 4ISHH 1C5OH 1V6DA 3NCLA 3M3TA 1LVMA 3LGWA 1WSSH 3E16B 3TK6A 2PKSB 1TNGA 3AW0A 2J94A 3A8DA 1INCA 1W12U 2GGVB 1C5LH 2G00A 3SQEE 4B2BA 3SHAH 1BMAA 2EC9H 4ISIH 1G3EA 1LPZB 1O3AA 3ATLA 1O2YA 2GT8A 2AERH 7GCHG 4TY6A 1GBJA 4AYYB 6ESTA 2F91A 2O8WA 3WY8A 2ZTXA 2ZFRH 4DT7B 1GI4A 1C1PA 2PKAA 4KGAA 3T26A 3JZ1B 1MD7A 3C1KA 1A2CH 1DY8A 3Q3YA 3GY8A 5JB9S 3PM3A 3KL6A 4ZKSU 1SFQB 4ISNA 2VB0A 2ODQA 5GXPA 1V2OT 3MNCA 2QF0A 1ID5H 2OQUA 2P94A 4Y79A 2ZC9H 1T8NA 3CP7A 3RXEA 2J4IA 3P8NA 2NU2E 2B7DH 1TGTA 2J92A 3VB7A 3OSYA 1BJUA 1O3EA 2TPIZ 2G5VA 1G2MA 1C1SA 3OYPA 1W7XH 4NFEA 3ZZCA 3ODDA 1OP2A 1O36A 3Q76A 1TGBA 1EP5A 1QFKH 1YKTA 2B5TB 3BTEE 1HUTH 3MU5A 1H1BA 1EZSC 4A92A 2GMTB 1LHCH 3G01A 2R2WU 1CGIE 1WU1A 3TNSA 1HXFH 2Z6BD 4UEHH 3RC5A 4BOHA 1GBIA 1OYTH 2TGDA 1P02A 3Q00A 1DWCH 5HMAA 1O34A 2FOAA 5F8ZA 1GG6C 1TNJA 3A7VA 3UY9A 4GHQA 1C5MD 1NRQH 3LDXH 1P8VC 1D3QB 1O33A 1SQOA 3KQCA 4MPVA 3UNQA 4FVDA 2CN0H 5EODA 1OX1A 3ATIA 1QRWA 3RXGA 5C1XA 2AIQA 1AO5A 2C3SA 4WXVA 4NIVA 1RS0A 3M5MA 3N7OA 3BTME 4K3JA 4WH8A 5ABWA 5ESTE 1ZGIA 4JZEH 2STBE 1ZRKA 1W14U 2PFEA 2ANWA 3M7UA 1N6YA 2ZQ1A 1C1OA 1BITA 1IQHA 2ZCKP 1FY8E 5FPSA 1TOCB 5LPRA 1C5ZB 1KLTA 1O30A 1UK2A 1W0YH 4KTCA 5DP9A 4ZROA 5EXMA 5TJXA 3S69A 3KQBA 4NWKA 1DT2A 3TH3H 3UR9A 2AMPA 2CHAB 1LTOA 1OWKA 1PPEE 1AKSB 5DP4A 1D3DB 1BHXB 2ZEBA 1UTMA 1S83A 6CHAB 3RMLH 3B23B 2SGAA 6GCHG 3RXCA 4CREA 1HYLA 1ELBA 3LKWA 2WPMS 1P04A 1W2KH 1GCTB 1B0FA 2ALVA 1C1VH 3RDZA 3O8BA 5A2MH 2QXJA 1NFWA 4ZKOU 1OPHB 3H7TA 4XBBA 1THPB 3LC5A 5LPEA 3VFEA 4LOYH 1RGQA 1MCTA 1S6HA 3SV7A 1RTLA 2SFAA 4KELA 2PGBB 1C5VA 4OS4A 4BTUB 1GJDB 3NZIA 4XDEA 1XVMA 2ZU4A 2FLBH 2YOLA 2UUJB 2RCEA 4NG9H 3TJVA 1CSOE 1PQAA 5FCKA 1IQIA 1SGPE 1S0QA 5JBTA 1YCPH 4QT8C 2Z3DA 2ZIQH 1ESTA 2FTLE 1TPSA 5DJ7A 1HIAB 3VGCB 2GKVE 4TYDA 1HJAB 1P0SH 3ZZDA 1ZTKA 5HYOA 1GBMA 1O3DA 1IQJA 1SGYE 1GHBG 1PPFE 2H5DA 1GCDA 5GWZA 3S9CA 2FDAA 3MU0A 2H9HA 2JETB 1GDNA 2PV9B 4JZFH 1CA8B 1SOZA 1GBCA 4O03A 3TITA 5A0CA 2D1JA 5EPYA 1EATA 2BY5X 1HPGA 3KN2A 1FLEE 1JBUH 2OBOA 5A8XA 1J16A 4Z0KA 1BQYA 1MU6B 1AUTC 1CBWC 1DY9A 1AE8H 2H1UA 5DP3A 1O38A 1SLWB 4YT7H 1D4PB 3U9AH 1P2QA 3RXRA 4GCHF 1GGDB 2BHGA 1EPTB 3BTTE 1SI5H 3T27A 1V2MT 4FUBA 1UTKA 5LPFA 1NC6A 1FUJA 3V3MA 1P2NA 2ZDVH 5JB8S 3A88A 1P10A 4K69A 2V3HH 4NWLA 3ATKA 2F83A 1Y3UA 1O35A 2FOEA 2ZPSA 3VPKA 1GJ8B 1L1NA 1C1MA 1QHRB 1C2MA 2XBYA 1V2UT 1AB9B 1S85A 2BDIA 1VCWA 2XC4A 1O2RA 1IQFA 4Q80A 3GCHB 2FS9A 3SU1A 2HNTE 3M5NA 4OGYA 3GY6A 1BJVA 1G30B 3RU4T 1GVKB 1H9LB 1C5WB 1BDAA 1SL3A 1BA8B 4OS7A 3VEQB 1ANEA 3U8TH 1VCQA 5F6MA 2ZDKA 5BPEA 1GMHG 2BOKA 2K1QA 1KDQA 4CHAC 4AFSA 1ABJH 1MKWH 3V7TA 2AGEX 1C9TA 1HFDA 1SQTA 3SUDA 1Z1JA 1DWEH 1ARBA 2VINA 4JZ1A 3MWIU 1KIGH 1ZMNA 4YLUA 1GI7B 2SGDE 2BQ6B 1UMAH 2Q6GA 5EOKA 1QBOA 1QQ4A 1KXFA 4DIIH 3EYDA 4BAKB 1UVUH 4IN2A 4JK5A 4AORA 2HVXA 2XBWA 1BRUP 4K1TA 1PFXC 3I78A 2BX3A 4DURA 2HLCA 2Z9IA 3TPIZ 2OCVB 1C2KA 2FXRA 3ATMA 1V2QT 1P3EA 2WPIS 3RXPA 2BY7X 1EAWA 3MH6A 3SQHE 1ELDE 4ABJA 3LGUA 1GBDA 4IS5A 1O3CA 2V0BA 3RXIA 3LC3A 2EI8A 2ZHFH 2WPKS 3KQDA 2O8UA 4U32A 2VWLA 1OXGA 3TJNA 2FMJA 1FPHH 1TNKA 1C1NA 3U8RH 3QGJA 1IHSH 3NUMA 2GP9B 1AHTH 1J14A 5JBAS 1DPOA 5F03A 2ZA5A 3SNEA 1SGEE 1KYNA 2BD7A 2J95A 1IQEA 1MD8A 3SUFA 1RTFB 1EOLA 2D2DA 4I8JA 1MZAA 1O0DH 2BDAA 5CHAB 1HGTH 2FYRA 3H5CB 1ANCA 3AAVA 3QTOH 3ZZ5A 3UNSA 2AMQA 2ZNKH 4ZAEA 5EU8A 3I77A 2WUCA 2P3TB 2H6MA 3M3SA 2XCFA 5DP7A 1NU7B 4OS1A 1JIRA 3UPEA 2H9EH 1W3CA 1EPTA 4WMEA 3PO1B 2ZTZA 4DJZB 3KCGH 4H6SB 1UTOA 3EQ0H 4NSVA 4TPIZ 1GMHF 1CT0E 1THRH 1T8OA 1FDPA 4NZLA 1GI5A 2KAIB 1K2I1 1BTHH 2Y5HA 1XUKA 2HOBA 1FY3A 1THSH 3SGQE 1F5KU 1C1TA 1FAKH 1SFIA 1T32A 3BTWE 4LZ1H 3UREA 2IN2A 3STJA 2FESH 4IN1A 4INHA 2AYWA 1ZTLA 4UFDH 4MNYA 1AVWA 2C93B 3CS0A 1GJ6A 2PTNA 5AFYH 4YT6H 3A7YA 4E06H 1QCPA 1NRSH 1P9UA 2HPQH 4UD9H 5E2PA 4H4FA 1OP8A 2PW8H 1CGJE 1O2MA 4KKDA 4FUCA 4X8SH 1Z7KA 1O2KA 3BTHE 3P17H 1SGCA 4R8TB 4NFFA 1TGSZ 2FEQH 2B0FA 2O9QA 2PLXA 2WINI 2ZCLP 2OC0A 1FY1A 3GCTG 3M7TA 1TPAE 3GY7A 1GL0E 2VGCB 1QR3E 5LGOA 1YPEH 4BAHB 3OX7U 4ZXXH 1OWEA 1AD8H 4OS2A 1DUEA 3P70B 1O2HA 1HAZB 1O2OA 2H2ZA 3D49H 4BNRA 2XRCA 1TA2A 4B1TA 2C4FH 2BMGB 2NU1E 4FU7A 3SO3A 4AGKA 3M3VA 1MCVA 2WYJA 3RXSA 3K6YA 2A4OA 1NN6A 2PKAB 2FX6A 3W94A 3TU7H 1T31A 1SBWA 3MO9A 4BAMB 1HAHH 1HAXB 2W7UA 4IC6A 3I29A 3QWCH 1O3LA 1S82A 1TFXA 5L2ZH 1P2IA 1SB1H 1ZLRA 3QK1A 1UTNA 1Z8GA 4KTUA 4F4OC 3RXOA 2EI6A 1QB1A 1D6WA 1QBVH 1O2LA 2WV4A 1PQ7A 4X1RU 1VZQH 1HDTH 4K8YA 4Z6AH 4CH8B 1O5DH 1T8LA 4AFQA 1EJMA 2VIPA 1EKBB 1Y8TA 5GIBA 1GBEA 3UUZA 1E35B 4J2YB 1GI6A
chains in the Genus database with same CATH superfamily
1WUNH 3PRBA 9LPRA 3BG4C 1B7XB 1SGDE 1VJAU 2GCTC 4XE4A 3RXLA 3DD2H 1E34B 3B9FH 3U1JB 1DS2E 1SGIB 4D9QA 1ZSKA 3RC4A 2BZAA 5LH8A 3F2FA 4JCNA 1NO9H 3T29A 3NWUA 1ZRBA 1L4DA 3DUXH 5L2YH 1U6QA 1W0JD 2BXUH 1D6RA 1TABE 4ABAA 1LKBA 2O8LA 3A84A 3NXPA 2WV9A 3ZZ3A 4GPGA 1TX8A 1BMNH 4IBLH 5CE1A 1E79D 2FOHA 5C67A 5HXFA 2UUFB 1P2MA 4FUFA 1OSSA 3PTBA 5HIZA 1ZR0A 1K1LA 2ZGJA 3PMBB 3U69H 3SGAE 2PWXA 4WY3A 3MO3A 2FZZA 1N1LA 2Y5GA 2G8TA 4DG4A 1E0FD 1O32A 1HV7A 1N8OC 1MU8B 2ZHEH 1EXFA 5HM2A 2QYIA 4CH2B 3GDSA 1O5EH 1W10U 3PV4A 3QDZB 5EW1H 3VXFH 1MMJN 3ZVAA 2IJOB 2ODPA 1ELVA 1YCPK 2ZDAH 1AMHA 2ZKSA 2BDCA 1O2PA 3GYMA 4ZUHA 2VWNA 1DFPA 1V2VT 1T4VH 2HLDD 4MNXA 3OEED 3ZVDA 2K8IA 4IMQA 2WSSD 2DE9A 4H42U 1XX9A 1NM6A 2V3MA 2AIPA 1C5QA 1EZXC 5GCHF 4X1QU 3MFJA 2FIRH 2GZ9A 4E7RG 4WWYA 3UWJH 1UHBA 3JZ2B 4XFQA 1ZJDA 1EFRD 1B0EA 3SJIA 3RXMA 1ZPBA 2ZPQA 4X6NA 2A2QH 2V7QD 3MNSA 4ABGA 1OOKB 3RXVA 1LCYA 1P01A 3BSQA 4YOIA 3RXTA 3TH4H 1XVOA 1GL1A 1YC0A 5FBEA 2BLQA 2EY4C 2W6ID 1P06A 2TGPZ 3RXJA 5J4QA 1IOEA 4B6EA 4MPXA 2VIQA 4A7IB 2FX4A 2BLWA 1O5AB 3M35A 3M36A 1FIWA 3SHCH 1G32B 1CE5A 2ZDLA 2FLRH 1Y3YA 2R0LA 1GBAA 1P2KA 4YLQH 3FFGA 1C5XB 1RIWC 1TRNA 3T28A 2TGAA 3A80A 2ULLA 5JYIA 1AY6H 2GZ7A 5C1UA 1NBME 4X2WA 4BANB 5F8TA 1UVTH 1FJSA 2JH0D 1C2JA 5F53A 2O8MA 1QIXB 8LPRA 4I8LA 4ABBA 1A5HA 1CO7E 4JYUH 2GCHF 2WV5A 2XW9A 3PLPA 4XOJA 4ESTE 3DT0H 1SMFE 1ZOMA 1IQGA 1O5GH 5H4IB 2FWWA 3UR6A 1JIMA 3FP7E 1WCZA 1VITH 1Y3XA 3HKJB 1ZZZA 4D9RA 2QAAA 3SNAA 3HKIB 5C5NA 1PYTD 1YLCA 1H9IE 1C1UH 2ESTE 3SU3A 2BTCE 4K1SA 1FPCH 2A7JA 1O31A 3U98H 2PP6A 1P3CA 1EP6A 2FPZA 2I6SA 5GPIB 3IITA 4Y11E 2DE8A 1O5FH 1MKWK 2Z9LA 1MTWA 5CHBA 3RLYH 1C5NH 1WV7H 4UFEH 4FU8A 1RTKA 2FI4E 1YM0A 3LT3A 2BD9A 4U30A 1JWTA 1O39A 1ACBE 1KSNA 3UOUA 1P09A 2ZHWH 3BIUH 5TCAA 1GI9B 4GLYA 2AGIX 1F5LA 1OHHD 1EQ9A 2SGFE 3ZVCA 2G5NA 3L6PA 2OINA 3ZZAA 3LH1A 2KCYA 1ZHRA 3PMJA 3SU0A 5B6OA 4Q63A 1A0HB 2GVFA 2XWAA 4OM9A 1MUEB 2HNTF 4U2WA 4UDWH 1GBTA 3CNRA 1SHHB 2WPHS 3RM2H 3SV8A 2V6NA 1MKXH 1NBMD 2QF4A 1ANBA 4GCHG 2Z9GA 3M5OA 8ESTE 2Y7XA 4RKOB 1TBQH 2JIZD 1ETTH 2OUAA 3KGPA 1HAVA 3SJ9A 2Q6FA 3EAJA 2V35A 3E90B 1KDQB 3BF6H 1WYKA 1TRYA 4I32A 3UFAA 1D9IA 1A5GH 4MVNA 3SGBE 1GI0A 1EASA 2ZCHP 1YPKH 4Q7YA 4YOJA 2BZ6H 3RU4E 5K7RA 4TSFD 2R3YA 1ZPCA 3KHVA 1MQ6A 5EXNA 2ZGXH 1PPHE 2BQWB 2ZU2A 1K1OA 3UQOA 1GG6B 3PV5A 4CRGA 4GUXA 1COWD 1NPMA 3M7QA 1GJ4H 3LGVA 1SOTA 3ZZBA 3F2HA 3TH2H 3F9GA 2BOHB 2Y7ZA 1J9CH 2SGEE 3SORA 1C5TA 3FZDA 1NFYA 1YBWA 3DSPA 2BD5A 3RMOH 3SJKA 4IGDA 2WPDD 2ZDNA 1WQVH 1K1IA 1LHFH 4GHTA 2J34A 1PQ8A 3IG6B 3RXUA 1AFQC 1O2WA 2GT7A 4I8HA 1SGTA 5HGGA 3R3GB 1F0TA 3L33A 2WUBA 1L2EA 5FPTA 2HGTH 1KLIH 1DXWA 4VGCC 1NS3A 3T2NA 2SNVA 1P11E 2BY9X 1OYQA 3ZZ7A 3E6PH 1GHVH 4NGAH 1F7ZA 1TAWA 3BIVH 3GCOA 1YY3A 1S0RA 1O5BB 1ELCA 1A3EH 4OS6A 3ZIAD 3AASA 3F2GA 5T3HA 4FUGA 3A86A 5IK2D 1OS8A 3MNXA 4Y8YA 2BDGA 1ETSH 1CA0C 4INKA 5G4BA 2THFB 4ZHMU 3H09A 1ETRH 1EJAA 3W95A 1HXEH 5FXLA 3M5LA 1EZUC 1SGFA 3T62A 2BVXH 2GZ8A 3RU4D 4BTTB 5C3NA 3NKKA 2XCNA 1G36A 3SNBA 4X1SU 3PMAB 4MDSA 1C5SA 2BX4A 1YLNA 1O2ZA 2VIOA 2ZZUH 1QL8A 1FMGA 4AFUA 3ZV8A 4DGJA 2PSXA 2QV1A 5GDSH 2OC7A 2ZP0H 5A09A 1ELFA 4M9FA 4MLFB 4MPWA 4I31A 1O2SA 1DWBH 1M9UA 1O3FA 5DGJA 2ALPA 2F9OA 1AVXA 2BQ7B 2GDEH 4BAOB 4YZUA 1UCYK 2ZG0H 1AFEH 2BLOA 4FVBA 3ZVGA 5EW2H 1GVZA 5AVDA 3V12A 1A0JA 5DP8A 3E91A 1H8DH 3U28C 3TLOA 2FTMA 2QY0B 4PROA 1ZYOA 1MQ5A 1QURH 5AFZH 2OQ5A 1DSUA 1E37B 3QUMP 2QXGA 4IC5A 1C4V2 2P16A 2VVCA 4HTCH 1K0HA 1J15A 3URCA 1O2XA 4E05H 4Y8ZA 3NPSA 5FAHA 3GCNA 3HGPA 2CJIA 1WQSA 5EQSA 1F0UA 1E36B 1FN8A 1QJ6B 3OEHD 4Y0YE 8GCHG 1D3TB 2RA0A 1PQ5A 1V2WT 4I33A 1HAGE 1K28D 4ASUD 4ISLA 5F8XA 2GTBA 2XXLA 4WJG2 1CBWB 2GV7A 5E0HA 4DCDA 1NT1A 3N7DA 1C2EA 1TPPA 3DFJA 4B2AA 3KIDU 1V2NT 2CGAA 4YESB 4ZHLU 3P8GA 1HBTH 4B71A 2J9NA 1AI8H 1TNHA 1JRTA 4Y10E 2AEIH 1EOJA 1GJCB 2NWNA 3MOCA 3VB6A 1BBRH 2FOFA 2VJ1A 1C1RA 1AZZA 5DKMA 1BHXF 2H9TH 3P6ZB 1A61H 1C5YB 1TBRH 3S7HB 2F43B 3ZVFA 1NZQH 4P00A 1W0KD 3GS9A 1MTSA 1ESBA 1LQDB 1V2PT 2A32A 2FO9A 1GBHA 2PR3A 2QIQA 2FOBA 3EA8A 2J38A 1XXFA 1UW7A 2ZWLH 3TGIE 2AFQB 1BBRE 1CHGA 1PPZA 1FY5A 4DVAU 3TJOA 5JBCS 2R3UA 2LPRA 2VU8E 1MH0A 3A7TA 1F0SA 2RDEA 5C1YA 4AOQA 4X8TH 4X2YA 5DO4H 2ZHDA 5KGOA 4CHAB 3KF2A 2IPHA 4XSKU 1UJ1A 3S9AA 5JPMH 2XOKD 3RXBA 1O2JA 1JMOH 4B73A 4I8KA 1ELEE 3R0FA 3SI4H 3QLPH 2ZU5A 2FOCA 1UTLM 1P2OA 4ZH8A 4AC9A 3RLWH 4FUHA 5BRRE 3A8BA 1MAYA 3U1IB 2AH4X 1TPOA 2O8TA 2OBQA 1AVGH 1OWJA 4X8VH 1NRNH 3TK9A 4B2CA 1TWXB 4MTBA 1WBGB 1DITH 1BTUA 1KXEA 1KXAA 1GJ7B 1FAXA 1F0RA 1WAYB 4LK4A 4MNVA 1T7CA 3RP2A 2HRVA 3RXDA 2F9BH 3MHWU 8GCHF 2J5UA 3B8JA 1BRCE 2VWOA 3RMNH 1LPKB 4HGCA 4X6PA 4F49A 1ZPZA 1FN6A 2VIVA 1ORFA 4CR5A 3SV9A 5C5OA 2CF8H 3KQEA 4NIYA 3S7KB 1RRKA 1A3BH 1MBMA 1SKYE 2STAE 4MQAA 4WH6A 1O2NA 3UIRA 1TNIA 2QA9E 2V3OH 1UO6A 3ZZ8A 4RSPA 1G3CA 3SV2H 2YMSC 4AYVB 1LVYA 3MH5A 2ZFSA 3UAIC 1AIXH 4CBOA 2RFKC 4JZIA 5FBIA 4BXWA 4Y76A 1NRRH 1O37A 1EZQA 5EG4A 2BDYA 1A1RA 1UHBB 5E0JA 2B9LA 2W3KA 3ZYDA 3S0NA 1N6XA 2ANMH 2FOMB 3MU4A 1E1RD 1KXBA 4AB9A 1SSXA 1MAXA 1HJ8A 2ZFPH 3SNDA 3ZYEA 1S6FA 3ODFA 3D23A 1WOFA 1VGCC 4NZQA 2A5IA 1C5UA 1NROH 3STIA 4MNWA 1JRSA 1T8MA 3RXFA 4NIWA 2JDID 2QF3A 1ZMJA 2UWLA 3SI3H 1TIOA 3KNXA 1MTUA 5GCHG 2AS9A 2TIOA 5T6GA 1BTWA 1C2DA 1MBQA 1GVLA 1HAYB 3VB5A 4ISOA 2G4TA 1W8BH 1YPLH 2SGPE 1NY22 1A46H 5HIYA 2OTVA 1VCPA 3UWIA 2KZ4A 1QBNA 4IW4E 9ESTA 1SQAA 1GI3A 2VH6A 3SN8A 2P8OC 1GMDF 3BV9B 1SLUB 1QJ1B 1GHAG 4MG3A 3ESTA 5JBBS 3PLBA 5K0HA 2M5TA 5T6FA 2VBCA 4A1XA 2VIWA 1RD3B 4K5ZA 2VVUA 4GAWA 1BTYA 1UVSH 1Y3WA 1KXCA 1E38B 2PTCE 4KP0A 2A1DB 4D8NA 5FX5A 1BZXE 2BXTH 2RA3A 1ELGA 1YPHC 2NU4E 1O3GA 4A1VA 3T5FH 2C90B 2Z3CA 3SW2B 1TGNA 1TE0A 3GYLB 1IAUA 1SC8U 5EQQA 1YLDA 4TY7A 1PJPA 3A82A 1G3BA 3E0PB 1O3NA 5C94A 3F9HA 3LPRA 1MTNC 2OK5A 3TGJE 1C4Y2 1EAIA 1VITF 1GWAA 4NA9H 4FU9A 1BRBE 2GCHG 3A87A 1W7GH 1RJXB 3RXQA 1UVOA 3GY4A 4FUDA 2PKSC 1AGJA 3LGIA 2WPJS 7LPRA 2ZGCA 1YPMH 2Y80A 3RXAA 3LU9B 2ZF0H 2BD8A 1EX3A 5E0GA 1PPGE 1A4WH 1BMLA 1GBKA 5DK1A 2FM2A 3F1SB 1WTGH 1TX6A 2VH0A 2UUKB 1NTPA 3ELAH 3U8OH 3EE0B 3TGKE 2ZFFH 1V2ST 2JKHA 1W13U 4CRDA 1TNLA 1C2FA 3OU0A 1ESAA 3GDUA 1WTHD 2W26A 5SGAE 5IYTA 5L30H 1HAVB 1IQLA 2PGQB 1HB0B 1AWFH 1P12E 2Y5FA 3BG4B 7ESTE 4Q4LA 1QRZA 5FX6A 3EA9A 3MO6A 2GCTB 1S6LA 5E2OA 1H9HE 4AFZA 2XBXA 1Q3XA 1BOQA 2KR7A 4ZXYH 2RG3A 2A7CA 3BN9A 5PTPA 3E1XB 2EEKA 3UOPA 4UE7H 4UONA 1IQMA 1TMBH 3HK3B 1GI2A 1GHAF 2ANKH 3HATH 3K2UA 2GD4B 3ZZ4A 3K6ZA 3ENSB 1X7AC 2GMTC 2JH6D 2D8WA 4WF8A 1FV9A 4THNH 3SUEA 2B8OH 3LGYA 1WXRA 2G51A 2PUXB 4FXGH 1CHOF 1EB1H 1HLTH 2LP6A 4AB8A 1FIZA 1GBBA 3BTDE 2BLVA 1YF4A 2GV6A 2UWOA 4Y6DA 1UTJA 1S84A 1RXPA 2CV3A 1N8OB 4A5TS 1QB6A 3ZVEA 4NCYA 2XWBI 1KTTB 2ZHQH 5IDKA 1E1QD 4WVPE 1ELAA 2VWMA 5JDUB 1FXYA 1QJ7B 2L74A 2DUCA 4HZHA 4U01A 1OKXA 5EJZA 2G81E 1F92A 1DWDH 1XUIA 3PWCA 2FOGA 3SBKA 1TRMA 1DUAA 2ODYB 2BY8X 3URDA 1GBLA 4GSOA 3SU2A 2NU3E 1QTFA 4DW2U 1QB9A 3N7EA 1GJBB 5EIYA 2CHAC 2OLGA 1BTXA 4E7NA 3BEFB 1TB6H 1HAIH 4SGAE 1EB2A 1CQQA 2Z94A 4SGBE 3F6UH 5A0AE 4O3UA 6CHAC 3E0NB 1ZJKA 4GVUA 1VJ9U 3O8RA 1BTZA 2ZGHA 1GCTC 3OY5U 3SU4A 5J4SA 1QZ8A 3MU1A 1FZZA 1KLJH 1LPGB 1TA6A 3KQ5A 4ASHA 5KEDA 2C8ZB 4DY7B 1LHEH 3SOSA 1QL7A 2QF5A 5C0UA 3AAUA 1TALA 3LGTA 2A4QA 3LIWA 2RDLA 4D7FA 2OC1A 1RIWB 2ZU3A 1HRTH 3QGNB 2A7HA 1MTVA 1BBRK 1LO6A 1BMFD 2FI3E 2BDBA 4YO9A 2Y6TA 3E3TA 1KXDA 3V13A 3GICB 3BTKE 5AHGH 3HPTB 4K2YA 1DM4B 1AZ8A 2GDDA 3Q3XA 5EPNA 2W3IA 4JMYA 3Q3KA 5EXLA 3VGCC 3MQKC 1HJAC 4WMDA 2XYAA 4FUIA 3SYJA 2TBSA 1SLVB 4X6MA 1S81A 1C2HA 3FN8A 1K21H 1QNJA 4JK6A 3MNBA 1UTPA 2SGQE 1DLKB 1BMMH 2FI5E 3BEUA 1J8AA 2JETC 4XD7D 1BIOA 1LQEA 1XUGA 7GCHF 2H5CA 2Q6DA 4Y7BA 1AN1E 2Y81A 1XM1A 3MU8A 1SR5C 3GOVB 1IQNA 1SGFG 1QA7A 1V2TT 1GDQA 1O2QA 1DANH 1K1JA 1KY9A 1SLXB 1QL9A 3DA9B 1JOUB 1Q2WA 5EJ1A 2ZECA 3M37A 4CRBA 2W5EA 1DSTA 1YCPM 2FS8A 2LELA 1Y5BT 1TYNA 1Q31A 1B5GH 2A4RA 1DLEA 3TJUA 3PTNA 1Y3VA 1VR1H 2OXSA 1C5RA 3RXHA 1EUFA 1DDJA 1G3DA 3FAOA 1CU1A 3LJOA 2BB4A 5B6LA 1NRPH 1TX7A 2PHBA 1C2LA 3MI4A 1NESE 3D62A 1GGDC 1PYTC 1EPTC 1ZHMA 4A6LA 1SGNE 1LVOA 1QRXA 4LZ4B 5FHTA 4IMZA 1GJAB 3FP6E 1O3PB 8KME2 3BG8A 5ESBA 1AWHB 3QO6A 4OS5A 5TCCA 1AB9C 3EDXB 4HFPB 2F9NA 3GCHC 1JXPA 2QXIA 5DP5A 1UVPA 1AE5A 4DT4A 1XKAC 3T25A 3HGNA 1P03A 5GJ4B 1TQ0B 5A8YA 3NRLA 2HWLB 4Y0ZE 5EGMA 3AK5A 1GHYH 2SNWA 3FOAA 2P3UB 3V0XA 3KYGA 3F0OA 2A4GA 2YNAA 3FZZA 4FETA 1ZGVA 3SZNA 4AZ2B 1FNIA 1F5RA 2ZDMA 4NA8A 2ASUB 1G2LA 3BTGE 3S9BA 1A5IA 4Y8XA 3MMGA 3F68H 2PUQH 2OD3B 1ZSLA 3MH7A 1T4UH 2BDHA 1SPJA 1H8ED 2R0KA 3BTFE 4KTSA 1O2VA 2BD4A 2BY6X 4X2VA 2A45B 2WYGA 4D76A 4ZMAH 1DXPA 1GHWH 1PPCE 3ATWA 3HK6B 3UQVA 1GMCG 3VXEH 1DX5M 5DP6A 4ZKRU 1AFQB 2IPQX 2ZQ2A 1GHZA 2A31A 3DHKH 4RT1A 5I46H 1TLDA 4WMFA 6GCHF 3EE7A 4VGCB 2ANYA 1O3OA 4Q7XA 4Q7ZA 1HAOH 4X1PU 2XNIA 1Y5AT 2BVSH 4RKJB 2F9PA 4F48B 5A0BA 2F9UA 3ZZ9A 1NFUA 1CA0B 1A7SA 5CMXH 2BM2A 2J2UA 1A0LA 2Y82A 3W1EA 4MPUA 3A89A 1AKSA 1O3BA 1S5SA 3A81A 5CHAC 3DSOA 1D3PB 3PMHB 1O3MA 1Z71A 4CRAA 1GHXH 3E8LA 1CGHA 1V2RT 1TBZH 1H8IH 1GJ5H 2P93A 4AN7A 3OTJE 4Q2KA 1BUIA 1Z8JB 1BCUH 1C9PA 2QGRA 3QZRA 1AU8A 3PO1C 3P95A 1GHBF 3NK8A 3D65E 1YPHE 3H7OA 4HI3A 4Y71A 1C2GA 4JYVH 4X8UH 2UUYA 3PWBA 1YYY1 1Z8IB 3UNRA 1FONA 2FYQA 4INLA 1HCGA 1VKYA 3OFND 1V2JT 4OGXA 3SUGA 3QX5H 1FI8A 1FQ3A 3P92A 3EA7A 4J1YA 5T6DA 4P02A 3A8AA 2J98A 1CT2E 1HIAA 1NU9A 3SU6A 2XNDD 1O2GH 4DOQA 1OWIA 2JH5D 3TK5A 4AG1A 2BD2A 1QGFA 2YNBA 3O8CA 1K1PA 1L1GA 1ZSJA 2J97A 1RFNA 4ZKNU 3VB3A 1C1QA 3A7ZA 4H6TA 2VIDA 4I7YH 2CMYA 1G9IE 4X0WU 3RM0H 1O5CB 1GMDG 5C17A 3RXKA 3ZZ6A 1SG8B 3K9XB 1GJ9B 1QA0A 1O2TA 1GMCF 2HVYB 2QN5T 1HAPH 4FUJA 5DG6A 3FVFB 3ZV9A 2Z3EA 2ZPRA 5AF9H 2C8WB 1HJ9A 4TWWA 1KTSB 4YM9A 3AVZA 1O2IA 1J17T 2VGCC 4O9VA 2EA3A 4B74A 1PPBH 1GBFA 2PSYA 3A83A 1EAUA 1K1MA 3GY5A 1UTQA 1XUHA 4LXBH 3CENA 1Z6EA 4K1EA 3RMMH 6LPRA 1P9SA 2BD3A 3LJJA 4NSYA 1IQKA 3SU5A 3QZQA 1Y5UT 2BVRH 1XXDA 4TWYA 3SNCA 3GY2A 1Z8RA 2XC5A 2Z9JA 3GISB 1YGCH 5L6NH 4JZDH 1VITG 2FODA 2P59A 3ITIA 3VB4A 4ABHA 1BTPA 1YPJH 3PYHA 5CDFE 2TGTA 1AQ7A 3MH4A 4B75A 1OWHA 1XUJA 2VNTA 2AGGX 4X6OA 1UK4A 2HALA 3OTPA 2VVVA 4DIHH 2ZI2H 4NIXA 2FP7B 1O3KA 1LVBA 4RN6A 1TMUH 2GX4A 3LH3A 2G52A 3L3TA 1K1NA 4BTIB 1MZDA 3ZVBA 3Q77A 1W0ZU 2OC8A 2Q1JA 3F9FA 4CBNA 2Z9KA 5HM9A 1XMNB 3LONA 1O2UA 3LOXA 2A0QB 3P8FA 1HNEE 2XTTB 4O3TA 4ZCNA 1P2JA 3BTQE 3SV6A 1QY6A 1V2LT 1ELTA 3P8OA 3IWMA 2ZU1A 3UTUH 4ZHAA 3OY6U 2F3CE 1ANDA 1K9OE 2P95A 5ETXA 1DVAH 3SJOA 2HNTC 4AGJA 1P05A 4JYTA 4CR9A 1Z1IA 1EJNA 2C8YB 2G55A 1OP0A 2C8XB 2HPPH 2M2AA 3TVJB 2CF9H 1BT7A 5A8ZA 1XUFA 1TOMH 3TIUA 2R2MB 4UFGH 1ZTJA 3K65B 2KCAA 1Y59T 4NA7A 2LNCA 2P3FH 2ZO3H 1FY4A 1O3JA 3PROA 1UCYH 2WZQA 3QN7A 4ABDA 1DOJA 3FANA 4YTAA 4ABEA 1AUJA 2NU0E 3GDVA 2JJ2D 3M61U 2CK3D 3F9EA 1EAXA 1F2SE 5I25A 4AX9H 4FUEA 4X1NU 4YOGA 3BEIB 1CT4E 4AG2A 4UFFH 1SVPA 1P57B 2YMSB 1G37A 4R0IA 2IOTA 1MKXK 1UCYE 3C27B 1DICA 1CHOG 2A5AA 5C2ZA 1L4ZA 1ARCA 1C5PA 3MTYA 3PLKA 1XKBC 3FP8E 3AW1A 2ZTYA 3QTVH 1TQ7B 4CRCA 7KMEH 1TMTH 5E8EH 1ZMLA 1V3XA 2ZGBH 3RUOA 1SGQE 3O8DA 5FPYA 1W11U 4K60A 3DFLA 4X2XA 2BYAX 4A1TA 1L1JA 1V2KT 2OP9A 3A85A 1UK3A 1VGCB 2TRMA 4K8BA 1O3IA 1ZHPA 1BRAA 4ABFA 3RC6A 1CVWH 2W7SA 2XBVA 2EI7A 1LMWB 3A7XA 3TNTA 1LKAA 2A2XH 3A8CA 2ILNA 2QCYA 1ABIH 5DPAA 5C20A 3PB1E 4WXIA 2I6QA 1C1WH 2WPLS 1C4U2 2G4UA 1OWDA 4I8GA 4TPYA 3SJ8A 2AMDA 1GI8B 1YP9A 2R9PA 2A5KA 1C2IA 2ZFQH 2P8OB 2CXVA 4O97A 4D7GA 1K22H 1LHDH 4B76A 3CS7A 2ZFTA 1LHGH 1Z6JH 2D26C 2KAIA 2QXHA 2XC0A 3A7WA 3FKSD 4Y7AA 5FCRA 4BAQB 4B6FA 1GI1A 4M7GA 2K0QA 4XBCA 1L0ZA 1GDUA 2Z7FE 1SGRE 2F9VA 4XBDA 1KMHB 1IHTH 1TGCA 3GCTF 3KEEA 1O3HA 5DN6D 1DE7H 1SHYA 1YPGH 3GY3A 1BB0B 5HKKD 3MYWA 1NFXA 1H4WA 3EGKH 1LDTT 1GPZA 1TONA 4ACAA 4BXSA 1QQUA 4CRFA 5EQRA 4F55A 3VG8A 4ABIA 2F4LA 2QC2A 3WWBA 1MTNB 1WDIA 2UWPA 4ISHH 1C5OH 4XRNA 1V6DA 3F0PA 3NCLA 3M3TA 1LVMA 3LGWA 1WSSH 3E16B 2GJGA 3TK6A 3UB0A 2PKSB 1TNGA 3AW0A 2J94A 3A8DA 1INCA 1W12U 2GGVB 1C5LH 2G00A 3SQEE 4B2BA 3SHAH 1BMAA 2EC9H 4ISIH 1G3EA 1LPZB 1O3AA 2EQNA 3ATLA 1O2YA 2GT8A 2AERH 7GCHG 4TY6A 1GBJA 3SZEA 4AYYB 6ESTA 2F91A 2O8WA 3WY8A 2ZTXA 2ZFRH 4DT7B 1GI4A 1C1PA 2PKAA 4KGAA 3T26A 3JZ1B 1MD7A 3C1KA 1A2CH 1DY8A 3Q3YA 3GY8A 5JB9S 3PM3A 3KL6A 4ZKSU 1SFQB 4ISNA 2VB0A 2ODQA 5GXPA 2AHME 1V2OT 3MNCA 2QF0A 1ID5H 2OQUA 2KFWA 5C0TA 2P94A 4Y79A 2ZC9H 1T8NA 3CP7A 3RXEA 2J4IA 3P8NA 2NU2E 2B7DH 1TGTA 2J92A 3VB7A 3OSYA 1BJUA 1O3EA 2TPIZ 2G5VA 1G2MA 1C1SA 3OYPA 1W7XH 4NFEA 3ZZCA 3ODDA 1OP2A 1O36A 3PRDA 1TGBA 1EP5A 1QFKH 1YKTA 2B5TB 3Q76A 3BTEE 1HUTH 3MU5A 1H1BA 1EZSC 4A92A 2GMTB 1LHCH 3G01A 2R2WU 1CGIE 1WU1A 3TNSA 3PV2A 1HXFH 2Z6BD 4UEHH 3RC5A 4BOHA 1GBIA 1OYTH 2TGDA 1P02A 3Q00A 1DWCH 5HMAA 1O34A 2FOAA 5F8ZA 1GG6C 1TNJA 3A7VA 3DSGA 3UY9A 4GHQA 1C5MD 1NRQH 3LDXH 1P8VC 1D3QB 1O33A 1SQOA 3KQCA 4MPVA 3UNQA 4FVDA 2CN0H 5EODA 1OX1A 2JJ1D 3ATIA 1QRWA 3RXGA 5C1XA 2AIQA 1AO5A 2C3SA 4WXVA 4NIVA 1RS0A 3M5MA 3N7OA 3BTME 4K3JA 4WH8A 5ABWA 5ESTE 1ZGIA 4JZEH 2KCPA 2STBE 1ZRKA 1W14U 2PFEA 2ANWA 3M7UA 1N6YA 2ZQ1A 1C1OA 1BITA 1IQHA 2ZCKP 1FY8E 5FPSA 1TOCB 2WHXA 5LPRA 1C5ZB 1KLTA 1O30A 1UK2A 1W0YH 4KTCA 5DP9A 4ZROA 5EXMA 5TJXA 3S69A 3KQBA 1FX0B 4NWKA 1DT2A 3TH3H 3UR9A 2AMPA 2CHAB 1LTOA 1OWKA 1PPEE 1AKSB 5DP4A 1D3DB 1BHXB 2ZEBA 1UTMA 4RT0A 1S83A 6CHAB 3RMLH 3B23B 2SGAA 6GCHG 3RXCA 4CREA 1HYLA 1ELBA 3LKWA 2WPMS 1P04A 1W2KH 1GCTB 1B0FA 2ALVA 5KECA 1C1VH 2IJD1 4I86A 3RDZA 3O8BA 5A2MH 2QXJA 1NFWA 3DCLA 4ZKOU 1OPHB 3H7TA 4XBBA 1THPB 3LC5A 5LPEA 3VFEA 4LOYH 1RGQA 1MCTA 1S6HA 3SV7A 1RTLA 2SFAA 4KELA 2PGBB 1C5VA 4OS4A 4BTUB 1GJDB 3NZIA 4XDEA 1XVMA 2ZU4A 2FLBH 2YOLA 2UUJB 2RCEA 4NG9H 3TJVA 1CSOE 1PQAA 5FCKA 1IQIA 1SGPE 1S0QA 5JBTA 1YCPH 5FL7D 4QT8C 2Z3DA 2ZIQH 4FOUC 1ESTA 2FTLE 1TPSA 2J98B 5DJ7A 1HIAB 3VGCB 2GKVE 4TYDA 1HJAB 1P0SH 3ZZDA 1ZTKA 5HYOA 1GBMA 1O3DA 1IQJA 1SGYE 1GHBG 1PPFE 2H5DA 1GCDA 5GWZA 3S9CA 2FDAA 3MU0A 2H9HA 2JETB 1GDNA 2PV9B 4YXWD 4JZFH 1CA8B 1SOZA 1GBCA 4O03A 3TITA 1YWUA 1H8HD 3OAAD 5A0CA 2D1JA 4ACBA 5EPYA 1EATA 2BY5X 1HPGA 3KN2A 1FLEE 1JBUH 2OBOA 5A8XA 1J16A 4Z0KA 1BQYA 1MU6B 1AUTC 1CBWC 1DY9A 1AE8H 2H1UA 3FO8D 5DP3A 1O38A 1SLWB 4YT7H 1D4PB 3U9AH 1P2QA 3RXRA 4GCHF 1GGDB 2BHGA 1EPTB 3BTTE 1SI5H 3T27A 1V2MT 4FUBA 1UTKA 5LPFA 1NC6A 1FUJA 3V3MA 1P2NA 2ZDVH 5JB8S 3A88A 1P10A 4K69A 2V3HH 4NWLA 3ATKA 2F83A 1Y3UA 1O35A 2FOEA 2ZPSA 3VPKA 1GJ8B 1L1NA 1C1MA 1QHRB 1C2MA 2XBYA 1V2UT 1AB9B 1S85A 2BDIA 1VCWA 2XC4A 1O2RA 1IQFA 4Q80A 3GCHB 3WW7A 2FS9A 3SU1A 2HNTE 3M5NA 4OGYA 3GY6A 1BJVA 1G30B 3RU4T 1GVKB 1H9LB 1C5WB 1BDAA 1SL3A 1BA8B 4OS7A 3VEQB 1ANEA 3U8TH 1VCQA 5F6MA 3KYFA 2ZDKA 5BPEA 1GMHG 2BOKA 2K1QA 1KDQA 4CHAC 4AFSA 1ABJH 1MKWH 3V7TA 2AGEX 1C9TA 1HFDA 1SQTA 3SUDA 1Z1JA 2KCOA 1DWEH 1ARBA 2VINA 4JZ1A 3MWIU 1KIGH 1ZMNA 4YLUA 1GI7B 2SGDE 2BQ6B 1UMAH 2Q6GA 5EOKA 1QBOA 1QQ4A 1KXFA 4DIIH 3EYDA 4BAKB 1UVUH 2YMSD 4IN2A 4JK5A 4AORA 2HVXA 2XBWA 1BRUP 4K1TA 1PFXC 3I78A 2BX3A 4DURA 2HLCA 2Z9IA 3TPIZ 2OCVB 1C2KA 2FXRA 3ATMA 1V2QT 1P3EA 2WPIS 3RXPA 2BY7X 1EAWA 3MH6A 3SQHE 1ELDE 4ABJA 3LGUA 1GBDA 4IS5A 1O3CA 2V0BA 3RXIA 3LC3A 2EI8A 2ZHFH 2WPKS 3KQDA 2O8UA 4U32A 3N99A 2VWLA 1OXGA 3TJNA 2FMJA 1FPHH 1TNKA 1C1NA 3U8RH 3QGJA 1IHSH 3NUMA 2GP9B 1AHTH 1J14A 5JBAS 1DPOA 5F03A 2ZA5A 3SNEA 1SGEE 1KYNA 2BD7A 2J95A 1IQEA 1MD8A 3SUFA 1RTFB 3F3BA 1EOLA 2D2DA 4I8JA 1MZAA 5EJLA 1O0DH 2BDAA 5CHAB 1HGTH 2FYRA 3H5CB 1ANCA 3AAVA 3QTOH 5DSFA 3ZZ5A 3UNSA 2AMQA 2ZNKH 4ZAEA 2L6OA 5EU8A 3I77A 2WUCA 2P3TB 2H6MA 3M3SA 2XCFA 5DP7A 1NU7B 4OS1A 1JIRA 3UPEA 2H9EH 1W3CA 1EPTA 4WMEA 3PO1B 2ZTZA 4DJZB 1SQRA 3KCGH 4H6SB 4Z1MD 1UTOA 3EQ0H 4NSVA 4TPIZ 1GMHF 1CT0E 1THRH 1T8OA 1FDPA 4NZLA 1GI5A 2KAIB 1K2I1 3WWFA 1BTHH 2Y5HA 1XUKA 2HOBA 1FY3A 1THSH 3SGQE 1F5KU 1C1TA 1FAKH 1SFIA 1T32A 3BTWE 4LZ1H 3UREA 2KX4A 2IN2A 5T1VA 3STJA 2FESH 4IN1A 4INHA 2AYWA 1ZTLA 4UFDH 4MNYA 1AVWA 2C93B 3CS0A 1GJ6A 2PTNA 5AFYH 4YT6H 3A7YA 4E06H 1QCPA 5GNDA 1NRSH 1P9UA 2HPQH 4UD9H 5E2PA 4H4FA 1OP8A 2PW8H 2QE7D 1CGJE 1O2MA 4KKDA 4FUCA 4X8SH 1Z7KA 1O2KA 3BTHE 3P17H 1SGCA 4R8TB 4NFFA 1TGSZ 2FEQH 2B0FA 2O9QA 2PLXA 2WINI 2ZCLP 1FY1A 2OC0A 3GCTG 3M7TA 1TPAE 3GY7A 1GL0E 2VGCB 1QR3E 5LGOA 4RI0A 1YPEH 4BAHB 3OX7U 4ZXXH 1OWEA 1AD8H 4OS2A 1DUEA 4TT3D 3P70B 1O2HA 1HAZB 1O2OA 2H2ZA 3D49H 4BNRA 2XRCA 1TA2A 4B1TA 2C4FH 2BMGB 2NU1E 4FU7A 2W6JD 3SO3A 4AGKA 3M3VA 1MCVA 2WYJA 4HG6A 2KM0A 3RXSA 3K6YA 2A4OA 1NN6A 2PKAB 2FX6A 3W94A 3TU7H 1T31A 1SBWA 3MO9A 4BAMB 1HAHH 1HAXB 2W7UA 4IC6A 1MABB 3I29A 3QWCH 1O3LA 1S82A 1TFXA 5L2ZH 1P2IA 1SB1H 1ZLRA 3QK1A 1UTNA 1Z8GA 4KTUA 4F4OC 3RXOA 2EI6A 1QB1A 1D6WA 1QBVH 1O2LA 2WV4A 1PQ7A 4X1RU 1VZQH 1HDTH 4K8YA 3OE7D 4Z6AH 4CH8B 1O5DH 1T8LA 4AFQA 1EJMA 2VIPA 1EKBB 1Y8TA 5GIBA 1GBEA 3UUZA 1E35B 4J2YB 1GI6A
chains in the Genus database with same CATH topology
1WUNH 9LPRA 3BG4C 1B7XB 1SGDE 1VJAU 2GCTC 4XE4A 3RXLA 3DD2H 1E34B 3B9FH 3U1JB 1DS2E 1SGIB 4D9QA 1ZSKA 3RC4A 2BZAA 5LH8A 4JCNA 1NO9H 3T29A 3NWUA 1ZRBA 1L4DA 3DUXH 5L2YH 1U6QA 2BXUH 1D6RA 1TABE 4ABAA 1LKBA 2O8LA 3A84A 3NXPA 3ZZ3A 4GPGA 1TX8A 1BMNH 4IBLH 5CE1A 2FOHA 5C67A 5HXFA 2UUFB 1P2MA 4FUFA 1OSSA 3PTBA 1ZR0A 1K1LA 2ZGJA 3PMBB 3U69H 3SGAE 2PWXA 4WY3A 3MO3A 2FZZA 1N1LA 2Y5GA 2G8TA 4DG4A 1E0FD 1O32A 1HV7A 1N8OC 1MU8B 2ZHEH 1EXFA 5HM2A 2QYIA 4CH2B 3GDSA 1O5EH 1W10U 3PV4A 3QDZB 5EW1H 3VXFH 1MMJN 3ZVAA 2IJOB 2ODPA 1ELVA 1YCPK 2ZDAH 1AMHA 2ZKSA 2BDCA 1O2PA 3GYMA 4ZUHA 2VWNA 1DFPA 1V2VT 1T4VH 4MNXA 3ZVDA 4IMQA 2DE9A 4H42U 1XX9A 1NM6A 2AIPA 1C5QA 1EZXC 5GCHF 4X1QU 3MFJA 2FIRH 2GZ9A 4E7RG 4WWYA 3UWJH 1UHBA 3JZ2B 4XFQA 1ZJDA 1B0EA 3SJIA 3RXMA 1ZPBA 2ZPQA 4X6NA 2A2QH 4ABGA 3MNSA 1OOKB 3RXVA 1LCYA 1P01A 3BSQA 4YOIA 3RXTA 3TH4H 1XVOA 1GL1A 1YC0A 5FBEA 2BLQA 1P06A 2TGPZ 3RXJA 5J4QA 1IOEA 4MPXA 2VIQA 4A7IB 2FX4A 2BLWA 1O5AB 3M35A 3M36A 1FIWA 3SHCH 1G32B 1CE5A 2ZDLA 2FLRH 1Y3YA 2R0LA 1GBAA 1P2KA 4YLQH 3FFGA 1C5XB 1RIWC 1TRNA 3T28A 2TGAA 3A80A 2ULLA 5JYIA 1AY6H 2GZ7A 5C1UA 4X2WA 4BANB 5F8TA 1UVTH 1FJSA 2JH0D 1C2JA 8LPRA 2O8MA 1QIXB 4I8LA 4ABBA 1A5HA 1CO7E 4JYUH 2GCHF 2WV5A 2XW9A 3PLPA 4XOJA 4ESTE 3DT0H 1SMFE 1ZOMA 1IQGA 1O5GH 5H4IB 2FWWA 3UR6A 1JIMA 3FP7E 1WCZA 1VITH 1Y3XA 3HKJB 1ZZZA 4D9RA 2QAAA 3SNAA 3HKIB 5C5NA 1PYTD 1YLCA 1H9IE 1C1UH 2ESTE 3SU3A 2BTCE 4K1SA 1FPCH 2A7JA 1O31A 3U98H 1P3CA 1EP6A 2FPZA 2I6SA 5GPIB 3IITA 4Y11E 2DE8A 1O5FH 1MKWK 2Z9LA 1MTWA 3RLYH 1C5NH 1WV7H 4UFEH 4FU8A 1RTKA 2FI4E 1YM0A 3LT3A 2BD9A 4U30A 1JWTA 1O39A 1ACBE 1KSNA 3UOUA 1P09A 2ZHWH 3BIUH 5TCAA 1GI9B 4GLYA 2AGIX 1F5LA 1EQ9A 2SGFE 3ZVCA 2G5NA 3L6PA 2OINA 3ZZAA 3LH1A 1ZHRA 3PMJA 3SU0A 5B6OA 1A0HB 2GVFA 2XWAA 1MUEB 2HNTF 4U2WA 4UDWH 1GBTA 1SHHB 2WPHS 3RM2H 3SV8A 2V6NA 1MKXH 1ANBA 4GCHG 2Z9GA 3M5OA 8ESTE 2Y7XA 4RKOB 1TBQH 1ETTH 2OUAA 3KGPA 1HAVA 3SJ9A 2Q6FA 3EAJA 2V35A 3E90B 1KDQB 3BF6H 1WYKA 1TRYA 4I32A 3UFAA 1D9IA 1A5GH 4MVNA 3SGBE 1GI0A 1EASA 2ZCHP 1YPKH 4Q7YA 4YOJA 2BZ6H 3RU4E 5K7RA 2R3YA 1ZPCA 3KHVA 1MQ6A 5EXNA 2ZGXH 1PPHE 2BQWB 2ZU2A 1K1OA 3UQOA 1GG6B 4CRGA 4GUXA 1NPMA 3M7QA 1GJ4H 3LGVA 1SOTA 3ZZBA 3TH2H 3F9GA 2BOHB 2Y7ZA 1J9CH 2SGEE 3SORA 1C5TA 3FZDA 1NFYA 1YBWA 2BD5A 3RMOH 3SJKA 4IGDA 2ZDNA 1WQVH 1K1IA 1LHFH 4GHTA 2J34A 1PQ8A 3IG6B 3RXUA 1AFQC 1O2WA 2GT7A 4I8HA 1SGTA 5HGGA 3R3GB 1F0TA 3L33A 2WUBA 1L2EA 5FPTA 2HGTH 1KLIH 1DXWA 4VGCC 1NS3A 3T2NA 2SNVA 1P11E 2BY9X 1OYQA 3ZZ7A 3E6PH 1GHVH 4NGAH 1F7ZA 1TAWA 3BIVH 3GCOA 1S0RA 1O5BB 1ELCA 1A3EH 4OS6A 3AASA 5T3HA 4FUGA 3A86A 1OS8A 3MNXA 4Y8YA 2BDGA 1ETSH 1CA0C 4INKA 5G4BA 2THFB 4ZHMU 1ETRH 1EJAA 3W95A 1HXEH 5FXLA 3M5LA 1EZUC 1SGFA 3T62A 2BVXH 2GZ8A 3RU4D 4BTTB 5C3NA 3NKKA 2XCNA 1G36A 3SNBA 4X1SU 3PMAB 4MDSA 1C5SA 2BX4A 1O2ZA 2VIOA 2ZZUH 1QL8A 1FMGA 4AFUA 3ZV8A 4DGJA 2PSXA 2QV1A 5GDSH 2OC7A 2ZP0H 5A09A 1ELFA 4MLFB 4MPWA 4I31A 1O2SA 1DWBH 1M9UA 1O3FA 5DGJA 2ALPA 2F9OA 1AVXA 2BQ7B 2GDEH 4BAOB 4YZUA 1UCYK 2ZG0H 1AFEH 2BLOA 4FVBA 3ZVGA 5EW2H 1GVZA 5AVDA 3V12A 1A0JA 5DP8A 3E91A 1H8DH 3TLOA 2FTMA 2QY0B 4PROA 1ZYOA 1MQ5A 1QURH 5AFZH 2OQ5A 1DSUA 1E37B 3QUMP 2QXGA 4IC5A 1C4V2 2P16A 2VVCA 4HTCH 1J15A 3URCA 1O2XA 4E05H 4Y8ZA 3NPSA 5FAHA 3GCNA 3HGPA 2CJIA 1WQSA 5EQSA 1F0UA 1E36B 1FN8A 1QJ6B 4Y0YE 8GCHG 1D3TB 2RA0A 1PQ5A 1V2WT 4I33A 1HAGE 1K28D 4ISLA 5F8XA 2GTBA 2XXLA 4WJG2 1CBWB 2GV7A 5E0HA 4DCDA 1NT1A 1C2EA 1TPPA 3DFJA 4B2AA 3KIDU 1V2NT 2CGAA 4YESB 4ZHLU 3P8GA 1HBTH 4B71A 2J9NA 1AI8H 1TNHA 1JRTA 4Y10E 2AEIH 1EOJA 2NWNA 1GJCB 3MOCA 3VB6A 1BBRH 2FOFA 2VJ1A 1C1RA 1AZZA 5DKMA 1BHXF 2H9TH 3P6ZB 1A61H 1C5YB 1TBRH 3S7HB 3ZVFA 1NZQH 1MTSA 1ESBA 1LQDB 1V2PT 2A32A 2FO9A 1GBHA 2PR3A 2QIQA 2FOBA 3EA8A 2J38A 1XXFA 2ZWLH 3TGIE 2AFQB 1BBRE 1CHGA 1PPZA 1FY5A 4DVAU 3TJOA 5JBCS 2R3UA 2LPRA 2VU8E 1MH0A 3A7TA 1F0SA 5C1YA 4AOQA 4X8TH 4X2YA 5DO4H 2ZHDA 4CHAB 3KF2A 2IPHA 4XSKU 1UJ1A 3S9AA 5JPMH 3RXBA 1O2JA 1JMOH 4B73A 4I8KA 1ELEE 3R0FA 3SI4H 3QLPH 2ZU5A 2FOCA 1UTLM 1P2OA 4ZH8A 5BRRE 3RLWH 4FUHA 3A8BA 1MAYA 3U1IB 2AH4X 1TPOA 2O8TA 2OBQA 1AVGH 1OWJA 4X8VH 1NRNH 3TK9A 4B2CA 1TWXB 4MTBA 1WBGB 1DITH 1BTUA 1KXEA 1KXAA 1GJ7B 1FAXA 1F0RA 1WAYB 4LK4A 4MNVA 1T7CA 3RP2A 2HRVA 3RXDA 2F9BH 3MHWU 8GCHF 3B8JA 1BRCE 2VWOA 3RMNH 1LPKB 4HGCA 4X6PA 4F49A 1ZPZA 1FN6A 2VIVA 1ORFA 4CR5A 3SV9A 5C5OA 2CF8H 3KQEA 4NIYA 3S7KB 1RRKA 1A3BH 1MBMA 2STAE 4MQAA 4WH6A 1O2NA 3UIRA 1TNIA 2QA9E 2V3OH 1UO6A 3ZZ8A 4RSPA 1G3CA 3SV2H 4AYVB 1LVYA 3MH5A 2ZFSA 4CBOA 1AIXH 4JZIA 5FBIA 4BXWA 4Y76A 1NRRH 1O37A 1EZQA 5EG4A 2BDYA 1A1RA 1UHBB 5E0JA 2B9LA 2W3KA 3ZYDA 3S0NA 1N6XA 2ANMH 2FOMB 3MU4A 1KXBA 4AB9A 1SSXA 1MAXA 1HJ8A 2ZFPH 3SNDA 3ZYEA 1S6FA 3ODFA 3D23A 1WOFA 1VGCC 4NZQA 2A5IA 1C5UA 1NROH 3STIA 4MNWA 1JRSA 1T8MA 3RXFA 4NIWA 2UWLA 2QF3A 1ZMJA 3SI3H 1TIOA 3KNXA 1MTUA 5GCHG 2AS9A 2TIOA 5T6GA 1BTWA 1C2DA 1MBQA 1GVLA 1HAYB 3VB5A 4ISOA 2G4TA 1W8BH 1YPLH 2SGPE 1NY22 1A46H 2OTVA 1VCPA 3UWIA 1QBNA 4IW4E 9ESTA 1SQAA 1GI3A 2VH6A 3SN8A 2P8OC 1GMDF 3BV9B 1SLUB 1QJ1B 1GHAG 4MG3A 3ESTA 5JBBS 3PLBA 5K0HA 2M5TA 5T6FA 4A1XA 2VIWA 1RD3B 4K5ZA 2VVUA 4GAWA 1BTYA 1UVSH 1Y3WA 1KXCA 1E38B 2PTCE 4KP0A 2A1DB 4D8NA 5FX5A 1BZXE 2BXTH 2RA3A 1ELGA 1YPHC 2NU4E 1O3GA 4A1VA 3T5FH 2C90B 2Z3CA 3SW2B 1TGNA 1TE0A 3GYLB 1IAUA 1SC8U 5EQQA 1YLDA 4TY7A 1PJPA 3A82A 1G3BA 3E0PB 1O3NA 3F9HA 3LPRA 1MTNC 3TGJE 1C4Y2 1EAIA 1VITF 1GWAA 4NA9H 4FU9A 1BRBE 2GCHG 3A87A 1W7GH 1RJXB 3RXQA 1UVOA 3GY4A 4FUDA 2PKSC 1AGJA 3LGIA 2WPJS 7LPRA 2ZGCA 1YPMH 2Y80A 3RXAA 3LU9B 2ZF0H 2BD8A 1EX3A 5E0GA 1PPGE 1A4WH 1BMLA 1GBKA 5DK1A 2FM2A 3F1SB 1WTGH 1TX6A 2VH0A 2UUKB 1NTPA 3ELAH 3U8OH 3EE0B 3TGKE 2ZFFH 1V2ST 2JKHA 1W13U 4CRDA 1TNLA 1C2FA 3OU0A 1ESAA 3GDUA 1WTHD 2W26A 5SGAE 5IYTA 5L30H 1HAVB 1IQLA 2PGQB 1HB0B 1AWFH 1P12E 2Y5FA 3BG4B 7ESTE 1QRZA 5FX6A 3EA9A 3MO6A 2GCTB 5E2OA 1H9HE 4AFZA 2XBXA 1Q3XA 1BOQA 4ZXYH 2RG3A 2A7CA 3BN9A 5PTPA 3E1XB 2EEKA 3UOPA 4UE7H 4UONA 1IQMA 1TMBH 3HK3B 1GI2A 1GHAF 2ANKH 3HATH 3K2UA 2GD4B 3ZZ4A 3K6ZA 3ENSB 1X7AC 2GMTC 2JH6D 2D8WA 4WF8A 1FV9A 4THNH 3SUEA 2B8OH 3LGYA 2G51A 2PUXB 4FXGH 1CHOF 1EB1H 1HLTH 4AB8A 1FIZA 1GBBA 3BTDE 2BLVA 1YF4A 2GV6A 2UWOA 4Y6DA 1UTJA 1S84A 1RXPA 2CV3A 1N8OB 4A5TS 1QB6A 3ZVEA 4NCYA 2XWBI 1KTTB 2ZHQH 5IDKA 4WVPE 1ELAA 2VWMA 5JDUB 1FXYA 1QJ7B 4HZHA 2DUCA 4U01A 1OKXA 2G81E 1F92A 1DWDH 1XUIA 3PWCA 2FOGA 3SBKA 1TRMA 1DUAA 2ODYB 2BY8X 3URDA 1GBLA 4GSOA 3SU2A 2NU3E 1QTFA 4DW2U 1QB9A 1GJBB 2CHAC 2OLGA 1BTXA 4E7NA 3BEFB 1TB6H 1HAIH 4SGAE 1EB2A 1CQQA 2Z94A 4SGBE 3F6UH 5A0AE 4O3UA 6CHAC 3E0NB 1ZJKA 4GVUA 1VJ9U 3O8RA 1BTZA 2ZGHA 1GCTC 3OY5U 3SU4A 5J4SA 3MU1A 1FZZA 1KLJH 1LPGB 1TA6A 4ASHA 2C8ZB 4DY7B 1LHEH 3SOSA 1QL7A 3AAUA 1TALA 3LGTA 2A4QA 3LIWA 2RDLA 4D7FA 2OC1A 1RIWB 2ZU3A 1HRTH 3QGNB 2A7HA 1MTVA 1BBRK 1LO6A 2FI3E 2BDBA 4YO9A 2Y6TA 3E3TA 1KXDA 3V13A 3GICB 3BTKE 5AHGH 3HPTB 4K2YA 1DM4B 1AZ8A 2GDDA 3Q3XA 5EPNA 2W3IA 4JMYA 3Q3KA 5EXLA 3VGCC 1HJAC 4WMDA 2XYAA 4FUIA 2TBSA 1SLVB 4X6MA 1S81A 1C2HA 1K21H 1QNJA 4JK6A 3MNBA 1UTPA 2SGQE 1DLKB 1BMMH 2FI5E 3BEUA 1J8AA 2JETC 1BIOA 1LQEA 1XUGA 7GCHF 2H5CA 2Q6DA 4Y7BA 1AN1E 2Y81A 1XM1A 3MU8A 1SR5C 3GOVB 1IQNA 1SGFG 1QA7A 1V2TT 1GDQA 1O2QA 1DANH 1K1JA 1KY9A 1SLXB 1QL9A 3DA9B 1JOUB 1Q2WA 2ZECA 3M37A 4CRBA 2W5EA 1DSTA 1YCPM 2FS8A 1Y5BT 1TYNA 1Q31A 1B5GH 2A4RA 1DLEA 3TJUA 3PTNA 1Y3VA 1VR1H 2OXSA 1C5RA 3RXHA 1EUFA 1DDJA 1G3DA 3FAOA 1CU1A 3LJOA 2BB4A 1NRPH 1TX7A 2PHBA 1C2LA 3MI4A 1NESE 3D62A 1GGDC 1PYTC 1EPTC 1ZHMA 4A6LA 1SGNE 1LVOA 1QRXA 4LZ4B 5FHTA 4IMZA 1GJAB 3FP6E 1O3PB 8KME2 3BG8A 5ESBA 1AWHB 3QO6A 4OS5A 5TCCA 1AB9C 3EDXB 4HFPB 2F9NA 3GCHC 1JXPA 2QXIA 5DP5A 1UVPA 1AE5A 1XKAC 3T25A 3HGNA 1P03A 5GJ4B 1TQ0B 5A8YA 2HWLB 4Y0ZE 5EGMA 1GHYH 2SNWA 2P3UB 3V0XA 2A4GA 2YNAA 3FZZA 1ZGVA 3SZNA 4AZ2B 1FNIA 1F5RA 2ZDMA 4NA8A 2ASUB 1G2LA 3BTGE 3S9BA 1A5IA 4Y8XA 3MMGA 3F68H 2PUQH 2OD3B 1ZSLA 3MH7A 1T4UH 2BDHA 1SPJA 2R0KA 3BTFE 4KTSA 1O2VA 2BD4A