2XTTB

Bovine trypsin in complex with evolutionary enhanced schistocerca gregaria protease inhibitor 1 (sgpi-1-p02)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEASE INHIBITOR SGPI-1
publication title The Catalytic Aspartate is Protonated in the Michaelis Complex Formed between Trypsin and an in Vitro Evolved Substrate-Like Inhibitor: A Refined Mechanism of Serine Protease Action.
pubmed rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xttB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xttB02
4IN1A 1O2JA 2FTMA 4NA7A 3RM2H 1SOZA 1CBWB 3MNCA 3A84A 1MUEB 1PPZA 1F5KU 1M9UA 4K1TA 2G00A 1V2KT 2TGPZ 1HIAA 3F9HA 3KIDU 1EPTB 1C1NA 1NT1A 3RXJA 1BOQA 3QN7A 4VGCB 2W7UA 2C8WB 2BY5X 3M5NA 3QTOH 4CRCA 5A8ZA 3RLYH 1HUTH 2FS9A 3QX5H 1IHSH 2G51A 2Q1JA 1TGNA 3U1IB 1D6RA 4AX9H 1HIAB 3BTEE 1MBMA 2G5NA 3SNBA 3SORA 1LCYA 3Q00A 1SC8U 2BDBA 1XXFA 2ZDNA 3SNAA 4INKA 5I46H 3T29A 1QBOA 1RRKA 4K8BA 5DP3A 1GJBB 3SQHE 1HPGA 1TMUH 2FOHA 3B9FH 5C20A 1BBRK 1F0UA 1LQDB 2GMTC 3ESTA 3AASA 2TRMA 3K6YA 4RSPA 3S0NA 1AUTC 2RDLA 3T26A 1YPEH 1Y59T 4R0IA 4IMZA 2Y81A 1GI5A 3KGPA 1K28D 3P95A 4O97A 2FODA 2FI5E 2QXHA 4D9RA 2Y80A 2AMQA 4GCHF 2W26A 2Z7FE 3F68H 2PHBA 3SGBE 1LO6A 1MBQA 1C5LH 2A5IA 1G3BA 1YPLH 4XBDA 1O2YA 1SQTA 4X1NU 2BLQA 1BMMH 3UUZA 1K1IA 1GBFA 5CHAB 2BYAX 2BD8A 2QYIA 1QR3E 4GSOA 1J14A 3LGTA 5EXLA 3UNSA 2FO9A 3V3MA 1GMCG 2FMJA 3FFGA 3A85A 4GHQA 2BQ6B 1KY9A 3I77A 5DJ7A 1O3GA 3SJOA 2VH6A 1A5HA 5F8XA 2BD4A 3MU0A 1WU1A 1LHCH 1BHXF 8LPRA 1GBKA 3EYDA 1E38B 3GDVA 1KTSB 1NESE 1LVMA 1FONA 1K2I1 4Q2KA 1GHVH 1DE7H 1GBLA 2VIPA 1O2UA 1TNIA 4FUHA 2P8OB 1QBNA 3FAOA 2GZ8A 7GCHG 1WQVH 2UUKB 2ZU5A 2PUXB 3GDUA 4OS4A 3GY4A 5T6GA 3SOSA 4CRAA 3S9BA 1A5IA 1LHDH 1NPMA 4I8HA 4KTSA 4CRGA 1ANCA 1ESTA 1AHTH 2Z9GA 1P8VC 1K21H 1A0LA 3ZZ6A 1G9IE 1SQAA 4BAHB 1SGRE 2ZU3A 1P57B 1Z8RA 3H5CB 1TA2A 1V6DA 1ZR0A 5FX6A 1J15A 1DY8A 5L30H 2M5TA 3E0NB 5ABWA 4Q7XA 4JK5A 3LOXA 1Y3UA 4ZUHA 3TU7H 2OCVB 1GMDG 2A1DB 2A4GA 3DHKH 4X1QU 2SGPE 3TNTA 2IOTA 1DPOA 2R2WU 1GJ4H 1CA0C 2ZZUH 1KDQA 1P06A 3PYHA 1PYTD 2FP7B 1SLXB 4ISOA 4Y8YA 1OWKA 5FAHA 1G2LA 3A80A 1PQ7A 2FOCA 3K6ZA 4IC5A 1TPSA 5FBIA 1F0RA 3GY7A 4Q80A 1GBMA 4WJG2 3TVJB 1BMNH 2BQWB 3M3VA 1XXDA 2BZ6H 4XE4A 2P93A 1NFUA 1V2UT 3F9GA 3ITIA 1ZTJA 2ZHWH 2WPMS 3OTJE 1ZRKA 4MTBA 1EJMA 1HXEH 3MI4A 5EXMA 2DE9A 4O9VA 2J38A 3LGIA 4JYVH 3TH4H 2EEKA 2BX4A 1S81A 1G36A 1G30B 4NGAH 4ISNA 3SJKA 1XX9A 1MH0A 1O3OA 3LKWA 2HPPH 1ABJH 2HOBA 3LONA 1SMFE 1CU1A 3KQCA 3RMNH 3O8DA 2H2ZA 3ZVDA 1C5PA 4UFEH 3ZZBA 3RC6A 2FDAA 2Y7XA 3B23B 2A7JA 2ESTE 4UEHH 1CO7E 3E91A 1HCGA 3RXUA 1YPMH 3OY6U 4YOJA 1IQNA 1H9IE 3RU4T 5EPNA 1ETSH 1LHGH 1O3AA 3QLPH 3A7WA 5JYIA 3TIUA 1IQIA 1OYTH 3ZZ8A 2QAAA 5EXNA 3MH5A 1P02A 4UONA 2ZCLP 5JBTA 1VITG 2BDIA 4Y76A 4FUIA 3A7XA 4TYDA 2P94A 4TWWA 3BSQA 3MU4A 3ODDA 1SGYE 1TNJA 4ZHAA 1P12E 3LU9B 3KHVA 2A7HA 1P09A 5L2ZH 4KTCA 1DM4B 1C5YB 4WVPE 1PPFE 2RA3A 3QZQA 1GJ9B 1E0FD 4MPUA 1YPJH 1S6FA 2F91A 1NRPH 2Y82A 1SFQB 1UJ1A 3LH3A 1WBGB 1WUNH 1HXFH 3S7HB 1EPTC 1AWHB 3T28A 3BTQE 2OD3B 1NRNH 4WXIA 4VGCC 2A0QB 4ZH8A 4WY3A 2CHAC 4AG1A 3A87A 1S82A 1ANEA 4CR9A 5C67A 4UE7H 2Z3EA 3U8OH 4AFUA 2ODYB 2ZFQH 1HFDA 1TRMA 1VZQH 3BIVH 1O3JA 2V3OH 3K9XB 4PROA 3E3TA 5FX5A 4X2VA 4FXGH 2QF0A 1DSTA 1O32A 2VIOA 2OQUA 1O2RA 1GJ5H 3NKKA 5HM9A 2FLRH 1LPZB 2FOFA 2Z9IA 1PPCE 1ELTA 2WPJS 4B1TA 2OBQA 3RXVA 4WH6A 4U32A 1O2KA 2ZTZA 2A7CA 1NRSH 1TB6H 1V2RT 3OSYA 5A0BA 1BTXA 2GX4A 3TJVA 3RXAA 5F6MA 4Z6AH 4IC6A 3EQ0H 4GCHG 3HK3B 2BM2A 5E2OA 2FEQH 3SV9A 4FU8A 1GI6A 4HI3A 2UUYA 4KKDA 1EOJA 4ZROA 4UFFH 4CH2B 5F03A 1FPCH 3ELAH 1S6HA 2BXTH 2Y7ZA 1C4Y2 2PSXA 1FJSA 1FAXA 2VB0A 5E0HA 3NZIA 1CVWH 2B8OH 1A3BH 1HGTH 2ZTXA 2ZFFH 1D6WA 1MKXH 1DICA 2ZHFH 3TGIE 3V0XA 5DP7A 2WUBA 3LC3A 3ZVBA 1FNIA 1C4V2 1A7SA 1WAYB 5AVDA 1TPPA 1JXPA 1KLIH 5EU8A 4YM9A 5CE1A 2PFEA 1HJ8A 4TWYA 2H1UA 2GDEH 4JYUH 2FWWA 4YO9A 1FUJA 3PMHB 1NO9H 1C9TA 3LH1A 1SGNE 1RS0A 1LDTT 3Q3KA 1ZMNA 1B7XB 3RXTA 2FXRA 2A4RA 2VGCB 2BHGA 4ABHA 1U6QA 3BEFB 2FLBH 2QXGA 4K60A 2A4QA 2ZU1A 4BAOB 1THRH 1NTPA 2ZPRA 4MPVA 1GI1A 3C1KA 4X6MA 4JZFH 2A2QH 1O3KA 2VIVA 1V3XA 2VNTA 1HDTH 2SGAA 3ZZCA 4OS1A 1BB0B 2BVSH 2ZKSA 2UWOA 1AFQB 2AMDA 4E05H 3PLPA 1WYKA 2VIDA 8ESTE 3GYLB 2FZZA 2Z94A 1XVOA 4AGJA 1CGHA 2W5EA 3D23A 4Y7BA 1IAUA 2ZPSA 3KQBA 1LKAA 4CRDA 3LJOA 1IHTH 1J8AA 1Y5UT 2GTBA 1DWCH 1TFXA 5HXFA 3UNRA 1HAHH 1MTUA 1QJ7B 3P8NA 4D7FA 2RA0A 2B0FA 1OX1A 4BXWA 1C5QA 1CHGA 2FOMB 1HAIH 2XBXA 4FUGA 1YPHC 2ZP0H 3GY2A 5FPSA 1DSUA 1O39A 1CT2E 4B2BA 3TJOA 1GI2A 3HK6B 2LNCA 1GDNA 3SUEA 1C4U2 3AVZA 1A5GH 3SUFA 2JH0D 2Y6TA 4ABGA 1UTOA 1AFEH 1SB1H 3MNSA 2A5KA 3RC5A 4JMYA 2W3IA 1GGDB 3DFJA 2KAIB 4K1SA 2NU1E 1H8DH 1ZTLA 1ELGA 1FN6A 3RXRA 3PWCA 4NZLA 1TONA 4J2YB 1C1QA 1FDPA 4WXVA 1ARBA 3I78A 5HGGA 4DGJA 5LPEA 1QCPA 5C5NA 1IQKA 1LVBA 3UQVA 1CHOF 3A8DA 3CS7A 4NWKA 1C2GA 4U2WA 2V35A 1O2QA 1N8OB 3UFAA 1K1MA 4XFQA 4Z0KA 2AERH 1TALA 1XMNB 1SG8B 2ZFTA 1SPJA 3SU2A 1UHBA 4X8TH 1NFXA 4FUBA 3ZVGA 1PFXC 1NC6A 2XC4A 3M36A 1AB9B 1A46H 4DCDA 1UCYE 4DIHH 3DT0H 4MQAA 2ZDMA 3KL6A 1ORFA 3U9AH 3ZVCA 3MU5A 5DK1A 1ABIH 3PWBA 1UK3A 4Q7ZA 1K9OE 2AH4X 3U98H 4M7GA 1KTTB 1L1NA 1ZSJA 1BTWA 2ZU4A 2H9EH 3U8TH 1C2EA 5ESBA 1GJCB 5EG4A 1DXPA 2PKAB 2WYGA 1C2DA 3ZZ4A 1ZGIA 1G3EA 2OXSA 1G2MA 3BEUA 1ARCA 1EX3A 2CF8H 2VWOA 1QQUA 4O3TA 3E1XB 4MNXA 2PKSC 3KN2A 4LXBH 1W14U 3RMOH 1P2KA 2V3HH 4B76A 1L1GA 8KME2 1YPHE 1DWDH 1GJ6A 8GCHF 2QXIA 5CMXH 1D9IA 5L2YH 5EQSA 1P05A 2F9VA 3JZ1B 2A5AA 4A5TS 1BBRH 4D9QA 4AFSA 1V2LT 3HGPA 2ZFRH 2BD2A 2ZEBA 4D76A 1E37B 3RC4A 1SGIB 1N1LA 1TQ0B 1XUJA 1FV9A 5DP5A 2A32A 3SHAH 1D3DB 1VITH 4X1PU 1T8LA 3GY3A 5HYOA 3NUMA 2F83A 1C1VH 1LHEH 2HALA 1JIRA 1A0HB 1XVMA 2XW9A 1EPTA 1P2MA 3O8BA 1OYQA 1GHAF 5PTPA 4JZEH 4Y79A 1MMJN 2GCTB 1BTUA 2ZGHA 5LGOA 1KIGH 3GY6A 1DLEA 5EOKA 3MWIU 1W12U 3FANA 5E0GA 3LC5A 1AVGH 4AORA 1RTKA 2IPHA 3IWMA 3UQOA 2BY9X 2ODQA 2ALPA 2ANYA 3SV8A 6CHAC 1O3NA 1SGQE 3R3GB 3PROA 7LPRA 4QT8C 3CP7A 1P01A 2AS9A 1XUHA 1HAGE 3R0FA 4X6OA 2OTVA 4NIYA 4AB9A 1T4UH 3BTHE 4A1TA 1P10A 4INLA 4CBOA 1DLKB 1IQHA 1C5VA 3CS0A 2GD4B 3ATWA 3F9EA 2FOGA 3MH4A 1QB1A 3E8LA 3SN8A 1TAWA 3BG4C 2GZ7A 1O2SA 3MNXA 4Y0ZE 3FZDA 3A89A 2G5VA 2GCHF 3URCA 1C1TA 2SNWA 2UWPA 3A7YA 5JB8S 3ZZAA 1TABE 3BV9B 1Z71A 3NK8A 2XWBI 1F7ZA 2VGCC 4TPIZ 2OUAA 2BTCE 1JRTA 1S83A 1YF4A 4JCNA 1N6XA 1D3PB 4NSYA 5C1YA 1WTGH 1GCTC 2PGBB 4DURA 1PYTC 1BRAA 2FYRA 3Q77A 2UUFB 4OS7A 2QV1A 1EKBB 3M5MA 5JBCS 3M7TA 1J16A 1AFQC 1EZXC 2FOEA 3RXSA 1JOUB 1MKWK 3TK5A 1O37A 3MU8A 1LMWB 2OINA 2VJ1A 2O8WA 3NXPA 5AHGH 1P3CA 1GBJA 1EJNA 1VCQA 3GCOA 1HAZB 1AKSB 3MU1A 3SBKA 1TE0A 1EB2A 2GVFA 3PMJA 1C5NH 3QK1A 4AOQA 3C27B 3EA7A 3GYMA 4NA8A 4ISLA 5DGJA 3PTBA 1LKBA 1L2EA 3HGNA 3RXHA 1SGFA 1L4ZA 1TRYA 1O35A 3RM0H 1VJAU 2BMGB 3S9CA 1C2HA 3DFLA 2C8ZB 1S5SA 3A82A 2ASUB 2WPIS 2GP9B 1F2SE 1EOLA 3PTNA 1WOFA 1AY6H 3SNCA 3S7KB 2J4IA 3OU0A 1FXYA 4H6TA 4JZDH 3ZV8A 5DO4H 2STBE 1W7GH 3RXFA 3QTVH 4YT7H 1GGDC 1ZZZA 3E16B 1BA8B 4YT6H 5JBBS 1AD8H 2HVXA 1FAKH 3NPSA 2VVVA 3UR6A 1UCYK 1O0DH 2Q6FA 1CHOG 1THPB 3SZNA 2XNIA 3DD2H 3FP6E 2THFB 2CN0H 1H8IH 3AAUA 4GLYA 1NU9A 1EQ9A 1C9PA 1TX7A 2JETB 2AGIX 1CT4E 3URDA 3RP2A 1TIOA 3A88A 3SU1A 2BLWA 4DW2U 1N8OC 3UIRA 2J94A 5AF9H 2PV9B 1C5OH 1NN6A 1BZXE 1A1RA 1RJXB 3PLBA 4BTTB 3SV6A 4Y7AA 3ZVAA 4UFDH 3ZZ3A 5FBEA 1QL8A 1GMHF 1UVOA 2C90B 5J4QA 1O3DA 1Z8GA 1BHXB 3GY8A 2VIWA 2XCFA 4FUDA 1PPEE 1UTMA 1QURH 5LPFA 2VIQA 2BY6X 4K5ZA 2F9PA 1WTHD 3QUMP 1O31A 1O3HA 4OGYA 1V2VT 2TIOA 3CENA 3RU4D 4A6LA 3BN9A 3G01A 2ZIQH 3L33A 3SV7A 4CRBA 4CHAB 2ZQ2A 4WMFA 4A7IB 4DG4A 4O03A 5JBAS 4DY7B 1HAYB 1NROH 1PJPA 2Q6GA 1QRZA 4I8LA 1W10U 4K8YA 1IQFA 3RMMH 4NG9H 4YLUA 4JZIA 3UY9A 3VGCB 4JZ1A 4B74A 4AYVB 2FYQA 1OKXA 5AFZH 1K1OA 1AI8H 1ACBE 2FOAA 2G8TA 4AYYB 4X8UH 3RXGA 2BY8X 2QXJA 2F9OA 1GI4A 5BPEA 2ANWA 1YLDA 4TPYA 5A8XA 3QGNB 2ZCKP 2YNAA 3NWUA 4WH8A 3LDXH 1V2MT 5A8YA 1SSXA 2AFQB 2QCYA 1BDAA 4NFEA 2GDDA 4NIWA 2H9TH 1OXGA 2H5DA 4U30A 1T4VH 3BTGE 2QY0B 6ESTA 1TNGA 3S9AA 1QL9A 2J92A 1ELAA 1DWBH 1E35B 1Q31A 3QWCH 1HAVA 1CA8B 1FIWA 1FLEE 1QBVH 1GHAG 1TRNA 3D65E 1Q3XA 2FESH 5JDUB 3QGJA 1YBWA 1O36A 4I7YH 4B2AA 4X1RU 1WV7H 3UPEA 4AFZA 2XTTB 2EA3A 1TMTH 1HJAB 1MQ5A 5DP6A 5IDKA 6LPRA 1CBWC 2ANKH 4NWLA 4AB8A 2FX4A 1C1PA 3TJNA 2BLVA 1HAVB 1GHYH 1A61H 5G4BA 3M61U 3SU3A 1KYNA 3ATLA 1INCA 2P3FH 2ZG0H 1TA6A 2GGVB 1GI8B 3VPKA 2EI6A 1FMGA 2BD9A 1RTFB 1A0JA 2O8UA 3ZVEA 5I25A 5FPYA 1F5LA 1AGJA 2AMPA 4X2WA 3LGVA 1RXPA 1Y3XA 1DX5M 1C5RA 1OS8A 1IQLA 3UTUH 1YCPK 2F9BH 3RXIA 1V2JT 3FZZA 3M5LA 2OC8A 2ZHDA 1VCWA 1GVKB 4KGAA 1KXDA 4FUJA 1AUJA 1GBHA 1QHRB 1KLJH 2GCHG 4SGBE 5DP9A 3M7UA 3O8RA 1GBAA 2BZAA 2G4TA 1Z6JH 1TX6A 1O2ZA 2VU8E 3H7TA 4KP0A 4ESTE 1DDJA 5GDSH 4AZ2B 3BTWE 1SHHB 1AWFH 1GVLA 5FXLA 1C1OA 1EB1H 2B9LA 1TGBA 3FVFB 4DJZB 1EASA 3RUOA 1SLVB 3BTTE 3VB7A 5EQQA 2Z6BD 4YOIA 1C5XB 1QRXA 1BMAA 3UOPA 1SOTA 5CHAC 2PTCE 4NIVA 2PWXA 5H4IB 1DY9A 1SQOA 1Q2WA 3GICB 1AVXA 3GCHB 2XC0A 1YGCH 3BEIB 1T32A 4ABFA 2G52A 4UD9H 4INHA 1O34A 1W3CA 1ZMJA 1TQ7B 3LIWA 3EE0B 2AGEX 2XYAA 1NRQH 1ZSKA 3V7TA 4FUEA 1MZAA 3TH2H 4FVBA 2PTNA 1GI9B 1BTYA 1ZPZA 2D8WA 2Q6DA 3SI3H 2BDAA 3SU0A 2P16A 5GCHF 2P8OC 1T7CA 5EW2H 3KCGH 1H9HE 2BB4A 1QA0A 1W0ZU 1WQSA 1EAIA 2YOLA 3DUXH 1ZPBA 2GMTB 2VINA 2F9UA 4O3UA 4NFFA 1C1MA 4B73A 1NFYA 1O5CB 1GBIA 4BAQB 3P6ZB 1TNKA 4ABDA 1DFPA 2CMYA 4ZXYH 1XUIA 1GHWH 1NFWA 1OP0A 5E2PA 1UTNA 3RXMA 1EZUC 4K69A 2VH0A 2GT8A 1QGFA 3P8FA 2ZO3H 4JK6A 2WPKS 2WUCA 4XDEA 1D4PB 3A8CA 1O2VA 3ZZ5A 1TBQH 2Z9KA 1C2FA 3BTDE 3E0PB 2ZDVH 3A83A 1C5TA 1YM0A 1D3TB 2B7DH 1QY6A 1BRCE 3MMGA 1AVWA 3A8AA 1O3FA 2BDHA 3L3TA 5T3HA 4ZKRU 1OPHB 1AO5A 1O2WA 3QZRA 4I8KA 4BTIB 3BF6H 2Z9LA 3M35A 4IMQA 2KAIA 2PUQH 3RMLH 2FTLE 1DITH 2TGTA 4AFQA 3SO3A 2Y5FA 3TJUA 1EJAA 2ZU2A 1F92A 5SGAE 5LPRA 1SBWA 3EA9A 2R2MB 2ODPA 1P03A 3OX7U 1CGJE 1O2XA 4H6SB 4YESB 1C1SA 1ID5H 2BD5A 3JZ2B 2FX6A 2R3UA 1HRTH 3IITA 4I8JA 3SU5A 1O3LA 2O8MA 2ZNKH 2J95A 1P2IA 1XKAC 3MTYA 4CREA 4CHAC 2CF9H 1YCPM 5E8EH 3RLWH 3GCTF 1FY5A 2PLXA 4KTUA 3U69H 4B2CA 1Y8TA 1GHXH 1WSSH 4X1SU 1VGCB 1GG6B 1O38A 4D8NA 4A1VA 1LQEA 1ZGVA 5GJ4B 3P17H 5IYTA 3UREA 3M3TA 2AIPA 2BDYA 3P70B 1E36B 3PB1E 4DIIH 1HYLA 2O8TA 1HV7A 2G55A 2UWLA 1O2TA 3SHCH 2VWMA 3HPTB 2IJOB 1V2QT 1OWJA 4E7RG 4ZMAH 3FP7E 1YKTA 2PKAA 3H7OA 2EC9H 3RDZA 1SGCA 2ZGXH 4ABBA 1NY22 1O3IA 2TBSA 1GMDF 1XKBC 3MNBA 1CA0B 4Y71A 1Y3WA 1TBRH 1C2JA 3AW0A 2CJIA 3MH7A 1DOJA 1MTWA 2I6SA 2R9PA 4CH8B 2R0KA 3PMBB 1IOEA 3TH3H 1J9CH 1UVTH 1NM6A 4ZHMU 3SNDA 5GXPA 4B71A 2PGQB 3ZZDA 3STJA 1O2LA 2WYJA 1V2NT 4RKOB 2ZPQA 1F5RA 1ZRBA 5EW1H 2EI8A 3P8OA 1B0FA 3L6PA 1AMHA 4D7GA 2BOKA 2C8YB 2GV6A 3VXEH 2SNVA 1RGQA 3SJIA 4LOYH 1IQMA 1FPHH 1LTOA 2D2DA 1C5WB 2ZA5A 1ETTH 1BUIA 2OC0A 4HTCH 1O5GH 1ZOMA 4I33A 4F49A 2R0LA 1GBBA 2P3TB 2ZGCA 2FM2A 4BTUB 4B75A 1BMLA 1UVSH 4XBBA 5JPMH 3SU4A 2BLOA 1O5BB 5C1XA 1UK2A 2XCNA 1SGDE 1OWHA 1A3EH 4BOHA 2SGFE 1PPHE 1GI3A 1ZHPA 2AIQA 4TY6A 1HLTH 3VXFH 1ZJKA 4KELA 5FCRA 2OC7A 2TGAA 3VB3A 4K2YA 5DPAA 3UNQA 2HNTC 3OY5U 5ESTE 1QFKH 1GJ7B 1PQ5A 2JH6D 1A4WH 3A86A 3LPRA 5BRRE 1B0EA 1MKWH 1OWEA 5E0JA 1LPGB 1WCZA 5LH8A 5K0HA 1FY3A 3E90B 1CT0E 1IQEA 3T25A 5A09A 1QTFA 3DA9B 5F8TA 2HPQH 3TGKE 1O30A 3GCHC 3KQEA 3SUDA 4NA9H 2WV4A 1A2CH 2A2XH 1O2PA 2QC2A 1SGEE 2H5CA 2WPLS 2AEIH 1O3MA 1HB0B 2CHAB 1GHBF 3UWIA 3PO1B 4GAWA 4NCYA 1LPKB 1MCTA 4JYTA 1O3CA 1MTNB 3K2UA 1AE8H 2OQ5A 2FPZA 1S0QA 2XBVA 5K7RA 3PM3A 3MO9A 2VWLA 1RIWB 1P11E 5GCHG 1QJ6B 2WPHS 2HWLB 4ZKNU 1TOMH 1T8MA 2NU4E 1PPBH 4X8VH 4GPGA 1QA7A 1UTLM 4DT7B 2ILNA 3A7ZA 3SGQE 1ZYOA 3OYPA 1GPZA 2QIQA 2A45B 5J4SA 4K1EA 3QO6A 3TLOA 5A0CA 2CGAA 5AFYH 3T62A 3VB4A 4K3JA 3V12A 1E34B 1UCYH 1S85A 4YZUA 3IG6B 3ZV9A 1SI5H 1AKSA 7KMEH 2NU2E 3STIA 1SR5C 2J2UA 2OC1A 3K65B 3TITA 2I6QA 1NZQH 1TYNA 1CGIE 4HGCA 1ELBA 1W0YH 1VR1H 1P2QA 1MTVA 4ZXXH 5DKMA 2C4FH 1O2HA 2VVUA 1O3BA 4E7NA 3GDSA 1CSOE 4AN7A 1QNJA 3D49H 4TY7A 4ABIA 1FN8A 3PLKA 1LHFH 4Y8XA 3QDZB 2FOBA 1TPOA 3BTKE 1IQJA 1ELDE 4IBLH 2HNTE 1XM1A 4IGDA 1YYY1 2STAE 1EATA 2AGGX 3SW2B 1MQ6A 1O5DH 1BT7A 1MCVA 3UWJH 4GHTA 1Z8IB 1TX8A 2BDGA 5FHTA 3SU6A 4H4FA 1IQGA 1BTPA 1Y3YA 1SL3A 3VB6A 1YP9A 1X7AC 3LGWA 4X6PA 1V2ST 1ESBA 1BJUA 3RXQA 1BITA 1GVZA 2CXVA 1DUEA 1O3EA 2ZTYA 2SGQE 1GHZA 1T8OA 1QL7A 1O5FH 1Z1JA 2XC5A 2QN5T 5DP4A 3GCTG 3F1SB 2BOHB 3VEQB 1XUGA 3VFEA 1G32B 1KXAA 2ZI2H 1O33A 4OS2A 4U01A 2NU3E 1VGCC 2ZGBH 3RXCA 1ELCA 3W94A 3SGAE 1GG6C 1P2OA 2O8LA 1PQ8A 4MDSA 3T2NA 1Z8JB 5T6FA 1LVYA 1GL1A 3PV4A 2XRCA 2ZECA 4IS5A 1SFIA 1ELEE 2PSYA 1FY8E 1RFNA 1QB9A 4LZ4B 1AB9C 4WF8A 1PPGE 2OP9A 1TGSZ 2ZC9H 4BAKB 1ZTKA 3KNXA 1GBTA 1UO6A 3FP8E 1L1JA 3ZYEA 1TNHA 4XBCA 1UVPA 7ESTE 1AE5A 1HJ9A 1K1NA 3P8GA 4F4OC 2DE8A 1F0TA 1C1RA 1UK4A 1V2WT 1VJ9U 2C8XB 4I8GA 1P3EA 4DOQA 1UVUH 2GZ9A 1C2KA 4WMDA 2ALVA 3VB5A 3RU4E 1AIXH 4THNH 5EGMA 5A0AE 5JB9S 2BDCA 2G4UA 5DG6A 1KDQB 4LZ1H 2TGDA 3M3SA 2ZDKA 2EI7A 1YCPH 1D3QB 3NCLA 2BD3A 2P59A 5TCAA 3GCNA 8GCHG 1TNLA 4ZKOU 1DT2A 2W7SA 4RN6A 2NWNA 5GWZA 1C5SA 1OWIA 1CQQA 3RXDA 1TMBH 1L4DA 1Y5AT 2F9NA 5EQRA 3SV2H 3RXOA 4BNRA 3Q3YA 3M37A 5DP8A 4UDWH 1EP6A 3TNSA 1YC0A 1K1LA 1OSSA 1S84A 3U1JB 1ZPCA 4H42U 1XUKA 1VCPA 2C93B 4ABAA 2OLGA 2R3YA 3BG8A 2D1JA 4A1XA 1W8BH 1GDQA 1AN1E 3TK6A 2GCTC 5C3NA 2HLCA 1BRBE 3ENSB 1ZJDA 3GISB 5F8ZA 1P04A 1EAWA 2ZQ1A 3EDXB 3V13A 6GCHF 2HNTF 3GY5A 1ESAA 4X0WU 1Z6EA 5HMAA 1C5ZB 1CE5A 1HBTH 3MHWU 1OP8A 2AYWA 2D26C 4RKJB 1MU6B 4ABJA 2B5TB 1JIMA 2J34A 4UFGH 2Z3DA 1ZHMA 3I29A 4OS5A 2Y5HA 1SGPE 4CRFA 3MOCA 2C3SA 2PKSB 2ZDAH 1O2OA 1Y5BT 9LPRA 2FI3E 3N7OA 1C2IA 4BXSA 4IN2A 5A2MH 4Q7YA 1GJ8B 1JBUH 1GHBG 2VWNA 2NU0E 3KEEA 3PO1C 1HAXB 2K1QA 1BIOA 1C5MD 1MTNC 3A81A 1JRSA 1GCDA 4ABEA 1BQYA 1RIWC 2ANMH 1GBDA 2W3KA 1C1UH 1MAXA 4CR5A 1GBCA 1TGTA 4R8TB 1ETRH 1F0SA 4NIXA 5TJXA 1DWEH 1T8NA 3ATIA 3LJJA 1AU8A 1TWXB 3GOVB 1EAUA 2ZFPH 2V0BA 4ISIH 1GJDB 1SGFG 1TPAE 1L0ZA 1DUAA 5EODA 1EAXA 1P2NA 5TCCA 3A7TA 4FUCA 1GI7B 2JH5D 2BY7X 4Y11E 1JMOH 2A31A 4NZQA 6CHAB 1V2OT 1FQ3A 5C5OA 1P2JA 4DVAU 2LPRA 5B6OA 3ODFA 1GWAA 2BD7A 3T5FH 4MPXA 1EP5A 4MVNA 1SGTA 1RD3B 2HRVA 4FVDA 2VVCA 1N6YA 1THSH 4FU9A 1NU7B 1EUFA 3BG4B 1EZSC 1V2TT 5ETXA 1P9SA 1FZZA 3TGJE 3WY8A 1ZLRA 4ASHA 1FI8A 2BXUH 1S0RA 3A8BA 1FY1A 1UTQA 5L6NH 2Y5GA 1C1WH 2A4OA 3O8CA 2QGRA 1W2KH 3RXPA 4XOJA 3LGUA 2IN2A 1QIXB 1B5GH 3EGKH 3MYWA 3Q3XA 1BBRE 2ZFSA 1W11U 3ZZ7A 1GCTB 1KXFA 1YPGH 3A7VA 3KQDA 1KXCA 1FIZA 1LVOA 2XXLA 1GL0E 3Q76A 1YPKH 2SFAA 4Y0YE 2JETC 1ZSLA 4GUXA 1O5AB 2ZWLH 1EXFA 2GT7A 1MTSA 1GMCF 3F9FA 3PMAB 1H9LB 3B8JA 1GMHG 1Z7KA 3MFJA 4HFPB 1OOKB 1KLTA 3P92A 2H9HA 1EZQA 1TOCB 4MNYA 2BVXH 4OGXA 4SGAE 5HM2A 1QRWA 1MKXK 1SHYA 3SUGA 2PR3A 3SJ9A 1MD8A 3F6UH 1P9UA 1O3PB 4Y10E 1P0SH 1H1BA 3MH6A 7GCHF 1C2LA 1NS3A 4MLFB 4ZHLU 1AQ7A 1GBEA 9ESTA 1ANBA 2BQ7B 1QQ4A 1G3DA 1BTHH 1C2MA 1V2PT 3RXLA 3RXEA 2XBWA 2WINI 4ISHH 1Y3VA 1ZHRA 5C2ZA 3AAVA 4HZHA 3BTME 1K22H 4FU7A 2H6MA 5GPIB 1K1PA 4AGKA 3M7QA 1J17T 4Y8ZA 3SI4H 2V6NA 2Z3CA 3VGCC 2ZHQH 4YLQH 3EA8A 1XUFA 2OBOA 3BTFE 4X8SH 1YLCA 3MO6A 2O9QA 3M5OA 1OWDA 1UTKA 1W7XH 1KSNA 2YNBA 2RG3A 2SGEE 1TGCA 2ZHEH 1HNEE 4I31A 1MZDA 3E6PH 1UMAH 4GVUA 4IW4E 4BANB 1MAYA 4FUFA 1ELFA 1W13U 2G81E 1O2GH 1SLWB 3KF2A 1ZMLA 1AZZA 5T6DA 3HATH 2ULLA 1O2IA 1G3CA 4NSVA 4A92A 3SQEE 1H4WA 1HAPH 3ZYDA 1T31A 1KXEA 3ATMA 5FPTA 3RXBA 4MNWA 2GKVE 1PQAA 1MU8B 4Y6DA 3SNEA 6GCHG 1K1JA 1HJAC 1O2MA 2FI4E 4YOGA 2XBYA 1UHBB 2QA9E 2TPIZ 3S69A 2ZGJA 2FIRH 1HAOH 2RCEA 4ZAEA 2QF3A 2CV3A 1FY4A 1C5UA 3RXKA 3U8RH 1TBZH 1O2NA 1UTPA 3BIUH 1G37A 3D62A 4WMEA 2HGTH 2BX3A 2F3CE 3HKIB 3MO3A 4YTAA 4XSKU 1DS2E 3AW1A 1BCUH 1BJVA 5EPYA 3UR9A 1UTJA 2J9NA 3UOUA 1GDUA 2BVRH 3ZVFA 2P3UB 1QJ1B 2WV5A 5FCKA 2FS8A 3TK9A 1ELVA 3SJ8A 2PW8H 4LK4A 1O5EH 1GJAB 1SVPA 1SLUB 4X6NA 5C1UA 1DANH 2JKHA 4CBNA 4MNVA 2GV7A 4MG3A 4X2YA 4WWYA 1JWTA 3HKJB 3TPIZ 1DVAH 2DUCA 2P95A 1ANDA 4MPWA 3T27A 4J1YA 4OS6A 1AZ8A 1NRRH 1TLDA 3ATKA 1MD7A 1VITF 4I32A 1BTZA 2UUJB 3W95A 1QB6A 5GIBA 1KXBA 2Z9JA 2ZCHP 2ZDLA 1OP2A 1DXWA 1RTLA 1BRUP 1Z1IA 3LGYA 1GI0A 4ZKSU 2SGDE 4X2XA 3LT3A 2XWAA 3EAJA 4BAMB 2ZF0H 4AG2A 4E06H 3ZZ9A
chains in the Genus database with same CATH superfamily
4IN1A 1O2JA 2FTMA 4NA7A 3RM2H 1SOZA 1CBWB 3MNCA 3A84A 1MUEB 1PPZA 1F5KU 1M9UA 4K1TA 2G00A 1V2KT 2V7QD 4ACBA 2TGPZ 1HIAA 3F9HA 3KIDU 1EPTB 3SYJA 1C1NA 1NT1A 3RXJA 1BOQA 3QN7A 4VGCB 2W7UA 2C8WB 2BY5X 3M5NA 3QTOH 5T1VA 4CRCA 3RLYH 5A8ZA 2FS9A 3QX5H 1HUTH 1IHSH 2G51A 2Q1JA 1TGNA 4P02A 3U1IB 1D6RA 4AX9H 1HIAB 3BTEE 1MBMA 2G5NA 3SNBA 2KCOA 3SORA 1LCYA 3Q00A 1SC8U 2BDBA 1XXFA 2ZDNA 3SNAA 4INKA 5I46H 3T29A 1QBOA 1RRKA 4K8BA 5DP3A 1GJBB 3SQHE 1HPGA 1TMUH 2FOHA 3B9FH 5C20A 1BBRK 1F0UA 1LQDB 2GMTC 3ESTA 3AASA 2TRMA 3K6YA 4RSPA 3S0NA 1AUTC 2RDLA 3T26A 1YPEH 1Y59T 4R0IA 4IMZA 2Y81A 1GI5A 3KGPA 1K28D 3P95A 4O97A 2FODA 2FI5E 2QXHA 4D9RA 2Y80A 2AMQA 4GCHF 2W26A 2Z7FE 3F68H 2PHBA 3SGBE 1LO6A 1MBQA 1C5LH 1WDIA 2A5IA 1G3BA 1YPLH 4XBDA 1O2YA 1SQTA 4X1NU 2BLQA 1BMMH 3UUZA 1K1IA 1GBFA 5CHAB 2BYAX 2BD8A 2QYIA 1QR3E 4GSOA 1J14A 3LGTA 5EXLA 3UNSA 2FO9A 3V3MA 1GMCG 2FMJA 3FFGA 3A85A 4GHQA 2BQ6B 1KY9A 3I77A 5DJ7A 1O3GA 3SJOA 2VH6A 1A5HA 5F8XA 2BD4A 3MU0A 1WU1A 1LHCH 1BHXF 8LPRA 1GBKA 3EYDA 1E38B 3GDVA 1KTSB 1NESE 1LVMA 1FONA 1K2I1 4Q2KA 1GHVH 1DE7H 1GBLA 2VIPA 1O2UA 1TNIA 4FUHA 2P8OB 1QBNA 3FAOA 2GZ8A 7GCHG 1WQVH 2UUKB 2ZU5A 2PUXB 3GDUA 4OS4A 3GY4A 5T6GA 3SOSA 4CRAA 3S9BA 1A5IA 5KGOA 1LHDH 1NPMA 4I8HA 4KTSA 4CRGA 1ANCA 1ESTA 1AHTH 2Z9GA 1P8VC 1K21H 1A0LA 3ZZ6A 1G9IE 1SQAA 4BAHB 1SGRE 4HG6A 2ZU3A 1P57B 1Z8RA 3H5CB 1TA2A 1V6DA 1ZR0A 5FX6A 1J15A 1DY8A 5L30H 2M5TA 3E0NB 5ABWA 4Q7XA 4JK5A 3LOXA 1Y3UA 4ZUHA 3TU7H 2OCVB 1GMDG 2A1DB 2A4GA 3DHKH 4X1QU 2SGPE 3TNTA 2IOTA 5C0UA 1DPOA 2R2WU 1GJ4H 1CA0C 2ZZUH 1KDQA 1P06A 2KZ4A 3PYHA 1PYTD 2FP7B 1SLXB 4ISOA 4Y8YA 1OWKA 5FAHA 1G2LA 2KCPA 3A80A 1PQ7A 2FOCA 3K6ZA 4IC5A 1TPSA 5FBIA 1F0RA 3GY7A 4Q80A 1GBMA 4WJG2 3TVJB 1BMNH 2BQWB 3M3VA 1XXDA 2BZ6H 4XE4A 2P93A 1NFUA 1V2UT 3F9GA 3ITIA 1ZTJA 2ZHWH 2WPMS 3OTJE 1ZRKA 4MTBA 1EJMA 1HXEH 3MI4A 5EXMA 2DE9A 4O9VA 1VKYA 2J38A 3LGIA 4JYVH 3TH4H 2EEKA 2BX4A 1S81A 1G36A 1G30B 4NGAH 4ISNA 3SJKA 3PV2A 1XX9A 1EFRD 1MH0A 1O3OA 3LKWA 2HPPH 1ABJH 2HOBA 3LONA 1SMFE 1CU1A 3KQCA 4Q63A 3RMNH 3O8DA 2L74A 2H2ZA 3ZVDA 1C5PA 4UFEH 3ZZBA 3RC6A 2FDAA 2Y7XA 3B23B 2A7JA 2ESTE 4UEHH 1CO7E 3E91A 1HCGA 3RXUA 1YPMH 3OY6U 4YOJA 1IQNA 1H9IE 3RU4T 5EPNA 1ETSH 1LHGH 1O3AA 3QLPH 3A7WA 5JYIA 3TIUA 1IQIA 1OYTH 4FETA 3ZZ8A 1OHHD 2QAAA 5EXNA 3MH5A 1P02A 4UONA 2ZCLP 5JBTA 1VITG 2BDIA 4Y76A 4FUIA 3A7XA 4TYDA 2P94A 4TWWA 3BSQA 3MU4A 3ODDA 1SGYE 1TNJA 4ZHAA 1P12E 3LU9B 3KHVA 2V3MA 2A7HA 1P09A 5L2ZH 4KTCA 1DM4B 1C5YB 4WVPE 1PPFE 2RA3A 3QZQA 1GJ9B 1E0FD 4MPUA 1YPJH 1S6FA 2F91A 1NRPH 2Y82A 1SFQB 1UJ1A 2RFKC 3LH3A 1WBGB 1WUNH 1HXFH 3S7HB 1EPTC 1AWHB 3T28A 3BTQE 2OD3B 1NRNH 4F48B 4WXIA 4VGCC 2A0QB 4ZH8A 4WY3A 2CHAC 4AG1A 3A87A 1SQRA 1S82A 1ANEA 4CR9A 5C67A 1H8ED 4UE7H 2Z3EA 3KQ5A 3U8OH 4AFUA 2ODYB 2ZFQH 1HFDA 5HKKD 1TRMA 1VZQH 3BIVH 1O3JA 2V3OH 3W1EA 3K9XB 4PROA 3E3TA 5FX5A 4X2VA 4FXGH 2QF0A 1DSTA 2KCAA 1O32A 2VIOA 2OQUA 1O2RA 1GJ5H 3NKKA 5HM9A 2FLRH 1LPZB 2FOFA 2Z9IA 1PPCE 1ELTA 2WPJS 4B1TA 2OBQA 3RXVA 4WH6A 4U32A 1O2KA 2ZTZA 2A7CA 1NRSH 1TB6H 1V2RT 3OSYA 5A0BA 1BTXA 2GX4A 3TJVA 3RXAA 5CHBA 5F6MA 4P00A 4Z6AH 4IC6A 3EQ0H 4GCHG 3HK3B 2BM2A 3ZIAD 4I86A 5E2OA 2FEQH 3WW7A 3SV9A 4FU8A 1GI6A 4HI3A 2UUYA 4KKDA 1EOJA 4ZROA 4UFFH 4CH2B 5F03A 1FPCH 3ELAH 1S6HA 2BXTH 2Y7ZA 1C4Y2 5C0TA 2PSXA 1FJSA 1FAXA 2VB0A 5E0HA 3NZIA 1CVWH 2B8OH 1A3BH 1HGTH 2ZTXA 2ZFFH 1D6WA 1MKXH 1DICA 2ZHFH 3TGIE 2JDID 3V0XA 5DP7A 2WUBA 3LC3A 3ZVBA 1FNIA 1C4V2 1A7SA 1WAYB 5AVDA 1TPPA 1JXPA 1KLIH 5EU8A 4YM9A 5CE1A 2PFEA 1HJ8A 4TWYA 2H1UA 2K8IA 2GDEH 4JYUH 2FWWA 4YO9A 1FUJA 3PMHB 1NO9H 1C9TA 3LH1A 1SGNE 1RS0A 1LDTT 3Q3KA 1ZMNA 1B7XB 3RXTA 2FXRA 2A4RA 2VGCB 2BHGA 2QF5A 4ABHA 1K0HA 1U6QA 3BEFB 2FLBH 2QXGA 4K60A 2A4QA 2ZU1A 4BAOB 1THRH 1NTPA 2ZPRA 4MPVA 1GI1A 3C1KA 2YMSC 3PRDA 4X6MA 4JZFH 2A2QH 1O3KA 2VIVA 1V3XA 2VNTA 1HDTH 2SGAA 3ZZCA 4OS1A 1BB0B 2BVSH 2ZKSA 2UWOA 1AFQB 3H09A 2AMDA 4E05H 3PLPA 1WYKA 2VIDA 8ESTE 3GYLB 2FZZA 2Z94A 1XVOA 3F0OA 4AGJA 1CGHA 2W5EA 3D23A 4Y7BA 1IAUA 2ZPSA 3KQBA 1LKAA 2J98A 4CRDA 3LJOA 1IHTH 3UAIC 1J8AA 1Y5UT 2GTBA 1DWCH 1TFXA 5HXFA 3UNRA 1HAHH 1MTUA 1QJ7B 3P8NA 2EY4C 4D7FA 2RA0A 2B0FA 1OX1A 4BXWA 1C5QA 1CHGA 2FOMB 1HAIH 2XBXA 3DSPA 4FUGA 1YPHC 2ZP0H 3GY2A 5FPSA 1DSUA 1O39A 1CT2E 4B2BA 1E1QD 2J97A 3VG8A 3TJOA 1GI2A 3HK6B 2LNCA 1GDNA 3SUEA 1C4U2 3AVZA 1A5GH 3SUFA 2JH0D 2Y6TA 4ABGA 1UTOA 1AFEH 1SB1H 3MNSA 2A5KA 3RC5A 4JMYA 2W3IA 1GGDB 3DFJA 5C94A 2KAIB 4K1SA 2NU1E 1H8DH 1ZTLA 1ELGA 1FN6A 3RXRA 2WHXA 3PWCA 4NZLA 1TONA 4J2YB 1C1QA 1FDPA 4WXVA 1ARBA 3I78A 5HGGA 4DGJA 5LPEA 1NBMD 1QCPA 5C5NA 1IQKA 1LVBA 3UQVA 1CHOF 3A8DA 3CS7A 4NWKA 1C2GA 4U2WA 2V35A 1NBME 1O2QA 1N8OB 3UFAA 1K1MA 4XFQA 4Z0KA 2AERH 1TALA 1XMNB 1SG8B 2ZFTA 1SPJA 3SU2A 1UHBA 4X8TH 1NFXA 4FUBA 3ZVGA 1PFXC 1NC6A 2XC4A 3M36A 1AB9B 1A46H 4DCDA 1UCYE 4DIHH 3DT0H 4MQAA 2ZDMA 3KL6A 3OE7D 1ORFA 3U9AH 3ZVCA 3MU5A 5DK1A 1ABIH 3PWBA 1UK3A 4Q7ZA 1K9OE 2AH4X 3U98H 1BMFD 3EE7A 4M7GA 1KTTB 1L1NA 1ZSJA 1BTWA 2ZU4A 2H9EH 3U8TH 1C2EA 5ESBA 1GJCB 5EG4A 1DXPA 2PKAB 2WYGA 1C2DA 3ZZ4A 1ZGIA 1G3EA 2OXSA 1G2MA 3BEUA 1ARCA 2LELA 1EX3A 2CF8H 2VWOA 1QQUA 1UW7A 2IPQX 4O3TA 3E1XB 3OFND 4MNXA 2PKSC 3KN2A 4LXBH 1W14U 3RMOH 1P2KA 2V3HH 4B76A 1L1GA 8KME2 1YPHE 5KECA 1DWDH 1GJ6A 8GCHF 2QXIA 5CMXH 1D9IA 5L2YH 5EQSA 1P05A 2F9VA 3JZ1B 2A5AA 4A5TS 1BBRH 4D9QA 4AFSA 1V2LT 3HGPA 2ZFRH 2BD2A 2ZEBA 4D76A 1E37B 3RC4A 1SGIB 1N1LA 1TQ0B 1XUJA 1H8HD 1FV9A 5DP5A 2A32A 3SHAH 1D3DB 1VITH 4X1PU 4XRNA 1T8LA 3GY3A 5HYOA 3NUMA 2F83A 1C1VH 1LHEH 2HALA 1JIRA 1A0HB 1XVMA 2XW9A 1EPTA 1P2MA 3O8BA 1OYQA 1GHAF 5PTPA 1COWD 1YY3A 4JZEH 2QF4A 3WWFA 4Y79A 1MMJN 2GCTB 1BTUA 2ZGHA 5LGOA 1KIGH 3GY6A 1DLEA 5EOKA 3MWIU 1W12U 3FANA 5E0GA 3LC5A 1AVGH 4AORA 1RTKA 2IPHA 3IWMA 3UQOA 2BY9X 2ODQA 2ALPA 2ANYA 3SV8A 6CHAC 1O3NA 1SGQE 3R3GB 3PROA 7LPRA 4QT8C 3CP7A 2W6JD 1P01A 2AS9A 1XUHA 1HAGE 3R0FA 4X6OA 2OTVA 4NIYA 4AB9A 1T4UH 3BTHE 1YWUA 4A1TA 1P10A 4INLA 4CBOA 1DLKB 1IQHA 1C5VA 2K0QA 3CS0A 2GD4B 3ATWA 3F9EA 2FOGA 3MH4A 1QB1A 3E8LA 3SN8A 1TAWA 3BG4C 2GZ7A 1O2SA 3MNXA 4Y0ZE 3FZDA 3CNRA 3A89A 2G5VA 2GCHF 3URCA 1C1TA 2SNWA 2UWPA 3A7YA 3PRBA 5JB8S 3ZZAA 1TABE 3BV9B 3UB0A 1Z71A 3NK8A 2XWBI 1F7ZA 2VGCC 4TPIZ 2OUAA 2BTCE 1JRTA 1S83A 1YF4A 4JCNA 1N6XA 2OK5A 1D3PB 4DT4A 4NSYA 2JJ2D 1KMHB 5C1YA 1WTGH 1GCTC 2PGBB 4DURA 1PYTC 1BRAA 2FYRA 3Q77A 2UUFB 4OS7A 2QV1A 1EKBB 3M5MA 5JBCS 3M7TA 1J16A 1AFQC 1EZXC 2FOEA 3RXSA 1JOUB 1MKWK 3TK5A 1O37A 3MU8A 1LMWB 2OINA 2VJ1A 2O8WA 3NXPA 5AHGH 1P3CA 1GBJA 1EJNA 1VCQA 3GCOA 1HAZB 1AKSB 3MU1A 3SBKA 1TE0A 1EB2A 2GVFA 3PMJA 1C5NH 3QK1A 4AOQA 3C27B 3EA7A 3GYMA 5EIYA 4NA8A 4ISLA 5DGJA 5F53A 3PTBA 1LKBA 1L2EA 3HGNA 3RXHA 2EQNA 1SGFA 1L4ZA 1TRYA 3PV5A 1O35A 3RM0H 1VJAU 2BMGB 3S9CA 1C2HA 3DFLA 2C8ZB 1S5SA 3A82A 2ASUB 2WPIS 1MABB 2GP9B 1F2SE 1EOLA 3PTNA 1WOFA 1AY6H 3SNCA 3S7KB 2J4IA 3OU0A 1FXYA 4H6TA 4JZDH 3ZV8A 5DO4H 2STBE 1W7GH 3RXFA 3QTVH 4YT7H 1GGDC 1ZZZA 3E16B 1BA8B 4YT6H 5JBBS 1AD8H 1QZ8A 2HVXA 1FAKH 3NPSA 2VVVA 3UR6A 1UCYK 1O0DH 2Q6FA 1CHOG 1THPB 3SZNA 2XNIA 3DD2H 1W0JD 3FP6E 2THFB 2CN0H 1H8IH 3AAUA 4GLYA 1NU9A 1EQ9A 1C9PA 1TX7A 2JETB 2AGIX 1CT4E 3URDA 3RP2A 1TIOA 3A88A 3SU1A 2BLWA 4DW2U 1N8OC 3UIRA 2J94A 5AF9H 2PV9B 1C5OH 1NN6A 1BZXE 1A1RA 1RJXB 3PLBA 4BTTB 3SV6A 4Q4LA 4Y7AA 3ZVAA 4UFDH 3ZZ3A 5FBEA 1QL8A 1GMHF 1UVOA 4B6FA 2C90B 5J4QA 1O3DA 1Z8GA 1BHXB 3GY8A 3U28C 2VIWA 2XCFA 4FUDA 1PPEE 1UTMA 1QURH 5LPFA 2VIQA 2BY6X 4K5ZA 5GNDA 2F9PA 1WTHD 3QUMP 1O31A 1O3HA 4OGYA 1V2VT 2TIOA 3CENA 3RU4D 4A6LA 3BN9A 3G01A 2ZIQH 1W0KD 3L33A 3SV7A 4CRBA 4CHAB 2ZQ2A 4WMFA 4A7IB 4DG4A 4O03A 5JBAS 4DY7B 1HAYB 1NROH 1PJPA 2Q6GA 1QRZA 4I8LA 1W10U 4K8YA 1IQFA 3RMMH 4NG9H 4YLUA 4JZIA 3UY9A 3VGCB 4JZ1A 4B74A 4AYVB 2FYQA 1OKXA 5AFZH 1K1OA 1AI8H 1ACBE 2FOAA 2G8TA 4AYYB 4X8UH 3RXGA 2BY8X 2QXJA 2F9OA 1GI4A 5BPEA 2ANWA 1YLDA 2KCYA 4TPYA 5A8XA 3QGNB 2ZCKP 2YNAA 3N7EA 3NWUA 4WH8A 3LDXH 1V2MT 5A8YA 1SSXA 2AFQB 2QCYA 1BDAA 4NFEA 2GDDA 4NIWA 2H9TH 1OXGA 2H5DA 4U30A 1T4VH 3BTGE 2QY0B 6ESTA 3SZEA 1TNGA 3S9AA 1QL9A 2J92A 1ELAA 1DWBH 1E35B 1Q31A 3QWCH 1HAVA 1CA8B 1FIWA 1FLEE 1QBVH 1GHAG 1TRNA 3D65E 1Q3XA 2FESH 5JDUB 3QGJA 1YBWA 1O36A 4I7YH 4B2AA 4X1RU 1WV7H 4YXWD 3UPEA 4AFZA 2XTTB 2EA3A 1TMTH 1HJAB 1MQ5A 5DP6A 5IDKA 6LPRA 1CBWC 2ANKH 4NWLA 4AB8A 2FX4A 1C1PA 3TJNA 2BLVA 1HAVB 1GHYH 1A61H 5G4BA 3M61U 3SU3A 1KYNA 3ATLA 1INCA 2P3FH 2ZG0H 1TA6A 2GGVB 1GI8B 3VPKA 2EI6A 1FMGA 2BD9A 1RTFB 1A0JA 2O8UA 3ZVEA 5I25A 5FPYA 4ACAA 1F5LA 1AGJA 2AMPA 4X2WA 3LGVA 1RXPA 1Y3XA 1DX5M 1C5RA 1OS8A 1IQLA 3UTUH 1YCPK 2F9BH 3RXIA 1V2JT 3N99A 3FZZA 3M5LA 2OC8A 2ZHDA 1VCWA 2GJGA 1GVKB 4KGAA 1KXDA 4FUJA 1AUJA 3OTPA 1GBHA 1QHRB 1KLJH 2GCHG 4SGBE 5DP9A 3M7UA 3O8RA 1GBAA 2BZAA 2G4TA 1Z6JH 1TX6A 1O2ZA 2VU8E 3H7TA 4KP0A 4ESTE 1DDJA 5GDSH 4AZ2B 3BTWE 1SHHB 1AWFH 1GVLA 5FXLA 1C1OA 1EB1H 2B9LA 1TGBA 3FVFB 4DJZB 1EASA 3RUOA 1SLVB 3BTTE 3VB7A 5EQQA 2Z6BD 4YOIA 1C5XB 1QRXA 1BMAA 3UOPA 1SOTA 5CHAC 2VBCA 2PTCE 4NIVA 2PWXA 5H4IB 1DY9A 1SQOA 1Q2WA 3GICB 1AVXA 3GCHB 2XC0A 1YGCH 3BEIB 1T32A 4ABFA 2G52A 2F43B 4UD9H 4INHA 1O34A 1W3CA 1ZMJA 1TQ7B 3LIWA 3EE0B 2AGEX 1E79D 2XYAA 4F55A 3OEED 1NRQH 1ZSKA 3V7TA 4FUEA 1MZAA 3TH2H 4FVBA 2PTNA 1GI9B 1BTYA 1ZPZA 2D8WA 2Q6DA 3SI3H 2BDAA 3SU0A 2P16A 5GCHF 2P8OC 1T7CA 5EW2H 3KCGH 1H9HE 2BB4A 1QA0A 1W0ZU 1WQSA 1EAIA 2L6OA 2YOLA 3DUXH 1ZPBA 2GMTB 2VINA 2F9UA 4O3UA 4NFFA 1C1MA 4B73A 1NFYA 1O5CB 1GBIA 4BAQB 3P6ZB 1TNKA 4ABDA 1DFPA 2CMYA 4ZXYH 1XUIA 3F0PA 3F2GA 1GHWH 1NFWA 1OP0A 5E2PA 1UTNA 3DSGA 3RXMA 1EZUC 4K69A 2VH0A 2GT8A 1QGFA 3P8FA 2ZO3H 4JK6A 2WPKS 2WUCA 4XDEA 1D4PB 3A8CA 1O2VA 3ZZ5A 1TBQH 2Z9KA 1C2FA 3BTDE 3E0PB 2ZDVH 3A83A 1C5TA 1YM0A 1D3TB 2B7DH 1QY6A 2JIZD 1BRCE 3MMGA 1AVWA 3A8AA 1O3FA 4RT0A 2BDHA 3L3TA 5T3HA 4ZKRU 1OPHB 1AO5A 1O2WA 5B6LA 3QZRA 4I8KA 4BTIB 3BF6H 2Z9LA 3M35A 4IMQA 2KAIA 2CK3D 2PUQH 3RMLH 2FTLE 1E1RD 1DITH 2TGTA 4AFQA 3SO3A 2Y5FA 3TJUA 1EJAA 2ZU2A 1F92A 5SGAE 5LPRA 1SBWA 3EA9A 2R2MB 2ODPA 1P03A 3OX7U 1CGJE 1O2XA 4H6SB 4YESB 1C1SA 1ID5H 2BD5A 3JZ2B 2FX6A 2R3UA 1HRTH 3IITA 2KM0A 4I8JA 3SU5A 1O3LA 2O8MA 2ZNKH 2J95A 1P2IA 1XKAC 3MTYA 4CREA 4CHAC 2CF9H 1YCPM 5E8EH 3RLWH 3GCTF 3FO8D 1FY5A 2PLXA 4KTUA 2XOKD 3U69H 4B2CA 5KEDA 1Y8TA 1GHXH 1WSSH 4X1SU 1VGCB 1GG6B 1O38A 4D8NA 4A1VA 1LQEA 1ZGVA 5GJ4B 3P17H 5IYTA 3UREA 3M3TA 2AIPA 2BDYA 3P70B 1E36B 3PB1E 4DIIH 1HYLA 2O8TA 1HV7A 2G55A 2UWLA 5IK2D 1O2TA 3SHCH 2VWMA 3HPTB 2IJOB 1V2QT 1OWJA 4E7RG 4ZMAH 3FP7E 1YKTA 2PKAA 3H7OA 2EC9H 3RDZA 1SGCA 2ZGXH 4ABBA 1NY22 1O3IA 2TBSA 1GMDF 1XKBC 3MNBA 1CA0B 4Y71A 1Y3WA 1TBRH 1C2JA 3AW0A 2CJIA 3MH7A 1DOJA 1MTWA 2I6SA 2R9PA 4CH8B 2R0KA 2J5UA 1IOEA 3PMBB 3TH3H 1J9CH 1UVTH 1NM6A 4ZHMU 3SNDA 5GXPA 4B71A 2PGQB 3ZZDA 3STJA 1O2LA 2WYJA 1V2NT 4RKOB 2ZPQA 1F5RA 1ZRBA 5EW1H 2EI8A 3P8OA 1B0FA 3L6PA 1AMHA 4D7GA 2BOKA 2C8YB 2GV6A 3VXEH 2SNVA 1RGQA 3SJIA 2HVYB 4LOYH 1IQMA 1FPHH 1LTOA 4AC9A 2D2DA 1C5WB 5DSFA 2ZA5A 2HLDD 1ETTH 1BUIA 2OC0A 4HTCH 3AK5A 1O5GH 1ZOMA 4Z1MD 4I33A 3NRLA 4F49A 3F2FA 2R0LA 1GBBA 2P3TB 2WSSD 2ZGCA 2FM2A 4BTUB 4B75A 1BMLA 1UVSH 4XBBA 5JPMH 3SU4A 5HIZA 2BLOA 1O5BB 5C1XA 1UK2A 2XCNA 1SGDE 1OWHA 1A3EH 4BOHA 2SGFE 1PPHE 1GI3A 1ZHPA 2AIQA 3KYGA 1HLTH 4TY6A 3VXFH 1ZJKA 4KELA 5FCRA 2OC7A 2TGAA 3VB3A 4K2YA 5DPAA 3UNQA 2HNTC 3OY5U 5ESTE 1QFKH 1GJ7B 1PQ5A 2JH6D 1A4WH 3A86A 3LPRA 5BRRE 1B0EA 4RI0A 1MKWH 4RT1A 1OWEA 5E0JA 1LPGB 1WCZA 5LH8A 5K0HA 1FY3A 3E90B 5CDFE 1CT0E 1IQEA 3T25A 5A09A 1QTFA 3DA9B 5F8TA 2HPQH 1SKYE 3TGKE 1O30A 3GCHC 3KQEA 3SUDA 4NA9H 2WV4A 1A2CH 2A2XH 1O2PA 5EJLA 2QC2A 1SGEE 2H5CA 2WPLS 2AEIH 1O3MA 1HB0B 2CHAB 3FN8A 1GHBF 3UWIA 3PO1B 4GAWA 4NCYA 1LPKB 1MCTA 4JYTA 1O3CA 1MTNB 3K2UA 1AE8H 2OQ5A 2FPZA 1S0QA 2XBVA 5K7RA 3PM3A 3MO9A 2VWLA 1RIWB 1P11E 5GCHG 1QJ6B 2WPHS 2HWLB 4ZKNU 1TOMH 1T8MA 2NU4E 1PPBH 4X8VH 5DN6D 4GPGA 1QA7A 1UTLM 4DT7B 2ILNA 3A7ZA 3SGQE 1ZYOA 3OYPA 1GPZA 2QIQA 2A45B 5J4SA 4K1EA 3QO6A 3TLOA 5A0CA 2CGAA 4M9FA 5AFYH 3T62A 3VB4A 4K3JA 3V12A 1E34B 1UCYH 1S85A 4YZUA 3IG6B 3ZV9A 1SI5H 1AKSA 7KMEH 2NU2E 3STIA 1SR5C 2J2UA 2OC1A 3K65B 3TITA 2I6QA 1NZQH 1TYNA 1CGIE 4HGCA 1ELBA 1W0YH 1VR1H 1P2QA 1MTVA 4ZXXH 5DKMA 2C4FH 1O2HA 2VVUA 1O3BA 4E7NA 3GDSA 1CSOE 4AN7A 1QNJA 3D49H 4TY7A 4ABIA 1FN8A 3PLKA 1LHFH 4Y8XA 3QDZB 2FOBA 1TPOA 3BTKE 1IQJA 1ELDE 4IBLH 2HNTE 1XM1A 4IGDA 1YYY1 2STAE 1EATA 2AGGX 2WPDD 3SW2B 1MQ6A 1O5DH 1BT7A 1MCVA 3UWJH 4GHTA 1Z8IB 1TX8A 2BDGA 5FHTA 3SU6A 4H4FA 1IQGA 1BTPA 1Y3YA 1SL3A 3VB6A 1YP9A 1X7AC 3LGWA 4X6PA 1V2ST 1ESBA 1BJUA 3RXQA 1BITA 1GVZA 2CXVA 1DUEA 1O3EA 2ZTYA 2SGQE 1GHZA 1T8OA 3WWBA 1QL7A 1O5FH 2PP6A 1Z1JA 2XC5A 2QN5T 5DP4A 3GCTG 3F1SB 2BOHB 3VEQB 1XUGA 3VFEA 1G32B 1KXAA 2YMSB 1O33A 2ZI2H 4OS2A 4U01A 2NU3E 1VGCC 3FOAA 2ZGBH 3RXCA 1ELCA 3W94A 3SGAE 1GG6C 1P2OA 2O8LA 1PQ8A 5C17A 4MDSA 3T2NA 1Z8JB 5T6FA 1LVYA 1GL1A 3PV4A 2XRCA 2ZECA 4IS5A 1SFIA 1ELEE 2PSYA 1FY8E 1RFNA 2F4LA 1QB9A 4LZ4B 1AB9C 4WF8A 1PPGE 2OP9A 1TGSZ 2ZC9H 3FKSD 4BAKB 1ZTKA 3KNXA 1GBTA 1UO6A 3FP8E 1L1JA 3ZYEA 1TNHA 5HIYA 4XBCA 1UVPA 7ESTE 2KX4A 1AE5A 1HJ9A 1K1NA 2KR7A 3P8GA 4F4OC 2DE8A 1F0TA 1C1RA 1UK4A 2KFWA 1V2WT 1VJ9U 2C8XB 4B6EA 4I8GA 1P3EA 4DOQA 1UVUH 2GZ9A 1C2KA 4WMDA 2ALVA 3VB5A 3RU4E 1AIXH 4THNH 5EGMA 5A0AE 5JB9S 2BDCA 2G4UA 5DG6A 1KDQB 4LZ1H 2TGDA 3M3SA 1S6LA 2ZDKA 2RDEA 2EI7A 1YCPH 1D3QB 3NCLA 2BD3A 2P59A 5TCAA 3GCNA 8GCHG 1TNLA 4ZKOU 1DT2A 2W7SA 4RN6A 2NWNA 5GWZA 1C5SA 1OWIA 1CQQA 3RXDA 1TMBH 1L4DA 1Y5AT 2F9NA 5EQRA 3SV2H 3RXOA 4BNRA 3Q3YA 3M37A 4ASUD 5DP8A 4UDWH 1EP6A 3TNSA 1YC0A 1K1LA 1OSSA 1S84A 3U1JB 1ZPCA 4H42U 1XUKA 1VCPA 2C93B 4ABAA 2OLGA 2R3YA 3BG8A 2D1JA 4A1XA 1W8BH 1GDQA 1AN1E 3TK6A 2GCTC 5C3NA 2HLCA 1BRBE 3ENSB 1ZJDA 3GISB 3DSOA 5F8ZA 1P04A 1EAWA 2ZQ1A 3EDXB 3V13A 6GCHF 2HNTF 3GY5A 1ESAA 4X0WU 1Z6EA 4FOUC 3GS9A 5HMAA 1C5ZB 1CE5A 1HBTH 3MHWU 1OP8A 2AYWA 2D26C 4RKJB 1MU6B 4ABJA 2B5TB 1JIMA 4OM9A 3MQKC 2J34A 4UFGH 2Z3DA 1ZHMA 3I29A 4OS5A 2Y5HA 1SGPE 4CRFA 3MOCA 2C3SA 2PKSB 2ZDAH 1O2OA 1Y5BT 9LPRA 2FI3E 3N7OA 5EJ1A 1C2IA 4BXSA 4IN2A 5A2MH 4Q7YA 1GJ8B 1JBUH 1GHBG 2VWNA 2NU0E 3KEEA 3PO1C 1HAXB 2K1QA 1BIOA 1C5MD 1MTNC 3A81A 1JRSA 1GCDA 4ABEA 1BQYA 2QE7D 1WXRA 1RIWC 2ANMH 1GBDA 2W3KA 1C1UH 1MAXA 4CR5A 1GBCA 1TGTA 4R8TB 5EJZA 1ETRH 1F0SA 4NIXA 5TJXA 1DWEH 1T8NA 3ATIA 3LJJA 1AU8A 1TWXB 3GOVB 1EAUA 2ZFPH 2V0BA 4ISIH 1GJDB 1SGFG 3DCLA 1TPAE 1L0ZA 1DUAA 5EODA 1EAXA 1P2NA 5TCCA 2W6ID 3A7TA 4FUCA 1GI7B 2JH5D 2BY7X 4Y11E 1JMOH 2A31A 4NZQA 6CHAB 1V2OT 1FQ3A 5C5OA 1P2JA 4DVAU 2LPRA 5B6OA 5FL7D 3ODFA 1GWAA 2BD7A 3T5FH 4MPXA 1EP5A 4MVNA 1SGTA 1RD3B 2HRVA 4FVDA 2VVCA 3F3BA 1N6YA 1THSH 4FU9A 1NU7B 1EUFA 3OEHD 3BG4B 1EZSC 1V2TT 5ETXA 1P9SA 1FZZA 3TGJE 3WY8A 1ZLRA 4ASHA 1FI8A 2BXUH 1S0RA 3A8BA 1FY1A 1UTQA 3KYFA 5L6NH 2Y5GA 1C1WH 3OAAD 2A4OA 3O8CA 2QGRA 1W2KH 3RXPA 4XOJA 3LGUA 2IN2A 1QIXB 1B5GH 3EGKH 3MYWA 3Q3XA 1BBRE 2ZFSA 1W11U 3ZZ7A 1GCTB 1KXFA 1YPGH 3A7VA 3KQDA 1KXCA 1FIZA 1LVOA 2XXLA 1GL0E 3Q76A 1YPKH 2SFAA 4Y0YE 2JETC 1ZSLA 4GUXA 1O5AB 2ZWLH 1EXFA 2GT7A 1MTSA 1GMCF 3F9FA 3PMAB 1H9LB 3B8JA 1GMHG 4XD7D 1Z7KA 3MFJA 4HFPB 1FX0B 1OOKB 1KLTA 3P92A 2H9HA 1EZQA 1TOCB 4MNYA 2BVXH 4OGXA 4SGAE 2IJD1 1QRWA 1MKXK 1SHYA 5HM2A 3SUGA 2PR3A 3SJ9A 1MD8A 3F6UH 1P9UA 1O3PB 4Y10E 1P0SH 1H1BA 3MH6A 7GCHF 1C2LA 1NS3A 4MLFB 4ZHLU 1AQ7A 3N7DA 1GBEA 9ESTA 1ANBA 2BQ7B 1QQ4A 1G3DA 1BTHH 1C2MA 1V2PT 3RXLA 3RXEA 2XBWA 2WINI 4ISHH 1Y3VA 1ZHRA 2JJ1D 2J98B 5C2ZA 3AAVA 4HZHA 3BTME 1K22H 4FU7A 2H6MA 2WZQA 5GPIB 1K1PA 4AGKA 3M7QA 1J17T 4Y8ZA 3SI4H 3F2HA 2V6NA 2Z3CA 3VGCC 2ZHQH 4YLQH 3EA8A 1XUFA 2OBOA 3BTFE 4X8SH 1YLCA 3MO6A 2O9QA 3M5OA 4ZCNA 1OWDA 1UTKA 1W7XH 1KSNA 2WV9A 2YNBA 2RG3A 2SGEE 1TGCA 2ZHEH 1HNEE 4I31A 1MZDA 3E6PH 1UMAH 2M2AA 4GVUA 4IW4E 4BANB 1MAYA 4FUFA 2YMSD 1ELFA 1W13U 2G81E 1O2GH 1SLWB 3KF2A 1ZMLA 1AZZA 5T6DA 3HATH 2ULLA 1O2IA 1G3CA 4NSVA 4A92A 4TT3D 3SQEE 1H4WA 2LP6A 1HAPH 3ZYDA 1T31A 1KXEA 3ATMA 5FPTA 3RXBA 4MNWA 2GKVE 1PQAA 1MU8B 4Y6DA 3SNEA 6GCHG 1K1JA 1HJAC 1O2MA 2FI4E 4YOGA 2XBYA 1UHBB 2QA9E 2TPIZ 3S69A 2ZGJA 2FIRH 2XNDD 2RCEA 4ZAEA 1HAOH 2QF3A 2CV3A 1FY4A 1C5UA 3RXKA 3U8RH 1TBZH 1O2NA 1UTPA 3BIUH 1G37A 3D62A 4WMEA 2HGTH 2BX3A 2F3CE 3HKIB 3MO3A 4YTAA 4XSKU 1DS2E 3AW1A 1BCUH 1BJVA 5EPYA 3UR9A 1UTJA 2J9NA 3UOUA 1GDUA 2BVRH 3ZVFA 2P3UB 1QJ1B 2WV5A 5FCKA 2FS8A 3TK9A 1ELVA 3SJ8A 2PW8H 4LK4A 1YLNA 1O5EH 1GJAB 1SVPA 1SLUB 4X6NA 5C1UA 1DANH 2JKHA 4CBNA 4MNVA 2GV7A 4MG3A 4X2YA 4TSFD 4WWYA 1JWTA 3HKJB 3TPIZ 1DVAH 2DUCA 2P95A 1ANDA 4MPWA 3T27A 4J1YA 4OS6A 1AZ8A 1NRRH 1TLDA 3ATKA 1MD7A 1VITF 4I32A 1BTZA 2UUJB 3W95A 1QB6A 5GIBA 1KXBA 2Z9JA 2ZCHP 2ZDLA 1OP2A 1DXWA 1RTLA 1BRUP 1Z1IA 3LGYA 1GI0A 4ZKSU 2SGDE 4X2XA 3LT3A 2XWAA 3EAJA 4BAMB 2AHME 2ZF0H 4AG2A 4E06H 3ZZ9A
chains in the Genus database with same CATH topology
4IN1A 1O2JA 2FTMA 4NA7A 3RM2H 1SOZA 1CBWB 3MNCA 3A84A 1MUEB 1PPZA 1F5KU 1M9UA 4K1TA 2G00A 1V2KT 2TGPZ 1HIAA 3F9HA 3KIDU 1EPTB 1C1NA 1NT1A 3RXJA 1BOQA 3QN7A 4VGCB 2W7UA 2C8WB 2BY5X 3M5NA 3QTOH 4CRCA 5A8ZA 3RLYH 1HUTH 2FS9A 3QX5H 1IHSH 2G51A 2Q1JA 1TGNA 3U1IB 1D6RA 4AX9H 1HIAB 3BTEE 1MBMA 2G5NA 3SNBA 3SORA 1LCYA 3Q00A 1SC8U 2BDBA 1XXFA 2ZDNA 3SNAA 4INKA 5I46H 3T29A 1QBOA 1RRKA 4K8BA 5DP3A 1GJBB 3SQHE 1HPGA 1TMUH 2FOHA 3B9FH 5C20A 1BBRK 1F0UA 1LQDB 2GMTC 3ESTA 3AASA 2TRMA 3K6YA 4RSPA 3S0NA 1AUTC 2RDLA 3T26A 1YPEH 1Y59T 4R0IA 4IMZA 2Y81A 1GI5A 3KGPA 1K28D 3P95A 4O97A 2FODA 2FI5E 2QXHA 4D9RA 2Y80A 2AMQA 4GCHF 2W26A 2Z7FE 3F68H 2PHBA 3SGBE 1LO6A 1MBQA 1C5LH 2A5IA 1G3BA 1YPLH 4XBDA 1O2YA 1SQTA 4X1NU 2BLQA 1BMMH 3UUZA 1K1IA 1GBFA 5CHAB 2BYAX 2BD8A 2QYIA 1QR3E 4GSOA 1J14A 3LGTA 5EXLA 3UNSA 2FO9A 3V3MA 1GMCG 2FMJA 3FFGA 3A85A 4GHQA 2BQ6B 1KY9A 3I77A 5DJ7A 1O3GA 3SJOA 2VH6A 1A5HA 5F8XA 2BD4A 3MU0A 1WU1A 1LHCH 1BHXF 8LPRA 1GBKA 3EYDA 1E38B 3GDVA 1KTSB 1NESE 1LVMA 1FONA 1K2I1 4Q2KA 1GHVH 1DE7H 1GBLA 2VIPA 1O2UA 1TNIA 4FUHA 2P8OB 1QBNA 3FAOA 2GZ8A 7GCHG 1WQVH 2UUKB 2ZU5A 2PUXB 3GDUA 4OS4A 3GY4A 5T6GA 3SOSA 4CRAA 3S9BA 1A5IA 1LHDH 1NPMA 4I8HA 4KTSA 4CRGA 1ANCA 1ESTA 1AHTH 2Z9GA 1P8VC 1K21H 1A0LA 3ZZ6A 1G9IE 1SQAA 4BAHB 1SGRE 2ZU3A 1P57B 1Z8RA 3H5CB 1TA2A 1V6DA 1ZR0A 5FX6A 1J15A 1DY8A 5L30H 2M5TA 3E0NB 5ABWA 4Q7XA 4JK5A 3LOXA 1Y3UA 4ZUHA 3TU7H 2OCVB 1GMDG 2A1DB 2A4GA 3DHKH 4X1QU 2SGPE 3TNTA 2IOTA 1DPOA 2R2WU 1GJ4H 1CA0C 2ZZUH 1KDQA 1P06A 3PYHA 1PYTD 2FP7B 1SLXB 4ISOA 4Y8YA 1OWKA 5FAHA 1G2LA 3A80A 1PQ7A 2FOCA 3K6ZA 4IC5A 1TPSA 5FBIA 1F0RA 3GY7A 4Q80A 1GBMA 4WJG2 3TVJB 1BMNH 2BQWB 3M3VA 1XXDA 2BZ6H 4XE4A 2P93A 1NFUA 1V2UT 3F9GA 3ITIA 1ZTJA 2ZHWH 2WPMS 3OTJE 1ZRKA 4MTBA 1EJMA 1HXEH 3MI4A 5EXMA 2DE9A 4O9VA 2J38A 3LGIA 4JYVH 3TH4H 2EEKA 2BX4A 1S81A 1G36A 1G30B 4NGAH 4ISNA 3SJKA 1XX9A 1MH0A 1O3OA 3LKWA 2HPPH 1ABJH 2HOBA 3LONA 1SMFE 1CU1A 3KQCA 3RMNH 3O8DA 2H2ZA 3ZVDA 1C5PA 4UFEH 3ZZBA 3RC6A 2FDAA 2Y7XA 3B23B 2A7JA 2ESTE 4UEHH 1CO7E 3E91A 1HCGA 3RXUA 1YPMH 3OY6U 4YOJA 1IQNA 1H9IE 3RU4T 5EPNA 1ETSH 1LHGH 1O3AA 3QLPH 3A7WA 5JYIA 3TIUA 1IQIA 1OYTH 3ZZ8A 2QAAA 5EXNA 3MH5A 1P02A 4UONA 2ZCLP 5JBTA 1VITG 2BDIA 4Y76A 4FUIA 3A7XA 4TYDA 2P94A 4TWWA 3BSQA 3MU4A 3ODDA 1SGYE 1TNJA 4ZHAA 1P12E 3LU9B 3KHVA 2A7HA 1P09A 5L2ZH 4KTCA 1DM4B 1C5YB 4WVPE 1PPFE 2RA3A 3QZQA 1GJ9B 1E0FD 4MPUA 1YPJH 1S6FA 2F91A 1NRPH 2Y82A 1SFQB 1UJ1A 3LH3A 1WBGB 1WUNH 1HXFH 3S7HB 1EPTC 1AWHB 3T28A 3BTQE 2OD3B 1NRNH 4WXIA 4VGCC 2A0QB 4ZH8A 4WY3A 2CHAC 4AG1A 3A87A 1S82A 1ANEA 4CR9A 5C67A 4UE7H 2Z3EA 3U8OH 4AFUA 2ODYB 2ZFQH 1HFDA 1TRMA 1VZQH 3BIVH 1O3JA 2V3OH 3K9XB 4PROA 3E3TA 5FX5A 4X2VA 4FXGH 2QF0A 1DSTA 1O32A 2VIOA 2OQUA 1O2RA 1GJ5H 3NKKA 5HM9A 2FLRH 1LPZB 2FOFA 2Z9IA 1PPCE 1ELTA 2WPJS 4B1TA 2OBQA 3RXVA 4WH6A 4U32A 1O2KA 2ZTZA 2A7CA 1NRSH 1TB6H 1V2RT 3OSYA 5A0BA 1BTXA 2GX4A 3TJVA 3RXAA 5F6MA 4Z6AH 4IC6A 3EQ0H 4GCHG 3HK3B 2BM2A 5E2OA 2FEQH 3SV9A 4FU8A 1GI6A 4HI3A 2UUYA 4KKDA 1EOJA 4ZROA 4UFFH 4CH2B 5F03A 1FPCH 3ELAH 1S6HA 2BXTH 2Y7ZA 1C4Y2 2PSXA 1FJSA 1FAXA 2VB0A 5E0HA 3NZIA 1CVWH 2B8OH 1A3BH 1HGTH 2ZTXA 2ZFFH 1D6WA 1MKXH 1DICA 2ZHFH 3TGIE 3V0XA 5DP7A 2WUBA 3LC3A 3ZVBA 1FNIA 1C4V2 1A7SA 1WAYB 5AVDA 1TPPA 1JXPA 1KLIH 5EU8A 4YM9A 5CE1A 2PFEA 1HJ8A 4TWYA 2H1UA 2GDEH 4JYUH 2FWWA 4YO9A 1FUJA 3PMHB 1NO9H 1C9TA 3LH1A 1SGNE 1RS0A 1LDTT 3Q3KA 1ZMNA 1B7XB 3RXTA 2FXRA 2A4RA 2VGCB 2BHGA 4ABHA 1U6QA 3BEFB 2FLBH 2QXGA 4K60A 2A4QA 2ZU1A 4BAOB 1THRH 1NTPA 2ZPRA 4MPVA 1GI1A 3C1KA 4X6MA 4JZFH 2A2QH 1O3KA 2VIVA 1V3XA 2VNTA 1HDTH 2SGAA 3ZZCA 4OS1A 1BB0B 2BVSH 2ZKSA 2UWOA 1AFQB 2AMDA 4E05H 3PLPA 1WYKA 2VIDA 8ESTE 3GYLB 2FZZA 2Z94A 1XVOA 4AGJA 1CGHA 2W5EA 3D23A 4Y7BA 1IAUA 2ZPSA 3KQBA 1LKAA 4CRDA 3LJOA 1IHTH 1J8AA 1Y5UT 2GTBA 1DWCH 1TFXA 5HXFA 3UNRA 1HAHH 1MTUA 1QJ7B 3P8NA 4D7FA 2RA0A 2B0FA 1OX1A 4BXWA 1C5QA 1CHGA 2FOMB 1HAIH 2XBXA 4FUGA 1YPHC 2ZP0H 3GY2A 5FPSA 1DSUA 1O39A 1CT2E 4B2BA 3TJOA 1GI2A 3HK6B 2LNCA 1GDNA 3SUEA 1C4U2 3AVZA 1A5GH 3SUFA 2JH0D 2Y6TA 4ABGA 1UTOA 1AFEH 1SB1H 3MNSA 2A5KA 3RC5A 4JMYA 2W3IA 1GGDB 3DFJA 2KAIB 4K1SA 2NU1E 1H8DH 1ZTLA 1ELGA 1FN6A 3RXRA 3PWCA 4NZLA 1TONA 4J2YB 1C1QA 1FDPA 4WXVA 1ARBA 3I78A 5HGGA 4DGJA 5LPEA 1QCPA 5C5NA 1IQKA 1LVBA 3UQVA 1CHOF 3A8DA 3CS7A 4NWKA 1C2GA 4U2WA 2V35A 1O2QA 1N8OB 3UFAA 1K1MA 4XFQA 4Z0KA 2AERH 1TALA 1XMNB 1SG8B 2ZFTA 1SPJA 3SU2A 1UHBA 4X8TH 1NFXA 4FUBA 3ZVGA 1PFXC 1NC6A 2XC4A 3M36A 1AB9B 1A46H 4DCDA 1UCYE 4DIHH 3DT0H 4MQAA 2ZDMA 3KL6A 1ORFA 3U9AH 3ZVCA 3MU5A 5DK1A 1ABIH 3PWBA 1UK3A 4Q7ZA 1K9OE 2AH4X 3U98H 4M7GA 1KTTB 1L1NA 1ZSJA 1BTWA 2ZU4A 2H9EH 3U8TH 1C2EA 5ESBA 1GJCB 5EG4A 1DXPA 2PKAB 2WYGA 1C2DA 3ZZ4A 1ZGIA 1G3EA 2OXSA 1G2MA 3BEUA 1ARCA 1EX3A 2CF8H 2VWOA 1QQUA 4O3TA 3E1XB 4MNXA 2PKSC 3KN2A 4LXBH 1W14U 3RMOH 1P2KA 2V3HH 4B76A 1L1GA 8KME2 1YPHE 1DWDH 1GJ6A 8GCHF 2QXIA 5CMXH 1D9IA 5L2YH 5EQSA 1P05A 2F9VA 3JZ1B 2A5AA 4A5TS 1BBRH 4D9QA 4AFSA 1V2LT 3HGPA 2ZFRH 2BD2A 2ZEBA 4D76A 1E37B 3RC4A 1SGIB 1N1LA 1TQ0B 1XUJA 1FV9A 5DP5A 2A32A 3SHAH 1D3DB 1VITH 4X1PU 1T8LA 3GY3A 5HYOA 3NUMA 2F83A 1C1VH 1LHEH 2HALA 1JIRA 1A0HB 1XVMA 2XW9A 1EPTA 1P2MA 3O8BA 1OYQA 1GHAF 5PTPA 4JZEH 4Y79A 1MMJN 2GCTB 1BTUA 2ZGHA 5LGOA 1KIGH 3GY6A 1DLEA 5EOKA 3MWIU 1W12U 3FANA 5E0GA 3LC5A 1AVGH 4AORA 1RTKA 2IPHA 3IWMA 3UQOA 2BY9X 2ODQA 2ALPA 2ANYA 3SV8A 6CHAC 1O3NA 1SGQE 3R3GB 3PROA 7LPRA 4QT8C 3CP7A 1P01A 2AS9A 1XUHA 1HAGE 3R0FA 4X6OA 2OTVA 4NIYA 4AB9A 1T4UH 3BTHE 4A1TA 1P10A 4INLA 4CBOA 1DLKB 1IQHA 1C5VA 3CS0A 2GD4B 3ATWA 3F9EA 2FOGA 3MH4A 1QB1A 3E8LA 3SN8A 1TAWA 3BG4C 2GZ7A 1O2SA 3MNXA 4Y0ZE 3FZDA 3A89A 2G5VA 2GCHF 3URCA 1C1TA 2SNWA 2UWPA 3A7YA 5JB8S 3ZZAA 1TABE 3BV9B 1Z71A 3NK8A 2XWBI 1F7ZA 2VGCC 4TPIZ 2OUAA 2BTCE 1JRTA 1S83A 1YF4A 4JCNA 1N6XA 1D3PB 4NSYA 5C1YA 1WTGH 1GCTC 2PGBB 4DURA 1PYTC 1BRAA 2FYRA 3Q77A 2UUFB 4OS7A 2QV1A 1EKBB 3M5MA 5JBCS 3M7TA 1J16A 1AFQC 1EZXC 2FOEA 3RXSA 1JOUB 1MKWK 3TK5A 1O37A 3MU8A 1LMWB 2OINA 2VJ1A 2O8WA 3NXPA 5AHGH 1P3CA 1GBJA 1EJNA 1VCQA 3GCOA 1HAZB 1AKSB 3MU1A 3SBKA 1TE0A 1EB2A 2GVFA 3PMJA 1C5NH 3QK1A 4AOQA 3C27B 3EA7A 3GYMA 4NA8A 4ISLA 5DGJA 3PTBA 1LKBA 1L2EA 3HGNA 3RXHA 1SGFA 1L4ZA 1TRYA 1O35A 3RM0H 1VJAU 2BMGB 3S9CA 1C2HA 3DFLA 2C8ZB 1S5SA 3A82A 2ASUB 2WPIS 2GP9B 1F2SE 1EOLA 3PTNA 1WOFA 1AY6H 3SNCA 3S7KB 2J4IA 3OU0A 1FXYA 4H6TA 4JZDH 3ZV8A 5DO4H 2STBE 1W7GH 3RXFA 3QTVH 4YT7H 1GGDC 1ZZZA 3E16B 1BA8B 4YT6H 5JBBS 1AD8H 2HVXA 1FAKH 3NPSA 2VVVA 3UR6A 1UCYK 1O0DH 2Q6FA 1CHOG 1THPB 3SZNA 2XNIA 3DD2H 3FP6E 2THFB 2CN0H 1H8IH 3AAUA 4GLYA 1NU9A 1EQ9A 1C9PA 1TX7A 2JETB 2AGIX 1CT4E 3URDA 3RP2A 1TIOA 3A88A 3SU1A 2BLWA 4DW2U 1N8OC 3UIRA 2J94A 5AF9H 2PV9B 1C5OH 1NN6A 1BZXE 1A1RA 1RJXB 3PLBA 4BTTB 3SV6A 4Y7AA 3ZVAA 4UFDH 3ZZ3A 5FBEA 1QL8A 1GMHF 1UVOA 2C90B 5J4QA 1O3DA 1Z8GA 1BHXB 3GY8A 2VIWA 2XCFA 4FUDA 1PPEE 1UTMA 1QURH 5LPFA 2VIQA 2BY6X 4K5ZA 2F9PA 1WTHD 3QUMP 1O31A 1O3HA 4OGYA 1V2VT 2TIOA 3CENA 3RU4D 4A6LA 3BN9A 3G01A 2ZIQH 3L33A 3SV7A 4CRBA 4CHAB 2ZQ2A 4WMFA 4A7IB 4DG4A 4O03A 5JBAS 4DY7B 1HAYB 1NROH 1PJPA 2Q6GA 1QRZA 4I8LA 1W10U 4K8YA 1IQFA 3RMMH 4NG9H 4YLUA 4JZIA 3UY9A 3VGCB 4JZ1A 4B74A 4AYVB 2FYQA 1OKXA 5AFZH 1K1OA 1AI8H 1ACBE 2FOAA 2G8TA 4AYYB 4X8UH 3RXGA 2BY8X 2QXJA 2F9OA 1GI4A 5BPEA 2ANWA 1YLDA 4TPYA 5A8XA 3QGNB 2ZCKP 2YNAA 3NWUA 4WH8A 3LDXH 1V2MT 5A8YA 1SSXA 2AFQB 2QCYA 1BDAA 4NFEA 2GDDA 4NIWA 2H9TH 1OXGA 2H5DA 4U30A 1T4VH 3BTGE 2QY0B 6ESTA 1TNGA 3S9AA 1QL9A 2J92A 1ELAA 1DWBH 1E35B 1Q31A 3QWCH 1HAVA 1CA8B 1FIWA 1FLEE 1QBVH 1GHAG 1TRNA 3D65E 1Q3XA 2FESH 5JDUB 3QGJA 1YBWA 1O36A 4I7YH 4B2AA 4X1RU 1WV7H 3UPEA 4AFZA 2XTTB 2EA3A 1TMTH 1HJAB 1MQ5A 5DP6A 5IDKA 6LPRA 1CBWC 2ANKH 4NWLA 4AB8A 2FX4A 1C1PA 3TJNA 2BLVA 1HAVB 1GHYH 1A61H 5G4BA 3M61U 3SU3A 1KYNA 3ATLA 1INCA 2P3FH 2ZG0H 1TA6A 2GGVB 1GI8B 3VPKA 2EI6A 1FMGA 2BD9A 1RTFB 1A0JA 2O8UA 3ZVEA 5I25A 5FPYA 1F5LA 1AGJA 2AMPA 4X2WA 3LGVA 1RXPA 1Y3XA 1DX5M 1C5RA 1OS8