1GBBA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by ala complex with methoxysuccinyl-ala-ala-pro-alanine boronic acid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGANVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 52
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbbA01
2A5KA 4MDSA 1AKSB 4D9QA 1F0SA 1GDUA 4RKJB 4FXGH 4X8TH 1NFWA 4BAQB 2STBE 1CGIE 1P57B 4X1QU 4IW4E 1OKXA 5EW1H 1CE5A 3SBKA 3RU4E 1O5GH 1G30B 1BMLA 2GT8A 1C2EA 1D9IA 2R2MB 1WU1A 2FOHA 1GI4A 1K1OA 1SGFA 1SHHB 2Z6BD 2ZC9H 1C4Y2 2A4GA 3I29A 1D6WA 1O3OA 1XXDA 4NIWA 1C5XB 2Z9GA 1W7GH 5HYOA 1DE7H 2P8OC 3EA9A 4JZDH 2W7SA 5FCRA 5DG6A 5DGJA 1SMFE 3MTYA 3UUZA 1HRTH 1C1UH 4TWYA 4WH6A 3TVJB 2D1JA 4IN1A 3T28A 2BD5A 5GDSH 3SU0A 1C2FA 4GAWA 1DLEA 3U8TH 4AFQA 4Q7XA 1TPPA 4Y0ZE 1XVOA 3H7OA 2H5DA 4RKOB 3M35A 1MCTA 3K6YA 5C20A 2PGBB 4Y79A 1DUAA 1C2LA 1EJAA 3FP8E 1C5UA 2FI3E 3TJUA 1Z8JB 2A7JA 4D7FA 3RMOH 3U1JB 5JBBS 2FO9A 3PMAB 1ABIH 4F4OC 3M5MA 3AW0A 4UDWH 5EQSA 4MNWA 3TK9A 4AG1A 3TJVA 1S84A 4DIHH 1NRSH 2Q6DA 2PV9B 4FVDA 2Q6FA 2G4UA 5I25A 2ZI2H 4VGCB 1HB0B 4DW2U 1J16A 1A0JA 1KTTB 4XDEA 3BG8A 1C5VA 4CR5A 1AVXA 1FN8A 4OS6A 3BTME 3KGPA 3VEQB 4X1PU 1C5QA 2BDGA 3P8FA 3SZNA 2FMJA 1PJPA 1NU7B 2ZDKA 1XUIA 1C5ZB 2VIWA 4ZMAH 2FLRH 1V2UT 3QDZB 4ZAEA 1J15A 3BTFE 4H6SB 1TQ7B 5JBTA 2CMYA 3MHWU 4K2YA 1EJNA 1GBKA 3DUXH 4DG4A 2YNBA 1TGSZ 2SGQE 1KDQB 5FX5A 1LVOA 5GCHG 3NZIA 1ANBA 2EI8A 2O8TA 3A7TA 4INKA 1X7AC 1BRAA 1TNJA 3BTTE 3HKJB 4GPGA 1NS3A 3PWBA 5FXLA 1S83A 3S7KB 1Y3WA 1P11E 1GCTC 1MTSA 1LPKB 1YPHC 2R0LA 3PMJA 2PKSB 4XBDA 4FUBA 1HAXB 4THNH 1A5IA 1DT2A 1RJXB 3P8NA 1GBFA 1QJ6B 1K22H 3S9CA 3GCTF 3B9FH 2OINA 5EQRA 3RM2H 3KEEA 2J2UA 2ALVA 1NU9A 3A81A 4BTUB 1O3HA 2EEKA 2EA3A 3A84A 3MH4A 5DPAA 1SSXA 2BLWA 5DO4H 1SVPA 2G5VA 1P2JA 1MBQA 1PQAA 4TPIZ 4I8HA 3RXEA 1O2IA 1K28D 2HNTF 2CJIA 3QZQA 1O35A 1IQEA 4CRAA 3PM3A 1O5EH 2Z94A 3GY3A 2A0QB 1A2CH 2BD4A 2SNVA 4FUGA 3SV8A 2GV7A 4DVAU 1UHBB 3GYLB 3VB7A 2P3UB 3SU6A 4JZIA 1EPTB 1W0ZU 2GD4B 4DJZB 1FJSA 2Y82A 1B5GH 1BITA 1ZTLA 3VGCB 3MFJA 1TGTA 1Z6EA 2NU3E 4FUDA 2CGAA 2XWAA 1QBOA 1OWEA 2FESH 2VB0A 1T7CA 1UJ1A 1UK2A 3MU8A 3U8RH 4CRCA 2JETB 3TNTA 2A32A 1TIOA 1O30A 1C5SA 1EZXC 2R9PA 1TBQH 4A6LA 1C1PA 2SGPE 4A7IB 1ELGA 1AFQB 1WTGH 2PKAB 1SB1H 1LO6A 1BRUP 1P9SA 1TX6A 4NWKA 5DP5A 1Y8TA 2BY6X 3RXLA 4OS7A 1A7SA 3SNEA 1LHCH 4ZXXH 1QL7A 1TA6A 1DX5M 4AGJA 2FDAA 1NRNH 1QQ4A 5J4SA 2FI5E 1O3FA 1T4UH 3F9GA 1JRSA 5ESBA 2C90B 3LGVA 4BTIB 2GTBA 2TGDA 1Z7KA 3GCNA 5CHAC 1KXBA 1RTKA 2FTMA 1SQOA 1T32A 1F5LA 2V6NA 5JB8S 1EAXA 1BMMH 3LPRA 2QIQA 5C67A 4CBOA 4FVBA 1EOJA 1J17T 2TGTA 2R3YA 8KME2 3A80A 2FS9A 4QT8C 3K6ZA 4UFGH 1V2VT 2VIPA 4O03A 3RC4A 1UVTH 2FX6A 1RRKA 2A4RA 2H9EH 4UONA 5HMAA 1C2IA 1LVYA 4SGAE 2R2WU 1AUTC 1QURH 4IGDA 4LXBH 1O37A 1ZZZA 3RXOA 2Q1JA 4MNVA 2QN5T 3TGKE 1MTUA 1Y3UA 1FZZA 3OX7U 4LK4A 1H8IH 1O5BB 3KQEA 1IQIA 5B6OA 2GKVE 1FY1A 4ZHMU 1VZQH 1O2NA 2FOMB 5A0AE 1UCYE 2WUCA 1TGBA 1YP9A 1XXFA 4BAOB 5EU8A 3VGCC 2KAIB 1JBUH 1TWXB 3STJA 5BRRE 1FY4A 7LPRA 4YTAA 1XX9A 3P92A 4AN7A 2XCNA 2W5EA 4JYUH 1YPGH 4YZUA 1O3MA 1CU1A 3UIRA 1BJVA 5EXLA 3FZDA 1GJBB 1NESE 3VB4A 2ILNA 1HNEE 2QAAA 3UFAA 1SOTA 4O3UA 5DKMA 4CH8B 4ISLA 4J2YB 1Z8IB 2J92A 2PTNA 1QCPA 2BY8X 2AFQB 4KKDA 2ODYB 4TY7A 1AB9B 1O2JA 1O32A 4JZ1A 1JIRA 5ABWA 4D76A 3SQEE 2D26C 1SLXB 5DP3A 2ZHFH 3NUMA 3P8GA 1XUHA 3V13A 5AVDA 6ESTA 2F9UA 3R0FA 3V12A 4U2WA 3ELAH 1OWKA 3VB3A 2GMTB 2VWLA 3GY6A 1AZ8A 1GJ4H 3L3TA 1TQ0B 1L0ZA 1ELFA 4BXWA 1BBRK 1GMHF 3PV4A 2B0FA 5PTPA 1MQ5A 3FP7E 3A83A 2QXIA 2FIRH 2YNAA 3UY9A 3RXSA 5E0HA 3BTQE 2P59A 3TIUA 1F7ZA 3TITA 4X8SH 1MKWH 3ZZCA 2EI6A 1TALA 1IQGA 2OQ5A 3SGQE 1B0EA 4FU9A 3EDXB 2ZG0H 1DPOA 1VCPA 3PTBA 4K1EA 2FS8A 3VFEA 3S9BA 1TYNA 2H9TH 1FY3A 5FBIA 3MU4A 2F91A 3GICB 2ZECA 3O8RA 2G5NA 5HXFA 4Y10E 1C5WB 3F68H 6CHAB 4ABIA 1MKXK 3RXFA 1SGNE 1KTSB 1LHEH 4WMEA 1CGHA 2GV6A 4MPUA 3M61U 4Z6AH 1VITG 1HCGA 1NC6A 4DURA 4GHTA 1C5RA 1O3EA 1NRRH 1UO6A 3U98H 1XM1A 1DWBH 3UPEA 1A46H 2PW8H 1BBRE 1G36A 1B7XB 1XUFA 1EAUA 1CA8B 3SI3H 3M3SA 1ZJDA 1CT4E 1ZPBA 2XYAA 3RXRA 1GHXH 1UTMA 1E36B 1GHZA 1K9OE 9ESTA 4WF8A 3UR6A 3BTEE 1QL9A 4K1TA 1P3CA 2ZIQH 1QB1A 4FUHA 1W8BH 1GHVH 1O2SA 3FFGA 1AHTH 3GY4A 1E35B 4MPXA 3SJIA 3T27A 4UFDH 2F9PA 2XXLA 2J38A 1UTOA 1BRCE 4ESTE 5FAHA 1NZQH 1YPKH 4KELA 3S69A 1D3PB 3EAJA 3OU0A 2BDAA 2VVCA 1IAUA 4E06H 2B9LA 1IQNA 2BVRH 2ZU1A 1ELAA 1TBZH 1SBWA 1C2MA 4B73A 1F2SE 2D2DA 4H42U 1KY9A 2BQWB 1QGFA 1YPEH 1P2KA 2ZFFH 3SU4A 2WYJA 2GCHG 1BT7A 1NO9H 4TY6A 2H6MA 3QO6A 4OGXA 4AGKA 3RLWH 1TOCB 4JYVH 2GX4A 3RXMA 1VJAU 2PWXA 3U8OH 2ZGHA 5FX6A 2XTTB 1GI5A 2HPPH 1PPBH 1SI5H 1ZJKA 2P95A 1DFPA 2V3HH 2STAE 2JETC 1QR3E 3BEFB 2B8OH 1CBWB 1TX7A 1FUJA 1SFQB 3G01A 5A0CA 3OYPA 1C5YB 1DWCH 1QBVH 4IC5A 4Q7ZA 1O2PA 3H5CB 3QUMP 4Y7BA 3W95A 4O97A 2OQUA 3V7TA 3SJ9A 3SU1A 2ZQ2A 3TNSA 1P09A 1VITF 1IQFA 3ATIA 1UTLM 1GHAG 4MPWA 1SGIB 2O8UA 4CREA 2F3CE 5AFZH 1YLCA 1AWHB 4Y71A 1SQAA 6LPRA 1ANCA 1S6HA 1N6XA 1ELEE 2PR3A 1HXEH 1ACBE 3F9HA 3ZZ4A 1TPOA 1F5RA 5A8XA 1ZOMA 2FOBA 3RMMH 2QXHA 4HTCH 3BTHE 5G4BA 2GDEH 1K1JA 4X8UH 1C2GA 2A4OA 4ABJA 3OY6U 4Y8YA 1IOEA 3T62A 1C5OH 4NIXA 4F49A 1Y3XA 1ZSJA 2GGVB 2XBXA 3ITIA 3AAUA 5DP9A 1LQDB 2BD8A 1DY9A 2ZHDA 2W26A 4X1SU 1A0LA 1GBMA 3N7OA 1UCYH 1V2TT 2HNTE 1TOMH 1P2MA 1TB6H 2ZGJA 1YCPM 3A8DA 5A2MH 1HJ8A 1AWFH 5JPMH 5EGMA 2A4QA 2P3TB 1ARCA 1AZZA 3M7TA 4A1TA 3IG6B 3M3VA 3Q3KA 3KNXA 1TFXA 4NFFA 4U32A 1M9UA 4I32A 6CHAC 5EPNA 4E7RG 5DP8A 5L6NH 1S81A 1HJAC 3GCTG 1BMAA 1ZR0A 4ZKRU 1GMDG 1UVPA 1AFEH 4JZFH 1GG6B 4Q7YA 3S0NA 1W11U 1MD8A 1B0FA 3RXUA 3VB6A 2BLOA 4HFPB 3ZZ6A 4CRDA 1FXYA 1HAZB 3RXQA 2P3FH 3UNRA 1RS0A 3QK1A 1DUEA 1FY8E 4AFZA 1HGTH 1AE5A 2V3OH 3QTVH 4FUIA 3ZVAA 1C2DA 1GVLA 1ELTA 2ZGCA 2JKHA 5F03A 1G2LA 3C1KA 3ZZ3A 2G00A 2QCYA 1V2OT 4XBBA 2VIQA 4O9VA 1EP5A 1CHGA 4JCNA 1WV7H 1HAHH 1Y3YA 1HAGE 3LGTA 2H9HA 2ZKSA 1E0FD 3D62A 3SJOA 4KTCA 4I7YH 1OWJA 2Y80A 3HK6B 3SUDA 4UE7H 2ZPRA 4Y76A 1W2KH 2HWLB 2BVSH 1EJMA 1C2KA 3IWMA 3ZYEA 5JB9S 3L6PA 3LH1A 1P0SH 1K21H 2SGAA 3RUOA 1Q31A 1GCTB 1P12E 1HYLA 1A3EH 1BTHH 1LVMA 4ASHA 3SV6A 4U30A 5EQQA 3BG4C 2ANKH 3EYDA 4M7GA 1HJ9A 2AMQA 1C5LH 3IITA 1W0YH 2WPMS 3URCA 4XOJA 2ZA5A 5F8ZA 1RIWB 3K9XB 1GBDA 3MNBA 1BCUH 1EB1H 5TJXA 1GHBF 1HUTH 1UK4A 4LOYH 2ZWLH 1TGNA 2C93B 3ATMA 4YLQH 1S82A 3BN9A 2C3SA 3LOXA 1RTFB 2AERH 4AYYB 1BDAA 4ZKSU 3ENSB 3SGBE 3M5LA 5F8TA 1GL1A 1OYTH 1T4VH 1BTYA 1TNLA 3FAOA 3LH3A 1MZAA 2WINI 3ZZ9A 2BLVA 4ISNA 7KMEH 3UNQA 2BD3A 1L2EA 3ZVGA 1HJAB 3RXBA 1O2UA 1ZSLA 2ZHWH 3SHAH 2AGGX 3F9EA 1A5GH 2RCEA 1V2NT 1BJUA 2BDBA 3NCLA 5T6FA 4ZXYH 1D3DB 1N8OB 2G8TA 1QFKH 2TGPZ 2GCHF 4KP0A 1CBWC 1GBBA 1DITH 3RU4T 2AIPA 2PTCE 1DS2E 2NU0E 1WQVH 1W13U 2UUFB 4GCHF 1CSOE 4PROA 3JZ2B 2ULLA 2BD7A 2DUCA 5AHGH 1YCPH 2HALA 3RXPA 4K3JA 1QIXB 1RFNA 2R0KA 3CS0A 4SGBE 5JBCS 2BZ6H 3R3GB 2BMGB 2F9OA 1O5AB 3PO1C 1BTPA 1D6RA 1HLTH 5E0JA 3M7UA 5L2YH 2AYWA 1KLTA 1AVWA 1MD7A 1RGQA 3SOSA 3QN7A 3ZZ8A 1P9UA 1FAXA 5T6GA 1O3NA 2ESTE 2BYAX 5J4QA 5JYIA 2PKSC 1O34A 2FTLE 3RXKA 2QF3A 3HGNA 1P03A 1ZSKA 3GYMA 4K1SA 4RSPA 1C2JA 3BIUH 3T25A 2OC1A 1CQQA 5H4IB 2WPLS 1SGCA 4OS5A 1YGCH 2BQ7B 4Y8ZA 2IN2A 4I8GA 2WUBA 2ZF0H 1SLUB 1QRWA 1HAYB 2ZU2A 3TGIE 2BX4A 1C9PA 2GCTB 2Q6GA 3PYHA 1VJ9U 2ZFSA 1DWDH 2ALPA 1KIGH 1O36A 4NIVA 1O2LA 1W10U 5FPYA 1MH0A 1OP0A 4UD9H 2J94A 1O3GA 1W14U 2SNWA 3UWIA 4ZHLU 1UTJA 1Y59T 4IMQA 3RM0H 3HGPA 2VVUA 1GGDB 4X6OA 1O3JA 4AFUA 3Q00A 4D9RA 3SUGA 1LVBA 1O3BA 1O2OA 2J95A 2HPQH 2C8WB 3ZVDA 1EXFA 3MH7A 2NWNA 1KLIH 4KTSA 1O3LA 5A09A 1QB6A 4MG3A 4AOQA 4CR9A 4HI3A 1CT0E 3NWUA 5LH8A 3LGIA 3A82A 2V0BA 4AORA 3LJJA 2XCFA 5K0HA 2QC2A 3E3TA 1EATA 1VGCC 2BXTH 1D3QB 3SNBA 5T3HA 3E90B 4LZ1H 1O2HA 1IHSH 2ASUB 2DE9A 1GBLA 2QA9E 3SV7A 1QY6A 4ISIH 1VCWA 2FOAA 3HK3B 1SOZA 3GY8A 1ZHRA 3RU4D 1ZTJA 2CHAC 4X2VA 1LCYA 3MWIU 1CVWH 4GSOA 1G32B 2J9NA 1O2VA 2QF0A 1DDJA 2ZCHP 1OWDA 3LONA 1WBGB 1PYTD 1NFYA 1YC0A 1AD8H 4X6NA 3FZZA 1AN1E 2EC9H 3KHVA 1EKBB 2RA0A 4GUXA 5CHAB 1OP2A 1PPCE 1SHYA 3Q3YA 4AB9A 1DXPA 1O2RA 3DFLA 4TPYA 3CENA 1EZUC 4ABAA 8GCHF 2LNCA 1O39A 1TNGA 4IS5A 4MNXA 3UOUA 1A5HA 1VCQA 3GY2A 1C5MD 1FDPA 1L1GA 1ZPZA 5IYTA 4NSYA 4CHAC 1KSNA 4GVUA 1RTLA 4X6PA 2QGRA 3A86A 3SU3A 2TIOA 1DWEH 3HATH 4Y11E 1TX8A 1IQJA 5C1YA 1KXFA 5LPEA 2A31A 3TGJE 4E05H 3HPTB 2QY0B 1IHTH 1H9LB 4Y8XA 4XFQA 4AX9H 1GGDC 1GMCG 2H2ZA 1HIAB 2AS9A 1TPAE 4H6TA 5LGOA 1BBRH 2IOTA 2O8MA 1V2LT 3HKIB 3SJ8A 3SGAE 3K2UA 2CXVA 1LKAA 3MNXA 1IQLA 1KLJH 5C5NA 2ZFPH 1NN6A 2BD2A 1MAXA 1QJ7B 4WXIA 3KL6A 1CGJE 1P2IA 1HAIH 2FWWA 4YO9A 2OLGA 3AW1A 1WYKA 1MUEB 4WJG2 2FI4E 1SGTA 2OP9A 3KCGH 3B8JA 1K2I1 4KTUA 1G2MA 3E16B 3QLPH 1CT2E 1IQMA 2Z3EA 3A88A 3BV9B 1GMHG 1N6YA 1YF4A 1J9CH 1GHAF 2WV5A 1CO7E 1MKXH 1DVAH 2BQ6B 2ZTYA 2LPRA 2BX3A 1AB9C 1EOLA 4A5TS 1RXPA 2OC8A 2SFAA 1H9HE 2QXGA 1EB2A 4NA8A 1HBTH 1TRYA 3MH5A 1O2MA 1AVGH 3NPSA 2OCVB 2ZP0H 3NK8A 3FP6E 3M7QA 5E0GA 1QJ1B 2J4IA 1SGQE 3E6PH 2Y5GA 2V35A 1GI9B 2GMTC 4A1XA 3SNAA 4AFSA 2XWBI 2AH4X 3SUFA 2ZHEH 1GJ6A 2B5TB 2PGQB 1NROH 5L2ZH 1BUIA 2BY7X 2CF8H 2FYQA 4AZ2B 4JZEH 3A7ZA 4YLUA 2ZHQH 2HGTH 3BF6H 2AEIH 4B1TA 1G3EA 2NU4E 3RXGA 1BMNH 1FIZA 1O2TA 2OD3B 1TBRH 2CF9H 1BTUA 1UTQA 4I8KA 3QX5H 5TCCA 1SGPE 1XUGA 3UNSA 3A7XA 1FONA 5EOKA 5HM2A 2VINA 4K8BA 4XE4A 3T29A 1SR5C 2VH6A 4JYTA 1O5FH 5C1XA 4ABHA 1KYNA 4UEHH 5HM9A 1F0RA 4R8TB 2VWOA 2ZDNA 1SGDE 1GMDF 1ZMNA 2ZTZA 3EQ0H 4WY3A 3UQVA 1YBWA 1LHFH 5CE1A 3SV9A 3BSQA 2FOGA 2FPZA 4Y6DA 4JK5A 3S9AA 1YLDA 4Z0KA 3F1SB 3Q77A 3RXTA 1GBIA 1PPFE 1SC8U 3ZVEA 1GDNA 1UK3A 1VITH 1C1VH 1O3PB 4BAHB 2ZU5A 2TRMA 1O33A 1ZHMA 3U69H 2A5IA 2XRCA 1QTFA 1P05A 1J8AA 1O31A 1GI6A 4CRGA 1S5SA 3QGNB 3MO6A 1TNHA 3LT3A 4K8YA 2FEQH 1D4PB 2XNIA 2FP7B 1A3BH 1BHXB 1ESTA 2AMDA 3BEIB 4XBCA 3SI4H 3ZZ5A 1GJAB 3QGJA 3ODFA 3LKWA 4DCDA 4X6MA 3TU7H 1DSUA 1W3CA 3TJOA 3NXPA 2ZPSA 4BTTB 1INCA 1XUJA 3PLBA 2GDDA 1MTNB 3MO9A 1HIAA 1P2OA 3UR9A 1O2QA 2BDIA 7GCHG 1K1PA 2IJOB 1GI7B 2PSYA 1O2GH 5C3NA 4X2YA 3LU9B 2Z3CA 1BZXE 2ZTXA 3RDZA 1V2JT 3O8CA 1ZPCA 1O38A 2HVXA 1EZSC 1BRBE 4LZ4B 3M3TA 4IC6A 1MTWA 1C1QA 3GDSA 1UHBA 1HAVB 5GIBA 1O2YA 1GJDB 1ZTKA 1GWAA 1UCYK 1WQSA 3MO3A 3LJOA 2PUQH 2JH6D 1Z6JH 4MTBA 2PFEA 1HAVA 1ZLRA 2XW9A 1A0HB 4YOIA 2FOFA 4VGCC 1HDTH 3Q76A 3V0XA 1T8OA 4MPVA 4RN6A 1YCPK 1N1LA 5GPIB 2OC7A 4ZKNU 3B23B 3RC5A 1O5DH 4MQAA 3PB1E 3LC3A 2CHAB 4WXVA 4ABFA 4TWWA 2Y6TA 3ZZ7A 3M36A 2PSXA 4IN2A 2OBQA 3AVZA 1ANEA 1PQ7A 3LC5A 1H8DH 1P04A 3U1IB 1DXWA 5FBEA 1EAWA 1T31A 1LTOA 3KQCA 3RXVA 3RLYH 1XUKA 1Y5AT 2J34A 3GISB 1ZGVA 1AKSA 2C4FH 1GMCF 2WYGA 3PROA 4NA7A 8LPRA 1S0QA 4YM9A 2BVXH 1QQUA 2DE8A 1WCZA 2H5CA 3A7YA 1EX3A 2O8WA 3ZVCA 1KXCA 3TH2H 1C1NA 1BB0B 1SL3A 3T26A 1AQ7A 2NU1E 3BTGE 1GBJA 4INHA 1TA2A 4Q80A 3TLOA 2Z9KA 3BG4B 2NU2E 1SGFG 1MTVA 4I33A 5FHTA 1Y5BT 1QBNA 2BB4A 4UFFH 1GVKB 1DICA 1TMUH 1P2QA 1SFIA 1EP6A 5F6MA 1BTWA 1GBEA 1C1TA 1SLWB 2QXJA 3MOCA 5DK1A 2W3KA 3MNCA 2UUYA 3DFJA 1TNIA 1Z1JA 1Z1IA 3M5NA 5E2PA 2A2QH 3RMLH 1FI8A 2G55A 3SV2H 3TH3H 2UWLA 2UWOA 3E8LA 2UUJB 2JH5D 3S7HB 2F9BH 3KF2A 3P17H 1NFXA 1OX1A 1HV7A 2BOHB 1DOJA 5FPTA 1O3IA 1HAOH 2G52A 1GG6C 2BOKA 3GDVA 1Q3XA 2AIQA 3FVFB 1ESAA 4BAKB 2ZNKH 1N8OC 1LDTT 2HOBA 2VU8E 1WUNH 3U9AH 2I6QA 4FU7A 5GWZA 1AU8A 5I46H 1QHRB 3BTWE 2ODQA 3GCHC 3ATLA 4K60A 1AIXH 2GZ8A 5GCHF 4ISOA 1DM4B 1LHDH 1FNIA 1K1IA 2SGDE 3LIWA 1DY8A 2RA3A 2FM2A 1LKBA 5C1UA 4TYDA 1GBCA 1K1NA 3O8DA 4BAMB 4O3TA 3D65E 1ELDE 1V2PT 2TPIZ 1TABE 1O2KA 4ISHH 3TH4H 1O3AA 1J14A 6GCHF 2BDYA 2FOEA 2BD9A 2THFB 4KGAA 4ZH8A 1EPTC 3OY5U 5CMXH 1NPMA 2A7CA 1W12U 2ZCKP 2HLCA 1GI2A 4JMYA 3D49H 4YT7H 1THRH 3GCOA 2ANMH 2UWPA 1F5KU 1YM0A 5EG4A 1NFUA 3D23A 2A7HA 3DA9B 1QRXA 3P8OA 2HRVA 3PWCA 1YKTA 3A89A 4E7NA 3UTUH 3P6ZB 1PPGE 1GJCB 3JZ1B 1Y5UT 3QZRA 4I31A 1GL0E 1V2WT 2VIOA 3SHCH 1ELVA 2Z9LA 2GCTC 4DT7B 4DIIH 3RXJA 4X2XA 2B7DH 2BHGA 1G3CA 3TK6A 2ZDMA 1AO5A 1GJ8B 2GT7A 1GHWH 2RDLA 3P95A 1H1BA 4I8LA 4MLFB 5F8XA 1MU6B 2ZDVH 1LHGH 1PPEE 4J1YA 1UVUH 1O2ZA 1G37A 1UVOA 1CA0C 3O8BA 4FUJA 3SW2B 2ZFTA 2FYRA 1MMJN 1YPHE 4CBNA 1L4DA 4Q2KA 1P01A 3STIA 1V2KT 3RXAA 4YOGA 1ZYOA 1EQ9A 2UUKB 3SO3A 3SQHE 3EA8A 4DOQA 2XBVA 4BNRA 1G3DA 2FZZA 1VR1H 3A7VA 3URDA 4AYVB 3GCHB 4NGAH 2Z9IA 1NY22 1BTXA 1ETSH 4MVNA 2BDCA 1HFDA 3DHKH 1ANDA 2BXUH 2F9NA 1Z8RA 4X1RU 1G3BA 4NA9H 4B2AA 1GBTA 1JXPA 1RIWC 1OOKB 2CV3A 3ZVBA 1HAPH 1LQEA 1FAKH 1OSSA 1EUFA 4B74A 4ZUHA 1C5PA 5C2ZA 1UMAH 4ZROA 3PO1B 1ZMJA 2I6SA 1OYQA 1SGYE 4B2CA 5BPEA 3MNSA 4JK6A 2BM2A 3I78A 1FQ3A 1OWIA 1ABJH 1JIMA 3GDUA 1GJ9B 1QL8A 8GCHG 2PUXB 2VJ1A 3KIDU 3K65B 2O8LA 4U01A 1Z71A 1CHOG 4XSKU 1O2WA 4GLYA 4H4FA 4YT6H 2OBOA 1V3XA 1YPMH 3SNDA 3RC6A 3SORA 2VGCC 2BY5X 2XBYA 2Y7ZA 3W94A 2ZGXH 3SJKA 4AG2A 2ZZUH 2G51A 3VXFH 1TRMA 1V2ST 3FANA 1GPZA 2OC0A 1WSSH 1BTZA 3SU5A 2VH0A 1GCDA 1KXDA 3PLKA 4NWLA 1O3KA 5JDUB 1GBHA 3AASA 2OXSA 1ZHPA 4FUCA 4WMDA 2IPHA 2VWNA 2P93A 2XC0A 2GZ7A 3UOPA 1QNJA 1ID5H 1ELBA 3KN2A 1C2HA 1FV9A 2BLQA 2D8WA 1W7XH 2F9VA 1A61H 1ZRBA 5TCAA 1KXEA 1PPHE 1E34B 2FLBH 3ZYDA 1DANH 4HGCA 1C4U2 2Y5FA 1GHYH 1DLKB 1PYTC 1XKAC 4INLA 1BA8B 4CRFA 5FCKA 1GI0A 4K5ZA 2OTVA 3E1XB 2ANWA 1Y3VA 3MYWA 4X1NU 3MI4A 4BOHA 2XC5A 4ABDA 1O3CA 2XC4A 5A8ZA 2VIDA 3C27B 1THPB 1XVMA 5DP7A 5K7RA 5A8YA 5HGGA 3ZZBA 1A4WH 1AFQC 1TMBH 2OUAA 5T6DA 1PQ8A 1TNKA 2A2XH 4ABGA 1OS8A 1F0UA 3ZV8A 1S85A 1YPJH 2A45B 2FXRA 3RXDA 2ZO3H 5AF9H 5IDKA 4BXSA 4OS1A 1ELCA 1KXAA 4NZLA 1P3EA 1QB9A 3M5OA 2P16A 3PMHB 3WY8A 1CHOF 1V6DA 2TGAA 3EGKH 1F92A 3UWJH 1UTNA 1P2NA 2FOCA 1TPSA 2QYIA 1P8VC 2KAIA 4A92A 2ZU3A 1QA0A 3LGUA 1T8MA 3E0PB 3QWCH 2ZU4A 2ZCLP 1LMWB 4CHAB 3A85A 4GCHG 1VGCB 5LPFA 2ZGBH 3TJNA 1Z8GA 1H9IE 5EPYA 1OP8A 5E8EH 1O0DH 1NTPA 1S6FA 1MCVA 1H4WA 2ODPA 1GDQA 4NSVA 1T8LA 1T8NA 2Y7XA 1BOQA 1WOFA 4OS4A 1O5CB 1JOUB 1AY6H 3A87A 2VIVA 2ZFRH 1L1JA 4K69A 4IMZA 1K1LA 3MH6A 4GHQA 1IQKA 1C1RA 3BIVH 2TBSA 3LGWA 1EAIA 1C1WH 1CA0B 1MAYA 1JRTA 1SQTA 2BTCE 1EASA 3L33A 1DSTA 3RP2A 3RXCA 1V2QT 2A1DB 4B75A 3RXIA 4X0WU 1NRQH 1O2XA 2BY9X 4Y7AA 1FPHH 5L30H 1AUJA 1BQYA 1Q2WA 1L4ZA 1PPZA 1V2RT 3ZVFA 4X8VH 1FLEE 3UREA 1ORFA 1JMOH 1WAYB 2PLXA 3BTKE 5GXPA 4X2WA 4B71A 2SGEE 4NCYA 3DT0H 5SGAE 3OTJE 1NT1A 2BDHA 1P06A 4ZKOU 3E0NB 3V3MA 1C4V2 1GJ7B 2P8OB 3ZZDA 3ATWA 3KQBA 5DP4A 2VGCB 3MU0A 4AB8A 1SLVB 1OXGA 1EZQA 2Z9JA 1D3TB 4ABEA 3A8CA 3AAVA 1GBAA 2ZEBA 4FU8A 5E2OA 1MQ6A 1MTNC 1MBMA 2HNTC 2CN0H 4DGJA 5A0BA 5EODA 1MKWK 1NM6A 1QA7A 3GY5A 1K1MA 1SG8B 1OWHA 2ZPQA 3TK5A 3VXEH 3VB5A 4YESB 4ABBA 1GI8B 1GI1A 7ESTE 4WWYA 1MZDA 1MU8B 2FX4A 2WPIS 3GOVB 1AE8H 2AGEX 3KQDA 2A5AA 3H7TA 5AFYH 4ZHAA 4I8JA 2FODA 5ETXA 2G81E 3OSYA 4Y0YE 2JH0D 8ESTE 1C5TA 3MMGA 1E37B 2C8YB 3ODDA 3A7WA 3ATKA 1ETRH 4FUEA 1E38B 3CP7A 1UVSH 1UTKA 1AMHA 4WH8A 1ZRKA 1ETTH 1PFXC 4FUFA 3P70B 2RG3A 2BZAA 3SU2A 2H1UA 5GJ4B 2WPJS 1V2MT 3A8BA 1U6QA 2VWMA 2PKAA 2WPKS 5EXMA 2AMPA 2ZDAH 1GJ5H 3M37A 1TRNA 3RMNH 2WV4A 1AI8H 2VNTA 3QTOH 3LDXH 1YPLH 9LPRA 2XBWA 4WMFA 1WTHD 1GHBG 1S0RA 1EPTA 1ESBA 2GZ9A 3Q3XA 3SNCA 4CH2B 2GP9B 4OGYA 1C1OA 1ZMLA 1F0TA 1OPHB 3BEUA 7GCHF 1TE0A 1LPGB 2C8ZB 1HPGA 2ANYA 3EA7A 1XMNB 2C8XB 1IQHA 1UTPA 4NG9H 1AGJA 2Z7FE 5EW2H 1ZGIA 1FPCH 2R3UA 2PHBA 3ZZAA 1JWTA 1BIOA 1L1NA 3UQOA 1TLDA 1FMGA 3T5FH 1C1SA 4IBLH 4B76A 2WPHS 1RD3B 1C5NH 3PMBB 5ESTE 1G9IE 1TONA 4NZQA 1FY5A 1C9TA 2YOLA 6GCHG 4DY7B 3BTDE 1P10A 1O3DA 1GI3A 4BANB 3CS7A 3A8AA 1YYY1 1TAWA 3F6UH 2O9QA 5C5OA 3I77A 1SPJA 5EXNA 4NIYA 3EE0B 2W3IA 3LGYA 2M5TA 2F83A 5FPSA 3ZV9A 1KDQA 2P94A 3GY7A 1HXFH 3F9FA 4HZHA 3DD2H 4D7GA 3NKKA 1ARBA 2AGIX 2GVFA 1THSH 2W7UA 2QV1A 3MU5A 1SGRE 4R0IA 4WVPE 1A1RA 4A1VA 2ZFQH 5JBAS 1C1MA 3RXHA 1SGEE 2K1QA 3SUEA 4B2BA 2VVVA 1P02A 2ZQ1A 3PTNA 1TMTH 2EI7A 1NRPH 1TGCA 1PQ5A 3TPIZ 1GVZA 5DP6A 2Y81A 4MNYA 2Y5HA 3ESTA 4CRBA 3T2NA 3MU1A 4UFEH 2ZDLA 1BHXF 3SN8A 4OS2A 5DJ7A 4YOJA 1FIWA 3PLPA 4D8NA 1XKBC 2SGFE 1LPZB 2G4TA 5LPRA 1FN6A 1QRZA 2Z3DA 3VPKA 4NFEA 3E91A
chains in the Genus database with same CATH superfamily
2A5KA 4MDSA 1AKSB 4D9QA 1F0SA 1GDUA 4RKJB 4FXGH 4X8TH 1NFWA 4BAQB 2STBE 1CGIE 1P57B 4X1QU 4IW4E 1OKXA 5EW1H 1CE5A 3SBKA 3RU4E 2F43B 1O5GH 1G30B 1BMLA 2GT8A 1C2EA 1D9IA 2R2MB 3F0PA 1WU1A 2FOHA 1GI4A 1WXRA 1K1OA 1SGFA 1SHHB 5C0UA 2Z6BD 2ZC9H 3OTPA 1C4Y2 2A4GA 3I29A 1D6WA 1O3OA 1XXDA 4NIWA 1C5XB 2Z9GA 1W7GH 5HYOA 1DE7H 2P8OC 3EA9A 4JZDH 2W7SA 5FCRA 5DG6A 5DGJA 4F55A 1SMFE 1COWD 2W6ID 3MTYA 3UUZA 1HRTH 1C1UH 4TWYA 4WH6A 3TVJB 2D1JA 4IN1A 3T28A 2BD5A 5GDSH 3SU0A 1C2FA 1YWUA 4GAWA 1DLEA 4FOUC 3U8TH 4AFQA 4Q7XA 1TPPA 4Y0ZE 1XVOA 3H7OA 2H5DA 4RKOB 3M35A 1MCTA 3K6YA 5C20A 2VBCA 2PGBB 4Y79A 1DUAA 1C2LA 1EJAA 3FP8E 1C5UA 2FI3E 3TJUA 1Z8JB 2A7JA 4D7FA 3RMOH 3U1JB 5JBBS 2FO9A 3PMAB 1ABIH 4F4OC 5CDFE 3M5MA 3AW0A 4UDWH 5EQSA 4MNWA 3TK9A 4AG1A 2YMSB 3TJVA 1S84A 4DIHH 1NRSH 2Q6DA 2PV9B 4FVDA 2Q6FA 2G4UA 5I25A 2ZI2H 4VGCB 1HB0B 4DW2U 1J16A 1A0JA 1KTTB 4XDEA 3BG8A 1C5VA 4CR5A 1AVXA 1FN8A 4OS6A 3BTME 3KGPA 3VEQB 4X1PU 1C5QA 2BDGA 3P8FA 3SZNA 2FMJA 1PJPA 1NU7B 2ZDKA 1XUIA 1C5ZB 2VIWA 4ZMAH 2FLRH 1V2UT 3QDZB 4ZAEA 1J15A 3BTFE 4H6SB 1TQ7B 5JBTA 2CMYA 3MHWU 4K2YA 1EJNA 1GBKA 3DUXH 4DG4A 2YNBA 1TGSZ 2SGQE 1KDQB 5FX5A 1LVOA 5GCHG 3NZIA 1ANBA 2EI8A 2O8TA 3A7TA 4INKA 1X7AC 1BRAA 1TNJA 3BTTE 3HKJB 4GPGA 1NS3A 3PWBA 5FXLA 1S83A 3S7KB 1Y3WA 1P11E 1GCTC 1MTSA 1LPKB 1YPHC 2R0LA 3PMJA 2PKSB 4XBDA 4FUBA 1HAXB 4THNH 1A5IA 1DT2A 1RJXB 3P8NA 1GBFA 1QJ6B 1K22H 3S9CA 3GCTF 3B9FH 2OINA 5EQRA 3RM2H 3KEEA 2J2UA 2ALVA 1NU9A 3A81A 4BTUB 1O3HA 2EEKA 2EA3A 3A84A 3MH4A 5DPAA 1SSXA 2BLWA 5DO4H 1SVPA 4RT1A 2G5VA 1P2JA 1MBQA 1PQAA 4TPIZ 4I8HA 3RXEA 1H8ED 1O2IA 1K28D 2HNTF 2CJIA 3QZQA 1O35A 1IQEA 4CRAA 3PM3A 1O5EH 5F53A 2Z94A 3GY3A 2A0QB 1A2CH 2BD4A 2SNVA 4FUGA 3SV8A 2GV7A 4DVAU 1UHBB 3GYLB 3VB7A 2P3UB 3SU6A 4JZIA 1EPTB 1W0ZU 2GD4B 4DJZB 1FJSA 2Y82A 1B5GH 1BITA 1ZTLA 3VGCB 3MFJA 1TGTA 1Z6EA 2NU3E 4FUDA 2CGAA 2XWAA 1QBOA 3ZIAD 1OWEA 2FESH 2VB0A 1T7CA 1UJ1A 1UK2A 3MU8A 3U8RH 4CRCA 2JETB 3OFND 3TNTA 2A32A 1TIOA 1O30A 1C5SA 1EZXC 2R9PA 1TBQH 4A6LA 1C1PA 2SGPE 4A7IB 1ELGA 1AFQB 1WTGH 2PKAB 1SB1H 1LO6A 1BRUP 1P9SA 1TX6A 4NWKA 5DP5A 1Y8TA 2BY6X 3RXLA 4OS7A 1A7SA 3SNEA 1LHCH 4ZXXH 1QL7A 1TA6A 1DX5M 4AGJA 1K0HA 2FDAA 1NRNH 1QQ4A 5J4SA 2FI5E 1O3FA 1T4UH 3F9GA 1JRSA 5ESBA 2C90B 2IJD1 3LGVA 4BTIB 2GTBA 2TGDA 1Z7KA 3GCNA 5CHAC 2JIZD 4B6EA 1KXBA 1RTKA 2FTMA 1SQOA 1T32A 1F5LA 2V6NA 5JB8S 1EAXA 1BMMH 3LPRA 2QIQA 5C67A 4CBOA 4FVBA 1EOJA 1J17T 2TGTA 5HIZA 2R3YA 8KME2 3A80A 2FS9A 4QT8C 3K6ZA 4UFGH 1V2VT 2VIPA 4O03A 3RC4A 1UVTH 2FX6A 1RRKA 2A4RA 2H9EH 4UONA 5HMAA 1C2IA 1LVYA 4SGAE 2R2WU 1AUTC 1QURH 4IGDA 4LXBH 1O37A 5EJ1A 1ZZZA 3RXOA 2Q1JA 4MNVA 2QN5T 3TGKE 1MTUA 1Y3UA 1FZZA 3OX7U 4LK4A 1H8IH 2YMSD 1O5BB 2JJ2D 3KQEA 1IQIA 5B6OA 2GKVE 1FY1A 4ZHMU 1VZQH 1O2NA 2FOMB 2PP6A 5A0AE 1UCYE 2WUCA 3SZEA 1TGBA 1YP9A 1XXFA 4BAOB 5EU8A 3VGCC 2KAIB 1JBUH 3W1EA 1TWXB 3STJA 5BRRE 1YY3A 1FY4A 7LPRA 4YTAA 1XX9A 3UAIC 3P92A 4AN7A 2XCNA 2W5EA 4JYUH 1YPGH 4YZUA 1O3MA 1CU1A 3UIRA 1BJVA 5EXLA 3FZDA 1GJBB 1NESE 2KCPA 3VB4A 2ILNA 1HNEE 2QAAA 3UFAA 1SOTA 4O3UA 2KCYA 5DKMA 4CH8B 4ISLA 4J2YB 1Z8IB 2J92A 2PTNA 1QCPA 2BY8X 2KM0A 2AFQB 4KKDA 2ODYB 4TY7A 1AB9B 1O2JA 1O32A 4JZ1A 1JIRA 5ABWA 4D76A 3SQEE 2D26C 1SLXB 5DP3A 2ZHFH 3NUMA 3P8GA 1XUHA 3V13A 5AVDA 6ESTA 2F9UA 3R0FA 3V12A 4U2WA 3ELAH 1OWKA 3VB3A 2GMTB 2VWLA 3GY6A 1AZ8A 1GJ4H 3L3TA 1TQ0B 1L0ZA 1ELFA 4BXWA 1BBRK 1GMHF 3PV4A 2B0FA 5PTPA 1MQ5A 3FP7E 3A83A 2QXIA 2FIRH 2YNAA 3UY9A 3RXSA 5E0HA 3BTQE 2P59A 3TIUA 5C94A 1F7ZA 3TITA 4X8SH 1MKWH 3ZZCA 2EI6A 1TALA 1IQGA 2OQ5A 3SGQE 1B0EA 4FU9A 3EDXB 2ZG0H 1DPOA 1VCPA 3PTBA 4K1EA 2FS8A 3VFEA 3S9BA 1TYNA 2QF5A 2H9TH 1FY3A 5FBIA 3MU4A 2F91A 3GICB 2ZECA 3O8RA 2G5NA 5HXFA 4Y10E 1C5WB 3F68H 6CHAB 4ABIA 1MKXK 3RXFA 1SGNE 1KTSB 1LHEH 4WMEA 1CGHA 2GV6A 4MPUA 3M61U 4Z6AH 1VITG 1HCGA 1NC6A 4DURA 4GHTA 1C5RA 1O3EA 1NRRH 1UO6A 3SYJA 1XM1A 3U98H 3OE7D 4P00A 1DWBH 3UPEA 1A46H 2PW8H 1BBRE 1G36A 1B7XB 1XUFA 1EAUA 1CA8B 3SI3H 3M3SA 1ZJDA 1CT4E 1ZPBA 2J97A 2XYAA 3RXRA 1GHXH 1UTMA 1S6LA 4I86A 1E36B 1GHZA 2RDEA 1K9OE 5CHBA 9ESTA 4WF8A 2KCOA 3UR6A 3BTEE 1QL9A 4K1TA 1P3CA 2ZIQH 1QB1A 2V7QD 4FUHA 1W8BH 1GHVH 1O2SA 3FFGA 1AHTH 3GY4A 1E35B 4MPXA 3SJIA 3T27A 4UFDH 2F9PA 5EJZA 2XXLA 2J38A 1UTOA 1BRCE 4ESTE 5FAHA 1NZQH 1YPKH 4KELA 3S69A 1D3PB 3EAJA 3OU0A 2BDAA 2VVCA 3FKSD 1IAUA 4E06H 2B9LA 1IQNA 2BVRH 2ZU1A 1ELAA 1TBZH 1SBWA 1C2MA 4B73A 1F2SE 2D2DA 4H42U 1KY9A 2BQWB 1QGFA 1YPEH 1P2KA 2ZFFH 3SU4A 2WYJA 2GCHG 1BT7A 1NO9H 4TY6A 2H6MA 3QO6A 4OGXA 2IPQX 4AGKA 3RLWH 2F4LA 1TOCB 4JYVH 2GX4A 3RXMA 1VJAU 2PWXA 2WSSD 3U8OH 2ZGHA 5FX6A 2XTTB 1GI5A 2HPPH 1PPBH 1SI5H 1ZJKA 5T1VA 2P95A 1DFPA 2V3HH 2JJ1D 2STAE 2JETC 1QR3E 3BEFB 2B8OH 1CBWB 1TX7A 1FUJA 1SFQB 3G01A 5A0CA 3OYPA 1C5YB 1DWCH 1QBVH 4IC5A 4Q7ZA 1O2PA 3H5CB 3QUMP 4Y7BA 3W95A 4O97A 2OQUA 3V7TA 3DCLA 3SJ9A 3SU1A 2ZQ2A 3TNSA 1P09A 1VITF 1IQFA 3ATIA 1UTLM 1GHAG 4MPWA 1SGIB 2O8UA 2K0QA 4CREA 2F3CE 5AFZH 1YLCA 1AWHB 4Y71A 1SQAA 6LPRA 1ANCA 1S6HA 1N6XA 1ELEE 2PR3A 1HXEH 1ACBE 3F9HA 3ZZ4A 1TPOA 1F5RA 5A8XA 1ZOMA 2FOBA 3RMMH 2QXHA 4HTCH 3BTHE 5G4BA 2GDEH 1K1JA 4X8UH 1C2GA 2A4OA 4ABJA 3OY6U 4Y8YA 1IOEA 3T62A 1C5OH 4NIXA 4F49A 3FO8D 1Y3XA 1ZSJA 2GGVB 2XBXA 3ITIA 4TSFD 4ZCNA 3AAUA 5DP9A 1LQDB 2BD8A 1DY9A 2ZHDA 2W26A 2KZ4A 4X1SU 1A0LA 1GBMA 3N7OA 1UCYH 1V2TT 2HNTE 1TOMH 1P2MA 1TB6H 2ZGJA 1YCPM 3A8DA 5A2MH 1HJ8A 4Z1MD 1AWFH 5JPMH 5EGMA 2A4QA 2P3TB 1ARCA 1AZZA 3M7TA 4A1TA 3IG6B 3M3VA 3Q3KA 3KNXA 1TFXA 4NFFA 4U32A 1M9UA 4I32A 6CHAC 5EPNA 4E7RG 5DP8A 5L6NH 1S81A 1HJAC 3GCTG 1BMAA 1ZR0A 4ZKRU 1GMDG 1UVPA 1AFEH 4JZFH 1GG6B 4Q7YA 3S0NA 1W11U 1MD8A 1B0FA 3RXUA 3VB6A 2BLOA 4HFPB 3ZZ6A 4CRDA 1FXYA 1HAZB 3RXQA 2P3FH 3UNRA 1RS0A 3QK1A 1DUEA 1FY8E 4AFZA 1HGTH 1AE5A 2V3OH 3QTVH 4FUIA 3ZVAA 1C2DA 1GVLA 1ELTA 2ZGCA 2JKHA 5F03A 1G2LA 3C1KA 3ZZ3A 2G00A 2QCYA 1V2OT 4XBBA 2VIQA 4O9VA 3F3BA 1EP5A 1CHGA 4JCNA 1WV7H 1HAHH 1Y3YA 1HAGE 3LGTA 2H9HA 2ZKSA 1E0FD 2WV9A 3D62A 3SJOA 4KTCA 4I7YH 1OWJA 2Y80A 3HK6B 3SUDA 4UE7H 2ZPRA 4Y76A 1W2KH 2HWLB 2BVSH 1EJMA 3NRLA 1C2KA 3IWMA 3ZYEA 5JB9S 3L6PA 3LH1A 1P0SH 1K21H 2SGAA 3RUOA 1Q31A 1GCTB 1P12E 1HYLA 1A3EH 1BTHH 1LVMA 4ASHA 3SV6A 4U30A 5EQQA 3BG4C 2ANKH 3EYDA 4M7GA 1HJ9A 2AMQA 5DSFA 1C5LH 3IITA 1W0YH 2WPMS 3URCA 4XOJA 2ZA5A 5F8ZA 1RIWB 3K9XB 1GBDA 3MNBA 1BCUH 1EB1H 5TJXA 1GHBF 1HUTH 1UK4A 2J98B 4LOYH 2ZWLH 4OM9A 1TGNA 2C93B 3ATMA 4YLQH 1S82A 3BN9A 2C3SA 3LOXA 1RTFB 2AERH 4AYYB 1BDAA 4ZKSU 3ENSB 3SGBE 1EFRD 3M5LA 5F8TA 1GL1A 1OYTH 1T4VH 1BTYA 1TNLA 2CK3D 3FAOA 1MZAA 2WINI 3LH3A 3ZZ9A 2BLVA 4ISNA 7KMEH 3UNQA 2BD3A 1L2EA 3ZVGA 1HJAB 3RXBA 1O2UA 1ZSLA 5HKKD 2ZHWH 3SHAH 2AGGX 3F9EA 1A5GH 2RCEA 1V2NT 1BJUA 2BDBA 3NCLA 5T6FA 4ZXYH 1D3DB 1N8OB 2G8TA 1QFKH 2TGPZ 2GCHF 4KP0A 1CBWC 1GBBA 1DITH 3RU4T 2AIPA 2PTCE 1DS2E 2NU0E 1WQVH 1W13U 2UUFB 4GCHF 1CSOE 4PROA 3JZ2B 2ULLA 2BD7A 2DUCA 5AHGH 1YCPH 2HALA 3RXPA 4K3JA 1QIXB 1RFNA 2WZQA 2R0KA 3CS0A 4SGBE 5JBCS 2BZ6H 3OEED 3R3GB 2BMGB 2F9OA 1O5AB 3PO1C 1BTPA 1D6RA 1HLTH 5E0JA 3M7UA 5L2YH 2AYWA 1KLTA 1AVWA 1MD7A 1RGQA 4XD7D 3SOSA 3QN7A 3ZZ8A 1P9UA 1FAXA 5T6GA 1O3NA 2ESTE 2BYAX 5J4QA 5JYIA 3DSOA 2PKSC 1O34A 2FTLE 1KMHB 3RXKA 2QF3A 3HGNA 1P03A 1ZSKA 3GYMA 4K1SA 2XNDD 4RSPA 1C2JA 3BIUH 3T25A 2OC1A 1CQQA 5H4IB 2WPLS 1SGCA 4OS5A 1YGCH 2BQ7B 4Y8ZA 4Q63A 2IN2A 4I8GA 2WUBA 2ZF0H 1SLUB 1QRWA 1HAYB 2ZU2A 3TGIE 2BX4A 1C9PA 2GCTB 2Q6GA 3PYHA 1VJ9U 2ZFSA 1DWDH 2ALPA 1KIGH 1O36A 4NIVA 1O2LA 1W10U 5FPYA 1MH0A 1OP0A 4UD9H 2J94A 1O3GA 1W14U 2SNWA 3UWIA 4ZHLU 1UTJA 1Y59T 4IMQA 3RM0H 3HGPA 2VVUA 1GGDB 4X6OA 2LELA 1O3JA 4AFUA 3GS9A 3Q00A 4D9RA 3SUGA 1LVBA 1O3BA 1O2OA 2J95A 2HPQH 2C8WB 3ZVDA 1EXFA 3MH7A 2NWNA 1KLIH 4KTSA 1O3LA 5A09A 1QB6A 4MG3A 4AOQA 4CR9A 4HI3A 1CT0E 3NWUA 5LH8A 3LGIA 3A82A 2V0BA 4AORA 3LJJA 2XCFA 5K0HA 2QC2A 3E3TA 1EATA 2AHME 1VGCC 2BXTH 1D3QB 3SNBA 1SQRA 5T3HA 3E90B 4LZ1H 1O2HA 1IHSH 2ASUB 2DE9A 1GBLA 2QA9E 3SV7A 1QY6A 4ISIH 1UW7A 1VCWA 2FOAA 3HK3B 1SOZA 3GY8A 1ZHRA 3RU4D 1ZTJA 2CHAC 4X2VA 1WDIA 1LCYA 3MWIU 1CVWH 4GSOA 3PV2A 1G32B 2J9NA 1O2VA 2QF0A 1DDJA 2ZCHP 1OWDA 3LONA 1WBGB 1PYTD 1NFYA 1YC0A 1AD8H 4Q4LA 4X6NA 3FZZA 1AN1E 2EC9H 3KHVA 1EKBB 2RA0A 4GUXA 5CHAB 1OP2A 1PPCE 1SHYA 3Q3YA 2KFWA 4AB9A 1DXPA 1O2RA 3DFLA 4TPYA 3CENA 1EZUC 4ABAA 8GCHF 2LNCA 1O39A 1TNGA 1VKYA 4IS5A 4MNXA 3UOUA 1A5HA 1VCQA 3GY2A 1C5MD 1FDPA 1L1GA 1ZPZA 5IYTA 4NSYA 4CHAC 1KSNA 4GVUA 1RTLA 4X6PA 2QGRA 3A86A 3SU3A 2TIOA 1DWEH 3HATH 4Y11E 1TX8A 1IQJA 5C1YA 5HIYA 1KXFA 5LPEA 2A31A 3TGJE 4E05H 3HPTB 2QY0B 1IHTH 1H9LB 4Y8XA 4XFQA 4AX9H 1GGDC 1GMCG 2H2ZA 1HIAB 2AS9A 1TPAE 4H6TA 5LGOA 1BBRH 2IOTA 2O8MA 1V2LT 3HKIB 3SJ8A 3SGAE 3K2UA 2CXVA 2J5UA 1LKAA 3MNXA 5KEDA 1IQLA 1KLJH 5C5NA 2EQNA 2ZFPH 1NN6A 2BD2A 1MAXA 1QJ7B 1BMFD 4WXIA 3KL6A 1CGJE 1P2IA 1QZ8A 1HAIH 2FWWA 4YO9A 1NBMD 2OLGA 3AW1A 1WYKA 1MUEB 4WJG2 2FI4E 1SGTA 2OP9A 3KCGH 3B8JA 1K2I1 4KTUA 1G2MA 3E16B 3QLPH 5EIYA 1CT2E 2L6OA 1IQMA 2Z3EA 3A88A 3BV9B 1GMHG 1N6YA 1YF4A 1J9CH 1GHAF 2WV5A 1CO7E 1MKXH 1DVAH 2BQ6B 2LP6A 2ZTYA 2LPRA 2BX3A 1AB9C 1NBME 1EOLA 4A5TS 1RXPA 2OC8A 2SFAA 1H9HE 2QXGA 1EB2A 4NA8A 1HBTH 1TRYA 3MH5A 1O2MA 1AVGH 3NPSA 3PV5A 2KCAA 2OCVB 2ZP0H 3NK8A 3FP6E 3M7QA 5E0GA 1QJ1B 2J4IA 1SGQE 3E6PH 2Y5GA 2V35A 1GI9B 2GMTC 4A1XA 4RI0A 3SNAA 4AFSA 2XWBI 2AH4X 3SUFA 2ZHEH 1GJ6A 2B5TB 2PGQB 1NROH 5L2ZH 1BUIA 2BY7X 2CF8H 2FYQA 4AZ2B 4JZEH 3A7ZA 4YLUA 2ZHQH 2HGTH 3BF6H 2AEIH 4B1TA 1G3EA 2NU4E 3RXGA 4RT0A 1BMNH 1FIZA 1O2TA 2OD3B 1TBRH 2CF9H 1BTUA 1W0KD 1UTQA 3DSGA 4I8KA 3QX5H 5TCCA 1SGPE 1XUGA 3UNSA 3A7XA 1FONA 5EOKA 5HM2A 2VINA 4K8BA 4XE4A 3T29A 1SR5C 2VH6A 4JYTA 1O5FH 5C1XA 1E79D 4ABHA 1KYNA 4UEHH 5HM9A 1F0RA 4R8TB 2VWOA 2ZDNA 1SGDE 1GMDF 5B6LA 3H09A 1ZMNA 2ZTZA 3EQ0H 4WY3A 3UQVA 1YBWA 1LHFH 5CE1A 3SV9A 3BSQA 2FOGA 2FPZA 4Y6DA 4JK5A 3S9AA 1YLDA 4Z0KA 3F1SB 3Q77A 3RXTA 1GBIA 1PPFE 1SC8U 3ZVEA 1GDNA 1UK3A 1VITH 1C1VH 1O3PB 4BAHB 2ZU5A 2TRMA 1O33A 1ZHMA 3PRBA 3U69H 2A5IA 1QTFA 2XRCA 1P05A 2HVYB 1J8AA 1O31A 1GI6A 4CRGA 1S5SA 3QGNB 3MO6A 1TNHA 3LT3A 4K8YA 2FEQH 1D4PB 2XNIA 2FP7B 1A3BH 1BHXB 1ESTA 2AMDA 3BEIB 4XBCA 3SI4H 3ZZ5A 1GJAB 3QGJA 3ODFA 3LKWA 4DCDA 4X6MA 3TU7H 3AK5A 1DSUA 1W3CA 3TJOA 3NXPA 2ZPSA 4BTTB 1INCA 1XUJA 3PLBA 2GDDA 1MTNB 3MO9A 3N7DA 1HIAA 1P2OA 3UR9A 1O2QA 2BDIA 7GCHG 1K1PA 2IJOB 1GI7B 2PSYA 1O2GH 5C3NA 4X2YA 3LU9B 2Z3CA 1BZXE 5C17A 2ZTXA 3RDZA 1V2JT 5EJLA 3O8CA 1ZPCA 1O38A 2HVXA 1EZSC 1BRBE 4LZ4B 3M3TA 4IC6A 1MTWA 1C1QA 3GDSA 1UHBA 1HAVB 5GIBA 1O2YA 1GJDB 1ZTKA 1GWAA 1UCYK 1WQSA 3MO3A 3LJOA 2PUQH 2JH6D 1Z6JH 4MTBA 2PFEA 1HAVA 1ZLRA 2XW9A 1A0HB 4YOIA 2FOFA 4VGCC 1HDTH 3Q76A 3V0XA 1T8OA 4MPVA 1MABB 4RN6A 1YCPK 1N1LA 5GPIB 2OC7A 4ZKNU 3B23B 3RC5A 1O5DH 4MQAA 3PB1E 3F2GA 3LC3A 2CHAB 4WXVA 4ABFA 4TWWA 2Y6TA 3ZZ7A 3M36A 2PSXA 4IN2A 2OBQA 3AVZA 1ANEA 1PQ7A 3LC5A 1H8DH 1P04A 3U1IB 3F0OA 1DXWA 5FBEA 1EAWA 1T31A 1LTOA 3KQCA 3RXVA 3RLYH 1XUKA 1Y5AT 2J34A 3GISB 1ZGVA 3UB0A 1AKSA 2C4FH 2M2AA 1GMCF 2WYGA 3PROA 4NA7A 8LPRA 1S0QA 4YM9A 2BVXH 1QQUA 2DE8A 2K8IA 1WCZA 2H5CA 3A7YA 4M9FA 1EX3A 2O8WA 3ZVCA 1KXCA 3TH2H 1C1NA 1BB0B 1SL3A 3T26A 1AQ7A 2NU1E 3BTGE 1GBJA 4INHA 1TA2A 4Q80A 3TLOA 2Z9KA 3BG4B 2NU2E 1SGFG 1MTVA 4I33A 5FHTA 1Y5BT 1QBNA 2BB4A 2JDID 4YXWD 4UFFH 1GVKB 1DICA 1TMUH 1P2QA 1SFIA 1EP6A 5F6MA 1BTWA 1GBEA 1C1TA 1SLWB 2QXJA 3MOCA 5DK1A 2W3KA 3MNCA 2UUYA 3WWFA 3DFJA 1TNIA 1Z1JA 1Z1IA 3FN8A 3M5NA 5E2PA 2A2QH 3RMLH 1FI8A 2G55A 3SV2H 3TH3H 2UWLA 2UWOA 3E8LA 2UUJB 2JH5D 3S7HB 2F9BH 3KYFA 3KF2A 3P17H 1NFXA 1OX1A 1HV7A 2BOHB 1DOJA 5FPTA 1O3IA 1HAOH 2G52A 1GG6C 2BOKA 3U28C 3GDVA 1Q3XA 3N99A 2AIQA 3FVFB 1ESAA 3OEHD 4BAKB 2ZNKH 1N8OC 1LDTT 4DT4A 2HOBA 2HLDD 2VU8E 1WUNH 3U9AH 2I6QA 4FU7A 5GWZA 1AU8A 5I46H 1QHRB 3BTWE 4XRNA 2ODQA 3GCHC 3ATLA 4K60A 1AIXH 2GZ8A 5GCHF 4ISOA 1DM4B 1LHDH 1FNIA 1K1IA 2SGDE 3LIWA 1DY8A 2RA3A 2FM2A 1LKBA 5C1UA 4TYDA 1GBCA 1K1NA 3O8DA 4BAMB 4O3TA 3D65E 1ELDE 1V2PT 2TPIZ 1TABE 1O2KA 4FETA 4ISHH 1O3AA 1J14A 3TH4H 6GCHF 2BDYA 2FOEA 2BD9A 2THFB 4KGAA 4ZH8A 1EPTC 3OY5U 5CMXH 1NPMA 2A7CA 1W12U 2ZCKP 2HLCA 1GI2A 4JMYA 3D49H 3OAAD 4YT7H 1THRH 3GCOA 2ANMH 2UWPA 1F5KU 1YM0A 5EG4A 1NFUA 3D23A 2A7HA 3DA9B 1QRXA 3P8OA 2HRVA 3PWCA 1YKTA 3A89A 4E7NA 3UTUH 3P6ZB 1PPGE 1GJCB 3JZ1B 1Y5UT 3QZRA 4I31A 1GL0E 1V2WT 2VIOA 3SHCH 1ELVA 2Z9LA 2GCTC 4DT7B 4DIIH 3RXJA 4X2XA 2B7DH 1OHHD 2BHGA 1G3CA 3TK6A 2ZDMA 1AO5A 1GJ8B 2GT7A 1GHWH 2RDLA 3P95A 1H1BA 4I8LA 4MLFB 5F8XA 1MU6B 2ZDVH 1LHGH 1PPEE 4F48B 4J1YA 1UVUH 1O2ZA 1G37A 1UVOA 1CA0C 3O8BA 4FUJA 3SW2B 2ZFTA 2FYRA 1MMJN 1YPHE 4CBNA 1L4DA 4Q2KA 1P01A 3STIA 3KYGA 1V2KT 3RXAA 4YOGA 1ZYOA 2WHXA 1EQ9A 3F2FA 2UUKB 2YMSC 3SO3A 3SQHE 3EA8A 4DOQA 2XBVA 4BNRA 1G3DA 2FZZA 1VR1H 3A7VA 3URDA 4AYVB 3GCHB 4NGAH 2Z9IA 1NY22 1BTXA 1ETSH 4MVNA 2BDCA 1HFDA 3DHKH 1ANDA 2BXUH 2F9NA 1Z8RA 4X1RU 1G3BA 4NA9H 4B2AA 1GBTA 1JXPA 1RIWC 1OOKB 2CV3A 5IK2D 3ZVBA 1HAPH 1LQEA 1FAKH 1OSSA 1EUFA 4B74A 4ZUHA 1C5PA 5C2ZA 1UMAH 4ZROA 3PO1B 1ZMJA 2I6SA 1OYQA 1SGYE 4B2CA 5BPEA 3MNSA 4JK6A 2BM2A 3I78A 1FQ3A 1OWIA 1ABJH 1JIMA 3GDUA 1GJ9B 1QL8A 8GCHG 2PUXB 2VJ1A 3KIDU 3K65B 2O8LA 4U01A 1Z71A 1CHOG 4XSKU 1O2WA 4GLYA 4H4FA 4YT6H 2OBOA 1V3XA 1YPMH 3SNDA 3RC6A 2KX4A 3SORA 2VGCC 2KR7A 2BY5X 2XBYA 2Y7ZA 3W94A 2ZGXH 3SJKA 4AG2A 2ZZUH 2G51A 3VXFH 1TRMA 1V2ST 3FANA 1GPZA 2OC0A 5FL7D 3KQ5A 1WSSH 1BTZA 3SU5A 2VH0A 1GCDA 1KXDA 3PLKA 4NWLA 1O3KA 5JDUB 1GBHA 3AASA 2OXSA 1ZHPA 4FUCA 4WMDA 2IPHA 4ASUD 2VWNA 2P93A 2XC0A 2GZ7A 3UOPA 1QNJA 1ID5H 1ELBA 3KN2A 1C2HA 1FV9A 2BLQA 2D8WA 1W7XH 2F9VA 1A61H 1ZRBA 5TCAA 1KXEA 1PPHE 1E34B 2FLBH 3ZYDA 1DANH 4HGCA 1C4U2 2Y5FA 1GHYH 1DLKB 3WWBA 1PYTC 1XKAC 4INLA 1BA8B 4CRFA 5FCKA 1GI0A 4K5ZA 2OTVA 3E1XB 2QF4A 2ANWA 1Y3VA 3MYWA 4X1NU 3MI4A 4BOHA 2XC5A 4ABDA 1O3CA 2XC4A 5A8ZA 2VIDA 3C27B 1THPB 1XVMA 5DP7A 2RFKC 2V3MA 5K7RA 5A8YA 5HGGA 4AC9A 4HG6A 2L74A 3ZZBA 1A4WH 1AFQC 1TMBH 2OUAA 5T6DA 1PQ8A 1TNKA 2A2XH 4ABGA 1OS8A 1F0UA 3ZV8A 1S85A 1YPJH 2A45B 2FXRA 3RXDA 2ZO3H 5AF9H 5IDKA 4BXSA 4OS1A 1ELCA 5KGOA 1KXAA 4NZLA 1P3EA 1QB9A 3M5OA 2P16A 3PMHB 3WY8A 1CHOF 1V6DA 2TGAA 3EGKH 1F92A 3UWJH 1UTNA 1P2NA 2FOCA 1TPSA 2QYIA 1P8VC 2KAIA 4A92A 2ZU3A 1E1RD 1QA0A 3LGUA 1T8MA 3E0PB 3QWCH 2ZU4A 2ZCLP 1LMWB 4CHAB 3A85A 4GCHG 1VGCB 5LPFA 2ZGBH 2OK5A 3TJNA 1Z8GA 1H9IE 5EPYA 1OP8A 5E8EH 1O0DH 1NTPA 1S6FA 2GJGA 1MCVA 1H4WA 2ODPA 1GDQA 4NSVA 1T8LA 1T8NA 2Y7XA 1BOQA 1WOFA 4OS4A 1O5CB 1JOUB 3MQKC 1AY6H 3A87A 2XOKD 2VIVA 2ZFRH 1L1JA 4K69A 4IMZA 1K1LA 3MH6A 4GHQA 1IQKA 1C1RA 3BIVH 2TBSA 3LGWA 1EAIA 1C1WH 1CA0B 1MAYA 1JRTA 1SQTA 2BTCE 1EASA 3L33A 1DSTA 3RP2A 3RXCA 1V2QT 2A1DB 4B75A 3RXIA 4X0WU 1NRQH 1O2XA 2BY9X 4Y7AA 1FPHH 5L30H 1AUJA 1BQYA 1Q2WA 1L4ZA 1PPZA 1V2RT 3ZVFA 4X8VH 1FLEE 3UREA 1ORFA 1JMOH 1WAYB 1YLNA 2PLXA 3BTKE 5GXPA 4X2WA 4B71A 2SGEE 4NCYA 3DT0H 5SGAE 3OTJE 1NT1A 2BDHA 1P06A 4ZKOU 4B6FA 3WW7A 3E0NB 3V3MA 1C4V2 1GJ7B 2P8OB 3ZZDA 3ATWA 3KQBA 5DP4A 2VGCB 3MU0A 4AB8A 1SLVB 2EY4C 1OXGA 1EZQA 2Z9JA 1D3TB 1W0JD 4ABEA 3A8CA 3AAVA 1GBAA 2ZEBA 4FU8A 5E2OA 5C0TA 1MQ6A 1MTNC 1MBMA 2J98A 2HNTC 2CN0H 4DGJA 5A0BA 5EODA 1MKWK 1NM6A 1QA7A 3GY5A 1K1MA 1SG8B 1OWHA 2ZPQA 3PRDA 3TK5A 3VXEH 3VB5A 4YESB 4ABBA 1GI8B 3CNRA 1GI1A 7ESTE 4WWYA 1MZDA 2QE7D 1MU8B 2FX4A 2WPIS 5GNDA 3EE7A 3GOVB 1AE8H 2AGEX 3KQDA 2A5AA 3H7TA 5AFYH 4ZHAA 4I8JA 2FODA 5ETXA 2G81E 3OSYA 4Y0YE 2JH0D 8ESTE 1C5TA 3MMGA 1E37B 2C8YB 3ODDA 3A7WA 3ATKA 1ETRH 4FUEA 1E38B 3CP7A 1UVSH 1UTKA 1AMHA 4WH8A 1ZRKA 1ETTH 1PFXC 4FUFA 3P70B 2RG3A 2BZAA 3SU2A 3DSPA 2H1UA 5GJ4B 2WPJS 1V2MT 3A8BA 1U6QA 3VG8A 2VWMA 2PKAA 2WPKS 5EXMA 2AMPA 2ZDAH 1GJ5H 3M37A 1TRNA 3RMNH 2WV4A 1AI8H 2VNTA 1E1QD 3QTOH 3LDXH 1YPLH 4ACAA 9LPRA 2XBWA 4WMFA 1WTHD 1GHBG 1S0RA 1EPTA 1ESBA 2GZ9A 3Q3XA 3SNCA 4CH2B 2GP9B 4OGYA 1FX0B 1C1OA 1ZMLA 1F0TA 1OPHB 3BEUA 7GCHF 1TE0A 1LPGB 2C8ZB 1HPGA 2ANYA 3EA7A 1XMNB 2C8XB 1IQHA 1UTPA 4NG9H 1AGJA 2Z7FE 5EW2H 1ZGIA 1FPCH 2R3UA 5KECA 2PHBA 3ZZAA 1JWTA 1BIOA 1L1NA 3UQOA 1TLDA 1FMGA 3T5FH 1C1SA 4IBLH 4B76A 4TT3D 2WPHS 1RD3B 4P02A 1C5NH 3PMBB 5ESTE 1G9IE 1TONA 4NZQA 3N7EA 1FY5A 1C9TA 2YOLA 6GCHG 4DY7B 3BTDE 1P10A 1O3DA 1GI3A 4BANB 3CS7A 3A8AA 1SKYE 1YYY1 1TAWA 3F6UH 2O9QA 5C5OA 3I77A 1SPJA 5EXNA 4NIYA 3EE0B 2W3IA 3LGYA 2M5TA 2F83A 5FPSA 3ZV9A 1KDQA 2P94A 3GY7A 1HXFH 3F9FA 4HZHA 3DD2H 4D7GA 3NKKA 1ARBA 2AGIX 2GVFA 1THSH 2W7UA 2QV1A 3MU5A 1SGRE 2W6JD 4R0IA 4WVPE 1A1RA 4A1VA 2ZFQH 5JBAS 3FOAA 1C1MA 3RXHA 1SGEE 2K1QA 3SUEA 4B2BA 2VVVA 1P02A 2ZQ1A 3PTNA 1TMTH 2EI7A 5DN6D 1NRPH 1TGCA 1PQ5A 3TPIZ 1GVZA 5DP6A 2Y81A 4MNYA 2Y5HA 3ESTA 4CRBA 3T2NA 3MU1A 4UFEH 2ZDLA 1BHXF 3SN8A 4OS2A 5DJ7A 4YOJA 1FIWA 3PLPA 4D8NA 4ACBA 1XKBC 2SGFE 3F2HA 1LPZB 2G4TA 5LPRA 1H8HD 1FN6A 1QRZA 2WPDD 2Z3DA 3VPKA 4NFEA 3E91A
chains in the Genus database with same CATH topology
2A5KA 4MDSA 1AKSB 4D9QA 1F0SA 1GDUA 4RKJB 4FXGH 4X8TH 1NFWA 4BAQB 2STBE 1CGIE 1P57B 4X1QU 4IW4E 1OKXA 5EW1H 1CE5A 3SBKA 3RU4E 1O5GH 1G30B 1BMLA 2GT8A 1C2EA 1D9IA 2R2MB 1WU1A 2FOHA 1GI4A 1K1OA 1SGFA 1SHHB 2Z6BD 2ZC9H 1C4Y2 2A4GA 3I29A 1D6WA 1O3OA 1XXDA 4NIWA 1C5XB 2Z9GA 1W7GH 5HYOA 1DE7H 2P8OC 3EA9A 4JZDH 2W7SA 5FCRA 5DG6A 5DGJA 1SMFE 3MTYA 3UUZA 1HRTH 1C1UH 4TWYA 4WH6A 3TVJB 2D1JA 4IN1A 3T28A 2BD5A 5GDSH 3SU0A 1C2FA 4GAWA 1DLEA 3U8TH 4AFQA 4Q7XA 1TPPA 4Y0ZE 1XVOA 3H7OA 2H5DA 4RKOB 3M35A 1MCTA 3K6YA 5C20A 2PGBB 4Y79A 1DUAA 1C2LA 1EJAA 3FP8E 1C5UA 2FI3E 3TJUA 1Z8JB 2A7JA 4D7FA 3RMOH 3U1JB 5JBBS 2FO9A 3PMAB 1ABIH 4F4OC 3M5MA 3AW0A 4UDWH 5EQSA 4MNWA 3TK9A 4AG1A 3TJVA 1S84A 4DIHH 1NRSH 2Q6DA 2PV9B 4FVDA 2Q6FA 2G4UA 5I25A 2ZI2H 4VGCB 1HB0B 4DW2U 1J16A 1A0JA 1KTTB 4XDEA 3BG8A 1C5VA 4CR5A 1AVXA 1FN8A 4OS6A 3BTME 3KGPA 3VEQB 4X1PU 1C5QA 2BDGA 3P8FA 3SZNA 2FMJA 1PJPA 1NU7B 2ZDKA 1XUIA 1C5ZB 2VIWA 4ZMAH 2FLRH 1V2UT 3QDZB 4ZAEA 1J15A 3BTFE 4H6SB 1TQ7B 5JBTA 2CMYA 3MHWU 4K2YA 1EJNA 1GBKA 3DUXH 4DG4A 2YNBA 1TGSZ 2SGQE 1KDQB 5FX5A 1LVOA 5GCHG 3NZIA 1ANBA 2EI8A 2O8TA 3A7TA 4INKA 1X7AC 1BRAA 1TNJA 3BTTE 3HKJB 4GPGA 1NS3A 3PWBA 5FXLA 1S83A 3S7KB 1Y3WA 1P11E 1GCTC 1MTSA 1LPKB 1YPHC 2R0LA 3PMJA 2PKSB 4XBDA 4FUBA 1HAXB 4THNH 1A5IA 1DT2A 1RJXB 3P8NA 1GBFA 1QJ6B 1K22H 3S9CA 3GCTF 3B9FH 2OINA 5EQRA 3RM2H 3KEEA 2J2UA 2ALVA 1NU9A 3A81A 4BTUB 1O3HA 2EEKA 2EA3A 3A84A 3MH4A 5DPAA 1SSXA 2BLWA 5DO4H 1SVPA 2G5VA 1P2JA 1MBQA 1PQAA 4TPIZ 4I8HA 3RXEA 1O2IA 1K28D 2HNTF 2CJIA 3QZQA 1O35A 1IQEA 4CRAA 3PM3A 1O5EH 2Z94A 3GY3A 2A0QB 1A2CH 2BD4A 2SNVA 4FUGA 3SV8A 2GV7A 4DVAU 1UHBB 3GYLB 3VB7A 2P3UB 3SU6A 4JZIA 1EPTB 1W0ZU 2GD4B 4DJZB 1FJSA 2Y82A 1B5GH 1BITA 1ZTLA 3VGCB 3MFJA 1TGTA 1Z6EA 2NU3E 4FUDA 2CGAA 2XWAA 1QBOA 1OWEA 2FESH 2VB0A 1T7CA 1UJ1A 1UK2A 3MU8A 3U8RH 4CRCA 2JETB 3TNTA 2A32A 1TIOA 1O30A 1C5SA 1EZXC 2R9PA 1TBQH 4A6LA 1C1PA 2SGPE 4A7IB 1ELGA 1AFQB 1WTGH 2PKAB 1SB1H 1LO6A 1BRUP 1P9SA 1TX6A 4NWKA 5DP5A 1Y8TA 2BY6X 3RXLA 4OS7A 1A7SA 3SNEA 1LHCH 4ZXXH 1QL7A 1TA6A 1DX5M 4AGJA 2FDAA 1NRNH 1QQ4A 5J4SA 2FI5E 1O3FA 1T4UH 3F9GA 1JRSA 5ESBA 2C90B 3LGVA 4BTIB 2GTBA 2TGDA 1Z7KA 3GCNA 5CHAC 1KXBA 1RTKA 2FTMA 1SQOA 1T32A 1F5LA 2V6NA 5JB8S 1EAXA 1BMMH 3LPRA 2QIQA 5C67A 4CBOA 4FVBA 1EOJA 1J17T 2TGTA 2R3YA 8KME2 3A80A 2FS9A 4QT8C 3K6ZA 4UFGH 1V2VT 2VIPA 4O03A 3RC4A 1UVTH 2FX6A 1RRKA 2A4RA 2H9EH 4UONA 5HMAA 1C2IA 1LVYA 4SGAE 2R2WU 1AUTC 1QURH 4IGDA 4LXBH 1O37A 1ZZZA 3RXOA 2Q1JA 4MNVA 2QN5T 3TGKE 1MTUA 1Y3UA 1FZZA 3OX7U 4LK4A 1H8IH 1O5BB 3KQEA 1IQIA 5B6OA 2GKVE 1FY1A 4ZHMU 1VZQH 1O2NA 2FOMB 5A0AE 1UCYE 2WUCA 1TGBA 1YP9A 1XXFA 4BAOB 5EU8A 3VGCC 2KAIB 1JBUH 1TWXB 3STJA 5BRRE 1FY4A 7LPRA 4YTAA 1XX9A 3P92A 4AN7A 2XCNA 2W5EA 4JYUH 1YPGH 4YZUA 1O3MA 1CU1A 3UIRA 1BJVA 5EXLA 3FZDA 1GJBB 1NESE 3VB4A 2ILNA 1HNEE 2QAAA 3UFAA 1SOTA 4O3UA 5DKMA 4CH8B 4ISLA 4J2YB 1Z8IB 2J92A 2PTNA 1QCPA 2BY8X 2AFQB 4KKDA 2ODYB 4TY7A 1AB9B 1O2JA 1O32A 4JZ1A 1JIRA 5ABWA 4D76A 3SQEE 2D26C 1SLXB 5DP3A 2ZHFH 3NUMA 3P8GA 1XUHA 3V13A 5AVDA 6ESTA 2F9UA 3R0FA 3V12A 4U2WA 3ELAH 1OWKA 3VB3A 2GMTB 2VWLA 3GY6A 1AZ8A 1GJ4H 3L3TA 1TQ0B 1L0ZA 1ELFA 4BXWA 1BBRK 1GMHF 3PV4A 2B0FA 5PTPA 1MQ5A 3FP7E 3A83A 2QXIA 2FIRH 2YNAA 3UY9A 3RXSA 5E0HA 3BTQE 2P59A 3TIUA 1F7ZA 3TITA 4X8SH 1MKWH 3ZZCA 2EI6A 1TALA 1IQGA 2OQ5A 3SGQE 1B0EA 4FU9A 3EDXB 2ZG0H 1DPOA 1VCPA 3PTBA 4K1EA 2FS8A 3VFEA 3S9BA 1TYNA 2H9TH 1FY3A 5FBIA 3MU4A 2F91A 3GICB 2ZECA 3O8RA 2G5NA 5HXFA 4Y10E 1C5WB 3F68H 6CHAB 4ABIA 1MKXK 3RXFA 1SGNE 1KTSB 1LHEH 4WMEA 1CGHA 2GV6A 4MPUA 3M61U 4Z6AH 1VITG 1HCGA 1NC6A 4DURA 4GHTA 1C5RA 1O3EA 1NRRH 1UO6A 3U98H 1XM1A 1DWBH 3UPEA 1A46H 2PW8H 1BBRE 1G36A 1B7XB 1XUFA 1EAUA 1CA8B 3SI3H 3M3SA 1ZJDA 1CT4E 1ZPBA 2XYAA 3RXRA 1GHXH 1UTMA 1E36B 1GHZA 1K9OE 9ESTA 4WF8A 3UR6A 3BTEE 1QL9A 4K1TA 1P3CA 2ZIQH 1QB1A 4FUHA 1W8BH 1GHVH 1O2SA 3FFGA 1AHTH 3GY4A 1E35B 4MPXA 3SJIA 3T27A 4UFDH 2F9PA 2XXLA 2J38A 1UTOA 1BRCE 4ESTE 5FAHA 1NZQH 1YPKH 4KELA 3S69A 1D3PB 3EAJA 3OU0A 2BDAA 2VVCA 1IAUA 4E06H 2B9LA 1IQNA 2BVRH 2ZU1A 1ELAA 1TBZH 1SBWA 1C2MA 4B73A 1F2SE 2D2DA 4H42U 1KY9A 2BQWB 1QGFA 1YPEH 1P2KA 2ZFFH 3SU4A 2WYJA 2GCHG 1BT7A 1NO9H 4TY6A 2H6MA 3QO6A 4OGXA 4AGKA 3RLWH 1TOCB 4JYVH 2GX4A 3RXMA 1VJAU 2PWXA 3U8OH 2ZGHA 5FX6A 2XTTB 1GI5A 2HPPH 1PPBH 1SI5H 1ZJKA 2P95A 1DFPA 2V3HH 2STAE 2JETC 1QR3E 3BEFB 2B8OH 1CBWB 1TX7A 1FUJA 1SFQB 3G01A 5A0CA 3OYPA 1C5YB 1DWCH 1QBVH 4IC5A 4Q7ZA 1O2PA 3H5CB 3QUMP 4Y7BA 3W95A 4O97A 2OQUA 3V7TA 3SJ9A 3SU1A 2ZQ2A 3TNSA 1P09A 1VITF 1IQFA 3ATIA 1UTLM 1GHAG 4MPWA 1SGIB 2O8UA 4CREA 2F3CE 5AFZH 1YLCA 1AWHB 4Y71A 1SQAA 6LPRA 1ANCA 1S6HA 1N6XA 1ELEE 2PR3A 1HXEH 1ACBE 3F9HA 3ZZ4A 1TPOA 1F5RA 5A8XA 1ZOMA 2FOBA 3RMMH 2QXHA 4HTCH 3BTHE 5G4BA 2GDEH 1K1JA 4X8UH 1C2GA 2A4OA 4ABJA 3OY6U 4Y8YA 1IOEA 3T62A 1C5OH 4NIXA 4F49A 1Y3XA 1ZSJA 2GGVB 2XBXA 3ITIA 3AAUA 5DP9A 1LQDB 2BD8A 1DY9A 2ZHDA 2W26A 4X1SU 1A0LA 1GBMA 3N7OA 1UCYH 1V2TT 2HNTE 1TOMH 1P2MA 1TB6H 2ZGJA 1YCPM 3A8DA 5A2MH 1HJ8A 1AWFH 5JPMH 5EGMA 2A4QA 2P3TB 1ARCA 1AZZA 3M7TA 4A1TA 3IG6B 3M3VA 3Q3KA 3KNXA 1TFXA 4NFFA 4U32A 1M9UA 4I32A 6CHAC 5EPNA 4E7RG 5DP8A 5L6NH 1S81A 1HJAC 3GCTG 1BMAA 1ZR0A 4ZKRU 1GMDG 1UVPA 1AFEH 4JZFH 1GG6B 4Q7YA 3S0NA 1W11U 1MD8A 1B0FA 3RXUA 3VB6A 2BLOA 4HFPB 3ZZ6A 4CRDA 1FXYA 1HAZB 3RXQA 2P3FH 3UNRA 1RS0A 3QK1A 1DUEA 1FY8E 4AFZA 1HGTH 1AE5A 2V3OH 3QTVH 4FUIA 3ZVAA 1C2DA 1GVLA 1ELTA 2ZGCA 2JKHA 5F03A 1G2LA 3C1KA 3ZZ3A 2G00A 2QCYA 1V2OT 4XBBA 2VIQA 4O9VA 1EP5A 1CHGA 4JCNA 1WV7H 1HAHH 1Y3YA 1HAGE 3LGTA 2H9HA 2ZKSA 1E0FD 3D62A 3SJOA 4KTCA 4I7YH 1OWJA 2Y80A 3HK6B 3SUDA 4UE7H 2ZPRA 4Y76A 1W2KH 2HWLB 2BVSH 1EJMA 1C2KA 3IWMA 3ZYEA 5JB9S 3L6PA 3LH1A 1P0SH 1K21H 2SGAA 3RUOA 1Q31A 1GCTB 1P12E 1HYLA 1A3EH 1BTHH 1LVMA 4ASHA 3SV6A 4U30A 5EQQA 3BG4C 2ANKH 3EYDA 4M7GA 1HJ9A 2AMQA 1C5LH 3IITA 1W0YH 2WPMS 3URCA 4XOJA 2ZA5A 5F8ZA 1RIWB 3K9XB 1GBDA 3MNBA 1BCUH 1EB1H 5TJXA 1GHBF 1HUTH 1UK4A 4LOYH 2ZWLH 1TGNA 2C93B 3ATMA 4YLQH 1S82A 3BN9A 2C3SA 3LOXA 1RTFB 2AERH 4AYYB 1BDAA 4ZKSU 3ENSB 3SGBE 3M5LA 5F8TA 1GL1A 1OYTH 1T4VH 1BTYA 1TNLA 3FAOA 3LH3A 1MZAA 2WINI 3ZZ9A 2BLVA 4ISNA 7KMEH 3UNQA 2BD3A 1L2EA 3ZVGA 1HJAB 3RXBA 1O2UA 1ZSLA 2ZHWH 3SHAH 2AGGX 3F9EA 1A5GH 2RCEA 1V2NT 1BJUA 2BDBA 3NCLA 5T6FA 4ZXYH 1D3DB 1N8OB 2G8TA 1QFKH 2TGPZ 2GCHF 4KP0A 1CBWC 1GBBA 1DITH 3RU4T 2AIPA 2PTCE 1DS2E 2NU0E 1WQVH 1W13U 2UUFB 4GCHF 1CSOE 4PROA 3JZ2B 2ULLA 2BD7A 2DUCA 5AHGH 1YCPH 2HALA 3RXPA 4K3JA 1QIXB 1RFNA 2R0KA 3CS0A 4SGBE 5JBCS 2BZ6H 3R3GB 2BMGB 2F9OA 1O5AB 3PO1C 1BTPA 1D6RA 1HLTH 5E0JA 3M7UA 5L2YH 2AYWA 1KLTA 1AVWA 1MD7A 1RGQA 3SOSA 3QN7A 3ZZ8A 1P9UA 1FAXA 5T6GA 1O3NA 2ESTE 2BYAX 5J4QA 5JYIA 2PKSC 1O34A 2FTLE 3RXKA 2QF3A 3HGNA 1P03A 1ZSKA 3GYMA 4K1SA 4RSPA 1C2JA 3BIUH 3T25A 2OC1A 1CQQA 5H4IB 2WPLS 1SGCA 4OS5A 1YGCH 2BQ7B 4Y8ZA 2IN2A 4I8GA 2WUBA 2ZF0H 1SLUB 1QRWA 1HAYB 2ZU2A 3TGIE 2BX4A 1C9PA 2GCTB 2Q6GA 3PYHA 1VJ9U 2ZFSA 1DWDH 2ALPA 1KIGH 1O36A 4NIVA 1O2LA 1W10U 5FPYA 1MH0A 1OP0A 4UD9H 2J94A 1O3GA 1W14U 2SNWA 3UWIA 4ZHLU 1UTJA 1Y59T 4IMQA 3RM0H 3HGPA 2VVUA 1GGDB 4X6OA 1O3JA 4AFUA 3Q00A 4D9RA 3SUGA 1LVBA 1O3BA 1O2OA 2J95A 2HPQH 2C8WB 3ZVDA 1EXFA 3MH7A 2NWNA 1KLIH 4KTSA 1O3LA 5A09A 1QB6A 4MG3A 4AOQA 4CR9A 4HI3A 1CT0E 3NWUA 5LH8A 3LGIA 3A82A 2V0BA 4AORA 3LJJA 2XCFA 5K0HA 2QC2A 3E3TA 1EATA 1VGCC 2BXTH 1D3QB 3SNBA 5T3HA 3E90B 4LZ1H 1O2HA 1IHSH 2ASUB 2DE9A 1GBLA 2QA9E 3SV7A 1QY6A 4ISIH 1VCWA 2FOAA 3HK3B 1SOZA 3GY8A 1ZHRA 3RU4D 1ZTJA 2CHAC 4X2VA 1LCYA 3MWIU 1CVWH 4GSOA 1G32B 2J9NA 1O2VA 2QF0A 1DDJA 2ZCHP 1OWDA 3LONA 1WBGB 1PYTD 1NFYA 1YC0A 1AD8H 4X6NA 3FZZA 1AN1E 2EC9H 3KHVA 1EKBB 2RA0A 4GUXA 5CHAB 1OP2A 1PPCE 1SHYA 3Q3YA 4AB9A 1DXPA 1O2RA 3DFLA 4TPYA 3CENA 1EZUC 4ABAA 8GCHF 2LNCA 1O39A 1TNGA 4IS5A 4MNXA 3UOUA 1A5HA 1VCQA 3GY2A 1C5MD 1FDPA 1L1GA 1ZPZA 5IYTA 4NSYA 4CHAC 1KSNA 4GVUA 1RTLA 4X6PA 2QGRA 3A86A 3SU3A 2TIOA 1DWEH 3HATH 4Y11E 1TX8A