2KM0A

Cu(i)-bound copk
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEALRKGHSEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Copper resistance protein K
publication title CopK from Cupriavidus metallidurans CH34 Binds Cu(I) in a Tetrathioether Site: Characterization by X-ray Absorption and NMR Spectroscopy
pubmed doi rcsb
source organism Ralstonia metallidurans
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2009-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2km0A00
3DSOA 3N7EA 3DSPA 2LELA 2K0QA 3N7DA 2KM0A
chains in the Genus database with same CATH superfamily
1K22H 2A5KA 3LGIA 3B23B 4NA9H 1WV7H 4A1XA 1S85A 4NA8A 3UNSA 4FUGA 3SV2H 2GX4A 5DP5A 1L0ZA 3ITIA 3TJVA 3HK6B 2CHAC 1O5BB 4XE4A 3GOVB 1ZHPA 5BRRE 4JK6A 1FPHH 2YMSD 4P00A 1ZR0A 1EZXC 2ANWA 2YMSC 4NGAH 3V3MA 1HAYB 3TNSA 3MH6A 4FETA 3SU4A 3K9XB 4FUBA 1BBRE 1P11E 1MBQA 3PRBA 1A7SA 2BDCA 1H8HD 1UK3A 1GDNA 3GISB 2H9EH 3BEFB 3F6UH 1WOFA 1THPB 3SHCH 2FX6A 4X8SH 5K7RA 1HAHH 3S9BA 2JH0D 3SJIA 1ZPCA 3SJOA 3N7DA 2AGEX 2IJD1 4GHQA 1DWBH 1O39A 5A0AE 1GJCB 1GG6B 3DSPA 3A8BA 1F0RA 1GGDC 3KQDA 1GJ6A 1H9LB 1NBMD 2OC7A 3S9CA 1LPZB 2Y5GA 1IQKA 1QFKH 3OYPA 1RJXB 1A5IA 1HYLA 3LDXH 2I6QA 2UUYA 4I31A 1O2WA 5DP9A 2ZHWH 2OC1A 1PPEE 4OS5A 3STIA 4FUJA 5JBAS 5CE1A 1DVAH 5J4QA 1C1NA 1LHEH 3UWJH 1P2JA 1SI5H 3SZEA 4H42U 1KXEA 3M36A 2A2XH 3BTKE 4ZH8A 1GBTA 1EOLA 2H2ZA 4WXIA 1O3IA 2EI8A 5A8ZA 1GBLA 1P8VC 1A3BH 2FOBA 4KTSA 1TNGA 1FPCH 6GCHG 2XCNA 1D3TB 3WY8A 2LNCA 2F91A 3TK5A 4OS6A 4DOQA 8LPRA 4INHA 2OK5A 2Y5FA 4GHTA 1LHGH 1LTOA 1TNIA 3U9AH 4FOUC 4O97A 4BXSA 4INKA 3TLOA 4CRFA 1YM0A 3QLPH 2BTCE 2DE9A 2P3FH 4D7FA 2Z6BD 2Z7FE 1O2XA 2A4GA 1O3HA 5B6LA 2M5TA 4AORA 4DJZB 1MKWK 1SFQB 3CNRA 1QGFA 2HVXA 2RDEA 4SGAE 3VGCC 1FY3A 4YXWD 1EB1H 1EQ9A 3ZV8A 1EATA 1SOTA 1Z8GA 4NSYA 1THRH 4XSKU 1TLDA 4JZEH 3ZZDA 1UVOA 4MLFB 4X1SU 3GY5A 8ESTE 3NK8A 4U30A 4YO9A 4NIVA 2WHXA 4RT0A 5EXMA 1Y59T 4ZAEA 1NZQH 1O2ZA 1ELTA 4RKOB 3VGCB 4ESTE 4ZHLU 1J16A 1GI9B 4MNVA 3WWFA 1WQSA 2KAIA 3EA9A 4CRGA 4ABHA 4NG9H 1AVGH 4ZROA 2ESTE 1TNHA 1C2LA 1JIMA 1RIWC 3M7UA 2EI7A 3A81A 1L1NA 3MNCA 1ELCA 1GVLA 1G37A 2LELA 4A1VA 1TYNA 2XNDD 1NRQH 3GY6A 1A46H 1XXFA 1EUFA 4X2YA 1HCGA 1F5LA 2PW8H 1DSTA 3EQ0H 2J98A 4XFQA 1GBBA 1BJVA 1ZTKA 2ZF0H 3OY5U 1F0TA 2P93A 3EAJA 1HJ9A 2PKAA 2H5DA 2A5IA 1C5YB 3DSOA 4NFEA 2QY0B 1NU7B 1C1UH 1VJAU 2LPRA 3SN8A 4KTUA 1L1JA 1GJ4H 2ZGJA 1UVPA 2Z3DA 1HAOH 1K0HA 4NZQA 3VB6A 1JBUH 3KCGH 3W1EA 1GMDG 1GHXH 1ZJKA 3TK9A 5GWZA 1FAKH 3G01A 2PHBA 1SB1H 5ESTE 3HPTB 3UFAA 2B7DH 3P8FA 1QY6A 1YGCH 4TPYA 1P12E 3P8OA 1VJ9U 4FUIA 1MH0A 3PWCA 1O30A 3HATH 5EQQA 5DGJA 5T6GA 1T32A 2WYJA 2ZGXH 1ELAA 2FOHA 4NA7A 3H7TA 1MTSA 4B2CA 1PPHE 3F0OA 2W7UA 1HAPH 5AVDA 3UIRA 1SFIA 1DSUA 3TH4H 4FU9A 2ZTYA 1ZJDA 1OWKA 1UVSH 5EJLA 4CREA 2Y82A 2H9TH 2VIVA 1QJ7B 3FZZA 2PKSB 4XDEA 2NU0E 5FPTA 3U98H 3UY9A 2R3YA 1TAWA 2ZGBH 4FUHA 3FVFB 1TBQH 1N6XA 1RTLA 2BY8X 1A5HA 3E3TA 3KQBA 5LPFA 4E05H 3BTTE 1NFWA 1CU1A 3ZVEA 1UHBA 1Y3VA 2R0KA 2L74A 3E16B 1KLJH 7ESTE 2ZHFH 4LZ1H 2OUAA 1ELVA 2BMGB 1UTJA 3E6PH 1O3FA 1Z1IA 5EQRA 1PFXC 3LGTA 2BX4A 3PMAB 4VGCC 2BZAA 4KELA 1CT4E 4DURA 1P01A 2XOKD 2OQUA 3SORA 1DT2A 2GT7A 4CH8B 2QAAA 2GKVE 2PFEA 5JB8S 2ZU3A 5FCRA 4CHAC 1ZMJA 2ZCLP 4IBLH 1SGFG 4LOYH 4I8HA 5HM2A 4X0WU 1N1LA 1BTPA 2V6NA 4KP0A 1JOUB 1XX9A 2B8OH 5AF9H 1RXPA 3QZRA 2FO9A 2IJOB 3U28C 4B71A 3O8CA 1KXFA 2PWXA 1OYTH 4I8KA 4CHAB 3SV7A 1WTGH 2HGTH 2QIQA 1ELBA 1C4Y2 1QR3E 2VIDA 1UVTH 1VITH 2QF4A 1E1RD 2P95A 1Y3YA 1SGNE 3PYHA 1HJ8A 1DX5M 4X6PA 2QE7D 1NBME 1ZSKA 2ZQ2A 1LHDH 1RTFB 2KAIB 1GDQA 1C4V2 4GSOA 2OC0A 1SQRA 1DXWA 3SOSA 1UTKA 2ZFTA 2QC2A 1RS0A 1O2NA 2WUBA 2OINA 2EA3A 1VCPA 3FP7E 2AFQB 1HAVB 5T6DA 1A0LA 1SGCA 3RXCA 5AHGH 1SVPA 2XWBI 1AFEH 1ELGA 1SGDE 2THFB 1BJUA 1YCPH 4MTBA 2SGDE 2J98B 3E1XB 3VEQB 1FIWA 2FX4A 1W8BH 2YNBA 3O8RA 1BZXE 1EX3A 1HPGA 1P2NA 2PKAB 2ZFSA 5H4IB 3A86A 4ZHAA 2G00A 1W0JD 2VWMA 2GD4B 2GCTB 1K21H 2C4FH 1SGQE 3K65B 2BVRH 2BLVA 2CF8H 1O3OA 1UCYK 2FI3E 2FPZA 3WW7A 4IS5A 1TWXB 2Y81A 2H9HA 4H6SB 4AFQA 4Q4LA 5EPYA 1GJDB 2FS9A 1H8IH 3A7TA 4BTTB 2ZO3H 3V12A 2WYGA 3RXUA 2AGGX 2FI5E 3TIUA 1C9TA 1O3CA 2ULLA 1MAYA 3ATWA 1K1NA 3QK1A 1C5MD 3SV8A 2VB0A 3DCLA 3OE7D 1FY4A 1L2EA 3SNBA 2HNTE 3RXVA 7KMEH 2K1QA 1GBAA 5EPNA 3SO3A 2TGTA 2UUJB 1P02A 3ODDA 4Y71A 2IPHA 1NO9H 3FKSD 1P9SA 2ZHDA 3TGIE 1EAXA 4O3UA 5FAHA 2F9UA 1C2JA 4ZKOU 2A7CA 2EY4C 1MU8B 1YWUA 4MPWA 1F5KU 4A6LA 1DLEA 4ZKNU 4AZ2B 4GUXA 2FLRH 3ZZ8A 1IOEA 1O33A 2Z9GA 3AW0A 1UO6A 1W7GH 1VGCC 4THNH 2RFKC 1XUJA 3GDSA 1FY8E 1LQEA 1TQ7B 1GCDA 4ABBA 1CT0E 1ZLRA 3VB5A 1UHBB 1TPSA 1BHXF 1FAXA 1AY6H 3ZYDA 1HIAA 1QB9A 5FPYA 4ABEA 1O2RA 5C0UA 2VWLA 2BD4A 1PPFE 2V3MA 1INCA 1BTYA 2F43B 2RDLA 1T8OA 3GICB 1E35B 2BB4A 1BQYA 2Z94A 3RXDA 3LJOA 4AYVB 1XUFA 1SSXA 5DN6D 1PQ7A 1BRAA 4OS7A 2UWOA 3T62A 1J8AA 1YCPK 1ZHRA 3OFND 3RXBA 3AK5A 3AVZA 1XUKA 3ATIA 3LGUA 5EU8A 3BG8A 1SHHB 3MH5A 1CA0B 4F4OC 1SPJA 1GHAF 1G3CA 3RXMA 4TPIZ 2A4QA 4AB9A 1P06A 1O5GH 2BY9X 1FUJA 3GDUA 3GCHB 3MWIU 2KFWA 2CXVA 1O2OA 3RXTA 2QF3A 1SLWB 2P16A 5FL7D 2W7SA 5IK2D 1GJAB 3LGVA 1GHZA 3BG4C 5JB9S 1AZ8A 3WWBA 3ATMA 1WDIA 5EIYA 1B0EA 3LGWA 1GL1A 1FJSA 2D1JA 2Z3EA 4UONA 3P92A 2SNVA 1LQDB 1ZOMA 3OY6U 1BTWA 4Y0ZE 2QF0A 4P02A 3A83A 4BXWA 2P8OB 3A82A 1C2DA 4X8UH 4MNYA 2BDGA 2PUQH 4NWKA 2KR7A 1FLEE 3PMHB 1D3PB 1Z8IB 4LZ4B 1HFDA 2VIQA 3KYGA 1AFQC 1AWHB 2Y7XA 1FV9A 2GV7A 4FUCA 1YPMH 3ODFA 1HGTH 4IMQA 1D3DB 1JRTA 1HXEH 2AIPA 1YY3A 1SL3A 2VH6A 3UR6A 1GJ5H 3MNBA 2SGQE 1MCVA 1A61H 1O2UA 3S0NA 2WUCA 4ABIA 1GL0E 1WYKA 1GI6A 3ZIAD 2CV3A 4WH6A 3ZZ7A 1IQMA 4D9RA 1TX7A 1P9UA 2VINA 3PB1E 4NIYA 4X8VH 5C1YA 2KCAA 2BLOA 2BD5A 2G51A 3GS9A 1BBRK 1D4PB 3PM3A 1TNJA 1C1VH 1GMCF 2FXRA 1Y5UT 4JZIA 2QXHA 1FXYA 2R0LA 2ALPA 2GGVB 4RT1A 4AGKA 2JETC 2BD3A 1O2VA 1T7CA 2ODPA 3V7TA 2ALVA 3E0PB 1AIXH 4FUDA 4B75A 1MAXA 3QTVH 1GBJA 1QCPA 3EYDA 2UUFB 3MOCA 3KF2A 1H1BA 1WQVH 3PV4A 2Z9KA 2GCHF 2ZHQH 3DT0H 2A32A 3F2FA 5FBIA 1Q2WA 3SUEA 2ZECA 4JCNA 3Q00A 1BA8B 3BIUH 1C5RA 4KGAA 3ZVCA 3RMLH 5HM9A 2D8WA 1EAWA 5ABWA 3PTBA 4X1QU 1O3JA 2ZWLH 1TFXA 1QB1A 1C1WH 2FOFA 2ZIQH 3LH1A 1TGNA 3BTGE 3DFLA 5J4SA 1A0JA 2QV1A 1C5TA 1OOKB 2ZDMA 1HNEE 5DK1A 2BXTH 2FDAA 1QRZA 2QXIA 1K1JA 3P95A 3K6ZA 4BNRA 2AH4X 2EC9H 4K8BA 1BTXA 1C5PA 2WPMS 2GTBA 3R0FA 4BTIB 3HKIB 3SU3A 1W0YH 2A0QB 1YCPM 4Y6DA 3E8LA 1HIAB 1W3CA 5B6OA 2Z9JA 2BOHB 1XMNB 1QRWA 1C2FA 1EZSC 5KECA 3LKWA 1O2IA 1A0HB 3TK6A 1D6RA 3FN8A 1TALA 3SYJA 1CGIE 2O8LA 2BD9A 2R2MB 2PSYA 3L3TA 4UFFH 3SI3H 2BD7A 2TGPZ 1C5WB 1SQTA 4PROA 3F2GA 1F2SE 1P10A 1GHBF 1YLDA 3SV6A 2XTTB 1GMHF 1XUIA 1AQ7A 4YLQH 1MD7A 5EW2H 2O8MA 2O8TA 1LPKB 2CHAB 2FEQH 3GY4A 1O3MA 4ASHA 4GLYA 1J15A 1O3NA 1DICA 2ZU2A 4FVDA 1ZRBA 2YMSB 2QN5T 2VIWA 1ABJH 2VIPA 2BLWA 3BV9B 4WVPE 1B7XB 5E8EH 1AKSA 1VKYA 5E0JA 5F8ZA 2UUKB 1V2PT 2ODQA 2XCFA 4K3JA 3RU4E 4K69A 3ZYEA 1DY8A 1QRXA 1G9IE 2BY5X 2WV9A 1QTFA 2HOBA 3FANA 1IHTH 1TPPA 3SU1A 2Y7ZA 3FP6E 1TONA 1CA8B 3SU2A 2ZCKP 1RRKA 2EI6A 1HAGE 2F4LA 2NU3E 2R9PA 1K9OE 3VB3A 1NTPA 4A7IB 3BTME 3OTPA 1CO7E 1FI8A 1KY9A 1VZQH 4IGDA 1GGDB 4K1TA 1BT7A 1NPMA 2VGCC 3GY7A 1QA0A 3F9EA 4CRBA 3QO6A 1HXFH 3SGAE 3RXGA 2XC4A 1XKAC 4XBCA 1Z6EA 4YLUA 1GJ9B 3DFJA 1AB9C 2VGCB 3SZNA 3UOPA 2V0BA 4NCYA 5GCHF 2WV5A 3GCTF 3AAUA 3SI4H 2WPIS 2P3TB 3SUFA 1XKBC 3DA9B 3GYLB 3S69A 4I33A 1AB9B 2JH6D 3SHAH 2XBVA 5EODA 3TH3H 1P09A 5I25A 1GCTC 1EJNA 2QA9E 3GY2A 2JJ1D 1MABB 1YC0A 3Q3YA 4CH2B 1GBIA 1O5FH 4AG2A 1BIOA 5FXLA 3O8BA 5L6NH 2H6MA 3ZZAA 3SQEE 1MTUA 2AHME 4YZUA 3URCA 4B74A 1RFNA 5T3HA 4I32A 3M7TA 5C67A 5C17A 1C5NH 2OQ5A 4TWYA 1AUJA 3H09A 3KQCA 1OWEA 3RC5A 1O3BA 2Z3CA 1Y8TA 4MPVA 1C2KA 4U32A 6LPRA 2TPIZ 1K1MA 1KMHB 4BAHB 2VNTA 2QCYA 3PWBA 1DOJA 1BCUH 4Y10E 4RN6A 1BB0B 4BAQB 4Q63A 3SNEA 5F6MA 1RIWB 3UUZA 2GT8A 2VH0A 4RSPA 4X1RU 1NFUA 2BVSH 3RMNH 3ZVDA 3KNXA 4DVAU 4FXGH 2ANYA 5DPAA 1EKBB 4Y7BA 4M9FA 1S83A 3TNTA 5GDSH 2ZPRA 3PRDA 4Y8XA 4JYVH 2DE8A 3BTQE 4XBBA 4ZXXH 4Q7XA 2VWNA 3BIVH 3PLKA 2K0QA 3M3VA 1NFYA 2STAE 3SNCA 2RA0A 5A2MH 3EE0B 1OPHB 3S9AA 5FHTA 1LHCH 1A3EH 3IG6B 4HI3A 4AX9H 1V2NT 1ETSH 1C1TA 2PLXA 1LVOA 3CS0A 3LOXA 1TA6A 2BX3A 3MMGA 4NZLA 3PO1C 3NWUA 3RC4A 3T5FH 5GPIB 4FUEA 1AKSB 3ATLA 3CENA 1EZUC 4Q7ZA 3RC6A 1BHXB 1C2GA 2FTMA 3ZZ6A 1GBEA 4AOQA 1NT1A 1SKYE 3PO1B 1O38A 2W6ID 1TQ0B 2XNIA 3UTUH 1O2JA 2F9BH 2JH5D 4YOGA 4UFGH 1JWTA 1ACBE 1OWJA 6CHAC 1TMTH 1TGBA 1F7ZA 1EJMA 1O2PA 4CR9A 3GYMA 1S82A 4YOIA 3MO3A 3BF6H 1B0FA 1YPHC 1FY5A 1SQOA 3SJ9A 5JBTA 3FOAA 3SGBE 3OEHD 3A7VA 1GI8B 1ANEA 2H5CA 1GMDF 1S81A 4IN2A 2SFAA 1GBCA 3RXLA 3ZZ5A 3VFEA 5A8XA 2FP7B 3PLPA 4QT8C 3SQHE 1O35A 3KQEA 3DHKH 2P3UB 2TIOA 2C8WB 1UK4A 3MH7A 1GBHA 5K0HA 2BZ6H 2QXJA 2PP6A 3PLBA 5JBCS 1AVXA 1COWD 1NN6A 3N7OA 4VGCB 2VJ1A 3MU1A 1OS8A 3M61U 1DANH 2BDBA 1G3DA 2BVXH 4ABJA 4XRNA 4ABGA 1UTLM 1SR5C 2O8UA 3ENSB 2PGQB 2W26A 3RXRA 4NSVA 4UEHH 1BRCE 1KTSB 2HLCA 5EW1H 1OKXA 4X2WA 5JBBS 4AGJA 5CDFE 4HGCA 2Q1JA 3SJKA 2O8WA 1DS2E 1N8OC 2QXGA 3PMJA 4AFSA 4MPXA 1O3KA 2PTNA 3LC3A 1B5GH 1X7AC 1YBWA 2J5UA 1K1LA 3FP8E 4GAWA 4K1EA 1RGQA 2FZZA 3JZ1B 2HLDD 2NWNA 2CN0H 2ZTXA 5DP8A 2QYIA 1QQUA 4Q80A 3STJA 2QF5A 1N8OB 3EGKH 2OCVB 1Z8RA 2PTCE 4WMEA 5EXNA 9ESTA 3I77A 5C5OA 1AE8H 4BANB 4CRDA 4Q7YA 2WSSD 2F83A 3RP2A 4ZHMU 3ESTA 2F9OA 1P2KA 1IQIA 2UWPA 2G4TA 5C0TA 1TBZH 1UK2A 2Q6FA 1O36A 1WTHD 2Y6TA 1YP9A 3VXEH 2BLQA 4OGYA 2CGAA 1V2ST 4UFEH 2BDAA 5AFZH 4DT7B 3UAIC 1YPGH 4JZFH 5F8XA 4M7GA 2IPQX 1ZYOA 1THSH 1LDTT 3V13A 2CF9H 1E36B 5DP3A 5GJ4B 3B9FH 3M5MA 1RD3B 3OU0A 4ZUHA 1CVWH 1IHSH 4X2VA 2FS8A 2WPJS 1QQ4A 4YOJA 4NFFA 3VXFH 1CE5A 1CHOF 2F9VA 4WMFA 3RLYH 1F0SA 1W11U 1NY22 1E79D 4MG3A 1IQNA 3UB0A 3QGJA 2BDHA 2QGRA 2ANMH 4B76A 4I86A 4Y76A 3KN2A 1FIZA 4Z0KA 2C8ZB 4LK4A 3KEEA 1J9CH 3D65E 2BM2A 1QURH 3BTEE 1IAUA 1QJ6B 5DP7A 3TGKE 1IQFA 1QL7A 1O3GA 4X1PU 5DO4H 1ELDE 2XC5A 1MQ5A 1SLVB 2KCYA 3KYFA 3MYWA 5DSFA 4Z6AH 1E34B 3ATKA 4FUFA 3NXPA 1KXBA 3SU0A 4U01A 4ISLA 1AGJA 1GHAG 3T25A 2P59A 3D23A 1Z7KA 2A5AA 3ELAH 4IC5A 3O8DA 4NWLA 2W3IA 1O2YA 1BRUP 2JDID 4ISNA 4IW4E 1S6HA 3TU7H 2M2AA 4O3TA 1ZPZA 1MD8A 4XOJA 5TCCA 1OP8A 1SGTA 4ZMAH 1VGCB 2ZCHP 3A7XA 1G3EA 8GCHF 4H6TA 4I8GA 5HMAA 1IQHA 1CT2E 2G5NA 2GZ8A 3QZQA 5C3NA 2FODA 4LXBH 2ILNA 4UDWH 4ISOA 1V2UT 2HPPH 2G5VA 4JK5A 1SGPE 4D8NA 1KIGH 3E91A 3I78A 3ZZ9A 3B8JA 1E38B 2OXSA 1G2LA 4Y79A 2ZZUH 1VCQA 1ZSJA 7GCHF 1C2EA 3ZZCA 3BEUA 4HZHA 2V7QD 2BD8A 1EAUA 1PYTD 3BTFE 1W10U 4TY7A 4TY6A 1PYTC 1GHVH 2AMDA 4ABDA 2CK3D 1Z6JH 1OX1A 9LPRA 2SNWA 2GMTC 4MNWA 1TIOA 1IQGA 1SC8U 3H5CB 1ANBA 3CS7A 1AE5A 1GMCG 3FFGA 1TGCA 2ZGCA 1JXPA 2BDYA 1GVZA 4HFPB 1UCYE 3D62A 1MUEB 2A4RA 2BDIA 4A92A 4WH8A 1MZDA 4GPGA 2XC0A 3BG4B 3MQKC 2VVCA 1FONA 3MU8A 1GJ8B 2Q6GA 1GJBB 3H7OA 3VB7A 1V2JT 1EPTC 3SV9A 1ZGVA 2GCHG 2WINI 2XBWA 5LPRA 3LPRA 1ELFA 1ZZZA 4CBOA 1KLIH 4WXVA 1KXAA 1Q31A 3F2HA 3F9GA 3LONA 4YT7H 5CHAC 1W14U 1K1PA 5HYOA 3A88A 1GBKA 1T8LA 1TMUH 5DKMA 1FX0B 1VITF 1AFQB 1W0KD 2GZ7A 5ETXA 1P3CA 3F1SB 1C2IA 1W7XH 3ZVFA 1EJAA 1TRMA 3DSGA 2FOMB 4JZ1A 2AEIH 2KX4A 4Y0YE 5G4BA 3EDXB 4XBDA 5A0CA 1U6QA 1LVMA 1HJAC 1Z8JB 2B5TB 2Q6DA 1NRRH 2LP6A 4XD7D 4A1TA 2GVFA 2AGIX 5FX6A 1CGJE 1PQ5A 3M35A 2NU4E 1PPBH 1O5EH 1LKAA 3UNRA 5EOKA 4ABAA 1EP6A 3TVJB 1K2I1 2JETB 3RM2H 3URDA 5PTPA 1O3LA 4R0IA 1O5CB 2BQ6B 3M3SA 2H1UA 4WF8A 2JJ2D 1OWIA 1BMMH 2BQ7B 1C9PA 4O9VA 3MH4A 2XXLA 1S5SA 3SU6A 3A89A 4WMDA 5E0GA 1PJPA 1GHBG 4ACAA 5FPSA 1TX6A 1KYNA 3A7WA 5C1XA 1FMGA 2SGPE 2HPQH 1DUEA 1NRNH 3OTJE 3UWIA 3ZVGA 2J2UA 1V6DA 3NCLA 4GCHF 2OBOA 1DE7H 2P94A 2AERH 3LIWA 3FZDA 3RXPA 5JPMH 1SGFA 1GI5A 4K8YA 2ZP0H 1XM1A 3U8RH 1JIRA 1TRYA 4AB8A 3U1JB 3BSQA 1CBWC 1O2HA 1SMFE 1FNIA 2FLBH 1BDAA 3BTWE 5CHBA 1QIXB 3GDVA 5L30H 1TABE 2J4IA 2WPLS 4X6MA 5HKKD 1QZ8A 3SBKA 7LPRA 4WWYA 4I8JA 2Z9IA 2FYQA 3NKKA 1AI8H 1O2GH 4ISIH 2BY6X 3SGQE 4WY3A 3TPIZ 1EFRD 1BTHH 1H8ED 1P03A 2OTVA 4JYUH 2WPKS 1ID5H 1UMAH 2VVVA 3T28A 1G30B 1DLKB 1XVMA 4AFUA 4X1NU 1F0UA 3IWMA 2YNAA 1MKWH 1WU1A 2CJIA 2TBSA 2ZHEH 3A85A 1GDUA 1AVWA 3UREA 2FWWA 3E0NB 4K2YA 3SU5A 1IQJA 4RKJB 1BRBE 1UTPA 4YT6H 3MI4A 1O2LA 1EXFA 1TBRH 4CBNA 2ZFQH 5C20A 1UTMA 5DP4A 2ZDNA 4SGBE 2A7JA 5GCHG 3GCTG 3RXIA 2CMYA 3AAVA 2GDEH 1ESBA 1MCTA 1YF4A 1KXDA 4F49A 1GG6C 1BITA 1AMHA 2XWAA 1QBNA 4ACBA 4HG6A 1C5ZB 1V2MT 2RA3A 3M37A 3Q3KA 3V0XA 5I46H 5TCAA 2PSXA 1O37A 1PPGE 2D26C 2GP9B 3UOUA 4Y8YA 1AWFH 2YOLA 4F48B 2J95A 1O31A 1NU9A 2W3KA 4BAKB 1GHWH 1O3PB 2GV6A 1Q3XA 1AD8H 4OM9A 3PV2A 3EE7A 3OSYA 4OGXA 1DUAA 3FO8D 2FMJA 1MU6B 2VWOA 1P2QA 4Y8ZA 2EEKA 1SQAA 1GI2A 1TB6H 5LH8A 1C5UA 1TPOA 2KCPA 1SLXB 1O5AB 2JIZD 2OC8A 2GJGA 4DCDA 3RM0H 4ABFA 1H9HE 4I7YH 2WPDD 4K5ZA 2ZC9H 4MVNA 5AFYH 3NZIA 2ZEBA 4MQAA 1AU8A 3ZVBA 1DDJA 3VB4A 2BYAX 1PPCE 5E2PA 1F92A 3QWCH 1P05A 1C5XB 1P57B 1TGSZ 1GBDA 1AUTC 3A84A 1XVOA 2A1DB 2PV9B 1BMAA 3KQ5A 1CGHA 3LJJA 1C1RA 2TGAA 4B2BA 1GCTB 2SGAA 1MTVA 2V3OH 2ZFRH 1TE0A 4OS1A 5T1VA 1W12U 2DUCA 2ZKSA 3ZZBA 8KME2 1E37B 1YPKH 4B73A 1V2KT 2ZDAH 5DJ7A 2B0FA 1EP5A 3KGPA 1GI1A 3GY8A 4KKDA 3BTDE 4B1TA 3L33A 3R3GB 1HRTH 2HNTC 2IN2A 1YLCA 1ZHMA 1W13U 4E7RG 2J92A 1BOQA 3A7YA 1BMLA 4Z1MD 2W6JD 3MO9A 1XXDA 4NIXA 1NM6A 3UNQA 1FZZA 2ZNKH 3T27A 6GCHF 1C5OH 1IQEA 1QNJA 1V2WT 1WUNH 2EQNA 1EOJA 1JRSA 1QB6A 2AMPA 4FVBA 1DWCH 3PV5A 5F53A 2OD3B 1HAVA 1SLUB 1GI4A 2OP9A 3C1KA 4AG1A 3I29A 1MKXH 3P8GA 2A31A 3BN9A 1G36A 3RXFA 2FM2A 2XYAA 3HKJB 2JKHA 1L4ZA 1FDPA 3Q3XA 3LT3A 3M7QA 3RXSA 1FY1A 2FOEA 2ZDVH 2W5EA 1LPGB 5IYTA 3GY3A 3F9FA 3F9HA 1SHYA 5GNDA 2HWLB 5L2ZH 3F0PA 5C5NA 1S0QA 4ASUD 1QL8A 3U1IB 2F9PA 2TGDA 2NU2E 1HAZB 1V2TT 1GVKB 2L6OA 3PROA 1NRPH 1O3EA 1K1OA 2BY7X 2FESH 1VCWA 1C1MA 2G8TA 2Z9LA 1MTWA 1OP2A 3KHVA 1ESTA 1A1RA 1L1GA 4X6OA 2ZFFH 2SGFE 2A4OA 4ZXYH 3T2NA 1Y5BT 3W95A 3RXJA 1SOZA 2PKSC 3MTYA 1MQ6A 1LO6A 1LVYA 1G2MA 3TGJE 1C1PA 4TSFD 2BOKA 3MFJA 1Y5AT 1Y3XA 4TT3D 4AFZA 3M3TA 5DP6A 3S7KB 3A8AA 1IQLA 4J2YB 6CHAB 5HXFA 3GCOA 2ZU5A 4NIWA 2G55A 1ORFA 3RDZA 1OWDA 1HDTH 4K1SA 2NU1E 5F8TA 4DIHH 1EZQA 2STBE 1C1SA 3QN7A 1UCYH 1YPEH 2OLGA 5EQSA 4IC6A 1EB2A 5EXLA 3VPKA 2XW9A 5EJ1A 3OAAD 4JYTA 3TJNA 4D9QA 2ZTZA 1GHYH 1ETTH 3F68H 3DUXH 1ZTLA 1TPAE 1T8MA 2A45B 4YESB 3MO6A 4D76A 1KDQA 4ZCNA 5JYIA 3TITA 1MBMA 4ZKRU 4OS4A 1WXRA 3A8DA 2J97A 3A80A 2G81E 3ZZ4A 1C5QA 4MPUA 1UTNA 2ZU1A 1MKXK 4YM9A 1TGTA 1P2IA 1TNKA 1S84A 2HALA 4DIIH 1F5RA 2ZDLA 3ZVAA 1ABIH 3JZ2B 2FOAA 1V3XA 1TNLA 3RUOA 1CHOG 1GWAA 1HAXB 1TX8A 1ARBA 4FU7A 3U8TH 1GI0A 4CRAA 3EA8A 1YPLH 1HV7A 3F3BA 5FBEA 1YKTA 4DGJA 1O3DA 5E2OA 1V2RT 1D9IA 5LPEA 1O3AA 3QTOH 2BQWB 2G52A 1CQQA 2ZQ1A 2VVUA 1O0DH 5GIBA 1MTNC 1SGEE 5BPEA 2ANKH 1C1OA 2V3HH 3RMOH 4YTAA 1DY9A 3D49H 1EPTA 3RXEA 1J14A 2I6SA 3SW2B 1QA7A 5HIYA 5GXPA 1ZTJA 1ELEE 1O2MA 1MMJN 2C8YB 2GCTC 3RXKA 1T31A 1MTNB 5EG4A 3S7HB 1O32A 2C8XB 3P6ZB 3N99A 5EJZA 2UWLA 4HTCH 5HGGA 1AHTH 1G3BA 1O2TA 5KGOA 2VBCA 2G4UA 4Q2KA 1PPZA 1G32B 4CRCA 1V2OT 2WV4A 2D2DA 1BMNH 1HB0B 2ZPSA 3PTNA 1EASA 1GJ7B 2HNTF 1NS3A 1E1QD 1W2KH 1OYQA 2VIOA 1UW7A 2PR3A 1ANCA 1J17T 1KLTA 1C2HA 3UPEA 1WSSH 4IMZA 1ZRKA 6ESTA 5T6FA 2HRVA 8GCHG 1RTKA 1V2VT 3P70B 4I8LA 3MNXA 1Y3WA 1UVUH 1H8DH 1O34A 4OS2A 3NPSA 3LC5A 1LVBA 3KIDU 4BAOB 2ZA5A 1DM4B 1ZPBA 1K28D 1O2KA 4E06H 3MHWU 2XBYA 4DW2U 1DITH 7GCHG 3ZV9A 1KTTB 2ZG0H 1FN8A 1C1QA 1V2LT 2AYWA 1LMWB 1T8NA 2C93B 3L6PA 3C27B 3MU0A 1LCYA 3A87A 3HGNA 4UE7H 4AC9A 2C90B 1GPZA 3RU4D 2BXUH 3QGNB 1UJ1A 1L4DA 4TWWA 1OP0A 3OEED 4F55A 1OWHA 3MU4A 4X6NA 3VG8A 1GI7B 1QJ1B 4GVUA 3SUGA 2BHGA 3BTHE 3E90B 1C5SA 2R2WU 1GBFA 1BBRH 1FQ3A 3TJUA 5JDUB 3IITA 3DD2H 2AIQA 2HVYB 2O9QA 1ARCA 2J9NA 2FIRH 3U8OH 2ZFPH 1P3EA 2C3SA 1TMBH 3RXAA 2ODYB 5C2ZA 5HIZA 3OX7U 1DWDH 2AS9A 4X2XA 4UFDH 3HK3B 1BTZA 4JMYA 1OHHD 1QBVH 1KDQB 2XBXA 1JMOH 2R3UA 1HAIH 3LGYA 1CA0C 4INLA 1HBTH 1ZMNA 2KCOA 1T4UH 3PMBB 1VITG 1H9IE 1AZZA 1P0SH 1C5VA 5A09A 3GCHC 1LKBA 1A5GH 1ETRH 3RU4T 1UTQA 3Q76A 4ZKSU 3UR9A 2ZU4A 1Z71A 1QBOA 3M5NA 1WBGB 1K1IA 2FOGA 4D7GA 3P8NA 5A8YA 3N7EA 2AMQA 1E0FD 1TOMH 3UQOA 1KSNA 3A7ZA 2GMTB 3AASA 2V35A 3U69H 2BD2A 1NROH 1ANDA 1CHGA 4WJG2 3TJOA 1HUTH 1M9UA 1P2OA 2GDDA 2P8OC 2PGBB 4B6EA 4Y11E 1YPHE 3RXQA 4CR5A 3AW1A 4BTUB 3LU9B 1DPOA 2KM0A 3W94A 1GI3A 5F03A 3SUDA 1D6WA 4FU8A 1VR1H 4A5TS 3M5LA 3K2UA 1C5LH 3RLWH 1BUIA 1TOCB 3Q77A 1QHRB 4U2WA 1ZMLA 1NC6A 1EPTB 3NRLA 1TRNA 1SG8B 4H4FA 1D3QB 2K8IA 2KZ4A 1CSOE 1FN6A 1C2MA 4KTCA 2SGEE 1AN1E 2RCEA 5CHAB 4GCHG 3HGPA 2A7HA 3P17H 1XUGA 1BMFD 2F3CE 5ESBA 3TH2H 5CMXH 3QX5H 1ESAA 2FTLE 1YPJH 2ZGHA 5KEDA 2J38A 5C1UA 2XRCA 1S6LA 1WCZA 4RI0A 4DG4A 3FAOA 3T29A 1GBMA 1NFXA 2ZI2H 3EA7A 2ASUB 1EAIA 3MNSA 4BOHA 4AN7A 1OSSA 1Y3UA 5E0HA 1MZAA 1HJAB 1DXPA 3LH3A 5LGOA 1WAYB 1V2QT 1P2MA 1SBWA 2A2QH 4DT4A 1XUHA 2J34A 1HLTH 1O2SA 2ZPQA 1S0RA 4R8TB 2IOTA 5C94A 1DWEH 1ZSLA 2WPHS 4B2AA 2GZ9A 1UTOA 1TA2A 3MU5A 2Y80A 1DFPA 2F9NA 1Z1JA 1N6YA 1AO5A 1GMHG 4MNXA 5TJXA 1S6FA 4DY7B 1YYY1 5A0BA 1H4WA 1KXCA 2Y5HA 3QUMP 4X8TH 1A4WH 2FYRA 3RXOA 1W0ZU 1QL9A 3RMMH 5EGMA 3NUMA 3SJ8A 5FX5A 3T26A 1P04A 4ISHH 5IDKA 2WZQA 3BEIB 2RG3A 4JZDH 3GCNA 1YLNA 4O03A 3SNAA 2OBQA 3ZZ3A 5SGAE 1SGYE 4Y7AA 1SGRE 4E7NA 3CP7A 3RXHA 3SNDA 2PUXB 4TYDA 4IN1A 5DG6A 2FI4E 4J1YA 1PQAA 1O2QA 2B9LA 1OXGA 4K60A 1ZGIA 2J94A 3M5OA 1C4U2 4AYYB 1BTUA 2VU8E 4B6FA 1CBWB 1PQ8A 2FOCA 5FCKA 2TRMA 3KL6A 1NESE 1T4VH 3QDZB 4BAMB 1A2CH 4MDSA 3K6YA 5L2YH 1SGIB 3UQVA 1LHFH 1NRSH 3A8CA 2ZDKA 4UD9H 1O5DH
chains in the Genus database with same CATH topology
4XD7D 3SUDA 4A1TA 3O8RA 2QV1A 3M5LA 2A4GA 4A1XA 2GVFA 2J5UA 5B6LA 5H4IB 1RGQA 1W0JD 2A4QA 2HLDD 3NRLA 5FPTA 3LOXA 2K8IA 4ZCNA 2KZ4A 4YXWD 2QF5A 3PV5A 5F53A 1RTLA 2KFWA 1WXRA 4KTCA 3RC4A 4K8BA 5FL7D 3WW7A 5GPIB 5IK2D 4WF8A 4Q4LA 5EPYA 2JJ2D 1CU1A 2FM2A 2YOLA 3SU3A 3L6PA 1BMFD 3RC6A 2WHXA 2YMSD 3SUFA 5ESBA 3WWBA 2WSSD 3SU6A 2YMSC 1W3CA 4I33A 5C0TA 3WWFA 1SKYE 3LKWA 4FETA 5FPSA 3SU4A 1S6LA 2W6ID 3OEED 4RI0A 4F55A 3SV8A 2XNIA 4B6FA 3DCLA 3OE7D 4OM9A 5EQRA 3FN8A 3PV2A 2V7QD 3VG8A 3SYJA 5GNDA 2JJ1D 1MABB 3SUGA 2K1QA 2OBOA 3PRBA 3E90B 2XOKD 1H8HD 3FO8D 4NWKA 3F0PA 2KR7A 5EPNA 4ASUD 3U1IB 2LELA 3F3BA 3O8BA 1DXPA 3F2GA 4A1VA 2CK3D 2XNDD 5GJ4B 3M5MA 4DT4A 3U1JB 2L6OA 3SV6A 2AHME 3FKSD 4R8TB 3N7DA 2IJD1 2KCPA 4B74A 5CHBA 2F9UA 1N1LA 3DSPA 2F9VA 2JIZD 2O8MA 4I32A 2OC8A 5C17A 1JXPA 2IJOB 4B71A 1NBMD 1E79D 2OC7A 2WPDD 3H09A 4JMYA 3DSOA 3O8CA 1OHHD 3RC5A 5HKKD 1A1RA 3ZIAD 3FOAA 2A4RA 4WH6A 3UB0A 4A92A 4WH8A 3OYPA 1DY9A 3OEHD 3SV7A 4B76A 1KMHB 3KN2A 2KCAA 2KCOA 4I31A 2FP7B 2YMSB 3GS9A 3KEEA 2OC1A 5IDKA 1EFRD 1H8ED 3SV9A 2QF4A 1E1RD 2WZQA 2OBQA 3N99A 4TSFD 3W1EA 3SZEA 2GGVB 2XCFA 2KCYA 2QE7D 1COWD 1NBME 3F2HA 3LONA 4Q63A 4TYDA 4TT3D 5DSFA 2VBCA 5T1VA 1DY8A 5FPYA 4B75A 2WV9A 4B73A 2OC0A 3M5NA 1DXWA 5C0UA 3EYDA 3P8OA 3P8NA 3N7EA 3KF2A 2OINA 2F43B 1NS3A 3KNXA 1E1QD 3M5OA 1FX0B 3OAAD 4U01A 5EQQA 3SU0A 2XCNA 1W0KD 3F2FA 4M9FA 5ETXA 3SU1A 3SU2A 5EQSA 3SUEA 5CDFE 2F4LA 2P59A 3PRDA 3SU5A 5DN6D 2OK5A 3OTPA 3F0OA 3O8DA 4NWLA 2FOMB 4B6EA 2JDID 4Z1MD 1BT7A 2W6JD 2K0QA 3OFND 2M2AA 3AK5A 2KM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSO A;  3N7E A;  3DSP A;  2LEL A;  2K0Q A;  3N7D A;  2KM0 A; 
#chains in the Genus database with same CATH topology
 1K22 H;  2A5K A;  3LGI A;  3B23 B;  4NA9 H;  1WV7 H;  4A1X A;  1S85 A;  4NA8 A;  3UNS A;  4FUG A;  3SV2 H;  2GX4 A;  5DP5 A;  1L0Z A;  3ITI A;  3TJV A;  3HK6 B;  2CHA C;  1O5B B;  4XE4 A;  3GOV B;  1ZHP A;  5BRR E;  4JK6 A;  1FPH H;  2YMS D;  4P00 A;  1ZR0 A;  1EZX C;  2ANW A;  2YMS C;  4NGA H;  3V3M A;  1HAY B;  3TNS A;  3MH6 A;  4FET A;  3SU4 A;  3K9X B;  4FUB A;  1BBR E;  1P11 E;  1MBQ A;  3PRB A;  1A7S A;  2BDC A;  1H8H D;  1UK3 A;  1GDN A;  3GIS B;  2H9E H;  3BEF B;  3F6U H;  1WOF A;  1THP B;  3SHC H;  2FX6 A;  4X8S H;  5K7R A;  1HAH H;  3S9B A;  2JH0 D;  3SJI A;  1ZPC A;  3SJO A;  3N7D A;  2AGE X;  2IJD 1;  4GHQ A;  1DWB H;  1O39 A;  5A0A E;  1GJC B;  1GG6 B;  3DSP A;  3A8B A;  1F0R A;  1GGD C;  3KQD A;  1GJ6 A;  1H9L B;  1NBM D;  2OC7 A;  3S9C A;  1LPZ B;  2Y5G A;  1IQK A;  1QFK H;  3OYP A;  1RJX B;  1A5I A;  1HYL A;  3LDX H;  2I6Q A;  2UUY A;  4I31 A;  1O2W A;  5DP9 A;  2ZHW H;  2OC1 A;  1PPE E;  4OS5 A;  3STI A;  4FUJ A;  5JBA S;  5CE1 A;  1DVA H;  5J4Q A;  1C1N A;  1LHE H;  3UWJ H;  1P2J A;  1SI5 H;  3SZE A;  4H42 U;  1KXE A;  3M36 A;  2A2X H;  3BTK E;  4ZH8 A;  1GBT A;  1EOL A;  2H2Z A;  4WXI A;  1O3I A;  2EI8 A;  5A8Z A;  1GBL A;  1P8V C;  1A3B H;  2FOB A;  4KTS A;  1TNG A;  1FPC H;  6GCH G;  2XCN A;  1D3T B;  3WY8 A;  2LNC A;  2F91 A;  3TK5 A;  4OS6 A;  4DOQ A;  8LPR A;  4INH A;  2OK5 A;  2Y5F A;  4GHT A;  1LHG H;  1LTO A;  1TNI A;  3U9A H;  4FOU C;  4O97 A;  4BXS A;  4INK A;  3TLO A;  4CRF A;  1YM0 A;  3QLP H;  2BTC E;  2DE9 A;  2P3F H;  4D7F A;  2Z6B D;  2Z7F E;  1O2X A;  2A4G A;  1O3H A;  5B6L A;  2M5T A;  4AOR A;  4DJZ B;  1MKW K;  1SFQ B;  3CNR A;  1QGF A;  2HVX A;  2RDE A;  4SGA E;  3VGC C;  1FY3 A;  4YXW D;  1EB1 H;  1EQ9 A;  3ZV8 A;  1EAT A;  1SOT A;  1Z8G A;  4NSY A;  1THR H;  4XSK U;  1TLD A;  4JZE H;  3ZZD A;  1UVO A;  4MLF B;  4X1S U;  3GY5 A;  8EST E;  3NK8 A;  4U30 A;  4YO9 A;  4NIV A;  2WHX A;  4RT0 A;  5EXM A;  1Y59 T;  4ZAE A;  1NZQ H;  1O2Z A;  1ELT A;  4RKO B;  3VGC B;  4EST E;  4ZHL U;  1J16 A;  1GI9 B;  4MNV A;  3WWF A;  1WQS A;  2KAI A;  3EA9 A;  4CRG A;  4ABH A;  4NG9 H;  1AVG H;  4ZRO A;  2EST E;  1TNH A;  1C2L A;  1JIM A;  1RIW C;  3M7U A;  2EI7 A;  3A81 A;  1L1N A;  3MNC A;  1ELC A;  1GVL A;  1G37 A;  2LEL A;  4A1V A;  1TYN A;  2XND D;  1NRQ H;  3GY6 A;  1A46 H;  1XXF A;  1EUF A;  4X2Y A;  1HCG A;  1F5L A;  2PW8 H;  1DST A;  3EQ0 H;  2J98 A;  4XFQ A;  1GBB A;  1BJV A;  1ZTK A;  2ZF0 H;  3OY5 U;  1F0T A;  2P93 A;  3EAJ A;  1HJ9 A;  2PKA A;  2H5D A;  2A5I A;  1C5Y B;  3DSO A;  4NFE A;  2QY0 B;  1NU7 B;  1C1U H;  1VJA U;  2LPR A;  3SN8 A;  4KTU A;  1L1J A;  1GJ4 H;  2ZGJ A;  1UVP A;  2Z3D A;  1HAO H;  1K0H A;  4NZQ A;  3VB6 A;  1JBU H;  3KCG H;  3W1E A;  1GMD G;  1GHX H;  1ZJK A;  3TK9 A;  5GWZ A;  1FAK H;  3G01 A;  2PHB A;  1SB1 H;  5EST E;  3HPT B;  3UFA A;  2B7D H;  3P8F A;  1QY6 A;  1YGC H;  4TPY A;  1P12 E;  3P8O A;  1VJ9 U;  4FUI A;  1MH0 A;  3PWC A;  1O30 A;  3HAT H;  5EQQ A;  5DGJ A;  5T6G A;  1T32 A;  2WYJ A;  2ZGX H;  1ELA A;  2FOH A;  4NA7 A;  3H7T A;  1MTS A;  4B2C A;  1PPH E;  3F0O A;  2W7U A;  1HAP H;  5AVD A;  3UIR A;  1SFI A;  1DSU A;  3TH4 H;  4FU9 A;  2ZTY A;  1ZJD A;  1OWK A;  1UVS H;  5EJL A;  4CRE A;  2Y82 A;  2H9T H;  2VIV A;  1QJ7 B;  3FZZ A;  2PKS B;  4XDE A;  2NU0 E;  5FPT A;  3U98 H;  3UY9 A;  2R3Y A;  1TAW A;  2ZGB H;  4FUH A;  3FVF B;  1TBQ H;  1N6X A;  1RTL A;  2BY8 X;  1A5H A;  3E3T A;  3KQB A;  5LPF A;  4E05 H;  3BTT E;  1NFW A;  1CU1 A;  3ZVE A;  1UHB A;  1Y3V A;  2R0K A;  2L74 A;  3E16 B;  1KLJ H;  7EST E;  2ZHF H;  4LZ1 H;  2OUA A;  1ELV A;  2BMG B;  1UTJ A;  3E6P H;  1O3F A;  1Z1I A;  5EQR A;  1PFX C;  3LGT A;  2BX4 A;  3PMA B;  4VGC C;  2BZA A;  4KEL A;  1CT4 E;  4DUR A;  1P01 A;  2XOK D;  2OQU A;  3SOR A;  1DT2 A;  2GT7 A;  4CH8 B;  2QAA A;  2GKV E;  2PFE A;  5JB8 S;  2ZU3 A;  5FCR A;  4CHA C;  1ZMJ A;  2ZCL P;  4IBL H;  1SGF G;  4LOY H;  4I8H A;  5HM2 A;  4X0W U;  1N1L A;  1BTP A;  2V6N A;  4KP0 A;  1JOU B;  1XX9 A;  2B8O H;  5AF9 H;  1RXP A;  3QZR A;  2FO9 A;  2IJO B;  3U28 C;  4B71 A;  3O8C A;  1KXF A;  2PWX A;  1OYT H;  4I8K A;  4CHA B;  3SV7 A;  1WTG H;  2HGT H;  2QIQ A;  1ELB A;  1C4Y 2;  1QR3 E;  2VID A;  1UVT H;  1VIT H;  2QF4 A;  1E1R D;  2P95 A;  1Y3Y A;  1SGN E;  3PYH A;  1HJ8 A;  1DX5 M;  4X6P A;  2QE7 D;  1NBM E;  1ZSK A;  2ZQ2 A;  1LHD H;  1RTF B;  2KAI B;  1GDQ A;  1C4V 2;  4GSO A;  2OC0 A;  1SQR A;  1DXW A;  3SOS A;  1UTK A;  2ZFT A;  2QC2 A;  1RS0 A;  1O2N A;  2WUB A;  2OIN A;  2EA3 A;  1VCP A;  3FP7 E;  2AFQ B;  1HAV B;  5T6D A;  1A0L A;  1SGC A;  3RXC A;  5AHG H;  1SVP A;  2XWB I;  1AFE H;  1ELG A;  1SGD E;  2THF B;  1BJU A;  1YCP H;  4MTB A;  2SGD E;  2J98 B;  3E1X B;  3VEQ B;  1FIW A;  2FX4 A;  1W8B H;  2YNB A;  3O8R A;  1BZX E;  1EX3 A;  1HPG A;  1P2N A;  2PKA B;  2ZFS A;  5H4I B;  3A86 A;  4ZHA A;  2G00 A;  1W0J D;  2VWM A;  2GD4 B;  2GCT B;  1K21 H;  2C4F H;  1SGQ E;  3K65 B;  2BVR H;  2BLV A;  2CF8 H;  1O3O A;  1UCY K;  2FI3 E;  2FPZ A;  3WW7 A;  4IS5 A;  1TWX B;  2Y81 A;  2H9H A;  4H6S B;  4AFQ A;  4Q4L A;  5EPY A;  1GJD B;  2FS9 A;  1H8I H;  3A7T A;  4BTT B;  2ZO3 H;  3V12 A;  2WYG A;  3RXU A;  2AGG X;  2FI5 E;  3TIU A;  1C9T A;  1O3C A;  2ULL A;  1MAY A;  3ATW A;  1K1N A;  3QK1 A;  1C5M D;  3SV8 A;  2VB0 A;  3DCL A;  3OE7 D;  1FY4 A;  1L2E A;  3SNB A;  2HNT E;  3RXV A;  7KME H;  2K1Q A;  1GBA A;  5EPN A;  3SO3 A;  2TGT A;  2UUJ B;  1P02 A;  3ODD A;  4Y71 A;  2IPH A;  1NO9 H;  3FKS D;  1P9S A;  2ZHD A;  3TGI E;  1EAX A;  4O3U A;  5FAH A;  2F9U A;  1C2J A;  4ZKO U;  2A7C A;  2EY4 C;  1MU8 B;  1YWU A;  4MPW A;  1F5K U;  4A6L A;  1DLE A;  4ZKN U;  4AZ2 B;  4GUX A;  2FLR H;  3ZZ8 A;  1IOE A;  1O33 A;  2Z9G A;  3AW0 A;  1UO6 A;  1W7G H;  1VGC C;  4THN H;  2RFK C;  1XUJ A;  3GDS A;  1FY8 E;  1LQE A;  1TQ7 B;  1GCD A;  4ABB A;  1CT0 E;  1ZLR A;  3VB5 A;  1UHB B;  1TPS A;  1BHX F;  1FAX A;  1AY6 H;  3ZYD A;  1HIA A;  1QB9 A;  5FPY A;  4ABE A;  1O2R A;  5C0U A;  2VWL A;  2BD4 A;  1PPF E;  2V3M A;  1INC A;  1BTY A;  2F43 B;  2RDL A;  1T8O A;  3GIC B;  1E35 B;  2BB4 A;  1BQY A;  2Z94 A;  3RXD A;  3LJO A;  4AYV B;  1XUF A;  1SSX A;  5DN6 D;  1PQ7 A;  1BRA A;  4OS7 A;  2UWO A;  3T62 A;  1J8A A;  1YCP K;  1ZHR A;  3OFN D;  3RXB A;  3AK5 A;  3AVZ A;  1XUK A;  3ATI A;  3LGU A;  5EU8 A;  3BG8 A;  1SHH B;  3MH5 A;  1CA0 B;  4F4O C;  1SPJ A;  1GHA F;  1G3C A;  3RXM A;  4TPI Z;  2A4Q A;  4AB9 A;  1P06 A;  1O5G H;  2BY9 X;  1FUJ A;  3GDU A;  3GCH B;  3MWI U;  2KFW A;  2CXV A;  1O2O A;  3RXT A;  2QF3 A;  1SLW B;  2P16 A;  5FL7 D;  2W7S A;  5IK2 D;  1GJA B;  3LGV A;  1GHZ A;  3BG4 C;  5JB9 S;  1AZ8 A;  3WWB A;  3ATM A;  1WDI A;  5EIY A;  1B0E A;  3LGW A;  1GL1 A;  1FJS A;  2D1J A;  2Z3E A;  4UON A;  3P92 A;  2SNV A;  1LQD B;  1ZOM A;  3OY6 U;  1BTW A;  4Y0Z E;  2QF0 A;  4P02 A;  3A83 A;  4BXW A;  2P8O B;  3A82 A;  1C2D A;  4X8U H;  4MNY A;  2BDG A;  2PUQ H;  4NWK A;  2KR7 A;  1FLE E;  3PMH B;  1D3P B;  1Z8I B;  4LZ4 B;  1HFD A;  2VIQ A;  3KYG A;  1AFQ C;  1AWH B;  2Y7X A;  1FV9 A;  2GV7 A;  4FUC A;  1YPM H;  3ODF A;  1HGT H;  4IMQ A;  1D3D B;  1JRT A;  1HXE H;  2AIP A;  1YY3 A;  1SL3 A;  2VH6 A;  3UR6 A;  1GJ5 H;  3MNB A;  2SGQ E;  1MCV A;  1A61 H;  1O2U A;  3S0N A;  2WUC A;  4ABI A;  1GL0 E;  1WYK A;  1GI6 A;  3ZIA D;  2CV3 A;  4WH6 A;  3ZZ7 A;  1IQM A;  4D9R A;  1TX7 A;  1P9U A;  2VIN A;  3PB1 E;  4NIY A;  4X8V H;  5C1Y A;  2KCA A;  2BLO A;  2BD5 A;  2G51 A;  3GS9 A;  1BBR K;  1D4P B;  3PM3 A;  1TNJ A;  1C1V H;  1GMC F;  2FXR A;  1Y5U T;  4JZI A;  2QXH A;  1FXY A;  2R0L A;  2ALP A;  2GGV B;  4RT1 A;  4AGK A;  2JET C;  2BD3 A;  1O2V A;  1T7C A;  2ODP A;  3V7T A;  2ALV A;  3E0P B;  1AIX H;  4FUD A;  4B75 A;  1MAX A;  3QTV H;  1GBJ A;  1QCP A;  3EYD A;  2UUF B;  3MOC A;  3KF2 A;  1H1B A;  1WQV H;  3PV4 A;  2Z9K A;  2GCH F;  2ZHQ H;  3DT0 H;  2A32 A;  3F2F A;  5FBI A;  1Q2W A;  3SUE A;  2ZEC A;  4JCN A;  3Q00 A;  1BA8 B;  3BIU H;  1C5R A;  4KGA A;  3ZVC A;  3RML H;  5HM9 A;  2D8W A;  1EAW A;  5ABW A;  3PTB A;  4X1Q U;  1O3J A;  2ZWL H;  1TFX A;  1QB1 A;  1C1W H;  2FOF A;  2ZIQ H;  3LH1 A;  1TGN A;  3BTG E;  3DFL A;  5J4S A;  1A0J A;  2QV1 A;  1C5T A;  1OOK B;  2ZDM A;  1HNE E;  5DK1 A;  2BXT H;  2FDA A;  1QRZ A;  2QXI A;  1K1J A;  3P95 A;  3K6Z A;  4BNR A;  2AH4 X;  2EC9 H;  4K8B A;  1BTX A;  1C5P A;  2WPM S;  2GTB A;  3R0F A;  4BTI B;  3HKI B;  3SU3 A;  1W0Y H;  2A0Q B;  1YCP M;  4Y6D A;  3E8L A;  1HIA B;  1W3C A;  5B6O A;  2Z9J A;  2BOH B;  1XMN B;  1QRW A;  1C2F A;  1EZS C;  5KEC A;  3LKW A;  1O2I A;  1A0H B;  3TK6 A;  1D6R A;  3FN8 A;  1TAL A;  3SYJ A;  1CGI E;  2O8L A;  2BD9 A;  2R2M B;  2PSY A;  3L3T A;  4UFF H;  3SI3 H;  2BD7 A;  2TGP Z;  1C5W B;  1SQT A;  4PRO A;  3F2G A;  1F2S E;  1P10 A;  1GHB F;  1YLD A;  3SV6 A;  2XTT B;  1GMH F;  1XUI A;  1AQ7 A;  4YLQ H;  1MD7 A;  5EW2 H;  2O8M A;  2O8T A;  1LPK B;  2CHA B;  2FEQ H;  3GY4 A;  1O3M A;  4ASH A;  4GLY A;  1J15 A;  1O3N A;  1DIC A;  2ZU2 A;  4FVD A;  1ZRB A;  2YMS B;  2QN5 T;  2VIW A;  1ABJ H;  2VIP A;  2BLW A;  3BV9 B;  4WVP E;  1B7X B;  5E8E H;  1AKS A;  1VKY A;  5E0J A;  5F8Z A;  2UUK B;  1V2P T;  2ODQ A;  2XCF A;  4K3J A;  3RU4 E;  4K69 A;  3ZYE A;  1DY8 A;  1QRX A;  1G9I E;  2BY5 X;  2WV9 A;  1QTF A;  2HOB A;  3FAN A;  1IHT H;  1TPP A;  3SU1 A;  2Y7Z A;  3FP6 E;  1TON A;  1CA8 B;  3SU2 A;  2ZCK P;  1RRK A;  2EI6 A;  1HAG E;  2F4L A;  2NU3 E;  2R9P A;  1K9O E;  3VB3 A;  1NTP A;  4A7I B;  3BTM E;  3OTP A;  1CO7 E;  1FI8 A;  1KY9 A;  1VZQ H;  4IGD A;  1GGD B;  4K1T A;  1BT7 A;  1NPM A;  2VGC C;  3GY7 A;  1QA0 A;  3F9E A;  4CRB A;  3QO6 A;  1HXF H;  3SGA E;  3RXG A;  2XC4 A;  1XKA C;  4XBC A;  1Z6E A;  4YLU A;  1GJ9 B;  3DFJ A;  1AB9 C;  2VGC B;  3SZN A;  3UOP A;  2V0B A;  4NCY A;  5GCH F;  2WV5 A;  3GCT F;  3AAU A;  3SI4 H;  2WPI S;  2P3T B;  3SUF A;  1XKB C;  3DA9 B;  3GYL B;  3S69 A;  4I33 A;  1AB9 B;  2JH6 D;  3SHA H;  2XBV A;  5EOD A;  3TH3 H;  1P09 A;  5I25 A;  1GCT C;  1EJN A;  2QA9 E;  3GY2 A;  2JJ1 D;  1MAB B;  1YC0 A;  3Q3Y A;  4CH2 B;  1GBI A;  1O5F H;  4AG2 A;  1BIO A;  5FXL A;  3O8B A;  5L6N H;  2H6M A;  3ZZA A;  3SQE E;  1MTU A;  2AHM E;  4YZU A;  3URC A;  4B74 A;  1RFN A;  5T3H A;  4I32 A;  3M7T A;  5C67 A;  5C17 A;  1C5N H;  2OQ5 A;  4TWY A;  1AUJ A;  3H09 A;  3KQC A;  1OWE A;  3RC5 A;  1O3B A;  2Z3C A;  1Y8T A;  4MPV A;  1C2K A;  4U32 A;  6LPR A;  2TPI Z;  1K1M A;  1KMH B;  4BAH B;  2VNT A;  2QCY A;  3PWB A;  1DOJ A;  1BCU H;  4Y10 E;  4RN6 A;  1BB0 B;  4BAQ B;  4Q63 A;  3SNE A;  5F6M A;  1RIW B;  3UUZ A;  2GT8 A;  2VH0 A;  4RSP A;  4X1R U;  1NFU A;  2BVS H;  3RMN H;  3ZVD A;  3KNX A;  4DVA U;  4FXG H;  2ANY A;  5DPA A;  1EKB B;  4Y7B A;  4M9F A;  1S83 A;  3TNT A;  5GDS H;  2ZPR A;  3PRD A;  4Y8X A;  4JYV H;  2DE8 A;  3BTQ E;  4XBB A;  4ZXX H;  4Q7X A;  2VWN A;  3BIV H;  3PLK A;  2K0Q A;  3M3V A;  1NFY A;  2STA E;  3SNC A;  2RA0 A;  5A2M H;  3EE0 B;  1OPH B;  3S9A A;  5FHT A;  1LHC H;  1A3E H;  3IG6 B;  4HI3 A;  4AX9 H;  1V2N T;  1ETS H;  1C1T A;  2PLX A;  1LVO A;  3CS0 A;  3LOX A;  1TA6 A;  2BX3 A;  3MMG A;  4NZL A;  3PO1 C;  3NWU A;  3RC4 A;  3T5F H;  5GPI B;  4FUE A;  1AKS B;  3ATL A;  3CEN A;  1EZU C;  4Q7Z A;  3RC6 A;  1BHX B;  1C2G A;  2FTM A;  3ZZ6 A;  1GBE A;  4AOQ A;  1NT1 A;  1SKY E;  3PO1 B;  1O38 A;  2W6I D;  1TQ0 B;  2XNI A;  3UTU H;  1O2J A;  2F9B H;  2JH5 D;  4YOG A;  4UFG H;  1JWT A;  1ACB E;  1OWJ A;  6CHA C;  1TMT H;  1TGB A;  1F7Z A;  1EJM A;  1O2P A;  4CR9 A;  3GYM A;  1S82 A;  4YOI A;  3MO3 A;  3BF6 H;  1B0F A;  1YPH C;  1FY5 A;  1SQO A;  3SJ9 A;  5JBT A;  3FOA A;  3SGB E;  3OEH D;  3A7V A;  1GI8 B;  1ANE A;  2H5C A;  1GMD F;  1S81 A;  4IN2 A;  2SFA A;  1GBC A;  3RXL A;  3ZZ5 A;  3VFE A;  5A8X A;  2FP7 B;  3PLP A;  4QT8 C;  3SQH E;  1O35 A;  3KQE A;  3DHK H;  2P3U B;  2TIO A;  2C8W B;  1UK4 A;  3MH7 A;  1GBH A;  5K0H A;  2BZ6 H;  2QXJ A;  2PP6 A;  3PLB A;  5JBC S;  1AVX A;  1COW D;  1NN6 A;  3N7O A;  4VGC B;  2VJ1 A;  3MU1 A;  1OS8 A;  3M61 U;  1DAN H;  2BDB A;  1G3D A;  2BVX H;  4ABJ A;  4XRN A;  4ABG A;  1UTL M;  1SR5 C;  2O8U A;  3ENS B;  2PGQ B;  2W26 A;  3RXR A;  4NSV A;  4UEH H;  1BRC E;  1KTS B;  2HLC A;  5EW1 H;  1OKX A;  4X2W A;  5JBB S;  4AGJ A;  5CDF E;  4HGC A;  2Q1J A;  3SJK A;  2O8W A;  1DS2 E;  1N8O C;  2QXG A;  3PMJ A;  4AFS A;  4MPX A;  1O3K A;  2PTN A;  3LC3 A;  1B5G H;  1X7A C;  1YBW A;  2J5U A;  1K1L A;  3FP8 E;  4GAW A;  4K1E A;  1RGQ A;  2FZZ A;  3JZ1 B;  2HLD D;  2NWN A;  2CN0 H;  2ZTX A;  5DP8 A;  2QYI A;  1QQU A;  4Q80 A;  3STJ A;  2QF5 A;  1N8O B;  3EGK H;  2OCV B;  1Z8R A;  2PTC E;  4WME A;  5EXN A;  9EST A;  3I77 A;  5C5O A;  1AE8 H;  4BAN B;  4CRD A;  4Q7Y A;  2WSS D;  2F83 A;  3RP2 A;  4ZHM U;  3EST A;  2F9O A;  1P2K A;  1IQI A;  2UWP A;  2G4T A;  5C0T A;  1TBZ H;  1UK2 A;  2Q6F A;  1O36 A;  1WTH D;  2Y6T A;  1YP9 A;  3VXE H;  2BLQ A;  4OGY A;  2CGA A;  1V2S T;  4UFE H;  2BDA A;  5AFZ H;  4DT7 B;  3UAI C;  1YPG H;  4JZF H;  5F8X A;  4M7G A;  2IPQ X;  1ZYO A;  1THS H;  1LDT T;  3V13 A;  2CF9 H;  1E36 B;  5DP3 A;  5GJ4 B;  3B9F H;  3M5M A;  1RD3 B;  3OU0 A;  4ZUH A;  1CVW H;  1IHS H;  4X2V A;  2FS8 A;  2WPJ S;  1QQ4 A;  4YOJ A;  4NFF A;  3VXF H;  1CE5 A;  1CHO F;  2F9V A;  4WMF A;  3RLY H;  1F0S A;  1W11 U;  1NY2 2;  1E79 D;  4MG3 A;  1IQN A;  3UB0 A;  3QGJ A;  2BDH A;  2QGR A;  2ANM H;  4B76 A;  4I86 A;  4Y76 A;  3KN2 A;  1FIZ A;  4Z0K A;  2C8Z B;  4LK4 A;  3KEE A;  1J9C H;  3D65 E;  2BM2 A;  1QUR H;  3BTE E;  1IAU A;  1QJ6 B;  5DP7 A;  3TGK E;  1IQF A;  1QL7 A;  1O3G A;  4X1P U;  5DO4 H;  1ELD E;  2XC5 A;  1MQ5 A;  1SLV B;  2KCY A;  3KYF A;  3MYW A;  5DSF A;  4Z6A H;  1E34 B;  3ATK A;  4FUF A;  3NXP A;  1KXB A;  3SU0 A;  4U01 A;  4ISL A;  1AGJ A;  1GHA G;  3T25 A;  2P59 A;  3D23 A;  1Z7K A;  2A5A A;  3ELA H;  4IC5 A;  3O8D A;  4NWL A;  2W3I A;  1O2Y A;  1BRU P;  2JDI D;  4ISN A;  4IW4 E;  1S6H A;  3TU7 H;  2M2A A;  4O3T A;  1ZPZ A;  1MD8 A;  4XOJ A;  5TCC A;  1OP8 A;  1SGT A;  4ZMA H;  1VGC B;  2ZCH P;  3A7X A;  1G3E A;  8GCH F;  4H6T A;  4I8G A;  5HMA A;  1IQH A;  1CT2 E;  2G5N A;  2GZ8 A;  3QZQ A;  5C3N A;  2FOD A;  4LXB H;  2ILN A;  4UDW H;  4ISO A;  1V2U T;  2HPP H;  2G5V A;  4JK5 A;  1SGP E;  4D8N A;  1KIG H;  3E91 A;  3I78 A;  3ZZ9 A;  3B8J A;  1E38 B;  2OXS A;  1G2L A;  4Y79 A;  2ZZU H;  1VCQ A;  1ZSJ A;  7GCH F;  1C2E A;  3ZZC A;  3BEU A;  4HZH A;  2V7Q D;  2BD8 A;  1EAU A;  1PYT D;  3BTF E;  1W10 U;  4TY7 A;  4TY6 A;  1PYT C;  1GHV H;  2AMD A;  4ABD A;  2CK3 D;  1Z6J H;  1OX1 A;  9LPR A;  2SNW A;  2GMT C;  4MNW A;  1TIO A;  1IQG A;  1SC8 U;  3H5C B;  1ANB A;  3CS7 A;  1AE5 A;  1GMC G;  3FFG A;  1TGC A;  2ZGC A;  1JXP A;  2BDY A;  1GVZ A;  4HFP B;  1UCY E;  3D62 A;  1MUE B;  2A4R A;  2BDI A;  4A92 A;  4WH8 A;  1MZD A;  4GPG A;  2XC0 A;  3BG4 B;  3MQK C;  2VVC A;  1FON A;  3MU8 A;  1GJ8 B;  2Q6G A;  1GJB B;  3H7O A;  3VB7 A;  1V2J T;  1EPT C;  3SV9 A;  1ZGV A;  2GCH G;  2WIN I;  2XBW A;  5LPR A;  3LPR A;  1ELF A;  1ZZZ A;  4CBO A;  1KLI H;  4WXV A;  1KXA A;  1Q31 A;  3F2H A;  3F9G A;  3LON A;  4YT7 H;  5CHA C;  1W14 U;  1K1P A;  5HYO A;  3A88 A;  1GBK A;  1T8L A;  1TMU H;  5DKM A;  1FX0 B;  1VIT F;  1AFQ B;  1W0K D;  2GZ7 A;  5ETX A;  1P3C A;  3F1S B;  1C2I A;  1W7X H;  3ZVF A;  1EJA A;  1TRM A;  3DSG A;  2FOM B;  4JZ1 A;  2AEI H;  2KX4 A;  4Y0Y E;  5G4B A;  3EDX B;  4XBD A;  5A0C A;  1U6Q A;  1LVM A;  1HJA C;  1Z8J B;  2B5T B;  2Q6D A;  1NRR H;  2LP6 A;  4XD7 D;  4A1T A;  2GVF A;  2AGI X;  5FX6 A;  1CGJ E;  1PQ5 A;  3M35 A;  2NU4 E;  1PPB H;  1O5E H;  1LKA A;  3UNR A;  5EOK A;  4ABA A;  1EP6 A;  3TVJ B;  1K2I 1;  2JET B;  3RM2 H;  3URD A;  5PTP A;  1O3L A;  4R0I A;  1O5C B;  2BQ6 B;  3M3S A;  2H1U A;  4WF8 A;  2JJ2 D;  1OWI A;  1BMM H;  2BQ7 B;  1C9P A;  4O9V A;  3MH4 A;  2XXL A;  1S5S A;  3SU6 A;  3A89 A;  4WMD A;  5E0G A;  1PJP A;  1GHB G;  4ACA A;  5FPS A;  1TX6 A;  1KYN A;  3A7W A;  5C1X A;  1FMG A;  2SGP E;  2HPQ H;  1DUE A;  1NRN H;  3OTJ E;  3UWI A;  3ZVG A;  2J2U A;  1V6D A;  3NCL A;  4GCH F;  2OBO A;  1DE7 H;  2P94 A;  2AER H;  3LIW A;  3FZD A;  3RXP A;  5JPM H;  1SGF A;  1GI5 A;  4K8Y A;  2ZP0 H;  1XM1 A;  3U8R H;  1JIR A;  1TRY A;  4AB8 A;  3U1J B;  3BSQ A;  1CBW C;  1O2H A;  1SMF E;  1FNI A;  2FLB H;  1BDA A;  3BTW E;  5CHB A;  1QIX B;  3GDV A;  5L30 H;  1TAB E;  2J4I A;  2WPL S;  4X6M A;  5HKK D;  1QZ8 A;  3SBK A;  7LPR A;  4WWY A;  4I8J A;  2Z9I A;  2FYQ A;  3NKK A;  1AI8 H;  1O2G H;  4ISI H;  2BY6 X;  3SGQ E;  4WY3 A;  3TPI Z;  1EFR D;  1BTH H;  1H8E D;  1P03 A;  2OTV A;  4JYU H;  2WPK S;  1ID5 H;  1UMA H;  2VVV A;  3T28 A;  1G30 B;  1DLK B;  1XVM A;  4AFU A;  4X1N U;  1F0U A;  3IWM A;  2YNA A;  1MKW H;  1WU1 A;  2CJI A;  2TBS A;  2ZHE H;  3A85 A;  1GDU A;  1AVW A;  3URE A;  2FWW A;  3E0N B;  4K2Y A;  3SU5 A;  1IQJ A;  4RKJ B;  1BRB E;  1UTP A;  4YT6 H;  3MI4 A;  1O2L A;  1EXF A;  1TBR H;  4CBN A;  2ZFQ H;  5C20 A;  1UTM A;  5DP4 A;  2ZDN A;  4SGB E;  2A7J A;  5GCH G;  3GCT G;  3RXI A;  2CMY A;  3AAV A;  2GDE H;  1ESB A;  1MCT A;  1YF4 A;  1KXD A;  4F49 A;  1GG6 C;  1BIT A;  1AMH A;  2XWA A;  1QBN A;  4ACB A;  4HG6 A;  1C5Z B;  1V2M T;  2RA3 A;  3M37 A;  3Q3K A;  3V0X A;  5I46 H;  5TCA A;  2PSX A;  1O37 A;  1PPG E;  2D26 C;  2GP9 B;  3UOU A;  4Y8Y A;  1AWF H;  2YOL A;  4F48 B;  2J95 A;  1O31 A;  1NU9 A;  2W3K A;  4BAK B;  1GHW H;  1O3P B;  2GV6 A;  1Q3X A;  1AD8 H;  4OM9 A;  3PV2 A;  3EE7 A;  3OSY A;  4OGX A;  1DUA A;  3FO8 D;  2FMJ A;  1MU6 B;  2VWO A;  1P2Q A;  4Y8Z A;  2EEK A;  1SQA A;  1GI2 A;  1TB6 H;  5LH8 A;  1C5U A;  1TPO A;  2KCP A;  1SLX B;  1O5A B;  2JIZ D;  2OC8 A;  2GJG A;  4DCD A;  3RM0 H;  4ABF A;  1H9H E;  4I7Y H;  2WPD D;  4K5Z A;  2ZC9 H;  4MVN A;  5AFY H;  3NZI A;  2ZEB A;  4MQA A;  1AU8 A;  3ZVB A;  1DDJ A;  3VB4 A;  2BYA X;  1PPC E;  5E2P A;  1F92 A;  3QWC H;  1P05 A;  1C5X B;  1P57 B;  1TGS Z;  1GBD A;  1AUT C;  3A84 A;  1XVO A;  2A1D B;  2PV9 B;  1BMA A;  3KQ5 A;  1CGH A;  3LJJ A;  1C1R A;  2TGA A;  4B2B A;  1GCT B;  2SGA A;  1MTV A;  2V3O H;  2ZFR H;  1TE0 A;  4OS1 A;  5T1V A;  1W12 U;  2DUC A;  2ZKS A;  3ZZB A;  8KME 2;  1E37 B;  1YPK H;  4B73 A;  1V2K T;  2ZDA H;  5DJ7 A;  2B0F A;  1EP5 A;  3KGP A;  1GI1 A;  3GY8 A;  4KKD A;  3BTD E;  4B1T A;  3L33 A;  3R3G B;  1HRT H;  2HNT C;  2IN2 A;  1YLC A;  1ZHM A;  1W13 U;  4E7R G;  2J92 A;  1BOQ A;  3A7Y A;  1BML A;  4Z1M D;  2W6J D;  3MO9 A;  1XXD A;  4NIX A;  1NM6 A;  3UNQ A;  1FZZ A;  2ZNK H;  3T27 A;  6GCH F;  1C5O H;  1IQE A;  1QNJ A;  1V2W T;  1WUN H;  2EQN A;  1EOJ A;  1JRS A;  1QB6 A;  2AMP A;  4FVB A;  1DWC H;  3PV5 A;  5F53 A;  2OD3 B;  1HAV A;  1SLU B;  1GI4 A;  2OP9 A;  3C1K A;  4AG1 A;  3I29 A;  1MKX H;  3P8G A;  2A31 A;  3BN9 A;  1G36 A;  3RXF A;  2FM2 A;  2XYA A;  3HKJ B;  2JKH A;  1L4Z A;  1FDP A;  3Q3X A;  3LT3 A;  3M7Q A;  3RXS A;  1FY1 A;  2FOE A;  2ZDV H;  2W5E A;  1LPG B;  5IYT A;  3GY3 A;  3F9F A;  3F9H A;  1SHY A;  5GND A;  2HWL B;  5L2Z H;  3F0P A;  5C5N A;  1S0Q A;  4ASU D;  1QL8 A;  3U1I B;  2F9P A;  2TGD A;  2NU2 E;  1HAZ B;  1V2T T;  1GVK B;  2L6O A;  3PRO A;  1NRP H;  1O3E A;  1K1O A;  2BY7 X;  2FES H;  1VCW A;  1C1M A;  2G8T A;  2Z9L A;  1MTW A;  1OP2 A;  3KHV A;  1EST A;  1A1R A;  1L1G A;  4X6O A;  2ZFF H;  2SGF E;  2A4O A;  4ZXY H;  3T2N A;  1Y5B T;  3W95 A;  3RXJ A;  1SOZ A;  2PKS C;  3MTY A;  1MQ6 A;  1LO6 A;  1LVY A;  1G2M A;  3TGJ E;  1C1P A;  4TSF D;  2BOK A;  3MFJ A;  1Y5A T;  1Y3X A;  4TT3 D;  4AFZ A;  3M3T A;  5DP6 A;  3S7K B;  3A8A A;  1IQL A;  4J2Y B;  6CHA B;  5HXF A;  3GCO A;  2ZU5 A;  4NIW A;  2G55 A;  1ORF A;  3RDZ A;  1OWD A;  1HDT H;  4K1S A;  2NU1 E;  5F8T A;  4DIH H;  1EZQ A;  2STB E;  1C1S A;  3QN7 A;  1UCY H;  1YPE H;  2OLG A;  5EQS A;  4IC6 A;  1EB2 A;  5EXL A;  3VPK A;  2XW9 A;  5EJ1 A;  3OAA D;  4JYT A;  3TJN A;  4D9Q A;  2ZTZ A;  1GHY H;  1ETT H;  3F68 H;  3DUX H;  1ZTL A;  1TPA E;  1T8M A;  2A45 B;  4YES B;  3MO6 A;  4D76 A;  1KDQ A;  4ZCN A;  5JYI A;  3TIT A;  1MBM A;  4ZKR U;  4OS4 A;  1WXR A;  3A8D A;  2J97 A;  3A80 A;  2G81 E;  3ZZ4 A;  1C5Q A;  4MPU A;  1UTN A;  2ZU1 A;  1MKX K;  4YM9 A;  1TGT A;  1P2I A;  1TNK A;  1S84 A;  2HAL A;  4DII H;  1F5R A;  2ZDL A;  3ZVA A;  1ABI H;  3JZ2 B;  2FOA A;  1V3X A;  1TNL A;  3RUO A;  1CHO G;  1GWA A;  1HAX B;  1TX8 A;  1ARB A;  4FU7 A;  3U8T H;  1GI0 A;  4CRA A;  3EA8 A;  1YPL H;  1HV7 A;  3F3B A;  5FBE A;  1YKT A;  4DGJ A;  1O3D A;  5E2O A;  1V2R T;  1D9I A;  5LPE A;  1O3A A;  3QTO H;  2BQW B;  2G52 A;  1CQQ A;  2ZQ1 A;  2VVU A;  1O0D H;  5GIB A;  1MTN C;  1SGE E;  5BPE A;  2ANK H;  1C1O A;  2V3H H;  3RMO H;  4YTA A;  1DY9 A;  3D49 H;  1EPT A;  3RXE A;  1J14 A;  2I6S A;  3SW2 B;  1QA7 A;  5HIY A;  5GXP A;  1ZTJ A;  1ELE E;  1O2M A;  1MMJ N;  2C8Y B;  2GCT C;  3RXK A;  1T31 A;  1MTN B;  5EG4 A;  3S7H B;  1O32 A;  2C8X B;  3P6Z B;  3N99 A;  5EJZ A;  2UWL A;  4HTC H;  5HGG A;  1AHT H;  1G3B A;  1O2T A;  5KGO A;  2VBC A;  2G4U A;  4Q2K A;  1PPZ A;  1G32 B;  4CRC A;  1V2O T;  2WV4 A;  2D2D A;  1BMN H;  1HB0 B;  2ZPS A;  3PTN A;  1EAS A;  1GJ7 B;  2HNT F;  1NS3 A;  1E1Q D;  1W2K H;  1OYQ A;  2VIO A;  1UW7 A;  2PR3 A;  1ANC A;  1J17 T;  1KLT A;  1C2H A;  3UPE A;  1WSS H;  4IMZ A;  1ZRK A;  6EST A;  5T6F A;  2HRV A;  8GCH G;  1RTK A;  1V2V T;  3P70 B;  4I8L A;  3MNX A;  1Y3W A;  1UVU H;  1H8D H;  1O34 A;  4OS2 A;  3NPS A;  3LC5 A;  1LVB A;  3KID U;  4BAO B;  2ZA5 A;  1DM4 B;  1ZPB A;  1K28 D;  1O2K A;  4E06 H;  3MHW U;  2XBY A;  4DW2 U;  1DIT H;  7GCH G;  3ZV9 A;  1KTT B;  2ZG0 H;  1FN8 A;  1C1Q A;  1V2L T;  2AYW A;  1LMW B;  1T8N A;  2C93 B;  3L6P A;  3C27 B;  3MU0 A;  1LCY A;  3A87 A;  3HGN A;  4UE7 H;  4AC9 A;  2C90 B;  1GPZ A;  3RU4 D;  2BXU H;  3QGN B;  1UJ1 A;  1L4D A;  4TWW A;  1OP0 A;  3OEE D;  4F55 A;  1OWH A;  3MU4 A;  4X6N A;  3VG8 A;  1GI7 B;  1QJ1 B;  4GVU A;  3SUG A;  2BHG A;  3BTH E;  3E90 B;  1C5S A;  2R2W U;  1GBF A;  1BBR H;  1FQ3 A;  3TJU A;  5JDU B;  3IIT A;  3DD2 H;  2AIQ A;  2HVY B;  2O9Q A;  1ARC A;  2J9N A;  2FIR H;  3U8O H;  2ZFP H;  1P3E A;  2C3S A;  1TMB H;  3RXA A;  2ODY B;  5C2Z A;  5HIZ A;  3OX7 U;  1DWD H;  2AS9 A;  4X2X A;  4UFD H;  3HK3 B;  1BTZ A;  4JMY A;  1OHH D;  1QBV H;  1KDQ B;  2XBX A;  1JMO H;  2R3U A;  1HAI H;  3LGY A;  1CA0 C;  4INL A;  1HBT H;  1ZMN A;  2KCO A;  1T4U H;  3PMB B;  1VIT G;  1H9I E;  1AZZ A;  1P0S H;  1C5V A;  5A09 A;  3GCH C;  1LKB A;  1A5G H;  1ETR H;  3RU4 T;  1UTQ A;  3Q76 A;  4ZKS U;  3UR9 A;  2ZU4 A;  1Z71 A;  1QBO A;  3M5N A;  1WBG B;  1K1I A;  2FOG A;  4D7G A;  3P8N A;  5A8Y A;  3N7E A;  2AMQ A;  1E0F D;  1TOM H;  3UQO A;  1KSN A;  3A7Z A;  2GMT B;  3AAS A;  2V35 A;  3U69 H;  2BD2 A;  1NRO H;  1AND A;  1CHG A;  4WJG 2;  3TJO A;  1HUT H;  1M9U A;  1P2O A;  2GDD A;  2P8O C;  2PGB B;  4B6E A;  4Y11 E;  1YPH E;  3RXQ A;  4CR5 A;  3AW1 A;  4BTU B;  3LU9 B;  1DPO A;  2KM0 A;  3W94 A;  1GI3 A;  5F03 A;  3SUD A;  1D6W A;  4FU8 A;  1VR1 H;  4A5T S;  3M5L A;  3K2U A;  1C5L H;  3RLW H;  1BUI A;  1TOC B;  3Q77 A;  1QHR B;  4U2W A;  1ZML A;  1NC6 A;  1EPT B;  3NRL A;  1TRN A;  1SG8 B;  4H4F A;  1D3Q B;  2K8I A;  2KZ4 A;  1CSO E;  1FN6 A;  1C2M A;  4KTC A;  2SGE E;  1AN1 E;  2RCE A;  5CHA B;  4GCH G;  3HGP A;  2A7H A;  3P17 H;  1XUG A;  1BMF D;  2F3C E;  5ESB A;  3TH2 H;  5CMX H;  3QX5 H;  1ESA A;  2FTL E;  1YPJ H;  2ZGH A;  5KED A;  2J38 A;  5C1U A;  2XRC A;  1S6L A;  1WCZ A;  4RI0 A;  4DG4 A;  3FAO A;  3T29 A;  1GBM A;  1NFX A;  2ZI2 H;  3EA7 A;  2ASU B;  1EAI A;  3MNS A;  4BOH A;  4AN7 A;  1OSS A;  1Y3U A;  5E0H A;  1MZA A;  1HJA B;  1DXP A;  3LH3 A;  5LGO A;  1WAY B;  1V2Q T;  1P2M A;  1SBW A;  2A2Q H;  4DT4 A;  1XUH A;  2J34 A;  1HLT H;  1O2S A;  2ZPQ A;  1S0R A;  4R8T B;  2IOT A;  5C94 A;  1DWE H;  1ZSL A;  2WPH S;  4B2A A;  2GZ9 A;  1UTO A;  1TA2 A;  3MU5 A;  2Y80 A;  1DFP A;  2F9N A;  1Z1J A;  1N6Y A;  1AO5 A;  1GMH G;  4MNX A;  5TJX A;  1S6F A;  4DY7 B;  1YYY 1;  5A0B A;  1H4W A;  1KXC A;  2Y5H A;  3QUM P;  4X8T H;  1A4W H;  2FYR A;  3RXO A;  1W0Z U;  1QL9 A;  3RMM H;  5EGM A;  3NUM A;  3SJ8 A;  5FX5 A;  3T26 A;  1P04 A;  4ISH H;  5IDK A;  2WZQ A;  3BEI B;  2RG3 A;  4JZD H;  3GCN A;  1YLN A;  4O03 A;  3SNA A;  2OBQ A;  3ZZ3 A;  5SGA E;  1SGY E;  4Y7A A;  1SGR E;  4E7N A;  3CP7 A;  3RXH A;  3SND A;  2PUX B;  4TYD A;  4IN1 A;  5DG6 A;  2FI4 E;  4J1Y A;  1PQA A;  1O2Q A;  2B9L A;  1OXG A;  4K60 A;  1ZGI A;  2J94 A;  3M5O A;  1C4U 2;  4AYY B;  1BTU A;  2VU8 E;  4B6F A;  1CBW B;  1PQ8 A;  2FOC A;  5FCK A;  2TRM A;  3KL6 A;  1NES E;  1T4V H;  3QDZ B;  4BAM B;  1A2C H;  4MDS A;  3K6Y A;  5L2Y H;  1SGI B;  3UQV A;  1LHF H;  1NRS H;  3A8C A;  2ZDK A;  4UD9 H;  1O5D H; 
#chains in the Genus database with same CATH homology
 4XD7 D;  3SUD A;  4A1T A;  3O8R A;  2QV1 A;  3M5L A;  2A4G A;  4A1X A;  2GVF A;  2J5U A;  5B6L A;  5H4I B;  1RGQ A;  1W0J D;  2A4Q A;  2HLD D;  3NRL A;  5FPT A;  3LOX A;  2K8I A;  4ZCN A;  2KZ4 A;  4YXW D;  2QF5 A;  3PV5 A;  5F53 A;  1RTL A;  2KFW A;  1WXR A;  4KTC A;  3RC4 A;  4K8B A;  5FL7 D;  3WW7 A;  5GPI B;  5IK2 D;  4WF8 A;  4Q4L A;  5EPY A;  2JJ2 D;  1CU1 A;  2FM2 A;  2YOL A;  3SU3 A;  3L6P A;  1BMF D;  3RC6 A;  2WHX A;  2YMS D;  3SUF A;  5ESB A;  3WWB A;  2WSS D;  3SU6 A;  2YMS C;  1W3C A;  4I33 A;  5C0T A;  3WWF A;  1SKY E;  3LKW A;  4FET A;  5FPS A;  3SU4 A;  1S6L A;  2W6I D;  3OEE D;  4RI0 A;  4F55 A;  3SV8 A;  2XNI A;  4B6F A;  3DCL A;  3OE7 D;  4OM9 A;  5EQR A;  3FN8 A;  3PV2 A;  2V7Q D;  3VG8 A;  3SYJ A;  5GND A;  2JJ1 D;  1MAB B;  3SUG A;  2K1Q A;  2OBO A;  3PRB A;  3E90 B;  2XOK D;  1H8H D;  3FO8 D;  4NWK A;  3F0P A;  2KR7 A;  5EPN A;  4ASU D;  3U1I B;  2LEL A;  3F3B A;  3O8B A;  1DXP A;  3F2G A;  4A1V A;  2CK3 D;  2XND D;  5GJ4 B;  3M5M A;  4DT4 A;  3U1J B;  2L6O A;  3SV6 A;  2AHM E;  3FKS D;  4R8T B;  3N7D A;  2IJD 1;  2KCP A;  4B74 A;  5CHB A;  2F9U A;  1N1L A;  3DSP A;  2F9V A;  2JIZ D;  2O8M A;  4I32 A;  2OC8 A;  5C17 A;  1JXP A;  2IJO B;  4B71 A;  1NBM D;  1E79 D;  2OC7 A;  2WPD D;  3H09 A;  4JMY A;  3DSO A;  3O8C A;  1OHH D;  3RC5 A;  5HKK D;  1A1R A;  3ZIA D;  3FOA A;  2A4R A;  4WH6 A;  3UB0 A;  4A92 A;  4WH8 A;  3OYP A;  1DY9 A;  3OEH D;  3SV7 A;  4B76 A;  1KMH B;  3KN2 A;  2KCA A;  2KCO A;  4I31 A;  2FP7 B;  2YMS B;  3GS9 A;  3KEE A;  2OC1 A;  5IDK A;  1EFR D;  1H8E D;  3SV9 A;  2QF4 A;  1E1R D;  2WZQ A;  2OBQ A;  3N99 A;  4TSF D;  3W1E A;  3SZE A;  2GGV B;  2XCF A;  2KCY A;  2QE7 D;  1COW D;  1NBM E;  3F2H A;  3LON A;  4Q63 A;  4TYD A;  4TT3 D;  5DSF A;  2VBC A;  5T1V A;  1DY8 A;  5FPY A;  4B75 A;  2WV9 A;  4B73 A;  2OC0 A;  3M5N A;  1DXW A;  5C0U A;  3EYD A;  3P8O A;  3P8N A;  3N7E A;  3KF2 A;  2OIN A;  2F43 B;  1NS3 A;  3KNX A;  1E1Q D;  3M5O A;  1FX0 B;  3OAA D;  4U01 A;  5EQQ A;  3SU0 A;  2XCN A;  1W0K D;  3F2F A;  4M9F A;  5ETX A;  3SU1 A;  3SU2 A;  5EQS A;  3SUE A;  5CDF E;  2F4L A;  2P59 A;  3PRD A;  3SU5 A;  5DN6 D;  2OK5 A;  3OTP A;  3F0O A;  3O8D A;  4NWL A;  2FOM B;  4B6E A;  2JDI D;  4Z1M D;  1BT7 A;  2W6J D;  2K0Q A;  3OFN D;  2M2A A;  3AK5 A;  2KM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...