1GBBA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by ala complex with methoxysuccinyl-ala-ala-pro-alanine boronic acid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGANVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
total genus 52
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbbA01
3ZYEA 5E0HA 1TPPA 4ISLA 2Z9JA 1LVYA 2PTCE 1YPLH 3SQEE 3TU7H 5FBIA 1G3BA 2FOEA 3ODDA 4IN2A 1TQ7B 1ETTH 2XWAA 1BTWA 1W14U 1D3DB 1ZPBA 3PO1C 4X2YA 3ZYDA 2SGDE 1YPKH 1ZMLA 1CGIE 4GLYA 1GBKA 1TOCB 4Q80A 2ZCHP 1HAYB 2AYWA 2DE9A 2FOMB 1LHEH 2DUCA 1T8OA 2SNWA 1HIAB 3D49H 1SGFA 3SO3A 2UUYA 3DT0H 2C8YB 2VVVA 3SNDA 1V2UT 3SORA 4BAKB 1C2JA 1EOJA 2ZU2A 3ATIA 3LIWA 1NTPA 5C20A 1E38B 1P57B 1MTUA 1PQ7A 4A5TS 4ZHLU 3ZZBA 4GCHF 4ZHMU 3P17H 2GMTB 2XW9A 4CR5A 4FVDA 3GOVB 5G4BA 4BANB 3QZQA 4ZUHA 2EI8A 3TGIE 1DITH 3MMGA 1EJAA 3FAOA 4NZLA 4WVPE 4Y8YA 3E16B 1ZTKA 2VIQA 3SU6A 1GHYH 1WTGH 3IG6B 3GY4A 1ZSKA 2A4RA 3OY5U 3SJOA 1BTXA 1KYNA 1NRPH 2GVFA 4Y10E 1TBZH 1TONA 2BB4A 2BHGA 4XE4A 1HJAC 1V2KT 2TGPZ 4XBDA 1HB0B 1CE5A 1VITH 1LPKB 3M5LA 2ZHDA 5GCHG 4LXBH 1K1IA 1P2NA 4A7IB 1TGSZ 1Y3YA 3LKWA 3FP8E 1DICA 2ZHEH 1SGIB 1CO7E 3Q3YA 3S0NA 3KQEA 1P2OA 2PSXA 4DT7B 1C9PA 2O9QA 1GCTB 3LONA 4HTCH 4KTCA 3VEQB 1MZDA 1BHXF 1O2KA 2ALPA 1S82A 3LGTA 1O3IA 1VCQA 2ZFFH 3TH4H 4BAOB 3TIUA 1JWTA 1LHFH 3A87A 4HFPB 2G5VA 1EAXA 4GAWA 2FX6A 3D23A 1P9UA 1UK4A 1RTLA 4Q7YA 3LC5A 4WMFA 1A0LA 4INKA 1L4DA 3VB5A 1NO9H 2UUJB 1MAXA 1AE8H 1EAIA 1C4U2 2AERH 3G01A 3RU4T 3ZVFA 2VVUA 2AGEX 5C5NA 2XCNA 3H7TA 2AMQA 2GMTC 1QL7A 4FUBA 4Y7BA 1KXCA 1EP6A 2XBYA 1N6YA 1HDTH 5A09A 1GHAG 2KAIB 2FI5E 1S84A 2P59A 2XTTB 1QQ4A 2BM2A 5DO4H 1SBWA 2PLXA 1DT2A 2FDAA 1CT4E 1GVZA 2OBQA 1ZR0A 1N8OB 4JYVH 3QLPH 3U8RH 4VGCC 1C1PA 1C2MA 3GCNA 1D3QB 1A5HA 2NWNA 4ABJA 1EX3A 1D3PB 2PGQB 2O8WA 4CBOA 4X1NU 4ABAA 3KQDA 1O2RA 1G32B 1PQ5A 3NWUA 1GCTC 1TRYA 1OS8A 1V2PT 4E06H 1W0YH 3BG4B 3E0NB 2F91A 2BDIA 5HGGA 3MU5A 1NS3A 1QQUA 3NKKA 5BRRE 5L6NH 2SGEE 4KP0A 3A7YA 1F5RA 1TOMH 1O5DH 3DFLA 3BTHE 1GHZA 4X2VA 1W7XH 2F9VA 2OLGA 1GI5A 3KGPA 4CRFA 2EA3A 5FHTA 3M7TA 1MQ5A 2BLOA 2NU2E 1D9IA 2GKVE 4K1EA 1TAWA 2G55A 1TGTA 1ZJDA 3UOPA 1A0HB 3SJ8A 1QRXA 1YLDA 1FY4A 3RMOH 4MNVA 2Z6BD 4Y76A 4NSVA 1K28D 2NU4E 3Q3XA 1KLIH 3T62A 1ZTLA 5I25A 4BXSA 1H8DH 1SQTA 4GHTA 4FUDA 2FODA 1MKXK 4JMYA 4AFQA 3DHKH 1K1JA 4Y11E 4UDWH 2FS9A 2XNIA 1W11U 2XRCA 1EZUC 4FU7A 4NCYA 1DWEH 2GT7A 1AWHB 1EB2A 2PWXA 3RC4A 1GBEA 4X1RU 1TE0A 1TB6H 4XOJA 4GVUA 5EPYA 3UQVA 1EPTA 1N8OC 1TBRH 1AIXH 5A0CA 7GCHF 4E7RG 3SGAE 4NIYA 1O32A 2B8OH 1AUJA 4AB9A 1SFQB 5ESBA 4YM9A 1O2IA 1AUTC 3SZNA 4ZKNU 3ZZ3A 2A7HA 3EA8A 1JRSA 3BG4C 3ZVGA 3KN2A 2QYIA 1ARBA 2A4OA 4ISHH 2VIWA 4SGAE 2A45B 4H6TA 5ESTE 3RUOA 3BTEE 1PQ8A 1J14A 2HGTH 3V0XA 1OP2A 3SU4A 4I7YH 1DXWA 1EAWA 5DP7A 1THSH 4AFZA 4MPXA 1P10A 1ZJKA 2ZTYA 3HPTB 1MKXH 2NU1E 2ZHFH 4K8YA 1P2KA 3MHWU 1GJDB 1Y5UT 1DSUA 1QJ7B 2HPQH 3NK8A 2W7SA 2CXVA 5T6DA 1UHBA 3KEEA 4M7GA 1RTKA 1TX6A 2Q6GA 1B0FA 3RLYH 2H9EH 2QCYA 4CRGA 1YBWA 2ZCLP 4BAHB 1DX5M 1SLXB 2F83A 1IQEA 1PFXC 3U8TH 1O5CB 1UTNA 1HAPH 2ZQ1A 1HLTH 3A7VA 3URCA 1DWCH 1O2SA 3LJJA 2YNAA 2A7CA 1BT7A 1ZRBA 4JK6A 1HGTH 1AKSA 3T5FH 2C8XB 1ELGA 6ESTA 2P8OB 1T4UH 1AN1E 3MI4A 1O2HA 1XUIA 3TK5A 5K0HA 4MNXA 4X8UH 4KGAA 2FS8A 3KQBA 1SGYE 3Q76A 2W3IA 2O8LA 2ZFPH 5B6OA 1EJMA 2BDBA 1LHGH 1NT1A 1CA0B 3VB4A 1PPEE 3GDVA 3CS7A 1VJ9U 1V2RT 1J16A 1O3JA 1UK3A 1T8LA 3F9EA 4O3TA 1UTMA 1QA7A 3SU2A 4ISIH 2VINA 1Z1IA 1NFWA 2CF8H 1FY8E 1F0TA 3TK9A 3UIRA 1KTTB 3RXBA 1NRNH 2H9TH 1FY1A 5DP3A 3ELAH 5GCHF 4H42U 2FESH 1LHCH 4OS7A 3VGCB 3IWMA 4CRAA 3A80A 1N6XA 2ZHQH 1C9TA 5C3NA 1CT0E 4RSPA 1F5KU 1P12E 5E0JA 3RXKA 1QBVH 1K22H 2Y80A 1O2MA 1BMMH 2HVXA 3QTOH 1C1WH 4FU8A 4X6MA 3A85A 4GPGA 3UR9A 1ZMNA 1TGBA 3QZRA 3V13A 1FUJA 5F8TA 1K1LA 2Y5FA 1VZQH 3AVZA 4ESTE 1AGJA 2Z3DA 2IOTA 1G3EA 8ESTE 1O37A 1Y3UA 2ZTZA 1V2ST 4X8TH 3LC3A 2JH6D 1O3LA 1GI1A 1O2VA 4Y8ZA 1LVOA 3DUXH 2P8OC 4NG9H 1TNJA 1LQEA 3FVFB 1TABE 1TPAE 3L6PA 1GJ7B 2AGGX 4BOHA 5LPFA 4IN1A 1ZTJA 3VB3A 1AFEH 4B1TA 1SG8B 3NZIA 3K6YA 1C4Y2 1WBGB 3NPSA 3SUGA 1O5FH 2FI4E 3FP7E 1SFIA 1CA0C 3LGWA 2SGQE 1EJNA 3RDZA 1GHAF 3RXUA 2QY0B 2ZA5A 1AZ8A 1TALA 5DP5A 3T29A 1UVOA 2Z94A 2FI3E 1DOJA 1HRTH 4CHAC 1XKBC 1EQ9A 3SNAA 2OC0A 4WH6A 4INHA 3AW0A 4FU9A 3EQ0H 2GX4A 1O30A 4J2YB 1F0SA 1OWDA 3QO6A 3PMBB 1DPOA 3VGCC 5GWZA 1SMFE 4MDSA 4X6OA 5DGJA 4HI3A 2ZDAH 3SU0A 3MH5A 1PPHE 2XC0A 1CT2E 4ZXYH 3GCOA 3OU0A 4ISNA 4I32A 4ZAEA 5C1XA 3PLPA 2JETB 4U32A 3RXOA 1LKBA 2FOGA 1FXYA 2V35A 1TA2A 4FUHA 1PPZA 2OXSA 2ZQ2A 2HOBA 1GG6C 4TY6A 3MYWA 4KELA 1UCYE 4B2CA 3M5MA 1Y3VA 2OQ5A 1GBIA 1OWHA 3HGPA 1MZAA 2XBXA 3AASA 3V12A 3MU0A 2EEKA 2VWMA 3PB1E 3SN8A 2WPKS 7GCHG 4K1TA 3W95A 2R3YA 3ATMA 3LDXH 2P93A 2GZ9A 3PTBA 3QGNB 1IOEA 2SGAA 3A8AA 4ZXXH 1C2FA 1HUTH 2ZG0H 4D8NA 4XDEA 2WYGA 3P8FA 4AG2A 1C1OA 1C2EA 5HM2A 1SGDE 4K60A 4WY3A 1G3DA 2BD2A 2ZPSA 3KQCA 4X8VH 3ZVCA 2ALVA 1O3BA 3P8OA 1TNKA 1Y59T 4OGXA 1YPEH 2OCVB 6CHAC 1NU7B 1BTZA 1SHHB 6LPRA 3FFGA 5SGAE 4DIHH 1GJAB 1AE5A 1XXDA 2ZFRH 1KXBA 1DUEA 3E91A 2FEQH 4DY7B 3PM3A 1GMDF 1VGCB 3RXTA 2BVRH 1C1UH 1P06A 1SGCA 1F7ZA 2ANMH 2AH4X 2BX3A 3EYDA 1HAXB 4TYDA 2OINA 1GHBF 2M5TA 5C1UA 1FAXA 1RIWB 3DA9B 5GJ4B 5EQRA 1BTUA 1CBWC 1GDUA 2AIQA 2GCTB 2QV1A 3EDXB 4NA9H 2V6NA 1KDQA 2BQ6B 4E05H 1ZHMA 1N1LA 1P05A 3LGVA 1PYTC 2THFB 4X1PU 3PMJA 4UEHH 5A8YA 3E90B 2BY5X 4ZROA 1E36B 4CREA 1S85A 1TBQH 1F2SE 3PROA 4B75A 4CRCA 2CF9H 1KTSB 1O3NA 1DUAA 4RKOB 1P2IA 3ITIA 2G8TA 5EQQA 3BIVH 4YT6H 3K6ZA 1AFQB 3F9HA 2FXRA 1C5NH 1HBTH 2EI7A 4IBLH 4ZHAA 3RXLA 3WY8A 1YPHE 2H5DA 1QB1A 3SJIA 1FMGA 2ZF0H 3TJNA 1O0DH 3ZVEA 1A3BH 2IJOB 1JBUH 1FLEE 1DM4B 3STJA 3SV6A 1FNIA 3SI4H 3A88A 1AI8H 1NZQH 3CP7A 3I29A 2VU8E 2ZCKP 2BLVA 1AVGH 2ESTE 1Q31A 3B23B 1OKXA 4NA7A 3LJOA 3MNXA 1PQAA 3RXVA 1O33A 2WPHS 1LVBA 1WQSA 3P6ZB 1LCYA 4XFQA 1ZRKA 4X1SU 1EZQA 1ZGIA 1P3EA 1ZGVA 4QT8C 3SNCA 4Y6DA 3MO3A 3RMLH 1VGCC 2CJIA 3SV9A 3AAVA 2GDEH 4ABGA 1UTKA 2G00A 2BMGB 5H4IB 2ULLA 4E7NA 1TNHA 2ANWA 1IQKA 1H9IE 1MD8A 2Z9IA 3HKIB 2FYRA 3RMNH 1MUEB 4B71A 4A92A 3VB6A 1GI3A 3RC6A 1O2XA 1TA6A 1ZPCA 1UHBB 2P3FH 3M61U 4MNYA 4NZQA 1T31A 1BMAA 1MTNB 3SV8A 1MBQA 1YC0A 1DWBH 4U2WA 2QXJA 1O2JA 2GZ8A 1GJ9B 3N7OA 1C2HA 2F9NA 4NWLA 4KKDA 3O8DA 2BOKA 3QUMP 1XX9A 1Z7KA 1V6DA 3Q00A 1SLVB 5T3HA 4IMZA 5L2YH 3UREA 1RRKA 1O2PA 1ABIH 1OYTH 2VNTA 3M3TA 5HMAA 1LPZB 4TY7A 1AKSB 4JZDH 1ZZZA 2J9NA 1ELAA 1LTOA 1OWIA 1HNEE 4U01A 3BTFE 4JCNA 2G52A 2FMJA 2O8UA 4CRBA 3U9AH 5C1YA 1BB0B 1RTFB 4AORA 2OQUA 2V3OH 3QN7A 4F4OC 1THRH 1MKWK 1DY8A 1V2NT 1ZSJA 1FN6A 2P16A 2QGRA 2XBWA 5A0AE 4CH2B 2C8WB 1UTQA 3SV2H 3K2UA 2CMYA 2ZGBH 2J34A 3TPIZ 2RG3A 1TNIA 4JZFH 1A61H 1J15A 1O31A 5AHGH 3TJVA 1O2GH 1OOKB 2OUAA 3AAUA 2WPMS 1ANBA 1FN8A 5FBEA 1FY5A 1A0JA 3BSQA 4A6LA 3GISB 1QBNA 3LU9B 4X2XA 1WV7H 4WH8A 1IQIA 3D65E 1IHTH 3O8BA 3KHVA 3RM2H 1NN6A 4YT7H 1NRRH 2Y5GA 1BA8B 4WXVA 3QTVH 3LGYA 3U1IB 1FDPA 1GL1A 2P94A 3ZZDA 2IN2A 3RXQA 1FI8A 1A3EH 1SSXA 1IQHA 2W26A 4YLQH 4WWYA 4IMQA 1AO5A 1YGCH 2JH0D 5A2MH 1SGPE 2B5TB 1Y5AT 2NU0E 3SQHE 2BVXH 3QGJA 5C2ZA 3SJ9A 5JB8S 2BLWA 1QTFA 3TJUA 3W94A 2F9UA 3HKJB 1MKWH 1LMWB 5GPIB 4ABIA 1TNLA 1G2MA 1P04A 5DP8A 5LPRA 4YESB 3RXDA 4UFFH 1ACBE 2STAE 1BCUH 2VVCA 3GY8A 1S83A 2PFEA 1GBDA 5F03A 2FOBA 3S7HB 1GHXH 1BBRK 2BZAA 1UJ1A 1TMUH 2G5NA 5AVDA 1IHSH 3ZVDA 2TGDA 4FXGH 4LZ4B 2XBVA 3K9XB 5EPNA 3RP2A 1BBRE 5LH8A 3KCGH 1A7SA 1TNGA 2ANKH 4O97A 1NROH 5DJ7A 1GMDG 1SLWB 2ZO3H 5HM9A 2ZFSA 1V2OT 1GBAA 1FV9A 2CGAA 4D9RA 1O35A 2J38A 4D9QA 1O3EA 1GHBG 1L2EA 1PPGE 3E8LA 1EXFA 1K9OE 4UONA 1GPZA 4MQAA 4ABFA 1INCA 3M7QA 1ANEA 3FZZA 4GUXA 4AX9H 2ODYB 7ESTE 4Q7XA 4AFSA 3RXPA 3RXIA 1GGDB 2B9LA 1KXFA 2BY6X 3SUDA 3S69A 1MH0A 1YKTA 4WMEA 2QAAA 2PW8H 4HGCA 1K1OA 2A32A 1FPCH 1W10U 4IC5A 2PR3A 2ZU1A 1E34B 1TX8A 1O3CA 3K65B 1MU6B 3BEIB 1V2TT 4MG3A 1FONA 5EOKA 1C5UA 2R9PA 4AYVB 2Z9KA 1F92A 1UTJA 2FM2A 2ZU4A 1IQNA 2W3KA 2WPIS 3R0FA 2Z3EA 1EOLA 1BBRH 3MO9A 5L2ZH 3FANA 3P70B 1O2YA 1YCPK 2J2UA 1V2QT 1QJ1B 1XXFA 1GHVH 2BQ7B 1Z8IB 3KIDU 1P03A 2CHAB 4YOJA 1SB1H 2A2QH 2BX4A 1DWDH 1MU8B 2OC8A 1S5SA 2P3TB 3S9AA 1S6HA 3T25A 4ZKSU 3SU5A 1FPHH 2BVSH 3RXJA 3URDA 1Z8RA 1EP5A 4K2YA 5A8ZA 4WF8A 4JYTA 4UFEH 3MNSA 3UFAA 2F9PA 1O2UA 1O34A 5DP6A 1WSSH 2FPZA 2WV4A 1A2CH 1GWAA 1V3XA 1UVUH 3ZVAA 1XUKA 2H6MA 2XC5A 3P92A 1MMJN 1SQOA 4BTTB 1KXEA 1TMTH 1G2LA 1BITA 1J9CH 1UVTH 3OTJE 3M5OA 2VH6A 1RXPA 1C5SA 2GV6A 2Y82A 3DD2H 5EQSA 1G9IE 2OC1A 5TCAA 1RFNA 2SFAA 3OSYA 1GI8B 2F3CE 1GVKB 1O3GA 1SOZA 3GY7A 1U6QA 1TRMA 2C3SA 2PV9B 4O03A 2ZIQH 3T28A 1GGDC 1KSNA 1P02A 2FO9A 2ZPQA 3UY9A 2CV3A 4FUFA 2VB0A 1O3KA 4BAMB 3RXFA 2VJ1A 1K1MA 1T4VH 1ESBA 1OSSA 1SGEE 4ZMAH 4OS5A 2QF0A 5PTPA 1SGFG 2O8TA 1GJ6A 2QN5T 3RXMA 2KAIA 5EG4A 1YCPH 4DJZB 1O2WA 1O2TA 1THPB 4NIXA 4DW2U 2A5IA 2ZWLH 1EZXC 1UK2A 5K7RA 3ZV9A 3ZVBA 4AN7A 4JZIA 3RC5A 1BDAA 3A83A 4OS1A 3TNSA 3RXRA 1CU1A 1AU8A 1BRUP 1UTPA 3SI3H 1VJAU 3MFJA 4D7FA 4Q2KA 1A46H 2ZFTA 1P2MA 1TFXA 2AEIH 2R2MB 2BZ6H 4SGBE 3BF6H 4I8GA 5EW1H 1WOFA 1WTHD 2PKSB 4I31A 2HRVA 1OXGA 1H8IH 3GY5A 4B2AA 1ZYOA 3BN9A 4KTUA 3I78A 4AGKA 5FCKA 3A8CA 5FAHA 5AF9H 4YO9A 1W2KH 5DP4A 2BQWB 4BNRA 1GBMA 1O3DA 1Z6EA 1AZZA 2ODPA 1DFPA 2BXTH 2QXHA 3F9FA 3S9CA 4UD9H 2WYJA 1GI7B 2UUFB 1H4WA 3LGUA 2VIVA 2SNVA 4YOIA 3RM0H 2TBSA 4WJG2 1DS2E 1HAVA 5J4QA 1C1RA 7LPRA 1QHRB 1AD8H 2B7DH 4INLA 1Y3XA 2AMDA 3MOCA 2FOHA 3PMHB 1EASA 3PLBA 5IDKA 2A0QB 5EODA 2BYAX 3SHCH 1MCTA 2A4QA 2ZFQH 1AWFH 2Z3CA 2ZGHA 2Y5HA 4DGJA 1SL3A 3RXHA 1J8AA 1KLTA 5T6FA 4MPVA 1H1BA 3UNRA 1Y5BT 2BLQA 1QIXB 3MH6A 1LDTT 1BUIA 2FOAA 2A2XH 3L3TA 1DLKB 2D1JA 2PUQH 2FX4A 2J92A 1OYQA 2FLRH 4BAQB 3MU8A 2ZDLA 1O2ZA 1GBFA 2A5AA 1XVOA 3PTNA 2H9HA 3BTME 4ZKRU 3BV9B 1NFYA 1UCYK 2PTNA 1W3CA 3A86A 2RA3A 4FVBA 4X6PA 2PKSC 3UTUH 1DY9A 3RXCA 3QK1A 1QJ6B 5JBAS 1C2DA 4MPUA 2NU3E 1C5MD 3E6PH 3ODFA 4Y0ZE 3RXGA 7KMEH 3GCHB 3PWBA 1BMLA 1XKAC 1ARCA 5EXMA 2BDAA 5E0GA 3PO1B 3PYHA 1YPMH 4ZH8A 1C2KA 2FP7B 3MTYA 3H7OA 3A7XA 1NY22 2VWNA 3UNSA 1ABJH 4CH8B 1QBOA 3M5NA 1WU1A 5ABWA 1YM0A 2QF3A 4BTUB 3LH1A 2XYAA 1OP8A 1TLDA 2WV5A 2G4TA 4MTBA 3MWIU 4NA8A 3TVJB 2A31A 2Z9GA 3RLWH 1QA0A 2XC4A 2OTVA 4UFGH 3UNQA 1G30B 4Y0YE 1C5QA 8GCHG 1UVSH 3VXFH 2QIQA 1K21H 4LK4A 1W8BH 4FUCA 4K5ZA 3BTKE 1WUNH 1AY6H 5JBBS 1RS0A 1GJ5H 3B8JA 2G4UA 1A5IA 5L30H 1GI9B 2BDHA 3ESTA 1LVMA 1UCYH 2ZC9H 1V2MT 1W7GH 2W7UA 1QB9A 3E3TA 3PMAB 1QURH 1MCVA 4X2WA 3GYMA 1IQJA 1O5BB 3A7ZA 2BD9A 5TCCA 1ELBA 3LGIA 5C67A 1O3AA 1UVPA 4X0WU 2JETC 3P8GA 4ABHA 1OWJA 2Y7ZA 1TGCA 1EAUA 3GCTG 3R3GB 5AFYH 4JZEH 1WAYB 4A1XA 2WPLS 1UTLM 2ZU3A 2ZPRA 1Z71A 3O8RA 5EXNA 1P8VC 4TWWA 1NU9A 4NFFA 1AQ7A 3ATWA 2Q6DA 1HCGA 4BXWA 3BEFB 2UWPA 2ZHWH 1ZHPA 3RMMH 3M3SA 2FZZA 2QXGA 2SGPE 1RD3B 1A1RA 2A7JA 2VIOA 1BJVA 3GCHC 5A8XA 5FPSA 2HNTE 1C5WB 1EPTB 5GDSH 2ZGJA 1OWKA 1TPSA 5DPAA 1DXPA 1IQFA 1HJ9A 4THNH 1V2LT 2D26C 3T2NA 8LPRA 4AYYB 4F49A 1G3CA 1SHYA 3C1KA 4O3UA 1ESTA 2R3UA 5BPEA 1BQYA 1MAYA 3A82A 3BIUH 5LGOA 2B0FA 1SGNE 1C5PA 2FYQA 1F5LA 1O39A 4HZHA 5ETXA 1NPMA 1ELFA 1WQVH 4Z0KA 4GSOA 2EI6A 1PPBH 1HYLA 4DIIH 3U1JB 1O5EH 4LZ1H 1QCPA 1QGFA 1ZLRA 1P01A 2F9OA 1YPJH 1CGJE 4FUJA 2RDLA 1SI5H 2JH5D 2SGFE 1IAUA 1O2NA 2D2DA 1V2WT 3F1SB 4PROA 3ZZ8A 1KLJH 2HWLB 1ESAA 3UQOA 1RIWC 1DDJA 3QWCH 4B74A 5A0BA 1O2LA 1NC6A 2A5KA 4JYUH 2GCTC 3EA7A 1NRQH 2BD8A 3P95A 4DOQA 2BDGA 5E2OA 4VGCB 5F6MA 1OX1A 3SNEA 1GBLA 2Y6TA 4FUEA 5GXPA 1Z6JH 1LO6A 4XSKU 1XUJA 1PPCE 1J17T 2ODQA 3LT3A 1JIMA 2ASUB 4MNWA 2G81E 2BDCA 1B7XB 1GI0A 3T27A 1Z8JB 3IITA 1IQMA 1ZHRA 3A84A 4D76A 2FOFA 1YPGH 1L1NA 2P95A 1ELVA 3RU4E 2WPJS 1AFQC 2OD3B 1TWXB 1EPTC 1IQLA 2I6QA 2PUXB 1ZPZA 1K1NA 5EXLA 1NESE 5T6GA 2BD5A 1F0RA 4DVAU 1NFXA 3UPEA 3TGJE 3P8NA 3QDZB 3F6UH 4NGAH 1X7AC 1C4V2 2TGAA 3TH2H 2XCFA 3GY3A 1E35B 4RKJB 3STIA 2ZGXH 1AB9B 2TIOA 1GHWH 4NSYA 4ASHA 4AZ2B 2P3UB 3JZ2B 1C1NA 3S7KB 2UWLA 2QXIA 1PPFE 3OX7U 3UOUA 1GJ4H 3LH3A 3GICB 3V7TA 3OYPA 5IYTA 4YOGA 1O3HA 4Z6AH 1VR1H 1GBBA 4WMDA 3MH4A 2ZZUH 1EB1H 1OPHB 1SGRE 1CHOG 4TWYA 1GCDA 1P9SA 4TPYA 1O38A 2AS9A 5C5OA 3ZZCA 1Z8GA 3NUMA 4I8JA 3TH3H 2BY9X 2BD4A 5JBTA 2BY7X 3TNTA 1VCPA 1HV7A 2WINI 1NM6A 2GZ7A 4ABBA 1BRAA 3A7WA 1O5AB 4TPIZ 1VCWA 1W0ZU 2H1UA 1D6RA 1LPGB 2TGTA 3SU3A 1GDQA 1LHDH 2A1DB 3A8BA 1ZMJA 3EE0B 3PLKA 4NIVA 3CENA 2G51A 1HAZB 1W13U 2C4FH 2VIDA 4B73A 1YLCA 1C2GA 1MTNC 1C1SA 1HAIH 2ZDVH 3A8DA 6GCHG 2Q6FA 4JK5A 3VPKA 1ETSH 1GMHG 2Y81A 1DANH 1O36A 4OGYA 5JB9S 2CN0H 3A89A 1HAHH 2LNCA 2Z7FE 4NFEA 5F8XA 5HXFA 2BD7A 4AGJA 1UMAH 4D7GA 1GMCG 1O2OA 1HXFH 1A4WH 1O2QA 1YCPM 2GDDA 1D3TB 9ESTA 5DKMA 1G36A 1G37A 4BTIB 4H6SB 1B0EA 3SBKA 1ELCA 1Z1JA 4IC6A 2PKAA 1M9UA 3MO6A 4XBBA 3ZV8A 2WUCA 3KL6A 3FZDA 1ANDA 1BTYA 1P3CA 4OS6A 1HAVB 1AB9C 4IW4E 2W5EA 1CVWH 1S6FA 5I46H 5TJXA 3ZZ6A 2GCHG 1WCZA 3RXAA 3HGNA 4B2BA 1MBMA 1CGHA 2ZDMA 3GY6A 1VITG 1TRNA 1UO6A 4A1TA 1GVLA 2C93B 5GIBA 3PWCA 5DP9A 2IPHA 1GDNA 4NIWA 3SUFA 1SGTA 2FOCA 3HK6B 1HIAA 4MVNA 3F9GA 5DG6A 1BIOA 5FPYA 2LPRA 1JRTA 3H5CB 3ZZ9A 2JKHA 3AW1A 1LQDB 3TJOA 4NWKA 3ZZ5A 2J94A 1T8MA 2FIRH 2R0KA 4Y79A 3VB7A 5EW2H 2VWLA 1YP9A 4GHQA 3I77A 2TPIZ 3EGKH 1ETRH 5JBCS 3PV4A 1UTOA 1AHTH 3E0PB 2GP9B 3DFJA 3QX5H 1S81A 1BTPA 2AIPA 8GCHF 1C5LH 1HXEH 1WYKA 4I8LA 3Q3KA 3BTDE 4K1SA 1SGQE 4FUIA 3SU1A 1BRBE 2C90B 1FQ3A 1FIZA 2O8MA 2VGCB 1GBCA 3L33A 4Y8XA 2K1QA 1Y3WA 3RXEA 1ORFA 1CA8B 3SHAH 1EZSC 1GI4A 1K2I1 2OP9A 1DSTA 1BZXE 1ZOMA 1E0FD 3SGQE 3M3VA 3SGBE 2AMPA 1L0ZA 3GCTF 2V3HH 1SC8U 1AMHA 3U69H 4AFUA 1SQAA 4GCHG 2VWOA 1L1GA 3BEUA 2HNTC 4MLFB 3UWIA 1YPHC 1TYNA 2FTLE 2AFQB 3E1XB 4CR9A 4K8BA 3VFEA 1XUHA 1QL9A 3ZZ7A 1YF4A 5FX6A 1B5GH 2GV7A 4IS5A 3B9FH 3U8OH 1TX7A 4AOQA 1Y8TA 3A7TA 1TGNA 3LPRA 1DE7H 4AB8A 1RGQA 1V2VT 1HPGA 2H5CA 1SPJA 3JZ1B 1ZSLA 1O3OA 1C5OH 1KXAA 1NRSH 1Q3XA 2OC7A 3D62A 1KDQB 4DCDA 3TGKE 2ZP0H 2Q1JA 1SVPA 1OWEA 1C5YB 4ABEA 1O3FA 2STBE 3FP6E 3LOXA 3V3MA 3EAJA 1KIGH 1S0QA 2AGIX 1QFKH 5CMXH 1C1TA 3A81A 3MH7A 1MQ6A 1KY9A 1QNJA 1MTSA 4KTSA 1C5RA 2ZDNA 1BHXB 2V0BA 1ELTA 2VGCC 1H9HE 1EATA 3F68H 3GYLB 1FZZA 2BY8X 3ZZ4A 4ABDA 1C1MA 4CHAB 2F9BH 2DE8A 2ZEBA 3OY6U 3RU4D 3TITA 2VH0A 1IQGA 2D8WA 1CHGA 1FIWA 2OBOA 3O8CA 1TPOA 2CHAC 5CHAB 5DK1A 5HYOA 1L1JA 1C5XB 2FTMA 1SR5C 4H4FA 2PGBB 1MTWA 3HATH 4AG1A 5CE1A 3M36A 1CQQA 1P11E 2C8ZB 5E2PA 1W12U 2YNBA 2Z9LA 3U98H 1O5GH 3BTQE 5FPTA 9LPRA 1BRCE 2ZI2H 3T26A 2BTCE 4ZKOU 2ZU5A 3M37A 2H2ZA 3GDUA 1FJSA 1GG6B 1K1PA 1RJXB 4X8SH 2GGVB 3TLOA 1S0RA 2XWBI 4A1VA 1AVWA 3SJKA 2WUBA 4R0IA 1QRZA 1MD7A 1C5TA 1ELEE 3BTTE 3GY2A 1DVAH 3HK3B 1TMBH 5LPEA 1SOTA 1CSOE 3BTWE 4RN6A 2UUKB 4I8KA 2RA0A 1XM1A 1A5GH 4J1YA 1TQ0B 2BOHB 3VXEH 1Q2WA 1T8NA 2BD3A 3SOSA 1QR3E 1D4PB 2XXLA 4X1QU 4FUGA 2R0LA 4I33A 1O3PB 1HJ8A 3ENSB 1P09A 1GBTA 1ELDE 2HLCA 4OS4A 3SUEA 3MU4A 2VIPA 4IGDA 1HAOH 3BG8A 4R8TB 4X6NA 1BTHH 4UE7H 5F8ZA 1CHOF 1HAGE 3KNXA 1C1VH 3SNBA 3RXSA 5J4SA 1P2QA 4DURA 4JZ1A 3NCLA 1V2JT 1LKAA 2ILNA 2YOLA 1HFDA 1C5VA 1GBJA 4I8HA 2FWWA 4CBNA 6CHAB 2HPPH 1QB6A 1E37B 1OP0A 4DG4A 1FY3A 4B76A 1C2LA 1EUFA 4YZUA 1MTVA 3MNBA 2J95A 2EC9H 5E8EH 1ANCA 3BTGE 1QRWA 2A4GA 2QA9E 3GDSA 4XBCA 5CHAC 2FLBH 1GJBB 2GTBA 3SW2B 6GCHF 1C1QA 1GMHF 2ZTXA 3UWJH 1GI6A 2PHBA 5EU8A 1CBWB 3EA9A 4MPWA 4Y7AA 8KME2 1GBHA 1O3MA 1GMCF 5EGMA 3SV7A 3S9BA 1BMNH 3UR6A 1T32A 4ISOA 4K69A 1XUFA 3NXPA 2BDYA 1XMNB 3ATLA 1D6WA 3CS0A 4CRDA 1T7CA 2ZECA 1ID5H 1JXPA 2Y7XA 4YTAA 1NFUA 1C2IA 1KXDA 1F0UA 2GCHF 2GT8A 2ANYA 1GJCB 2HNTF 1VITF 5FXLA 4YLUA 1BJUA 1EKBB 1QL8A 2ZGCA 3Q77A 4Y71A 1JMOH 1BOQA 5FX5A 1P2JA 1DLEA 5JDUB 4Q7ZA 2I6SA 2J4IA 4OS2A 1PJPA 2R2WU 5JPMH 3TK6A 3ZZAA 3MNCA 1XUGA 2ZNKH 1QY6A 2HALA 1AVXA 2PSYA 3C27B 4LOYH 1GI2A 1XVMA 2BXUH 1HJAB 1GJ8B 1L4ZA 4U30A 4O9VA 1JOUB 4K3JA 2PKAB 2GD4B 3MU1A 3M35A 2QC2A 2ZDKA 1YYY1 2UWOA 1GL0E 5JYIA 4WXIA 2RCEA 3KF2A 3ATKA 2ZKSA 2TRMA 5AFZH 1H9LB 1FAKH 1C5ZB 1PYTD 1TIOA 1P0SH 1SLUB 4UFDH 1JIRA 3UUZA 5FCRA 3M7UA
chains in the Genus database with same CATH superfamily
3ZYEA 5E0HA 1TPPA 4ISLA 2Z9JA 1LVYA 2PTCE 1YPLH 3SQEE 3TU7H 5FBIA 1G3BA 2FOEA 3ODDA 4IN2A 1TQ7B 5EIYA 1ETTH 2XWAA 1BTWA 1BMFD 1W14U 1D3DB 1ZPBA 5DSFA 3PO1C 4X2YA 3ZYDA 2SGDE 1YPKH 1ZMLA 1CGIE 4GLYA 1GBKA 1TOCB 4Q80A 2ZCHP 1HAYB 2AYWA 3OFND 2DE9A 2FOMB 1LHEH 2DUCA 1T8OA 2SNWA 2GJGA 1HIAB 3D49H 3NRLA 1SGFA 3SO3A 2UUYA 3DT0H 2C8YB 5KEDA 2VVVA 3SNDA 1V2UT 3SORA 4BAKB 1C2JA 4F55A 1EOJA 2ZU2A 3ATIA 3LIWA 1NTPA 5C20A 1E38B 1P57B 1MTUA 1PQ7A 4A5TS 4ZHLU 3ZZBA 4GCHF 4ZHMU 3P17H 2GMTB 2XW9A 4CR5A 4FVDA 3GOVB 5G4BA 4BANB 3QZQA 4ZUHA 2EI8A 3TGIE 1DITH 3MMGA 1EJAA 3FAOA 4NZLA 4WVPE 4Y8YA 3E16B 1ZTKA 2VIQA 3SU6A 1GHYH 1WTGH 3IG6B 3GY4A 1ZSKA 2A4RA 3OY5U 3SJOA 1BTXA 1KYNA 1NRPH 2GVFA 4Y10E 1TBZH 1TONA 2BB4A 2BHGA 4XE4A 1HJAC 1V2KT 2TGPZ 4XBDA 1HB0B 1CE5A 1VITH 1LPKB 3M5LA 2ZHDA 5GCHG 4LXBH 1K1IA 1P2NA 4A7IB 1TGSZ 1Y3YA 3LKWA 3CNRA 3FP8E 1DICA 2ZHEH 1SGIB 1CO7E 3Q3YA 3S0NA 3KQEA 1P2OA 2PSXA 4DT7B 1C9PA 2O9QA 1GCTB 3LONA 4HTCH 4KTCA 3VEQB 1MZDA 1BHXF 2W6ID 1O2KA 2ALPA 1S82A 3LGTA 1O3IA 1VCQA 2ZFFH 3TH4H 4BAOB 3TIUA 1JWTA 1LHFH 3A87A 4HFPB 3OE7D 2G5VA 1EAXA 4GAWA 2FX6A 3D23A 1P9UA 1UK4A 1RTLA 4Q7YA 3LC5A 4WMFA 1A0LA 4INKA 1COWD 1L4DA 3VB5A 1NO9H 2UUJB 1MAXA 1AE8H 1EAIA 1C4U2 2AERH 3G01A 3RU4T 3ZVFA 2VVUA 2AGEX 5C5NA 2XCNA 3H7TA 2AMQA 2GMTC 1QL7A 1MABB 4FUBA 4Y7BA 1KXCA 1EP6A 2XBYA 1N6YA 2KR7A 1HDTH 5A09A 1GHAG 2KAIB 2FI5E 1S84A 2P59A 2XTTB 1QQ4A 2BM2A 5DO4H 1SBWA 2PLXA 1DT2A 2FDAA 1CT4E 3PRBA 3OEED 1GVZA 2OBQA 1ZR0A 1N8OB 4JYVH 3QLPH 5T1VA 3U8RH 4VGCC 1C1PA 1C2MA 3GCNA 1D3QB 1A5HA 2NWNA 4ABJA 1EX3A 1D3PB 2PGQB 2O8WA 4CBOA 4X1NU 4ABAA 3KQDA 1O2RA 1G32B 1PQ5A 3NWUA 1GCTC 1TRYA 1OS8A 1V2PT 5F53A 4E06H 1W0YH 3BG4B 3E0NB 2F91A 2BDIA 5HGGA 3MU5A 1NS3A 1QQUA 3OAAD 3NKKA 5BRRE 5L6NH 2SGEE 4KP0A 3A7YA 1F5RA 1TOMH 1O5DH 3DFLA 3FOAA 3BTHE 1GHZA 4X2VA 1W7XH 2F9VA 2OLGA 1GI5A 3KGPA 4CRFA 2EA3A 5FHTA 3M7TA 5KECA 1MQ5A 2BLOA 2NU2E 1D9IA 2GKVE 4K1EA 1TAWA 2G55A 1TGTA 1ZJDA 3UOPA 2AHME 1A0HB 3SJ8A 1QRXA 1YLDA 1FY4A 3RMOH 4MNVA 2Z6BD 4Y76A 4NSVA 1K28D 2NU4E 4FETA 3Q3XA 1KLIH 3T62A 1ZTLA 5I25A 4BXSA 1H8DH 1SQTA 4GHTA 4FUDA 2FODA 1MKXK 4JMYA 4AFQA 3DHKH 1K1JA 4Y11E 4UDWH 2FS9A 2XNIA 1W11U 2XRCA 1EZUC 3PRDA 4FU7A 1DWEH 4NCYA 2GT7A 1AWHB 1EB2A 2PWXA 3RC4A 1GBEA 4X1RU 1TE0A 1TB6H 4XOJA 4GVUA 5EPYA 3UQVA 1EPTA 1N8OC 1TBRH 3MQKC 1AIXH 5A0CA 7GCHF 4E7RG 3SGAE 4NIYA 1O32A 2B8OH 1AUJA 4AB9A 1SFQB 5ESBA 4YM9A 1O2IA 1AUTC 3SZNA 4ZKNU 3ZZ3A 2A7HA 3EA8A 1JRSA 2JJ1D 3BG4C 3ZVGA 3KN2A 3ZIAD 2QYIA 2KZ4A 1ARBA 2A4OA 4ISHH 2VIWA 4SGAE 2A45B 4H6TA 5ESTE 3RUOA 4RI0A 3BTEE 1PQ8A 1J14A 2HGTH 3V0XA 1OP2A 3SU4A 4I7YH 1DXWA 1EAWA 5DP7A 1THSH 2J5UA 4AFZA 4MPXA 1P10A 3VG8A 1WXRA 1ZJKA 2ZTYA 3HPTB 1MKXH 2NU1E 2ZHFH 4K8YA 1P2KA 3MHWU 1GJDB 1Y5UT 1DSUA 1QJ7B 2HPQH 3NK8A 2W7SA 2CXVA 5T6DA 1UHBA 3KEEA 4M7GA 1RTKA 1TX6A 2Q6GA 1B0FA 3RLYH 2H9EH 2QCYA 4CRGA 1YBWA 2ZCLP 4BAHB 1DX5M 1SLXB 2F83A 1IQEA 1WDIA 1PFXC 3F2HA 3U8TH 1O5CB 1UTNA 1HAPH 2ZQ1A 1HLTH 3A7VA 3URCA 1DWCH 1O2SA 3LJJA 2YNAA 2A7CA 1BT7A 1ZRBA 4JK6A 1HGTH 1AKSA 3T5FH 2C8XB 1ELGA 6ESTA 2P8OB 1T4UH 1AN1E 3MI4A 1O2HA 1XUIA 3TK5A 5K0HA 3EE7A 4MNXA 4X8UH 4KGAA 2J97A 2QF5A 2FS8A 3KQBA 1SGYE 3Q76A 2W3IA 2O8LA 2ZFPH 5B6OA 1EJMA 2BDBA 1LHGH 1NT1A 1CA0B 3VB4A 1PPEE 3GDVA 4P02A 3CS7A 1VJ9U 1V2RT 1J16A 1O3JA 1UK3A 1T8LA 3F9EA 4O3TA 3W1EA 2EQNA 1UTMA 1QA7A 3SU2A 4ISIH 2VINA 1Z1IA 1NFWA 2CF8H 1FY8E 1F0TA 3TK9A 5C17A 1YLNA 3UIRA 1KTTB 3RXBA 1NRNH 2H9TH 1FY1A 5DP3A 3ELAH 5GCHF 4H42U 2FESH 1LHCH 4OS7A 3VGCB 3IWMA 4CRAA 3A80A 1N6XA 2ZHQH 1C9TA 5C3NA 1CT0E 4RSPA 1F5KU 1P12E 5E0JA 3RXKA 1QBVH 1K22H 2Y80A 1O2MA 1BMMH 2HVXA 1QZ8A 3QTOH 3DSOA 1C1WH 4FU8A 1KMHB 4X6MA 3A85A 4GPGA 3UR9A 4ASUD 1ZMNA 1TGBA 3QZRA 3V13A 1FUJA 5F8TA 1K1LA 2Y5FA 1VZQH 3AVZA 4ESTE 1AGJA 2Z3DA 2IOTA 1G3EA 8ESTE 1O37A 1Y3UA 2ZTZA 2PP6A 1V2ST 4X8TH 3LC3A 2JH6D 1O3LA 1GI1A 1O2VA 4Y8ZA 1LVOA 3U28C 3DUXH 2P8OC 4NG9H 1TNJA 1LQEA 3FVFB 1TABE 1TPAE 3L6PA 1GJ7B 2AGGX 4BOHA 5LPFA 4IN1A 1ZTJA 3VB3A 1AFEH 4B1TA 1SG8B 3NZIA 3K6YA 1C4Y2 1WBGB 3NPSA 3SUGA 1O5FH 2FI4E 3FP7E 1SFIA 1CA0C 3LGWA 2SGQE 1EJNA 3RDZA 4OM9A 1GHAF 3RXUA 2QY0B 2ZA5A 1AZ8A 1TALA 5DP5A 3T29A 1UVOA 2Z94A 2FI3E 1DOJA 1HRTH 4CHAC 1XKBC 1EQ9A 3SNAA 2OC0A 4WH6A 4INHA 3AW0A 4FU9A 3EQ0H 2GX4A 1O30A 4J2YB 1F0SA 1OWDA 3QO6A 3PMBB 1DPOA 3VGCC 5GWZA 3AK5A 1SMFE 4MDSA 4X6OA 5DGJA 4HI3A 2ZDAH 5HIZA 3SU0A 3MH5A 1PPHE 2XC0A 1CT2E 4ZXYH 3GCOA 3OU0A 4ISNA 3KYFA 4I32A 4ZAEA 5C1XA 3PLPA 2JETB 2LP6A 1S6LA 4U32A 3RXOA 1LKBA 2FOGA 1FXYA 2V35A 1TA2A 4FUHA 1PPZA 2OXSA 2ZQ2A 2HOBA 1GG6C 4TY6A 3MYWA 4KELA 1UCYE 4B2CA 3M5MA 1Y3VA 2OQ5A 1GBIA 2KX4A 2HVYB 1OWHA 2WZQA 1MZAA 3HGPA 2XBXA 3AASA 3UB0A 3V12A 3MU0A 2EEKA 2VWMA 3PB1E 3SN8A 2WPKS 7GCHG 4K1TA 3W95A 2R3YA 3ATMA 3LDXH 2P93A 2GZ9A 3PTBA 3QGNB 3GS9A 1IOEA 2SGAA 3A8AA 4ZXXH 1C2FA 1HUTH 2ZG0H 4D8NA 4XDEA 1YWUA 2WYGA 3P8FA 4AG2A 1C1OA 1C2EA 5HM2A 1SGDE 4K60A 4WY3A 1G3DA 2BD2A 2ZPSA 2WV9A 3KQCA 4X8VH 3ZVCA 2ALVA 1O3BA 2V3MA 2JDID 3P8OA 1TNKA 1Y59T 4OGXA 4RT1A 1YPEH 2W6JD 2OCVB 6CHAC 1NU7B 1BTZA 1SHHB 6LPRA 3FFGA 5SGAE 4DIHH 1GJAB 1AE5A 2KCOA 1XXDA 2ZFRH 1KXBA 1DUEA 3E91A 2FEQH 4DY7B 3PM3A 1GMDF 1VGCB 3RXTA 2BVRH 1C1UH 1P06A 1SGCA 1F7ZA 2ANMH 2AH4X 2J98A 2BX3A 3EYDA 1HAXB 4TYDA 2OINA 4TSFD 1GHBF 2M5TA 5C1UA 1FAXA 1RIWB 3DA9B 5GJ4B 5EQRA 1BTUA 1CBWC 1GDUA 2AIQA 2GCTB 2QV1A 3EDXB 4NA9H 2V6NA 1KDQA 2BQ6B 4E05H 3WW7A 1ZHMA 2KM0A 1N1LA 1P05A 2KCYA 3LGVA 1PYTC 2THFB 4X1PU 3PMJA 4UEHH 5A8YA 3E90B 2BY5X 2F43B 4ZROA 1E36B 4CREA 4ZCNA 1S85A 1TBQH 1F2SE 3PROA 4B75A 4CRCA 2CF9H 1KTSB 1O3NA 1DUAA 4RKOB 1P2IA 3ITIA 2G8TA 5EQQA 3BIVH 4YT6H 3K6ZA 1AFQB 3F9HA 2FXRA 1C5NH 1HBTH 2EI7A 4IBLH 4ZHAA 3RXLA 3WY8A 1YPHE 2H5DA 1QB1A 3SJIA 4FOUC 1FMGA 2ZF0H 3TJNA 1O0DH 3ZVEA 1A3BH 2IJOB 1JBUH 1FLEE 1DM4B 3STJA 3SV6A 1FNIA 3SI4H 3A88A 1AI8H 1NZQH 3CP7A 3I29A 2VU8E 2ZCKP 5FL7D 2BLVA 2F4LA 1E1RD 1AVGH 1Q31A 2ESTE 3B23B 3OTPA 1OKXA 4NA7A 4B6FA 3LJOA 3MNXA 1PQAA 3RXVA 1O33A 2WPHS 1LVBA 1WQSA 3P6ZB 1LCYA 4XFQA 1ZRKA 4X1SU 1EZQA 1NBME 1ZGIA 1P3EA 1ZGVA 4QT8C 3SNCA 4Y6DA 3MO3A 3RMLH 1VGCC 2K8IA 2CJIA 3SV9A 3AAVA 2GDEH 4ABGA 1UTKA 2G00A 2BMGB 5H4IB 2ULLA 4E7NA 1TNHA 2ANWA 1IQKA 1H9IE 1MD8A 2Z9IA 3HKIB 2FYRA 3RMNH 1MUEB 4B71A 4A92A 3VB6A 1GI3A 3RC6A 1O2XA 1TA6A 1ZPCA 1UHBB 2P3FH 2QF4A 3M61U 4MNYA 4NZQA 4RT0A 1T31A 1BMAA 1MTNB 3SV8A 1MBQA 1YC0A 1DWBH 4U2WA 2QXJA 1O2JA 2GZ8A 1GJ9B 3N7OA 1C2HA 2F9NA 4NWLA 4KKDA 3O8DA 2BOKA 3QUMP 1XX9A 1Z7KA 1V6DA 3Q00A 1SLVB 5T3HA 4IMZA 5CHBA 5L2YH 3UREA 1RRKA 1O2PA 1ABIH 1OYTH 2VNTA 2KCPA 3M3TA 5HMAA 1LPZB 4TY7A 1AKSB 4JZDH 1ZZZA 2J9NA 1ELAA 1LTOA 1OWIA 1HNEE 4U01A 3BTFE 4JCNA 2OK5A 2G52A 2FMJA 2O8UA 4CRBA 3U9AH 5C1YA 1BB0B 1RTFB 4AORA 2OQUA 2V3OH 3QN7A 4F4OC 1THRH 1MKWK 1DY8A 1V2NT 1ZSJA 1FN6A 2P16A 2QGRA 2XBWA 5A0AE 4CH2B 2C8WB 1UTQA 3SV2H 3K2UA 2CMYA 2ZGBH 2J34A 3TPIZ 2RG3A 1TNIA 4JZFH 1A61H 1J15A 1O31A 5AHGH 3TJVA 1O2GH 3F2FA 1OOKB 2OUAA 3AAUA 2WPMS 1ANBA 1FN8A 5FBEA 1FY5A 1A0JA 3BSQA 5C0UA 4A6LA 3GISB 1QBNA 3LU9B 4X2XA 1WV7H 4WH8A 1IQIA 3D65E 1IHTH 3O8BA 3KHVA 3RM2H 1NN6A 4YT7H 1NRRH 4B6EA 2Y5GA 1OHHD 1BA8B 4WXVA 3QTVH 3LGYA 5EJZA 3U1IB 1FDPA 1GL1A 2P94A 3ZZDA 1FX0B 2IN2A 3RXQA 1FI8A 1A3EH 1SSXA 1IQHA 2W26A 4YLQH 4WWYA 4IMQA 1AO5A 1YGCH 2JH0D 5A2MH 1SGPE 2B5TB 3FKSD 1Y5AT 2NU0E 3SQHE 2BVXH 3QGJA 4Q4LA 5C2ZA 3SJ9A 5JB8S 2BLWA 1QTFA 3TJUA 3W94A 2F9UA 3HKJB 2WPDD 1H8HD 1MKWH 1LMWB 5GPIB 4ABIA 1TNLA 1G2MA 1P04A 5DP8A 5LPRA 3FN8A 4YESB 3RXDA 4UFFH 1ACBE 2STAE 1BCUH 2VVCA 3GY8A 1S83A 2PFEA 1GBDA 4F48B 5F03A 2FOBA 4HG6A 3S7HB 1GHXH 1BBRK 2BZAA 1UJ1A 1TMUH 2G5NA 5AVDA 1IHSH 3ZVDA 2TGDA 4FXGH 4LZ4B 2XBVA 3K9XB 5EPNA 3RP2A 1BBRE 5LH8A 3KCGH 1A7SA 1TNGA 2ANKH 4O97A 1NROH 5DJ7A 1GMDG 1SLWB 2ZO3H 5HM9A 2ZFSA 1V2OT 1GBAA 1FV9A 2CGAA 4D9RA 4DT4A 1O35A 2J38A 4D9QA 1O3EA 1GHBG 1L2EA 1PPGE 3E8LA 1EXFA 1K9OE 4UONA 1GPZA 4MQAA 4ABFA 1INCA 3M7QA 1ANEA 3FZZA 3F0PA 5GNDA 4GUXA 4AX9H 2ODYB 7ESTE 4Q7XA 4AFSA 3RXPA 3RXIA 1GGDB 2B9LA 1KXFA 2BY6X 2M2AA 3SUDA 3S69A 1MH0A 1YKTA 4WMEA 2QAAA 2PW8H 4HGCA 1K1OA 2A32A 1FPCH 1W10U 4IC5A 2PR3A 2ZU1A 1E34B 1TX8A 1O3CA 3K65B 1MU6B 3BEIB 1V2TT 4MG3A 1FONA 5EOKA 1C5UA 2R9PA 4AYVB 2Z9KA 1F92A 1UTJA 2FM2A 2ZU4A 1IQNA 2W3KA 2WPIS 3R0FA 2Z3EA 1EOLA 1BBRH 3MO9A 5L2ZH 3FANA 3P70B 1O2YA 1YCPK 2J2UA 1V2QT 1QJ1B 1XXFA 1GHVH 2BQ7B 1Z8IB 3KIDU 1P03A 2CHAB 4YOJA 1SB1H 2A2QH 2BX4A 1DWDH 1MU8B 1W0JD 2OC8A 1S5SA 2P3TB 3S9AA 3F2GA 1S6HA 3T25A 4ZKSU 3SU5A 1FPHH 3KYGA 2BVSH 3RXJA 3URDA 1Z8RA 1EP5A 4K2YA 5A8ZA 4WF8A 4JYTA 4UFEH 3MNSA 3UFAA 2F9PA 1O2UA 1O34A 5DP6A 1WSSH 2FPZA 2WV4A 1A2CH 1GWAA 1V3XA 1UVUH 3ZVAA 1XUKA 2H6MA 2XC5A 3P92A 1MMJN 1SQOA 2IPQX 4BTTB 1KXEA 1TMTH 1G2LA 1BITA 1J9CH 1UVTH 2RFKC 3OTJE 3M5OA 2VH6A 1RXPA 1C5SA 2J98B 2GV6A 2Y82A 3DD2H 5EQSA 1G9IE 2OC1A 5TCAA 1RFNA 2SFAA 3OSYA 1GI8B 2F3CE 1GVKB 1O3GA 1SOZA 3GY7A 1U6QA 1TRMA 2C3SA 2PV9B 4O03A 2ZIQH 3T28A 1GGDC 1KSNA 1P02A 2FO9A 2ZPQA 3UY9A 2CV3A 4FUFA 2VB0A 1O3KA 4BAMB 3RXFA 2VJ1A 1K1MA 1T4VH 2XOKD 1ESBA 1OSSA 1SGEE 4ZMAH 4OS5A 2QF0A 5PTPA 1SGFG 2O8TA 1GJ6A 2QN5T 3RXMA 2KAIA 5EG4A 1YCPH 4DJZB 2JJ2D 1O2WA 1O2TA 1THPB 3F3BA 4NIXA 4DW2U 2A5IA 2ZWLH 1EZXC 1UK2A 5K7RA 3ZV9A 3ZVBA 4AN7A 4JZIA 3RC5A 1BDAA 3A83A 4OS1A 3TNSA 3RXRA 1CU1A 1AU8A 1BRUP 4Z1MD 1UTPA 3SI3H 1VJAU 2HLDD 3MFJA 1K0HA 4D7FA 4Q2KA 1A46H 2ZFTA 1P2MA 1TFXA 2AEIH 2R2MB 2BZ6H 4SGBE 3BF6H 4I8GA 5EW1H 1WOFA 1WTHD 2PKSB 4I31A 2HRVA 1OXGA 1H8IH 3GY5A 4YXWD 4B2AA 1ZYOA 2XNDD 3BN9A 3I78A 4KTUA 4AGKA 5FCKA 1W0KD 3A8CA 5FAHA 5AF9H 4YO9A 1W2KH 5DP4A 2BQWB 4BNRA 1SKYE 1GBMA 1O3DA 1Z6EA 1AZZA 2JIZD 2ODPA 2L74A 1DFPA 2BXTH 2QXHA 3F9FA 3S9CA 4UD9H 2WYJA 1GI7B 2UUFB 1H4WA 3LGUA 2VIVA 2SNVA 3DSPA 4YOIA 3RM0H 2TBSA 4WJG2 5IK2D 1DS2E 1HAVA 5J4QA 1C1RA 7LPRA 1QHRB 1AD8H 2B7DH 4INLA 1Y3XA 2AMDA 3MOCA 2FOHA 3PMHB 1EASA 3PLBA 5IDKA 2A0QB 5EODA 2BYAX 3SHCH 1MCTA 2A4QA 2ZFQH 3N7EA 1AWFH 2Z3CA 2ZGHA 2Y5HA 4Q63A 4DGJA 1SL3A 3RXHA 1J8AA 1KLTA 5T6FA 4MPVA 1H1BA 3UNRA 1Y5BT 2BLQA 1QIXB 3MH6A 1LDTT 1BUIA 2FOAA 2A2XH 3L3TA 1DLKB 2D1JA 2PUQH 4M9FA 2FX4A 2J92A 1OYQA 2FLRH 4BAQB 3MU8A 2ZDLA 1O2ZA 1GBFA 2A5AA 1XVOA 4ACAA 3PTNA 3KQ5A 2H9HA 3BTME 4ZKRU 3BV9B 1NFYA 1UCYK 2PTNA 1W3CA 3A86A 2RA3A 4FVBA 4X6PA 2RDEA 2PKSC 3UTUH 1DY9A 3RXCA 3QK1A 1QJ6B 5JBAS 1C2DA 4MPUA 2NU3E 1C5MD 3E6PH 3ODFA 4Y0ZE 3RXGA 2EY4C 7KMEH 3GCHB 3PV2A 3PWBA 2IJD1 1BMLA 1XKAC 1ARCA 5EXMA 2BDAA 5E0GA 3PO1B 3PYHA 1YPMH 4ZH8A 1C2KA 2FP7B 3MTYA 3H7OA 3A7XA 1NY22 2VWNA 3UNSA 1ABJH 4CH8B 1QBOA 3M5NA 1WU1A 5ABWA 1YM0A 2QF3A 4BTUB 3LH1A 2XYAA 1OP8A 1TLDA 2WV5A 2G4TA 4MTBA 3MWIU 4NA8A 3TVJB 1YY3A 2A31A 2Z9GA 3RLWH 1QA0A 2XC4A 2OTVA 4UFGH 3UNQA 1G30B 4Y0YE 1C5QA 8GCHG 1UVSH 3VXFH 2QIQA 1K21H 4LK4A 1W8BH 4FUCA 4K5ZA 3BTKE 1WUNH 1AY6H 5JBBS 1RS0A 1GJ5H 3B8JA 2G4UA 1A5IA 5L30H 1GI9B 2BDHA 3ESTA 1LVMA 1UCYH 2ZC9H 1V2MT 1W7GH 2W7UA 1QB9A 3E3TA 3PMAB 1QURH 1MCVA 4X2WA 3GYMA 1IQJA 1O5BB 3A7ZA 2BD9A 5TCCA 1ELBA 3LGIA 5C67A 1O3AA 1UVPA 4X0WU 2JETC 3OEHD 3P8GA 4ABHA 1OWJA 2Y7ZA 1TGCA 1EAUA 3GCTG 3R3GB 5AFYH 4JZEH 1WAYB 4A1XA 2WPLS 1UTLM 2ZU3A 2ZPRA 1Z71A 3O8RA 5EXNA 4ACBA 1P8VC 3PV5A 1NU9A 4NFFA 4TWWA 1AQ7A 3ATWA 2Q6DA 1HCGA 4BXWA 3BEFB 2CK3D 2UWPA 2ZHWH 1ZHPA 3RMMH 3M3SA 2FZZA 2QXGA 2SGPE 1RD3B 1A1RA 2A7JA 2VIOA 1BJVA 3GCHC 5A8XA 5FPSA 2HNTE 1C5WB 1EPTB 5GDSH 2ZGJA 1OWKA 1TPSA 5DPAA 1DXPA 1IQFA 1HJ9A 4THNH 1V2LT 2D26C 3T2NA 8LPRA 4AYYB 4F49A 1G3CA 1SHYA 1EFRD 3C1KA 4O3UA 1ESTA 2R3UA 5BPEA 1BQYA 1MAYA 3A82A 3BIUH 5LGOA 2B0FA 1SGNE 3N7DA 1C5PA 2FYQA 1F5LA 1O39A 4HZHA 5ETXA 1NPMA 1ELFA 1WQVH 4Z0KA 4GSOA 2EI6A 1PPBH 1HYLA 4DIIH 3U1JB 1O5EH 4LZ1H 1QCPA 1QGFA 1ZLRA 1P01A 2F9OA 1YPJH 1CGJE 4FUJA 2WHXA 2RDLA 1SI5H 2JH5D 2SGFE 1IAUA 1O2NA 2D2DA 1V2WT 3F1SB 4PROA 3ZZ8A 1KLJH 2HWLB 1ESAA 3UQOA 1RIWC 5HKKD 1DDJA 3QWCH 4B74A 5A0BA 1O2LA 1NC6A 2A5KA 4JYUH 2GCTC 3EA7A 1NRQH 2BD8A 3P95A 4DOQA 2BDGA 5E2OA 4VGCB 5F6MA 1OX1A 3SNEA 1GBLA 2Y6TA 4FUEA 5GXPA 1Z6JH 1LO6A 4XSKU 1XUJA 1PPCE 1J17T 2ODQA 3LT3A 1JIMA 2ASUB 4MNWA 2G81E 2BDCA 1B7XB 1GI0A 3T27A 1Z8JB 3IITA 3WWBA 1IQMA 1ZHRA 3A84A 4D76A 2FOFA 1YPGH 1L1NA 2P95A 1ELVA 3RU4E 2WPJS 1AFQC 2OD3B 1TWXB 1EPTC 1IQLA 2I6QA 2PUXB 1ZPZA 1K1NA 5EXLA 1NESE 5T6GA 2BD5A 1F0RA 2KFWA 4DVAU 1NFXA 2L6OA 3UPEA 2VBCA 3TGJE 3P8NA 3QDZB 3F6UH 3WWFA 4NGAH 1X7AC 1C4V2 2TGAA 3TH2H 2XCFA 3GY3A 1E35B 4RKJB 2YMSB 3STIA 2ZGXH 1AB9B 2TIOA 1GHWH 4NSYA 4ASHA 4AZ2B 2P3UB 3JZ2B 1C1NA 4P00A 3S7KB 2UWLA 2QXIA 1PPFE 3OX7U 3UOUA 1GJ4H 3LH3A 3GICB 3V7TA 3OYPA 5IYTA 4YOGA 1O3HA 4Z6AH 1VR1H 1GBBA 4WMDA 3MH4A 2ZZUH 1EB1H 1OPHB 1SGRE 1CHOG 4TWYA 1GCDA 1P9SA 4TPYA 1O38A 2AS9A 5C5OA 3ZZCA 1Z8GA 3NUMA 4I8JA 3TH3H 2BY9X 2BD4A 5JBTA 2BY7X 3TNTA 1VCPA 1HV7A 2WINI 1NM6A 2GZ7A 4ABBA 1BRAA 3A7WA 1O5AB 4TPIZ 1VCWA 1W0ZU 2H1UA 1D6RA 1LPGB 2TGTA 3SU3A 1GDQA 1LHDH 2A1DB 3A8BA 1ZMJA 3EE0B 3PLKA 4NIVA 3CENA 2G51A 1HAZB 1W13U 2C4FH 2VIDA 4B73A 1YLCA 1C2GA 1MTNC 1C1SA 1HAIH 2ZDVH 3A8DA 6GCHG 2Q6FA 4JK5A 3VPKA 1ETSH 1GMHG 2Y81A 1DANH 1O36A 4OGYA 5JB9S 2CN0H 3A89A 1HAHH 2LNCA 2Z7FE 4NFEA 5F8XA 5HXFA 2BD7A 4AGJA 1UMAH 4D7GA 1GMCG 1O2OA 1HXFH 1A4WH 1O2QA 1YCPM 2YMSD 2GDDA 1D3TB 9ESTA 5DKMA 1G36A 1G37A 4BTIB 4H6SB 1B0EA 3SBKA 1ELCA 1E1QD 1Z1JA 4IC6A 2PKAA 1M9UA 3MO6A 4XBBA 3ZV8A 2V7QD 2WUCA 3KL6A 3FZDA 1ANDA 2YMSC 1BTYA 1P3CA 4OS6A 1HAVB 1UW7A 1AB9C 4IW4E 2W5EA 1CVWH 1S6FA 5I46H 5TJXA 3UAIC 3ZZ6A 2GCHG 1WCZA 2LELA 3RXAA 3HGNA 4B2BA 1MBMA 1CGHA 2ZDMA 3GY6A 1VITG 1TRNA 5EJLA 3SZEA 1UO6A 4A1TA 1GVLA 2C93B 5GIBA 3PWCA 5DP9A 1VKYA 2IPHA 1GDNA 4NIWA 3SUFA 1SGTA 2FOCA 3HK6B 1HIAA 5C94A 4MVNA 3F9GA 5DG6A 1BIOA 5FPYA 4TT3D 2LPRA 1JRTA 3H5CB 3ZZ9A 2JKHA 3AW1A 1LQDB 3TJOA 4NWKA 3ZZ5A 2J94A 1T8MA 2FIRH 2R0KA 4Y79A 3VB7A 5EW2H 2VWLA 1YP9A 4GHQA 3I77A 2TPIZ 3EGKH 1ETRH 5JBCS 3PV4A 1UTOA 1AHTH 3E0PB 2GP9B 3DFJA 1E79D 3QX5H 1S81A 1BTPA 2AIPA 8GCHF 3H09A 1C5LH 1HXEH 1WYKA 3F0OA 4I8LA 3Q3KA 3BTDE 4K1SA 1SGQE 4FUIA 3SU1A 1BRBE 2C90B 1FQ3A 1FIZA 2O8MA 2VGCB 1GBCA 3L33A 4Y8XA 5C0TA 2K1QA 1Y3WA 3RXEA 1ORFA 3FO8D 1CA8B 3SHAH 1EZSC 1GI4A 1K2I1 2OP9A 1DSTA 1BZXE 1ZOMA 3N99A 1E0FD 3SGQE 3M3VA 3SGBE 2AMPA 1L0ZA 3GCTF 2V3HH 1SC8U 1AMHA 3U69H 4AFUA 1SQAA 4GCHG 2VWOA 1L1GA 3BEUA 2HNTC 4MLFB 3UWIA 1YPHC 1TYNA 2FTLE 2AFQB 3E1XB 4CR9A 4K8BA 3VFEA 1XUHA 4XRNA 1QL9A 3ZZ7A 1YF4A 5FX6A 1B5GH 2GV7A 4IS5A 3B9FH 3U8OH 1TX7A 4AOQA 1Y8TA 3A7TA 1TGNA 3LPRA 1NBMD 1DE7H 4AB8A 1RGQA 1V2VT 1HPGA 2H5CA 1SPJA 3JZ1B 5EJ1A 1ZSLA 1O3OA 1C5OH 1KXAA 1NRSH 1Q3XA 2OC7A 3D62A 1KDQB 4DCDA 3TGKE 2ZP0H 2Q1JA 1SVPA 1OWEA 1C5YB 4ABEA 1O3FA 2STBE 3FP6E 3LOXA 3V3MA 3EAJA 1KIGH 1S0QA 2AGIX 1QFKH 5CMXH 1C1TA 3A81A 3MH7A 1MQ6A 1KY9A 1QNJA 1MTSA 4KTSA 1C5RA 2ZDNA 1BHXB 2V0BA 1ELTA 2VGCC 1H9HE 1EATA 3F68H 3GYLB 1FZZA 2BY8X 3ZZ4A 4ABDA 1C1MA 4CHAB 2F9BH 2DE8A 2ZEBA 3OY6U 3RU4D 3TITA 2VH0A 1IQGA 2D8WA 1CHGA 1FIWA 2OBOA 3O8CA 1TPOA 2CHAC 5CHAB 5DK1A 5HYOA 4AC9A 1L1JA 1C5XB 2FTMA 1SR5C 4H4FA 2PGBB 1MTWA 3HATH 4AG1A 5CE1A 3M36A 1CQQA 1P11E 2C8ZB 5E2PA 1W12U 2YNBA 2Z9LA 3U98H 1O5GH 3BTQE 4XD7D 5FPTA 9LPRA 1BRCE 2QE7D 2ZI2H 3T26A 2KCAA 2BTCE 4ZKOU 2ZU5A 3M37A 2H2ZA 3GDUA 1FJSA 1GG6B 1K1PA 1RJXB 4X8SH 2GGVB 3TLOA 3DCLA 1S0RA 3DSGA 2XWBI 4A1VA 1AVWA 3SJKA 2WUBA 4R0IA 1QRZA 1MD7A 1H8ED 1C5TA 1ELEE 3BTTE 3GY2A 1DVAH 3HK3B 1TMBH 5LPEA 1SOTA 1CSOE 3BTWE 4RN6A 2UUKB 4I8KA 2RA0A 1XM1A 1A5GH 4J1YA 1TQ0B 2BOHB 3VXEH 1Q2WA 1T8NA 2BD3A 3SOSA 1QR3E 1D4PB 2XXLA 4X1QU 4FUGA 2R0LA 4I33A 1O3PB 5CDFE 1HJ8A 3ENSB 1P09A 1GBTA 1ELDE 2HLCA 4OS4A 3SUEA 3MU4A 2VIPA 4IGDA 1HAOH 3BG8A 4R8TB 4X6NA 1BTHH 4UE7H 5F8ZA 1CHOF 1HAGE 2K0QA 3KNXA 1C1VH 3SNBA 3RXSA 5J4SA 1P2QA 4DURA 4JZ1A 3NCLA 1V2JT 5B6LA 1LKAA 2ILNA 2YOLA 5HIYA 1HFDA 1C5VA 1GBJA 4I8HA 2FWWA 4CBNA 6CHAB 2HPPH 1QB6A 1E37B 1OP0A 4DG4A 1FY3A 4B76A 1C2LA 1EUFA 4YZUA 1MTVA 3MNBA 2J95A 2EC9H 5E8EH 1ANCA 3BTGE 1QRWA 2A4GA 2QA9E 3GDSA 4XBCA 5DN6D 5CHAC 2FLBH 1GJBB 2GTBA 3SW2B 6GCHF 1C1QA 1GMHF 2ZTXA 3UWJH 1GI6A 2PHBA 5EU8A 1CBWB 3EA9A 4MPWA 4Y7AA 8KME2 1GBHA 1O3MA 4I86A 1GMCF 1SQRA 5EGMA 3SV7A 3S9BA 1BMNH 2WSSD 3UR6A 1T32A 4ISOA 4K69A 1XUFA 3NXPA 2BDYA 1XMNB 3ATLA 1D6WA 3CS0A 4CRDA 1T7CA 2ZECA 1ID5H 1JXPA 2Y7XA 4YTAA 1NFUA 1C2IA 1KXDA 1F0UA 2GCHF 2GT8A 2ANYA 1GJCB 2HNTF 1VITF 5FXLA 4YLUA 1BJUA 3SYJA 1EKBB 1QL8A 2ZGCA 3Q77A 4Y71A 1JMOH 1BOQA 5FX5A 1P2JA 1DLEA 5JDUB 4Q7ZA 2I6SA 2J4IA 4OS2A 1PJPA 2R2WU 5JPMH 3TK6A 3ZZAA 3MNCA 1XUGA 2ZNKH 1QY6A 2HALA 1AVXA 2PSYA 3C27B 4LOYH 1GI2A 5KGOA 1XVMA 2BXUH 1HJAB 1GJ8B 1L4ZA 4U30A 4O9VA 1JOUB 4K3JA 2PKAB 2GD4B 3MU1A 3M35A 2QC2A 2ZDKA 1YYY1 2UWOA 1GL0E 5JYIA 4WXIA 2RCEA 3KF2A 3ATKA 2ZKSA 2TRMA 5AFZH 1H9LB 1FAKH 1C5ZB 1PYTD 1TIOA 1P0SH 1SLUB 4UFDH 1JIRA 3UUZA 5FCRA 3M7UA
chains in the Genus database with same CATH topology
3ZYEA 5E0HA 1TPPA 4ISLA 2Z9JA 1LVYA 2PTCE 1YPLH 3SQEE 3TU7H 5FBIA 1G3BA 2FOEA 3ODDA 4IN2A 1TQ7B 1ETTH 2XWAA 1BTWA 1W14U 1D3DB 1ZPBA 3PO1C 4X2YA 3ZYDA 2SGDE 1YPKH 1ZMLA 1CGIE 4GLYA 1GBKA 1TOCB 4Q80A 2ZCHP 1HAYB 2AYWA 2DE9A 2FOMB 1LHEH 2DUCA 1T8OA 2SNWA 1HIAB 3D49H 1SGFA 3SO3A 2UUYA 3DT0H 2C8YB 2VVVA 3SNDA 1V2UT 3SORA 4BAKB 1C2JA 1EOJA 2ZU2A 3ATIA 3LIWA 1NTPA 5C20A 1E38B 1P57B 1MTUA 1PQ7A 4A5TS 4ZHLU 3ZZBA 4GCHF 4ZHMU 3P17H 2GMTB 2XW9A 4CR5A 4FVDA 3GOVB 5G4BA 4BANB 3QZQA 4ZUHA 2EI8A 3TGIE 1DITH 3MMGA 1EJAA 3FAOA 4NZLA 4WVPE 4Y8YA 3E16B 1ZTKA 2VIQA 3SU6A 1GHYH 1WTGH 3IG6B 3GY4A 1ZSKA 2A4RA 3OY5U 3SJOA 1BTXA 1KYNA 1NRPH 2GVFA 4Y10E 1TBZH 1TONA 2BB4A 2BHGA 4XE4A 1HJAC 1V2KT 2TGPZ 4XBDA 1HB0B 1CE5A 1VITH 1LPKB 3M5LA 2ZHDA 5GCHG 4LXBH 1K1IA 1P2NA 4A7IB 1TGSZ 1Y3YA 3LKWA 3FP8E 1DICA 2ZHEH 1SGIB 1CO7E 3Q3YA 3S0NA 3KQEA 1P2OA 2PSXA 4DT7B 1C9PA 2O9QA 1GCTB 3LONA 4HTCH 4KTCA 3VEQB 1MZDA 1BHXF 1O2KA 2ALPA 1S82A 3LGTA 1O3IA 1VCQA 2ZFFH 3TH4H 4BAOB 3TIUA 1JWTA 1LHFH 3A87A 4HFPB 2G5VA 1EAXA 4GAWA 2FX6A 3D23A 1P9UA 1UK4A 1RTLA 4Q7YA 3LC5A 4WMFA 1A0LA 4INKA 1L4DA 3VB5A 1NO9H 2UUJB 1MAXA 1AE8H 1EAIA 1C4U2 2AERH 3G01A 3RU4T 3ZVFA 2VVUA 2AGEX 5C5NA 2XCNA 3H7TA 2AMQA 2GMTC 1QL7A 4FUBA 4Y7BA 1KXCA 1EP6A 2XBYA 1N6YA 1HDTH 5A09A 1GHAG 2KAIB 2FI5E 1S84A 2P59A 2XTTB 1QQ4A 2BM2A 5DO4H 1SBWA 2PLXA 1DT2A 2FDAA 1CT4E 1GVZA 2OBQA 1ZR0A 1N8OB 4JYVH 3QLPH 3U8RH 4VGCC 1C1PA 1C2MA 3GCNA 1D3QB 1A5HA 2NWNA 4ABJA 1EX3A 1D3PB 2PGQB 2O8WA 4CBOA 4X1NU 4ABAA 3KQDA 1O2RA 1G32B 1PQ5A 3NWUA 1GCTC 1TRYA 1OS8A 1V2PT 4E06H 1W0YH 3BG4B 3E0NB 2F91A 2BDIA 5HGGA 3MU5A 1NS3A 1QQUA 3NKKA 5BRRE 5L6NH 2SGEE 4KP0A 3A7YA 1F5RA 1TOMH 1O5DH 3DFLA 3BTHE 1GHZA 4X2VA 1W7XH 2F9VA 2OLGA 1GI5A 3KGPA 4CRFA 2EA3A 5FHTA 3M7TA 1MQ5A 2BLOA 2NU2E 1D9IA 2GKVE 4K1EA 1TAWA 2G55A 1TGTA 1ZJDA 3UOPA 1A0HB 3SJ8A 1QRXA 1YLDA 1FY4A 3RMOH 4MNVA 2Z6BD 4Y76A 4NSVA 1K28D 2NU4E 3Q3XA 1KLIH 3T62A 1ZTLA 5I25A 4BXSA 1H8DH 1SQTA 4GHTA 4FUDA 2FODA 1MKXK 4JMYA 4AFQA 3DHKH 1K1JA 4Y11E 4UDWH 2FS9A 2XNIA 1W11U 2XRCA 1EZUC 4FU7A 4NCYA 1DWEH 2GT7A 1AWHB 1EB2A 2PWXA 3RC4A 1GBEA 4X1RU 1TE0A 1TB6H 4XOJA 4GVUA 5EPYA 3UQVA 1EPTA 1N8OC 1TBRH 1AIXH 5A0CA 7GCHF 4E7RG 3SGAE 4NIYA 1O32A 2B8OH 1AUJA 4AB9A 1SFQB 5ESBA 4YM9A 1O2IA 1AUTC 3SZNA 4ZKNU 3ZZ3A 2A7HA 3EA8A 1JRSA 3BG4C 3ZVGA 3KN2A 2QYIA 1ARBA 2A4OA 4ISHH 2VIWA 4SGAE 2A45B 4H6TA 5ESTE 3RUOA 3BTEE 1PQ8A 1J14A 2HGTH 3V0XA 1OP2A 3SU4A 4I7YH 1DXWA 1EAWA 5DP7A 1THSH 4AFZA 4MPXA 1P10A 1ZJKA 2ZTYA 3HPTB 1MKXH 2NU1E 2ZHFH 4K8YA 1P2KA 3MHWU 1GJDB 1Y5UT 1DSUA 1QJ7B 2HPQH 3NK8A 2W7SA 2CXVA 5T6DA 1UHBA 3KEEA 4M7GA 1RTKA 1TX6A 2Q6GA 1B0FA 3RLYH 2H9EH 2QCYA 4CRGA 1YBWA 2ZCLP 4BAHB 1DX5M 1SLXB 2F83A 1IQEA 1PFXC 3U8TH 1O5CB 1UTNA 1HAPH 2ZQ1A 1HLTH 3A7VA 3URCA 1DWCH 1O2SA 3LJJA 2YNAA 2A7CA 1BT7A 1ZRBA 4JK6A 1HGTH 1AKSA 3T5FH 2C8XB 1ELGA 6ESTA 2P8OB 1T4UH 1AN1E 3MI4A 1O2HA 1XUIA 3TK5A 5K0HA 4MNXA 4X8UH 4KGAA 2FS8A 3KQBA 1SGYE 3Q76A 2W3IA 2O8LA 2ZFPH 5B6OA 1EJMA 2BDBA 1LHGH 1NT1A 1CA0B 3VB4A 1PPEE 3GDVA 3CS7A 1VJ9U 1V2RT 1J16A 1O3JA 1UK3A 1T8LA 3F9EA 4O3TA 1UTMA 1QA7A 3SU2A 4ISIH 2VINA 1Z1IA 1NFWA 2CF8H 1FY8E 1F0TA 3TK9A 3UIRA 1KTTB 3RXBA 1NRNH 2H9TH 1FY1A 5DP3A 3ELAH 5GCHF 4H42U 2FESH 1LHCH 4OS7A 3VGCB 3IWMA 4CRAA 3A80A 1N6XA 2ZHQH 1C9TA 5C3NA 1CT0E 4RSPA 1F5KU 1P12E 5E0JA 3RXKA 1QBVH 1K22H 2Y80A 1O2MA 1BMMH 2HVXA 3QTOH 1C1WH 4FU8A 4X6MA 3A85A 4GPGA 3UR9A 1ZMNA 1TGBA 3QZRA 3V13A 1FUJA 5F8TA 1K1LA 2Y5FA 1VZQH 3AVZA 4ESTE 1AGJA 2Z3DA 2IOTA 1G3EA 8ESTE 1O37A 1Y3UA 2ZTZA 1V2ST 4X8TH 3LC3A 2JH6D 1O3LA 1GI1A 1O2VA 4Y8ZA 1LVOA 3DUXH 2P8OC 4NG9H 1TNJA 1LQEA 3FVFB 1TABE 1TPAE 3L6PA 1GJ7B 2AGGX 4BOHA 5LPFA 4IN1A 1ZTJA 3VB3A 1AFEH 4B1TA 1SG8B 3NZIA 3K6YA 1C4Y2 1WBGB 3NPSA 3SUGA 1O5FH 2FI4E 3FP7E 1SFIA 1CA0C 3LGWA 2SGQE 1EJNA 3RDZA 1GHAF 3RXUA 2QY0B 2ZA5A 1AZ8A 1TALA 5DP5A 3T29A 1UVOA 2Z94A 2FI3E 1DOJA 1HRTH 4CHAC 1XKBC 1EQ9A 3SNAA 2OC0A 4WH6A 4INHA 3AW0A 4FU9A 3EQ0H 2GX4A 1O30A 4J2YB 1F0SA 1OWDA 3QO6A 3PMBB 1DPOA 3VGCC 5GWZA 1SMFE 4MDSA 4X6OA 5DGJA 4HI3A 2ZDAH 3SU0A 3MH5A 1PPHE 2XC0A 1CT2E 4ZXYH 3GCOA 3OU0A 4ISNA 4I32A 4ZAEA 5C1XA 3PLPA 2JETB 4U32A 3RXOA 1LKBA 2FOGA 1FXYA 2V35A 1TA2A 4FUHA 1PPZA 2OXSA 2ZQ2A 2HOBA 1GG6C 4TY6A 3MYWA 4KELA 1UCYE 4B2CA 3M5MA 1Y3VA 2OQ5A 1GBIA 1OWHA 3HGPA 1MZAA 2XBXA 3AASA 3V12A 3MU0A 2EEKA 2VWMA 3PB1E 3SN8A 2WPKS 7GCHG 4K1TA 3W95A 2R3YA 3ATMA 3LDXH 2P93A 2GZ9A 3PTBA 3QGNB 1IOEA 2SGAA 3A8AA 4ZXXH 1C2FA 1HUTH 2ZG0H 4D8NA 4XDEA 2WYGA 3P8FA 4AG2A 1C1OA 1C2EA 5HM2A 1SGDE 4K60A 4WY3A 1G3DA 2BD2A 2ZPSA 3KQCA 4X8VH 3ZVCA 2ALVA 1O3BA 3P8OA 1TNKA 1Y59T 4OGXA 1YPEH 2OCVB 6CHAC 1NU7B 1BTZA 1SHHB 6LPRA 3FFGA 5SGAE 4DIHH 1GJAB 1AE5A 1XXDA 2ZFRH 1KXBA 1DUEA 3E91A 2FEQH 4DY7B 3PM3A 1GMDF 1VGCB 3RXTA 2BVRH 1C1UH 1P06A 1SGCA 1F7ZA 2ANMH 2AH4X 2BX3A 3EYDA 1HAXB 4TYDA 2OINA 1GHBF 2M5TA 5C1UA 1FAXA 1RIWB 3DA9B 5GJ4B 5EQRA 1BTUA 1CBWC 1GDUA 2AIQA 2GCTB 2QV1A 3EDXB 4NA9H 2V6NA 1KDQA 2BQ6B 4E05H 1ZHMA 1N1LA 1P05A 3LGVA 1PYTC 2THFB 4X1PU 3PMJA 4UEHH 5A8YA 3E90B 2BY5X 4ZROA 1E36B 4CREA 1S85A 1TBQH 1F2SE 3PROA 4B75A 4CRCA 2CF9H 1KTSB 1O3NA 1DUAA 4RKOB 1P2IA 3ITIA 2G8TA 5EQQA 3BIVH 4YT6H 3K6ZA 1AFQB 3F9HA 2FXRA 1C5NH 1HBTH 2EI7A 4IBLH 4ZHAA 3RXLA 3WY8A 1YPHE 2H5DA 1QB1A 3SJIA 1FMGA 2ZF0H 3TJNA 1O0DH 3ZVEA 1A3BH 2IJOB 1JBUH 1FLEE 1DM4B 3STJA 3SV6A 1FNIA 3SI4H 3A88A 1AI8H 1NZQH 3CP7A 3I29A 2VU8E 2ZCKP 2BLVA 1AVGH 2ESTE 1Q31A 3B23B 1OKXA 4NA7A 3LJOA 3MNXA 1PQAA 3RXVA 1O33A 2WPHS 1LVBA 1WQSA 3P6ZB 1LCYA 4XFQA 1ZRKA 4X1SU 1EZQA 1ZGIA 1P3EA 1ZGVA 4QT8C 3SNCA 4Y6DA 3MO3A 3RMLH 1VGCC 2CJIA 3SV9A 3AAVA 2GDEH 4ABGA 1UTKA 2G00A 2BMGB 5H4IB 2ULLA 4E7NA 1TNHA 2ANWA 1IQKA 1H9IE 1MD8A 2Z9IA 3HKIB 2FYRA 3RMNH 1MUEB 4B71A 4A92A 3VB6A 1GI3A 3RC6A 1O2XA 1TA6A 1ZPCA 1UHBB 2P3FH 3M61U 4MNYA 4NZQA 1T31A 1BMAA 1MTNB 3SV8A 1MBQA 1YC0A 1DWBH 4U2WA 2QXJA 1O2JA 2GZ8A 1GJ9B 3N7OA 1C2HA 2F9NA 4NWLA 4KKDA 3O8DA 2BOKA 3QUMP 1XX9A 1Z7KA 1V6DA 3Q00A 1SLVB 5T3HA 4IMZA 5L2YH 3UREA 1RRKA 1O2PA 1ABIH 1OYTH 2VNTA 3M3TA 5HMAA 1LPZB 4TY7A 1AKSB 4JZDH 1ZZZA 2J9NA 1ELAA 1LTOA 1OWIA 1HNEE 4U01A 3BTFE 4JCNA 2G52A 2FMJA 2O8UA 4CRBA 3U9AH 5C1YA 1BB0B 1RTFB 4AORA 2OQUA 2V3OH 3QN7A 4F4OC 1THRH 1MKWK 1DY8A 1V2NT 1ZSJA 1FN6A 2P16A 2QGRA 2XBWA 5A0AE 4CH2B 2C8WB 1UTQA 3SV2H 3K2UA 2CMYA 2ZGBH 2J34A 3TPIZ 2RG3A 1TNIA 4JZFH 1A61H 1J15A 1O31A 5AHGH 3TJVA 1O2GH 1OOKB 2OUAA 3AAUA 2WPMS 1ANBA 1FN8A 5FBEA 1FY5A 1A0JA 3BSQA 4A6LA 3GISB 1QBNA 3LU9B 4X2XA 1WV7H 4WH8A 1IQIA 3D65E 1IHTH 3O8BA 3KHVA 3RM2H 1NN6A 4YT7H 1NRRH 2Y5GA 1BA8B 4WXVA 3QTVH 3LGYA 3U1IB 1FDPA 1GL1A 2P94A 3ZZDA 2IN2A 3RXQA 1FI8A 1A3EH 1SSXA 1IQHA 2W26A 4YLQH 4WWYA 4IMQA 1AO5A 1YGCH 2JH0D 5A2MH 1SGPE 2B5TB 1Y5AT 2NU0E 3SQHE 2BVXH 3QGJA 5C2ZA 3SJ9A 5JB8S 2BLWA 1QTFA 3TJUA 3W94A 2F9UA 3HKJB 1MKWH 1LMWB 5GPIB 4ABIA 1TNLA 1G2MA 1P04A 5DP8A 5LPRA 4YESB 3RXDA 4UFFH 1ACBE 2STAE 1BCUH 2VVCA 3GY8A 1S83A 2PFEA 1GBDA 5F03A 2FOBA 3S7HB 1GHXH 1BBRK 2BZAA 1UJ1A 1TMUH 2G5NA 5AVDA 1IHSH 3ZVDA 2TGDA 4FXGH 4LZ4B 2XBVA 3K9XB 5EPNA 3RP2A 1BBRE 5LH8A 3KCGH 1A7SA 1TNGA 2ANKH 4O97A 1NROH 5DJ7A 1GMDG 1SLWB 2ZO3H 5HM9A 2ZFSA 1V2OT 1GBAA 1FV9A 2CGAA 4D9RA 1O35A 2J38A 4D9QA 1O3EA 1GHBG 1L2EA 1PPGE 3E8LA 1EXFA 1K9OE 4UONA 1GPZA 4MQAA 4ABFA 1INCA 3M7QA 1ANEA 3FZZA 4GUXA 4AX9H 2ODYB 7ESTE 4Q7XA 4AFSA 3RXPA 3RXIA 1GGDB 2B9LA 1KXFA 2BY6X 3SUDA 3S69A 1MH0A 1YKTA 4WMEA 2QAAA 2PW8H 4HGCA 1K1OA 2A32A 1FPCH 1W10U 4IC5A 2PR3A 2ZU1A 1E34B 1TX8A 1O3CA 3K65B 1MU6B 3BEIB 1V2TT 4MG3A 1FONA 5EOKA 1C5UA 2R9PA 4AYVB 2Z9KA 1F92A 1UTJA 2FM2A 2ZU4A 1IQNA 2W3KA 2WPIS 3R0FA 2Z3EA 1EOLA 1BBRH 3MO9A 5L2ZH 3FANA 3P70B 1O2YA 1YCPK 2J2UA 1V2QT 1QJ1B 1XXFA 1GHVH 2BQ7B 1Z8IB 3KIDU 1P03A 2CHAB 4YOJA 1SB1H 2A2QH 2BX4A 1DWDH 1MU8B 2OC8A 1S5SA 2P3TB 3S9AA 1S6HA 3T25A 4ZKSU 3SU5A 1FPHH 2BVSH 3RXJA 3URDA 1Z8RA 1EP5A 4K2YA 5A8ZA 4WF8A 4JYTA 4UFEH 3MNSA 3UFAA 2F9PA 1O2UA 1O34A 5DP6A