2XTTB

Bovine trypsin in complex with evolutionary enhanced schistocerca gregaria protease inhibitor 1 (sgpi-1-p02)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEASE INHIBITOR SGPI-1
publication title The Catalytic Aspartate is Protonated in the Michaelis Complex Formed between Trypsin and an in Vitro Evolved Substrate-Like Inhibitor: A Refined Mechanism of Serine Protease Action.
pubmed rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xttB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2xttB02
1C1SA 1OPHB 2HNTC 1NT1A 4GPGA 1S84A 4OS2A 1GMCF 1VITF 4CBNA 1UK2A 2UWPA 4ABHA 1TA6A 5F8XA 1QCPA 3S7KB 2QXGA 2JH6D 1SGTA 3M3TA 1EJAA 1K22H 1HAXB 3VFEA 4Y8ZA 2ASUB 4DURA 2WPHS 1GBCA 2BD8A 4WJG2 8GCHG 4I8HA 2ODYB 2BHGA 1TYNA 3A8AA 3E3TA 3RU4T 2KAIB 2BD7A 1T8OA 4MPVA 3TGJE 1SHYA 1W7GH 1P3EA 3TLOA 3Q3XA 1JWTA 4OS7A 3BEUA 1UVSH 1NC6A 3RXGA 2FDAA 1QGFA 1H1BA 2JETB 2CF9H 2W26A 4JZFH 1K1JA 4LXBH 3A80A 4BTIB 4ZKOU 3PMBB 4I8LA 3SNAA 1C5TA 3M61U 2ZFTA 4WWYA 1WOFA 1BA8B 1E37B 1P10A 1IAUA 4RKJB 3PMHB 4X2YA 2XCFA 4JZ1A 3O8DA 4YM9A 1SVPA 2WYJA 4CR5A 1GJCB 1S6FA 5EG4A 2R0LA 3LDXH 1FUJA 1HPGA 3B23B 2C8XB 2ZTZA 1MKXH 1E36B 3S0NA 3PO1B 3AW0A 1BQYA 1GHYH 1V2PT 1A2CH 3U8OH 1V2WT 2SFAA 4YT6H 3MWIU 3PLPA 4OS6A 1KDQA 2P8OB 4IC6A 1PYTD 1TBQH 5C1YA 1F92A 1C9TA 2FX4A 2BDIA 5DP7A 2XXLA 5G4BA 3RXPA 1CHGA 1IQIA 1YLDA 1JIMA 5LPEA 3BTKE 4J1YA 2GX4A 1S82A 3RXJA 1KXFA 1L0ZA 2SGQE 1W0YH 4B2BA 1LHGH 1PQ7A 5E0GA 4X8TH 1K1PA 2ZCHP 5DKMA 2A5AA 1WAYB 1HXEH 3TVJB 1ELDE 4ZKSU 2F9NA 4IN1A 1O2MA 1QBVH 1H9LB 1F7ZA 5EU8A 3A8CA 1BBRH 1ZHMA 3SV6A 3SNBA 2WYGA 1Y8TA 4ZHMU 1O2VA 1BJUA 3LGVA 2GV6A 1SQTA 1NRRH 1QQ4A 1V2VT 3SO3A 4I7YH 4FUHA 3T28A 3LC5A 5J4QA 4CRCA 1W2KH 1C1WH 1MTUA 3LONA 2A32A 2ZHWH 3M5NA 3D49H 3GY7A 4BAKB 1A5GH 2FP7B 2B5TB 3UQOA 1GHBF 1SLXB 1EAUA 2C90B 1SI5H 2OQUA 2J95A 3RXCA 5FHTA 2BD9A 4CBOA 1AZ8A 1C1TA 1UJ1A 2Y6TA 7KMEH 2SNVA 3M5MA 1CT2E 1GI3A 5AFZH 3NXPA 2ZDKA 3QTOH 1CHOF 2C93B 4K2YA 1PQAA 3ZV9A 1HAOH 2VIWA 1DSTA 1QA0A 3RXUA 3ZZ3A 3CENA 1Y5UT 1BMNH 2GVFA 1O2RA 1DWEH 1QRXA 1YP9A 4OS1A 1C2FA 3MO9A 3SN8A 1AFQC 1SSXA 1FIWA 4H6SB 5A0AE 1T8LA 1FAKH 3IITA 3PV4A 1HAIH 2F9PA 4JCNA 4ABFA 3UQVA 1O3DA 1Y3UA 1A61H 1F0TA 3MU5A 1GDUA 2FOFA 5C1UA 1T7CA 1F5LA 2FI5E 2ZG0H 4NSVA 2Q6FA 4XBDA 1O3MA 3MH5A 2AEIH 4XSKU 1TX6A 1O37A 3QUMP 2BY6X 1NFUA 1P2NA 3MU0A 3ENSB 2GZ7A 2Z3DA 1BDAA 3F9FA 1MD7A 1LDTT 3KQEA 1FMGA 1GI0A 4X1SU 1IQKA 4OGYA 3RXIA 3MO3A 2A4QA 1DVAH 5A8YA 1Y5AT 2G81E 1DUAA 2QIQA 3SJIA 2ZPQA 1BTYA 5C67A 1C4V2 1ZMLA 2SNWA 1C2JA 5EXNA 1OWJA 4AFZA 2G8TA 1K1LA 2WPJS 4WY3A 4Y10E 6ESTA 2VVVA 4AFUA 4Q7ZA 3ZVGA 2PHBA 3U8RH 2QC2A 3ZZCA 3U1IB 2RG3A 4ZH8A 2OQ5A 2WV4A 2BZ6H 5AVDA 3RMLH 4JZDH 3RM2H 3A8DA 2G5NA 4GHQA 3ZZ6A 3BTQE 5B6OA 4WMEA 1NTPA 3TJNA 1GCDA 3SI3H 5SGAE 1O3JA 1L4ZA 3U69H 2VIQA 1ESAA 1GWAA 1AE5A 2K1QA 2BLOA 1WBGB 1RIWC 1CGIE 1A0LA 4MLFB 3FP7E 2GD4B 3ZVCA 1WV7H 4B73A 1THSH 2FWWA 1BIOA 1ESBA 2ZFQH 4ZXXH 1NO9H 2QXHA 3VB3A 2J2UA 1DWDH 1C2EA 2C8WB 3NUMA 1SL3A 3GICB 1V2RT 4CR9A 1C2GA 2W7SA 2FOAA 1XMNB 4X1QU 3TH4H 1QB6A 3OY5U 2BVRH 2ULLA 5CHAC 1A4WH 2GMTC 3TJUA 3SW2B 2PGBB 1UCYE 1ORFA 1PYTC 1FLEE 4OGXA 2FOGA 1HUTH 1MD8A 1Z8IB 1C2KA 5BRRE 1GBBA 4Y7BA 1CGHA 2FX6A 2ZIQH 4I8GA 3TGKE 2FI4E 4UFFH 1O3LA 3UPEA 3JZ2B 1TGTA 3CP7A 4X8SH 2PFEA 2VVUA 1IQEA 2ZDMA 4B71A 2RA3A 3M5LA 4D7FA 3SU1A 2BXTH 2XC0A 2FS9A 2I6QA 3MNCA 1ELTA 1CQQA 2HPPH 2ODPA 4CRFA 3GCHC 4Y0ZE 2VWOA 3UNQA 4WH8A 3PWBA 3A84A 3AAUA 1ZPZA 2OC0A 1MQ5A 3SV8A 5BPEA 2P94A 4UEHH 1IQNA 2ZDLA 3VGCB 2VINA 1VITH 4Z0KA 1P12E 1O3GA 1EX3A 5EGMA 1AKSA 4MDSA 3URDA 1BMMH 1A46H 1O3IA 1ZSJA 3GOVB 1G3BA 5LPFA 1GJBB 2J38A 2ZEBA 3SU4A 1KXCA 2SGDE 2GCHG 1TNHA 1O2JA 3TJVA 2FYQA 3LPRA 1YCPK 2F9OA 5A8ZA 3QWCH 1HRTH 2BB4A 1QJ7B 1T8NA 1C5SA 2V3OH 3RXTA 3P8FA 1LTOA 2XBWA 4K1SA 3DHKH 1ZMNA 4YLUA 1GJ9B 1Y59T 1DXPA 1G9IE 3UNRA 2PKAA 3RXQA 1C1VH 3UFAA 5DO4H 1O5EH 2B8OH 2BY5X 4NA8A 1O3EA 1P2QA 2J4IA 1PPEE 1TX7A 2ANKH 3G01A 2O8UA 3GY4A 3A89A 3HKIB 1TAWA 2Y5HA 3A7VA 1CSOE 2BX4A 5EW2H 3O8CA 1UTJA 1PPZA 3U9AH 4GCHG 3FANA 1OP2A 2BD3A 3P8OA 1HDTH 1HV7A 1V6DA 3SGQE 1C5ZB 1OS8A 1HAVB 4R0IA 2A4RA 3A85A 3C27B 1TIOA 1OWEA 3E1XB 1O2KA 4E05H 1A0HB 1YYY1 3L6PA 3NCLA 2D2DA 3ZVAA 1FXYA 5LPRA 1ZJKA 3EGKH 1G32B 4BXWA 1AVWA 3HGPA 3EE0B 3SU0A 5LH8A 5GPIB 4RSPA 2VJ1A 4OS4A 4YLQH 4MPUA 1KTTB 1KYNA 3LC3A 5EXMA 3EA7A 1FN6A 4THNH 1N6XA 4HTCH 3EQ0H 1F0UA 2AMDA 1JIRA 3FFGA 3DUXH 4NWKA 2R9PA 5JB8S 2Y5FA 2FESH 3TK5A 2BM2A 2JETC 5LGOA 1KIGH 1SPJA 1AGJA 3P92A 1EZSC 1LVMA 4AGKA 3ZZ8A 3SZNA 1MH0A 1YCPH 3BTWE 4ABDA 3RXMA 2VH0A 4BNRA 1PFXC 3KN2A 1YPEH 2J92A 2XWBI 3TU7H 3GCTF 4XFQA 1UTNA 1Z71A 4Q7XA 1ZHPA 1TOMH 4OS5A 1O2NA 1EJNA 2PTCE 3U8TH 1PJPA 1FY5A 4TWYA 4CH2B 4SGAE 1FY8E 4FUEA 1EAWA 4O9VA 4X6MA 2O8MA 2XC5A 3GY8A 3HGNA 1Q3XA 5DP8A 1CU1A 4LK4A 4IW4E 1ZZZA 3SUEA 3PO1C 3BG8A 2PTNA 2WPIS 5C3NA 2TRMA 1UVPA 4UE7H 4D9QA 3GCHB 2AYWA 3ZZDA 1QTFA 1GBDA 2OC7A 2H9TH 3F9HA 4AB9A 1GMHF 2TBSA 3SUDA 1FPHH 1O33A 1O5CB 2GCHF 3RC5A 3URCA 1LMWB 1B0EA 1GDNA 1KXDA 1WQSA 1ZGIA 2ZTXA 3EA9A 1RFNA 1V3XA 1HIAB 1FY4A 1B5GH 1DDJA 1DFPA 2ANMH 5GJ4B 2W7UA 3UNSA 3P70B 3P8GA 3MNBA 3V0XA 1QR3E 4NA9H 4BOHA 1Z1JA 1MTVA 2HGTH 5GXPA 1O30A 2HNTE 2XRCA 4X2VA 2VIOA 1O3OA 3BG4C 2ZGBH 2BDAA 5DGJA 4TPYA 4GAWA 1SQAA 2AGIX 3DT0H 1Z8RA 4FU7A 3TK9A 4E7NA 3A7TA 4GCHF 4ISNA 3E91A 4NSYA 5K7RA 1C5QA 2ZHEH 5JDUB 3VB6A 3ATMA 2Z9KA 1MKXK 2ZHFH 1A0JA 1NS3A 1LPKB 1Z8JB 2J9NA 4ZHLU 1Z1IA 2G52A 3DFLA 4MQAA 5ETXA 1SG8B 1HGTH 3PMAB 3T5FH 4INKA 2G00A 4ASHA 2Z3EA 1LO6A 2Y81A 5FX5A 1O3CA 2HWLB 5IDKA 1H4WA 4I31A 2A45B 3KQCA 3LKWA 3SBKA 1P01A 2PGQB 1UHBA 4D8NA 1AD8H 1GBKA 1U6QA 4B2AA 2Z3CA 5C2ZA 1GI5A 1NRNH 1O5AB 2VWNA 4PROA 1EKBB 2A7CA 3BEFB 3VEQB 1O38A 1V2MT 6CHAB 1UTOA 5DJ7A 1O2YA 2OBOA 2BDYA 3T2NA 1OYQA 2UUFB 1UK3A 1HNEE 1D4PB 5TCCA 1MU8B 1CVWH 3A88A 1GVLA 4Y0YE 2NU4E 5E8EH 1O2UA 3BTGE 1BBRK 3GY5A 3PLKA 2SGEE 1DOJA 1GJ8B 3BIVH 3BTFE 4X2WA 1QHRB 1S6HA 1FAXA 1TMBH 1LVYA 2ZU4A 1HXFH 4ISLA 1EJMA 2FEQH 1EPTC 3BV9B 3PROA 2VB0A 4XBCA 1V2KT 2A2QH 2GDDA 3ZYDA 5C5NA 3ZVFA 2A0QB 4K3JA 1F0SA 5EPYA 3RLWH 2B9LA 2TIOA 3DA9B 1ACBE 5C20A 1SGDE 2BD4A 2BD5A 1DANH 1L1GA 4SGBE 5A0CA 5ABWA 2BQ6B 5T6FA 5DP6A 1Y5BT 3F9GA 1TALA 2FYRA 3MH7A 4NIWA 1E38B 3LGIA 3MI4A 1DICA 1C5YB 1ELCA 3K9XB 3EYDA 1P05A 5GWZA 2C3SA 1GG6C 1CT4E 1C9PA 3NPSA 1DLKB 1V2LT 4IMQA 4DOQA 3DFJA 4E7RG 3QLPH 1T32A 3QO6A 4KP0A 4TYDA 1BHXF 3TPIZ 2BLWA 2ZNKH 1RTKA 2AS9A 1RXPA 2UUYA 2AMQA 1YPHC 1ELGA 2PUQH 3A81A 1EQ9A 3MNXA 3SOSA 4AG1A 4CREA 3M3VA 1C1RA 2BY7X 2PKSC 3A7YA 5L6NH 1G30B 2WUBA 3K2UA 1J17T 1TNIA 4NIVA 2FLRH 2I6SA 2VIDA 3RM0H 4WVPE 1EP6A 1DX5M 2GCTC 3SU6A 1GI6A 1QRZA 2EEKA 2ZU5A 3QN7A 4RKOB 1UMAH 1MMJN 3BG4B 4FU8A 1BTXA 1EAXA 2ZA5A 3MU8A 1TA2A 3IWMA 2A7HA 2FXRA 5JB9S 1BRBE 5EQRA 2CF8H 1OOKB 1VJ9U 3LU9B 1GI9B 2OINA 4BTUB 1V2NT 2TGPZ 3NK8A 4BANB 3RXHA 2ZDAH 1KSNA 1AB9B 1C5XB 1CE5A 1MTNC 1C5UA 4AB8A 2ODQA 8GCHF 1ZTKA 2RCEA 3T27A 2EC9H 2TPIZ 1Z8GA 5I46H 1AFEH 1GHVH 3P17H 5F8TA 3VXEH 3WY8A 1XUKA 1F2SE 1O35A 1V2ST 2BLQA 2DE9A 1LHFH 2ANWA 1P02A 4O03A 1O2GH 2BOKA 2B7DH 4GSOA 3KL6A 3UOUA 3OU0A 2WV5A 3RXVA 3TH2H 3MTYA 2BX3A 2GKVE 1KY9A 1Z6JH 3VGCC 4JZIA 2VU8E 3DD2H 4BAHB 1E0FD 7LPRA 4DGJA 1IHSH 2XBYA 4F49A 1DXWA 1SMFE 1VGCC 2EI7A 3E6PH 3UIRA 1MZDA 1C5LH 1O3HA 3BN9A 3NKKA 4U30A 1HCGA 1G3DA 4UDWH 1V2OT 2J94A 4Y71A 1EPTB 3LGTA 4R8TB 1NM6A 1SOZA 1BCUH 4YT7H 5DG6A 4I8KA 1GVZA 3AAVA 3QTVH 1O5DH 1ANBA 3RU4D 4MPXA 1TOCB 3MU4A 5JYIA 1C1OA 3GY2A 2QA9E 2OBQA 1P04A 1EASA 1VR1H 1VJAU 1E35B 2BYAX 7GCHG 1P2MA 4HI3A 1PPBH 4KELA 1MZAA 2PW8H 2F9UA 3KQBA 1BTZA 2ZO3H 2FZZA 1J8AA 3UUZA 1WCZA 1XXDA 1YPJH 1XUIA 3H5CB 3PWCA 5E2PA 2OTVA 1UTLM 1H9HE 3FP8E 2AFQB 1GG6B 1GHXH 2ZF0H 1P8VC 4X1PU 1OKXA 1JOUB 1HJ9A 2H9HA 1BTPA 2GZ9A 1DWCH 1KLJH 5DP9A 1GBFA 4O97A 4YO9A 1CGJE 4YOGA 4NWLA 3F1SB 3R0FA 1C1NA 1LPZB 1NFWA 1QURH 3S9AA 1V2TT 2P95A 2PKSB 1FQ3A 3N7OA 4LZ1H 4ABJA 3TITA 2ZCKP 2VVCA 2QGRA 3MYWA 3GY3A 9ESTA 1QL8A 3ZZAA 1XUFA 2XBVA 4H6TA 1D3PB 1XUJA 2GCTB 2XTTB 3HK6B 1GBLA 5JBAS 4M7GA 1P2KA 1GJDB 1THRH 3ITIA 4UONA 4XBBA 3S9BA 2GZ8A 1P2OA 1LHCH 3BTTE 2HLCA 2OC1A 2HVXA 2F83A 1WYKA 1EOLA 2A1DB 1OX1A 2EI8A 1EOJA 3PTBA 4BAOB 1ESTA 4K1EA 1GDQA 4AOQA 2KAIA 4RN6A 1ZRBA 3P6ZB 1MAXA 4JYTA 2C4FH 2TGAA 1DY9A 2FPZA 2QF3A 2UWOA 1MTNB 4AFSA 4BTTB 2OP9A 2C8YB 1KXAA 1TNKA 1IQMA 1FNIA 1XVMA 2R3UA 1C4U2 1E34B 2B0FA 3H7TA 2SGAA 4IGDA 1Y3VA 4LOYH 3H7OA 1TE0A 4NG9H 3MFJA 3SNDA 1VCWA 1LVBA 3SV9A 1GBJA 2ANYA 4Q7YA 5T6GA 1HBTH 1SR5C 1UO6A 1OWIA 1TB6H 3BF6H 3TH3H 3LOXA 3O8RA 4XDEA 4IN2A 5F6MA 1SLVB 5GCHG 1PPFE 1C2DA 1GJ4H 3OYPA 3ODDA 2FTLE 3I78A 1GI2A 1SGIB 3ATLA 1K28D 4X8UH 4FXGH 1YPMH 5JBCS 2QAAA 1W10U 1AE8H 1EUFA 3P95A 3KNXA 1G36A 1O3PB 3GYLB 3SV7A 1FPCH 5AF9H 1VGCB 3E8LA 2BMGB 1TRNA 3ESTA 3ZYEA 7GCHF 2BD2A 1GMDG 5EW1H 2ZHDA 3KHVA 1C5RA 2WUCA 2RA0A 2BQWB 1MAYA 4LZ4B 1BRAA 3I29A 3PB1E 2ZFFH 4IMZA 3MO6A 3QGNB 1L1NA 1YGCH 2PV9B 2R2WU 3VXFH 3SU3A 3SV2H 1P57B 2AIQA 2ZWLH 1EB1H 1IQJA 1EP5A 1G37A 3KF2A 2P59A 3VPKA 4Y8XA 3RU4E 1NRPH 2LPRA 2PSXA 1LVOA 1P9UA 1ARBA 1KDQB 1N6YA 3RLYH 3T29A 3TJOA 1MTSA 5HYOA 4ZKNU 4DCDA 4WXIA 1T4UH 3SJKA 1TGSZ 3TNSA 2OUAA 5H4IB 2AGEX 1SFQB 4IBLH 1SGNE 1TQ0B 1INCA 1B7XB 2QCYA 1JXPA 2P3UB 3Q3KA 2ZGHA 6CHAC 3M36A 4ISIH 3W95A 3U1JB 1SLWB 1GBTA 1WTHD 2STAE 4A1TA 2G55A 4XOJA 3RXKA 4MNYA 5E0HA 5JPMH 4AYVB 3SI4H 3SGBE 1NU9A 3A7WA 2CXVA 4UFEH 1MCTA 3BIUH 1SB1H 2Q1JA 1JRTA 1QB9A 1Y3WA 3A86A 3STJA 2FOEA 3VB5A 1T31A 5CE1A 1SFIA 2STBE 2UWLA 1PPGE 2BXUH 1FV9A 1ID5H 3A87A 1UVTH 3SNCA 4X8VH 1VITG 1N8OC 3MMGA 4Y79A 1FI8A 2ZGCA 3FAOA 2OC8A 1KXBA 3LGUA 4UFGH 3ATIA 1OYTH 4ZROA 3SU5A 1ELAA 1UCYH 1V2JT 2NWNA 3GCNA 1HAHH 3Q00A 5CMXH 1XVOA 1HYLA 1RJXB 2WPMS 1GJ6A 2QXIA 1EZQA 1WU1A 1GJ7B 1A1RA 1YPLH 2CGAA 1AO5A 2P16A 3BSQA 5GCHF 2BDHA 3KEEA 1HAZB 2H9EH 1DUEA 1G2LA 4ZHAA 1D3TB 3QX5H 1CA0C 1GBAA 3JZ1B 1SGPE 2DE8A 1TGCA 4X1RU 1SGCA 5EOKA 1YBWA 1C5OH 4ABIA 1C2HA 1O36A 2F91A 1MTWA 4B75A 5C1XA 2GDEH 1UTPA 4TY6A 2GT8A 7ESTE 3FZZA 1D6WA 2VH6A 2FIRH 4BAMB 1D3QB 4ABBA 4X2XA 1GMDF 1NRQH 1BHXB 4AORA 2AH4X 3T62A 5FPSA 3UREA 3EA8A 5J4SA 3T26A 1BITA 1HAGE 4DY7B 1ELBA 3L3TA 1GVKB 3LGYA 3STIA 1DPOA 1SBWA 3GDVA 1WSSH 2JKHA 1KTSB 1Q2WA 1GGDB 3HATH 3EDXB 4JYUH 2H5CA 1HAYB 3A7XA 3RUOA 4MTBA 3ZVDA 3W94A 4MNVA 1O2WA 1G3EA 2ZKSA 1W11U 4DG4A 3LT3A 3RMMH 1YPKH 3KGPA 2QV1A 5TCAA 3SGAE 3SHAH 5FCKA 1OSSA 1GBEA 4AN7A 1SGQE 1W7XH 5FX6A 1AI8H 1LKAA 3BTDE 1BZXE 3E90B 1FJSA 1UVUH 1TPPA 1SC8U 1ZRKA 5PTPA 1BBRE 1SQOA 1LCYA 1XM1A 1GI1A 3PTNA 5IYTA 3RMNH 2O8LA 4GHTA 3QZRA 3AASA 1C5PA 3UTUH 1SHHB 3M5OA 1AB9C 3MH6A 1KLIH 4ABGA 3SUGA 2TGDA 4JK5A 3RP2A 4Y7AA 5A09A 3PM3A 2Z9IA 1K2I1 4NIYA 1HAPH 2P3FH 1IQGA 2CN0H 4B74A 2VGCB 1DM4B 1V2QT 3RC4A 3TIUA 4WH6A 4KTSA 4VGCB 2D8WA 3L33A 1TGBA 3A7ZA 1TNGA 3RXAA 1GPZA 2QXJA 1K1IA 2XYAA 4ABAA 1A3EH 2F9VA 3EAJA 5AFYH 3ZZ7A 1K21H 2PSYA 2A7JA 3GDSA 1TLDA 1RTFB 1PQ8A 3KCGH 1FONA 1GCTB 2A5KA 3QK1A 4IS5A 1W3CA 5EQQA 1P3CA 1GJAB 2QY0B 2VNTA 3C1KA 4MNXA 4H42U 3UY9A 3LH1A 1ELFA 5L2ZH 1GHBG 5DP3A 9LPRA 4YOJA 4YTAA 3GYMA 2P93A 1MKWK 1MBMA 3M7UA 1K1NA 1YPGH 4Q2KA 1P11E 4QT8C 1RTLA 1D6RA 1CHOG 3ZZ4A 1A5IA 1N8OB 3ZZ9A 1O31A 2CHAB 1S0RA 3D62A 1QFKH 5T3HA 1WTGH 2FODA 1O3AA 1XX9A 2ZGJA 5DP4A 1O3FA 4A6LA 2QF0A 1NPMA 1GHAG 4TPIZ 3A83A 1JRSA 1ZSKA 2VWLA 4DIIH 3SQEE 1GHZA 1YPHE 4JYVH 4CRGA 1THPB 1K1OA 2A2XH 2BDGA 1CA0B 4D7GA 1AQ7A 3U98H 1DLEA 1QB1A 2BTCE 3MNSA 3VB4A 5EPNA 5EXLA 1LHDH 2UUKB 3SU2A 2BQ7B 3AVZA 4NFEA 1C1UH 1J14A 3F9EA 1IHTH 2H5DA 4NZQA 1P03A 1O3KA 4D76A 3QGJA 2XNIA 1AKSB 2BVSH 1MQ6A 3ELAH 2FTMA 2SGPE 5E2OA 3RMOH 4FUCA 4MPWA 1NROH 4IC5A 4KKDA 1OWDA 2Z94A 2F9BH 1SGRE 3TNTA 5HM2A 1HFDA 5TJXA 1M9UA 2C8ZB 3LGWA 3M3SA 1EZUC 2A5IA 2ZDNA 1IQFA 2W3IA 1TONA 1UTKA 5FCRA 2FOCA 5T6DA 1DE7H 3IG6B 4F4OC 1TRYA 5E0JA 5JBTA 1NESE 1WUNH 1TQ7B 1BTWA 2AMPA 2VIVA 4ABEA 1MKWH 2JH0D 2JH5D 4ZKRU 1HAVA 2PKAB 4AYYB 2OXSA 1ZGVA 1O2OA 1V2UT 1FY1A 1BTUA 1XUHA 2ZGXH 4A1XA 1F0RA 2HOBA 2G51A 2AIPA 2PLXA 2XW9A 2EI6A 1P9SA 2R2MB 1GL1A 1A3BH 1YC0A 3RXLA 3V7TA 5FAHA 2XCNA 4BAQB 1AHTH 1CA8B 5EODA 1PPHE 3M7QA 2GTBA 1QQUA 3UWIA 1OWHA 1T4VH 3A8BA 1S0QA 2R0KA 2Z9LA 3S69A 1TMUH 2Y82A 1D9IA 1GI7B 1VZQH 4GUXA 5AHGH 4K1TA 2DUCA 1TPAE 3QDZB 1RS0A 4X6NA 2ZU3A 1YM0A 2BY8X 5FPTA 2WINI 1GI8B 1O2HA 2XC4A 2ZI2H 1BJVA 4CRDA 1T8MA 2H6MA 4FVDA 4INHA 4FUBA 3E16B 3HKJB 4A5TS 1O32A 3B8JA 4A92A 1SGEE 3LJJA 2QYIA 4K69A 4CRBA 1S83A 3E0NB 1TGNA 1IQHA 4H4FA 1TFXA 1DY8A 1F5KU 2Z7FE 2SGFE 2ZFPH 4B76A 4UD9H 1GBHA 1YLCA 3S7HB 1O2XA 1HJ8A 1ELEE 1OP0A 2FOMB 3RXSA 4GVUA 1GHAF 3GY6A 1QJ6B 1P09A 8ESTE 4I33A 2O8TA 5FXLA 1ETSH 2CMYA 1BRCE 3MU1A 3SJ8A 1XKBC 2YOLA 4Q80A 4JZEH 1AU8A 1TX8A 1ZR0A 3SQHE 1Y3XA 1AWHB 4HFPB 1A7SA 1MBQA 3OTJE 2CV3A 1L2EA 3Q77A 1C1PA 1HB0B 1HIAA 1TABE 4TY7A 3B9FH 4YESB 1HLTH 1LPGB 2GP9B 1BB0B 4ISHH 2Q6DA 4DW2U 1ABJH 1O2IA 4I32A 1OP8A 3ZZ5A 1ETRH 1RD3B 1ZHRA 4E06H 4I8JA 3SJ9A 1CO7E 3TGIE 3HPTB 1H8DH 1BMLA 4CH8B 1AIXH 1TNJA 1HJAC 1QJ1B 1TMTH 1C5NH 2OLGA 4YOIA 5HXFA 3O8BA 2OCVB 2QN5T 3HK3B 4NCYA 3RXOA 1OXGA 1CT0E 2ESTE 2NU3E 1QY6A 3K6ZA 1OWKA 4AGJA 3OY6U 1ZMJA 4O3UA 3ATWA 3S9CA 1GL0E 1O2ZA 2ZC9H 2ILNA 4ISOA 1FDPA 3GISB 2J34A 1EXFA 2FLBH 4D9RA 2ZU1A 3F6UH 1ANCA 3KQDA 4O3TA 3FVFB 2A4GA 6GCHG 1P2IA 2OD3B 3MOCA 1C2MA 1O2QA 3UOPA 1JMOH 5A2MH 5F03A 2ZU2A 1W0ZU 1BTHH 2GV7A 2VIPA 5DK1A 2BOHB 2PUXB 3TK6A 1DWBH 2YNAA 2W3KA 4Y11E 2FOBA 5A0BA 4CHAC 1AVXA 1BT7A 4X0WU 4ZUHA 1C5VA 1O2LA 1WQVH 2Y80A 4INLA 1ABIH 4WF8A 2FS8A 4A1VA 1RRKA 4U2WA 3RXFA 3R3GB 2ALPA 1QL7A 4K8YA 1W12U 1N1LA 1CBWC 1C5WB 1SGFG 4TWWA 4KGAA 1EAIA 1UHBB 4KTCA 3T25A 1F5RA 4U01A 3NWUA 3K6YA 3PLBA 1TRMA 3ZVEA 1IQLA 2FOHA 1ZTLA 8KME2 2ZP0H 1H8IH 1NY22 4AX9H 1K9OE 3BTHE 2D26C 5DP5A 2RDLA 3V12A 2V6NA 1LKBA 4HZHA 1L4DA 1BRUP 4WMDA 2HNTF 4AZ2B 1QBNA 2Z6BD 5A8XA 2PWXA 3GCTG 4X1NU 1Z6EA 1C2LA 1QNJA 4MG3A 2R3YA 3UR6A 1C1MA 5FBIA 1W13U 5JBBS 1S85A 2V0BA 5K0HA 1QBOA 2NU0E 5HM9A 3GCOA 1GGDC 1AFQB 1XUGA 3FZDA 5ESTE 1MU6B 1FN8A 1MCVA 4DT7B 4ESTE 3M7TA 1B0FA 1TPSA 1G2MA 1NU7B 1ZPBA 5HMAA 3LIWA 1FZZA 4ZMAH 1JBUH 1W14U 1O0DH 3E0PB 2FM2A 1G3CA 1NFYA 5C5OA 4UFDH 1UCYK 1NN6A 3KIDU 1SLUB 2ZFRH 1J15A 1LQEA 1NZQH 2G4TA 1GMHG 4FUGA 1XKAC 2ZZUH 3V13A 2G5VA 1GBIA 1O2SA 4Z6AH 1C5MD 1ZYOA 2YNBA 1NFXA 1GI4A 1UTMA 3P8NA 1ZTJA 1FY3A 2Q6GA 1VCQA 1P06A 2ZCLP 4Y76A 1KXEA 1AN1E 1FIZA 3ODFA 4AFQA 1AY6H 4WMFA 2Z9JA 3OX7U 2O9QA 4KTUA 5L2YH 2VGCC 1HJAB 2GT7A 3RC6A 5HGGA 3RXEA 6GCHF 1D3DB 1TWXB 4VGCC 2V3HH 1AMHA 2HPQH 1DT2A 1NRSH 2THFB 5GDSH 2G4UA 1K1MA 3LJOA 2ZPSA 2ZQ1A 2HRVA 3K65B 4AG2A 3RXDA 2BDBA 2Y5GA 3ATKA 3BTEE 4MVNA 4NIXA 3ZVBA 3CS7A 1BOQA 1QL9A 5F8ZA 4WXVA 2ZECA 2Y7XA 1GCTC 1SOTA 3VB7A 1YCPM 4HGCA 3UWJH 3PMJA 3AW1A 4Y6DA 1UK4A 2XWAA 2A31A 3SUFA 1O2TA 3MH4A 4GLYA 1QA7A 1ZOMA 1Y3YA 2AERH 1EB2A 1RIWB 2NU2E 2ZDVH 4K8BA 1H9IE 1P2JA 3SHCH 3V3MA 2BY9X 2FMJA 2TGTA 5FBEA 3I77A 3OSYA 1PPCE 1ZPCA 3D65E 4CHAB 1BUIA 3UR9A 1GJ5H 2O8WA 1GMCG 3F68H 4K5ZA 4A7IB 1O3BA 1RGQA 2LNCA 1TBRH 4FUJA 3ZZBA 2A4OA 2M5TA 4X6PA 2ZTYA 5GIBA 2HALA 4FVBA 2CHAC 1O5BB 2FO9A 2ZPRA 3LH3A 1YF4A 2GGVB 1CBWB 1C2IA 1TBZH 4NZLA 1DITH 1UVOA 2BLVA 4MNWA 2IN2A 1VCPA 1P0SH 3ZV8A 3M37A 1EZXC 3RXRA 5CHAB 1Z7KA 4K60A 2IJOB 1O34A 4ZAEA 3SNEA 1ANEA 4B1TA 2ZQ2A 1LQDB 1ELVA 3SORA 1DSUA 3MHWU 2GMTB 1ZLRA 1AUJA 1J9CH 2FI3E 4FUFA 1PQ5A 5ESBA 1EPTA 1AVGH 1C1QA 1DS2E 1O39A 2H2ZA 3CS0A 4U32A 5FPYA 1BMAA 1A5HA 1QRWA 2EA3A 1ARCA 3Q76A 1O2PA 4J2YB 1S5SA 2ZFSA 1TNLA 3GDUA 5DPAA 1W8BH 1LHEH 2W5EA 4XE4A 1AUTC 4Y8YA 1QIXB 3PYHA 1MUEB 2WPKS 1GBMA 2P8OC 3D23A 4FUDA 4B2CA 4CRAA 1O5FH 2P3TB 3BTME 1IOEA 1UTQA 1ANDA 1EATA 4BXSA 2PR3A 1ETTH 4DIHH 1AWFH 1ZSLA 2BVXH 1AZZA 1KLTA 3RDZA 2WPLS 2ALVA 3M35A 1C4Y2 2H1UA 2VWMA 1SGFA 5L30H 4FU9A 2IOTA 2ZHQH 4FUIA 4NFFA 2V35A 3Q3YA 1X7AC 2IPHA 1TPOA 1XXFA 4YZUA 4X6OA 1YKTA 4JMYA 3QZQA 1S81A 2XBXA 3RXBA 3FP6E 8LPRA 4NA7A 4DJZB 4DVAU 4JK6A 2BDCA 1O3NA 2CJIA 5EQSA 2UUJB 1L1JA 4NGAH 4ZXYH 5I25A 3A82A 2F3CE 2D1JA 1GHWH 2BZAA 2NU1E 1O5GH 1J16A 3BEIB 2Y7ZA 2Z9GA 1Q31A 3NZIA 1ZJDA 2AGGX 6LPRA 1SGYE 3SJOA
chains in the Genus database with same CATH superfamily
1VKYA 1C1SA 2HLDD 1OPHB 2HNTC 1NT1A 4GPGA 1S84A 4OS2A 1GMCF 1VITF 4CBNA 1UK2A 2UWPA 4ABHA 1EFRD 1TA6A 5F8XA 1QCPA 3S7KB 2QXGA 2JH6D 1SGTA 3M3TA 1EJAA 1K22H 4B6EA 1HAXB 3VFEA 4Y8ZA 2ASUB 4DURA 2WPHS 1GBCA 2BD8A 4WJG2 8GCHG 4I8HA 2ODYB 2BHGA 1TYNA 3A8AA 3E3TA 3RU4T 2KAIB 3NRLA 2BD7A 1T8OA 4MPVA 3TGJE 1SHYA 1W7GH 1P3EA 3TLOA 3Q3XA 1JWTA 4OS7A 3BEUA 1UVSH 1NC6A 3RXGA 2FDAA 1QGFA 1H1BA 2JETB 2CF9H 2W26A 4JZFH 2CK3D 1K1JA 4LXBH 3A80A 4BTIB 4ZKOU 3PMBB 4I8LA 3SNAA 1C5TA 3M61U 2ZFTA 4WWYA 1WOFA 1BA8B 1E37B 1P10A 1IAUA 4RKJB 3PMHB 4X2YA 2F43B 2XCFA 3PV2A 4JZ1A 3O8DA 4YM9A 1SVPA 2WYJA 4CR5A 1GJCB 1S6FA 5EG4A 2PP6A 2R0LA 3LDXH 1FUJA 1HPGA 3B23B 2C8XB 2ZTZA 1MKXH 2HVYB 1E36B 3S0NA 3PO1B 3AW0A 1BQYA 1GHYH 1V2PT 1A2CH 3U8OH 1V2WT 2SFAA 4YT6H 3MWIU 3PLPA 4OS6A 1KDQA 2P8OB 4IC6A 1PYTD 1TBQH 5C1YA 1F92A 1C9TA 2FX4A 2BDIA 5DP7A 2XXLA 5G4BA 3RXPA 2JJ1D 1CHGA 1IQIA 1YLDA 1JIMA 5LPEA 3BTKE 4J1YA 2GX4A 1S82A 2M2AA 3RXJA 1KXFA 1L0ZA 2SGQE 1W0YH 4B2BA 1LHGH 1PQ7A 5E0GA 4X8TH 1K1PA 2ZCHP 5DKMA 1YWUA 2RDEA 2A5AA 3PRDA 1WAYB 1HXEH 3TVJB 1ELDE 2V7QD 4ZKSU 2F9NA 4IN1A 1O2MA 1QBVH 1H9LB 1F7ZA 5EU8A 3OAAD 3A8CA 1BBRH 1ZHMA 3SV6A 3SNBA 2WYGA 1Y8TA 4ZHMU 1O2VA 1BJUA 3LGVA 1UW7A 2GV6A 1SQTA 1NRRH 1QQ4A 1V2VT 3SO3A 4I7YH 4FUHA 3T28A 3LC5A 5J4QA 4CRCA 1W2KH 1C1WH 1MTUA 3LONA 2A32A 2ZHWH 3M5NA 3D49H 3GY7A 1YY3A 4BAKB 1A5GH 2FP7B 2B5TB 3UQOA 1GHBF 1SLXB 1EAUA 2C90B 1SI5H 2OQUA 2J95A 3RXCA 5FHTA 2BD9A 4CBOA 1AZ8A 1C1TA 1UJ1A 2Y6TA 7KMEH 2SNVA 3M5MA 1CT2E 1GI3A 4F55A 5AFZH 3NXPA 2ZDKA 3QTOH 1CHOF 2C93B 4K2YA 1PQAA 3ZV9A 1HAOH 2VIWA 3FN8A 1DSTA 1QA0A 3RXUA 3ZZ3A 3CENA 1Y5UT 1BMNH 2GVFA 1O2RA 1DWEH 1QRXA 1YP9A 4OS1A 1C2FA 3MO9A 3SN8A 1AFQC 1SSXA 1FIWA 4H6SB 5A0AE 1T8LA 1FAKH 3IITA 3PV4A 5DSFA 1HAIH 2F9PA 4JCNA 4ABFA 3UQVA 1O3DA 1Y3UA 1A61H 1F0TA 3MU5A 1GDUA 2FOFA 5C1UA 1T7CA 5EJLA 1F5LA 2FI5E 2ZG0H 4NSVA 2Q6FA 4XBDA 1O3MA 3MH5A 2AEIH 4XSKU 1TX6A 1O37A 3QUMP 2BY6X 1NFUA 1P2NA 3MU0A 1WDIA 3ENSB 2GZ7A 2Z3DA 1BDAA 3F9FA 1MD7A 1LDTT 3KQEA 1FMGA 1GI0A 4X1SU 1IQKA 4OGYA 3RXIA 3MO3A 2A4QA 1DVAH 5A8YA 1Y5AT 2G81E 1DUAA 2QIQA 3SJIA 2ZPQA 1BTYA 5C67A 1C4V2 1ZMLA 4FETA 2SNWA 1C2JA 5EXNA 1OWJA 4AFZA 1NBMD 2G8TA 1K1LA 2WPJS 4WY3A 4Y10E 6ESTA 2VVVA 4AFUA 4Q7ZA 3ZVGA 2KM0A 2PHBA 3U8RH 2QC2A 3ZZCA 1SQRA 3U1IB 2RG3A 4ZH8A 2OQ5A 2WV4A 2BZ6H 5AVDA 3RMLH 4JZDH 3RM2H 3F2HA 5CHBA 3A8DA 2JJ2D 2G5NA 4GHQA 3ZZ6A 3BTQE 5B6OA 4WMEA 1NTPA 3TJNA 1GCDA 3SI3H 5SGAE 1O3JA 1L4ZA 3U69H 2VIQA 3DCLA 1ESAA 1GWAA 1AE5A 2K1QA 2BLOA 1H8ED 1WBGB 1RIWC 1CGIE 1A0LA 4MLFB 3FP7E 2GD4B 3ZVCA 2LP6A 1WV7H 4B73A 1THSH 2FWWA 1BIOA 3N99A 1ESBA 2ZFQH 4ZXXH 1NO9H 2QXHA 3VB3A 2J2UA 1DWDH 4ASUD 1C2EA 2C8WB 3NUMA 1SL3A 3GICB 1V2RT 4CR9A 1C2GA 2W7SA 2FOAA 1XMNB 4X1QU 3TH4H 1QB6A 3OY5U 2BVRH 2ULLA 5CHAC 1A4WH 2GMTC 3TJUA 3SW2B 2PGBB 1UCYE 1ORFA 1PYTC 5T1VA 1FLEE 4OGXA 2FOGA 1HUTH 1MD8A 1Z8IB 1C2KA 5BRRE 3DSPA 4Q4LA 1GBBA 4Y7BA 1CGHA 2FX6A 2ZIQH 4I8GA 3TGKE 2FI4E 4UFFH 1O3LA 3UPEA 3JZ2B 1TGTA 3CP7A 4X8SH 2PFEA 2VVUA 1IQEA 2ZDMA 4B71A 2RA3A 1E1RD 3M5LA 4D7FA 3SU1A 2BXTH 2XC0A 2FS9A 2I6QA 3MNCA 4HG6A 1ELTA 1CQQA 2HPPH 2ODPA 4CRFA 3GCHC 4Y0ZE 2VWOA 3UNQA 4WH8A 3PWBA 3A84A 3AAUA 1ZPZA 2OC0A 1MQ5A 3SV8A 5BPEA 2P94A 2F4LA 4UEHH 1IQNA 2ZDLA 3VGCB 2EQNA 2VINA 1VITH 4Z0KA 1P12E 1O3GA 1EX3A 5EGMA 1AKSA 4MDSA 3URDA 1BMMH 1A46H 1O3IA 1ZSJA 3GOVB 1G3BA 5LPFA 1GJBB 2J38A 2ZEBA 3SU4A 1KXCA 2SGDE 2GCHG 1TNHA 1O2JA 3TJVA 2FYQA 4I86A 3LPRA 1YCPK 2F9OA 5A8ZA 3QWCH 1HRTH 2BB4A 2IPQX 1QJ7B 1T8NA 1C5SA 2V3OH 3RXTA 3P8FA 1LTOA 2XBWA 2W6ID 4K1SA 3DHKH 1ZMNA 4YLUA 5B6LA 1GJ9B 1Y59T 1DXPA 1G9IE 3UNRA 2PKAA 3RXQA 1C1VH 3UFAA 5DO4H 1O5EH 2B8OH 2BY5X 4NA8A 1O3EA 1P2QA 2J4IA 1PPEE 1TX7A 2ANKH 3G01A 2O8UA 3GY4A 3A89A 3HKIB 1TAWA 2Y5HA 3A7VA 1CSOE 2BX4A 5EW2H 3O8CA 1UTJA 1PPZA 3U9AH 4GCHG 3FANA 1NBME 1OP2A 2BD3A 3P8OA 1HDTH 1HV7A 1V6DA 3SGQE 1C5ZB 1OS8A 1HAVB 4R0IA 2A4RA 3A85A 3C27B 1TIOA 1OWEA 3E1XB 1O2KA 4E05H 1A0HB 1YYY1 3L6PA 3NCLA 2D2DA 3ZVAA 1FXYA 5LPRA 1ZJKA 3EGKH 1G32B 4BXWA 1AVWA 3HGPA 3EE0B 3SU0A 5LH8A 5GPIB 3PRBA 4RSPA 2VJ1A 4OS4A 4YLQH 4MPUA 1KTTB 1KYNA 3LC3A 5EXMA 3EA7A 1FN6A 4THNH 1N6XA 4HTCH 3EQ0H 1F0UA 2AMDA 1JIRA 3FFGA 3DUXH 4NWKA 2R9PA 5JB8S 2Y5FA 2FESH 3TK5A 2BM2A 2JETC 3OEED 1KIGH 1SPJA 1AGJA 3P92A 5LGOA 1EZSC 4ACBA 1LVMA 4AGKA 3ZZ8A 3SZNA 1MH0A 1YCPH 3BTWE 4ABDA 3RXMA 2VH0A 4BNRA 1PFXC 3KN2A 1YPEH 2J92A 2XWBI 3TU7H 3GCTF 4XFQA 1UTNA 1Z71A 1SKYE 4M9FA 4Q7XA 1ZHPA 1TOMH 4OS5A 1O2NA 1EJNA 2PTCE 3U8TH 1PJPA 1FY5A 4TWYA 4CH2B 4SGAE 1FY8E 4FUEA 1EAWA 4O9VA 4X6MA 2O8MA 3F3BA 2XC5A 3GY8A 3HGNA 1Q3XA 5DP8A 1CU1A 4LK4A 4IW4E 2OK5A 1ZZZA 3SUEA 3PO1C 3BG8A 2PTNA 2WPIS 5C3NA 2TRMA 1UVPA 4UE7H 4D9QA 3GCHB 2AYWA 3ZZDA 4B6FA 1QTFA 1GBDA 2OC7A 2H9TH 3F9HA 4AB9A 1GMHF 2TBSA 5KGOA 3SUDA 1FPHH 1O33A 1O5CB 2GCHF 3RC5A 3URCA 3WWBA 1LMWB 1B0EA 1GDNA 1KXDA 1WQSA 1ZGIA 2ZTXA 3EA9A 1RFNA 1V3XA 1HIAB 1FY4A 1B5GH 1DDJA 1DFPA 2ANMH 5GJ4B 2W7UA 2EY4C 3UNSA 3P70B 2XNDD 3FKSD 3P8GA 3MNBA 3V0XA 3AK5A 1QR3E 4NA9H 4BOHA 1Z1JA 1MTVA 2HGTH 5GXPA 1O30A 2HNTE 2XRCA 4X2VA 2VIOA 1O3OA 2K8IA 3BG4C 2ZGBH 2BDAA 5DGJA 4AC9A 4TPYA 4GAWA 1SQAA 2AGIX 3DT0H 1Z8RA 4FU7A 3TK9A 4E7NA 3A7TA 4GCHF 4ISNA 3E91A 4NSYA 5K7RA 1C5QA 2ZHEH 5JDUB 3VB6A 3ATMA 2Z9KA 1MKXK 2ZHFH 1A0JA 1NS3A 2JDID 1LPKB 1Z8JB 2J9NA 4ZHLU 1Z1IA 2G52A 3DFLA 4MQAA 5ETXA 1SG8B 2KCAA 1HGTH 3PMAB 3T5FH 4INKA 2G00A 5KEDA 4ASHA 2Z3EA 1LO6A 2Y81A 5FX5A 1O3CA 2HWLB 5IDKA 1H4WA 4I31A 2A45B 5EJZA 3KQCA 3LKWA 3OEHD 3SBKA 1P01A 2PGQB 1UHBA 4D8NA 1AD8H 1GBKA 1U6QA 2K0QA 4B2AA 2Z3CA 5C2ZA 1GI5A 1NRNH 1O5AB 2VWNA 4PROA 2J98B 1EKBB 2A7CA 3BEFB 3VEQB 1O38A 1V2MT 6CHAB 1UTOA 5DJ7A 1O2YA 2OBOA 2BDYA 3T2NA 1OYQA 2UUFB 1UK3A 1HNEE 3UB0A 1D4PB 5TCCA 1MU8B 1CVWH 3A88A 1GVLA 4Y0YE 2NU4E 5E8EH 1O2UA 3BTGE 1BBRK 3GY5A 3PLKA 2SGEE 1DOJA 1GJ8B 3BIVH 3BTFE 4X2WA 1QHRB 1S6HA 2QF4A 1FAXA 1TMBH 1LVYA 2ZU4A 1HXFH 3N7DA 4ISLA 1EJMA 2FEQH 1EPTC 3BV9B 3PROA 2VB0A 4XBCA 3F2GA 1V2KT 5EJ1A 2A2QH 2GDDA 3ZYDA 5C5NA 3ZVFA 2A0QB 4K3JA 1F0SA 5EPYA 3RLWH 2B9LA 2TIOA 3DA9B 1ACBE 5C20A 1SGDE 1H8HD 2BD4A 2BD5A 1DANH 1L1GA 4SGBE 5A0CA 5ABWA 2BQ6B 5T6FA 5DP6A 1Y5BT 3F9GA 1TALA 2FYRA 3MH7A 4NIWA 1E38B 3LGIA 3MI4A 4RI0A 1DICA 1C5YB 1ELCA 3K9XB 3EYDA 1P05A 5GWZA 2C3SA 1GG6C 1CT4E 1C9PA 3NPSA 1DLKB 1V2LT 4IMQA 4DOQA 3DFJA 4E7RG 3QLPH 1T32A 3QO6A 4KP0A 4TYDA 1BHXF 3TPIZ 2BLWA 2KCPA 2ZNKH 1RTKA 2AS9A 1RXPA 2UUYA 2AMQA 1YPHC 1ELGA 2PUQH 3A81A 1EQ9A 3MNXA 3SOSA 4AG1A 4CREA 3M3VA 1C1RA 2BY7X 2PKSC 2WHXA 3A7YA 5L6NH 1G30B 2WUBA 3K2UA 1J17T 1TNIA 4NIVA 2FLRH 2I6SA 2VIDA 3RM0H 4WVPE 1EP6A 1DX5M 2GCTC 3SU6A 1GI6A 1QRZA 2EEKA 2ZU5A 3QN7A 4RKOB 1UMAH 1MMJN 3BG4B 4FU8A 1BTXA 1EAXA 2ZA5A 3MU8A 1TA2A 3IWMA 2A7HA 2FXRA 5JB9S 1BRBE 5EQRA 2CF8H 1OOKB 1VJ9U 3LU9B 5HKKD 1GI9B 2OINA 4BTUB 1V2NT 2TGPZ 3NK8A 4BANB 3RXHA 2ZDAH 1KSNA 1AB9B 1C5XB 1CE5A 4Z1MD 1MTNC 1C5UA 4AB8A 2ODQA 8GCHF 1ZTKA 2RCEA 3T27A 5C94A 2EC9H 2TPIZ 1Z8GA 5I46H 1AFEH 1GHVH 3P17H 5F8TA 3VXEH 3WY8A 1XUKA 1F2SE 1O35A 1V2ST 2BLQA 2DE9A 1LHFH 2ANWA 1P02A 4O03A 1O2GH 2BOKA 2B7DH 4GSOA 5C0UA 3KL6A 3UOUA 3OU0A 2WV5A 3RXVA 3TH2H 3MTYA 2BX3A 2GKVE 1KY9A 1Z6JH 3VGCC 4JZIA 2VU8E 3DD2H 4BAHB 1E0FD 7LPRA 4DGJA 1IHSH 2XBYA 4F49A 1DXWA 1SMFE 1VGCC 2EI7A 3E6PH 3UIRA 5IK2D 1MZDA 1C5LH 1O3HA 3BN9A 5DN6D 3NKKA 4U30A 1HCGA 1G3DA 4UDWH 1V2OT 2J94A 4Y71A 1EPTB 3LGTA 4R8TB 1NM6A 1SOZA 1BCUH 4YT7H 5DG6A 4I8KA 1GVZA 3AAVA 3QTVH 1O5DH 1ANBA 3RU4D 4MPXA 1TOCB 3MU4A 5JYIA 1C1OA 3GY2A 2QA9E 2OBQA 1P04A 1EASA 1VR1H 1VJAU 1E35B 2BYAX 7GCHG 1P2MA 1W0KD 4HI3A 1PPBH 4KELA 1MZAA 2PW8H 2F9UA 3KQBA 1BTZA 2ZO3H 1WXRA 2FZZA 1J8AA 3UUZA 1WCZA 1XXDA 1YPJH 1XUIA 3H5CB 3PWCA 5E2PA 2OTVA 1UTLM 1H9HE 3FP8E 2AFQB 1GG6B 1GHXH 2ZF0H 1P8VC 4X1PU 1OKXA 1JOUB 1HJ9A 2H9HA 1BTPA 2GZ9A 1DWCH 1KLJH 5DP9A 1GBFA 4O97A 4YO9A 2KFWA 1CGJE 4YOGA 4NWLA 3F1SB 3R0FA 1C1NA 1LPZB 1NFWA 1QURH 3S9AA 1V2TT 2P95A 2PKSB 1FQ3A 3N7OA 4LZ1H 4ABJA 3TITA 2ZCKP 2VVCA 2QGRA 3MYWA 3GY3A 9ESTA 1QL8A 3ZZAA 1XUFA 2XBVA 4H6TA 1D3PB 1XUJA 2GCTB 2XTTB 3HK6B 1GBLA 5JBAS 4M7GA 1P2KA 1GJDB 1THRH 3ITIA 1W0JD 4UONA 4XBBA 3S9BA 2GZ8A 1P2OA 4TT3D 3W1EA 1LHCH 3BTTE 2HLCA 2OC1A 2HVXA 2F83A 1WYKA 1EOLA 2A1DB 1OX1A 2EI8A 1EOJA 3PTBA 4BAOB 1ESTA 4K1EA 1GDQA 4AOQA 2KAIA 4RN6A 1ZRBA 3P6ZB 1MAXA 4JYTA 2C4FH 2TGAA 1DY9A 2FPZA 2QF3A 2UWOA 1MTNB 4AFSA 4BTTB 2OP9A 2C8YB 1KXAA 4P02A 1TNKA 1IQMA 1FNIA 1XVMA 2R3UA 1C4U2 1E34B 2B0FA 2XOKD 2SGAA 3H7TA 1Y3VA 4IGDA 4LOYH 3H7OA 1TE0A 4NG9H 3MFJA 3SNDA 1VCWA 1LVBA 3SV9A 1GBJA 2ANYA 4Q7YA 5T6GA 1HBTH 1SR5C 1UO6A 1OWIA 1TB6H 3BF6H 3TH3H 3LOXA 3O8RA 4XDEA 4IN2A 5F6MA 1SLVB 5GCHG 1PPFE 1C2DA 1GJ4H 3OYPA 3ODDA 2FTLE 3I78A 1GI2A 1SGIB 3ATLA 1K28D 4X8UH 4FXGH 1YPMH 5JBCS 2QAAA 1W10U 1AE8H 1EUFA 3P95A 3KNXA 1G36A 1O3PB 3GYLB 3SV7A 1FPCH 2WPDD 5AF9H 1VGCB 3E8LA 2BMGB 1TRNA 3ESTA 3ZYEA 7GCHF 2BD2A 1GMDG 2KCYA 5EW1H 2ZHDA 3KHVA 5C0TA 1C5RA 2WUCA 2RA0A 2BQWB 1MAYA 4LZ4B 1BRAA 3I29A 3PB1E 2ZFFH 3EE7A 4IMZA 3MO6A 3QGNB 1L1NA 1YGCH 2PV9B 2R2WU 3VXFH 3SU3A 3PV5A 3F0PA 3SV2H 1P57B 2AIQA 2ZWLH 1EB1H 1IQJA 1EP5A 1G37A 1KMHB 1MABB 2P59A 3KF2A 3VPKA 4Y8XA 3RU4E 1NRPH 2LPRA 2PSXA 1LVOA 1P9UA 1ARBA 1KDQB 1N6YA 3RLYH 3T29A 5CDFE 3TJOA 1MTSA 5HYOA 4ZKNU 4DCDA 4WXIA 1T4UH 3SJKA 1TGSZ 3TNSA 2OUAA 5H4IB 2AGEX 1SFQB 4IBLH 1SGNE 1TQ0B 1INCA 1B7XB 2QCYA 1JXPA 2P3UB 3Q3KA 2ZGHA 6CHAC 3M36A 4ISIH 3W95A 3U1JB 1SLWB 1GBTA 1WTHD 2STAE 2KX4A 4A1TA 2G55A 4XOJA 3RXKA 4MNYA 5E0HA 5JPMH 4AYVB 3SI4H 3SGBE 1NU9A 3A7WA 2CXVA 2LELA 4UFEH 1MCTA 3BIUH 1SB1H 3WW7A 2Q1JA 1JRTA 1QB9A 1Y3WA 3A86A 3STJA 2FOEA 4FOUC 3VB5A 1T31A 5CE1A 1SFIA 2STBE 2UWLA 1PPGE 2BXUH 1FV9A 2JIZD 1ID5H 3A87A 1UVTH 3SNCA 4X8VH 1VITG 3VG8A 1N8OC 3MMGA 4Y79A 1FI8A 2ZGCA 3U28C 3FAOA 2OC8A 1KXBA 3LGUA 4UFGH 3ATIA 1OYTH 4ZROA 3SU5A 1ELAA 1UCYH 1V2JT 2NWNA 3GCNA 1HAHH 3Q00A 5CMXH 1XVOA 1HYLA 1RJXB 2WPMS 1GJ6A 2QXIA 1EZQA 1WU1A 1GJ7B 1A1RA 1YPLH 2CGAA 1AO5A 2P16A 3BSQA 5GCHF 2BDHA 3KEEA 1HAZB 2H9EH 1DUEA 1G2LA 4ZHAA 1D3TB 3QX5H 1CA0C 1GBAA 2GJGA 3JZ1B 1SGPE 2DE8A 1TGCA 4X1RU 1SGCA 5EOKA 1YBWA 1C5OH 4ABIA 1C2HA 1O36A 2F91A 1MTWA 4B75A 5C1XA 2GDEH 1UTPA 4TY6A 2GT8A 7ESTE 3FZZA 1D6WA 4F48B 2RFKC 2VH6A 2FIRH 4BAMB 1D3QB 4ABBA 4X2XA 1GMDF 1NRQH 1BHXB 4AORA 2AH4X 3T62A 5FPSA 3UREA 3EA8A 5J4SA 3T26A 1BITA 1HAGE 4DY7B 1ELBA 3L3TA 1GVKB 3LGYA 3STIA 1DPOA 1SBWA 3GDVA 1WSSH 2JKHA 1KTSB 1Q2WA 1GGDB 3HATH 3EDXB 4JYUH 2H5CA 1HAYB 3A7XA 3RUOA 4MTBA 3ZVDA 3W94A 4MNVA 1O2WA 1G3EA 2ZKSA 1W11U 4DG4A 3LT3A 3RMMH 1YPKH 3KGPA 2QV1A 5TCAA 3SYJA 3SGAE 3SHAH 5FCKA 1OSSA 1GBEA 4AN7A 1SGQE 1W7XH 5FX6A 1AI8H 1LKAA 2IJD1 3BTDE 1BZXE 2QE7D 3E90B 1FJSA 1UVUH 1TPPA 1SC8U 1ZRKA 5PTPA 1BBRE 1SQOA 1LCYA 3SZEA 1XM1A 1GI1A 3PTNA 5IYTA 3RMNH 2O8LA 4GHTA 3QZRA 3AASA 1C5PA 3UTUH 1SHHB 3M5OA 1AB9C 3MH6A 1KLIH 3F2FA 4ABGA 3SUGA 2TGDA 4JK5A 3RP2A 4Y7AA 5A09A 3PM3A 2Z9IA 1K2I1 4NIYA 1HAPH 2CN0H 1IQGA 2P3FH 4B74A 2VGCB 1DM4B 1V2QT 3RC4A 3TIUA 4WH6A 4KTSA 4VGCB 2D8WA 3L33A 1TGBA 3A7ZA 1TNGA 3RXAA 1GPZA 2QXJA 1K1IA 2XYAA 4ABAA 3F0OA 1A3EH 2F9VA 3EAJA 5AFYH 3ZZ7A 1K21H 2PSYA 2A7JA 3GDSA 1TLDA 1RTFB 1PQ8A 3OFND 3KCGH 1FONA 1GCTB 2A5KA 3QK1A 4IS5A 1W3CA 5EQQA 1P3CA 1GJAB 2QY0B 2VNTA 3C1KA 4MNXA 4H42U 3UY9A 3LH1A 1ELFA 5L2ZH 1GHBG 5DP3A 9LPRA 3OTPA 4YOJA 4YTAA 3GYMA 2P93A 1MKWK 1MBMA 4ACAA 3M7UA 1K1NA 1YPGH 4Q2KA 1P11E 4QT8C 1RTLA 1D6RA 5HIYA 1CHOG 3ZZ4A 1A5IA 1N8OB 3ZZ9A 1O31A 2CHAB 1S0RA 3D62A 1QFKH 5T3HA 1WTGH 2FODA 1O3AA 1XX9A 2ZGJA 5DP4A 1O3FA 4A6LA 2QF0A 1NPMA 1GHAG 4TPIZ 3A83A 1JRSA 1ZSKA 2VWLA 4DIIH 3SQEE 1GHZA 1YPHE 3FO8D 4JYVH 4CRGA 1THPB 1K1OA 2A2XH 2BDGA 1CA0B 4D7GA 1AQ7A 3U98H 1DLEA 1QB1A 2BTCE 3MNSA 3VB4A 5EPNA 5EXLA 1LHDH 2UUKB 3SU2A 2BQ7B 3AVZA 4NFEA 1C1UH 1J14A 3F9EA 1IHTH 2H5DA 4NZQA 1P03A 1BMFD 1O3KA 4D76A 3QGJA 2XNIA 1AKSB 2BVSH 1MQ6A 3ELAH 2FTMA 2SGPE 5E2OA 1FX0B 3RMOH 4FUCA 4MPWA 1NROH 4IC5A 4KKDA 1OWDA 2Z94A 2W6JD 2F9BH 1SGRE 3TNTA 5HM2A 1HFDA 5TJXA 1M9UA 2C8ZB 3LGWA 3M3SA 1EZUC 4ZCNA 2A5IA 2ZDNA 1IQFA 2W3IA 1TONA 1UTKA 5FCRA 2FOCA 5T6DA 1DE7H 1S6LA 3IG6B 4F4OC 1TRYA 3KQ5A 5E0JA 5JBTA 1NESE 1WUNH 1TQ7B 1BTWA 2AMPA 2VIVA 4ABEA 1MKWH 2JH0D 2JH5D 1E1QD 4ZKRU 1HAVA 2PKAB 4AYYB 2OXSA 1ZGVA 1O2OA 1V2UT 1FY1A 1BTUA 1XUHA 2ZGXH 4A1XA 1F0RA 2HOBA 2G51A 2AIPA 2PLXA 2XW9A 2EI6A 1P9SA 2R2MB 1GL1A 4Q63A 1A3BH 1YC0A 3RXLA 3V7TA 5FAHA 2XCNA 4BAQB 1AHTH 1CA8B 5EODA 1PPHE 2YMSB 2GTBA 3M7QA 2J97A 1QQUA 3UWIA 1OWHA 1T4VH 3A8BA 1S0QA 2R0KA 2Z9LA 3S69A 1TMUH 2Y82A 1D9IA 1GI7B 1VZQH 4GUXA 5AHGH 3H09A 4K1TA 2DUCA 2WZQA 1TPAE 3QDZB 1RS0A 4X6NA 2ZU3A 1YM0A 2BY8X 5FPTA 2WINI 1GI8B 1O2HA 2XC4A 2ZI2H 1BJVA 4CRDA 1T8MA 2H6MA 4FVDA 4INHA 4FUBA 3E16B 3HKJB 4A5TS 1O32A 3B8JA 4A92A 5KECA 1SGEE 3LJJA 2QYIA 4K69A 4CRBA 2KCOA 1S83A 3E0NB 1TGNA 1IQHA 4H4FA 1TFXA 1DY8A 1F5KU 2Z7FE 2SGFE 2ZFPH 4B76A 4UD9H 1GBHA 1YLCA 3S7HB 1O2XA 1HJ8A 1ELEE 1OP0A 2FOMB 3RXSA 4GVUA 1GHAF 3GY6A 1QJ6B 1P09A 8ESTE 4I33A 2O8TA 5FXLA 1ETSH 2CMYA 1BRCE 5EIYA 3MU1A 3SJ8A 1XKBC 2YOLA 4Q80A 4JZEH 1AU8A 1TX8A 1ZR0A 3SQHE 3ZIAD 1Y3XA 1AWHB 4HFPB 1K0HA 1A7SA 1MBQA 3OTJE 2L6OA 2CV3A 1L2EA 3Q77A 1C1PA 1HB0B 1HIAA 1TABE 3FOAA 4TY7A 3B9FH 4YESB 1HLTH 1LPGB 2GP9B 1BB0B 4ISHH 2Q6DA 4DW2U 1ABJH 1O2IA 4I32A 1OP8A 3ZZ5A 1ETRH 1RD3B 4RT0A 4XRNA 1ZHRA 4E06H 4I8JA 3KYGA 3SJ9A 1CO7E 5GNDA 3TGIE 3HPTB 1H8DH 5C17A 1BMLA 4CH8B 3DSOA 1AIXH 1TNJA 1HJAC 1QJ1B 1TMTH 1C5NH 2OLGA 4YOIA 5HXFA 3O8BA 2OCVB 2QN5T 3HK3B 4NCYA 3RXOA 1OXGA 1CT0E 2ESTE 2NU3E 1QY6A 3K6ZA 2L74A 1OWKA 4AGJA 3OY6U 1ZMJA 4O3UA 3ATWA 3S9CA 1GL0E 1O2ZA 2ZC9H 2ILNA 4ISOA 1FDPA 3GISB 2J34A 1EXFA 4DT4A 2FLBH 4D9RA 2ZU1A 3F6UH 1ANCA 3KQDA 4O3TA 3FVFB 2A4GA 6GCHG 1P2IA 2OD3B 3MOCA 1C2MA 1O2QA 3UOPA 1JMOH 5A2MH 5F03A 2ZU2A 1W0ZU 1BTHH 2GV7A 2VIPA 5DK1A 2BOHB 2PUXB 3TK6A 1DWBH 2YNAA 2W3KA 2WV9A 4Y11E 2FOBA 5A0BA 2J98A 4CHAC 1AVXA 1BT7A 4X0WU 4ZUHA 1C5VA 2AHME 1O2LA 1WQVH 2Y80A 4INLA 1ABIH 4WF8A 2FS8A 4A1VA 1RRKA 4U2WA 3RXFA 3R3GB 2ALPA 1QL7A 4K8YA 1W12U 1OHHD 1N1LA 1CBWC 1C5WB 1SGFG 4TWWA 4KGAA 1EAIA 1UHBB 4KTCA 3T25A 3OE7D 1F5RA 4U01A 3NWUA 3K6YA 3PLBA 1TRMA 3ZVEA 1IQLA 2FOHA 1ZTLA 8KME2 2ZP0H 1H8IH 1NY22 2QF5A 4AX9H 1K9OE 3BTHE 2D26C 5DP5A 2RDLA 3V12A 2V6NA 1LKBA 3N7EA 4HZHA 1L4DA 1BRUP 4TSFD 2YMSD 4WMDA 2HNTF 4AZ2B 1QBNA 2Z6BD 5A8XA 2PWXA 3GCTG 4X1NU 1Z6EA 1C2LA 1QNJA 4MG3A 2R3YA 2VBCA 3UR6A 1C1MA 5FBIA 1W13U 5JBBS 1S85A 2V0BA 5K0HA 1QBOA 2NU0E 5HM9A 3GCOA 1GGDC 1AFQB 1XUGA 3FZDA 5ESTE 1MU6B 1COWD 1FN8A 1MCVA 4DT7B 4ESTE 3M7TA 1B0FA 1TPSA 1G2MA 1NU7B 1ZPBA 5HMAA 3LIWA 1FZZA 4ZMAH 1JBUH 1W14U 1O0DH 3E0PB 5F53A 2FM2A 1G3CA 1NFYA 5C5OA 4UFDH 1UCYK 1NN6A 3KIDU 1SLUB 2ZFRH 1J15A 1LQEA 1NZQH 2G4TA 1GMHG 4FUGA 1XKAC 2ZZUH 3V13A 2G5VA 1GBIA 1O2SA 4Z6AH 1C5MD 1ZYOA 2YNBA 3MQKC 1NFXA 1GI4A 1UTMA 3P8NA 1ZTJA 1FY3A 2KR7A 2Q6GA 5HIZA 4YXWD 1VCQA 1P06A 2ZCLP 4Y76A 1KXEA 1AN1E 1FIZA 3ODFA 4AFQA 1AY6H 4WMFA 2Z9JA 3OX7U 2O9QA 4KTUA 5L2YH 2VGCC 1HJAB 2GT7A 3RC6A 5HGGA 3RXEA 6GCHF 1D3DB 1TWXB 4VGCC 2V3HH 1AMHA 2HPQH 1DT2A 1NRSH 2THFB 5GDSH 2G4UA 1K1MA 3LJOA 2ZPSA 2ZQ1A 2HRVA 3K65B 4AG2A 3DSGA 3RXDA 2BDBA 2Y5GA 3ATKA 3BTEE 4MVNA 4NIXA 3ZVBA 3CS7A 1BOQA 1QL9A 5F8ZA 4P00A 4WXVA 2ZECA 2Y7XA 1GCTC 1SOTA 3VB7A 1YCPM 4HGCA 3UWJH 3WWFA 3PMJA 3AW1A 4Y6DA 1UK4A 2XWAA 2A31A 3SUFA 1O2TA 3MH4A 4GLYA 1QA7A 1ZOMA 1Y3YA 2AERH 1EB2A 1RIWB 2NU2E 2ZDVH 4K8BA 1H9IE 1P2JA 3SHCH 3V3MA 2BY9X 2FMJA 2TGTA 5FBEA 2V3MA 3I77A 3OSYA 1PPCE 1ZPCA 3D65E 4CHAB 1BUIA 3UR9A 1GJ5H 2O8WA 1GMCG 3F68H 4K5ZA 4A7IB 1O3BA 1RGQA 2LNCA 1TBRH 4FUJA 3ZZBA 2A4OA 2M5TA 4X6PA 2ZTYA 5GIBA 2HALA 4FVBA 2CHAC 3CNRA 1O5BB 2FO9A 2WSSD 2ZPRA 3LH3A 1YF4A 2GGVB 1CBWB 1C2IA 1TBZH 4NZLA 1DITH 1UVOA 2BLVA 4MNWA 2IN2A 1VCPA 1P0SH 3ZV8A 3M37A 1EZXC 3RXRA 5CHAB 1Z7KA 4K60A 2IJOB 1O34A 4ZAEA 3SNEA 1ANEA 4B1TA 2ZQ2A 1LQDB 1ELVA 3SORA 1DSUA 3MHWU 2GMTB 1ZLRA 1AUJA 1J9CH 2FI3E 4FUFA 1PQ5A 2J5UA 5ESBA 1EPTA 1AVGH 2KZ4A 1C1QA 1DS2E 1O39A 2H2ZA 3CS0A 4U32A 5FPYA 1BMAA 1A5HA 1QRWA 2EA3A 1ARCA 3UAIC 3Q76A 1O2PA 4J2YB 1S5SA 2ZFSA 1TNLA 3GDUA 5DPAA 1W8BH 1LHEH 1YLNA 2W5EA 4XE4A 1AUTC 4Y8YA 1QIXB 3PYHA 1MUEB 2WPKS 1GBMA 2P8OC 3D23A 4FUDA 4B2CA 4CRAA 1O5FH 3KYFA 2P3TB 3BTME 1IOEA 1UTQA 1QZ8A 1ANDA 1EATA 4BXSA 2PR3A 1ETTH 5FL7D 4DIHH 1AWFH 1ZSLA 2BVXH 1AZZA 1KLTA 3RDZA 4XD7D 2WPLS 2ALVA 3M35A 1C4Y2 2H1UA 2VWMA 1SGFA 5L30H 4FU9A 2IOTA 2ZHQH 4FUIA 4NFFA 2V35A 3Q3YA 1X7AC 2IPHA 4RT1A 1TPOA 1XXFA 4YZUA 4X6OA 1YKTA 4JMYA 3QZQA 1S81A 4OM9A 2XBXA 3RXBA 3FP6E 8LPRA 4NA7A 4DJZB 4DVAU 2YMSC 4JK6A 2BDCA 1O3NA 1E79D 2CJIA 5EQSA 2UUJB 1L1JA 4NGAH 4ZXYH 5I25A 3A82A 2F3CE 2D1JA 1GHWH 2BZAA 2NU1E 1O5GH 1J16A 3BEIB 3GS9A 2Y7ZA 2Z9GA 1Q31A 3NZIA 1ZJDA 2AGGX 6LPRA 1SGYE 3SJOA
chains in the Genus database with same CATH topology
1C1SA 1OPHB 2HNTC 1NT1A 4GPGA 1S84A 4OS2A 1GMCF 1VITF 4CBNA 1UK2A 2UWPA 4ABHA 1TA6A 5F8XA 1QCPA 3S7KB 2QXGA 2JH6D 1SGTA 3M3TA 1EJAA 1K22H 1HAXB 3VFEA 4Y8ZA 2ASUB 4DURA 2WPHS 1GBCA 2BD8A 4WJG2 8GCHG 4I8HA 2ODYB 2BHGA 1TYNA 3A8AA 3E3TA 3RU4T 2KAIB 2BD7A 1T8OA 4MPVA 3TGJE 1SHYA 1W7GH 1P3EA 3TLOA 3Q3XA 1JWTA 4OS7A 3BEUA 1UVSH 1NC6A 3RXGA 2FDAA 1QGFA 1H1BA 2JETB 2CF9H 2W26A 4JZFH 1K1JA 4LXBH 3A80A 4BTIB 4ZKOU 3PMBB 4I8LA 3SNAA 1C5TA 3M61U 2ZFTA 4WWYA 1WOFA 1BA8B 1E37B 1P10A 1IAUA 4RKJB 3PMHB 4X2YA 2XCFA 4JZ1A 3O8DA 4YM9A 1SVPA 2WYJA 4CR5A 1GJCB 1S6FA 5EG4A 2R0LA 3LDXH 1FUJA 1HPGA 3B23B 2C8XB 2ZTZA 1MKXH 1E36B 3S0NA 3PO1B 3AW0A 1BQYA 1GHYH 1V2PT 1A2CH 3U8OH 1V2WT 2SFAA 4YT6H 3MWIU 3PLPA 4OS6A 1KDQA 2P8OB 4IC6A 1PYTD 1TBQH 5C1YA 1F92A 1C9TA 2FX4A 2BDIA 5DP7A 2XXLA 5G4BA 3RXPA 1CHGA 1IQIA 1YLDA 1JIMA 5LPEA 3BTKE 4J1YA 2GX4A 1S82A 3RXJA 1KXFA 1L0ZA 2SGQE 1W0YH 4B2BA 1LHGH 1PQ7A 5E0GA 4X8TH 1K1PA 2ZCHP 5DKMA 2A5AA 1WAYB 1HXEH 3TVJB 1ELDE 4ZKSU 2F9NA 4IN1A 1O2MA 1QBVH 1H9LB 1F7ZA 5EU8A 3A8CA 1BBRH 1ZHMA 3SV6A 3SNBA 2WYGA 1Y8TA 4ZHMU 1O2VA 1BJUA 3LGVA 2GV6A 1SQTA 1NRRH 1QQ4A 1V2VT 3SO3A 4I7YH 4FUHA 3T28A 3LC5A 5J4QA 4CRCA 1W2KH 1C1WH 1MTUA 3LONA 2A32A 2ZHWH 3M5NA 3D49H 3GY7A 4BAKB 1A5GH 2FP7B 2B5TB 3UQOA 1GHBF 1SLXB 1EAUA 2C90B 1SI5H 2OQUA 2J95A 3RXCA 5FHTA 2BD9A 4CBOA 1AZ8A 1C1TA 1UJ1A 2Y6TA 7KMEH 2SNVA 3M5MA 1CT2E 1GI3A 5AFZH 3NXPA 2ZDKA 3QTOH 1CHOF 2C93B 4K2YA 1PQAA 3ZV9A 1HAOH 2VIWA 1DSTA 1QA0A 3RXUA 3ZZ3A 3CENA 1Y5UT 1BMNH 2GVFA 1O2RA 1DWEH 1QRXA 1YP9A 4OS1A 1C2FA 3MO9A 3SN8A 1AFQC 1SSXA 1FIWA 4H6SB 5A0AE 1T8LA 1FAKH 3IITA 3PV4A 1HAIH 2F9PA 4JCNA 4ABFA 3UQVA 1O3DA 1Y3UA 1A61H 1F0TA 3MU5A 1GDUA 2FOFA 5C1UA 1T7CA 1F5LA 2FI5E 2ZG0H 4NSVA 2Q6FA 4XBDA 1O3MA 3MH5A 2AEIH 4XSKU 1TX6A 1O37A 3QUMP 2BY6X 1NFUA 1P2NA 3MU0A 3ENSB 2GZ7A 2Z3DA 1BDAA 3F9FA 1MD7A 1LDTT 3KQEA 1FMGA 1GI0A 4X1SU 1IQKA 4OGYA 3RXIA 3MO3A 2A4QA 1DVAH 5A8YA 1Y5AT 2G81E 1DUAA 2QIQA 3SJIA 2ZPQA 1BTYA 5C67A 1C4V2 1ZMLA 2SNWA 1C2JA 5EXNA 1OWJA 4AFZA 2G8TA 1K1LA 2WPJS 4WY3A 4Y10E 6ESTA 2VVVA 4AFUA 4Q7ZA 3ZVGA 2PHBA 3U8RH 2QC2A 3ZZCA 3U1IB 2RG3A 4ZH8A 2OQ5A 2WV4A 2BZ6H 5AVDA 3RMLH 4JZDH 3RM2H 3A8DA 2G5NA 4GHQA 3ZZ6A 3BTQE 5B6OA 4WMEA 1NTPA 3TJNA 1GCDA 3SI3H 5SGAE 1O3JA 1L4ZA 3U69H 2VIQA 1ESAA 1GWAA 1AE5A 2K1QA 2BLOA 1WBGB 1RIWC 1CGIE 1A0LA 4MLFB 3FP7E 2GD4B 3ZVCA 1WV7H 4B73A 1THSH 2FWWA 1BIOA 1ESBA 2ZFQH 4ZXXH 1NO9H 2QXHA 3VB3A 2J2UA 1DWDH 1C2EA 2C8WB 3NUMA 1SL3A 3GICB 1V2RT 4CR9A 1C2GA 2W7SA 2FOAA 1XMNB 4X1QU 3TH4H 1QB6A 3OY5U 2BVRH 2ULLA 5CHAC 1A4WH 2GMTC 3TJUA 3SW2B 2PGBB 1UCYE 1ORFA 1PYTC 1FLEE 4OGXA 2FOGA 1HUTH 1MD8A 1Z8IB 1C2KA 5BRRE 1GBBA 4Y7BA 1CGHA 2FX6A 2ZIQH 4I8GA 3TGKE 2FI4E 4UFFH 1O3LA 3UPEA 3JZ2B 1TGTA 3CP7A 4X8SH 2PFEA 2VVUA 1IQEA 2ZDMA 4B71A 2RA3A 3M5LA 4D7FA 3SU1A 2BXTH 2XC0A 2FS9A 2I6QA 3MNCA 1ELTA 1CQQA 2HPPH 2ODPA 4CRFA 3GCHC 4Y0ZE 2VWOA 3UNQA 4WH8A 3PWBA 3A84A 3AAUA 1ZPZA 2OC0A 1MQ5A 3SV8A 5BPEA 2P94A 4UEHH 1IQNA 2ZDLA 3VGCB 2VINA 1VITH 4Z0KA 1P12E 1O3GA 1EX3A 5EGMA 1AKSA 4MDSA 3URDA 1BMMH 1A46H 1O3IA 1ZSJA 3GOVB 1G3BA 5LPFA 1GJBB 2J38A 2ZEBA 3SU4A 1KXCA 2SGDE 2GCHG 1TNHA 1O2JA 3TJVA 2FYQA 3LPRA 1YCPK 2F9OA 5A8ZA 3QWCH 1HRTH 2BB4A 1QJ7B 1T8NA 1C5SA 2V3OH 3RXTA 3P8FA 1LTOA 2XBWA 4K1SA 3DHKH 1ZMNA 4YLUA 1GJ9B 1Y59T 1DXPA 1G9IE 3UNRA 2PKAA 3RXQA 1C1VH 3UFAA 5DO4H 1O5EH 2B8OH 2BY5X 4NA8A 1O3EA 1P2QA 2J4IA 1PPEE 1TX7A 2ANKH 3G01A 2O8UA 3GY4A 3A89A 3HKIB 1TAWA 2Y5HA 3A7VA 1CSOE 2BX4A 5EW2H 3O8CA 1UTJA 1PPZA 3U9AH 4GCHG 3FANA 1OP2A 2BD3A 3P8OA 1HDTH 1HV7A 1V6DA 3SGQE 1C5ZB 1OS8A 1HAVB 4R0IA 2A4RA 3A85A 3C27B 1TIOA 1OWEA 3E1XB 1O2KA 4E05H 1A0HB 1YYY1 3L6PA 3NCLA 2D2DA 3ZVAA 1FXYA 5LPRA 1ZJKA 3EGKH 1G32B 4BXWA 1AVWA 3HGPA 3EE0B 3SU0A 5LH8A 5GPIB 4RSPA 2VJ1A 4OS4A 4YLQH 4MPUA 1KTTB 1KYNA 3LC3A 5EXMA 3EA7A 1FN6A 4THNH 1N6XA 4HTCH 3EQ0H 1F0UA 2AMDA 1JIRA 3FFGA 3DUXH 4NWKA 2R9PA 5JB8S 2Y5FA 2FESH 3TK5A 2BM2A 2JETC 5LGOA 1KIGH 1SPJA 1AGJA 3P92A 1EZSC 1LVMA 4AGKA 3ZZ8A 3SZNA 1MH0A 1YCPH 3BTWE 4ABDA 3RXMA 2VH0A 4BNRA 1PFXC 3KN2A 1YPEH 2J92A 2XWBI 3TU7H 3GCTF 4XFQA 1UTNA 1Z71A 4Q7XA 1ZHPA 1TOMH 4OS5A 1O2NA 1EJNA 2PTCE 3U8TH 1PJPA 1FY5A 4TWYA 4CH2B 4SGAE 1FY8E 4FUEA 1EAWA 4O9VA 4X6MA 2O8MA 2XC5A 3GY8A 3HGNA 1Q3XA 5DP8A 1CU1A 4LK4A 4IW4E 1ZZZA 3SUEA 3PO1C 3BG8A 2PTNA 2WPIS 5C3NA 2TRMA 1UVPA 4UE7H 4D9QA 3GCHB 2AYWA 3ZZDA 1QTFA 1GBDA 2OC7A 2H9TH 3F9HA 4AB9A 1GMHF 2TBSA 3SUDA 1FPHH 1O33A 1O5CB 2GCHF 3RC5A 3URCA 1LMWB 1B0EA 1GDNA 1KXDA 1WQSA 1ZGIA 2ZTXA 3EA9A 1RFNA 1V3XA 1HIAB 1FY4A 1B5GH 1DDJA 1DFPA 2ANMH 5GJ4B 2W7UA 3UNSA 3P70B 3P8GA 3MNBA 3V0XA 1QR3E 4NA9H 4BOHA 1Z1JA 1MTVA 2HGTH 5GXPA 1O30A 2HNTE 2XRCA 4X2VA 2VIOA 1O3OA 3BG4C 2ZGBH 2BDAA 5DGJA 4TPYA 4GAWA 1SQAA 2AGIX 3DT0H 1Z8RA 4FU7A 3TK9A 4E7NA 3A7TA 4GCHF 4ISNA 3E91A 4NSYA 5K7RA 1C5QA 2ZHEH 5JDUB 3VB6A 3ATMA 2Z9KA 1MKXK 2ZHFH 1A0JA 1NS3A 1LPKB 1Z8JB 2J9NA 4ZHLU 1Z1IA 2G52A 3DFLA 4MQAA 5ETXA 1SG8B 1HGTH 3PMAB 3T5FH 4INKA 2G00A 4ASHA 2Z3EA 1LO6A 2Y81A 5FX5A 1O3CA 2HWLB 5IDKA 1H4WA 4I31A 2A45B 3KQCA 3LKWA 3SBKA 1P01A 2PGQB 1UHBA 4D8NA 1AD8H 1GBKA 1U6QA 4B2AA 2Z3CA 5C2ZA 1GI5A 1NRNH 1O5AB 2VWNA 4PROA 1EKBB 2A7CA 3BEFB 3VEQB 1O38A 1V2MT 6CHAB 1UTOA 5DJ7A 1O2YA 2OBOA 2BDYA 3T2NA 1OYQA 2UUFB 1UK3A 1HNEE 1D4PB 5TCCA 1MU8B 1CVWH 3A88A 1GVLA 4Y0YE 2NU4E 5E8EH 1O2UA 3BTGE 1BBRK 3GY5A 3PLKA 2SGEE 1DOJA 1GJ8B 3BIVH 3BTFE 4X2WA 1QHRB 1S6HA 1FAXA 1TMBH 1LVYA 2ZU4A 1HXFH 4ISLA 1EJMA 2FEQH 1EPTC 3BV9B 3PROA 2VB0A 4XBCA 1V2KT 2A2QH 2GDDA 3ZYDA 5C5NA 3ZVFA 2A0QB 4K3JA 1F0SA 5EPYA 3RLWH 2B9LA 2TIOA 3DA9B 1ACBE 5C20A 1SGDE 2BD4A 2BD5A 1DANH 1L1GA 4SGBE 5A0CA 5ABWA 2BQ6B 5T6FA 5DP6A 1Y5BT 3F9GA 1TALA 2FYRA 3MH7A 4NIWA 1E38B 3LGIA 3MI4A 1DICA 1C5YB 1ELCA 3K9XB 3EYDA 1P05A 5GWZA 2C3SA 1GG6C 1CT4E 1C9PA 3NPSA 1DLKB 1V2LT 4IMQA 4DOQA 3DFJA 4E7RG 3QLPH 1T32A 3QO6A 4KP0A 4TYDA 1BHXF 3TPIZ 2BLWA 2ZNKH 1RTKA 2AS9A 1RXPA 2UUYA 2AMQA 1YPHC 1ELGA 2PUQH 3A81A 1EQ9A 3MNXA 3SOSA 4AG1A 4CREA 3M3VA 1C1RA 2BY7X 2PKSC 3A7YA 5L6NH 1G30B 2WUBA 3K2UA 1J17T 1TNIA 4NIVA 2FLRH 2I6SA 2VIDA 3RM0H 4WVPE 1EP6A 1DX5M 2GCTC 3SU6A 1GI6A 1QRZA 2EEKA 2ZU5A 3QN7A 4RKOB 1UMAH 1MMJN 3BG4B 4FU8A 1BTXA 1EAXA 2ZA5A 3MU8A 1TA2A 3IWMA 2A7HA 2FXRA 5JB9S 1BRBE 5EQRA 2CF8H 1OOKB 1VJ9U 3LU9B 1GI9B 2OINA 4BTUB 1V2NT 2TGPZ 3NK8A 4BANB 3RXHA 2ZDAH 1KSNA 1AB9B 1C5XB 1CE5A 1MTNC 1C5UA 4AB8A 2ODQA 8GCHF 1ZTKA 2RCEA 3T27A 2EC9H 2TPIZ 1Z8GA 5I46H 1AFEH 1GHVH 3P17H 5F8TA 3VXEH 3WY8A 1XUKA 1F2SE 1O35A 1V2ST 2BLQA 2DE9A 1LHFH 2ANWA 1P02A 4O03A 1O2GH 2BOKA 2B7DH 4GSOA 3KL6A 3UOUA 3OU0A 2WV5A 3RXVA 3TH2H 3MTYA 2BX3A 2GKVE 1KY9A 1Z6JH 3VGCC 4JZIA 2VU8E 3DD2H 4BAHB 1E0FD 7LPRA 4DGJA 1IHSH 2XBYA 4F49A 1DXWA 1SMFE 1VGCC 2EI7A 3E6PH 3UIRA 1MZDA 1C5LH 1O3HA 3BN9A 3NKKA 4U30A 1HCGA 1G3DA 4UDWH 1V2OT 2J94A 4Y71A 1EPTB 3LGTA 4R8TB 1NM6A 1SOZA 1BCUH 4YT7H 5DG6A 4I8KA 1GVZA 3AAVA 3QTVH 1O5DH 1ANBA 3RU4D 4MPXA 1TOCB 3MU4A 5JYIA 1C1OA 3GY2A 2QA9E 2OBQA 1P04A 1EASA 1VR1H 1VJAU 1E35B 2BYAX 7GCHG 1P2MA 4HI3A 1PPBH 4KELA 1MZAA 2PW8H 2F9UA 3KQBA 1BTZA 2ZO3H 2FZZA 1J8AA 3UUZA 1WCZA 1XXDA 1YPJH 1XUIA 3H5CB 3PWCA 5E2PA 2OTVA 1UTLM 1H9HE 3FP8E 2AFQB 1GG6B 1GHXH 2ZF0H 1P8VC 4X1PU 1OKXA 1JOUB 1HJ9A 2H9HA 1BTPA 2GZ9A 1DWCH 1KLJH 5DP9A 1GBFA 4O97A 4YO9A 1CGJE 4YOGA 4NWLA 3F1SB 3R0FA 1C1NA 1LPZB 1NFWA 1QURH 3S9AA 1V2TT 2P95A 2PKSB 1FQ3A 3N7OA 4LZ1H 4ABJA 3TITA 2ZCKP 2VVCA 2QGRA 3MYWA 3GY3A 9ESTA 1QL8A 3ZZAA 1XUFA 2XBVA 4H6TA 1D3PB 1XUJA 2GCTB 2XTTB 3HK6B 1GBLA 5JBAS 4M7GA 1P2KA 1GJDB 1THRH 3ITIA 4UONA 4XBBA 3S9BA 2GZ8A 1P2OA 1LHCH 3BTTE 2HLCA 2OC1A 2HVXA 2F83A 1WYKA 1EOLA 2A1DB 1OX1A 2EI8A 1EOJA 3PTBA 4BAOB 1ESTA 4K1EA 1GDQA 4AOQA 2KAIA 4RN6A 1ZRBA 3P6ZB 1MAXA 4JYTA 2C4FH 2TGAA 1DY9A 2FPZA 2QF3A 2UWOA 1MTNB 4AFSA 4BTTB 2OP9A 2C8YB 1KXAA 1TNKA 1IQMA 1FNIA 1XVMA 2R3UA 1C4U2 1E34B 2B0FA 3H7TA 2SGAA 4IGDA 1Y3VA 4LOYH 3H7OA 1TE0A 4NG9H 3MFJA 3SNDA 1VCWA 1LVBA 3SV9A 1GBJA 2ANYA</