1GBBA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by ala complex with methoxysuccinyl-ala-ala-pro-alanine boronic acid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGANVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 52
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbbA01
1SLXB 1BHXB 4XBDA 3RXCA 2O9QA 1ZTKA 2BOKA 1FMGA 3ZZ7A 1HJ9A 2XNIA 1DANH 1LPGB 1C2HA 1AMHA 3BTFE 2PLXA 1Y3XA 3P92A 4Y8ZA 4JZ1A 1NO9H 1ZSJA 1VCPA 2XCNA 1YPHC 5FPTA 1AUTC 1AO5A 4Q7XA 2R3UA 4B2BA 3F9HA 2IJOB 1XKBC 3M5LA 3I29A 1FAXA 3KQEA 2F9BH 2Q6GA 2VIPA 1V2UT 2FLRH 1ELFA 1TBZH 2I6SA 4D9QA 1O36A 2ANYA 1P05A 1DE7H 5JB8S 4GHQA 3E8LA 1DLEA 2ZTYA 1GMCG 1EB2A 1XUGA 1UK4A 1SGDE 4Y10E 1O2LA 3KQDA 1LHEH 2JETC 1EZQA 2BDYA 3D65E 3FP7E 1B0FA 1GHZA 1GBMA 3ODFA 2SNWA 2EA3A 2HVXA 3BTME 1SHYA 1AVWA 1A5GH 1TNJA 4K69A 1QB6A 1V2RT 2AMPA 4R8TB 2BVSH 4NA7A 4A1TA 3QTVH 1M9UA 2VU8E 3RXGA 2CHAC 3SNBA 4YM9A 2FO9A 5L30H 3OY6U 3ZVBA 2XW9A 2TGPZ 4RN6A 1LVYA 1RTKA 1ESBA 2FMJA 3E16B 4WH8A 3E6PH 3GY4A 1TX6A 3F9GA 4UDWH 3RXIA 1JWTA 2BD3A 5LPFA 3S9AA 1GBCA 3O8BA 3LH1A 2V0BA 5HGGA 2ULLA 3UR9A 2FPZA 1SG8B 1P06A 2P93A 3SU4A 3P8OA 1BITA 3SJIA 1CT0E 1KIGH 1C2IA 1GDNA 1MTVA 4NZLA 2G52A 3UUZA 2B0FA 3BV9B 4NIYA 4OS2A 1CHOF 1DITH 2YOLA 1TGCA 4SGAE 1EKBB 3MH5A 5A8XA 1E36B 1O32A 1TNKA 1HRTH 5C5OA 2ZZUH 1L0ZA 2AYWA 1EB1H 1O3PB 2GCHG 2CGAA 3P6ZB 1IHTH 1QBOA 4DVAU 1LHCH 1SLWB 2PR3A 2A7JA 3GISB 4CBNA 2J95A 4ABAA 1YPLH 2HNTF 4ZROA 1PPEE 1IQKA 1AE5A 1DUEA 2F3CE 1JMOH 2B7DH 1W13U 3LGYA 3QWCH 3UR6A 1GHAF 2W5EA 2FOEA 4Z0KA 3A7YA 1CVWH 1NM6A 3OU0A 2ZFRH 2CXVA 3NZIA 2WUCA 1BRUP 1EZXC 2V6NA 2Z6BD 1EJMA 1LQDB 2QN5T 4BOHA 3GCNA 1U6QA 4PROA 3URDA 6GCHF 1ESTA 3HGNA 1TGSZ 1KLIH 1NU7B 4CR5A 1EX3A 1O38A 1O2PA 4NWKA 4NFFA 2C3SA 4BAMB 1P9UA 2STAE 2VH0A 1P0SH 3S9CA 4Y11E 3NWUA 1EUFA 1OYTH 2ZKSA 2SGAA 1T8MA 3KEEA 1H8DH 4JCNA 1ESAA 1TA2A 2GV6A 1CGIE 2XRCA 1DWDH 4MPUA 3K6YA 1UHBB 2QYIA 1O3BA 3T26A 1QY6A 3M7UA 1G9IE 1F92A 2FXRA 1XUIA 4MTBA 5FCRA 2GT7A 4KTSA 1IAUA 3A8BA 1O5CB 4Q7ZA 2JKHA 1DOJA 2Y5FA 1T8NA 8GCHF 3CENA 5FBIA 3LKWA 4A1VA 1NTPA 4Y0ZE 1S81A 4AFSA 1MCVA 5T6FA 1DXPA 1BRCE 3JZ1B 1P57B 3ZV8A 2A7HA 1XVMA 1XUHA 2FI4E 4I8KA 1KSNA 1S83A 1T4VH 1TMUH 8KME2 1A3BH 3B8JA 1ACBE 1AWFH 6CHAC 2GZ7A 1DY8A 2HNTE 1F5KU 2FDAA 1O3HA 4YT7H 4WH6A 2EI6A 4NSYA 2FS9A 2M5TA 1VJAU 3C1KA 1KLJH 3SUEA 1EOJA 1UVOA 1WAYB 4FUDA 1BMLA 1C5WB 3AVZA 2GZ9A 2BDIA 3F9EA 4JK5A 1MTNC 2ZQ2A 4I7YH 2UWOA 3MH7A 1SR5C 2BD8A 5HM2A 3TIUA 4I32A 1BTWA 2A1DB 1C2DA 1A0JA 2CJIA 4U32A 3VGCC 5AVDA 3EA9A 3P70B 1TLDA 1J15A 4XOJA 3A7VA 5H4IB 2BDAA 1Z7KA 3RLWH 1C2FA 2AGGX 3HPTB 1BRBE 3NKKA 2BQ7B 4ZAEA 1ZMNA 3RU4E 3IITA 2FEQH 1EPTC 3MU8A 4NGAH 3NCLA 1PPGE 5LPEA 1AUJA 1GBDA 3PYHA 1LCYA 2A5KA 3NXPA 1NZQH 4DW2U 1XMNB 3A82A 4X8SH 3VEQB 1K1MA 1P01A 3PMBB 5SGAE 4B76A 2Z7FE 3S7HB 3RXUA 4GCHG 1VCQA 1SSXA 3MMGA 1B0EA 2XWAA 3FZZA 3MH6A 4BAOB 1LHFH 3TH3H 3RXKA 1EZSC 5EPNA 1TX8A 4ZXXH 1XUFA 4WVPE 1ZLRA 1PQ7A 2IPHA 1ARCA 8ESTE 1KDQB 2QF0A 4X8TH 3OX7U 5AFZH 1LKAA 3KL6A 1TNGA 4HGCA 4B2CA 3SU5A 4B75A 5GIBA 4RSPA 2AMQA 4X0WU 1SGIB 1EOLA 1N1LA 3A85A 2HPPH 3SQHE 1UCYK 1F5RA 1A1RA 4ABHA 4NCYA 2VH6A 3PLKA 5EXLA 3G01A 1T32A 2FYRA 1C1PA 1C1VH 1QL8A 1C5ZB 1BDAA 2AGEX 4B2AA 1C9TA 5IYTA 2BY5X 4CRGA 1EQ9A 2G4TA 2KAIB 4D7FA 2G4UA 2J34A 3I78A 3UQOA 5A0CA 3M37A 2H5CA 1K2I1 2F9UA 1AB9B 1GI7B 5F8ZA 1GGDB 3RMLH 5LGOA 1P3EA 3RMMH 1LVOA 1H4WA 1E35B 1C1RA 3BSQA 1GG6B 1QA7A 4GAWA 2A2QH 4NFEA 2LNCA 2AFQB 2F91A 4ZXYH 1NFYA 5ESTE 4Y71A 4NZQA 1AFEH 2ZO3H 1A4WH 1C5VA 1AD8H 2D26C 1OYQA 1YPKH 1VITG 4O97A 3T62A 1RIWB 1FONA 4YOIA 3JZ2B 2FOGA 2GT8A 1OWKA 1OSSA 1TNHA 1CSOE 1HXFH 5E0JA 2OBQA 1QBNA 3M61U 2PGBB 4X1SU 2G55A 4E06H 2QF3A 3QTOH 2Z94A 1Z8GA 4A92A 3MU0A 3H5CB 3Q3YA 5FXLA 4FUHA 4X8UH 5DP8A 3LDXH 2R0LA 1V2OT 3RC4A 1J16A 1THSH 2WPJS 1ZHMA 1PPCE 4ABJA 3RU4T 1O2OA 3SU2A 1MD7A 1BBRK 1RJXB 1AFQC 2Q1JA 4JYTA 1CE5A 1YC0A 2STBE 1Z1JA 1NFXA 1ELGA 1V2ST 1P8VC 3AAVA 1G3BA 4BAKB 3EQ0H 5FPSA 2HRVA 1L4ZA 1OP0A 3ZZ5A 3TGKE 4UFGH 3GY7A 3ZZ3A 3Q3XA 4E05H 3S0NA 2ZFPH 2A4GA 1MUEB 1O2RA 3U8RH 2C93B 3TNTA 3SV6A 1HPGA 3F6UH 2O8UA 2OC1A 2OLGA 4X6MA 4FUJA 3EGKH 1UO6A 3MU4A 1MTSA 1E34B 2WYGA 2V3HH 1MBQA 2O8TA 4AX9H 3P8NA 3M5OA 4YTAA 2YNBA 1ELVA 3H7TA 3V3MA 4Y8XA 2FOMB 5AF9H 1AKSB 1CA0B 4D8NA 4R0IA 3RXFA 1SFIA 1D6WA 1SVPA 1AKSA 1CQQA 2ODYB 1HAXB 1SB1H 4OGXA 1Y59T 4AN7A 2V35A 3SJ9A 4AG2A 1D4PB 1C5QA 3MWIU 2BXUH 1FN8A 5FX5A 3LC5A 3MHWU 4ISNA 4FUFA 1AE8H 2A0QB 3SU1A 3SV7A 4ZUHA 2BXTH 2QIQA 4INHA 1C5UA 1O2SA 1C4Y2 1GJDB 1VCWA 3SNEA 4O03A 1QR3E 1LVBA 1YCPM 1GMCF 3PTBA 5EG4A 3T25A 3ZZAA 3ZZ6A 3M7TA 3K65B 3MO3A 1MKWH 4LZ4B 2BZ6H 1HAPH 1JRTA 2ZU3A 3TJOA 4NIXA 4Z6AH 3BEUA 4K2YA 4BXSA 3EYDA 1EPTA 2BY6X 1TAWA 4B73A 1MAXA 4AYVB 1FDPA 1W14U 2WV4A 3ATIA 3U98H 1P2NA 3FZDA 1BBRH 3FFGA 1ANCA 1KXDA 3GDVA 1SGTA 1OPHB 1GI3A 2AERH 1J8AA 2SFAA 2ZGCA 4IGDA 1GGDC 2BX3A 1P2KA 4MNYA 1EATA 2A4RA 3SUDA 2PUQH 4YT6H 3R0FA 2ZIQH 2FOFA 1QFKH 5A8YA 2ZWLH 2ZHWH 2ZFFH 2JETB 2Y7ZA 3SOSA 9ESTA 1KYNA 1W8BH 1ZTLA 1GJAB 1UCYE 1AGJA 3LGWA 2PSYA 1C2JA 1E38B 1ID5H 2SGFE 3TGIE 3V7TA 2GV7A 1AIXH 2XC4A 4AG1A 2BY9X 1GBIA 4U30A 1C1QA 4K8YA 4BNRA 3AW1A 3MH4A 3A80A 3QGJA 4JZIA 2ZFSA 1NROH 2VWLA 3CP7A 2QA9E 1K1IA 5J4SA 1PPBH 4TPIZ 1QIXB 2Y5GA 4MQAA 3ODDA 4I8GA 1JRSA 4ZHAA 5ABWA 1JBUH 2VGCB 3OSYA 3A7WA 3OTJE 1GDQA 2ZU2A 5ESBA 1BQYA 3MOCA 1AVGH 1DLKB 1H9HE 2FTLE 4ISLA 2A45B 1O2QA 5F8XA 1ZRKA 1EPTB 1ZRBA 4I8LA 3HGPA 1V3XA 2BY8X 5BPEA 3SQEE 1WTGH 5FX6A 4B71A 3A81A 2NU4E 3RMNH 1C4V2 1ZSKA 1GHAG 3BTHE 1TABE 3BTDE 1Q31A 3TLOA 1DUAA 1ZYOA 4ZKRU 1FNIA 2FIRH 1TWXB 1W7XH 4WXIA 2G00A 1FZZA 3K2UA 4GCHF 3B23B 2C8ZB 4FUGA 3UWIA 3VB4A 2FWWA 2ZU4A 4I33A 3S9BA 3SHCH 1QQ4A 1KXEA 3ENSB 4KGAA 1L2EA 4Y8YA 3ZVGA 3F9FA 5HXFA 3DUXH 4HFPB 1BMNH 1GPZA 1SMFE 1UTJA 4X1QU 1KXFA 2ANWA 3ZVDA 1DS2E 1C1MA 1UK2A 1HAYB 4GVUA 5L6NH 2VVCA 2PFEA 1NFUA 4KKDA 5A09A 2OC7A 4CR9A 1CHOG 1GJ7B 1V2NT 2BD4A 3RM0H 5FAHA 4ABBA 5EXMA 2PKSC 1C5XB 2F9VA 1N8OC 1G3CA 1RRKA 3SV8A 3UNRA 2GZ8A 1S0QA 1P02A 1NU9A 3AAUA 1GMHG 2ZHQH 1WBGB 1O2WA 4K1TA 2BQWB 5F8TA 2UUFB 1O3AA 4D9RA 2J94A 4ISHH 4ESTE 1TB6H 3TK9A 1KTTB 2ZTZA 3SNAA 1OXGA 1GHBF 1KXCA 3MTYA 1QL9A 1TE0A 1VGCB 1ZHRA 2XXLA 4OS6A 1GBJA 2EEKA 4AFZA 1Y5AT 2HNTC 1HAGE 3N7OA 3BG8A 4K3JA 3ZZDA 2NU0E 1E37B 1FIWA 1ANBA 4DT7B 2ZHDA 2J38A 1ELEE 1DT2A 1PYTC 1UMAH 1YGCH 2BYAX 3VB3A 2P94A 2BVXH 1N6YA 3ZV9A 3P95A 1IQHA 3SI3H 2Z9LA 3VGCB 1IQMA 1QRZA 1VJ9U 1SOTA 4TWYA 4CHAC 1YP9A 4WMDA 2VJ1A 2ZCKP 2FTMA 3GY8A 3A8DA 4UONA 1LHGH 4CBOA 1HAHH 1YCPH 1HLTH 1IHSH 1LPKB 3S69A 1BT7A 4K1EA 1ELBA 1DVAH 3BF6H 4BTTB 5B6OA 1T4UH 1ZPBA 1CGHA 5CHAB 2BHGA 4NSVA 2QCYA 2R2MB 5CMXH 1DX5M 1O5GH 2H5DA 3D62A 1GJBB 4A7IB 5C3NA 1C2MA 1TA6A 5JDUB 1MQ6A 3ITIA 1FV9A 1QJ1B 1AU8A 1NESE 3TNSA 2ZPRA 4D76A 3GOVB 1NC6A 2J92A 3SJOA 1TRYA 1NY22 1NPMA 2H9TH 1W0YH 1HJ8A 2Y5HA 3QZQA 4GUXA 4X2VA 3K6ZA 3ZVAA 2ZHEH 1GBTA 1O33A 3QX5H 1Y5BT 1Z8JB 1NFWA 4AFQA 3U1JB 3ZVCA 1TOCB 3SW2B 1ELCA 2BDBA 1FAKH 4JYUH 1BOQA 1WCZA 1J17T 1WQSA 2A4OA 5JBAS 1PQ5A 4BAHB 2F9OA 4F49A 1QA0A 3ZYEA 1GVLA 2C8XB 2XC0A 1NRPH 4O3UA 1D6RA 2A32A 3QZRA 2Z3EA 1YCPK 2PWXA 1AFQB 3V12A 2HALA 1O2TA 3RXEA 1T8OA 1MTWA 1LDTT 2ZGXH 3RDZA 3BTWE 3SV9A 4OS5A 2F9NA 3ATLA 4A1XA 4WWYA 2C8YB 3O8CA 4WF8A 1G3EA 1G32B 1B7XB 2P3UB 3SO3A 3SGAE 4IN2A 1P11E 2HWLB 2RG3A 1P2OA 1UVTH 2O8MA 2W26A 1TYNA 1FY5A 2PSXA 1XVOA 5E2OA 1EZUC 6CHAB 1C5MD 2ZCHP 4YOGA 5A0BA 5EGMA 3SU3A 5T6DA 1EASA 1FY4A 3LU9B 5JBBS 3KF2A 1V2QT 5TCCA 2O8LA 1RIWC 1WQVH 1HB0B 5I25A 1TMBH 1DXWA 3BG4B 1JXPA 2PGQB 1WU1A 3P8GA 3ZYDA 3MNXA 4Y6DA 3QK1A 2CF8H 2LPRA 2OQUA 1RFNA 1A5IA 3SGQE 4CRAA 1RTLA 2CHAB 1ETRH 1C2EA 2CN0H 1BBRE 1ZMJA 1H1BA 3L33A 3RXSA 4B1TA 1SFQB 1Z8IB 1D3QB 3VB5A 3TK6A 1EP6A 2ZHFH 1W11U 3PMHB 3I77A 1BIOA 5HYOA 2ZI2H 4TYDA 2DE8A 1GBLA 2ZEBA 3P8FA 2GKVE 4FU8A 4AB9A 2ZDLA 1UTOA 1C5NH 1DSUA 1ZZZA 2THFB 4WMEA 1O2VA 3UNSA 4XFQA 1L1GA 5EQRA 2TGDA 4AZ2B 2GDDA 1THPB 4CH8B 1GBHA 4MVNA 2ZQ1A 4WXVA 3LT3A 1MU8B 3D23A 2B8OH 1NS3A 4OGYA 4FVDA 1HNEE 3UOUA 1GMHF 4X2XA 1INCA 1T31A 2BD2A 2ZP0H 4HZHA 2HGTH 2PUXB 3GCHB 1HDTH 3HK6B 4BAQB 3TPIZ 1ABIH 1WYKA 4CREA 4KP0A 1TALA 1BMAA 1HJAC 2FX6A 3SORA 1FY1A 1XUKA 1S85A 1Z71A 5TCAA 8GCHG 1TX7A 1BJVA 4IN1A 2FOAA 1NRRH 2WPIS 5A2MH 3ZZ8A 2ILNA 2FP7B 2FODA 5DG6A 1YPHE 5DJ7A 1GCDA 1GI2A 1AN1E 2SNVA 3RXQA 1HUTH 1FJSA 3KNXA 1C5TA 4XBCA 3VB7A 3KIDU 2W3KA 2Y7XA 1GJ5H 3A83A 5GDSH 1OS8A 3TK5A 1P2IA 5K0HA 1O2IA 1C5LH 1V2WT 2R9PA 3M35A 1PFXC 5GCHG 2BLWA 4LZ1H 4Y7AA 3IG6B 1PJPA 3DFLA 6LPRA 4IMZA 3RXLA 4FUBA 3HKIB 3E90B 3RXHA 5DP5A 4MLFB 1N6XA 1O2ZA 1GI8B 1ZMLA 4U01A 5J4QA 5A8ZA 1D3DB 1GHWH 1EJNA 4RKOB 1GI4A 1ZGIA 2VWNA 2H1UA 1SI5H 3RXOA 1K9OE 1MZDA 5F6MA 5HMAA 3EAJA 5DO4H 2VIQA 3UOPA 3E0PB 2OTVA 4ZHLU 3LOXA 4X1NU 2VINA 4ZKOU 2CF9H 1GJ9B 1GI0A 4IBLH 2WPLS 1P9SA 1FI8A 2ANMH 5G4BA 4CRDA 2ZF0H 2ODPA 1G37A 3GY2A 1P09A 3TGJE 3TJUA 2ZGBH 1AHTH 4ISIH 4JMYA 1O3IA 1SGPE 5K7RA 4VGCB 1Z1IA 2SGQE 1SLUB 1MAYA 2ZG0H 1O5EH 3P17H 2P8OC 2QXHA 1G2LA 2IN2A 5DPAA 3VXEH 2H2ZA 5EODA 1DICA 1SGYE 1P2QA 1TNIA 2XBVA 4GSOA 1Y3YA 1PPZA 5C1XA 1UTQA 3EA8A 1GJ8B 4FUIA 3U9AH 2F83A 4IS5A 2QXJA 1BHXF 1AI8H 1F0SA 1UHBA 1Z6JH 2WUBA 1FPHH 5EQQA 2SGEE 4JZEH 4K60A 4WMFA 4LOYH 4ABFA 1T8LA 4UEHH 2VVVA 3U8OH 1MTNB 2QXIA 4VGCC 5CE1A 1QRXA 2P3TB 2GCTC 4FXGH 3T2NA 1BJUA 2OXSA 2KAIA 4JZDH 4TWWA 3GDUA 4BTIB 2ZFQH 3PWBA 3RXDA 3EE0B 2P95A 1YPEH 7GCHF 1VR1H 1A61H 1CA0C 1F7ZA 1XUJA 2QC2A 1K22H 1UTNA 1QB9A 4IMQA 2AH4X 4X8VH 1TBQH 7ESTE 3EA7A 2FESH 3SI4H 5GXPA 1D3TB 2Z9JA 4DCDA 4YOJA 2I6QA 2W7SA 3W94A 1O30A 4DIIH 2EI8A 1ANEA 1GBEA 1H9LB 1W3CA 4QT8C 1YYY1 1O5FH 1F2SE 1HBTH 1AB9C 2BLOA 2D2DA 3MNBA 2VNTA 2ZCLP 4A6LA 1C2KA 2BMGB 2HLCA 4Y7BA 2VVUA 1DDJA 1CA8B 4X2WA 2TRMA 3M5MA 3A87A 3GCTF 1UVSH 3A8CA 1EP5A 2BTCE 3T5FH 1XXFA 4A5TS 3DT0H 2UUKB 1W10U 2GTBA 1O3FA 1BA8B 1C5OH 1AY6H 1HIAA 3TJVA 1C4U2 2BVRH 4GPGA 1GL0E 1F0UA 1X7AC 3SUFA 1GVZA 4Q7YA 3LGTA 1S0RA 2BD7A 2ZU1A 1GHVH 2P16A 4LXBH 3KCGH 1LVMA 4Y76A 3GICB 3FAOA 1O5DH 1HAVB 1LKBA 1V2MT 1GBBA 1ZTJA 3M3VA 1BB0B 4UD9H 1GVKB 2UWPA 2GVFA 1LQEA 1KDQA 3QO6A 5FHTA 4DURA 2H9EH 5DP6A 1NRQH 2QAAA 3C27B 4ISOA 2Z3DA 1LTOA 4JZFH 4FVBA 1BZXE 3LGIA 1FIZA 4AORA 1MQ5A 5EQSA 3GCTG 1KLTA 2JH6D 1DWBH 1WOFA 1O3OA 3W95A 1WTHD 1BTXA 2ZNKH 2NWNA 1O2GH 2B9LA 3A7TA 1Y3WA 1HAZB 1O2XA 2SGPE 2P59A 1K1LA 4IC5A 1C5RA 4BXWA 1DM4B 1TQ0B 4CRFA 1PQ8A 3LGUA 3UPEA 4Y0YE 4ZMAH 2V3OH 1RXPA 1TNLA 3BTKE 4U2WA 3ATMA 4LK4A 1GJ6A 1O2KA 3OYPA 2PHBA 4MPXA 4ZH8A 4CHAB 3GY3A 1KXAA 4F4OC 4KTCA 4ABGA 1IOEA 2VIWA 4ABDA 3ZZCA 2EI7A 1UK3A 2FOCA 1QQUA 2G5VA 3MU5A 2BLQA 5TJXA 1TIOA 5L2ZH 5EW2H 2UUJB 2FOBA 7GCHG 2O8WA 2ZDKA 1QTFA 2ZDAH 2ALPA 3ESTA 2D8WA 1GI1A 4X6PA 2GP9B 2BDCA 1BTUA 4HTCH 2R0KA 5E2PA 4AB8A 3Q77A 1VGCC 2AMDA 1C1WH 2QY0B 1PQAA 2A5AA 2TBSA 1TQ7B 1A3EH 2RA0A 4XBBA 1BTYA 1O2YA 1G36A 4AGJA 4THNH 1GI9B 5ETXA 1FY3A 2BB4A 2W7UA 3L3TA 1P12E 3DHKH 2W3IA 5IDKA 1FPCH 1F5LA 1V2LT 1A46H 1IQNA 1O3CA 4AOQA 1JOUB 5HM9A 1CO7E 2C8WB 2DE9A 3RXRA 9LPRA 3O8DA 1TGTA 4YLUA 1UVPA 3PLBA 3T29A 2NU1E 4FU7A 4INKA 2C4FH 2ZDMA 3RXPA 3T27A 3SZNA 2BX4A 3RP2A 3PLPA 7KMEH 5EW1H 5EU8A 4IC6A 4TY7A 4K1SA 4K8BA 3OY5U 1F0TA 2VWOA 2PTCE 3VFEA 1ETTH 1ZOMA 1MH0A 1YLDA 3WY8A 2XBXA 1O34A 2AS9A 2Q6FA 2WYJA 3KQCA 2QXGA 1O3KA 3LJJA 1C1SA 2QV1A 4B74A 1SGFA 2GCTB 1BUIA 1AZ8A 1AVXA 4ZKSU 5DK1A 1CT4E 1LO6A 1CBWB 1Q2WA 1GI6A 1ZPCA 1E0FD 4OS7A 1A2CH 1Q3XA 1O31A 1W7GH 1Y5UT 1YM0A 4H4FA 3PWCA 1AWHB 1ZJKA 2GMTC 2PW8H 1SPJA 2D1JA 2TGAA 1G30B 3E91A 3LONA 3A86A 1HIAB 4GHTA 5FBEA 2ESTE 1K1NA 1MTUA 1UVUH 5C5NA 3MYWA 3PO1B 1G3DA 1C1TA 3TJNA 2BLVA 1QJ7B 1GBFA 1V2TT 4KELA 5FPYA 4ZKNU 3ZZ9A 1LPZB 1GBKA 1O3LA 2Y6TA 1O39A 3E1XB 3VXFH 1WV7H 1QBVH 1QURH 2AGIX 2A4QA 3UTUH 3UY9A 5JPMH 1A7SA 2C90B 1SGEE 4MNXA 4CRCA 3PROA 1C1NA 3UREA 1DPOA 2FI3E 2GMTB 1P03A 1TPSA 2WINI 3RXBA 3LGVA 3AASA 2OINA 2PV9B 5CHAC 2J4IA 1O5BB 1NRSH 3S7KB 4MDSA 5F03A 3BTGE 1K28D 3T28A 1BTPA 1MU6B 4H42U 2ZECA 3PV4A 4E7RG 2FS8A 2VIOA 1SQTA 3U8TH 3ZVEA 1PPHE 2FYQA 1OOKB 3RC5A 1YF4A 4UE7H 1P2JA 1JIRA 5BRRE 1IQGA 1OP2A 3RXAA 1GJCB 1GG6C 3BEFB 4DY7B 1UTLM 4I8HA 4UFEH 4YESB 1KTSB 3A89A 3GYMA 4AYYB 2J2UA 1QL7A 1VZQH 1Z6EA 2G8TA 1C5SA 1OWIA 2Q6DA 3SUGA 3MU1A 2ZPQA 1RTFB 4JYVH 3V0XA 2A7CA 3QUMP 1G2MA 1GWAA 4NIWA 1S6HA 1S84A 2G51A 4ZHMU 1W12U 5L2YH 1L1JA 4KTUA 1EAWA 3SNCA 2Z3CA 1O0DH 1CHGA 2FM2A 1P2MA 1SGCA 1T7CA 1J14A 2PKAB 2WPHS 3FP6E 3V13A 3ZVFA 2OP9A 1MKWK 3KHVA 3QDZB 2BOHB 1QJ6B 1TGNA 1MMJN 2Z9KA 3A8AA 1TOMH 3SJKA 2TPIZ 4FUEA 1HAOH 5PTPA 4Q2KA 3RMOH 1SQAA 4AFUA 2ZA5A 1IQLA 2GX4A 1XX9A 1LHDH 1JIMA 1XM1A 1ARBA 2GDEH 3RLYH 4ABIA 3MO6A 2BY7X 1QB1A 2FOHA 1DY9A 2F9PA 4I8JA 3RXTA 1GL1A 1K21H 4DOQA 2IOTA 1FN6A 4ABEA 4J2YB 1EAXA 1D9IA 5DGJA 1RS0A 1V2VT 2XTTB 1OWJA 2YNAA 2ZGHA 1O2NA 4X6NA 5E8EH 1YPJH 3A7XA 3B9FH 1HCGA 2PTNA 5DP4A 2R3YA 4X6OA 5GJ4B 2ASUB 1BRAA 5A0AE 1O3JA 3K9XB 4D7GA 1BMMH 2PKSB 3URCA 1HAIH 2FZZA 3NUMA 4GLYA 1WUNH 4E7NA 1LMWB 3LJOA 3F68H 4Y79A 3SBKA 2VGCC 4DG4A 1P04A 4HI3A 3O8RA 1FY8E 1GCTC 2WV5A 1MKXK 3NPSA 2SGDE 1KXBA 2P8OB 3H7OA 4O3TA 4CH2B 3ATWA 2BZAA 4Q80A 2RCEA 1Y3UA 8LPRA 1IQEA 1SHHB 4IW4E 1CT2E 1GHBG 1GI5A 1GHYH 2Y82A 1ELTA 5DP7A 1EAIA 3BTEE 4UFFH 2GGVB 2HPQH 2Z9IA 1C1OA 3SNDA 1L1NA 1C9PA 4MNWA 1ZSLA 3DA9B 1TPAE 1MBMA 1QNJA 3SHAH 4UFDH 2CMYA 4FUCA 2WPKS 2ZU5A 3GY6A 2UUYA 2ZGJA 1NT1A 3SN8A 1ZJDA 1NN6A 1TMTH 1YKTA 2AEIH 3RM2H 1GMDG 1S6FA 2FI5E 1P10A 3KGPA 4OS1A 4XDEA 1GMDF 2HOBA 2OCVB 2ZDNA 1VITF 3QN7A 3DD2H 1AZZA 1CBWC 2ZC9H 3NK8A 3UFAA 1EXFA 3EDXB 2UWLA 1SL3A 2A2XH 3SV2H 1L4DA 4MPVA 3KQBA 1C1UH 7LPRA 1TONA 2Y80A 3CS0A 1UTKA 1SC8U 4XE4A 1THRH 3E3TA 2NU2E 1ORFA 2J9NA 1SBWA 1KY9A 1IQFA 4NG9H 1OP8A 1W2KH 4MNVA 4BANB 3DFJA 1SGRE 2G5NA 1W0ZU 1YBWA 3TH4H 3TH2H 4J1YA 1QCPA 4H6TA 1ANDA 1J9CH 3QGNB 3TITA 1SGQE 1MD8A 1ZGVA 2ANKH 5JBTA 3MI4A 1P3CA 4WY3A 1O3NA 3ZZBA 3MO9A 5C2ZA 1Z8RA 1FQ3A 3TU7H 2RA3A 3UIRA 2G81E 3FVFB 3PMJA 1ELAA 3PB1E 1S5SA 2AIQA 1A0HB 1TFXA 3TVJB 1SOZA 1BTZA 3Q3KA 1O2HA 2FX4A 2FLBH 2RDLA 1PYTD 4XSKU 1HYLA 3LC3A 2R2WU 2ZTXA 2A5IA 2BQ6B 1V2KT 3GCOA 1V6DA 1O3GA 5C67A 3QLPH 5DP3A 1OKXA 2BM2A 6ESTA 3LIWA 4WJG2 1UJ1A 3BTTE 5C1YA 4TY6A 4DGJA 1C2LA 1S82A 1OX1A 1GJ4H 1C5PA 1UTPA 1YPGH 4AGKA 5GPIB 1OWHA 5T3HA 2NU3E 2PKAA 1HAVA 1QGFA 1ETSH 3STJA 1ZPZA 3PMAB 2ZPSA 3E0NB 3M3TA 4H6SB 5GCHF 1D3PB 1YLCA 5C1UA 2JH5D 1BCUH 3FANA 5E0GA 5EPYA 1DSTA 4INLA 4BTUB 2BD5A 3ATKA 4NWLA 1O2JA 1HFDA 4X1RU 1F0RA 2DUCA 3R3GB 4OS4A 4MPWA 1O2UA 3RC6A 5AFYH 4SGBE 1EAUA 2VIDA 1CU1A 1IQIA 3BG4C 3BEIB 3BIVH 4FU9A 4K5ZA 3L6PA 1O2MA 1ZR0A 2VWMA 4MG3A 2ALVA 4TPYA 1HJAB 2ZFTA 3MFJA 2P3FH 1O3EA 3GDSA 3UNQA 1C2GA 1GBAA 3GCHC 1IQJA 3SU0A 1TRMA 3HKJB 1ZHPA 1O35A 4X2YA 4YO9A 2GD4B 1V2PT 1GDUA 4I31A 1O3DA 1DWCH 2K1QA 2XC5A 5JYIA 1CGJE 5JB9S 3SU6A 2XYAA 3RU4D 5EOKA 1FUJA 5I46H 3A84A 1WSSH 1SGFG 1TGBA 3RXMA 3GY5A 1O37A 1MZAA 1SLVB 2VB0A 2JH0D 2WPMS 3HATH 4NA8A 2XBWA 5DKMA 4DIHH 3A88A 1TBRH 3U1IB 1VITH 3AW0A 2OC0A 4NIVA 4X1PU 1HGTH 1ABJH 3HK3B 1O5AB 2AIPA 2Z9GA 1UTMA 1ELDE 2GCHF 5AHGH 5EXNA 3SGBE 2BD9A 1FXYA 1V2JT 3LPRA 5GWZA 1K1JA 3Q76A 4M7GA 1MCTA 2A31A 3M3SA 1MKXH 3PM3A 4CRBA 2OC8A 1UCYH 3UWJH 2H6MA 1AQ7A 2OD3B 3PTNA 1SQOA 1H9IE 3BIUH 2OQ5A 1OWDA 1GCTB 5FCKA 2CV3A 4RKJB 1HV7A 3F1SB 1QHRB 1Y3VA 2OBOA 2TIOA 3CS7A 2BDGA 4YLQH 2XBYA 5LH8A 2B5TB 1HXEH 2VIVA 1EJAA 2Y81A 3BN9A 5DP9A 1PPFE 4YZUA 6GCHG 4NA9H 2H9HA 1YPMH 2EC9H 3Q00A 1XXDA 3RUOA 3BTQE 3U69H 1BTHH 3MNSA 1N8OB 1SGNE 3VPKA 2OUAA 3MNCA 1K1PA 3ZZ4A 3RXVA 3UQVA 2ODQA 1H8IH 3IWMA 3ELAH 1DWEH 1XKAC 1Y8TA 3VB6A 1O3MA 1RD3B 3SJ8A 1QRWA 2XCFA 3M36A 3LH3A 1K1OA 3A7ZA 1B5GH 3PO1C 5JBCS 1RGQA 4O9VA 1A0LA 3M7QA 1GHXH 1TRNA 4DJZB 3M5NA 5LPRA 1NRNH 1TPOA 3D49H 2BDHA 3STIA 1C5YB 1TPPA 1FLEE 1A5HA 1OWEA 2TGTA 4ASHA 2XWBI 5C20A 1DFPA 4JK6A 5T6GA 3GYLB 2QGRA 3RXJA 3KN2A 5E0HA 2ZDVH 3FP8E
chains in the Genus database with same CATH superfamily
1SLXB 1BHXB 4XBDA 3RXCA 2O9QA 1ZTKA 2BOKA 1FMGA 3ZZ7A 1HJ9A 2XNIA 1DANH 1LPGB 1C2HA 1AMHA 3BTFE 2PLXA 1Y3XA 2L74A 3P92A 4Y8ZA 4JZ1A 1NO9H 1ZSJA 1VCPA 2XCNA 1YPHC 5FPTA 3AK5A 1AUTC 1AO5A 4Q7XA 2R3UA 4B2BA 3F9HA 2IJOB 1XKBC 3M5LA 3I29A 1FAXA 3KQEA 2F9BH 2Q6GA 2VIPA 1V2UT 2FLRH 1ELFA 1TBZH 2I6SA 4D9QA 1O36A 2ANYA 1P05A 1DE7H 5JB8S 4GHQA 3E8LA 1DLEA 2V3MA 2ZTYA 1GMCG 1EB2A 1W0KD 1XUGA 1UK4A 1SGDE 4Y10E 1O2LA 3KQDA 1LHEH 2JETC 1EZQA 2BDYA 3D65E 3FP7E 1B0FA 1GHZA 1GBMA 3ODFA 3UAIC 2SNWA 2EA3A 2HVXA 3BTME 1SHYA 1AVWA 1A5GH 1TNJA 4K69A 1QB6A 1V2RT 2AMPA 4R8TB 2BVSH 4NA7A 4A1TA 3QTVH 1M9UA 2VU8E 3RXGA 2CHAC 3SNBA 4YM9A 2FO9A 5L30H 3OY6U 3ZVBA 2XW9A 2TGPZ 4RN6A 1LVYA 1RTKA 1ESBA 2FMJA 3E16B 4WH8A 3E6PH 3GY4A 1TX6A 3F9GA 4UDWH 3RXIA 1JWTA 2BD3A 5LPFA 3S9AA 1GBCA 3O8BA 3LH1A 2V0BA 5HGGA 2IPQX 2ULLA 3UR9A 2FPZA 1SG8B 1P06A 2P93A 3SU4A 3P8OA 1BITA 3SJIA 1CT0E 1KIGH 1C2IA 1GDNA 1MTVA 4NZLA 2G52A 3UUZA 2B0FA 3BV9B 4NIYA 4OS2A 1CHOF 1DITH 2YOLA 1TGCA 4SGAE 1EKBB 3MH5A 5A8XA 1E36B 1O32A 1TNKA 1HRTH 5C5OA 2ZZUH 2IJD1 1L0ZA 2AYWA 1EB1H 1O3PB 2GCHG 2CGAA 3P6ZB 1IHTH 1QBOA 4DVAU 1LHCH 1SLWB 2PR3A 2A7JA 3GISB 4CBNA 2J95A 4ABAA 1YPLH 2HNTF 4ZROA 2VBCA 1PPEE 1IQKA 1AE5A 1DUEA 2F3CE 1JMOH 2B7DH 1W13U 3LGYA 3QWCH 3UR6A 1GHAF 2W5EA 2FOEA 4Z0KA 3A7YA 1CVWH 1NM6A 3OU0A 2ZFRH 2CXVA 3NZIA 2WUCA 1BRUP 1EZXC 2V6NA 2Z6BD 1EJMA 1LQDB 3N7DA 2QN5T 4BOHA 3GCNA 1U6QA 4PROA 3URDA 6GCHF 1ESTA 3HGNA 1TGSZ 1KLIH 1NU7B 4CR5A 3W1EA 1EX3A 1O38A 1O2PA 4NWKA 1BMFD 3DSOA 4NFFA 2C3SA 4BAMB 1P9UA 2STAE 2VH0A 1P0SH 5EJZA 3S9CA 4Y11E 3NWUA 1EUFA 1OYTH 2ZKSA 2SGAA 1T8MA 3PRBA 3KEEA 1H8DH 1K0HA 4JCNA 1ESAA 1TA2A 2GV6A 1CGIE 2XRCA 1DWDH 4MPUA 3K6YA 1UHBB 2QYIA 1O3BA 3T26A 1QY6A 3M7UA 1G9IE 1F92A 2FXRA 1XUIA 4MTBA 5FCRA 2GT7A 4KTSA 1IAUA 3A8BA 1O5CB 4Q7ZA 2V7QD 4ACAA 2JKHA 1DOJA 2Y5FA 1T8NA 8GCHF 3CENA 5FBIA 3LKWA 4A1VA 1NTPA 4Y0ZE 1S81A 4AFSA 1MCVA 5T6FA 1DXPA 1BRCE 3JZ1B 1P57B 3ZV8A 2A7HA 1XVMA 1XUHA 2FI4E 4I8KA 1KSNA 1S83A 1T4VH 1TMUH 8KME2 1A3BH 3B8JA 1ACBE 1AWFH 6CHAC 2GZ7A 1DY8A 2HNTE 1F5KU 2FDAA 1O3HA 4YT7H 4WH6A 2EI6A 4NSYA 5HKKD 2FS9A 2M5TA 1VJAU 3C1KA 4F48B 1KLJH 3SUEA 1EOJA 1UVOA 1UW7A 1WAYB 4FUDA 1BMLA 1C5WB 3AVZA 2GZ9A 2BDIA 3F9EA 4JK5A 1MTNC 2ZQ2A 4I7YH 2UWOA 3MH7A 1SR5C 2BD8A 5HM2A 3TIUA 4I32A 1BTWA 2A1DB 1C2DA 1A0JA 2CJIA 4U32A 3VGCC 5AVDA 3EA9A 3P70B 1TLDA 1J15A 4XOJA 3A7VA 5H4IB 2BDAA 1Z7KA 3RLWH 1C2FA 2AGGX 3HPTB 1BRBE 3NKKA 2BQ7B 4ZAEA 1ZMNA 3RU4E 3IITA 2FEQH 1EPTC 3MU8A 4NGAH 3NCLA 4FOUC 1PPGE 5LPEA 1AUJA 1GBDA 3PYHA 1LCYA 2A5KA 3NXPA 1NZQH 4DW2U 5KECA 1XMNB 3A82A 4X8SH 3VEQB 1K1MA 1P01A 3PMBB 5SGAE 4B76A 2Z7FE 3S7HB 3RXUA 4GCHG 1VCQA 1SSXA 3MMGA 1B0EA 2XWAA 3FZZA 3MH6A 4BAOB 1LHFH 3TH3H 3RXKA 1EZSC 5EPNA 1TX8A 4ZXXH 2KCOA 1XUFA 4WVPE 1ZLRA 1PQ7A 2IPHA 1ARCA 8ESTE 1KDQB 1VKYA 2QF0A 4X8TH 3OX7U 5AFZH 1LKAA 3KL6A 1TNGA 4HGCA 4B2CA 3SU5A 4B75A 5GIBA 4RSPA 2AMQA 1YWUA 4X0WU 1SGIB 1EOLA 1N1LA 3A85A 2HPPH 3SQHE 1UCYK 1F5RA 1A1RA 4ABHA 4NCYA 2VH6A 3PLKA 5EXLA 3G01A 1T32A 2FYRA 1C1PA 1C1VH 1QL8A 1C5ZB 1BDAA 2W6JD 2AGEX 4B2AA 1C9TA 5IYTA 2BY5X 4CRGA 1EQ9A 2G4TA 2KAIB 4D7FA 2G4UA 2J34A 3I78A 3UQOA 5A0CA 3M37A 2LP6A 2H5CA 1K2I1 2F9UA 1AB9B 1GI7B 5F8ZA 1GGDB 3RMLH 5LGOA 1P3EA 3RMMH 3F0OA 1LVOA 1H4WA 1E35B 1C1RA 3BSQA 1GG6B 1QA7A 4GAWA 2A2QH 2QF5A 2LNCA 4NFEA 2AFQB 2F91A 4ZXYH 1NFYA 5ESTE 4Y71A 4NZQA 1AFEH 2ZO3H 1A4WH 1C5VA 1AD8H 2D26C 1OYQA 1YPKH 1VITG 4O97A 3T62A 1RIWB 1FONA 2WSSD 3JZ2B 4YOIA 2FOGA 2GT8A 1OWKA 1OSSA 1TNHA 1CSOE 1HXFH 5E0JA 2OBQA 2K0QA 1QBNA 3M61U 2PGBB 4X1SU 2G55A 4E06H 2QF3A 3QTOH 2Z94A 1Z8GA 4A92A 3MU0A 3H5CB 3Q3YA 5FXLA 3PV5A 4FUHA 4X8UH 5DP8A 3LDXH 2R0LA 1V2OT 4ZCNA 4RI0A 3RC4A 1J16A 1THSH 1YLNA 2WPJS 1ZHMA 5EIYA 1PPCE 4ABJA 1NBME 3RU4T 1O2OA 4M9FA 3SU2A 3EE7A 1MD7A 1BBRK 1RJXB 1AFQC 2Q1JA 4P02A 4JYTA 1CE5A 1NBMD 1YC0A 2STBE 1Z1JA 1NFXA 1ELGA 5EJ1A 1V2ST 1P8VC 3AAVA 2YMSB 1G3BA 4BAKB 3EQ0H 5FPSA 2HRVA 1L4ZA 1OP0A 3ZZ5A 3TGKE 4UFGH 3GY7A 3ZZ3A 3Q3XA 4E05H 3S0NA 2ZFPH 2A4GA 1MUEB 1O2RA 3U8RH 2C93B 3TNTA 3SV6A 1HPGA 3F6UH 2O8UA 2OC1A 2OLGA 4X6MA 4FUJA 3EGKH 1UO6A 3MU4A 1MTSA 1E34B 2WYGA 2V3HH 1MBQA 2O8TA 4AX9H 3P8NA 3M5OA 4YTAA 2YNBA 1ELVA 3H7TA 3V3MA 4Y8XA 2FOMB 5AF9H 1AKSB 1CA0B 4D8NA 4R0IA 3RXFA 1SFIA 1D6WA 1SVPA 1AKSA 1CQQA 2JDID 1HAXB 1SB1H 2ODYB 3DSGA 4OGXA 1Y59T 3F0PA 4AN7A 2V35A 3SJ9A 2JJ1D 4AG2A 1D4PB 1C5QA 3MWIU 2CK3D 2BXUH 1FN8A 5FX5A 3LC5A 3MHWU 4ISNA 4FUFA 1AE8H 2A0QB 3SU1A 3SV7A 2JIZD 4ZUHA 2BXTH 2QIQA 4INHA 1C5UA 1O2SA 2KCAA 2KR7A 1C4Y2 1GJDB 1VCWA 2OK5A 4ACBA 3SNEA 4O03A 1QR3E 1LVBA 1YCPM 1GMCF 3PTBA 5EG4A 3T25A 3ZZAA 3ZZ6A 3M7TA 3K65B 3MO3A 1MKWH 4LZ4B 2EQNA 2BZ6H 1HAPH 1JRTA 2ZU3A 3TJOA 4NIXA 4Z6AH 3BEUA 4K2YA 4BXSA 4RT1A 3EYDA 1EPTA 2BY6X 1TAWA 4B73A 1MAXA 4AYVB 1FDPA 1W14U 2WV4A 3ATIA 4DT4A 3U98H 1P2NA 3FZDA 2KCYA 1BBRH 3FFGA 1ANCA 1KXDA 3GDVA 1SGTA 1SKYE 1OPHB 1GI3A 2AERH 1J8AA 2SFAA 2ZGCA 4IGDA 2L6OA 1GGDC 2BX3A 1P2KA 4MNYA 1EATA 2A4RA 3F2HA 3SUDA 2PUQH 4YT6H 3R0FA 2ZIQH 2FOFA 1QFKH 5A8YA 2ZWLH 2ZHWH 3FO8D 2ZFFH 2JETB 2Y7ZA 3SOSA 9ESTA 3DCLA 1KYNA 1W8BH 1ZTLA 1GJAB 1UCYE 1AGJA 3LGWA 2PSYA 1C2JA 1E38B 1ID5H 2SGFE 3TGIE 2EY4C 3V7TA 2GV7A 1AIXH 2XC4A 4AG1A 2BY9X 1GBIA 4U30A 1C1QA 4K8YA 4BNRA 3AW1A 3MH4A 3A80A 3QGJA 4JZIA 2ZFSA 1NROH 2VWLA 3CP7A 2QA9E 1K1IA 5J4SA 5B6LA 1PPBH 4TPIZ 1QIXB 2Y5GA 4MQAA 3ODDA 4I8GA 1JRSA 4ZHAA 5ABWA 1JBUH 2VGCB 3OSYA 3A7WA 3OTJE 1GDQA 2ZU2A 5ESBA 1BQYA 2KX4A 3MOCA 1AVGH 1DLKB 1H9HE 2FTLE 4ISLA 2A45B 1O2QA 5F8XA 1ZRKA 1EPTB 1ZRBA 4I8LA 3HGPA 1V3XA 2BY8X 5BPEA 3SQEE 1WTGH 5FX6A 4B71A 3A81A 2NU4E 3RMNH 1C4V2 1ZSKA 1GHAG 3BTHE 1TABE 3BTDE 1Q31A 3TLOA 1DUAA 1ZYOA 4ZKRU 1FNIA 2FIRH 1TWXB 1W7XH 4WXIA 2G00A 1FZZA 3K2UA 4GCHF 3B23B 4TSFD 2C8ZB 4FUGA 3UWIA 3VB4A 2FWWA 2ZU4A 4I33A 3S9BA 3SHCH 1QQ4A 1KXEA 3ENSB 4KGAA 1L2EA 4Y8YA 3ZVGA 3F9FA 5HXFA 3DUXH 4HFPB 1BMNH 1GPZA 1SMFE 1UTJA 4X1QU 1KXFA 2ANWA 3ZVDA 1DS2E 1C1MA 1UK2A 1HAYB 4GVUA 5L6NH 2VVCA 2PFEA 1NFUA 4KKDA 5A09A 2OC7A 4CR9A 1CHOG 1GJ7B 1V2NT 2BD4A 3RM0H 1H8ED 5FAHA 4ABBA 5EXMA 2PKSC 1C5XB 2F9VA 1N8OC 1G3CA 1RRKA 3SV8A 3UNRA 2GZ8A 1S0QA 1P02A 1NU9A 3AAUA 1GMHG 2ZHQH 1WBGB 3FKSD 1O2WA 4K1TA 2BQWB 3N99A 4Q63A 5F8TA 2UUFB 1O3AA 4D9RA 2J94A 4ISHH 4ESTE 1TB6H 1OHHD 3TK9A 1KTTB 2ZTZA 3SNAA 1OXGA 1GHBF 1KXCA 3MTYA 1QL9A 1TE0A 1VGCB 1ZHRA 2XXLA 4OS6A 1GBJA 2EEKA 4AFZA 1Y5AT 2HNTC 1HAGE 1COWD 3N7OA 3BG8A 4K3JA 3ZZDA 2NU0E 1E37B 1FIWA 1ANBA 4DT7B 2ZHDA 2J38A 1ELEE 1DT2A 1PYTC 1UMAH 1YGCH 2BYAX 3VB3A 2P94A 2RDEA 2BVXH 1N6YA 2QE7D 3ZV9A 3P95A 1IQHA 3SI3H 2Z9LA 3VGCB 1IQMA 1QRZA 1VJ9U 1SOTA 4TWYA 4CHAC 1YP9A 5IK2D 4WMDA 2VJ1A 2ZCKP 2FTMA 3GY8A 3A8DA 4UONA 1LHGH 4CBOA 1HAHH 1YCPH 1HLTH 1IHSH 1LPKB 3S69A 4ASUD 1BT7A 4K1EA 1ELBA 1DVAH 3BF6H 4BTTB 5B6OA 1T4UH 1ZPBA 1CGHA 5KEDA 2QF4A 5CHAB 2BHGA 4NSVA 2QCYA 2R2MB 5CMXH 1DX5M 1O5GH 2H5DA 3D62A 1GJBB 4A7IB 5C3NA 1C2MA 1TA6A 5JDUB 1MQ6A 3ITIA 1FV9A 1QJ1B 1AU8A 1NESE 3TNSA 2ZPRA 4D76A 3GOVB 1NC6A 2J92A 3SJOA 1TRYA 1NY22 1NPMA 2H9TH 1W0YH 1HJ8A 2Y5HA 3QZQA 4GUXA 4X2VA 3F2FA 3K6ZA 3ZVAA 2ZHEH 1GBTA 1O33A 3QX5H 1Y5BT 1Z8JB 1NFWA 5FL7D 4AFQA 3U1JB 3ZVCA 2XNDD 3MQKC 1TOCB 1MABB 3SW2B 1ELCA 2BDBA 1FAKH 4JYUH 1BOQA 1WCZA 1J17T 1WQSA 2A4OA 5JBAS 1PQ5A 4BAHB 2F9OA 4F49A 1QA0A 3ZYEA 1GVLA 2C8XB 2XC0A 3OAAD 1NRPH 4O3UA 1D6RA 2A32A 3QZRA 2Z3EA 1YCPK 2PWXA 1AFQB 3V12A 2HALA 1O2TA 3RXEA 1T8OA 1MTWA 1LDTT 2ZGXH 3RDZA 3BTWE 3SV9A 4OS5A 2F9NA 3ATLA 4A1XA 4WWYA 2C8YB 3O8CA 4WF8A 1G3EA 1G32B 1B7XB 5CHBA 2P3UB 3SO3A 3SGAE 4IN2A 1P11E 2HWLB 2RG3A 1P2OA 1UVTH 2O8MA 2W26A 5KGOA 1TYNA 1FY5A 2PSXA 1XVOA 5E2OA 1EZUC 6CHAB 1C5MD 2ZCHP 4YOGA 5A0BA 5EGMA 3SU3A 5T6DA 1EASA 1FY4A 3LU9B 5JBBS 3KF2A 3FOAA 1V2QT 5TCCA 2O8LA 1RIWC 1WQVH 1HB0B 5I25A 1TMBH 1DXWA 3BG4B 1JXPA 2PGQB 1WU1A 3P8GA 3ZYDA 3MNXA 4Y6DA 3QK1A 2CF8H 2LPRA 2OQUA 1RFNA 1A5IA 3SGQE 4CRAA 1RTLA 2CHAB 1ETRH 1C2EA 2CN0H 2K8IA 1BBRE 1ZMJA 2J98A 1H1BA 3L33A 3RXSA 4B1TA 1SFQB 1Z8IB 1D3QB 3VB5A 3TK6A 1EP6A 4HG6A 2ZHFH 1W11U 3PMHB 3I77A 3KQ5A 1BIOA 5HYOA 2ZI2H 4TYDA 2DE8A 1GBLA 2ZEBA 2HLDD 3P8FA 2GKVE 4FU8A 4AB9A 2ZDLA 1UTOA 1C5NH 1DSUA 1ZZZA 2THFB 4WMEA 1O2VA 3UNSA 4XFQA 1L1GA 5EQRA 2TGDA 4XRNA 4AZ2B 5C0UA 2GDDA 1THPB 4CH8B 1GBHA 4MVNA 2J98B 2ZQ1A 4WXVA 3LT3A 1MU8B 3D23A 2B8OH 1NS3A 4OGYA 4FVDA 1HNEE 3UOUA 4Z1MD 1GMHF 4X2XA 4CRBA 1INCA 1T31A 2BD2A 2ZP0H 4HZHA 2KM0A 2HGTH 2PUXB 3GCHB 1HDTH 3HK6B 4BAQB 3TPIZ 1ABIH 1WYKA 4OM9A 4CREA 4KP0A 1TALA 1BMAA 1HJAC 2FX6A 3SORA 1FY1A 1XUKA 1S85A 1Z71A 5TCAA 8GCHG 1TX7A 1BJVA 4IN1A 2FOAA 1NRRH 4XD7D 2WPIS 5A2MH 3ZZ8A 2ILNA 2FP7B 2FODA 5DG6A 1YPHE 5DJ7A 1GCDA 1GI2A 1AN1E 2SNVA 3RXQA 3SYJA 1HUTH 1FJSA 3KNXA 1C5TA 4XBCA 3VB7A 3KIDU 2W3KA 2Y7XA 3H09A 1GJ5H 3A83A 5GDSH 1OS8A 3TK5A 1P2IA 5K0HA 1O2IA 1C5LH 1V2WT 2R9PA 3M35A 1PFXC 5GCHG 2BLWA 4LZ1H 4Y7AA 3IG6B 1PJPA 3DFLA 6LPRA 4IMZA 3OTPA 3RXLA 4FUBA 3HKIB 3E90B 3RXHA 5DP5A 4MLFB 1N6XA 1O2ZA 1GI8B 1ZMLA 4U01A 5J4QA 5A8ZA 1D3DB 1GHWH 3GS9A 1EJNA 4RKOB 1GI4A 1ZGIA 2VWNA 2H1UA 1SI5H 3RXOA 1K9OE 1MZDA 5F6MA 5HMAA 3EAJA 5DO4H 3U28C 2VIQA 3UOPA 3E0PB 2OTVA 4ZHLU 3LOXA 3OFND 2VINA 4X1NU 4ZKOU 1EFRD 2CF9H 1GJ9B 1GI0A 4IBLH 2WPLS 1P9SA 1FI8A 2ANMH 2YMSD 5G4BA 4CRDA 5CDFE 2ZF0H 2ODPA 1G37A 3GY2A 5DN6D 1P09A 3TGJE 3TJUA 2ZGBH 1AHTH 4ISIH 4JMYA 5HIYA 1O3IA 1SGPE 5K7RA 4VGCB 1Z1IA 2SGQE 1SLUB 1MAYA 2ZG0H 1O5EH 3P17H 2P8OC 2QXHA 1G2LA 2IN2A 5DPAA 3VXEH 2H2ZA 5EODA 1DICA 1SGYE 1P2QA 1TNIA 2XBVA 4GSOA 5T1VA 1Y3YA 1PPZA 5C1XA 1UTQA 3EA8A 1GJ8B 4FUIA 3U9AH 2J97A 2F83A 4IS5A 2QXJA 1BHXF 1AI8H 3CNRA 1F0SA 1UHBA 1Z6JH 2WUBA 1FPHH 5EQQA 2SGEE 4JZEH 4K60A 4WMFA 3PRDA 4LOYH 4ABFA 1T8LA 4UEHH 2VVVA 1QZ8A 1MTNB 3U8OH 2QXIA 4VGCC 5CE1A 1QRXA 2P3TB 2GCTC 4FXGH 3T2NA 1BJUA 2OXSA 2KAIA 4JZDH 4TWWA 3GDUA 4BTIB 2ZFQH 3PWBA 3RXDA 3EE0B 2P95A 1YPEH 7GCHF 1VR1H 3PV2A 1A61H 1CA0C 1F7ZA 1XUJA 2QC2A 1K22H 1UTNA 1QB9A 4IMQA 2AH4X 4X8VH 1TBQH 7ESTE 3EA7A 2FESH 2GJGA 3SI4H 5GXPA 1D3TB 2Z9JA 4DCDA 4YOJA 2I6QA 2W7SA 3W94A 1O30A 4DIIH 2EI8A 1ANEA 1GBEA 1H9LB 1W3CA 4QT8C 1YYY1 1O5FH 1F2SE 1HBTH 1AB9C 2BLOA 2D2DA 3MNBA 2VNTA 2ZCLP 3UB0A 4A6LA 1C2KA 2BMGB 2HLCA 4Y7BA 2J5UA 5GNDA 2VVUA 1DDJA 1CA8B 4X2WA 2TRMA 3M5MA 3A87A 3GCTF 1UVSH 3A8CA 1EP5A 2BTCE 3T5FH 1XXFA 4A5TS 3DT0H 3KYGA 2UUKB 1W10U 2GTBA 1O3FA 1BA8B 1C5OH 1AY6H 1HIAA 3TJVA 1C4U2 2BVRH 3FN8A 5F53A 4GPGA 1GL0E 1F0UA 3WW7A 1X7AC 3SUFA 1GVZA 4Q7YA 3LGTA 1S0RA 2BD7A 2ZU1A 1GHVH 2P16A 4LXBH 3KCGH 1LVMA 4Y76A 3GICB 3FAOA 1O5DH 1HAVB 1LKBA 1V2MT 1GBBA 1ZTJA 3M3VA 1BB0B 4UD9H 1GVKB 2UWPA 2GVFA 1LQEA 1KDQA 3QO6A 5FHTA 4DURA 2H9EH 5DP6A 1NRQH 2QAAA 3C27B 4ISOA 2Z3DA 1LTOA 4JZFH 4FVBA 1BZXE 3LGIA 1FIZA 4AORA 1MQ5A 5EQSA 3GCTG 1KLTA 2JH6D 1DWBH 1WOFA 1O3OA 3W95A 1WTHD 1BTXA 2ZNKH 2NWNA 1O2GH 2B9LA 3A7TA 1Y3WA 1HAZB 1O2XA 2SGPE 2P59A 1K1LA 4IC5A 1C5RA 4BXWA 1DM4B 1TQ0B 4CRFA 1PQ8A 3LGUA 3UPEA 2XOKD 4Y0YE 4ZMAH 2V3OH 1RXPA 3SZEA 1TNLA 3BTKE 4U2WA 3ATMA 4LK4A 1GJ6A 1O2KA 3OYPA 2PHBA 4MPXA 4ZH8A 4CHAB 3GY3A 1KXAA 4F4OC 4KTCA 4ABGA 1IOEA 1E1QD 2VIWA 4ABDA 3ZZCA 2EI7A 1UK3A 2FOCA 1QQUA 2G5VA 3MU5A 2BLQA 5TJXA 1TIOA 2WPDD 5L2ZH 5EW2H 2UUJB 1E1RD 2FOBA 7GCHG 2O8WA 2ZDKA 1QTFA 2ZDAH 2F43B 2ALPA 3ESTA 2D8WA 1GI1A 4X6PA 2GP9B 3OE7D 2BDCA 1BTUA 4HTCH 2R0KA 5E2PA 4AB8A 3Q77A 1VGCC 2AMDA 1C1WH 2QY0B 1PQAA 2A5AA 2TBSA 1TQ7B 1A3EH 2RA0A 4XBBA 1BTYA 1O2YA 1G36A 4AGJA 4THNH 1GI9B 5ETXA 1FY3A 2BB4A 2W7UA 3L3TA 1P12E 3DHKH 2W3IA 5IDKA 1FPCH 1F5LA 1V2LT 1A46H 1IQNA 1O3CA 4AOQA 1JOUB 5HM9A 1CO7E 2C8WB 2DE9A 3RXRA 9LPRA 3O8DA 1TGTA 4YLUA 1UVPA 3PLBA 3T29A 2NU1E 4FU7A 3F3BA 4INKA 2C4FH 2ZDMA 3RXPA 3T27A 3SZNA 2BX4A 3KYFA 3RP2A 3PLPA 4I86A 7KMEH 5EW1H 5EU8A 4IC6A 4TY7A 4K1SA 4K8BA 3OY5U 1F0TA 2VWOA 2PTCE 3VFEA 1ETTH 1WDIA 1ZOMA 1MH0A 1YLDA 3WY8A 2XBXA 1O34A 2AS9A 2Q6FA 2WYJA 2RFKC 3KQCA 2QXGA 1O3KA 3LJJA 1C1SA 2QV1A 4B74A 1SGFA 2GCTB 1BUIA 1AZ8A 1AVXA 2LELA 4ZKSU 5DK1A 1CT4E 1LO6A 1CBWB 1Q2WA 1GI6A 1ZPCA 1E0FD 4OS7A 4TT3D 1A2CH 1Q3XA 1O31A 1W7GH 1Y5UT 1YM0A 4H4FA 3PWCA 1AWHB 1ZJKA 2GMTC 2PW8H 1SPJA 2D1JA 2TGAA 1G30B 3E91A 3LONA 3A86A 1HIAB 4GHTA 5FBEA 2ESTE 1K1NA 1MTUA 1UVUH 5C5NA 3MYWA 2YMSC 3PO1B 1G3DA 1C1TA 3TJNA 2BLVA 1QJ7B 1GBFA 1V2TT 4KELA 5FPYA 4ZKNU 3ZZ9A 5HIZA 1LPZB 1GBKA 1O3LA 2Y6TA 1O39A 3E1XB 3VXFH 1WV7H 1QBVH 1QURH 2AGIX 2A4QA 3UTUH 3UY9A 5JPMH 1A7SA 2C90B 1SGEE 4MNXA 4CRCA 3PROA 1C1NA 3UREA 1DPOA 2FI3E 2GMTB 1P03A 1TPSA 2WINI 3RXBA 3LGVA 3AASA 2OINA 2PV9B 5CHAC 2J4IA 1O5BB 1NRSH 3S7KB 1WXRA 4MDSA 5EJLA 5F03A 3BTGE 2F4LA 1K28D 3T28A 1BTPA 4P00A 1MU6B 4H42U 2ZECA 3PV4A 4E7RG 2FS8A 2VIOA 1SQTA 3U8TH 3ZVEA 1PPHE 2FYQA 3N7EA 1OOKB 3RC5A 1YF4A 4UE7H 1P2JA 1JIRA 5BRRE 1IQGA 1OP2A 3RXAA 1GJCB 1GG6C 3BEFB 4DY7B 1UTLM 4I8HA 4UFEH 4YESB 1KTSB 3A89A 3GYMA 4AYYB 2J2UA 1QL7A 1VZQH 1Z6EA 2WZQA 2G8TA 1C5SA 4FETA 1OWIA 2Q6DA 3SUGA 3MU1A 2ZPQA 1FX0B 1RTFB 4JYVH 3V0XA 2A7CA 3QUMP 1G2MA 1GWAA 4NIWA 1S6HA 1S84A 2G51A 4ZHMU 1W12U 5L2YH 1L1JA 4KTUA 1EAWA 3SNCA 2Z3CA 1O0DH 1CHGA 2FM2A 1P2MA 1SGCA 1T7CA 1J14A 2PKAB 2WPHS 3FP6E 3V13A 3ZVFA 2OP9A 1MKWK 2KCPA 3KHVA 3QDZB 2BOHB 1QJ6B 1TGNA 1MMJN 2Z9KA 3A8AA 1TOMH 3SJKA 2TPIZ 4FUEA 1HAOH 5PTPA 4Q2KA 3RMOH 1SQAA 4AFUA 2ZA5A 1IQLA 2GX4A 1XX9A 1LHDH 1JIMA 1XM1A 1ARBA 2GDEH 3RLYH 4ABIA 3MO6A 2BY7X 1QB1A 2FOHA 1DY9A 2F9PA 4I8JA 3RXTA 1GL1A 1K21H 4DOQA 2IOTA 1FN6A 4ABEA 4J2YB 1EAXA 3VG8A 1D9IA 5DGJA 1RS0A 1V2VT 2XTTB 1OWJA 2YNAA 2ZGHA 1O2NA 4X6NA 2W6ID 5E8EH 1YPJH 3A7XA 2PP6A 3B9FH 1HCGA 2PTNA 5DP4A 2R3YA 4X6OA 5GJ4B 5C17A 2ASUB 1BRAA 5A0AE 1O3JA 3K9XB 4D7GA 1SQRA 2HVYB 1BMMH 2PKSB 3URCA 1HAIH 2FZZA 3NUMA 4GLYA 1WUNH 4E7NA 1LMWB 3LJOA 3F68H 4Y79A 3SBKA 2VGCC 4DG4A 1P04A 4HI3A 3O8RA 1FY8E 1GCTC 2WV5A 1MKXK 3NPSA 2SGDE 3F2GA 1KXBA 2P8OB 3H7OA 4RT0A 4O3TA 4CH2B 3ATWA 2BZAA 4Q80A 2RCEA 1Y3UA 8LPRA 1IQEA 1SHHB 4IW4E 1CT2E 1GHBG 3DSPA 1GI5A 1GHYH 2Y82A 1ELTA 5DP7A 1EAIA 3BTEE 4UFFH 2GGVB 2HPQH 2Z9IA 1C1OA 3SNDA 1L1NA 1C9PA 4MNWA 1ZSLA 3DA9B 4AC9A 1TPAE 1MBMA 1QNJA 3SHAH 4UFDH 2CMYA 4FUCA 2WPKS 2ZU5A 3GY6A 2UUYA 2ZGJA 1NT1A 3OEED 3SN8A 1ZJDA 1NN6A 1TMTH 1YKTA 2AEIH 2WHXA 3RM2H 5DSFA 1GMDG 1S6FA 2FI5E 1P10A 3KGPA 4OS1A 4XDEA 1GMDF 2HOBA 2OCVB 2ZDNA 1VITF 3QN7A 3NRLA 3DD2H 1AZZA 1CBWC 2ZC9H 3NK8A 3UFAA 1EXFA 3EDXB 2UWLA 1SL3A 2A2XH 3SV2H 1L4DA 4MPVA 3KQBA 1C1UH 7LPRA 1TONA 2Y80A 3CS0A 1UTKA 1SC8U 4XE4A 1THRH 4F55A 3WWFA 3E3TA 2NU2E 1ORFA 2J9NA 1SBWA 3OEHD 1KY9A 1IQFA 4NG9H 1OP8A 1W2KH 4MNVA 4BANB 3DFJA 1SGRE 2G5NA 1W0ZU 1YBWA 3TH4H 3TH2H 4J1YA 1QCPA 4H6TA 1ANDA 1J9CH 3QGNB 3TITA 1SGQE 1MD8A 1ZGVA 2ANKH 5JBTA 3MI4A 1P3CA 4WY3A 1O3NA 3ZZBA 3MO9A 5C2ZA 1Z8RA 2KFWA 1FQ3A 4YXWD 3TU7H 4Q4LA 2RA3A 3UIRA 2G81E 3FVFB 3PMJA 1ELAA 3PB1E 1S5SA 2AIQA 1A0HB 1TFXA 3TVJB 1SOZA 1S6LA 1BTZA 1H8HD 3Q3KA 1O2HA 2FX4A 2FLBH 2RDLA 1PYTD 4XSKU 1HYLA 3LC3A 2R2WU 2ZTXA 2A5IA 2BQ6B 1V2KT 3GCOA 1V6DA 1O3GA 5C67A 3QLPH 5DP3A 1OKXA 5C94A 2BM2A 6ESTA 3LIWA 4WJG2 1UJ1A 3BTTE 5C1YA 4TY6A 4DGJA 1C2LA 1S82A 1OX1A 1GJ4H 1C5PA 1UTPA 1YPGH 4AGKA 1W0JD 5GPIB 1OWHA 5T3HA 2NU3E 2PKAA 1HAVA 1QGFA 1ETSH 3STJA 1ZPZA 1KMHB 3PMAB 2ZPSA 3E0NB 3M3TA 4H6SB 5GCHF 1D3PB 1YLCA 5C1UA 2JH5D 1BCUH 3FANA 5E0GA 5EPYA 1DSTA 3WWBA 4INLA 4BTUB 5C0TA 2BD5A 3ATKA 4NWLA 1O2JA 1HFDA 4X1RU 1F0RA 2DUCA 3R3GB 4OS4A 4MPWA 1O2UA 2JJ2D 3RC6A 5AFYH 4SGBE 1EAUA 2VIDA 1CU1A 1IQIA 3BG4C 3BEIB 3BIVH 4FU9A 4K5ZA 3L6PA 1YY3A 1O2MA 1ZR0A 2VWMA 4MG3A 2ALVA 4TPYA 1HJAB 2ZFTA 3MFJA 2P3FH 1O3EA 4B6FA 3GDSA 3UNQA 1C2GA 1GBAA 3GCHC 1IQJA 3SU0A 1TRMA 3HKJB 1ZHPA 1O35A 4X2YA 4YO9A 2GD4B 1V2PT 1GDUA 4I31A 1O3DA 1DWCH 2K1QA 2XC5A 5JYIA 1CGJE 5JB9S 3SU6A 2XYAA 3RU4D 5EOKA 1FUJA 5I46H 3A84A 1WSSH 1SGFG 1TGBA 3RXMA 3GY5A 1O37A 1MZAA 1SLVB 2VB0A 2JH0D 2WPMS 3HATH 4B6EA 4NA8A 2XBWA 5DKMA 4DIHH 3A88A 1TBRH 3U1IB 1VITH 3AW0A 2OC0A 4NIVA 4X1PU 2WV9A 1HGTH 1ABJH 3HK3B 1O5AB 2AIPA 2Z9GA 1UTMA 1ELDE 2GCHF 5AHGH 5EXNA 3SGBE 2BD9A 1FXYA 1V2JT 3LPRA 5GWZA 1K1JA 3Q76A 4M7GA 1MCTA 2A31A 3M3SA 1MKXH 3PM3A 3ZIAD 2OC8A 1E79D 1UCYH 3UWJH 2H6MA 1AQ7A 2OD3B 3PTNA 1SQOA 1H9IE 3BIUH 2OQ5A 1OWDA 1GCTB 5FCKA 2CV3A 4RKJB 1HV7A 3F1SB 1QHRB 1Y3VA 2OBOA 2TIOA 3CS7A 2BDGA 4YLQH 2XBYA 5LH8A 2B5TB 1HXEH 2VIVA 1EJAA 2Y81A 3BN9A 5DP9A 1PPFE 4YZUA 6GCHG 2M2AA 2KZ4A 4NA9H 2H9HA 1YPMH 2AHME 2EC9H 3Q00A 1XXDA 3RUOA 3BTQE 3U69H 1BTHH 3MNSA 1N8OB 1SGNE 3VPKA 2OUAA 3MNCA 1K1PA 3ZZ4A 3RXVA 3UQVA 2ODQA 1H8IH 3IWMA 3ELAH 1DWEH 1XKAC 1Y8TA 3VB6A 1O3MA 1RD3B 3SJ8A 1QRWA 2XCFA 3M36A 3LH3A 1K1OA 3A7ZA 1B5GH 3PO1C 5JBCS 1RGQA 4O9VA 1A0LA 3M7QA 1GHXH 1TRNA 4DJZB 3M5NA 5LPRA 1NRNH 1TPOA 3D49H 2BDHA 3STIA 1C5YB 1TPPA 1FLEE 1A5HA 1OWEA 2TGTA 4ASHA 2XWBI 5C20A 1DFPA 4JK6A 5T6GA 3GYLB 2QGRA 3RXJA 3KN2A 5E0HA 2ZDVH 3FP8E
chains in the Genus database with same CATH topology
1SLXB 1BHXB 4XBDA 3RXCA 2O9QA 1ZTKA 2BOKA 1FMGA 3ZZ7A 1HJ9A 2XNIA 1DANH 1LPGB 1C2HA 1AMHA 3BTFE 2PLXA 1Y3XA 3P92A 4Y8ZA 4JZ1A 1NO9H 1ZSJA 1VCPA 2XCNA 1YPHC 5FPTA 1AUTC 1AO5A 4Q7XA 2R3UA 4B2BA 3F9HA 2IJOB 1XKBC 3M5LA 3I29A 1FAXA 3KQEA 2F9BH 2Q6GA 2VIPA 1V2UT 2FLRH 1ELFA 1TBZH 2I6SA 4D9QA 1O36A 2ANYA 1P05A 1DE7H 5JB8S 4GHQA 3E8LA 1DLEA 2ZTYA 1GMCG 1EB2A 1XUGA 1UK4A 1SGDE 4Y10E 1O2LA 3KQDA 1LHEH 2JETC 1EZQA 2BDYA 3D65E 3FP7E 1B0FA 1GHZA 1GBMA 3ODFA 2SNWA 2EA3A 2HVXA 3BTME 1SHYA 1AVWA 1A5GH 1TNJA 4K69A 1QB6A 1V2RT 2AMPA 4R8TB 2BVSH 4NA7A 4A1TA 3QTVH 1M9UA 2VU8E 3RXGA 2CHAC 3SNBA 4YM9A 2FO9A 5L30H 3OY6U 3ZVBA 2XW9A 2TGPZ 4RN6A 1LVYA 1RTKA 1ESBA 2FMJA 3E16B 4WH8A 3E6PH 3GY4A 1TX6A 3F9GA 4UDWH 3RXIA 1JWTA 2BD3A 5LPFA 3S9AA 1GBCA 3O8BA 3LH1A 2V0BA 5HGGA 2ULLA 3UR9A 2FPZA 1SG8B 1P06A 2P93A 3SU4A 3P8OA 1BITA 3SJIA 1CT0E 1KIGH 1C2IA 1GDNA 1MTVA 4NZLA 2G52A 3UUZA 2B0FA 3BV9B 4NIYA 4OS2A 1CHOF 1DITH 2YOLA 1TGCA 4SGAE 1EKBB 3MH5A 5A8XA 1E36B 1O32A 1TNKA 1HRTH 5C5OA 2ZZUH 1L0ZA 2AYWA 1EB1H 1O3PB 2GCHG 2CGAA 3P6ZB 1IHTH 1QBOA 4DVAU 1LHCH 1SLWB 2PR3A 2A7JA 3GISB 4CBNA 2J95A 4ABAA 1YPLH 2HNTF 4ZROA 1PPEE 1IQKA 1AE5A 1DUEA 2F3CE 1JMOH 2B7DH 1W13U 3LGYA 3QWCH 3UR6A 1GHAF 2W5EA 2FOEA 4Z0KA 3A7YA 1CVWH 1NM6A 3OU0A 2ZFRH 2CXVA 3NZIA 2WUCA 1BRUP 1EZXC 2V6NA 2Z6BD 1EJMA 1LQDB 2QN5T 4BOHA 3GCNA 1U6QA 4PROA 3URDA 6GCHF 1ESTA 3HGNA 1TGSZ 1KLIH 1NU7B 4CR5A 1EX3A 1O38A 1O2PA 4NWKA 4NFFA 2C3SA 4BAMB 1P9UA 2STAE 2VH0A 1P0SH 3S9CA 4Y11E 3NWUA 1EUFA 1OYTH 2ZKSA 2SGAA 1T8MA 3KEEA 1H8DH 4JCNA 1ESAA 1TA2A 2GV6A 1CGIE 2XRCA 1DWDH 4MPUA 3K6YA 1UHBB 2QYIA 1O3BA 3T26A 1QY6A 3M7UA 1G9IE 1F92A 2FXRA 1XUIA 4MTBA 5FCRA 2GT7A 4KTSA 1IAUA 3A8BA 1O5CB 4Q7ZA 2JKHA 1DOJA 2Y5FA 1T8NA 8GCHF 3CENA 5FBIA 3LKWA 4A1VA 1NTPA 4Y0ZE 1S81A 4AFSA 1MCVA 5T6FA 1DXPA 1BRCE 3JZ1B 1P57B 3ZV8A 2A7HA 1XVMA 1XUHA 2FI4E 4I8KA 1KSNA 1S83A 1T4VH 1TMUH 8KME2 1A3BH 3B8JA 1ACBE 1AWFH 6CHAC 2GZ7A 1DY8A 2HNTE 1F5KU 2FDAA 1O3HA 4YT7H 4WH6A 2EI6A 4NSYA 2FS9A 2M5TA 1VJAU 3C1KA 1KLJH 3SUEA 1EOJA 1UVOA 1WAYB 4FUDA 1BMLA 1C5WB 3AVZA 2GZ9A 2BDIA 3F9EA 4JK5A 1MTNC 2ZQ2A 4I7YH 2UWOA 3MH7A 1SR5C 2BD8A 5HM2A 3TIUA 4I32A 1BTWA 2A1DB 1C2DA 1A0JA 2CJIA 4U32A 3VGCC 5AVDA 3EA9A 3P70B 1TLDA 1J15A 4XOJA 3A7VA 5H4IB 2BDAA 1Z7KA 3RLWH 1C2FA 2AGGX 3HPTB 1BRBE 3NKKA 2BQ7B 4ZAEA 1ZMNA 3RU4E 3IITA 2FEQH 1EPTC 3MU8A 4NGAH 3NCLA 1PPGE 5LPEA 1AUJA 1GBDA 3PYHA 1LCYA 2A5KA 3NXPA 1NZQH 4DW2U 1XMNB 3A82A 4X8SH 3VEQB 1K1MA 1P01A 3PMBB 5SGAE 4B76A 2Z7FE 3S7HB 3RXUA 4GCHG 1VCQA 1SSXA 3MMGA 1B0EA 2XWAA 3FZZA 3MH6A 4BAOB 1LHFH 3TH3H 3RXKA 1EZSC 5EPNA 1TX8A 4ZXXH 1XUFA 4WVPE 1ZLRA 1PQ7A 2IPHA 1ARCA 8ESTE 1KDQB 2QF0A 4X8TH 3OX7U 5AFZH 1LKAA 3KL6A 1TNGA 4HGCA 4B2CA 3SU5A 4B75A 5GIBA 4RSPA 2AMQA 4X0WU 1SGIB 1EOLA 1N1LA 3A85A 2HPPH 3SQHE 1UCYK 1F5RA 1A1RA 4ABHA 4NCYA 2VH6A 3PLKA 5EXLA 3G01A 1T32A 2FYRA 1C1PA 1C1VH 1QL8A 1C5ZB 1BDAA 2AGEX 4B2AA 1C9TA 5IYTA 2BY5X 4CRGA 1EQ9A 2G4TA 2KAIB 4D7FA 2G4UA 2J34A 3I78A 3UQOA 5A0CA 3M37A 2H5CA 1K2I1 2F9UA 1AB9B 1GI7B 5F8ZA 1GGDB 3RMLH 5LGOA 1P3EA 3RMMH 1LVOA 1H4WA 1E35B 1C1RA 3BSQA 1GG6B 1QA7A 4GAWA 2A2QH 4NFEA 2LNCA 2AFQB 2F91A 4ZXYH 1NFYA 5ESTE 4Y71A 4NZQA 1AFEH 2ZO3H 1A4WH 1C5VA 1AD8H 2D26C 1OYQA 1YPKH 1VITG 4O97A 3T62A 1RIWB 1FONA 4YOIA 3JZ2B 2FOGA 2GT8A 1OWKA 1OSSA 1TNHA 1CSOE 1HXFH 5E0JA 2OBQA 1QBNA 3M61U 2PGBB 4X1SU 2G55A 4E06H 2QF3A 3QTOH 2Z94A 1Z8GA 4A92A 3MU0A 3H5CB 3Q3YA 5FXLA 4FUHA 4X8UH 5DP8A 3LDXH 2R0LA 1V2OT 3RC4A 1J16A 1THSH 2WPJS 1ZHMA 1PPCE 4ABJA 3RU4T 1O2OA 3SU2A 1MD7A 1BBRK 1RJXB 1AFQC 2Q1JA 4JYTA 1CE5A 1YC0A 2STBE 1Z1JA 1NFXA 1ELGA 1V2ST 1P8VC 3AAVA 1G3BA 4BAKB 3EQ0H 5FPSA 2HRVA 1L4ZA 1OP0A 3ZZ5A 3TGKE 4UFGH 3GY7A 3ZZ3A 3Q3XA 4E05H 3S0NA 2ZFPH 2A4GA 1MUEB 1O2RA 3U8RH 2C93B 3TNTA 3SV6A 1HPGA 3F6UH 2O8UA 2OC1A 2OLGA 4X6MA 4FUJA 3EGKH 1UO6A 3MU4A 1MTSA 1E34B 2WYGA 2V3HH 1MBQA 2O8TA 4AX9H 3P8NA 3M5OA 4YTAA 2YNBA 1ELVA 3H7TA 3V3MA 4Y8XA 2FOMB 5AF9H 1AKSB 1CA0B 4D8NA 4R0IA 3RXFA 1SFIA 1D6WA 1SVPA 1AKSA 1CQQA 2ODYB 1HAXB 1SB1H 4OGXA 1Y59T 4AN7A 2V35A 3SJ9A 4AG2A 1D4PB 1C5QA 3MWIU 2BXUH 1FN8A 5FX5A 3LC5A 3MHWU 4ISNA 4FUFA 1AE8H 2A0QB 3SU1A 3SV7A 4ZUHA 2BXTH 2QIQA 4INHA 1C5UA 1O2SA 1C4Y2 1GJDB 1VCWA 3SNEA 4O03A 1QR3E 1LVBA 1YCPM 1GMCF 3PTBA 5EG4A 3T25A 3ZZAA 3ZZ6A 3M7TA 3K65B 3MO3A 1MKWH 4LZ4B 2BZ6H 1HAPH 1JRTA 2ZU3A 3TJOA 4NIXA 4Z6AH 3BEUA 4K2YA 4BXSA 3EYDA 1EPTA 2BY6X 1TAWA 4B73A 1MAXA 4AYVB 1FDPA 1W14U 2WV4A 3ATIA 3U98H 1P2NA 3FZDA 1BBRH 3FFGA 1ANCA 1KXDA 3GDVA 1SGTA 1OPHB 1GI3A 2AERH 1J8AA 2SFAA 2ZGCA 4IGDA 1GGDC 2BX3A 1P2KA 4MNYA 1EATA 2A4RA 3SUDA 2PUQH 4YT6H 3R0FA 2ZIQH 2FOFA 1QFKH 5A8YA 2ZWLH 2ZHWH 2ZFFH 2JETB 2Y7ZA 3SOSA 9ESTA 1KYNA 1W8BH 1ZTLA 1GJAB 1UCYE 1AGJA 3LGWA 2PSYA 1C2JA 1E38B 1ID5H 2SGFE 3TGIE 3V7TA 2GV7A 1AIXH 2XC4A 4AG1A 2BY9X 1GBIA 4U30A 1C1QA 4K8YA 4BNRA 3AW1A 3MH4A 3A80A 3QGJA 4JZIA 2ZFSA 1NROH 2VWLA 3CP7A 2QA9E 1K1IA 5J4SA 1PPBH 4TPIZ 1QIXB 2Y5GA 4MQAA 3ODDA 4I8GA 1JRSA 4ZHAA 5ABWA 1JBUH 2VGCB 3OSYA 3A7WA 3OTJE 1GDQA 2ZU2A 5ESBA 1BQYA 3MOCA 1AVGH 1DLKB 1H9HE 2FTLE 4ISLA 2A45B 1O2QA 5F8XA 1ZRKA 1EPTB 1ZRBA 4I8LA 3HGPA 1V3XA 2BY8X 5BPEA 3SQEE 1WTGH 5FX6A 4B71A 3A81A 2NU4E 3RMNH 1C4V2 1ZSKA 1GHAG 3BTHE 1TABE 3BTDE 1Q31A 3TLOA 1DUAA 1ZYOA 4ZKRU 1FNIA 2FIRH 1TWXB 1W7XH 4WXIA 2G00A 1FZZA 3K2UA 4GCHF 3B23B 2C8ZB 4FUGA 3UWIA 3VB4A 2FWWA 2ZU4A 4I33A 3S9BA 3SHCH 1QQ4A 1KXEA 3ENSB 4KGAA 1L2EA 4Y8YA 3ZVGA 3F9FA 5HXFA 3DUXH 4HFPB 1BMNH 1GPZA 1SMFE 1UTJA 4X1QU 1KXFA 2ANWA 3ZVDA 1DS2E 1C1MA 1UK2A 1HAYB 4GVUA 5L6NH 2VVCA 2PFEA 1NFUA 4KKDA 5A09A 2OC7A 4CR9A 1CHOG 1GJ7B 1V2NT 2BD4A 3RM0H 5FAHA 4ABBA 5EXMA 2PKSC 1C5XB 2F9VA 1N8OC 1G3CA 1RRKA 3SV8A 3UNRA 2GZ8A 1S0QA 1P02A 1NU9A 3AAUA 1GMHG 2ZHQH 1WBGB 1O2WA 4K1TA 2BQWB 5F8TA 2UUFB 1O3AA 4D9RA 2J94A 4ISHH 4ESTE 1TB6H 3TK9A 1KTTB 2ZTZA 3SNAA 1OXGA 1GHBF 1KXCA 3MTYA 1QL9A 1TE0A 1VGCB 1ZHRA 2XXLA 4OS6A 1GBJA 2EEKA 4AFZA 1Y5AT 2HNTC 1HAGE 3N7OA 3BG8A 4K3JA 3ZZDA 2NU0E 1E37B 1FIWA 1ANBA 4DT7B 2ZHDA 2J38A 1ELEE 1DT2A 1PYTC 1UMAH 1YGCH 2BYAX 3VB3A 2P94A 2BVXH 1N6YA 3ZV9A 3P95A 1IQHA 3SI3H 2Z9LA 3VGCB 1IQMA 1QRZA 1VJ9U 1SOTA 4TWYA 4CHAC 1YP9A 4WMDA 2VJ1A 2ZCKP 2FTMA 3GY8A 3A8DA 4UONA 1LHGH 4CBOA 1HAHH 1YCPH 1HLTH 1IHSH 1LPKB 3S69A 1BT7A 4K1EA 1ELBA 1DVAH 3BF6H 4BTTB 5B6OA 1T4UH 1ZPBA 1CGHA 5CHAB 2BHGA 4NSVA 2QCYA 2R2MB 5CMXH 1DX5M 1O5GH 2H5DA 3D62A 1GJBB 4A7IB 5C3NA 1C2MA 1TA6A 5JDUB 1MQ6A 3ITIA 1FV9A 1QJ1B 1AU8A 1NESE 3TNSA 2ZPRA 4D76A 3GOVB 1NC6A 2J92A 3SJOA 1TRYA 1NY22 1NPMA 2H9TH 1W0YH 1HJ8A 2Y5HA 3QZQA 4GUXA 4X2VA 3K6ZA 3ZVAA 2ZHEH 1GBTA 1O33A 3QX5H 1Y5BT 1Z8JB 1NFWA 4AFQA 3U1JB 3ZVCA 1TOCB 3SW2B 1ELCA 2BDBA 1FAKH 4JYUH 1BOQA 1WCZA 1J17T 1WQSA 2A4OA 5JBAS 1PQ5A 4BAHB 2F9OA 4F49A 1QA0A 3ZYEA 1GVLA 2C8XB 2XC0A 1NRPH 4O3UA 1D6RA 2A32A 3QZRA 2Z3EA 1YCPK 2PWXA 1AFQB 3V12A 2HALA 1O2TA 3RXEA 1T8OA 1MTWA 1LDTT 2ZGXH 3RDZA 3BTWE 3SV9A 4OS5A 2F9NA 3ATLA 4A1XA 4WWYA 2C8YB 3O8CA 4WF8A 1G3EA 1G32B 1B7XB 2P3UB 3SO3A 3SGAE 4IN2A 1P11E 2HWLB 2RG3A 1P2OA 1UVTH 2O8MA 2W26A 1TYNA 1FY5A 2PSXA 1XVOA 5E2OA 1EZUC 6CHAB 1C5MD 2ZCHP 4YOGA 5A0BA 5EGMA 3SU3A 5T6DA 1EASA 1FY4A 3LU9B 5JBBS 3KF2A 1V2QT 5TCCA 2O8LA 1RIWC 1WQVH 1HB0B 5I25A 1TMBH 1DXWA 3BG4B 1JXPA 2PGQB 1WU1A 3P8GA 3ZYDA 3MNXA 4Y6DA 3QK1A 2CF8H 2LPRA 2OQUA 1RFNA 1A5IA 3SGQE 4CRAA 1RTLA 2CHAB 1ETRH 1C2EA 2CN0H 1BBRE 1ZMJA 1H1BA 3L33A 3RXSA 4B1TA 1SFQB 1Z8IB 1D3QB 3VB5A 3TK6A 1EP6A 2ZHFH 1W11U 3PMHB 3I77A 1BIOA 5HYOA 2ZI2H 4TYDA 2DE8A 1GBLA 2ZEBA 3P8FA 2GKVE 4FU8A 4AB9A 2ZDLA 1UTOA 1C5NH 1DSUA 1ZZZA 2THFB 4WMEA 1O2VA 3UNSA 4XFQA 1L1GA 5EQRA 2TGDA 4AZ2B 2GDDA 1THPB 4CH8B 1GBHA 4MVNA 2ZQ1A 4WXVA 3LT3A 1MU8B 3D23A 2B8OH 1NS3A 4OGYA 4FVDA 1HNEE 3UOUA 1GMHF 4X2XA 1INCA 1T31A 2BD2A 2ZP0H 4HZHA 2HGTH 2PUXB 3GCHB 1HDTH 3HK6B 4BAQB 3TPIZ 1ABIH 1WYKA 4CREA 4KP0A 1TALA 1BMAA 1HJAC 2FX6A 3SORA 1FY1A 1XUKA 1S85A 1Z71A 5TCAA 8GCHG 1TX7A 1BJVA