2XTTB

Bovine trypsin in complex with evolutionary enhanced schistocerca gregaria protease inhibitor 1 (sgpi-1-p02)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEASE INHIBITOR SGPI-1
publication title The Catalytic Aspartate is Protonated in the Michaelis Complex Formed between Trypsin and an in Vitro Evolved Substrate-Like Inhibitor: A Refined Mechanism of Serine Protease Action.
pubmed rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xttB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xttB02
1HGTH 3O8DA 2W7UA 5BRRE 3SNBA 1BBRE 3P8FA 2I6QA 3TNSA 4B2CA 1ARBA 4BAKB 3RXBA 4NGAH 1O3AA 4ABDA 1EP6A 1OKXA 1UTPA 1ELEE 1EPTB 4X1QU 3ZZAA 5T6FA 3E0PB 4HZHA 3SJKA 1C5TA 3EQ0H 2OLGA 3SJIA 3ZVEA 2Y6TA 4I33A 4OS4A 1D6WA 1FJSA 1F0TA 1TRNA 2GDEH 3KQDA 4WH6A 1BUIA 5FX5A 4WMEA 1P2IA 1GGDC 3E8LA 4FVBA 2TGDA 4AFQA 4DT7B 4TYDA 2TGAA 2AMQA 3UR6A 2KAIA 3KNXA 5JBAS 3I78A 3ELAH 3ZZ5A 2WPJS 1V2NT 2SGAA 1QRWA 3C27B 5EOKA 2OC7A 1O3KA 1C1RA 2A7HA 2QIQA 5C5NA 1SOTA 1TGSZ 2GZ9A 1C1SA 2ZI2H 1SVPA 1PQ7A 4K69A 3LONA 3LPRA 2A1DB 3ESTA 2JETC 1ZSLA 1BBRH 1O2IA 1AWHB 2PTNA 5FHTA 1A7SA 4ZH8A 5JDUB 3QN7A 4GHTA 4AX9H 4MVNA 4NA8A 4IC5A 1DT2A 2C90B 4F49A 4JYVH 1SC8U 2GV6A 4GUXA 4X8UH 3MHWU 1W7GH 3T29A 4Z0KA 3ZVCA 1UTKA 2XYAA 4LZ4B 1NRRH 5EXLA 1C1MA 1Z1JA 3FP7E 4D7GA 1GI2A 2SGQE 1L2EA 1V2JT 1Y5UT 3U8TH 1O3HA 4JK5A 3BTQE 2WPKS 3LU9B 1P2NA 3SV9A 4X8TH 1K1MA 2KAIB 3PWBA 5GWZA 2J38A 1D3DB 1NM6A 4Y0ZE 4OGYA 4B75A 1YPJH 4TPYA 1YPHC 2ZHEH 1HFDA 5SGAE 1AVGH 2A45B 4CBOA 1FY4A 1TNIA 2R9PA 1V2TT 2AMDA 3FANA 2FP7B 3GCTF 1P9UA 3KQEA 1GBFA 1XVMA 2ODPA 1K2I1 1ZGIA 3TJOA 1EAXA 3UTUH 5EXMA 1MD8A 2HNTF 2AMPA 5HGGA 3PLPA 1AZZA 4K1SA 2QXHA 1GHBG 1QQ4A 1G30B 5FPSA 1J8AA 4UFEH 1IQGA 1PPZA 1A5GH 1GCTB 1TGBA 3MNCA 3SU4A 4O3TA 2D1JA 1NU9A 2UUKB 4ABBA 3LDXH 4IC6A 3V13A 2FDAA 3EE0B 3GOVB 4TWYA 1KXFA 1O5FH 5EG4A 2V6NA 4BAMB 3CP7A 1EATA 2GT8A 2D26C 3SGBE 1GBDA 1AVWA 2F83A 5G4BA 3ZV9A 1RTFB 1O2QA 2AYWA 1THRH 1WCZA 1DSUA 4K8YA 1EAUA 3V0XA 2FI5E 1C5XB 1W3CA 3N7OA 1DY9A 1PJPA 1V6DA 2BVXH 1AHTH 3U8OH 1DUEA 2ESTE 1CHOG 1GHAF 5GPIB 4Q80A 1LHCH 1W12U 3RU4D 4ISOA 1TBQH 5F8XA 4FVDA 1A5IA 3ZYDA 2ZU3A 1UVPA 1C2DA 2V0BA 3W95A 2IN2A 3R3GB 1FDPA 1GJ4H 2W7SA 3VPKA 1FY1A 2FX6A 1TPPA 2Y5FA 2ZKSA 4UE7H 4A7IB 2UWLA 4RSPA 1CBWB 1GJ9B 1WQSA 1AQ7A 1K1LA 1D3TB 2VWLA 1WV7H 3PMHB 1FIWA 3UNQA 3NUMA 1UMAH 2QGRA 1HAZB 4OS5A 2IPHA 2VIWA 1OP2A 2CHAB 4NSYA 2ZFFH 3ODDA 5DO4H 3FZZA 4A1XA 1A4WH 2ANMH 2BY7X 1TFXA 3ENSB 1SMFE 1BJUA 4SGBE 5EW2H 3V12A 1CGHA 1GMCF 1QB9A 2A2QH 1E38B 3BEUA 2UUFB 5FX6A 2SGEE 4A92A 3A81A 1ZHPA 4RN6A 5F8TA 3RLYH 4B74A 5FPYA 3T2NA 4GCHG 5F6MA 1A3BH 4XDEA 1VCQA 2JH5D 3GCNA 5F03A 2ODYB 1W13U 2W3IA 2C4FH 1NRNH 3GY7A 2ZTXA 3SORA 3VB3A 1T8NA 2BQ6B 4MDSA 1UTMA 3BEFB 3BG8A 3RXRA 1X7AC 2P93A 2A7CA 4Y71A 2VJ1A 4U32A 1CT0E 1XUIA 3LH3A 2SNWA 1S84A 1SGNE 1HBTH 2CN0H 1IHTH 5EXNA 1SGFG 4IN2A 1MKXH 1UCYH 1BBRK 2QV1A 1DE7H 1EZSC 5EQQA 3SU2A 3SUGA 1GI8B 1HIAB 1DWCH 1SLWB 1KXBA 2D8WA 4KELA 4ABAA 3ATLA 4YT7H 5GXPA 1ZSKA 2XBXA 2EA3A 3P6ZB 2BD2A 1P8VC 1AFEH 1O5DH 1SQTA 1XUHA 2A4QA 4ZKNU 4YOIA 1GI1A 1OWIA 1OYTH 1P9SA 1ZJKA 1O37A 4FUHA 5L30H 4B2BA 1J14A 4KTSA 3SV8A 2FS8A 4CRAA 1S83A 2BDHA 4CREA 1W0ZU 4WY3A 4E7RG 4JK6A 4TPIZ 1KTSB 3UFAA 3T62A 1NRPH 1J9CH 2B5TB 5FBEA 1P2KA 5BPEA 5EODA 3GYLB 3MH6A 1P3EA 1DUAA 1S81A 2FYRA 3TPIZ 1C2LA 1BZXE 1WYKA 2GMTC 1RTLA 3EA7A 1O30A 3GCOA 2NWNA 1C1OA 1ELAA 3RU4E 2Q6GA 3RDZA 1LQDB 1OX1A 1UHBB 2ZU4A 4X1PU 4YT6H 2P8OC 3RMOH 4MNVA 1E35B 3SNCA 1NPMA 1BRCE 2BDYA 3B9FH 4X2YA 2GZ8A 1YPEH 4KTUA 1C5MD 4DIIH 1FLEE 1ESTA 1TNJA 2G4UA 2WPMS 1MMJN 3S9AA 2ZPQA 1YBWA 1UTNA 5TCAA 1AD8H 4OGXA 4XE4A 7GCHF 1BITA 1MTWA 1C5YB 2ZFQH 1TA2A 1NFUA 4UONA 5AFZH 2PTCE 3RXJA 3AAUA 1BOQA 3SOSA 2XC5A 2YNBA 3K2UA 1EB1H 3A83A 2Z94A 3BTME 1CHGA 1V2ST 4GSOA 2SGFE 5C1UA 2UUYA 3Q3YA 1C1QA 1QQUA 1YPHE 1Z8RA 2PUQH 2BX3A 4O97A 3FVFB 1A61H 3QX5H 4MNXA 1XKBC 2WYGA 1ZOMA 2FS9A 3PWCA 1F0SA 1ZHRA 1O2UA 2TIOA 3MNSA 3ZZBA 5JBCS 1KXAA 4NA9H 2PKAA 4CRCA 1Y8TA 1W0YH 4X2VA 2UWPA 2PFEA 1QR3E 1AFQB 1UK2A 2FTMA 2BD4A 1HAPH 1ABJH 3MU5A 2XNIA 3PMBB 1BRAA 1OS8A 3STJA 3SUEA 1DWEH 4IMQA 1UTLM 5PTPA 5AF9H 8GCHG 1LQEA 1T4VH 1Y3WA 1ZPZA 3I77A 2FODA 1ELTA 1CA0B 3DHKH 1XM1A 3RXDA 1EKBB 2BHGA 3A8BA 4KGAA 3ZYEA 2H5CA 2GZ7A 4K5ZA 1NC6A 1QA0A 1UO6A 5FPTA 5GIBA 1FY5A 1OWHA 2GX4A 1UK4A 3TK5A 4U01A 1QY6A 1ANCA 5E0GA 1TX8A 4IN1A 3GY6A 3VGCC 2QC2A 2Y7ZA 4PROA 1TOMH 1V2MT 3SI3H 2CJIA 4NIYA 3SJOA 3E6PH 1V2LT 3PMJA 1G9IE 4XBDA 3QO6A 5DP5A 3RMNH 3K6YA 5HM9A 2AIQA 5EU8A 1IQHA 2GT7A 2PSYA 2F9BH 2LPRA 2O8TA 2XC4A 3MOCA 3E3TA 2Q6DA 4ABHA 2FOGA 1HAXB 4YTAA 4CHAC 1ZRBA 1KIGH 4Y7BA 2PKAB 4X6OA 1O0DH 1O35A 4DOQA 5HXFA 1V2KT 3SV2H 1HJ9A 3UNSA 1YP9A 1Q31A 3LC3A 1ZTLA 1BMNH 1MTSA 1AB9B 5DP6A 2ZDNA 2ZPRA 2PKSC 3MO6A 1N6XA 3S9BA 2FI3E 1SQAA 3HATH 1W11U 2ZIQH 2P59A 4JZEH 1O2SA 1GMDF 4ZXYH 4UFGH 3GY3A 3ATKA 1Y3VA 1MKXK 1XUFA 1QGFA 4QT8C 3GICB 2C8XB 1C4U2 3P8GA 1SFIA 1L1NA 4WXVA 1JXPA 5JBBS 2QAAA 2F91A 1NS3A 2XCNA 5ETXA 1G3EA 2A4RA 3D23A 1CO7E 4ISHH 2ZFTA 2OBQA 1P0SH 1SGEE 1C2HA 3M3SA 1EZQA 1QJ6B 3RM2H 2H9HA 4UD9H 7KMEH 1QJ1B 1YCPK 1ELCA 1RS0A 2GGVB 5C5OA 3NK8A 1V2OT 4INKA 2BXTH 1TNKA 1SPJA 2WPHS 1ZTKA 3SUFA 4IMZA 1OYQA 5E2PA 3AASA 3TU7H 1IHSH 6ESTA 1VCPA 3RC6A 4ASHA 1C5ZB 2ZF0H 1RD3B 3ZZDA 2ZEBA 4OS2A 2QY0B 1Z7KA 1GBLA 2Z9GA 4GVUA 1MAXA 5ESBA 1NFWA 1VITF 1O2VA 5CHAC 3ZZ9A 1DPOA 2BY8X 1QB1A 1VGCC 1DANH 4B2AA 1C5QA 4YM9A 2XTTB 1H9HE 3DFLA 3A8CA 3SN8A 1L4DA 2BOHB 2ZU1A 3H7OA 2FLBH 4RKOB 2G8TA 1BTUA 3VFEA 3SW2B 1UVSH 1BHXB 1L0ZA 1DWBH 4NWLA 1ESBA 4X6MA 1RIWC 2NU2E 1KTTB 2ZA5A 5FCRA 2VVCA 3GY5A 3MFJA 3R0FA 1BMLA 2VWNA 3LKWA 1GJDB 3NZIA 1T31A 2Z3EA 4BANB 1K22H 1O3EA 2BDAA 1SSXA 2VVVA 1KXDA 1SHHB 1BJVA 4TY6A 3QDZB 3FP6E 4WWYA 2TPIZ 2BLWA 1ESAA 1BTHH 1OWKA 3CENA 5ABWA 1NESE 3RXEA 4JYUH 1D3QB 1O3CA 1TB6H 2ZG0H 1TRYA 3S69A 1MCVA 3SU5A 2JH0D 2UWOA 2STBE 4LZ1H 1A5HA 2PGQB 3HK6B 4ZHLU 3GCTG 4ZXXH 3RXLA 1CGJE 3VB7A 3ZZ8A 2Y80A 2ANYA 6GCHF 4K60A 4ISNA 1HAGE 1GBAA 5C3NA 3SV6A 1O3DA 3M3TA 1KYNA 1HAVA 3LH1A 2OC8A 5C1XA 3SHCH 1GL1A 3EA9A 1GBMA 1O38A 1W7XH 4GPGA 1V2VT 1TMBH 1OWDA 1C1NA 2GCTC 2J34A 3TH3H 3A82A 2BOKA 2GCHF 1K21H 2AFQB 2F9UA 3TH4H 3S9CA 1DXWA 1O39A 4YLUA 1N8OC 1GBEA 2XRCA 1GBBA 4Q2KA 1HJ8A 6CHAC 1AI8H 1ANDA 3HGNA 1EUFA 1G3DA 4AFSA 5JB8S 2C93B 3E0NB 1XXFA 3LOXA 3KGPA 3KCGH 3BTHE 3TGIE 1S85A 1G2LA 2BY6X 1SI5H 1WQVH 3SBKA 2BD8A 5JPMH 1O3OA 1HPGA 1LDTT 1GVKB 1TRMA 2VGCC 2Y81A 4NIXA 3ATMA 3GCHB 1C2JA 1J17T 3DT0H 3TK6A 1P01A 2FOCA 3M5MA 1GJ6A 3RUOA 2VIOA 1QNJA 2ZZUH 2R2WU 2FX4A 2M5TA 2BX4A 1GHAG 3VXEH 5C2ZA 1CGIE 2F9NA 1B0EA 1TONA 2ULLA 4HFPB 1HAVB 3UOPA 2GVFA 2DUCA 2FIRH 3VEQB 1DICA 1H4WA 1Z8IB 2K1QA 3OX7U 4MPUA 5EPYA 4IBLH 3B23B 1JRSA 2IJOB 4Y7AA 4X0WU 1EPTC 5B6OA 3BG4B 4XBCA 4FUDA 1G32B 1ANBA 3BTKE 3P95A 4Y76A 3FP8E 2BM2A 2VIVA 3JZ2B 4FUBA 1H9LB 4NG9H 4WJG2 3RMLH 3TNTA 1O33A 3KHVA 1AE8H 3SNAA 4X8VH 1BA8B 3T25A 4VGCB 3LIWA 1O5BB 1FQ3A 1F92A 1W2KH 3T5FH 1DY8A 1FAKH 2G55A 3QUMP 2Z9LA 4Y0YE 1EB2A 1O2HA 2C8YB 1CT2E 4BNRA 1C1WH 1KLIH 1C5WB 2BZAA 1ZMNA 1GMCG 3UIRA 3ZZ7A 1TIOA 1ETTH 1THPB 2ANWA 4NCYA 1F0RA 1ORFA 1SGYE 4AGKA 2FEQH 3E16B 3KQCA 2J94A 1SGDE 4MPVA 1CE5A 2RDLA 3B8JA 3M5NA 3PROA 1MQ6A 3LT3A 2HPPH 3A7VA 1GL0E 1HUTH 3VXFH 1QRXA 2G51A 1DS2E 3SQEE 2J9NA 2ZFPH 3OYPA 1LCYA 1C1UH 4CRDA 1BRBE 1DM4B 2Y5HA 1V2UT 1LKBA 3SHAH 2BLOA 2A5KA 1HAHH 4U2WA 3A86A 1C1VH 1O5CB 1GMHG 4KTCA 1MTNB 3O8RA 1JRTA 1O2MA 1UCYE 2ZNKH 1FMGA 1P2MA 2WINI 2A4GA 1ZJDA 1BQYA 4CRGA 4CRBA 1M9UA 1QBOA 4LOYH 1GHBF 1FPCH 4B76A 3BEIB 3TK9A 2AGEX 1PPFE 2ZP0H 1O5AB 4WVPE 4AZ2B 4WH8A 1ZPBA 3MU0A 3A88A 4AN7A 4WMFA 3GY8A 4F4OC 1GCTC 2G5VA 4DURA 1GJAB 2A7JA 2GD4B 3F9HA 4BAHB 1XKAC 1LVYA 4FUEA 3LGIA 2FOAA 6LPRA 4D7FA 1YPKH 2OC1A 1KY9A 1Z6EA 3MO9A 1AUTC 1TNGA 1WTGH 4I7YH 1JOUB 2F9VA 1CSOE 2FOBA 5K0HA 1O2GH 1Y3XA 1IQJA 1EOLA 4ABJA 1O2RA 3D62A 1KLTA 1ZMJA 3SNEA 5A0CA 3MH5A 5FAHA 1P10A 1BRUP 1JIRA 1P02A 2XC0A 2HNTC 1D3PB 1GBIA 2C8WB 1AKSA 1C5VA 4CRFA 1QL8A 7GCHG 5GCHF 3BTFE 1O3JA 3JZ1B 2XWBI 3RXFA 3TITA 1LKAA 3V3MA 1WBGB 2ZDAH 5A0BA 3V7TA 3A7XA 1K1NA 2ALPA 4X1NU 1G2MA 1AMHA 1GG6B 2ZECA 3H7TA 1F5LA 1RJXB 1DLEA 2PWXA 2IOTA 2ZDLA 1GCDA 1C5OH 1DDJA 3SJ8A 1E37B 3RU4T 2H1UA 3RMMH 4GLYA 1C5NH 1V2WT 1V2RT 1FAXA 1HAOH 4Q7ZA 3HGPA 4K1EA 1CBWC 1S5SA 2FO9A 4Y11E 1BMMH 2ZDKA 3QWCH 5DPAA 5T3HA 1ZPCA 4I8GA 3HKIB 2OINA 1NO9H 1N6YA 1XVOA 2CHAC 1PPCE 1XXDA 3MH7A 1AKSB 2AERH 2G4TA 1Z71A 2THFB 3EA8A 3U69H 1MD7A 4X8SH 2JH6D 1OP0A 1P03A 1C2MA 1O31A 1EJNA 3UOUA 3AAVA 2OBOA 1AVXA 2VWMA 2FI4E 4Y79A 1BMAA 5T6GA 1JWTA 2O8LA 3PO1B 3KL6A 1O2OA 2BLVA 1O2XA 3ZVFA 3UQVA 3FFGA 1VJ9U 1C2KA 5DP4A 2ZGBH 2VWOA 3Q3XA 2BTCE 1UVTH 2Y5GA 2VIDA 3D65E 1FNIA 1Y3YA 1MBMA 4HGCA 3A7WA 2GP9B 3KN2A 1SGIB 2FMJA 1FN6A 4O9VA 3ODFA 1HLTH 5DG6A 1WAYB 1HB0B 1U6QA 4BXSA 4CR9A 1NFYA 4ABFA 4WXIA 2FYQA 1QCPA 2AEIH 5DGJA 5DP9A 4TY7A 1YF4A 2W3KA 5F8ZA 1HAIH 1GDUA 3SUDA 1O2ZA 1Z6JH 1S82A 3DFJA 1GPZA 4MNWA 1OXGA 2WYJA 2ZDVH 3F1SB 2F9PA 3Q77A 3MTYA 3M5OA 4AFUA 1DVAH 1HJAB 4MTBA 1O2LA 2PLXA 2EC9H 1QHRB 1VZQH 2VU8E 1GMDG 3OY6U 1ZRKA 1AWFH 2NU1E 1AZ8A 5HYOA 1UVUH 1MTVA 2A2XH 3U1IB 1O3PB 2A32A 1C4V2 1D9IA 1V2QT 2W26A 3NWUA 2ODQA 1TE0A 1D4PB 2ZO3H 1FY8E 1V2PT 4NZQA 1IQLA 3IG6B 2DE8A 4IS5A 3UR9A 4BOHA 3A8AA 4FXGH 3RXKA 4E7NA 1T8MA 4AOQA 4Y6DA 2GKVE 1PPEE 4A5TS 3QTOH 4Q7XA 1QJ7B 1HAYB 1H8IH 4XFQA 2QF0A 4NFFA 2CGAA 4FUFA 2BDGA 1H1BA 4AFZA 1C1PA 1SGQE 2CV3A 1P2OA 1EOJA 1BTZA 3P70B 3KIDU 3O8BA 4K2YA 1C2FA 1L4ZA 4O03A 1T32A 4WF8A 2BYAX 2F9OA 3OSYA 4OS1A 3F6UH 1O2KA 1O3GA 2ZHFH 3RXHA 5L6NH 2A5IA 3MU1A 2W5EA 2G00A 3RXQA 3MU4A 1BTWA 1XUJA 1VITG 1W14U 1TBZH 5FBIA 1GVLA 1RXPA 2VIQA 2Z9KA 1TYNA 5JB9S 2WV5A 1TPSA 2ILNA 4INHA 1B7XB 1EZXC 4E05H 3MU8A 1ABIH 5EQRA 2ZFSA 3EAJA 1UCYK 2QA9E 1HXFH 3LGUA 2HPQH 1LPGB 3ZVAA 1O5GH 4ZHAA 1AE5A 2ZU5A 5ESTE 4ZHMU 4ABEA 2FOEA 3UQOA 1XMNB 1DXPA 3RXCA 1HRTH 2PV9B 3U8RH 1EQ9A 1O34A 1Y5BT 1ETRH 1ELBA 1EJAA 1C2EA 5IYTA 1YPLH 3SQHE 4ZUHA 1EAIA 1GJ5H 1MQ5A 1TOCB 2G52A 1GBTA 2A4OA 1AFQC 2ZWLH 4BTIB 1ETSH 1MKWH 2H9TH 1BIOA 1UK3A 1GGDB 1PQ5A 2WPLS 4ZROA 1GI7B 4NIVA 4NWKA 1DFPA 3K6ZA 5LH8A 1CA0C 1MCTA 1PQ8A 1V3XA 4MNYA 3SO3A 2ZCKP 2P94A 2PUXB 3QTVH 1GI4A 1MBQA 1TNHA 4X6NA 4U30A 5HMAA 1LO6A 1D6RA 2VINA 1EXFA 3WY8A 5AFYH 4E06H 4Z6AH 1C1TA 6GCHG 1SG8B 1GHZA 2SGDE 2JETB 2TGTA 1Y59T 1LPZB 2FZZA 1O2JA 1OP8A 2HNTE 3S7HB 1O5EH 1EPTA 2O8UA 4FU9A 3PM3A 8ESTE 4FU7A 3SU1A 3T26A 1GI5A 2BB4A 1YCPM 3LGTA 3BTGE 3PTBA 4SGAE 3ZVGA 1K1OA 1PYTC 1O2NA 1J15A 1TAWA 1P2QA 1FZZA 3TGJE 4YZUA 3A8DA 3BTDE 2WUBA 1DOJA 1TGTA 4I32A 3SGAE 1O36A 1GI9B 3GYMA 5C1YA 3ATIA 2PHBA 3LJJA 1S0RA 5E0JA 4BAQB 5JYIA 1C2IA 1WTHD 4AORA 1CQQA 1PQAA 2OC0A 5C20A 1P06A 2BDIA 2G81E 3F68H 1TA6A 4BTUB 5AHGH 1AB9C 1NN6A 1FXYA 1O3NA 4KP0A 1B0FA 1NROH 3TVJB 1QBVH 1C5PA 2AGIX 2FESH 3VB4A 5LPEA 1F5KU 1TWXB 1H9IE 3Q3KA 1SLXB 4B1TA 4B73A 1GJ8B 9ESTA 1GWAA 2QF3A 1ELFA 1N1LA 1HNEE 2VB0A 3UNRA 4AYYB 2BQWB 1J16A 1P12E 5I46H 4D9RA 3LGVA 2SGPE 2PGBB 1F0UA 2WV4A 1ELDE 1LVMA 1SL3A 2P3UB 4FUCA 4I8JA 1K1JA 2P3FH 4DVAU 2OQUA 2HGTH 4YOJA 1S6HA 4X2WA 1AO5A 3TJUA 2TRMA 1O2YA 2R2MB 2Z9IA 3E1XB 3DD2H 4ESTE 1PPBH 8KME2 1H8DH 4MPWA 4GHQA 3E91A 2ZGJA 4AG2A 1C9TA 1IQKA 1GJCB 1P04A 2NU3E 2ZFRH 4JZDH 1SOZA 4ZMAH 1G37A 1OOKB 1Y3UA 2ZHDA 2SNVA 1TBRH 1CVWH 1W8BH 2VH6A 3S0NA 4CR5A 3URCA 2GTBA 4I31A 5J4SA 4CBNA 1O3LA 3MNBA 3ZZ3A 1ZLRA 1FIZA 2BDBA 3UREA 1Z8JB 4DJZB 4KKDA 4X1SU 1WU1A 3DA9B 5A09A 4Y8YA 1NZQH 3NCLA 1AGJA 1SGPE 5EPNA 1XUKA 3RXOA 3G01A 1C5UA 4OS7A 1P11E 4ZAEA 4GAWA 3GDUA 3GY4A 2J2UA 3AW0A 3RP2A 4FUGA 3RM0H 5H4IB 3TJNA 2O8WA 1A0HB 1PYTD 5DK1A 3RC5A 3ZZ6A 4DGJA 4DIHH 4ISIH 1A2CH 1NRQH 1O32A 5JBTA 2FWWA 1YLDA 1CT4E 3TLOA 1AIXH 2QXJA 4BTTB 2Z3DA 4D76A 1TQ7B 1PFXC 1TLDA 4YESB 4B71A 1TNLA 3RXVA 1GBJA 5HM2A 1S0QA 2YNAA 1NTPA 2UUJB 3S7KB 1SB1H 3M36A 1B5GH 2HWLB 2ZGXH 1T8OA 1UTOA 2A0QB 1TMTH 1E0FD 2ZTZA 4Y8XA 4TWWA 2XW9A 3IITA 1O3BA 1P09A 1TMUH 1KDQA 4LK4A 7ESTE 3A7TA 2RA0A 3PTNA 5LPFA 5L2YH 1YLCA 1MUEB 4FU8A 4ZKOU 4MQAA 5A8ZA 1YPMH 1YKTA 2BDCA 5TCCA 1SLUB 1MKWK 1AUJA 1ZZZA 3RLWH 1QB6A 2A5AA 1VJAU 2XXLA 3BTTE 5DP7A 1UJ1A 4XSKU 3URDA 3EYDA 3SNDA 1LHFH 1PPHE 2GDDA 3LC5A 3LGYA 5DP3A 1RTKA 4AYVB 4DG4A 1O2PA 1YPGH 2HOBA 5A2MH 2Q6FA 2ZGCA 3LGWA 2AGGX 3PLBA 3C1KA 1YGCH 5CE1A 1MU8B 2OXSA 1YYY1 1T7CA 1LVBA 1O2WA 2F3CE 2ZU2A 1FUJA 1SBWA 4X6PA 2A31A 2O9QA 4UEHH 3VB6A 2BXUH 2I6SA 3A89A 2OUAA 1O3IA 4JMYA 1WSSH 1ZGVA 2ZHQH 1TABE 9LPRA 4JCNA 1G3CA 3M37A 4INLA 5I25A 1JMOH 1ZTJA 3SGQE 1GHXH 1TALA 4HI3A 2TGPZ 1TGNA 1KDQB 1IQNA 4FUIA 4MLFB 4M7GA 2EI8A 1DLKB 4ZKRU 3OY5U 1CU1A 3GCHC 3M61U 1JIMA 2HVXA 3QGJA 5GCHG 3EGKH 1WUNH 1ZSJA 2AS9A 5TJXA 4NZLA 1GBKA 3MI4A 3E90B 1GVZA 3SU6A 2H5DA 1INCA 2ZTYA 4NFEA 3Q00A 2ZCLP 1P3CA 5E2OA 3BTEE 3QZQA 4H6TA 4CH2B 4UDWH 3NPSA 1C5LH 2R3UA 1BTXA 1THSH 3RXPA 1GI0A 3Q76A 3AW1A 3MYWA 3P17H 4J2YB 4ABGA 3HK3B 1QRZA 2H9EH 3CS0A 3GISB 4H4FA 5A8YA 2FOFA 2GMTB 1T4UH 4YO9A 4RKJB 4WMDA 3SI4H 3BG4C 4I8HA 2D2DA 2V3OH 4UFDH 1C5RA 3MO3A 3EDXB 2P8OB 1L1JA 1HCGA 3ZVBA 3MMGA 5DJ7A 1LTOA 1DX5M 4K1TA 1HIAA 1AY6H 1A46H 3ZZCA 1GBHA 2OQ5A 1Z1IA 3BF6H 2CF9H 2EEKA 4VGCC 1SQOA 2AIPA 3UPEA 3FAOA 2XBWA 2OCVB 1QTFA 3L33A 1GI3A 4D8NA 3KQBA 1Q3XA 1Z8GA 2RG3A 2VNTA 4LXBH 4DCDA 1Q2WA 3P8OA 1CHOF 4NSVA 1QL9A 1TX6A 2GV7A 1C5SA 4IW4E 3ZZ4A 1JBUH 1GDQA 4FUJA 2HALA 1RRKA 4JZIA 3I29A 4K3JA 1LHEH 5GDSH 2ZQ2A 1HYLA 1SLVB 2C3SA 3GY2A 5IDKA 3RXTA 1LHDH 2VH0A 1LPKB 4AB8A 4I8LA 2QYIA 1ELGA 1UHBA 2VIPA 3U1JB 3L3TA 1EASA 5LGOA 3U9AH 3PV4A 2VVUA 1GMHF 5DP8A 1ACBE 3BTWE 1ANEA 1OWJA 1LMWB 3DUXH 1IQMA 2V3HH 2V35A 4YLQH 1SR5C 3QGNB 2Z7FE 1A0JA 1P05A 5FXLA 1MTNC 1VR1H 3FZDA 1RGQA 3U98H 1P57B 1GHYH 4X1RU 1E36B 3TH2H 1NY22 1BB0B 1EZUC 1YCPH 1KXEA 2ALVA 2G5NA 2QXIA 2STAE 2Y82A 3D49H 1NU7B 2PW8H 3T27A 4A1VA 2BD7A 1C9PA 2XCFA 1BTYA 4OS6A 1O2TA 2P95A 3SJ9A 1SFQB 3VGCB 3SU3A 5A0AE 1KLJH 1EJMA 1KXCA 4GCHF 1SGCA 1UTJA 5DKMA 3IWMA 1SGFA 1TX7A 1ARCA 4Y8ZA 1YC0A 2Z9JA 3NKKA 2B9LA 2XWAA 3TJVA 1QA7A 2EI6A 2B8OH 3M35A 4CHAB 5L2ZH 1VCWA 2YOLA 3A85A 1K9OE 2DE9A 3RXSA 4A6LA 3QZRA 2CXVA 1A0LA 3O8CA 1TPOA 1UVOA 1A1RA 2C8ZB 2BMGB 1AN1E 3HPTB 4R0IA 3QLPH 1S6FA 1FV9A 1CA8B 2PSXA 2FLRH 2FM2A 1K28D 3PYHA 4O3UA 3OU0A 2PKSB 1FONA 3P8NA 3ATWA 2QXGA 3M7QA 3PMAB 1BT7A 2H2ZA 1GHWH 3A84A 1BDAA 2OP9A 1A3EH 5EW1H 2OTVA 3GDVA 3BV9B 1XUGA 5EQSA 3QK1A 3RXIA 1ID5H 1SGRE 5C67A 1GI6A 4K8BA 3MWIU 3F9EA 2XBYA 1FY3A 3HKJB 4UFFH 2EI7A 4AG1A 1AU8A 2PR3A 2CMYA 4DW2U 4CH8B 1GG6C 1DWDH 4H6SB 1IQFA 2XBVA 3L6PA 1XX9A 2ZQ1A 5T6DA 1MZDA 2ASUB 2FTLE 3UWJH 1K1IA 1GBCA 1P2JA 4H42U 1ELVA 1IAUA 2ZHWH 2JKHA 5EGMA 4AB9A 2J95A 3A80A 4NA7A 3F9GA 2HLCA 2CF8H 2ZPSA 3OTJE 1IQIA 1FPHH 3M7TA 1OSSA 2O8MA 5E8EH 3M5LA 4YOGA 1KSNA 4MPXA 1WOFA 1EAWA 1BTPA 1GDNA 1F7ZA 3UY9A 2B7DH 4X2XA 3LJOA 1L1GA 5GJ4B 1LVOA 2BD3A 2RCEA 2QCYA 3A7YA 8LPRA 3F9FA 3AVZA 1PPGE 2BVRH 2BVSH 3MNXA 1F2SE 5CHAB 1DSTA 1HV7A 1QIXB 1VITH 1VGCB 2Q1JA 1O3MA 1O3FA 2J4IA 3M3VA 1MTUA 1QBNA 3PO1C 4R8TB 2B0FA 2RA3A 4ZKSU 2FXRA 3GDSA 1MAYA 1ZHMA 4Y10E 1HDTH 2AH4X 4NIWA 3K65B 1YM0A 1G3BA 2R0LA 1T8LA 2ZCHP 4MG3A 1UTQA 2BY5X 1QL7A 1RIWB 3PLKA 3RXMA 2P3TB 3BSQA 1ZMLA 1HXEH 7LPRA 3H5CB 3KEEA 2HRVA 5AVDA 1FI8A 3TIUA 3MH4A 4D9QA 2SFAA 1C4Y2 2ANKH 1NT1A 8GCHF 2Z6BD 1EP5A 1Y5AT 4JZFH 3W94A 1OWEA 3A7ZA 3SU0A 4IGDA 2WPIS 1HJAC 3PB1E 1QFKH 1MZAA 1GJBB 2R0KA 2FPZA 3ZV8A 3ITIA 1MU6B 1TPAE 3VB5A 1NRSH 1SGTA 2NU0E 4XBBA 2BD5A 3K9XB 3UUZA 4THNH 2BZ6H 1ZR0A 2FOHA 1E34B 2J92A 4HTCH 3BN9A 3BIVH 3CS7A 5K7RA 3RC4A 5CMXH 5FCKA 2H6MA 2QN5T 3TGKE 1C2GA 3RXUA 3SV7A 2OD3B 4A1TA 4ISLA 3RXAA 5LPRA 2GCTB 1RFNA 1SHYA 1IOEA 2BQ7B 4BXWA 1BHXF 4J1YA 4XOJA 2Z3CA 1N8OB 2FOMB 4JZ1A 3P92A 2P16A 4JYTA 1ZYOA 6CHAB 2LNCA 2GCHG 4ABIA 5E0HA 3A87A 4Q7YA 1EX3A 4BAOB 2Y7XA 3T28A 1G36A 5J4QA 2TBSA 1IQEA 1LHGH 2BD9A 2ZGHA 1FN8A 1W10U 1K1PA 4AGJA 1TQ0B 2BLQA 1MH0A 2ZDMA 2VGCB 2R3YA 3SZNA 3RXGA 3KF2A 3ZVDA 1F5RA 2WUCA 5A8XA 4I8KA 2ZC9H 1BCUH 3BIUH 1DITH 1QURH 4DY7B 1OPHB 3UWIA 1NFXA 1TGCA 2BY9X 1GHVH 3STIA 3M7UA 3NXPA 2NU4E 1GJ7B
chains in the Genus database with same CATH superfamily
1HGTH 3O8DA 2W7UA 5BRRE 3SNBA 1BBRE 3P8FA 2I6QA 3TNSA 4B2CA 1ARBA 4BAKB 3RXBA 4NGAH 3F0PA 1O3AA 4ABDA 1EP6A 1OKXA 1UTPA 1ELEE 1EPTB 4X1QU 3ZZAA 5T6FA 3E0PB 4RT0A 4HZHA 3SJKA 1C5TA 3EQ0H 2OLGA 3SJIA 3ZVEA 2Y6TA 4I33A 4OS4A 1D6WA 1FJSA 1F0TA 1TRNA 2GDEH 3KQDA 4WH6A 1BUIA 5FX5A 4WMEA 1P2IA 1GGDC 3E8LA 4FVBA 2TGDA 4AFQA 4DT7B 1COWD 4TYDA 2TGAA 2AMQA 3UR6A 2KAIA 3KNXA 4FETA 3I78A 3SZEA 5JBAS 3ELAH 3ZZ5A 2WPJS 1V2NT 2SGAA 1QRWA 3C27B 5EOKA 2OC7A 1O3KA 1C1RA 2A7HA 2QIQA 5C5NA 1SOTA 1TGSZ 2GZ9A 1C1SA 2ZI2H 1SVPA 1PQ7A 4K69A 3LONA 3LPRA 2A1DB 3ESTA 3PV2A 2JETC 1ZSLA 1BBRH 1O2IA 1AWHB 2YMSD 2PTNA 5FHTA 1A7SA 3NRLA 4ZH8A 5JDUB 3QN7A 4GHTA 4AX9H 4MVNA 4NA8A 4IC5A 1DT2A 2C90B 4F49A 4JYVH 1SC8U 2GV6A 4GUXA 3W1EA 4X8UH 3MHWU 1W7GH 3T29A 4Z0KA 3ZVCA 1UTKA 2XYAA 4LZ4B 1NRRH 5EXLA 1C1MA 1Z1JA 3FP7E 4D7GA 1GI2A 2SGQE 1L2EA 1V2JT 1Y5UT 3U8TH 1O3HA 4JK5A 3BTQE 2WPKS 3LU9B 1P2NA 3SV9A 4X8TH 1K1MA 2KAIB 3PWBA 2WZQA 5GWZA 2J38A 1D3DB 1NM6A 4Y0ZE 4OGYA 4B75A 1YPJH 4TPYA 1YPHC 2ZHEH 1HFDA 5SGAE 1AVGH 2A45B 4CBOA 1FY4A 1TNIA 2R9PA 1V2TT 2AMDA 3FANA 2FP7B 3GCTF 1P9UA 3KQEA 1GBFA 1XVMA 2ODPA 1K2I1 1ZGIA 3TJOA 1EAXA 3UTUH 5EXMA 1MD8A 2HNTF 2AMPA 5HGGA 3PLPA 1AZZA 4K1SA 2QXHA 1GHBG 1QQ4A 1G30B 5FPSA 1J8AA 4UFEH 1IQGA 1PPZA 1EFRD 1A5GH 1GCTB 1TGBA 3MNCA 3SU4A 4O3TA 2D1JA 1NU9A 2UUKB 4ABBA 3LDXH 4IC6A 3WWBA 3V13A 2FDAA 3EE0B 3GOVB 4TWYA 1KXFA 1O5FH 5EG4A 2V6NA 4BAMB 3CP7A 1EATA 2GT8A 2D26C 3SGBE 1GBDA 1AVWA 2F83A 5G4BA 3ZV9A 1RTFB 1O2QA 2AYWA 1THRH 1WCZA 1DSUA 4K8YA 1EAUA 3V0XA 2FI5E 3DSGA 1C5XB 1W3CA 2L74A 2RDEA 3N7OA 1DY9A 1PJPA 3ZIAD 4F55A 1V6DA 2BVXH 1AHTH 3U8OH 3PV5A 1DUEA 2ESTE 1CHOG 1GHAF 5GPIB 4Q80A 1LHCH 1W12U 3RU4D 4ISOA 1TBQH 5F8XA 4FVDA 1A5IA 3ZYDA 2ZU3A 1UVPA 1C2DA 2V0BA 3W95A 2IN2A 3R3GB 2W6ID 4ZCNA 1FDPA 1GJ4H 2W7SA 3VPKA 1FY1A 2FX6A 1TPPA 2Y5FA 2ZKSA 4UE7H 4A7IB 2UWLA 4RSPA 1CBWB 1GJ9B 1WQSA 1AQ7A 1K1LA 1D3TB 2VWLA 1W0JD 1WV7H 5C0TA 3PMHB 1FIWA 3UNQA 3NUMA 1UMAH 2QGRA 1HAZB 4OS5A 2IPHA 2VIWA 1OP2A 2CHAB 4NSYA 2ZFFH 2HVYB 3ODDA 5DO4H 3FZZA 4A1XA 1A4WH 1NBMD 2ANMH 2BY7X 1TFXA 3ENSB 1SMFE 1BJUA 4SGBE 5EW2H 3V12A 1CGHA 1GMCF 1QB9A 2A2QH 1E38B 3BEUA 2UUFB 5FX6A 2SGEE 4A92A 3A81A 1ZHPA 4RN6A 5F8TA 3RLYH 4B74A 5FPYA 3T2NA 4GCHG 5F6MA 1A3BH 3PRBA 4XDEA 1VCQA 2JH5D 3GCNA 5F03A 2ODYB 1W13U 2W3IA 2C4FH 1NRNH 3GY7A 2ZTXA 3SORA 3VB3A 1T8NA 2BQ6B 4MDSA 2RFKC 1UTMA 3BEFB 3BG8A 3RXRA 1X7AC 2P93A 2A7CA 4Y71A 2VJ1A 4U32A 1CT0E 1XUIA 3LH3A 2SNWA 1S84A 1SGNE 1HBTH 2CN0H 5HKKD 1IHTH 5EXNA 1SGFG 4IN2A 1MKXH 1UCYH 1BBRK 4TT3D 2QV1A 1DE7H 1EZSC 5EQQA 2VBCA 5B6LA 3SU2A 3SUGA 1GI8B 1HIAB 1DWCH 1KMHB 1SLWB 1KXBA 2D8WA 4KELA 4ABAA 3ATLA 4YT7H 5GXPA 1ZSKA 2XBXA 2EA3A 3P6ZB 2BD2A 1P8VC 1AFEH 1O5DH 1SQTA 1XUHA 2A4QA 4ZKNU 4YOIA 1GI1A 1OWIA 1OYTH 1P9SA 1ZJKA 1O37A 4FUHA 5L30H 4B2BA 1J14A 4KTSA 3SV8A 2FS8A 4CRAA 1S83A 2OK5A 2BDHA 4CREA 1W0ZU 4WY3A 4E7RG 4JK6A 4TPIZ 1KTSB 3UFAA 3T62A 1NRPH 1J9CH 2B5TB 5FBEA 1P2KA 5BPEA 5EODA 4I86A 3GYLB 3MH6A 1P3EA 1DUAA 1S81A 2FYRA 3TPIZ 1C2LA 1BZXE 1WYKA 2GMTC 1RTLA 3EA7A 1O30A 3GCOA 2NWNA 1C1OA 1ELAA 3RU4E 2Q6GA 3RDZA 1LQDB 1OX1A 1UHBB 2ZU4A 4X1PU 4YT6H 2P8OC 3RMOH 4MNVA 1E35B 3SNCA 1NPMA 1BRCE 2BDYA 3B9FH 4X2YA 2GZ8A 1YPEH 4KTUA 1C5MD 4DIIH 1FLEE 1ESTA 1TNJA 2G4UA 2WPMS 1MMJN 3S9AA 2ZPQA 1YBWA 2IPQX 1UTNA 5TCAA 1AD8H 4OGXA 4XE4A 7GCHF 1BITA 1MTWA 1C5YB 2KR7A 2ZFQH 1TA2A 1NFUA 4UONA 5AFZH 2PTCE 3RXJA 3AAUA 1BOQA 3SOSA 2XC5A 2YNBA 3K2UA 3F2GA 1EB1H 3A83A 2Z94A 3BTME 1CHGA 1V2ST 4GSOA 2SGFE 5C1UA 2UUYA 3Q3YA 1C1QA 1QQUA 1YPHE 1Z8RA 2PUQH 2BX3A 4O97A 3FVFB 1A61H 3U28C 3FKSD 3QX5H 4MNXA 1XKBC 2WYGA 1ZOMA 2FS9A 3PWCA 1F0SA 1ZHRA 1O2UA 2TIOA 3MNSA 3ZZBA 5JBCS 1KXAA 4NA9H 2PKAA 4CRCA 1Y8TA 3DCLA 1W0YH 4X2VA 2UWPA 2PFEA 2KCAA 1QR3E 1AFQB 1UK2A 2FTMA 2BD4A 1HAPH 1ABJH 3MU5A 2XNIA 3PMBB 1BRAA 1OS8A 3STJA 3SUEA 1DWEH 4IMQA 5DN6D 4XRNA 1UTLM 5PTPA 5AF9H 8GCHG 1LQEA 1T4VH 1Y3WA 1ZPZA 3I77A 2FODA 1ELTA 1OHHD 1CA0B 3DHKH 1XM1A 3RXDA 1EKBB 2BHGA 3A8BA 4KGAA 3ZYEA 2H5CA 2GZ7A 4K5ZA 1NC6A 1QA0A 1UO6A 5FPTA 5GIBA 1FY5A 1OWHA 2GX4A 1UK4A 3TK5A 4U01A 1QY6A 2QF4A 1ANCA 5E0GA 1TX8A 4IN1A 3GY6A 3VGCC 2QC2A 2Y7ZA 4PROA 1TOMH 1V2MT 3SI3H 2CJIA 4NIYA 3SJOA 3E6PH 1V2LT 3PMJA 1G9IE 4XBDA 3QO6A 5DP5A 3RMNH 3K6YA 5HM9A 2AIQA 5EU8A 1IQHA 2GT7A 2PSYA 2F9BH 2LPRA 2O8TA 2XC4A 3MOCA 3E3TA 2Q6DA 4ABHA 2FOGA 1HAXB 4YTAA 4CHAC 1ZRBA 1KIGH 4Y7BA 2PKAB 4X6OA 1O0DH 1O35A 4DOQA 5HXFA 1V2KT 3SV2H 1HJ9A 3UNSA 1YP9A 1Q31A 3LC3A 1ZTLA 1BMNH 1MTSA 1AB9B 5DP6A 2ZDNA 2ZPRA 2PKSC 3MO6A 1N6XA 3S9BA 2FI3E 1SQAA 3HATH 1W11U 2ZIQH 2P59A 4JZEH 1O2SA 1GMDF 4ZXYH 4UFGH 3GY3A 3ATKA 1Y3VA 1MKXK 1XUFA 3VG8A 1QGFA 4QT8C 3GICB 2C8XB 1C4U2 3P8GA 2JIZD 1SFIA 1L1NA 4WXVA 1JXPA 5JBBS 2QAAA 2F91A 1NS3A 2XCNA 5ETXA 3OAAD 1G3EA 2CK3D 2A4RA 3D23A 1CO7E 4ISHH 2ZFTA 2OBQA 1P0SH 1SGEE 1C2HA 3AK5A 3M3SA 1EZQA 2YMSC 1QJ6B 3RM2H 2H9HA 4UD9H 7KMEH 1QJ1B 1YCPK 1ELCA 1RS0A 2GGVB 5C5OA 3NK8A 1V2OT 4INKA 2BXTH 1TNKA 1SPJA 2WPHS 1ZTKA 3SUFA 4IMZA 1OYQA 5E2PA 3AASA 3TU7H 1IHSH 6ESTA 1VCPA 3RC6A 4ASHA 1C5ZB 2ZF0H 1RD3B 3ZZDA 2ZEBA 4OS2A 2QY0B 1Z7KA 1GBLA 2Z9GA 4GVUA 1MAXA 5ESBA 1NFWA 1VITF 1O2VA 5CHAC 3ZZ9A 1DPOA 2BY8X 1QB1A 1VGCC 1DANH 4B2AA 1C5QA 4YM9A 2XTTB 1H9HE 3DFLA 3A8CA 3SN8A 1L4DA 2K0QA 2BOHB 2ZU1A 4F48B 3H7OA 2FLBH 4RKOB 2G8TA 1BTUA 3VFEA 4DT4A 3SW2B 1UVSH 1BHXB 1L0ZA 1DWBH 3N7EA 4NWLA 1ESBA 4X6MA 1RIWC 2NU2E 1KTTB 2AHME 2ZA5A 5FCRA 2VVCA 3GY5A 3MFJA 3R0FA 1BMLA 2VWNA 3LKWA 1GJDB 3NZIA 1T31A 2Z3EA 4BANB 1K22H 1O3EA 2BDAA 1SSXA 2VVVA 1KXDA 1SHHB 1BJVA 2J98A 4TY6A 2KFWA 3QDZB 3FP6E 4WWYA 2TPIZ 2BLWA 1ESAA 1BTHH 1OWKA 3F2HA 2PP6A 2KZ4A 1NESE 3CENA 5ABWA 3RXEA 4JYUH 1D3QB 3N7DA 1O3CA 4P00A 1TB6H 2ZG0H 1TRYA 3S69A 1MCVA 3SU5A 2JH0D 2UWOA 2STBE 4LZ1H 1A5HA 2PGQB 3HK6B 4ZHLU 3GCTG 4ZXXH 3RXLA 1CGJE 3VB7A 3ZZ8A 2Y80A 2ANYA 6GCHF 4K60A 4ISNA 1HAGE 1GBAA 2LP6A 5C3NA 3SV6A 1O3DA 3M3TA 1KYNA 1HAVA 3UB0A 3LH1A 2GJGA 2OC8A 3SHCH 5C1XA 1GL1A 3EA9A 1GBMA 1O38A 1W7XH 4GPGA 1V2VT 1TMBH 1OWDA 1C1NA 2GCTC 2J34A 3TH3H 3A82A 2BOKA 2GCHF 1K21H 2AFQB 2F9UA 3TH4H 3S9CA 1DXWA 1O39A 4YLUA 1N8OC 1GBEA 2XRCA 1GBBA 4Q2KA 1HJ8A 6CHAC 1AI8H 1ANDA 2V7QD 3HGNA 1EUFA 1G3DA 4AFSA 5JB8S 2C93B 3E0NB 1XXFA 3LOXA 3KGPA 5EJLA 2J98B 3KCGH 1E1QD 3BTHE 5HIYA 1BMFD 3TGIE 1S85A 1G2LA 1UW7A 2BY6X 1SI5H 1WQVH 3SBKA 2BD8A 5JPMH 1O3OA 3MQKC 1HPGA 1LDTT 1GVKB 1TRMA 2VGCC 2Y81A 4NIXA 3ATMA 3GCHB 1C2JA 1J17T 3DT0H 3TK6A 1P01A 2FOCA 3M5MA 1GJ6A 3RUOA 2VIOA 1QNJA 2ZZUH 2R2WU 2FX4A 2M5TA 2BX4A 1GHAG 3VXEH 5C2ZA 1CGIE 2F9NA 1B0EA 1TONA 2ULLA 4HFPB 1HAVB 3UOPA 2GVFA 2DUCA 2FIRH 3VEQB 1DICA 1H4WA 1Z8IB 2K1QA 3OX7U 4MPUA 5EPYA 4IBLH 3B23B 1JRSA 2IJOB 4Y7AA 4X0WU 1EPTC 5B6OA 3BG4B 4XBCA 1K0HA 4FUDA 1G32B 1ANBA 3BTKE 3P95A 3SYJA 4Y76A 3FP8E 2BM2A 2VIVA 3JZ2B 4FUBA 1H9LB 4NG9H 4WJG2 3GS9A 3RMLH 3TNTA 1O33A 3KHVA 3F3BA 1AE8H 3SNAA 4X8VH 1BA8B 3T25A 4VGCB 3LIWA 1O5BB 1FQ3A 1F92A 1W2KH 3T5FH 1DY8A 1FAKH 2G55A 3QUMP 2Z9LA 4Y0YE 1EB2A 1O2HA 2C8YB 1CT2E 4BNRA 1C1WH 1KLIH 1C5WB 2BZAA 1ZMNA 1GMCG 3UIRA 3ZZ7A 1TIOA 1ETTH 5CHBA 1THPB 2ANWA 4NCYA 1F0RA 1ORFA 5T1VA 1SGYE 4AGKA 2FEQH 3E16B 3OEHD 3KQCA 2J94A 1SGDE 4MPVA 1CE5A 2RDLA 3B8JA 3M5NA 3PROA 1MQ6A 3LT3A 2HPPH 3A7VA 1GL0E 1HUTH 2XNDD 3VXFH 1QRXA 2G51A 1DS2E 3SQEE 2J9NA 2ZFPH 3OYPA 1YWUA 1LCYA 1C1UH 4CRDA 1BRBE 1DM4B 2Y5HA 1V2UT 1LKBA 3SHAH 2BLOA 2A5KA 1HAHH 4U2WA 3A86A 1C1VH 1O5CB 1GMHG 4KTCA 1MTNB 3O8RA 1JRTA 1O2MA 1UCYE 2ZNKH 1FMGA 5FL7D 1P2MA 2WINI 2A4GA 1ZJDA 1BQYA 4CRGA 4CRBA 1M9UA 1QBOA 4LOYH 1GHBF 1FPCH 4B76A 3BEIB 3TK9A 2AGEX 1PPFE 2ZP0H 1O5AB 4WVPE 4AZ2B 4WH8A 1ZPBA 5C94A 3MU0A 3A88A 4AN7A 4WMFA 3GY8A 4F4OC 1GCTC 2G5VA 4DURA 1GJAB 2A7JA 2GD4B 3F9HA 4BAHB 1XKAC 1LVYA 4FUEA 4XD7D 3LGIA 2FOAA 6LPRA 4D7FA 1YPKH 2OC1A 1KY9A 1Z6EA 3MO9A 1AUTC 1TNGA 1WTGH 4I7YH 1JOUB 2F9VA 1CSOE 2FOBA 5K0HA 2IJD1 1O2GH 1Y3XA 1IQJA 1EOLA 4ABJA 1O2RA 3D62A 1KLTA 1ZMJA 3SNEA 5A0CA 3KYGA 3MH5A 5FAHA 1P10A 1BRUP 1JIRA 1P02A 2XC0A 2HNTC 1D3PB 1GBIA 2C8WB 1AKSA 1C5VA 4CRFA 1QL8A 7GCHG 2HLDD 5GCHF 3BTFE 1O3JA 3JZ1B 2XWBI 3RXFA 3TITA 1LKAA 3V3MA 1WBGB 2ZDAH 5A0BA 2WV9A 3V7TA 3A7XA 1K1NA 4HG6A 1VKYA 2ALPA 4X1NU 1G2MA 1AMHA 1GG6B 2ZECA 3H7TA 1F5LA 1RJXB 1DLEA 2PWXA 2IOTA 2ZDLA 1GCDA 1SKYE 1C5OH 1DDJA 3SJ8A 1E37B 3RU4T 2H1UA 3RMMH 4GLYA 1C5NH 1V2WT 1V2RT 1FAXA 1HAOH 5IK2D 4Q7ZA 3HGPA 4K1EA 1CBWC 1S5SA 2FO9A 4Y11E 1BMMH 2ZDKA 3QWCH 5DPAA 5T3HA 1ZPCA 4I8GA 4P02A 3HKIB 2OINA 1NO9H 1N6YA 1XVOA 2CHAC 1PPCE 1XXDA 3MH7A 1AKSB 2AERH 2G4TA 1Z71A 2THFB 3OTPA 3EA8A 3U69H 1MD7A 1H8ED 4X8SH 2JH6D 1OP0A 1P03A 1C2MA 1O31A 1EJNA 3UOUA 3AAVA 2OBOA 1AVXA 2VWMA 2FI4E 4Y79A 1BMAA 5T6GA 1JWTA 2O8LA 2QF5A 3PO1B 3KL6A 1O2OA 2BLVA 1O2XA 3ZVFA 3UQVA 3FFGA 1VJ9U 1C2KA 5DP4A 2ZGBH 2VWOA 3Q3XA 2WHXA 2BTCE 1UVTH 2Y5GA 2VIDA 3D65E 1FNIA 1Y3YA 1MBMA 3WW7A 4HGCA 3A7WA 2GP9B 3KN2A 1SGIB 2FMJA 1FN6A 4O9VA 3ODFA 1HLTH 5DG6A 1WAYB 1HB0B 1NBME 1U6QA 1H8HD 4BXSA 4CR9A 1NFYA 4ABFA 3F2FA 4WXIA 2FYQA 1QCPA 2AEIH 5DGJA 5DP9A 4TY7A 1YF4A 4TSFD 2W3KA 5F8ZA 1HAIH 1GDUA 3SUDA 1O2ZA 1Z6JH 1S82A 3DFJA 1GPZA 1YY3A 4MNWA 1OXGA 2WYJA 2ZDVH 3F1SB 2F9PA 3Q77A 3MTYA 3M5OA 4AFUA 1DVAH 1HJAB 4MTBA 1O2LA 2PLXA 2EC9H 1QHRB 1VZQH 2VU8E 1GMDG 3OY6U 1ZRKA 1AWFH 2NU1E 1AZ8A 5HYOA 1UVUH 1MTVA 2A2XH 3U1IB 1O3PB 2A32A 1C4V2 1D9IA 1V2QT 2W26A 3NWUA 2ODQA 1TE0A 1D4PB 2ZO3H 1FY8E 1V2PT 4NZQA 1IQLA 3IG6B 2DE8A 4IS5A 3UR9A 4BOHA 3A8AA 4FXGH 3RXKA 4E7NA 1T8MA 4AOQA 4Y6DA 2GKVE 1PPEE 4A5TS 3QTOH 4Q7XA 1QJ7B 1HAYB 1H8IH 4XFQA 2QF0A 4NFFA 2CGAA 4FUFA 2BDGA 1H1BA 4AFZA 1C1PA 1SGQE 2CV3A 1P2OA 1EOJA 1BTZA 3P70B 3KIDU 3OFND 3O8BA 4K2YA 1C2FA 1L4ZA 4O03A 1T32A 4WF8A 2BYAX 2F9OA 3OSYA 4OS1A 3F6UH 2KCYA 1O2KA 1O3GA 2F4LA 2ZHFH 3RXHA 5L6NH 2A5IA 3MU1A 2W5EA 2G00A 3RXQA 3MU4A 1BTWA 1XUJA 1VITG 1W14U 1TBZH 5FBIA 1GVLA 1RXPA 2VIQA 2Z9KA 1TYNA 5JB9S 2WV5A 1TPSA 2ILNA 4INHA 1B7XB 1EZXC 4E05H 3MU8A 1ABIH 5EQRA 2ZFSA 3EAJA 1UCYK 2QA9E 1HXFH 3LGUA 2HPQH 1LPGB 3ZVAA 1O5GH 4ZHAA 1AE5A 2ZU5A 5ESTE 4ZHMU 4ABEA 2FOEA 2KX4A 3UQOA 1WDIA 1XMNB 1DXPA 3RXCA 1HRTH 2PV9B 3U8RH 1EQ9A 1O34A 1Y5BT 1ETRH 1ELBA 1EJAA 1C2EA 5IYTA 1YPLH 3SQHE 4ZUHA 1EAIA 1GJ5H 1MQ5A 1TOCB 2G52A 1GBTA 2A4OA 1AFQC 2ZWLH 4BTIB 1ETSH 1MKWH 2H9TH 1BIOA 1UK3A 1GGDB 1PQ5A 2WPLS 4ZROA 1GI7B 4NIVA 4NWKA 1DFPA 3K6ZA 5LH8A 1CA0C 1MCTA 1PQ8A 1V3XA 4MNYA 3SO3A 2ZCKP 2P94A 2PUXB 3QTVH 1GI4A 1MBQA 1TNHA 4X6NA 4U30A 5HMAA 1LO6A 1D6RA 2VINA 1EXFA 3WY8A 5AFYH 4E06H 4Z6AH 1C1TA 6GCHG 1SG8B 1GHZA 2SGDE 2JETB 2TGTA 1Y59T 1LPZB 2FZZA 1O2JA 1OP8A 2HNTE 3S7HB 1O5EH 1EPTA 2O8UA 4FU9A 3PM3A 8ESTE 4FU7A 3SU1A 3T26A 1GI5A 2BB4A 1YCPM 3LGTA 3BTGE 3PTBA 4SGAE 3ZVGA 1WXRA 2QE7D 1K1OA 1PYTC 1O2NA 1J15A 1TAWA 1P2QA 1FZZA 3TGJE 4YZUA 3A8DA 3BTDE 2WUBA 1DOJA 1TGTA 4I32A 1YLNA 3SGAE 1O36A 1GI9B 3GYMA 5C1YA 3ATIA 2PHBA 3LJJA 1S0RA 5E0JA 4BAQB 5JYIA 1C2IA 1WTHD 4AORA 1CQQA 1PQAA 2OC0A 2V3MA 5C20A 1P06A 2BDIA 2G81E 4Q4LA 3F68H 1TA6A 4BTUB 5AHGH 1AB9C 1NN6A 1FXYA 1O3NA 4KP0A 5KECA 1B0FA 1NROH 3TVJB 1QBVH 1C5PA 2AGIX 2FESH 3VB4A 5LPEA 1F5KU 1TWXB 1H9IE 3Q3KA 1SLXB 4B1TA 4B73A 1GJ8B 9ESTA 1GWAA 2QF3A 2K8IA 1ELFA 1N1LA 1HNEE 2VB0A 5GNDA 3UNRA 2L6OA 4AYYB 2BQWB 2EY4C 1J16A 1P12E 5I46H 4OM9A 4D9RA 3LGVA 2SGPE 2PGBB 1F0UA 2WV4A 1ELDE 1LVMA 1SL3A 2P3UB 4FUCA 4I8JA 1K1JA 2P3FH 4DVAU 2OQUA 2HGTH 4YOJA 1S6HA 4X2WA 1AO5A 3TJUA 2TRMA 1O2YA 2R2MB 2Z9IA 3E1XB 3DD2H 4ESTE 1PPBH 2J97A 8KME2 1H8DH 4MPWA 4GHQA 3E91A 2ZGJA 4AG2A 1C9TA 1IQKA 1GJCB 1P04A 2NU3E 2ZFRH 4JZDH 1SOZA 4ZMAH 1G37A 1OOKB 1Y3UA 2ZHDA 2SNVA 2M2AA 1TBRH 4B6FA 1CVWH 1W8BH 2VH6A 3S0NA 4CR5A 3URCA 2GTBA 4I31A 5J4SA 4CBNA 1O3LA 3MNBA 3ZZ3A 1ZLRA 1FIZA 2BDBA 3UREA 1Z8JB 4DJZB 4KKDA 4X1SU 1WU1A 3DA9B 5A09A 4Y8YA 1NZQH 3NCLA 1AGJA 1SGPE 3H09A 5EPNA 1XUKA 3RXOA 3G01A 1C5UA 4OS7A 1P11E 4ZAEA 4GAWA 3GDUA 3GY4A 2J2UA 3AW0A 3RP2A 4FUGA 3RM0H 5H4IB 3TJNA 1A0HB 1PYTD 2O8WA 5DK1A 3RC5A 3ZZ6A 4DGJA 4DIHH 4ISIH 1A2CH 1NRQH 1O32A 5JBTA 2FWWA 1YLDA 1CT4E 3TLOA 1AIXH 2QXJA 4BTTB 2J5UA 2Z3DA 4D76A 1TQ7B 1PFXC 1TLDA 4YESB 4B71A 1TNLA 3RXVA 1GBJA 5HM2A 1S0QA 2YNAA 1NTPA 2UUJB 3KQ5A 3S7KB 1SB1H 3M36A 1B5GH 2HWLB 2ZGXH 2A0QB 1T8OA 1UTOA 1TMTH 1E0FD 2ZTZA 4Y8XA 4TWWA 2XW9A 3IITA 1O3BA 1P09A 1TMUH 1KDQA 4LK4A 7ESTE 3A7TA 2RA0A 3PTNA 5LPFA 5L2YH 1YLCA 1MUEB 4FU8A 4ZKOU 4MQAA 5A8ZA 1YPMH 1YKTA 2BDCA 5TCCA 1SLUB 1MKWK 1AUJA 1ZZZA 3RLWH 1QB6A 2A5AA 1VJAU 2XXLA 3BTTE 5DP7A 1UJ1A 4XSKU 3URDA 4Q63A 3EYDA 3SNDA 1LHFH 1PPHE 2GDDA 3LC5A 3LGYA 5DP3A 1RTKA 4AYVB 4DG4A 1O2PA 1YPGH 2HOBA 5A2MH 2Q6FA 2ZGCA 3LGWA 2AGGX 3PLBA 3C1KA 1YGCH 5CE1A 1MU8B 2OXSA 3CNRA 1YYY1 1T7CA 1LVBA 3DSOA 1O2WA 2F3CE 2ZU2A 1FUJA 1SBWA 4X6PA 2A31A 4ACBA 2O9QA 4UEHH 3VB6A 2BXUH 2I6SA 3A89A 2OUAA 1O3IA 4JMYA 1WSSH 1ZGVA 2ZHQH 1TABE 9LPRA 4Z1MD 2LELA 4JCNA 1G3CA 3M37A 5EJZA 3EE7A 4INLA 5I25A 1JMOH 1ZTJA 3SGQE 1GHXH 1TALA 4HI3A 2TGPZ 1TGNA 1KDQB 1IQNA 4FUIA 4MLFB 4M7GA 2EI8A 1DLKB 4ZKRU 3OY5U 1CU1A 3GCHC 3M61U 1JIMA 2HVXA 3QGJA 5GCHG 3EGKH 1WUNH 1ZSJA 2AS9A 5TJXA 4NZLA 1GBKA 3MI4A 3E90B 1GVZA 3SU6A 2H5DA 1INCA 1E79D 2ZTYA 4NFEA 3Q00A 2ZCLP 5F53A 1P3CA 5E2OA 3BTEE 1W0KD 3QZQA 4H6TA 2W6JD 4CH2B 4UDWH 3NPSA 1C5LH 2R3UA 1BTXA 1THSH 3RXPA 4ACAA 1GI0A 3Q76A 3AW1A 3MYWA 3P17H 4J2YB 4ABGA 3HK3B 1QRZA 2H9EH 3CS0A 3GISB 4H4FA 5A8YA 2FOFA 2GMTB 1T4UH 4YO9A 4RKJB 4WMDA 3SI4H 3BG4C 4I8HA 2D2DA 2V3OH 4UFDH 5KGOA 1C5RA 3F0OA 3EDXB 2P8OB 1L1JA 3MO3A 3WWFA 1HCGA 3ZVBA 3MMGA 5DJ7A 1LTOA 1DX5M 4K1TA 1HIAA 1AY6H 1A46H 1MABB 3ZZCA 1GBHA 2OQ5A 1Z1IA 3BF6H 5HIZA 2CF9H 2EEKA 4VGCC 1SQOA 2AIPA 3UPEA 3FAOA 2XBWA 4RT1A 2OCVB 5C0UA 1QTFA 3L33A 1GI3A 4D8NA 3KQBA 1Q3XA 1Z8GA 2RG3A 2VNTA 4LXBH 4DCDA 1Q2WA 3P8OA 1CHOF 4NSVA 1QL9A 1TX6A 2GV7A 1C5SA 4IW4E 3ZZ4A 1JBUH 1GDQA 4FUJA 2HALA 1RRKA 4JZIA 3I29A 4K3JA 1LHEH 5GDSH 2ZQ2A 1HYLA 1SLVB 2C3SA 3GY2A 5IDKA 3RXTA 1LHDH 2VH0A 1LPKB 4AB8A 4I8LA 2QYIA 1ELGA 1UHBA 2VIPA 3U1JB 3L3TA 1EASA 5LGOA 3U9AH 3PV4A 2VVUA 1GMHF 5DP8A 4B6EA 1ACBE 3BTWE 1ANEA 1OWJA 1LMWB 3DUXH 1IQMA 2V3HH 2V35A 4YLQH 1SR5C 3QGNB 5CDFE 2Z7FE 1A0JA 1P05A 5FXLA 1MTNC 1VR1H 3FZDA 1RGQA 3U98H 1P57B 1GHYH 1S6LA 4X1RU 1E36B 3TH2H 1NY22 1BB0B 1EZUC 1YCPH 1KXEA 2ALVA 2G5NA 2QXIA 2STAE 2Y82A 3D49H 1NU7B 2JJ1D 2PW8H 3T27A 4A1VA 2BD7A 1C9PA 2XCFA 1BTYA 4OS6A 1O2TA 2P95A 3SJ9A 1SFQB 3VGCB 2EQNA 3SU3A 5A0AE 1KLJH 1EJMA 1KXCA 4GCHF 1SGCA 1UTJA 4ASUD 5DKMA 3IWMA 1SGFA 1TX7A 1ARCA 4Y8ZA 1YC0A 2Z9JA 3NKKA 4M9FA 2B9LA 2XWAA 3TJVA 1QA7A 2EI6A 2B8OH 3M35A 4CHAB 5L2ZH 1VCWA 2YOLA 3A85A 1K9OE 2DE9A 4FOUC 2F43B 3RXSA 4A6LA 3QZRA 2CXVA 1A0LA 3O8CA 1TPOA 1UVOA 1A1RA 2C8ZB 2XOKD 2BMGB 1AN1E 3HPTB 3PRDA 4R0IA 1S6FA 3QLPH 1FV9A 1CA8B 2PSXA 2FLRH 2FM2A 1K28D 3PYHA 4O3UA 3OU0A 2PKSB 1FONA 3P8NA 3ATWA 3FN8A 2QXGA 3M7QA 3PMAB 1BT7A 1E1RD 2H2ZA 1GHWH 3A84A 1BDAA 3N99A 2OP9A 5C17A 1A3EH 5EW1H 2OTVA 3GDVA 3BV9B 1XUGA 5EQSA 3QK1A 3RXIA 1ID5H 3KYFA 1SGRE 5C67A 1GI6A 4K8BA 3MWIU 3F9EA 2XBYA 2JJ2D 1FY3A 3HKJB 4UFFH 2EI7A 4AG1A 1AU8A 2PR3A 2CMYA 4DW2U 4CH8B 1GG6C 1DWDH 4H6SB 1IQFA 2XBVA 3L6PA 1XX9A 2ZQ1A 5T6DA 1MZDA 2ASUB 2FTLE 3UWJH 1K1IA 1GBCA 1P2JA 4H42U 1ELVA 2YMSB 1IAUA 2ZHWH 2JKHA 5EGMA 4AB9A 2J95A 3A80A 4NA7A 3F9GA 2HLCA 2CF8H 2ZPSA 3OTJE 1IQIA 1FPHH 3M7TA 2KCOA 3FOAA 1OSSA 2WPDD 2O8MA 5E8EH 3M5LA 4YOGA 1KSNA 4MPXA 1WOFA 1EAWA 1BTPA 1GDNA 1F7ZA 3UY9A 2B7DH 5EIYA 4X2XA 3LJOA 1L1GA 5GJ4B 1LVOA 2BD3A 2RCEA 2QCYA 2WSSD 3A7YA 3F9FA 3AVZA 3FO8D 8LPRA 1PPGE 2BVRH 2BVSH 3MNXA 1F2SE 2KM0A 5CHAB 1DSTA 1HV7A 1QIXB 1VITH 1VGCB 2Q1JA 1O3MA 1O3FA 2J4IA 3M3VA 1MTUA 1QBNA 3PO1C 5KEDA 4R8TB 2B0FA 2RA3A 4ZKSU 2FXRA 3GDSA 1MAYA 1ZHMA 4Y10E 1HDTH 2AH4X 4NIWA 3K65B 1YM0A 1G3BA 2R0LA 1T8LA 2ZCHP 4MG3A 1UTQA 2BY5X 1QL7A 1RIWB 1FX0B 3UAIC 3PLKA 5DSFA 3RXMA 2P3TB 3BSQA 1ZMLA 1HXEH 7LPRA 1SQRA 3H5CB 3KEEA 2HRVA 4RI0A 1FI8A 5AVDA 3TIUA 3MH4A 4D9QA 2SFAA 3OE7D 1C4Y2 2ANKH 1NT1A 8GCHF 2Z6BD 1EP5A 1Y5AT 4JZFH 3W94A 1OWEA 3A7ZA 3SU0A 4IGDA 2WPIS 1HJAC 3PB1E 1QFKH 2JDID 1MZAA 1GJBB 2R0KA 2FPZA 2KCPA 3ZV8A 3ITIA 1MU6B 1TPAE 3VB5A 1NRSH 1SGTA 2NU0E 4XBBA 2BD5A 3K9XB 3UUZA 4THNH 2BZ6H 1ZR0A 2FOHA 1E34B 2J92A 4HTCH 3BN9A 3BIVH 3CS7A 5K7RA 3RC4A 5CMXH 5FCKA 2H6MA 2QN5T 3TGKE 1C2GA 3RXUA 3SV7A 3DSPA 2OD3B 1QZ8A 4AC9A 4A1TA 4ISLA 3RXAA 5LPRA 2GCTB 4YXWD 1RFNA 1SHYA 1IOEA 2BQ7B 4BXWA 1BHXF 4J1YA 4XOJA 2Z3CA 1N8OB 2FOMB 4JZ1A 3P92A 2P16A 4JYTA 1ZYOA 6CHAB 2LNCA 2GCHG 4ABIA 5E0HA 3A87A 4Q7YA 1EX3A 4BAOB 2Y7XA 3T28A 1G36A 5J4QA 2TBSA 1IQEA 3OEED 1LHGH 2BD9A 2ZGHA 1FN8A 1W10U 1K1PA 4AGJA 1TQ0B 2BLQA 1MH0A 2ZDMA 2VGCB 2R3YA 3SZNA 3RXGA 3KF2A 3ZVDA 5EJ1A 1F5RA 2WUCA 5A8XA 4I8KA 2ZC9H 1BCUH 3BIUH 1DITH 1QURH 4DY7B 1OPHB 3UWIA 1NFXA 1TGCA 2BY9X 1GHVH 3STIA 3M7UA 3NXPA 2NU4E 1GJ7B
chains in the Genus database with same CATH topology
1HGTH 3O8DA 2W7UA 5BRRE 3SNBA 1BBRE 3P8FA 2I6QA 3TNSA 4B2CA 1ARBA 4BAKB 3RXBA 4NGAH 1O3AA 4ABDA 1EP6A 1OKXA 1UTPA 1ELEE 1EPTB 4X1QU 3ZZAA 5T6FA 3E0PB 4HZHA 3SJKA 1C5TA 3EQ0H 2OLGA 3SJIA 3ZVEA 2Y6TA 4I33A 4OS4A 1D6WA 1FJSA 1F0TA 1TRNA 2GDEH 3KQDA 4WH6A 1BUIA 5FX5A 4WMEA 1P2IA 1GGDC 3E8LA 4FVBA 2TGDA 4AFQA 4DT7B 4TYDA 2TGAA 2AMQA 3UR6A 2KAIA 3KNXA 5JBAS 3I78A 3ELAH 3ZZ5A 2WPJS 1V2NT 2SGAA 1QRWA 3C27B 5EOKA 2OC7A 1O3KA 1C1RA 2A7HA 2QIQA 5C5NA 1SOTA 1TGSZ 2GZ9A 1C1SA 2ZI2H 1SVPA 1PQ7A 4K69A 3LONA 3LPRA 2A1DB 3ESTA 2JETC 1ZSLA 1BBRH 1O2IA 1AWHB 2PTNA 5FHTA 1A7SA 4ZH8A 5JDUB 3QN7A 4GHTA 4AX9H 4MVNA 4NA8A 4IC5A 1DT2A 2C90B 4F49A 4JYVH 1SC8U 2GV6A 4GUXA 4X8UH 3MHWU 1W7GH 3T29A 4Z0KA 3ZVCA 1UTKA 2XYAA 4LZ4B 1NRRH 5EXLA 1C1MA 1Z1JA 3FP7E 4D7GA 1GI2A 2SGQE 1L2EA 1V2JT 1Y5UT 3U8TH 1O3HA 4JK5A 3BTQE 2WPKS 3LU9B 1P2NA 3SV9A 4X8TH 1K1MA 2KAIB 3PWBA 5GWZA 2J38A 1D3DB 1NM6A 4Y0ZE 4OGYA 4B75A 1YPJH 4TPYA 1YPHC 2ZHEH 1HFDA 5SGAE 1AVGH 2A45B 4CBOA 1FY4A 1TNIA 2R9PA 1V2TT 2AMDA 3FANA 2FP7B 3GCTF 1P9UA 3KQEA 1GBFA 1XVMA 2ODPA 1K2I1 1ZGIA 3TJOA 1EAXA 3UTUH 5EXMA 1MD8A 2HNTF 2AMPA 5HGGA 3PLPA 1AZZA 4K1SA 2QXHA 1GHBG 1QQ4A 1G30B 5FPSA 1J8AA 4UFEH 1IQGA 1PPZA 1A5GH 1GCTB 1TGBA 3MNCA 3SU4A 4O3TA 2D1JA 1NU9A 2UUKB 4ABBA 3LDXH 4IC6A 3V13A 2FDAA 3EE0B 3GOVB 4TWYA 1KXFA 1O5FH 5EG4A 2V6NA 4BAMB 3CP7A 1EATA 2GT8A 2D26C 3SGBE 1GBDA 1AVWA 2F83A 5G4BA 3ZV9A 1RTFB 1O2QA 2AYWA 1THRH 1WCZA 1DSUA 4K8YA 1EAUA 3V0XA 2FI5E 1C5XB 1W3CA 3N7OA 1DY9A 1PJPA 1V6DA 2BVXH 1AHTH 3U8OH 1DUEA 2ESTE 1CHOG 1GHAF 5GPIB 4Q80A 1LHCH 1W12U 3RU4D 4ISOA 1TBQH 5F8XA 4FVDA 1A5IA 3ZYDA 2ZU3A 1UVPA 1C2DA 2V0BA 3W95A 2IN2A 3R3GB 1FDPA 1GJ4H 2W7SA 3VPKA 1FY1A 2FX6A 1TPPA 2Y5FA 2ZKSA 4UE7H 4A7IB 2UWLA 4RSPA 1CBWB 1GJ9B 1WQSA 1AQ7A 1K1LA 1D3TB 2VWLA 1WV7H 3PMHB 1FIWA 3UNQA 3NUMA 1UMAH 2QGRA 1HAZB 4OS5A 2IPHA 2VIWA 1OP2A 2CHAB 4NSYA 2ZFFH 3ODDA 5DO4H 3FZZA 4A1XA 1A4WH 2ANMH 2BY7X 1TFXA 3ENSB 1SMFE 1BJUA 4SGBE 5EW2H 3V12A 1CGHA 1GMCF 1QB9A 2A2QH 1E38B 3BEUA 2UUFB 5FX6A 2SGEE 4A92A 3A81A 1ZHPA 4RN6A 5F8TA 3RLYH 4B74A 5FPYA 3T2NA 4GCHG 5F6MA 1A3BH 4XDEA 1VCQA 2JH5D 3GCNA 5F03A 2ODYB 1W13U 2W3IA 2C4FH 1NRNH 3GY7A 2ZTXA 3SORA 3VB3A 1T8NA 2BQ6B 4MDSA 1UTMA 3BEFB 3BG8A 3RXRA 1X7AC 2P93A 2A7CA 4Y71A 2VJ1A 4U32A 1CT0E 1XUIA 3LH3A 2SNWA 1S84A 1SGNE 1HBTH 2CN0H 1IHTH 5EXNA 1SGFG 4IN2A 1MKXH 1UCYH 1BBRK 2QV1A 1DE7H 1EZSC 5EQQA 3SU2A 3SUGA 1GI8B 1HIAB 1DWCH 1SLWB 1KXBA 2D8WA 4KELA 4ABAA 3ATLA 4YT7H 5GXPA 1ZSKA 2XBXA 2EA3A 3P6ZB 2BD2A 1P8VC 1AFEH 1O5DH 1SQTA 1XUHA 2A4QA 4ZKNU 4YOIA 1GI1A 1OWIA 1OYTH 1P9SA 1ZJKA 1O37A 4FUHA 5L30H 4B2BA 1J14A 4KTSA 3SV8A 2FS8A 4CRAA 1S83A 2BDHA 4CREA 1W0ZU 4WY3A 4E7RG 4JK6A 4TPIZ 1KTSB 3UFAA 3T62A 1NRPH 1J9CH 2B5TB 5FBEA 1P2KA 5BPEA 5EODA 3GYLB 3MH6A 1P3EA 1DUAA 1S81A 2FYRA 3TPIZ 1C2LA 1BZXE 1WYKA 2GMTC 1RTLA 3EA7A 1O30A 3GCOA 2NWNA 1C1OA 1ELAA 3RU4E 2Q6GA 3RDZA 1LQDB 1OX1A 1UHBB 2ZU4A 4X1PU 4YT6H 2P8OC 3RMOH 4MNVA 1E35B 3SNCA 1NPMA 1BRCE 2BDYA 3B9FH 4X2YA 2GZ8A 1YPEH 4KTUA 1C5MD 4DIIH 1FLEE 1ESTA 1TNJA 2G4UA 2WPMS 1MMJN 3S9AA 2ZPQA 1YBWA 1UTNA 5TCAA 1AD8H 4OGXA 4XE4A 7GCHF 1BITA 1MTWA 1C5YB 2ZFQH 1TA2A 1NFUA 4UONA 5AFZH 2PTCE 3RXJA 3AAUA 1BOQA 3SOSA 2XC5A 2YNBA 3K2UA 1EB1H 3A83A 2Z94A 3BTME 1CHGA 1V2ST 4GSOA 2SGFE 5C1UA 2UUYA 3Q3YA 1C1QA 1QQUA 1YPHE 1Z8RA 2PUQH 2BX3A 4O97A 3FVFB 1A61H 3QX5H 4MNXA 1XKBC 2WYGA 1ZOMA 2FS9A 3PWCA 1F0SA 1ZHRA 1O2UA 2TIOA 3MNSA 3ZZBA 5JBCS 1KXAA 4NA9H 2PKAA 4CRCA 1Y8TA 1W0YH 4X2VA 2UWPA 2PFEA 1QR3E 1AFQB 1UK2A 2FTMA 2BD4A 1HAPH 1ABJH 3MU5A 2XNIA 3PMBB 1BRAA 1OS8A 3STJA 3SUEA 1DWEH 4IMQA 1UTLM 5PTPA 5AF9H 8GCHG 1LQEA 1T4VH 1Y3WA 1ZPZA 3I77A 2FODA 1ELTA 1CA0B 3DHKH 1XM1A 3RXDA 1EKBB 2BHGA 3A8BA 4KGAA 3ZYEA 2H5CA 2GZ7A 4K5ZA 1NC6A 1QA0A 1UO6A 5FPTA 5GIBA 1FY5A 1OWHA 2GX4A 1UK4A 3TK5A 4U01A 1QY6A 1ANCA 5E0GA 1TX8A 4IN1A 3GY6A 3VGCC 2QC2A 2Y7ZA 4PROA 1TOMH 1V2MT 3SI3H 2CJIA 4NIYA 3SJOA 3E6PH 1V2LT 3PMJA 1G9IE 4XBDA 3QO6A 5DP5A 3RMNH 3K6YA 5HM9A 2AIQA 5EU8A 1IQHA 2GT7A 2PSYA 2F9BH 2LPRA 2O8TA 2XC4A 3MOCA 3E3TA 2Q6DA 4ABHA 2FOGA 1HAXB 4YTAA 4CHAC 1ZRBA 1KIGH 4Y7BA 2PKAB 4X6OA 1O0DH 1O35A 4DOQA 5HXFA 1V2KT 3SV2H 1HJ9A 3UNSA 1YP9A 1Q31A 3LC3A 1ZTLA 1BMNH 1MTSA 1AB9B 5DP6A 2ZDNA 2ZPRA 2PKSC 3MO6A 1N6XA 3S9BA 2FI3E 1SQAA 3HATH 1W11U 2ZIQH 2P59A 4JZEH 1O2SA 1GMDF 4ZXYH 4UFGH 3GY3A 3ATKA 1Y3VA 1MKXK 1XUFA 1QGFA 4QT8C 3GICB 2C8XB 1C4U2 3P8GA 1SFIA 1L1NA 4WXVA 1JXPA 5JBBS 2QAAA 2F91A 1NS3A 2XCNA 5ETXA 1G3EA 2A4RA 3D23A 1CO7E 4ISHH 2ZFTA 2OBQA 1P0SH 1SGEE 1C2HA 3M3SA 1EZQA 1QJ6B 3RM2H 2H9HA 4UD9H 7KMEH 1QJ1B 1YCPK 1ELCA 1RS0A 2GGVB 5C5OA 3NK8A 1V2OT 4INKA 2BXTH 1TNKA 1SPJA 2WPHS 1ZTKA 3SUFA 4IMZA 1OYQA 5E2PA 3AASA 3TU7H 1IHSH 6ESTA 1VCPA 3RC6A 4ASHA 1C5ZB 2ZF0H 1RD3B 3ZZDA 2ZEBA 4OS2A 2QY0B 1Z7KA 1GBLA 2Z9GA 4GVUA 1MAXA 5ESBA 1NFWA 1VITF 1O2VA 5CHAC 3ZZ9A 1DPOA 2BY8X 1QB1A 1VGCC 1DANH 4B2AA 1C5QA 4YM9A 2XTTB 1H9HE 3DFLA 3A8CA 3SN8A 1L4DA 2BOHB 2ZU1A 3H7OA 2FLBH 4RKOB 2G8TA 1BTUA 3VFEA 3SW2B 1UVSH 1BHXB 1L0ZA 1DWBH 4NWLA 1ESBA 4X6MA 1RIWC 2NU2E 1KTTB 2ZA5A 5FCRA 2VVCA 3GY5A 3MFJA 3R0FA 1BMLA 2VWNA 3LKWA 1GJDB 3NZIA 1T31A 2Z3EA 4BANB 1K22H 1O3EA 2BDAA 1SSXA 2VVVA 1KXDA 1SHHB 1BJVA 4TY6A 3QDZB 3FP6E 4WWYA 2TPIZ 2BLWA 1ESAA 1BTHH 1OWKA 3CENA 5ABWA 1NESE 3RXEA 4JYUH 1D3QB 1O3CA 1TB6H 2ZG0H 1TRYA 3S69A 1MCVA 3SU5A 2JH0D 2UWOA 2STBE 4LZ1H 1A5HA 2PGQB 3HK6B 4ZHLU 3GCTG 4ZXXH 3RXLA 1CGJE 3VB7A 3ZZ8A 2Y80A 2ANYA 6GCHF 4K60A 4ISNA 1HAGE 1GBAA 5C3NA 3SV6A 1O3DA 3M3TA 1KYNA 1HAVA 3LH1A 2OC8A 5C1XA 3SHCH 1GL1A 3EA9A 1GBMA 1O38A 1W7XH 4GPGA 1V2VT 1TMBH 1OWDA 1C1NA 2GCTC 2J34A 3TH3H 3A82A 2BOKA 2GCHF 1K21H 2AFQB 2F9UA 3TH4H 3S9CA 1DXWA 1O39A 4YLUA 1N8OC 1GBEA 2XRCA 1GBBA 4Q2KA 1HJ8A 6CHAC 1AI8H 1ANDA 3HGNA 1EUFA 1G3DA 4AFSA 5JB8S 2C93B 3E0NB 1XXFA 3LOXA 3KGPA 3KCGH 3BTHE 3TGIE 1S85A 1G2LA 2BY6X 1SI5H 1WQVH 3SBKA 2BD8A 5JPMH 1O3OA 1HPGA 1LDTT 1GVKB 1TRMA 2VGCC 2Y81A 4NIXA 3ATMA 3GCHB 1C2JA 1J17T 3DT0H 3TK6A 1P01A 2FOCA 3M5MA 1GJ6A 3RUOA 2VIOA 1QNJA 2ZZUH 2R2WU 2FX4A 2M5TA 2BX4A 1GHAG 3VXEH 5C2ZA 1CGIE 2F9NA 1B0EA 1TONA 2ULLA 4HFPB 1HAVB 3UOPA 2GVFA 2DUCA 2FIRH 3VEQB 1DICA 1H4WA 1Z8IB 2K1QA 3OX7U 4MPUA 5EPYA 4IBLH 3B23B 1JRSA 2IJOB 4Y7AA 4X0WU 1EPTC 5B6OA 3BG4B 4XBCA 4FUDA 1G32B 1ANBA 3BTKE 3P95A 4Y76A 3FP8E 2BM2A 2VIVA 3JZ2B 4FUBA 1H9LB 4NG9H 4WJG2 3RMLH 3TNTA 1O33A 3KHVA 1AE8H 3SNAA 4X8VH 1BA8B 3T25A 4VGCB 3LIWA 1O5BB 1FQ3A 1F92A 1W2KH 3T5FH 1DY8A 1FAKH 2G55A 3QUMP 2Z9LA 4Y0YE 1EB2A 1O2HA 2C8YB 1CT2E 4BNRA 1C1WH 1KLIH 1C5WB 2BZAA 1ZMNA 1GMCG 3UIRA 3ZZ7A 1TIOA 1ETTH 1THPB 2ANWA 4NCYA 1F0RA 1ORFA 1SGYE 4AGKA 2FEQH 3E16B 3KQCA 2J94A 1SGDE 4MPVA 1CE5A 2RDLA 3B8JA 3M5NA 3PROA 1MQ6A 3LT3A 2HPPH 3A7VA 1GL0E 1HUTH 3VXFH 1QRXA 2G51A 1DS2E 3SQEE 2J9NA 2ZFPH 3OYPA 1LCYA 1C1UH 4CRDA 1BRBE 1DM4B 2Y5HA 1V2UT 1LKBA 3SHAH 2BLOA 2A5KA 1HAHH 4U2WA 3A86A 1C1VH 1O5CB 1GMHG 4KTCA 1MTNB 3O8RA 1JRTA 1O2MA 1UCYE 2ZNKH 1FMGA 1P2MA 2WINI 2A4GA 1ZJDA 1BQYA 4CRGA 4CRBA 1M9UA 1QBOA 4LOYH 1GHBF 1FPCH 4B76A 3BEIB 3TK9A 2AGEX 1PPFE 2ZP0H 1O5AB 4WVPE 4AZ2B 4WH8A 1ZPBA 3MU0A 3A88A 4AN7A 4WMFA 3GY8A 4F4OC 1GCTC 2G5VA 4DURA 1GJAB 2A7JA 2GD4B 3F9HA 4BAHB 1XKAC 1LVYA 4FUEA 3LGIA 2FOAA 6LPRA 4D7FA 1YPKH 2OC1A 1KY9A 1Z6EA 3MO9A 1AUTC 1TNGA 1WTGH 4I7YH 1JOUB 2F9VA 1CSOE 2FOBA 5K0HA 1O2GH 1Y3XA 1IQJA 1EOLA 4ABJA 1O2RA 3D62A 1KLTA 1ZMJA 3SNEA 5A0CA 3MH5A 5FAHA 1P10A 1BRUP 1JIRA 1P02A 2XC0A 2HNTC 1D3PB 1GBIA 2C8WB 1AKSA 1C5VA 4CRFA 1QL8A 7GCHG 5GCHF 3BTFE 1O3JA 3JZ1B 2XWBI 3RXFA 3TITA 1LKAA 3V3MA 1WBGB 2ZDAH 5A0BA 3V7TA 3A7XA 1K1NA 2ALPA 4X1NU 1G2MA 1AMHA 1GG6B 2ZECA 3H7TA 1F5LA 1RJXB 1DLEA 2PWXA 2IOTA 2ZDLA 1GCDA 1C5OH 1DDJA 3SJ8A 1E37B 3RU4T 2H1UA 3RMMH 4GLYA 1C5NH 1V2WT 1V2RT 1FAXA 1HAOH 4Q7ZA 3HGPA 4K1EA 1CBWC 1S5SA 2FO9A 4Y11E 1BMMH 2ZDKA 3QWCH 5DPAA 5T3HA 1ZPCA 4I8GA 3HKIB 2OINA 1NO9H 1N6YA 1XVOA 2CHAC 1PPCE 1XXDA 3MH7A 1AKSB 2AERH 2G4TA 1Z71A 2THFB 3EA8A 3U69H