2XTTB

Bovine trypsin in complex with evolutionary enhanced schistocerca gregaria protease inhibitor 1 (sgpi-1-p02)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Catalytic Aspartate is Protonated in the Michaelis Complex Formed between Trypsin and an in Vitro Evolved Substrate-Like Inhibitor: A Refined Mechanism of Serine Protease Action.
pubmed rcsb
molecule tags Hydrolase
molecule keywords PROTEASE INHIBITOR SGPI-1
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xttB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xttB02
3SW2B 2C90B 2AEIH 4F49A 1TBQH 3MH5A 1QL7A 5DP4A 5C20A 1G3DA 2BZAA 1O3OA 4AFSA 6LPRA 2SGEE 1B7XB 1EP5A 3BTKE 4NA8A 2A2XH 2VWLA 2P3TB 2SNVA 1LPKB 1UCYK 3P70B 4YLQH 1MKWK 4Y71A 2Z9IA 1FY8E 5HM2A 1LTOA 2BVRH 2GZ8A 4OS6A 4ABEA 5LH8A 3TH3H 5DP7A 4XOJA 1IQKA 3ATMA 2RDLA 2FWWA 1UTLM 1ANBA 4ZKRU 5EQSA 3IG6B 3M7QA 4JZDH 1F92A 1LHFH 5JYIA 1J16A 3HGNA 1BJUA 3TK9A 2BLVA 1CA8B 1UTMA 3HPTB 2F9BH 1KDQB 1ZSKA 3NWUA 2ZCKP 4O3TA 4Y7AA 4INHA 1K9OE 3TNTA 3SJ8A 3FP7E 7GCHF 4AX9H 1PJPA 2P93A 1Y3UA 1TONA 5K0HA 1O2YA 1W13U 1YC0A 1P01A 3ZV9A 5EPNA 1MZAA 3BG8A 1PFXC 1FDPA 1PQ7A 4ZH8A 1EUFA 4FUCA 1KXCA 4K3JA 2FZZA 1JOUB 4K2YA 1Q3XA 2PFEA 2HLCA 4OS1A 3PLKA 4Y7BA 5ESBA 3M7TA 2QA9E 1GHAF 4NIVA 3VB7A 1GG6C 4JMYA 1IQFA 4ABGA 3PMAB 1C5NH 1DOJA 2LNCA 3RMNH 1E35B 2HALA 1GDQA 1GPZA 1K1LA 1LQDB 1ZMJA 1XVOA 4Z6AH 1UK3A 1HDTH 1O5FH 3BF6H 1EQ9A 2ODPA 2ZHDA 4RKJB 1T32A 1TA6A 1ZLRA 3TJVA 3SU5A 3SHCH 1LHEH 4KTCA 1YCPM 1ZPBA 4PROA 2F83A 3VB3A 4LOYH 1T4VH 1OSSA 4GHTA 4UONA 2FOBA 1FUJA 3U8OH 1UCYE 3PM3A 3SI3H 3PO1C 5AFYH 4YOJA 3KGPA 2XW9A 1XUKA 1GI7B 1MKWH 2BD4A 1TNJA 1C5UA 1GBJA 2GZ7A 2G4UA 1V2OT 4K1SA 2BY5X 4O03A 2AGIX 1CVWH 1YP9A 4CHAC 1A3EH 1AGJA 3LGVA 3KL6A 3BG4B 1WTGH 3ELAH 2ZU1A 4U30A 1YPKH 4NA7A 2A7JA 5A8XA 3PLPA 3QN7A 4Q7ZA 2R2WU 1RIWB 3DA9B 1O2NA 4NFFA 1KXFA 1HXEH 4LZ1H 1VGCB 1Y5UT 5EGMA 2BLOA 4H42U 1WQVH 1PPHE 1XUFA 5I25A 4WMEA 4X6MA 1TGNA 2JH0D 1IQHA 2BVXH 1NRSH 1W0ZU 3PMJA 2GD4B 2BY9X 4NFEA 4YT7H 3NPSA 1GI8B 1SLXB 2FYQA 3ZVAA 3FP6E 1S6FA 4QT8C 2BYAX 1ELBA 3W95A 1E0FD 1ELFA 1AIXH 3SU0A 1GVZA 1S0RA 2FXRA 1C2DA 2BX3A 4H4FA 3FVFB 2O9QA 1SLUB 2FX6A 3E90B 3ZVBA 4UFEH 1QBNA 1BMAA 3SUGA 1PPZA 3MU1A 4U32A 3PWCA 4DURA 1Z8GA 1PYTD 2EA3A 2G81E 2V0BA 2ZPQA 3F68H 2GT7A 2QN5T 2FTLE 3P92A 1DUEA 3GISB 4F4OC 1NESE 2OINA 2PSXA 6GCHG 1G2LA 1DX5M 1GBLA 1AWHB 5AF9H 2TBSA 2GDEH 1OYQA 1E37B 1O3CA 1HB0B 1HAZB 3PYHA 2IJOB 1DY8A 2XYAA 1HAHH 1EOLA 1Y3YA 4JZ1A 2A4RA 4MNVA 1CE5A 3MNXA 4B76A 3QO6A 4FXGH 2DUCA 4YOGA 3TK5A 1YYY1 1NPMA 3QTOH 3O8CA 3FFGA 3OY6U 2A32A 3ATWA 1KLTA 5TJXA 3RXIA 5JBBS 1J8AA 1E38B 4X2WA 1X7AC 3SUEA 1GWAA 2AS9A 1SBWA 1KDQA 4D7FA 5L2YH 5C1XA 2ULLA 1LVYA 1YPEH 1K1PA 2NU4E 1JIRA 1L0ZA 1C1OA 1QL9A 2FI3E 3TH4H 2BD2A 1QIXB 3UREA 3LONA 4OS7A 4X8VH 3OTJE 1C1UH 3S0NA 2R9PA 4XBCA 1FY1A 1JRTA 2J4IA 3D23A 1P2MA 1GI1A 1K21H 1ESAA 2ALVA 3RMOH 1DLEA 5K7RA 3A85A 1A0HB 3P6ZB 1BTUA 1HJAC 2Z3EA 3A7YA 1K22H 2FIRH 3E91A 1F0UA 4XDEA 1ZR0A 2Y80A 3NZIA 1O2XA 5EXMA 3CS7A 1GCTB 2A4GA 1Q31A 4Y0ZE 2BDBA 2ZNKH 3VGCC 4Y8YA 2XXLA 4INLA 1V6DA 1EB1H 3KEEA 1TALA 3RXRA 2BY6X 1P2QA 3QX5H 1ELVA 1GBMA 1YPMH 1TOMH 3GCHC 2Z3DA 4D76A 2JH5D 1J15A 2BY7X 3K65B 2J95A 3RU4D 1W7XH 1C1MA 3UR6A 2SGFE 1QBOA 1C5QA 3MH6A 1GI6A 2B8OH 2Z94A 1H8DH 1UVTH 1GCDA 2H9EH 3SV9A 1GHWH 1XXDA 4MQAA 3G01A 2IN2A 5DKMA 4BAHB 1QGFA 2K1QA 2CF9H 1SMFE 3P17H 2PUQH 3FZDA 2J92A 1C5WB 3GY2A 4NIWA 2OLGA 1C1NA 3MMGA 1O5DH 4DT7B 2BDGA 1OX1A 3ZZAA 2CXVA 2FS8A 2F9UA 3AVZA 1BMNH 3M3SA 1V2JT 1P9UA 1BITA 1ZHMA 5GCHG 3RXCA 4GVUA 2Q6DA 1MQ6A 2GMTB 1B5GH 3SV2H 2Y5HA 3A7TA 1TWXB 2RG3A 5JBAS 1NTPA 1EPTC 1EXFA 1GHYH 1NS3A 1NFYA 1ORFA 3ITIA 1O5GH 1BTWA 1SQOA 2XWAA 1FXYA 3ZZBA 3QDZB 1SFIA 1GI4A 2PKSC 2VWOA 1F5KU 4Y6DA 1LMWB 4IGDA 1C5LH 2PTCE 3RMLH 2HNTE 5T6DA 2WUCA 4CREA 1A5GH 1AQ7A 3R0FA 4MDSA 3GY6A 1TNKA 3P8NA 1O3BA 5HXFA 1AE8H 1BBRK 1Y5BT 2O8TA 1MMJN 3ZZ9A 2O8WA 1TOCB 2G5NA 1P10A 2FP7B 1C5MD 5LGOA 3S9BA 1HV7A 2OUAA 3QZQA 2ZGHA 1C1RA 1G9IE 2OC7A 3QUMP 2AGEX 1H8IH 1RFNA 3UQVA 3T29A 1HUTH 1FN8A 3T5FH 1HYLA 2CGAA 2STBE 2Y81A 3BEIB 3E3TA 2A7CA 3HK6B 3TGKE 1O0DH 3LGWA 1U6QA 4GHQA 1ANCA 4ZKNU 1QFKH 2WUBA 1YPJH 1LQEA 2BB4A 2WYJA 3ZZ6A 5A2MH 3ZVGA 4X6OA 3ZVEA 4FUJA 8GCHG 3UOUA 1C2KA 1PPEE 4B1TA 4GAWA 1DM4B 4GCHG 4FUBA 3UOPA 4AN7A 5FXLA 4IS5A 2GZ9A 1QJ6B 5AHGH 2EC9H 2WPJS 1JRSA 3F6UH 1B0EA 1MKXH 2BDIA 4YESB 2CF8H 1QA0A 4NSVA 1ZSJA 3AASA 1FONA 1O3IA 1NU9A 2FTMA 1OYTH 4NWLA 3P8FA 3K2UA 5TCCA 1HJAB 3MHWU 4FU7A 1GMCG 3QGNB 3TITA 1ZPZA 2C93B 8LPRA 1IQEA 2VINA 1NY22 2GGVB 4AFZA 1A1RA 4AORA 2D1JA 3LDXH 2ZFSA 2QAAA 5DP3A 3A83A 1E34B 2QC2A 1G3CA 1FPHH 1EAXA 1MZDA 2GDDA 4ABBA 1L1GA 4R8TB 2ZTXA 2BY8X 1P3EA 2CHAB 1UK2A 1TBRH 2ZEBA 3RMMH 2ZDNA 1C9PA 1GBKA 6CHAB 4MG3A 4NCYA 1ELTA 4ABFA 1Z6JH 4XBBA 4WMDA 3EGKH 1MQ5A 1F2SE 6ESTA 1SGTA 1GGDB 2QY0B 1GHBG 3A8CA 2PLXA 1GL0E 2AGGX 2XBWA 5FAHA 1BOQA 1VJAU 1WAYB 2XTTB 4B74A 3IWMA 4ASHA 2ZI2H 3STJA 1SOZA 1AN1E 3U8TH 1HGTH 4FUGA 1C5VA 3LGTA 3LKWA 1YCPK 1K1IA 1O2QA 1VR1H 1OWEA 2UWPA 1AVGH 4UFDH 3BSQA 3URDA 1O2OA 3MH7A 1SPJA 2Z9KA 4K8YA 1NO9H 1RS0A 1GI9B 4XBDA 2PHBA 2C8XB 3UNQA 4Y11E 3RXBA 3VXFH 5JB8S 1XX9A 3OX7U 1SGEE 1SGYE 3MNBA 1AD8H 1OWDA 3BTQE 3RXKA 4NGAH 1Y3VA 5C67A 1QB1A 1C9TA 2BVSH 4UD9H 1FY4A 3SGQE 2BDYA 1VCPA 2QXGA 3BEUA 1O2ZA 1ZZZA 5FPYA 1TPPA 5JBCS 4D9QA 2ZPRA 2B9LA 4OS4A 2ZA5A 3RUOA 2HNTC 1P2JA 3ATKA 3AW0A 4BANB 1XKBC 1HAIH 3GOVB 4ZHAA 1CHOG 2UUKB 3HATH 1YGCH 3A84A 1QRWA 1FPCH 3RXQA 1P12E 4JK6A 3O8RA 1AO5A 1TFXA 3V3MA 3SU6A 3JZ1B 4RKOB 1YLCA 2AH4X 3K9XB 1O5CB 1YPHE 1HCGA 3A82A 9ESTA 2AMDA 1SGQE 4Q2KA 2GCTB 1W12U 3DFLA 1GBDA 1OWJA 2BD8A 2Z9JA 3ATIA 1W10U 2QYIA 3F9FA 1P02A 1CGJE 3TJUA 1ABJH 1O2HA 2BLWA 3RM0H 1C4U2 4MLFB 2FI4E 1SQAA 4E06H 5EW1H 1BDAA 4BTTB 3KHVA 1CBWC 1O2SA 3UUZA 1O3HA 1GJ4H 1SR5C 3VB4A 1TRNA 1DWBH 4DGJA 3HKIB 2F9OA 2A5KA 2H2ZA 4X2XA 5JBTA 4ZKSU 4CR9A 1C5XB 1CHGA 1O2KA 3A87A 1SHYA 2BDHA 3ZZ7A 1XM1A 1ZMNA 1MU8B 4ZHMU 3TU7H 5DP5A 1ZOMA 1GDUA 2ALPA 1UMAH 1BIOA 7ESTE 1S82A 1BTYA 1GCTC 3ZZ4A 3MOCA 1UO6A 1QRXA 2SGDE 3ENSB 3FP8E 4DG4A 1TNGA 1K1JA 5TCAA 5ABWA 1HAGE 1NU7B 1PPCE 4X1RU 1RXPA 4KKDA 1BBRE 1C5PA 1C4V2 1EPTA 5E0HA 2D8WA 1H9HE 4Q80A 3MU8A 2PW8H 4Q7YA 5FBEA 5EW2H 3SBKA 1RJXB 3SN8A 1C2EA 2EI8A 4B71A 1KTSB 2OCVB 2WV4A 4A5TS 5HMAA 3F1SB 1EZQA 4KP0A 9LPRA 1QB6A 2VWMA 2CN0H 2EI6A 1BMLA 1ZMLA 4JYVH 1DVAH 4Y8XA 1NRPH 2FPZA 1HFDA 2AFQB 3M61U 2UWLA 1DT2A 3NXPA 1NN6A 3VEQB 4H6TA 1QA7A 3BIVH 3GY7A 2BX4A 2PR3A 3DUXH 6CHAC 4AZ2B 4I8JA 7GCHG 1GMDG 2C4FH 1ELDE 1O3JA 2ZIQH 2H5CA 1RD3B 1TE0A 2ZFRH 5EXLA 1TGBA 1AWFH 3ZZCA 2Q6FA 1NROH 1BRBE 5C1UA 2OBQA 4TYDA 2BQ7B 3PLBA 3U98H 2VH0A 4A1VA 3H7OA 1FMGA 5EG4A 4WH8A 1MCVA 4HFPB 3T25A 1TYNA 3MU5A 2QIQA 4A1XA 2G55A 4WH6A 3R3GB 3RXUA 1D3QB 2G5VA 3SV8A 1AFQB 2FM2A 1BUIA 1ELGA 5AFZH 2XWBI 1MUEB 3RXLA 4ABAA 4K69A 1K1MA 2OC0A 2ANKH 4DW2U 4OGXA 1NFXA 3BTFE 3JZ2B 4Y10E 1D9IA 3RC5A 4FUDA 4J2YB 3SUFA 1WV7H 4AG2A 2XC4A 1GHVH 1O2GH 1TPOA 4KTSA 3ZZ8A 1DXWA 3PMBB 2BHGA 1OWIA 1QB9A 1A2CH 2NU3E 1A0JA 1MU6B 2ZDKA 2H6MA 4WMFA 2W26A 3SNAA 5EXNA 4ISHH 1GJ7B 2F9NA 5FPSA 1HNEE 1D6RA 1TMTH 1O3DA 4B75A 1GBCA 2FYRA 1DICA 3CS0A 3M5OA 4YOIA 1A5HA 1LO6A 2AERH 2GVFA 3A88A 4RN6A 1XUIA 1GI5A 2M5TA 4UEHH 4WJG2 3TH2H 1UTKA 1A3BH 2H5DA 3A7VA 1VITF 5T3HA 1F7ZA 3GY8A 3LC5A 3UQOA 2WYGA 1T8NA 5C2ZA 1V2TT 5EU8A 4CH2B 1HJ9A 3EDXB 4CRGA 1D3TB 2G4TA 2TGDA 1YBWA 1C2MA 1WYKA 1ZTJA 2BD3A 3K6ZA 1LVBA 1PYTC 3LGYA 2PTNA 2ZTYA 2ZU3A 1OWKA 2BM2A 1KXEA 2AYWA 1V2UT 3E0NB 4Y76A 4XFQA 5EQQA 2TGTA 2ZF0H 4MNXA 2A2QH 1O2IA 2W5EA 3ZV8A 1VJ9U 1RTKA 1YPLH 5GJ4B 1V2VT 1SGFG 1MAYA 4NIXA 5J4QA 2WPHS 3S7HB 1TIOA 3UNSA 1NRRH 4J1YA 1WUNH 4WWYA 1HXFH 3AAUA 4DY7B 1NFUA 1IQLA 2XBXA 1SG8B 1XMNB 2ZFPH 4RSPA 5A09A 2Z9LA 1Z1JA 4X8UH 3L33A 5E2PA 2ZGBH 4IMQA 1O5BB 1RTLA 4YLUA 1HIAA 4E05H 2A4OA 2FO9A 4M7GA 4BNRA 2QXHA 1C1VH 2BD7A 3T26A 5EODA 1MTNC 1G37A 2HRVA 4YM9A 2BQ6B 1KTTB 1W2KH 1Z6EA 1VZQH 4DIHH 1UJ1A 3PO1B 1P2IA 2FOMB 5ETXA 1IQJA 1GHZA 5EOKA 3S69A 2BDCA 1Z8JB 1C5RA 1O3AA 1P0SH 2CHAC 3NCLA 1SGDE 2QV1A 1CSOE 2ZGCA 5E0GA 1O2RA 1EZSC 4CRDA 1O2LA 1QURH 5H4IB 5A0CA 3LGIA 4WXIA 2ZZUH 2Y5FA 1K1OA 1TNHA 1C5TA 5GXPA 3M3VA 2B7DH 2J94A 2FLRH 4YO9A 3TGIE 2ANMH 4Z0KA 1Q2WA 1AFEH 2BTCE 2XNIA 2CMYA 4WF8A 1E36B 1V2WT 1P05A 1C1QA 2HPQH 4X2YA 2VIPA 2O8MA 1D3DB 2BZ6H 1GBEA 5CHAC 1PQ5A 1TNLA 1WOFA 1H1BA 1LPGB 3GDVA 3HKJB 3RXVA 1J9CH 3D49H 3GYMA 2V3HH 1GI2A 3RC4A 1H9LB 4ABDA 2G8TA 1KY9A 2WPLS 1N6XA 1ZTLA 1O34A 4ISIH 2ZTZA 3UR9A 1TMUH 1F5RA 1G32B 4K1EA 1PQ8A 3SU3A 1DWCH 1DXPA 1V2QT 2OTVA 1P03A 1ELAA 2HPPH 3GCTF 4JYTA 3GCNA 3N7OA 1WU1A 2ZECA 1WCZA 3L3TA 2P3UB 3GICB 2IOTA 1P2OA 3LH1A 5HYOA 4GPGA 2W7SA 3SI4H 1DPOA 1EAUA 3WY8A 1CA0C 3SQHE 5JDUB 2WPMS 2J38A 4CRBA 3DHKH 4BAMB 1QQUA 1O39A 2GCTC 1LDTT 1O3PB 2XBYA 3SV7A 1K28D 4TY7A 3U69H 1WQSA 1P09A 3A8BA 4X1QU 3E8LA 1K2I1 1ANDA 3TGJE 1O33A 5B6OA 2VU8E 5F8TA 4GUXA 1TGTA 4X8TH 1MTWA 2ZFQH 5PTPA 1QRZA 1GJAB 3SNBA 3U8RH 2AIPA 3C1KA 1YF4A 2F9PA 2ZDMA 2SGAA 2Y7XA 1HAVA 1G2MA 4I8LA 1S0QA 1BRCE 2NWNA 5SGAE 1GG6B 1KIGH 1O2UA 4A92A 2F9VA 5HGGA 4HI3A 1TPSA 3SU4A 1QHRB 3IITA 2I6SA 1O32A 1TB6H 2SGQE 3S7KB 1TX8A 7LPRA 1T8OA 3EA7A 5BPEA 1IQNA 3TNSA 1IQIA 2R3YA 5DG6A 1DANH 3KNXA 3Q76A 2P8OC 3P8OA 4K8BA 3SJ9A 5A0BA 2H9HA 4BOHA 2UWOA 4X6PA 1UK4A 4AGJA 1S83A 2YNBA 3W94A 4ESTE 2HOBA 5AVDA 3GCTG 4OS5A 2ZU2A 4H6SB 4MVNA 1NRQH 5GIBA 3MFJA 4JCNA 2Q6GA 1SL3A 1UTNA 1H9IE 3TK6A 3BTME 2FOGA 1AMHA 3M35A 1YPGH 1DITH 3PTNA 2PKAA 1MTSA 2BXTH 1G3BA 2A1DB 1N6YA 3S9CA 1BT7A 2PGBB 1UVPA 2BDAA 1TAWA 3M7UA 2B5TB 1GMHF 1TQ0B 3RXJA 4JZEH 1ETSH 2VNTA 1P3CA 3NUMA 1TMBH 4DJZB 2VIQA 2NU2E 1P57B 2A0QB 1TX7A 3MO9A 3SGBE 4VGCB 1Y8TA 1AB9B 2H1UA 1C5YB 1F0TA 1XUHA 3MNCA 5L30H 1OP8A 5EQRA 2R0LA 3RLYH 2ZP0H 1VGCC 1PPBH 2O8UA 3HGPA 1NC6A 2UUYA 1MH0A 2VVVA 1RTFB 3RXHA 1HAYB 1UHBA 1ZSLA 1C2LA 1VITG 2A45B 3KQDA 2G51A 1C1SA 3LC3A 1PPFE 4X1SU 1ABIH 3UWIA 1ETTH 3TJOA 3SU1A 4CRCA 2CV3A 1A61H 1GBFA 1F0SA 3EA8A 3FZZA 3M5MA 1BTZA 3E16B 2ANYA 4FUIA 3M37A 1GVLA 1OPHB 2KAIA 4I33A 1GDNA 5HM9A 2OD3B 1ETRH 1EJAA 1FY5A 1EASA 2FDAA 2XCNA 3A8DA 1GI0A 5DJ7A 1LVOA 4DCDA 2GTBA 4IMZA 4LK4A 5J4SA 4UFGH 4BTIB 3T28A 4NG9H 5CHAB 3K6YA 2A5IA 1MBMA 4A7IB 3SO3A 1LKBA 4O97A 1TBZH 3CENA 1WSSH 2FOCA 2PKSB 1C1TA 1KYNA 3MU0A 4A6LA 1TGCA 4CRAA 4ABHA 3I78A 2ODQA 1KSNA 3M5LA 4BAKB 3DT0H 3D65E 7KMEH 5DP6A 3UIRA 1P2NA 2ZHEH 4A1TA 1EJNA 5I46H 1SGPE 1Z8RA 2DE8A 4ISLA 4KTUA 3V12A 1VITH 3RXAA 3I29A 1DWDH 4HZHA 4O3UA 1GVKB 4I31A 1CT0E 3A81A 5IDKA 1XVMA 4INKA 3KIDU 3U1IB 1GBAA 3VFEA 1AKSB 1EJMA 3KQCA 1IAUA 1ZYOA 1HAPH 1W7GH 1KXBA 3A89A 3CP7A 2Z6BD 2GT8A 1FI8A 1O2WA 1OXGA 2PV9B 1NFWA 4ZROA 1MKXK 1GBBA 3S9AA 1HPGA 2P3FH 3ZYEA 2GP9B 1AVXA 2RA3A 4UFFH 2RCEA 2FESH 4U01A 1FV9A 1O5AB 2VVCA 3I77A 4JZFH 4Y79A 1QY6A 2QCYA 2W3IA 2TGAA 3O8DA 1GJ6A 3RDZA 1GJBB 3BG4C 1F5LA 4Y8ZA 1DE7H 5A8ZA 4UE7H 1ELEE 4KGAA 4MPVA 1TX6A 1SLVB 1JIMA 1A46H 2VVUA 1EP6A 3OYPA 4CBOA 3M36A 1SQTA 3RP2A 4ABJA 2AMPA 1Z7KA 1L4DA 3UNRA 2QF0A 3LGUA 8GCHF 3LPRA 4I8HA 1QQ4A 2V3OH 1C2FA 4FU9A 2XRCA 2VIWA 1JBUH 1CT4E 1SGFA 2YNAA 1ID5H 2P8OB 2FOEA 1P8VC 2ZFTA 1F0RA 1XUJA 3LIWA 1DLKB 4FUEA 1D6WA 1V2MT 1FN6A 3BV9B 4IW4E 1V3XA 3RLWH 6GCHF 4NIYA 2HGTH 2GMTC 3RU4T 3T62A 3B23B 2G52A 5F03A 2TRMA 3F9EA 2BXUH 3DFJA 2PUXB 3SOSA 3H7TA 3MU4A 4BAOB 4I8GA 4HGCA 3SJIA 1T8LA 1FZZA 4WVPE 1T7CA 1ZGVA 1P11E 3AAVA 2J34A 2ZCHP 1GHBF 1HJ8A 3EA9A 2VGCC 4R0IA 2XCFA 3LJOA 4D7GA 1GJ8B 1TQ7B 2ZFFH 5FBIA 2BOKA 3A7WA 2OXSA 1D3PB 2D26C 3E6PH 3TPIZ 1LPZB 1INCA 1NRNH 4WXVA 1C2HA 1DWEH 5DPAA 3KF2A 1O35A 3MWIU 4YZUA 1XKAC 3SORA 1FAKH 1P9SA 1AHTH 1SB1H 1TPAE 4VGCC 3V13A 3ZYDA 1AB9C 1ZPCA 1HRTH 1UVSH 1GGDC 1G36A 2WPIS 1V2NT 2JKHA 1V2ST 2Y7ZA 3M5NA 2THFB 1EOJA 3PWBA 1G30B 1P06A 1TGSZ 3QLPH 2ZGJA 2XC0A 3Q00A 3MYWA 3P95A 3V7TA 1ARCA 2Z9GA 2V6NA 3A7XA 3QZRA 2TPIZ 1QCPA 2I6QA 2AIQA 2ZCLP 1QL8A 2ZKSA 1GBTA 1HBTH 1BHXF 1O5EH 1FIWA 2Q1JA 1LHCH 2UUJB 2A4QA 2DE9A 3LH3A 2OQ5A 1ZRBA 2Y5GA 4MNYA 3UY9A 3TLOA 1ESTA 3ZVFA 1YPHC 3MI4A 1V2KT 3MH4A 4OGYA 4CBNA 1UTQA 1TRMA 1BHXB 4IC6A 1QJ7B 1L4ZA 3SU2A 1BTXA 1Z71A 1QR3E 5GDSH 1A7SA 3T27A 1CO7E 3D62A 1T4UH 4MPUA 4AB8A 2ZDVH 1QNJA 3SJKA 2W7UA 4ISOA 4BXSA 1SLWB 2GV7A 2A7HA 1S84A 4AYVB 4ZHLU 1Y59T 1FAXA 1CGHA 1CA0B 1J17T 5A8YA 5T6GA 4X1PU 3EE0B 2D2DA 3BTGE 2ZHWH 2SNWA 4XE4A 4TWWA 3GCHB 1EB2A 2JETC 1GHXH 5FCKA 4B2CA 2VIVA 1BMMH 1OWHA 1M9UA 4JYUH 1IQMA 1GHAG 3GYLB 2ZC9H 1N8OC 1HAVB 1MAXA 1W14U 1W8BH 4Y0YE 2SGPE 8KME2 3SUDA 1O37A 4WY3A 4ZKOU 3PMHB 2PKAB 4FUFA 1O2PA 1ZHPA 1O3EA 2BD9A 2ZQ2A 1BRUP 1CBWB 3SV6A 1XUGA 1UTJA 2HVXA 4ZXYH 2Z7FE 4X0WU 1O2TA 2ZGXH 3EAJA 1IHTH 5F8XA 2ZU4A 5G4BA 3UTUH 1EATA 3FAOA 5LPRA 4AYYB 4ZMAH 4K5ZA 3OSYA 1XXFA 3MTYA 3RXEA 3MO6A 3MO3A 2F91A 2NU1E 3ZZ3A 2J9NA 2AMQA 1GJCB 5FHTA 5FX5A 1DY9A 1GBHA 1EAWA 1PPGE 2OC8A 1BA8B 1MD8A 3QWCH 4Q7XA 1UTOA 5DP8A 1O30A 3EYDA 2EEKA 2GV6A 1ZHRA 2JH6D 3A7ZA 2KAIB 3SJOA 1AVWA 1L2EA 1AKSA 4JK5A 1GL1A 1GJ9B 3ZZ5A 2OBOA 2UUFB 2ZDLA 3OU0A 3RXOA 1TABE 2ZDAH 4ZXXH 1C1WH 1UTPA 1CGIE 1JWTA 2YOLA 5C1YA 2V35A 4K1TA 5IYTA 4FVBA 1O2VA 1LKAA 2VGCB 2FOAA 2FX4A 3C27B 2ESTE 1EKBB 3RC6A 1JMOH 4MTBA 3VXEH 1FJSA 3BTTE 3RXDA 3BTHE 3Q3XA 3GY4A 4B73A 2HWLB 2ZPSA 1Z1IA 2WPKS 4AFQA 1VCWA 4IN1A 1PQAA 4O9VA 5A0AE 5F8ZA 1GJDB 2OC1A 1OP0A 1MBQA 1YM0A 1V2PT 2IPHA 4BXWA 4BAQB 3QTVH 1BBRH 4YTAA 3GCOA 2ZHQH 4MNWA 2QXIA 3A8AA 4FVDA 1O2MA 2TGPZ 4CH8B 5GPIB 2GCHG 1O3MA 5ESTE 1O31A 3F9HA 4ABIA 1BTHH 4IC5A 1O3KA 1O3LA 1B0FA 2ZQ1A 1MTVA 2W3KA 2GX4A 3MNSA 1GI3A 1GMHG 2CJIA 4ZAEA 1AUJA 1RGQA 3Q77A 3SNDA 1C2GA 2O8LA 1UHBB 1GMDF 1IQGA 3ZVDA 4KELA 2ZWLH 3B9FH 3BEFB 4ISNA 8ESTE 1LHGH 1CHOF 4TWYA 1QJ1B 4DIIH 2EI7A 4BTUB 2PSYA 4I32A 5FX6A 1P2KA 4HTCH 4D9RA 1ACBE 4IN2A 1BQYA 3RXFA 3BN9A 3QK1A 4MPXA 2GKVE 1D4PB 3GY5A 4AGKA 2WINI 3B8JA 4DOQA 4DVAU 5C5NA 1SGNE 5GCHF 2OQUA 5E8EH 5EPYA 5FPTA 4X2VA 1ESBA 2B0FA 2BMGB 5FCRA 3PTBA 2FS9A 1L1NA 3PROA 4UDWH 5L6NH 3LU9B 2PWXA 3O8BA 1EZUC 1HAXB 1CU1A 1KLJH 4X1NU 1KXAA 1A5IA 2TIOA 2JETB 4GSOA 4SGBE 3RXGA 4B2BA 4CR5A 3V0XA 1HLTH 1AE5A 1S85A 3ODDA 5E0JA 4TPIZ 1H4WA 3RXSA 1P04A 3PV4A 1MTUA 1SFQB 3A80A 3SZNA 4GLYA 3STIA 4CHAB 1SI5H 1AI8H 1VCQA 3TJNA 1C2JA 1S81A 2ZG0H 2ZO3H 3LOXA 3SHAH 4LZ4B 2G00A 3BIUH 1W11U 1RIWC 2C8YB 5DO4H 3FANA 1BRAA 5DK1A 3P8GA 3HK3B 1S5SA 5C3NA 3KQBA 1OP2A 2QF3A 4JZIA 4AOQA 3LT3A 1EX3A 1AY6H 1TA2A 1DFPA 1A0LA 1O3FA 2FODA 5BRRE 2C8WB 1G3EA 1Y3WA 2BQWB 1UVOA 1FNIA 1AUTC 3T2NA 4K60A 4B2AA 3RM2H 3EQ0H 1HIAB 3DD2H 2FOHA 3QGJA 3NKKA 1IHSH 1AU8A 4CRFA 4XSKU 1N1LA 1TNIA 3ZZDA 1FQ3A 1MTNB 4FU8A 4NWKA 3KQEA 1YKTA 3VPKA 4X8SH 1SGCA 3SGAE 1C5SA 3RXPA 2GCHF 4LXBH 3GDSA 4OS2A 2FOFA 3U1JB 1EAIA 1YLDA 5E2OA 5L2ZH 1QTFA 5JPMH 2FI5E 5GWZA 4NSYA 3RU4E 4AB9A 1AZ8A 3URCA 1GMCF 1SOTA 1T31A 2OP9A 3SNCA 1DSUA 3RXMA 5DGJA 2QXJA 1NM6A 2VIOA 2XBVA 3ESTA 5CMXH 2H9TH 2F3CE 2Y82A 3ODFA 3AW1A 1ZGIA 2ZU5A 3TVJB 1ZTKA 4I7YH 4IBLH 1THRH 1BTPA 4GCHF 2WV5A 2R0KA 2BLQA 1FY3A 1C1PA 1T8MA 1S6HA 3VB6A 2P16A 1W0YH 5LPEA 1EZXC 1CQQA 4D8NA 1MCTA 2ASUB 2LPRA 3KCGH 2VJ1A 2VIDA 1WBGB 3RXTA 4NZQA 1DUAA 4THNH 3H5CB 1GJ5H 1O2JA 1GBIA 1THSH 1V2LT 1THPB 3E0PB 5F6MA 1OOKB 2ILNA 3UFAA 2A31A 2FEQH 3M3TA 1ELCA 2C3SA 1A4WH 1K1NA 1C5ZB 2SFAA 1SGRE 2P59A 2C8ZB 4ZUHA 1SGIB 1ANEA 3UWJH 3BTWE 2FMJA 1KLIH 2XC5A 2Y6TA 4AG1A 3A86A 2NU0E 2HNTF 2ZHFH 5JB9S 1KXDA 3GDUA 3GY3A 2BD5A 1RRKA 1LCYA 2QGRA 1O3NA 1C4Y2 4E7NA 4YT6H 1LVMA 4NA9H 1OKXA 3VGCB 1QBVH 3ZVCA 3UPEA 1UVUH 4I8KA 2P94A 3F9GA 1V2RT 4FUHA 2VWNA 1IOEA 3E1XB 3U9AH 1O3GA 1C2IA 2FLBH 1NT1A 3NK8A 2R3UA 3VB5A 5C5OA 1ZJKA 3BTDE 5LPFA 1J14A 2VB0A 3Q3KA 1SSXA 1LHDH 1L1JA 2STAE 1N8OB 1CT2E 1W3CA 2BOHB 1BB0B 1BZXE 1FLEE 1UCYH 2VH6A 2A5AA 1OS8A 2ODYB 1HAOH 1BJVA 1BCUH 1DSTA 4TY6A 4MPWA 5T6FA 1SVPA 3PB1E 2ANWA 1SC8U 1O38A 3BTEE 1FIZA 4TPYA 3TIUA 1Y5AT 2RA0A 5DP9A 3LJJA 2J2UA 1JXPA 1C5OH 1SHHB 4NZLA 1DDJA 1NZQH 4X6NA 1O36A 4U2WA 1TRYA 1ZRKA 2P95A 3KN2A 3SNEA 1Z8IB 1Y3XA 3OY5U 1YCPH 1ZJDA 3SQEE 3Q3YA 4AFUA 1AFQC 2Z3CA 1DS2E 1ARBA 1AZZA 1EPTB 1MD7A 3L6PA 1WTHD 3ATLA 4E7RG 2PGQB 2R2MB 1TLDA 4SGAE 5CE1A
chains in the Genus database with same CATH superfamily
3SW2B 2C90B 2AEIH 4F49A 1TBQH 3MH5A 1QL7A 5DP4A 5C20A 1G3DA 2BZAA 1O3OA 4RT0A 4AFSA 6LPRA 2SGEE 1B7XB 1EP5A 3BTKE 4NA8A 2A2XH 2VWLA 2P3TB 2SNVA 3PRDA 1LPKB 1UCYK 3P70B 4YLQH 1MKWK 4Y71A 2Z9IA 1FY8E 5HM2A 1LTOA 2BVRH 2GZ8A 4OS6A 4ABEA 5LH8A 3TH3H 5DP7A 4XOJA 1IQKA 3ATMA 2RDLA 2FWWA 1UTLM 1ANBA 4ZKRU 5EQSA 3IG6B 3M7QA 4JZDH 4ACBA 1F92A 1LHFH 5JYIA 1J16A 3HGNA 1BJUA 3TK9A 2BLVA 1CA8B 1UTMA 3HPTB 2F9BH 1KDQB 1ZSKA 3NWUA 2ZCKP 4O3TA 4Y7AA 4INHA 1K9OE 3TNTA 3SJ8A 3FP7E 7GCHF 4AX9H 1PJPA 2P93A 1Y3UA 1TONA 5K0HA 1O2YA 1W13U 1YC0A 1P01A 3ZV9A 5EPNA 1MZAA 3BG8A 1PFXC 1FDPA 1PQ7A 4ZH8A 1EUFA 4FUCA 1KXCA 4K3JA 2FZZA 1JOUB 4K2YA 1Q3XA 2PFEA 2HLCA 4OS1A 3PLKA 4Y7BA 5GNDA 5ESBA 3M7TA 2QA9E 1GHAF 4NIVA 3VB7A 1GG6C 4JMYA 1IQFA 4ABGA 3PMAB 1C5NH 1DOJA 2LNCA 3RMNH 1E35B 1QZ8A 2HALA 1GDQA 1GPZA 1K1LA 1LQDB 1ZMJA 1XVOA 4Z6AH 1UK3A 1HDTH 1O5FH 3BF6H 1EQ9A 2ODPA 2ZHDA 4RKJB 1T32A 1TA6A 1ZLRA 3TJVA 3SU5A 3SHCH 1LHEH 4KTCA 1YCPM 3WW7A 1ZPBA 4PROA 2F83A 3VB3A 4LOYH 1T4VH 1OSSA 4GHTA 1NBME 4UONA 2FOBA 1FUJA 3U8OH 1UCYE 3PM3A 3SI3H 3PO1C 5AFYH 4YOJA 3KGPA 2XW9A 4ZCNA 1XUKA 2RFKC 1GI7B 1MKWH 2BD4A 1TNJA 1C5UA 1GBJA 2GZ7A 2G4UA 1V2OT 4K1SA 2BY5X 4O03A 2AGIX 1CVWH 1YP9A 4CHAC 1A3EH 1AGJA 5HIZA 3LGVA 3KL6A 3BG4B 1WTGH 3ELAH 2ZU1A 4U30A 1YPKH 4NA7A 2A7JA 5A8XA 3PLPA 3DSOA 3QN7A 4Q7ZA 2R2WU 1RIWB 3DA9B 1O2NA 4NFFA 1KXFA 2W6ID 1HXEH 4LZ1H 1VGCB 1Y5UT 1FX0B 5EGMA 2BLOA 4H42U 1WQVH 1PPHE 1XUFA 5I25A 4WMEA 4X6MA 1TGNA 2JH0D 1IQHA 2BVXH 1NRSH 1W0ZU 3PMJA 2GD4B 2BY9X 4NFEA 4YT7H 2KZ4A 3NPSA 1GI8B 1SLXB 2FYQA 3ZVAA 3FP6E 1S6FA 4QT8C 2BYAX 1ELBA 3W95A 1E0FD 1ELFA 1AIXH 3SU0A 1GVZA 1S0RA 2FXRA 1C2DA 2BX3A 4H4FA 3FVFB 2O9QA 1SLUB 2FX6A 3E90B 3ZVBA 4UFEH 1QBNA 1BMAA 3SUGA 1PPZA 3MU1A 4U32A 3PWCA 4DURA 1Z8GA 1PYTD 2EA3A 2G81E 2V0BA 2ZPQA 3F68H 2GT7A 2QN5T 2FTLE 3P92A 1DUEA 3GISB 4F4OC 1NESE 3OEHD 2OINA 2PSXA 6GCHG 1G2LA 1E1RD 1DX5M 1GBLA 1AWHB 5AF9H 2TBSA 2GDEH 1OYQA 1E37B 1O3CA 1HB0B 1HAZB 3PYHA 2IJOB 1DY8A 2XYAA 1HAHH 1EOLA 1Y3YA 4JZ1A 2A4RA 4MNVA 1CE5A 3MNXA 4B76A 3QO6A 3F2GA 4FXGH 2DUCA 4YOGA 3TK5A 1YYY1 1NPMA 3QTOH 3O8CA 3FFGA 3OY6U 2A32A 3ATWA 1KLTA 5TJXA 3RXIA 5JBBS 1J8AA 1E38B 4X2WA 1X7AC 3SUEA 3OE7D 1GWAA 2AS9A 1SBWA 1KDQA 4D7FA 3OFND 5FL7D 5C1XA 2ULLA 5L2YH 2YMSD 1LVYA 1YPEH 1K1PA 2NU4E 1JIRA 1L0ZA 1C1OA 1QL9A 2FI3E 3TH4H 2BD2A 1QIXB 3UREA 3LONA 4OS7A 4X8VH 3OTJE 1C1UH 3S0NA 2R9PA 4XBCA 1FY1A 1JRTA 2J4IA 3F3BA 5DN6D 3D23A 1P2MA 1GI1A 1K21H 1ESAA 5C17A 2ALVA 3RMOH 1DLEA 5K7RA 3A85A 1A0HB 4AC9A 3P6ZB 1BTUA 1HJAC 2Z3EA 3A7YA 1K22H 2FIRH 3E91A 1F0UA 4XDEA 1ZR0A 2Y80A 3NZIA 1O2XA 5EXMA 3CS7A 1GCTB 2A4GA 1Q31A 4Y0ZE 2BDBA 2ZNKH 3VGCC 4Y8YA 2XXLA 4INLA 1V6DA 1EB1H 3KEEA 1TALA 3RXRA 2BY6X 1P2QA 3QX5H 1ELVA 1GBMA 1YPMH 1TOMH 3GCHC 2Z3DA 4D76A 2JH5D 1J15A 2BY7X 3K65B 2J95A 3RU4D 1W7XH 1C1MA 3UR6A 2SGFE 1QBOA 1C5QA 3MH6A 1GI6A 2B8OH 2Z94A 2YMSC 1H8DH 1UVTH 1GCDA 2H9EH 3SV9A 1GHWH 1XXDA 4MQAA 3G01A 2IN2A 5DKMA 4BAHB 1QGFA 2K1QA 2CF9H 1SMFE 3P17H 2PUQH 3FZDA 3F0OA 2J92A 1C5WB 3GY2A 4NIWA 2OLGA 1C1NA 3MMGA 1O5DH 4DT7B 2BDGA 1OX1A 3ZZAA 2CXVA 2FS8A 2F9UA 3AVZA 1BMNH 5IK2D 3M3SA 1V2JT 1P9UA 1BITA 2EQNA 1ZHMA 5GCHG 3RXCA 4GVUA 2Q6DA 2VBCA 3FN8A 1MQ6A 2GMTB 1B5GH 3SV2H 2Y5HA 3A7TA 1TWXB 2RG3A 5JBAS 1NTPA 1EPTC 1EXFA 1GHYH 1NS3A 1NFYA 1ORFA 4I86A 3ITIA 1O5GH 1BTWA 1SQOA 2XWAA 1FXYA 3ZZBA 3QDZB 1NBMD 1SFIA 1GI4A 2PKSC 2VWOA 1F5KU 4Y6DA 1LMWB 4IGDA 1C5LH 2PTCE 3RMLH 2HNTE 5T6DA 2WUCA 4CREA 1A5GH 1AQ7A 3R0FA 4MDSA 3GY6A 1TNKA 3P8NA 1O3BA 2LELA 5HXFA 2KR7A 1AE8H 1BBRK 1Y5BT 2O8TA 1MMJN 3ZZ9A 2O8WA 2KCPA 1TOCB 2G5NA 1P10A 2FP7B 1C5MD 5LGOA 3S9BA 1HV7A 2OUAA 3QZQA 2ZGHA 1C1RA 1G9IE 2OC7A 3QUMP 2AGEX 1H8IH 1RFNA 3UQVA 3T29A 1HUTH 1FN8A 3T5FH 1HYLA 2CGAA 2STBE 2Y81A 3BEIB 3E3TA 2A7CA 3HK6B 3TGKE 1O0DH 3LGWA 1U6QA 4GHQA 1ANCA 4ZKNU 1QFKH 2WUBA 1YPJH 2V7QD 1LQEA 2BB4A 2WYJA 3ZZ6A 5A2MH 3ZVGA 4X6OA 3ZVEA 4FUJA 8GCHG 3UOUA 1C2KA 1PPEE 4B1TA 4GAWA 1DM4B 4GCHG 4FUBA 3UOPA 2W6JD 4AN7A 5FXLA 4RI0A 4IS5A 2GZ9A 1QJ6B 5AHGH 2EC9H 2WPJS 1JRSA 3F6UH 1B0EA 1MKXH 2BDIA 4YESB 2CF8H 1QA0A 4NSVA 1ZSJA 5C0UA 3AASA 1FONA 1O3IA 1NU9A 2FTMA 1OYTH 2WZQA 4NWLA 3P8FA 3K2UA 5TCCA 1HJAB 3MHWU 4FU7A 2AHME 1GMCG 3QGNB 3TITA 1ZPZA 2C93B 8LPRA 1IQEA 2VINA 1NY22 2GGVB 4AFZA 1A1RA 4AORA 2D1JA 3LDXH 2ZFSA 2QAAA 5DP3A 3A83A 1E34B 2QC2A 1G3CA 1FPHH 1EAXA 1MZDA 2GDDA 4ABBA 1L1GA 4R8TB 2ZTXA 2BY8X 1P3EA 2CHAB 1UK2A 1TBRH 2ZEBA 3RMMH 2ZDNA 5CDFE 1C9PA 1GBKA 6CHAB 4MG3A 4NCYA 1ELTA 4ABFA 1Z6JH 4XBBA 4WMDA 3EGKH 1MQ5A 1F2SE 2M2AA 6ESTA 1SGTA 5C94A 1GGDB 2QY0B 1GHBG 3A8CA 2PLXA 1GL0E 2AGGX 2XBWA 5FAHA 1BOQA 1VJAU 1WAYB 2XTTB 4B74A 3IWMA 4ASHA 2ZI2H 3STJA 1SOZA 1AN1E 3U8TH 1HGTH 4FUGA 1C5VA 3LGTA 3LKWA 1YCPK 1K1IA 1O2QA 1VR1H 1OWEA 2UWPA 1AVGH 4UFDH 3BSQA 3URDA 1O2OA 3MH7A 5C0TA 1SPJA 2Z9KA 4K8YA 1NO9H 1RS0A 1GI9B 4XBDA 2PHBA 2C8XB 3UNQA 4Y11E 3RXBA 3F2FA 3VXFH 5JB8S 1XX9A 3OX7U 5F53A 1SGEE 3SYJA 1SGYE 3MNBA 1AD8H 1MABB 1OWDA 3BTQE 3RXKA 4NGAH 1Y3VA 5C67A 1QB1A 5EIYA 1C9TA 2BVSH 4UD9H 1FY4A 3SGQE 2BDYA 1VCPA 2QXGA 3BEUA 1O2ZA 1ZZZA 5FPYA 1TPPA 5JBCS 4D9QA 4YXWD 2ZPRA 2B9LA 4OS4A 2ZA5A 3RUOA 2HNTC 1P2JA 3ATKA 3AW0A 4BANB 1XKBC 1HAIH 3GOVB 4ZHAA 1CHOG 2UUKB 3HATH 1YGCH 3A84A 1QRWA 1FPCH 3RXQA 1P12E 4JK6A 3O8RA 1AO5A 1TFXA 3V3MA 3SU6A 3JZ1B 4RKOB 1YLCA 5HIYA 2AH4X 3K9XB 1O5CB 1YPHE 1HCGA 3A82A 9ESTA 2AMDA 1SGQE 4Q2KA 2GCTB 1W12U 3DFLA 4M9FA 1GBDA 1OWJA 2BD8A 2Z9JA 4TSFD 2OK5A 3ATIA 1W10U 5KGOA 2QYIA 3F9FA 1P02A 1CGJE 3TJUA 1ABJH 1O2HA 2BLWA 3RM0H 1C4U2 4MLFB 2FI4E 1SQAA 4E06H 5EW1H 1BDAA 4BTTB 1K0HA 3KHVA 3DCLA 1CBWC 1O2SA 3UUZA 1O3HA 1GJ4H 1SR5C 3VB4A 1TRNA 1DWBH 4DGJA 2F43B 3HKIB 2F9OA 2A5KA 2H2ZA 4X2XA 5JBTA 4ZKSU 4CR9A 1C5XB 1CHGA 1O2KA 3A87A 1SHYA 2CK3D 2BDHA 3ZZ7A 1XM1A 1ZMNA 1MU8B 4ZHMU 3TU7H 5DP5A 2WV9A 1ZOMA 1GDUA 1E1QD 2ALPA 1UMAH 2HLDD 1BIOA 7ESTE 1S82A 1BTYA 1GCTC 2L74A 3MOCA 1UO6A 3ZZ4A 1QRXA 2SGDE 3ENSB 3FP8E 4DG4A 1TNGA 1K1JA 5TCAA 5ABWA 1HAGE 1NU7B 1PPCE 4X1RU 1RXPA 4KKDA 1BBRE 1C5PA 1C4V2 1EPTA 5E0HA 2D8WA 1WDIA 1H9HE 4Q80A 3MU8A 2PW8H 4Q7YA 5FBEA 5KECA 5EW2H 3SBKA 1RJXB 3SN8A 1C2EA 2EI8A 4B71A 1KTSB 2OCVB 2KM0A 2WV4A 4A5TS 5HMAA 3F1SB 1EZQA 4KP0A 9LPRA 1QB6A 2VWMA 1WXRA 2CN0H 2EI6A 1BMLA 1ZMLA 4JYVH 1DVAH 1E79D 3SZEA 4Y8XA 1NRPH 2FPZA 1HFDA 2AFQB 3M61U 1YLNA 2UWLA 1DT2A 3NXPA 5T1VA 1NN6A 3VEQB 4H6TA 1QA7A 3BIVH 3GY7A 2BX4A 2PR3A 3DUXH 6CHAC 4AZ2B 4I8JA 7GCHG 1GMDG 2C4FH 1ELDE 1O3JA 4XD7D 2ZIQH 2H5CA 1RD3B 1TE0A 2ZFRH 5EXLA 1TGBA 1AWFH 3ZZCA 2Q6FA 3GS9A 1NROH 1BRBE 5C1UA 2OBQA 4TYDA 2BQ7B 3MQKC 3PLBA 3U98H 2VH0A 4A1VA 3H7OA 1FMGA 5EG4A 4WH8A 1MCVA 4HFPB 3T25A 1TYNA 3MU5A 2QIQA 4A1XA 2G55A 2WSSD 4WH6A 3VG8A 3R3GB 3RXUA 1D3QB 2G5VA 3SV8A 1AFQB 2FM2A 3F2HA 1BUIA 1ELGA 5AFZH 2XWBI 1MUEB 3RXLA 4ABAA 4K69A 1K1MA 2OC0A 3OEED 2ANKH 4DW2U 4OGXA 1NFXA 3BTFE 3JZ2B 4Y10E 1D9IA 3RC5A 4FUDA 4J2YB 3SUFA 1WV7H 4AG2A 2XC4A 1GHVH 1O2GH 1TPOA 4KTSA 3ZZ8A 1DXWA 3PMBB 2BHGA 3DSPA 1OWIA 1QB9A 1A2CH 2NU3E 1A0JA 1MU6B 2ZDKA 1YY3A 2H6MA 4WMFA 2W26A 3SNAA 5EXNA 4ISHH 1GJ7B 2F9NA 5FPSA 1HNEE 1D6RA 1TMTH 1O3DA 4B75A 1GBCA 2FYRA 1DICA 3CS0A 3M5OA 4YOIA 1A5HA 1LO6A 2AERH 2GVFA 3A88A 4RN6A 1XUIA 1GI5A 2M5TA 4UEHH 4WJG2 3TH2H 1UTKA 1A3BH 2H5DA 3A7VA 1VITF 5T3HA 1F7ZA 3GY8A 3LC5A 3UQOA 2WYGA 1T8NA 5C2ZA 1V2TT 2QE7D 5EU8A 4CH2B 1HJ9A 3EDXB 1OHHD 4CRGA 1D3TB 2G4TA 2TGDA 1YBWA 4TT3D 1C2MA 1WYKA 1ZTJA 2BD3A 3K6ZA 1LVBA 1PYTC 2J98B 3LGYA 2KX4A 2PTNA 2ZTYA 2ZU3A 1OWKA 2BM2A 1KXEA 2AYWA 1V2UT 3E0NB 4Y76A 4XFQA 5EQQA 2TGTA 2ZF0H 4MNXA 2A2QH 1O2IA 2W5EA 3ZV8A 1S6LA 1VJ9U 1RTKA 1YPLH 4XRNA 5GJ4B 1V2VT 1SGFG 1MAYA 4NIXA 5J4QA 2WPHS 3S7HB 1TIOA 3UNSA 1NRRH 4J1YA 1WUNH 4WWYA 1HXFH 3AAUA 4DY7B 1NFUA 1IQLA 1SG8B 1XMNB 2XBXA 2ZFPH 4RSPA 5A09A 2Z9LA 1Z1JA 4X8UH 3L33A 5E2PA 2ZGBH 4IMQA 1O5BB 1RTLA 4YLUA 1HIAA 4E05H 2A4OA 2FO9A 4M7GA 4BNRA 3WWBA 2QXHA 1BMFD 1C1VH 2BD7A 3T26A 5EODA 1MTNC 1G37A 2HRVA 4YM9A 2BQ6B 1KTTB 1W2KH 1Z6EA 1VZQH 4DIHH 1UJ1A 3PO1B 1P2IA 2FOMB 5ETXA 1IQJA 1GHZA 5EOKA 3S69A 2BDCA 1Z8JB 1C5RA 1O3AA 3FO8D 1P0SH 2CHAC 3NCLA 1SGDE 2QV1A 1CSOE 2ZGCA 5EJLA 5E0GA 1O2RA 1EZSC 4CRDA 1O2LA 1QURH 5H4IB 5A0CA 3LGIA 4WXIA 2ZZUH 2Y5FA 1K1OA 1W0KD 1TNHA 1C5TA 3M3VA 5GXPA 2B7DH 4FETA 2J94A 2FLRH 4YO9A 3TGIE 2ANMH 4Z0KA 1Q2WA 1AFEH 2BTCE 2XNIA 2CMYA 4WF8A 1E36B 1V2WT 1P05A 1C1QA 2HPQH 4P00A 4X2YA 2VIPA 2O8MA 1D3DB 2BZ6H 1GBEA 1SKYE 5CHAC 1PQ5A 1TNLA 1WOFA 2J5UA 2RDEA 1H1BA 1COWD 1LPGB 3GDVA 3HKJB 3RXVA 1J9CH 3D49H 3GYMA 2V3HH 1GI2A 3RC4A 1H9LB 3KYGA 4ABDA 2G8TA 1KY9A 2WPLS 1N6XA 1ZTLA 1O34A 4ISIH 2ZTZA 3UR9A 1TMUH 1F5RA 1G32B 4K1EA 1PQ8A 3SU3A 1DWCH 1DXPA 1V2QT 2OTVA 1P03A 1ELAA 2HPPH 3GCTF 4JYTA 3GCNA 3N7OA 3KYFA 5CHBA 1WU1A 2ZECA 1WCZA 3L3TA 2P3UB 3GICB 2GJGA 2IOTA 1P2OA 3LH1A 5HYOA 4GPGA 2W7SA 3SI4H 1DPOA 1EAUA 3WY8A 1CA0C 3SQHE 5JDUB 2WPMS 2J38A 4CRBA 3DHKH 4BAMB 1QQUA 1O39A 2GCTC 1LDTT 1O3PB 2XBYA 3SV7A 1K28D 4TY7A 3U69H 1WQSA 1P09A 3A8BA 4X1QU 3E8LA 1K2I1 1ANDA 3TGJE 1O33A 5B6OA 2VU8E 5F8TA 4GUXA 1TGTA 4X8TH 1MTWA 2ZFQH 5PTPA 1QRZA 1GJAB 3SNBA 3U8RH 2AIPA 3C1KA 1YF4A 2F9PA 2ZDMA 2SGAA 2Y7XA 1HAVA 1G2MA 4I8LA 1S0QA 1BRCE 2NWNA 5SGAE 1GG6B 1KIGH 1O2UA 4A92A 2F9VA 5HGGA 4HI3A 1TPSA 3SU4A 1QHRB 4Z1MD 3IITA 2I6SA 1O32A 1TB6H 2SGQE 3UAIC 3S7KB 1TX8A 7LPRA 1T8OA 3EA7A 5BPEA 1IQNA 3TNSA 1IQIA 2R3YA 5DG6A 1DANH 3KNXA 3Q76A 2P8OC 3P8OA 4K8BA 3SJ9A 5A0BA 2H9HA 4BOHA 2UWOA 1YWUA 4X6PA 1UK4A 4AGJA 1S83A 2YNBA 3W94A 4ESTE 2KCAA 2HOBA 3NRLA 5AVDA 2IJD1 3GCTG 4OS5A 2ZU2A 2KFWA 4H6SB 4MVNA 1NRQH 3PRBA 5GIBA 3W1EA 3MFJA 4JCNA 2Q6GA 1SL3A 1UTNA 1H9IE 3TK6A 3BTME 2FOGA 1AMHA 3M35A 1YPGH 1DITH 3PTNA 2PKAA 1MTSA 2BXTH 4Q4LA 1G3BA 2A1DB 1N6YA 3S9CA 1BT7A 5KEDA 2PGBB 1UVPA 2BDAA 1TAWA 3OAAD 3M7UA 2B5TB 1GMHF 1TQ0B 3RXJA 4JZEH 1ETSH 2VNTA 4FOUC 1P3CA 3NUMA 1TMBH 4DJZB 2VIQA 2NU2E 1P57B 2A0QB 1TX7A 3MO9A 3SGBE 4VGCB 1Y8TA 1AB9B 2H1UA 1C5YB 1F0TA 1XUHA 5HKKD 3MNCA 5L30H 1OP8A 5EQRA 2R0LA 3RLYH 2ZP0H 1VGCC 1PPBH 2O8UA 3HGPA 1NC6A 2UUYA 1MH0A 1RTFB 2VVVA 3RXHA 1HAYB 1UHBA 1ZSLA 1C2LA 1VITG 2A45B 2V3MA 4Q63A 3KQDA 2G51A 1C1SA 3LC3A 1PPFE 4X1SU 1ABIH 3UWIA 1ETTH 3TJOA 3SU1A 4CRCA 2CV3A 1A61H 1GBFA 1F0SA 3EA8A 3FZZA 3M5MA 1BTZA 3E16B 2ANYA 4FUIA 3M37A 1GVLA 1OPHB 2KAIA 4I33A 1GDNA 5HM9A 2OD3B 1ETRH 1EJAA 1FY5A 1EASA 2FDAA 2XCNA 3A8DA 1GI0A 5DJ7A 1LVOA 4DCDA 2GTBA 4IMZA 4LK4A 5J4SA 4UFGH 4BTIB 3T28A 4NG9H 5CHAB 3K6YA 2A5IA 1MBMA 3CNRA 4A7IB 3SO3A 1LKBA 4O97A 3DSGA 1TBZH 3CENA 1WSSH 2FOCA 2PKSB 1C1TA 1KYNA 3WWFA 3MU0A 4A6LA 1TGCA 4CRAA 4ABHA 3I78A 2ODQA 1KSNA 3M5LA 3FOAA 4BAKB 3DT0H 3ZIAD 3D65E 7KMEH 5DP6A 3UIRA 1P2NA 2ZHEH 4A1TA 1EJNA 5I46H 1SGPE 1Z8RA 2DE8A 4ISLA 4KTUA 3V12A 1VITH 3RXAA 3I29A 1DWDH 4HZHA 4O3UA 1GVKB 4I31A 1CT0E 3A81A 5IDKA 1XVMA 4INKA 3KIDU 3U1IB 1GBAA 3VFEA 1AKSB 1EJMA 3KQCA 2JJ2D 1IAUA 1ZYOA 1HAPH 1W7GH 1KXBA 3A89A 3CP7A 2Z6BD 2GT8A 3N7DA 1FI8A 1O2WA 1OXGA 2PV9B 1NFWA 4ZROA 1MKXK 1GBBA 3H09A 3S9AA 1HPGA 2JIZD 2P3FH 3ZYEA 2GP9B 1AVXA 2RA3A 4UFFH 2RCEA 2FESH 4U01A 1FV9A 1O5AB 2VVCA 3I77A 4JZFH 4Y79A 1QY6A 2QCYA 2W3IA 2XNDD 2TGAA 3O8DA 1GJ6A 3RDZA 1GJBB 3BG4C 1F5LA 4Y8ZA 1DE7H 5A8ZA 4UE7H 4B6FA 1ELEE 4KGAA 4MPVA 1TX6A 1SLVB 1JIMA 3U28C 1KMHB 1A46H 2VVUA 1EP6A 3OYPA 4CBOA 3M36A 1SQTA 3RP2A 4ABJA 2AMPA 1Z7KA 1L4DA 3UNRA 2QF0A 3LGUA 2HVYB 8GCHF 3LPRA 4I8HA 1QQ4A 2V3OH 1C2FA 4FU9A 2XRCA 2VIWA 1JBUH 1CT4E 1SGFA 2YNAA 1ID5H 2P8OB 2FOEA 1P8VC 2ZFTA 1F0RA 1XUJA 3LIWA 1DLKB 4FUEA 1D6WA 1V2MT 1FN6A 3BV9B 4IW4E 1V3XA 3RLWH 6GCHF 4NIYA 2HGTH 2GMTC 3RU4T 3T62A 3B23B 2G52A 5F03A 2TRMA 3F9EA 2BXUH 3DFJA 2PUXB 3SOSA 3H7TA 3MU4A 4BAOB 4I8GA 4HGCA 3SJIA 1T8LA 1FZZA 4WVPE 1T7CA 2EY4C 1ZGVA 1P11E 3AAVA 2J34A 2ZCHP 1GHBF 1HJ8A 3EA9A 2VGCC 4R0IA 2XCFA 3LJOA 4D7GA 1GJ8B 1TQ7B 2ZFFH 5FBIA 2BOKA 3A7WA 2OXSA 1D3PB 2D26C 3E6PH 3TPIZ 1LPZB 1INCA 1NRNH 4WXVA 1C2HA 1DWEH 5DPAA 3KF2A 1O35A 3MWIU 4YZUA 1XKAC 3SORA 1FAKH 1P9SA 1AHTH 1SB1H 1TPAE 4VGCC 3V13A 2WHXA 1AB9C 3ZYDA 1ZPCA 1HRTH 1UVSH 1GGDC 1G36A 2WPIS 1V2NT 2JKHA 1V2ST 2Y7ZA 3M5NA 2THFB 1EOJA 2JDID 3PWBA 1G30B 1P06A 1TGSZ 3QLPH 2ZGJA 2XC0A 3Q00A 3MYWA 3P95A 3V7TA 1ARCA 2Z9GA 2V6NA 3A7XA 3QZRA 2TPIZ 1QCPA 2I6QA 2AIQA 2ZCLP 1QL8A 2ZKSA 1GBTA 1HBTH 1BHXF 1O5EH 1FIWA 2Q1JA 1LHCH 2UUJB 2A4QA 2DE9A 3LH3A 2OQ5A 1ZRBA 2Y5GA 4ASUD 4MNYA 4P02A 3UY9A 3TLOA 1ESTA 3ZVFA 1YPHC 3MI4A 1V2KT 3MH4A 4OGYA 4CBNA 1UTQA 1TRMA 1H8HD 1BHXB 4IC6A 1QJ7B 1L4ZA 3SU2A 1BTXA 1Z71A 1QR3E 5GDSH 1A7SA 3T27A 1CO7E 3D62A 1T4UH 4MPUA 4AB8A 2ZDVH 1QNJA 3SJKA 2W7UA 4ISOA 4BXSA 1SLWB 2GV7A 2A7HA 1S84A 4AYVB 4ZHLU 1Y59T 1FAXA 1CGHA 1CA0B 1J17T 5A8YA 5T6GA 4X1PU 3EE0B 2D2DA 3BTGE 2ZHWH 2SNWA 4XE4A 4TWWA 3GCHB 1EB2A 2JETC 1GHXH 5FCKA 2F4LA 4B2CA 2VIVA 1BMMH 1OWHA 1M9UA 4JYUH 2YMSB 1IQMA 1GHAG 3GYLB 2ZC9H 1N8OC 1HAVB 1MAXA 1W14U 1W8BH 2L6OA 2SGPE 4Y0YE 8KME2 3SUDA 1O37A 4WY3A 4ZKOU 3PMHB 2PKAB 4FUFA 1O2PA 1ZHPA 1O3EA 2BD9A 2ZQ2A 1BRUP 1CBWB 3SV6A 1XUGA 1UTJA 2HVXA 4ZXYH 2Z7FE 4X0WU 1O2TA 2ZGXH 3EAJA 1IHTH 5F8XA 2ZU4A 3PV5A 5G4BA 3UTUH 1EATA 3FAOA 5LPRA 1W0JD 4AYYB 2IPQX 4ZMAH 4K5ZA 3OSYA 1XXFA 3MTYA 3RXEA 3MO6A 3MO3A 2F91A 2NU1E 3ZZ3A 2J9NA 2AMQA 1GJCB 5FHTA 5FX5A 1DY9A 1GBHA 1EAWA 1PPGE 2OC8A 1BA8B 1MD8A 3QWCH 4Q7XA 1UTOA 5DP8A 1O30A 3EYDA 2EEKA 2GV6A 1ZHRA 2JH6D 3A7ZA 2KAIB 3SJOA 1AVWA 1L2EA 1AKSA 4JK5A 1GL1A 1GJ9B 3ZZ5A 2OBOA 2UUFB 2ZDLA 3OU0A 3RXOA 1TABE 2ZDAH 4ZXXH 2WPDD 1C1WH 1UTPA 1CGIE 1JWTA 2YOLA 5C1YA 2V35A 4K1TA 5IYTA 2J97A 1SQRA 2KCOA 4FVBA 1O2VA 1LKAA 2VGCB 2FOAA 3AK5A 2FX4A 3C27B 2ESTE 1EKBB 3RC6A 1JMOH 4MTBA 3VXEH 1FJSA 3BTTE 3RXDA 4B6EA 3BTHE 3Q3XA 3GY4A 4B73A 2HWLB 2ZPSA 1Z1IA 1EFRD 2WPKS 2XOKD 4AFQA 1VCWA 4IN1A 1PQAA 4O9VA 5A0AE 5F8ZA 1GJDB 2OC1A 1OP0A 1MBQA 1YM0A 1V2PT 2IPHA 4BXWA 4BAQB 3QTVH 2QF4A 1BBRH 4YTAA 3GCOA 2ZHQH 4MNWA 2QXIA 3A8AA 4FVDA 1O2MA 2TGPZ 5EJZA 4CH8B 5GPIB 2GCHG 1O3MA 5ESTE 1O31A 3F9HA 4ABIA 1BTHH 4IC5A 1O3KA 1O3LA 1B0FA 3KQ5A 2ZQ1A 1MTVA 2W3KA 2GX4A 2LP6A 3MNSA 1GI3A 1GMHG 2CJIA 4ZAEA 1AUJA 1RGQA 3Q77A 3SNDA 1C2GA 2O8LA 1UHBB 1GMDF 1IQGA 3ZVDA 4KELA 2ZWLH 3B9FH 3BEFB 4ISNA 8ESTE 3PV2A 1LHGH 1CHOF 4TWYA 1QJ1B 4DIIH 2EI7A 4BTUB 2PSYA 4I32A 5FX6A 1P2KA 4HTCH 4D9RA 1ACBE 4IN2A 1BQYA 3RXFA 3BN9A 3QK1A 4MPXA 2GKVE 1D4PB 3GY5A 4AGKA 2WINI 3B8JA 4DOQA 4DVAU 5C5NA 1SGNE 5GCHF 2OQUA 5E8EH 5EPYA 5FPTA 4X2VA 1ESBA 2B0FA 4F55A 2BMGB 5FCRA 3PTBA 2FS9A 1L1NA 3PROA 4UDWH 5L6NH 3LU9B 2PWXA 3O8BA 1VKYA 1EZUC 1HAXB 1CU1A 1KLJH 4X1NU 1KXAA 4RT1A 1A5IA 2TIOA 2JETB 4GSOA 4SGBE 3RXGA 4B2BA 4CR5A 3V0XA 1HLTH 1AE5A 1S85A 3ODDA 5E0JA 4TPIZ 1H4WA 3RXSA 1P04A 3PV4A 1MTUA 1SFQB 3A80A 3SZNA 4GLYA 3STIA 4CHAB 1SI5H 1AI8H 1VCQA 3TJNA 1C2JA 1S81A 2ZG0H 2ZO3H 3LOXA 3SHAH 3F0PA 4LZ4B 2G00A 3BIUH 1W11U 1RIWC 2C8YB 5DO4H 3FANA 1BRAA 5DK1A 3P8GA 3HK3B 1S5SA 5C3NA 3KQBA 1OP2A 2QF3A 4JZIA 4AOQA 3LT3A 1EX3A 1AY6H 1TA2A 1DFPA 1A0LA 1O3FA 2FODA 5BRRE 2C8WB 1G3EA 4HG6A 1Y3WA 2BQWB 1UVOA 1FNIA 1AUTC 3T2NA 4K60A 4B2AA 3RM2H 3EQ0H 1HIAB 3DD2H 2FOHA 3QGJA 3NKKA 1IHSH 1AU8A 4CRFA 4XSKU 1N1LA 1TNIA 3ZZDA 1FQ3A 1MTNB 4FU8A 4NWKA 3KQEA 1YKTA 3VPKA 4X8SH 1SGCA 3SGAE 1C5SA 3RXPA 2GCHF 4LXBH 3GDSA 4OS2A 2FOFA 3U1JB 1EAIA 1YLDA 5E2OA 5L2ZH 1QTFA 5JPMH 2FI5E 5GWZA 4DT4A 4NSYA 3RU4E 4AB9A 1AZ8A 3URCA 1GMCF 2PP6A 5EJ1A 1SOTA 1T31A 2OP9A 3SNCA 2QF5A 1DSUA 3RXMA 5DGJA 2QXJA 1NM6A 2VIOA 2XBVA 3ESTA 5CMXH 2H9TH 2F3CE 2Y82A 3ODFA 3AW1A 1ZGIA 2ZU5A 3TVJB 1ZTKA 4I7YH 3N99A 3EE7A 4IBLH 1THRH 1BTPA 4GCHF 2WV5A 2R0KA 2BLQA 1FY3A 1C1PA 1T8MA 1S6HA 3VB6A 2P16A 1W0YH 5LPEA 1EZXC 1CQQA 4D8NA 1MCTA 2ASUB 2LPRA 3KCGH 2VJ1A 2VIDA 1WBGB 3RXTA 4NZQA 1DUAA 4THNH 3H5CB 1GJ5H 1O2JA 1GBIA 1THSH 1V2LT 1THPB 3E0PB 5F6MA 3OTPA 1OOKB 2ILNA 3UFAA 2A31A 2FEQH 3M3TA 1ELCA 2C3SA 1A4WH 1K1NA 1C5ZB 2SFAA 1SGRE 2P59A 2C8ZB 4ZUHA 1SGIB 1ANEA 3UWJH 3BTWE 2FMJA 1KLIH 2XC5A 2Y6TA 4AG1A 3A86A 2NU0E 2HNTF 2ZHFH 5JB9S 1KXDA 3GDUA 3GY3A 2BD5A 1RRKA 1LCYA 2QGRA 1O3NA 1C4Y2 4E7NA 4YT6H 1LVMA 4NA9H 1OKXA 3VGCB 1QBVH 3ZVCA 3UPEA 1UVUH 4I8KA 2P94A 3F9GA 1V2RT 4FUHA 2VWNA 1IOEA 3E1XB 3U9AH 1O3GA 1C2IA 2FLBH 1NT1A 3NK8A 2R3UA 3VB5A 5C5OA 1ZJKA 3BTDE 5LPFA 1J14A 2VB0A 3Q3KA 1SSXA 1LHDH 1L1JA 2STAE 1N8OB 1CT2E 3UB0A 1W3CA 2BOHB 1BB0B 1BZXE 1FLEE 1UCYH 2VH6A 2A5AA 1OS8A 2ODYB 1HAOH 1BJVA 1BCUH 1DSTA 4TY6A 4ACAA 4MPWA 5T6FA 1SVPA 3PB1E 2ANWA 1SC8U 1O38A 3N7EA 3BTEE 1FIZA 2K8IA 4TPYA 3TIUA 1Y5AT 2RA0A 5DP9A 3LJJA 2J2UA 1JXPA 1C5OH 1SHHB 4NZLA 1DDJA 1NZQH 3FKSD 2J98A 2KCYA 4X6NA 1O36A 4U2WA 5DSFA 1TRYA 1ZRKA 2P95A 3KN2A 4OM9A 3SNEA 1Z8IB 1UW7A 1Y3XA 3OY5U 1YCPH 1ZJDA 3SQEE 3Q3YA 4AFUA 1AFQC 2Z3CA 1DS2E 5B6LA 2K0QA 2JJ1D 1ARBA 1AZZA 1EPTB 1MD7A 4F48B 3L6PA 1WTHD 3ATLA 4E7RG 2PGQB 1H8ED 2R2MB 1TLDA 4SGAE 5CE1A
chains in the Genus database with same CATH topology
3SW2B 2C90B 2AEIH 4F49A 1TBQH 3MH5A 1QL7A 5DP4A 5C20A 1G3DA 2BZAA 1O3OA 4AFSA 6LPRA 2SGEE 1B7XB 1EP5A 3BTKE 4NA8A 2A2XH 2VWLA 2P3TB 2SNVA 1LPKB 1UCYK 3P70B 4YLQH 1MKWK 4Y71A 2Z9IA 1FY8E 5HM2A 1LTOA 2BVRH 2GZ8A 4OS6A 4ABEA 5LH8A 3TH3H 5DP7A 4XOJA 1IQKA 3ATMA 2RDLA 2FWWA 1UTLM 1ANBA 4ZKRU 5EQSA 3IG6B 3M7QA 4JZDH 1F92A 1LHFH 5JYIA 1J16A 3HGNA 1BJUA 3TK9A 2BLVA 1CA8B 1UTMA 3HPTB 2F9BH 1KDQB 1ZSKA 3NWUA 2ZCKP 4O3TA 4Y7AA 4INHA 1K9OE 3TNTA 3SJ8A 3FP7E 7GCHF 4AX9H 1PJPA 2P93A 1Y3UA 1TONA 5K0HA 1O2YA 1W13U 1YC0A 1P01A 3ZV9A 5EPNA 1MZAA 3BG8A 1PFXC 1FDPA 1PQ7A 4ZH8A 1EUFA 4FUCA 1KXCA 4K3JA 2FZZA 1JOUB 4K2YA 1Q3XA 2PFEA 2HLCA 4OS1A 3PLKA 4Y7BA 5ESBA 3M7TA 2QA9E 1GHAF 4NIVA 3VB7A 1GG6C 4JMYA 1IQFA 4ABGA 3PMAB 1C5NH 1DOJA 2LNCA 3RMNH 1E35B 2HALA 1GDQA 1GPZA 1K1LA 1LQDB 1ZMJA 1XVOA 4Z6AH 1UK3A 1HDTH 1O5FH 3BF6H 1EQ9A 2ODPA 2ZHDA 4RKJB 1T32A 1TA6A 1ZLRA 3TJVA 3SU5A 3SHCH 1LHEH 4KTCA 1YCPM 1ZPBA 4PROA 2F83A 3VB3A 4LOYH 1T4VH 1OSSA 4GHTA 4UONA 2FOBA 1FUJA 3U8OH 1UCYE 3PM3A 3SI3H 3PO1C 5AFYH 4YOJA 3KGPA 2XW9A 1XUKA 1GI7B 1MKWH 2BD4A 1TNJA 1C5UA 1GBJA 2GZ7A 2G4UA 1V2OT 4K1SA 2BY5X 4O03A 2AGIX 1CVWH 1YP9A 4CHAC 1A3EH 1AGJA 3LGVA 3KL6A 3BG4B 1WTGH 3ELAH 2ZU1A 4U30A 1YPKH 4NA7A 2A7JA 5A8XA 3PLPA 3QN7A 4Q7ZA 2R2WU 1RIWB 3DA9B 1O2NA 4NFFA 1KXFA 1HXEH 4LZ1H 1VGCB 1Y5UT 5EGMA 2BLOA 4H42U 1WQVH 1PPHE 1XUFA 5I25A 4WMEA 4X6MA 1TGNA 2JH0D 1IQHA 2BVXH 1NRSH 1W0ZU 3PMJA 2GD4B 2BY9X 4NFEA 4YT7H 3NPSA 1GI8B 1SLXB 2FYQA 3ZVAA 3FP6E 1S6FA 4QT8C 2BYAX 1ELBA 3W95A 1E0FD 1ELFA 1AIXH 3SU0A 1GVZA 1S0RA 2FXRA 1C2DA 2BX3A 4H4FA 3FVFB 2O9QA 1SLUB 2FX6A 3E90B 3ZVBA 4UFEH 1QBNA 1BMAA 3SUGA 1PPZA 3MU1A 4U32A 3PWCA 4DURA 1Z8GA 1PYTD 2EA3A 2G81E 2V0BA 2ZPQA 3F68H 2GT7A 2QN5T 2FTLE 3P92A 1DUEA 3GISB 4F4OC 1NESE 2OINA 2PSXA 6GCHG 1G2LA 1DX5M 1GBLA 1AWHB 5AF9H 2TBSA 2GDEH 1OYQA 1E37B 1O3CA 1HB0B 1HAZB 3PYHA 2IJOB 1DY8A 2XYAA 1HAHH 1EOLA 1Y3YA 4JZ1A 2A4RA 4MNVA 1CE5A 3MNXA 4B76A 3QO6A 4FXGH 2DUCA 4YOGA 3TK5A 1YYY1 1NPMA 3QTOH 3O8CA 3FFGA 3OY6U 2A32A 3ATWA 1KLTA 5TJXA 3RXIA 5JBBS 1J8AA 1E38B 4X2WA 1X7AC 3SUEA 1GWAA 2AS9A 1SBWA 1KDQA 4D7FA 5L2YH 5C1XA 2ULLA 1LVYA 1YPEH 1K1PA 2NU4E 1JIRA 1L0ZA 1C1OA 1QL9A 2FI3E 3TH4H 2BD2A 1QIXB 3UREA 3LONA 4OS7A 4X8VH 3OTJE 1C1UH 3S0NA 2R9PA 4XBCA 1FY1A 1JRTA 2J4IA 3D23A 1P2MA 1GI1A 1K21H 1ESAA 2ALVA 3RMOH 1DLEA 5K7RA 3A85A 1A0HB 3P6ZB 1BTUA 1HJAC 2Z3EA 3A7YA 1K22H 2FIRH 3E91A 1F0UA 4XDEA 1ZR0A 2Y80A 3NZIA 1O2XA 5EXMA 3CS7A 1GCTB 2A4GA 1Q31A 4Y0ZE 2BDBA 2ZNKH 3VGCC 4Y8YA 2XXLA 4INLA 1V6DA 1EB1H 3KEEA 1TALA 3RXRA 2BY6X 1P2QA 3QX5H 1ELVA 1GBMA 1YPMH 1TOMH 3GCHC 2Z3DA 4D76A 2JH5D 1J15A 2BY7X 3K65B 2J95A 3RU4D 1W7XH 1C1MA 3UR6A 2SGFE 1QBOA 1C5QA 3MH6A 1GI6A 2B8OH 2Z94A 1H8DH 1UVTH 1GCDA 2H9EH 3SV9A 1GHWH 1XXDA 4MQAA 3G01A 2IN2A 5DKMA 4BAHB 1QGFA 2K1QA 2CF9H 1SMFE 3P17H 2PUQH 3FZDA 2J92A 1C5WB 3GY2A 4NIWA 2OLGA 1C1NA 3MMGA 1O5DH 4DT7B 2BDGA 1OX1A 3ZZAA 2CXVA 2FS8A 2F9UA 3AVZA 1BMNH 3M3SA 1V2JT 1P9UA 1BITA 1ZHMA 5GCHG 3RXCA 4GVUA 2Q6DA 1MQ6A 2GMTB 1B5GH 3SV2H 2Y5HA 3A7TA 1TWXB 2RG3A 5JBAS 1NTPA 1EPTC 1EXFA 1GHYH 1NS3A 1NFYA 1ORFA 3ITIA 1O5GH 1BTWA 1SQOA 2XWAA 1FXYA 3ZZBA 3QDZB 1SFIA 1GI4A 2PKSC 2VWOA 1F5KU 4Y6DA 1LMWB 4IGDA 1C5LH 2PTCE 3RMLH 2HNTE 5T6DA 2WUCA 4CREA 1A5GH 1AQ7A 3R0FA 4MDSA 3GY6A 1TNKA 3P8NA 1O3BA 5HXFA 1AE8H 1BBRK 1Y5BT 2O8TA 1MMJN 3ZZ9A 2O8WA 1TOCB 2G5NA 1P10A 2FP7B 1C5MD 5LGOA 3S9BA 1HV7A 2OUAA 3QZQA 2ZGHA 1C1RA 1G9IE 2OC7A 3QUMP 2AGEX 1H8IH 1RFNA 3UQVA 3T29A 1HUTH 1FN8A 3T5FH 1HYLA 2CGAA 2STBE 2Y81A 3BEIB 3E3TA 2A7CA 3HK6B 3TGKE 1O0DH 3LGWA 1U6QA 4GHQA 1ANCA 4ZKNU 1QFKH 2WUBA 1YPJH 1LQEA 2BB4A 2WYJA 3ZZ6A 5A2MH 3ZVGA 4X6OA 3ZVEA 4FUJA 8GCHG 3UOUA 1C2KA 1PPEE 4B1TA 4GAWA 1DM4B 4GCHG 4FUBA 3UOPA 4AN7A 5FXLA 4IS5A 2GZ9A 1QJ6B 5AHGH 2EC9H 2WPJS 1JRSA 3F6UH 1B0EA 1MKXH 2BDIA 4YESB 2CF8H 1QA0A 4NSVA 1ZSJA 3AASA 1FONA 1O3IA 1NU9A 2FTMA 1OYTH 4NWLA 3P8FA 3K2UA 5TCCA 1HJAB 3MHWU 4FU7A 1GMCG 3QGNB 3TITA 1ZPZA 2C93B 8LPRA 1IQEA 2VINA 1NY22 2GGVB 4AFZA 1A1RA 4AORA 2D1JA 3LDXH 2ZFSA 2QAAA 5DP3A 3A83A 1E34B 2QC2A 1G3CA 1FPHH 1EAXA 1MZDA 2GDDA 4ABBA 1L1GA 4R8TB 2ZTXA 2BY8X 1P3EA 2CHAB 1UK2A 1TBRH 2ZEBA 3RMMH 2ZDNA 1C9PA 1GBKA 6CHAB 4MG3A 4NCYA 1ELTA 4ABFA 1Z6JH 4XBBA 4WMDA 3EGKH 1MQ5A 1F2SE 6ESTA 1SGTA 1GGDB 2QY0B 1GHBG 3A8CA 2PLXA 1GL0E 2AGGX 2XBWA 5FAHA 1BOQA 1VJAU 1WAYB 2XTTB 4B74A 3IWMA 4ASHA 2ZI2H 3STJA 1SOZA 1AN1E 3U8TH 1HGTH 4FUGA 1C5VA 3LGTA 3LKWA 1YCPK 1K1IA 1O2QA 1VR1H 1OWEA 2UWPA 1AVGH 4UFDH 3BSQA 3URDA 1O2OA 3MH7A 1SPJA 2Z9KA 4K8YA 1NO9H 1RS0A 1GI9B 4XBDA 2PHBA 2C8XB 3UNQA 4Y11E 3RXBA 3VXFH 5JB8S 1XX9A 3OX7U 1SGEE 1SGYE 3MNBA 1AD8H 1OWDA 3BTQE 3RXKA 4NGAH 1Y3VA 5C67A 1QB1A 1C9TA 2BVSH 4UD9H 1FY4A 3SGQE 2BDYA 1VCPA 2QXGA 3BEUA 1O2ZA 1ZZZA 5FPYA 1TPPA 5JBCS 4D9QA 2ZPRA 2B9LA 4OS4A 2ZA5A 3RUOA 2HNTC 1P2JA 3ATKA 3AW0A 4BANB 1XKBC 1HAIH 3GOVB 4ZHAA 1CHOG 2UUKB 3HATH 1YGCH 3A84A 1QRWA 1FPCH 3RXQA 1P12E 4JK6A 3O8RA 1AO5A 1TFXA 3V3MA 3SU6A 3JZ1B 4RKOB 1YLCA 2AH4X 3K9XB 1O5CB 1YPHE 1HCGA 3A82A 9ESTA 2AMDA 1SGQE 4Q2KA 2GCTB 1W12U 3DFLA 1GBDA 1OWJA 2BD8A 2Z9JA 3ATIA 1W10U 2QYIA 3F9FA 1P02A 1CGJE 3TJUA 1ABJH 1O2HA 2BLWA 3RM0H 1C4U2 4MLFB 2FI4E 1SQAA 4E06H 5EW1H 1BDAA 4BTTB 3KHVA 1CBWC 1O2SA 3UUZA 1O3HA 1GJ4H 1SR5C 3VB4A 1TRNA 1DWBH 4DGJA 3HKIB 2F9OA 2A5KA 2H2ZA 4X2XA 5JBTA 4ZKSU 4CR9A 1C5XB 1CHGA 1O2KA 3A87A 1SHYA 2BDHA 3ZZ7A 1XM1A 1ZMNA 1MU8B 4ZHMU 3TU7H 5DP5A 1ZOMA 1GDUA 2ALPA 1UMAH 1BIOA 7ESTE 1S82A 1BTYA 1GCTC 3ZZ4A 3MOCA 1UO6A 1QRXA 2SGDE 3ENSB 3FP8E 4DG4A 1TNGA 1K1JA 5TCAA 5ABWA 1HAGE 1NU7B 1PPCE 4X1RU 1RXPA 4KKDA 1BBRE 1C5PA 1C4V2 1EPTA 5E0HA 2D8WA 1H9HE 4Q80A 3MU8A 2PW8H 4Q7YA 5FBEA 5EW2H 3SBKA 1RJXB 3SN8A 1C2EA 2EI8A 4B71A 1KTSB 2OCVB 2WV4A 4A5TS 5HMAA 3F1SB 1EZQA 4KP0A 9LPRA 1QB6A 2VWMA 2CN0H 2EI6A 1BMLA 1ZMLA 4JYVH 1DVAH 4Y8XA 1NRPH 2FPZA 1HFDA 2AFQB 3M61U 2UWLA 1DT2A 3NXPA 1NN6A 3VEQB 4H6TA 1QA7A 3BIVH 3GY7A 2BX4A 2PR3A 3DUXH 6CHAC 4AZ2B 4I8JA 7GCHG 1GMDG 2C4FH 1ELDE 1O3JA 2ZIQH 2H5CA 1RD3B 1TE0A 2ZFRH 5EXLA 1TGBA 1AWFH 3ZZCA 2Q6FA 1NROH 1BRBE 5C1UA 2OBQA 4TYDA 2BQ7B 3PLBA 3U98H 2VH0A 4A1VA 3H7OA 1FMGA 5EG4A 4WH8A 1MCVA 4HFPB 3T25A 1TYNA 3MU5A 2QIQA 4A1XA 2G55A 4WH6A 3R3GB 3RXUA 1D3QB 2G5VA 3SV8A 1AFQB 2FM2A 1BUIA 1ELGA 5AFZH 2XWBI 1MUEB 3RXLA 4ABAA 4K69A 1K1MA 2OC0A 2ANKH 4DW2U 4OGXA 1NFXA 3BTFE 3JZ2B 4Y10E 1D9IA 3RC5A 4FUDA 4J2YB 3SUFA 1WV7H 4AG2A 2XC4A 1GHVH 1O2GH 1TPOA 4KTSA 3ZZ8A 1DXWA 3PMBB 2BHGA 1OWIA 1QB9A 1A2CH 2NU3E 1A0JA 1MU6B 2ZDKA 2H6MA 4WMFA 2W26A 3SNAA 5EXNA 4ISHH 1GJ7B 2F9NA 5FPSA 1HNEE 1D6RA 1TMTH 1O3DA 4B75A 1GBCA 2FYRA 1DICA 3CS0A 3M5OA 4YOIA 1A5HA 1LO6A 2AERH 2GVFA 3A88A 4RN6A 1XUIA 1GI5A 2M5TA 4UEHH 4WJG2 3TH2H 1UTKA 1A3BH 2H5DA 3A7VA 1VITF 5T3HA 1F7ZA 3GY8A 3LC5A 3UQOA 2WYGA 1T8NA 5C2ZA 1V2TT 5EU8A 4CH2B 1HJ9A 3EDXB 4CRGA 1D3TB 2G4TA 2TGDA 1YBWA 1C2MA 1WYKA 1ZTJA 2BD3A 3K6ZA 1LVBA 1PYTC 3LGYA 2PTNA 2ZTYA 2ZU3A 1OWKA 2BM2A 1KXEA 2AYWA 1V2UT 3E0NB 4Y76A 4XFQA 5EQQA 2TGTA 2ZF0H 4MNXA 2A2QH 1O2IA 2W5EA 3ZV8A 1VJ9U 1RTKA 1YPLH 5GJ4B 1V2VT 1SGFG 1MAYA 4NIXA 5J4QA 2WPHS 3S7HB 1TIOA 3UNSA 1NRRH 4J1YA 1WUNH 4WWYA 1HXFH 3AAUA 4DY7B 1NFUA 1IQLA 2XBXA 1SG8B 1XMNB 2ZFPH 4RSPA 5A09A 2Z9LA 1Z1JA 4X8UH 3L33A 5E2PA 2ZGBH 4IMQA 1O5BB 1RTLA 4YLUA 1HIAA 4E05H 2A4OA 2FO9A 4M7GA 4BNRA 2QXHA 1C1VH 2BD7A 3T26A 5EODA 1MTNC 1G37A 2HRVA 4YM9A 2BQ6B 1KTTB 1W2KH 1Z6EA 1VZQH 4DIHH 1UJ1A 3PO1B 1P2IA 2FOMB 5ETXA 1IQJA 1GHZA 5EOKA 3S69A 2BDCA 1Z8JB 1C5RA 1O3AA 1P0SH 2CHAC 3NCLA 1SGDE 2QV1A 1CSOE 2ZGCA 5E0GA 1O2RA 1EZSC 4CRDA 1O2LA 1QURH 5H4IB 5A0CA 3LGIA 4WXIA 2ZZUH 2Y5FA 1K1OA 1TNHA 1C5TA 5GXPA 3M3VA 2B7DH 2J94A 2FLRH 4YO9A 3TGIE 2ANMH 4Z0KA 1Q2WA 1AFEH 2BTCE 2XNIA 2CMYA 4WF8A 1E36B 1V2WT 1P05A 1C1QA 2HPQH 4X2YA 2VIPA 2O8MA 1D3DB 2BZ6H 1GBEA 5CHAC 1PQ5A 1TNLA 1WOFA 1H1BA 1LPGB 3GDVA 3HKJB 3RXVA 1J9CH 3D49H 3GYMA 2V3HH 1GI2A 3RC4A 1H9LB 4ABDA 2G8TA 1KY9A 2WPLS 1N6XA 1ZTLA 1O34A 4ISIH 2ZTZA