1BMAA

Benzyl methyl aminimide inhibitor complexed to porcine pancreatic elastase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of a peptidomimetic aminimide inhibitor with elastase.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Chymotrypsin-like elastase family member 1
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1995-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bmaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bmaA01
4O3UA 1D6RA 3GY3A 3SU1A 3O8DA 1TX7A 4Y79A 4YZUA 4CH8B 1C2HA 1ACBE 1ELCA 3K9XB 4IN1A 3M5NA 3LGIA 2JETC 2WPIS 3RMOH 3S9BA 1TNKA 1SC8U 3SU4A 4KTUA 1MUEB 1WCZA 1V2NT 4NSYA 1EASA 1T4VH 3BTME 1GBHA 3KGPA 1EP5A 1S5SA 6LPRA 1BRAA 1NPMA 2R9PA 2Y6TA 3M7QA 1QJ7B 3UREA 4YT7H 1QGFA 1SQOA 2BLWA 1HAVB 1LO6A 2FX4A 3P70B 5EODA 4X6OA 3KIDU 1B0EA 1ESBA 1ZYOA 3QUMP 1O2RA 2ZDNA 5F03A 1AB9B 4YESB 1C2LA 2ZFFH 1GGDB 3PB1E 5DP5A 3RMLH 1TIOA 4NIXA 3P17H 1AE5A 1NRSH 2CF9H 4X2VA 4IC5A 3QN7A 1BBRE 2FWWA 3U8OH 1GJBB 3A7XA 2FLBH 3UR9A 2QY0B 9LPRA 2Y82A 1GJ6A 2ZZUH 1G37A 3F6UH 1O3OA 1XKBC 2FOBA 4CH2B 1V2ST 2JH5D 2KAIB 4LZ4B 3BTDE 4B75A 1O3EA 1O5GH 4NGAH 1NFXA 1SQTA 2BY5X 1P2IA 3MO3A 1EPTB 2Z94A 3RC4A 2VIQA 1NY22 2BMGB 3PMHB 4FVBA 2ZIQH 4JZIA 3P8GA 1MBQA 2TRMA 1AU8A 4FU7A 1O2GH 4CRBA 3SU3A 2VB0A 1BTWA 3EA9A 1NO9H 4KKDA 2CJIA 1BIOA 3RLWH 1BTUA 4YLUA 4A1TA 5DP4A 2OINA 1V2QT 2VIPA 2G4UA 1O2ZA 1ELVA 5GJ4B 1AQ7A 1DFPA 1J15A 1W7GH 1UHBA 4IBLH 1Z8JB 1SGEE 2ZI2H 2F9VA 2ZP0H 2NWNA 5J4SA 1C5SA 3VEQB 3RXAA 1NN6A 1P9SA 2EI8A 3S0NA 2O8TA 2TGAA 1MH0A 3U1IB 2ZHDA 3HGPA 1FPHH 3B23B 3Q76A 3TK5A 3LGYA 1QL7A 1AD8H 1GI1A 2C90B 2BDYA 4AORA 1ELTA 1IQEA 1SFQB 3BTFE 1GHBG 3MWIU 4IW4E 1C1SA 4WMFA 2F9OA 1H9IE 2Y5FA 2YOLA 2G81E 3RXHA 2XC0A 4FU8A 4K2YA 1O2JA 1GHAG 1UCYE 4R8TB 1TNJA 1UMAH 4CR9A 3ODDA 1FY5A 1TGCA 8GCHF 1K1NA 3SJ9A 2EEKA 1WUNH 3PO1C 4FUEA 1CGIE 4YOIA 1GBMA 1FNIA 5EG4A 4MVNA 1GI7B 3CP7A 3FP6E 4OS4A 4YTAA 5AVDA 2BVXH 3ZYDA 1FY1A 1UVUH 3NKKA 2ZU1A 3LH1A 3SV2H 4K69A 2ZHWH 4JYUH 1W13U 1C5TA 1FDPA 3ESTA 6CHAB 2G51A 5JDUB 1D4PB 1DWDH 1ESTA 1UVSH 2P16A 1P10A 3SJKA 2GX4A 1QB9A 1AFQC 1GJ8B 2BY8X 3RU4D 2H2ZA 3SNBA 3GY7A 2W3KA 1MAYA 3JZ1B 2XWBI 4UFEH 4TWYA 2WINI 2K1QA 4D7FA 3M36A 1K21H 1ZPZA 2QYIA 3NZIA 1MCVA 5ETXA 3A82A 3GDVA 4JZDH 5FX5A 1E36B 2EA3A 2OC7A 4UONA 4ISOA 3ZVBA 1QA0A 2BTCE 1GHWH 4XDEA 1L1JA 2O8WA 2OQ5A 4A92A 1K1MA 2ZQ2A 5DJ7A 1RIWB 3CENA 4VGCB 1A5HA 3URCA 1EB2A 3P95A 3HKIB 3T25A 1CT2E 1TALA 3SU0A 3GCHB 1XX9A 2H9TH 1K1JA 1C1MA 2BXTH 2QAAA 3RXVA 3QZRA 3HPTB 5FX6A 2VIVA 1MD8A 1RIWC 5EGMA 2ZU4A 1FJSA 3R3GB 1MBMA 1FIWA 1A3EH 4K1TA 4OGXA 2FS9A 1GHYH 1GHZA 1ID5H 1LVMA 2ZEBA 1A4WH 5AFYH 3SU2A 1XKAC 3SNAA 1O5EH 4WJG2 3LGTA 5C2ZA 1GWAA 2BX3A 1SSXA 2F9BH 3S9CA 8KME2 1LKAA 3A87A 2SGEE 1O3CA 1AZ8A 2PGBB 3TPIZ 5HM9A 1QQUA 1KTTB 2JETB 1P2NA 1HYLA 2NU0E 4U30A 1KIGH 1TABE 1DSUA 3BIVH 1GBJA 1K2I1 1QIXB 1WSSH 3WY8A 5DG6A 1EAWA 3FP7E 5H4IB 1Q2WA 1MMJN 2BD7A 1C1UH 1FY4A 2G5NA 2ANYA 4KP0A 1Y8TA 2Y5HA 1SR5C 4IMQA 1A0LA 1CA0C 1RFNA 1ZPCA 4AB8A 4DW2U 1A61H 3UFAA 1ABJH 2Q6GA 4M7GA 2PKSB 3UOPA 4J1YA 4GLYA 1GBBA 1GJDB 2GKVE 1D3QB 3M5MA 1ARBA 2P8OB 3KCGH 4JCNA 2ESTE 1SLXB 3ZZAA 1LMWB 3QTOH 3T2NA 3GY2A 1TRNA 4AZ2B 1XUKA 2HOBA 1C2KA 3ATLA 2XNIA 2Z7FE 2G4TA 3UWJH 1L1GA 2VIWA 1WBGB 1IQJA 4E7NA 1CGHA 5EXLA 3E8LA 3QDZB 4FUDA 2P3UB 4CBNA 1P01A 5FPSA 4AOQA 1UVTH 4RN6A 1QJ1B 3M37A 1VCWA 1GJ5H 3F1SB 1J9CH 1LPZB 1RXPA 1MKXH 2VGCB 4ABJA 1TGSZ 4X2XA 3GCNA 1GBKA 3ZZDA 1P03A 2F83A 3P92A 4XOJA 2CHAB 2F9NA 5DO4H 2STAE 2DUCA 1V2PT 1YGCH 4DURA 1VJAU 3UNRA 3MU0A 2HWLB 1G9IE 1IQHA 2P95A 1DICA 1TGTA 1TB6H 1O5DH 3EA8A 4IS5A 1W2KH 2FESH 3KQEA 5CHAB 4MG3A 1O2WA 1SGIB 3EQ0H 4NWLA 4BTUB 3M61U 1IQGA 4ZXXH 1BMLA 1DM4B 3GYLB 3RXPA 1ZSLA 2A7CA 5E0GA 2G55A 2ZHQH 1NT1A 3QZQA 4YOGA 3RMNH 2ZFRH 1EOJA 4CRAA 4FUGA 4BNRA 2VWLA 1NESE 2HNTF 1C1QA 2W26A 3STIA 2UWOA 2XBWA 2Y80A 4DVAU 1B7XB 2HLCA 1O3HA 1SGYE 1ESAA 1TA2A 2R2MB 3Q77A 1QL8A 3SO3A 3MHWU 3MO9A 2PR3A 5IDKA 2JH0D 1PQ7A 3SN8A 4F4OC 1Y3UA 4U2WA 2ZC9H 3SJIA 1C1PA 1NFYA 1M9UA 3O8BA 2KAIA 1BBRK 1WOFA 3U98H 1SPJA 3T29A 1W0YH 4ABBA 3OSYA 1QBVH 2ZPRA 1GBDA 2A31A 2BDBA 2IN2A 5EQQA 3U1JB 5G4BA 3RXQA 4O3TA 1DT2A 1C2GA 2PWXA 4AFQA 1TRYA 1GBEA 2R0LA 3TGJE 5T6FA 2ZGBH 1RTLA 5JBTA 2A32A 1H1BA 4X6NA 4NZQA 2B9LA 3E1XB 4Y76A 4BAOB 1EPTC 3BIUH 1ETRH 1HAHH 3GYMA 1HLTH 1ZR0A 3B8JA 3BTTE 3M7TA 5E8EH 1O2PA 2ZTXA 1F92A 3VB5A 3G01A 2FOFA 1BRUP 1BMAA 1Y59T 1HAYB 2XXLA 1A1RA 1LVYA 2VIDA 2Z3CA 2V3HH 1FN8A 3FANA 1H8DH 1IQIA 4Y8ZA 3T62A 2F9PA 1XM1A 2XBYA 2BHGA 2PUQH 2ZCHP 3P8OA 2A2QH 2GDDA 2ANWA 5JYIA 1EAIA 1GI6A 1HAZB 1DOJA 3LC3A 1LQDB 1C5NH 1O2IA 2OBOA 4O97A 1GJ9B 5C1YA 1TNIA 1C5PA 2F91A 3P8FA 2NU1E 1HIAA 2PTCE 1WTGH 5GXPA 2BQ6B 5EU8A 4A1VA 1SL3A 4MNXA 1BT7A 1KSNA 2ZWLH 1SMFE 1TGNA 2RA3A 1E38B 2HNTE 2C3SA 2AGGX 1QCPA 2TGDA 1O2NA 2QN5T 2ZPSA 3OYPA 5L6NH 1T8LA 5EXMA 2I6QA 3A84A 5C20A 4JYTA 2ZGXH 4IMZA 1MD7A 2GT8A 2BVSH 2HALA 3ZYEA 2SFAA 1O3GA 3S7KB 1FN6A 3ZZ6A 4XSKU 1JRSA 3SV8A 1F5KU 3T26A 1EATA 3VB4A 2AH4X 2ZTYA 1FAXA 3U9AH 3GY4A 4NCYA 3A7YA 1GHBF 1OWEA 1F2SE 1UTNA 4DIIH 1F5LA 1TNLA 5EOKA 1U6QA 3FP8E 3QGNB 5FHTA 1YBWA 2A5AA 2J34A 2A4OA 4B74A 3UNQA 3I29A 1INCA 1O5CB 4X1PU 1IHSH 1OPHB 1P3EA 1XUFA 1WQVH 1UCYK 1T8MA 1UTKA 4Z6AH 2XC4A 1NU7B 4ABIA 5LPEA 3PMJA 2V0BA 5ESTE 2P59A 2XC5A 1CHOF 1SOZA 3H5CB 1N1LA 4AGKA 1XXDA 3M3VA 3LGUA 1OKXA 1UHBB 4I8LA 4YO9A 1BRCE 3A8DA 4UE7H 1T4UH 1YF4A 3UY9A 2RCEA 3ZZ9A 2EI7A 4XBDA 4O9VA 3RM2H 3GY8A 4U01A 4AFZA 1HJAB 4D76A 1C4U2 4DIHH 1OS8A 2Q1JA 3KN2A 2ANMH 1HXEH 1ZGVA 2ZCLP 1KXFA 1T31A 1EAXA 4TY6A 3CS7A 1UK4A 1C5YB 1YPHC 1ZSJA 8LPRA 1LHEH 1P2JA 2FI5E 1OWKA 3GDUA 1A7SA 4E06H 1A0HB 1ETTH 1YPHE 1C5ZB 2FIRH 5AFZH 2ZU2A 1GBAA 1IQKA 4B73A 1PPZA 1Z6EA 1PPHE 2Q6FA 3VB3A 4FUBA 1O3JA 1TQ7B 4FUHA 7LPRA 7KMEH 1EZSC 2SNWA 3TVJB 3ENSB 1DDJA 2VWNA 1BJVA 4INLA 2ZFPH 4ABGA 1IQMA 1PPEE 1MKWH 1BRBE 4XE4A 1E0FD 3Q3XA 4F49A 5HM2A 1TPAE 1JOUB 2A5KA 2QF0A 1V2TT 1Y5BT 3UQVA 1LKBA 2QF3A 3C27B 3PWCA 1O2QA 1GDUA 1G32B 2PFEA 5C67A 4BOHA 1GVKB 3RXBA 1UCYH 1SGTA 3HKJB 1TMTH 3RU4T 4K3JA 1SGDE 5F8TA 1RTKA 2F9UA 1BCUH 1O2OA 2I6SA 1TMUH 1G3CA 2ZFSA 1G3BA 3A80A 4YOJA 2C93B 3E91A 1NROH 2ZG0H 1KXAA 1K1IA 1AUJA 1FONA 4JK5A 2QIQA 2FMJA 1K1PA 4KTCA 4X0WU 1QB1A 4I32A 1UTOA 2OC1A 3A8AA 2J92A 4JMYA 1SB1H 1DUAA 5LH8A 1CA0B 1HFDA 1FMGA 1A46H 4U32A 3SU5A 1O2KA 1O2XA 1DS2E 2ZDKA 2B5TB 3ZVAA 1A0JA 2TGTA 1GDNA 2WPMS 3RXJA 2FOGA 3LPRA 4FVDA 1C5WB 1A3BH 1PQAA 2A4RA 1HGTH 1P0SH 1ABIH 1FPCH 1JXPA 1T8OA 3H7OA 7GCHF 1IQNA 1SGQE 2M5TA 2PKAA 2UUJB 3LT3A 4Y0YE 3PMAB 4K1SA 2FLRH 4X8TH 1FQ3A 4YM9A 2BDHA 5FXLA 2QV1A 1Y5AT 4DT7B 2BD3A 1MQ5A 3RXGA 2XBXA 1C2DA 1VGCB 2SGPE 1KXEA 3FZZA 4AFSA 3TNSA 5A2MH 1QRZA 4X8UH 1ZTJA 3PWBA 1ZGIA 2RDLA 2G8TA 1C4Y2 4TPIZ 4XFQA 3W95A 4J2YB 1GL1A 4BXSA 3TJUA 1LPGB 5BPEA 1D9IA 1O5FH 4HZHA 1B5GH 1EOLA 1ZTLA 2PLXA 1K22H 1DITH 1D3DB 1CA8B 1O2TA 1C2EA 3SQHE 5K0HA 3I78A 2Z9LA 1W10U 2UUYA 4I8KA 1CU1A 2AGEX 3DFLA 1CT0E 1BMMH 1N8OC 2A4QA 4K1EA 2VNTA 1AHTH 1QB6A 1L1NA 1THSH 2BOKA 2GDEH 4X1RU 2P93A 4R0IA 2CN0H 2SGDE 3SUDA 1F0UA 5A0AE 1V2MT 1HCGA 1UTPA 5A8XA 1L0ZA 3OU0A 4GHTA 3MH6A 3FVFB 6GCHF 3MU8A 1HAOH 2BDIA 4FUJA 4CHAB 2G52A 1C1RA 1VITH 3SV6A 1V2UT 1KLJH 2XBVA 1Z8GA 1PQ5A 2WPKS 4DCDA 3RXMA 1JRTA 5GCHF 1EKBB 3SNDA 1LVOA 2VVVA 1BBRH 3MNBA 1QURH 1EJNA 3LDXH 1C9PA 1GCTB 4OS1A 2AERH 3NK8A 3KQDA 3GICB 1MAXA 4Y6DA 4WWYA 2THFB 1QY6A 1L2EA 1NRPH 3SHCH 1O2YA 3SI4H 1W11U 3SUEA 2AS9A 1A2CH 1SGPE 4BTTB 3ZVGA 1F5RA 4D9RA 2V35A 2BD5A 3TH3H 1TA6A 2XWAA 3ATMA 3RMMH 2G00A 1Y3WA 1W8BH 2HRVA 3BF6H 5IYTA 4ESTE 4INKA 5A0CA 1ZJDA 3ZZ3A 1EJMA 1BB0B 3D23A 3HATH 3BTGE 1FXYA 3AASA 1C5VA 2A5IA 1AIXH 2VVCA 2BLVA 4Q7XA 4ASHA 1EAUA 1EP6A 2UUKB 1FY3A 5FPTA 2BQ7B 3QO6A 4AG1A 2BB4A 1NM6A 5JBCS 4HFPB 3QLPH 1A5GH 1O33A 1PPCE 2ZKSA 2P3FH 1DX5M 1VR1H 3ATKA 5E0JA 2H5DA 4ABFA 1SGRE 2SGFE 3PTNA 1DY8A 2C8XB 1Q3XA 1BTPA 2FOAA 3M35A 3SGQE 1Z7KA 2PSYA 1EQ9A 2PTNA 3GCHC 2C8YB 1AFEH 3D49H 4DOQA 3EAJA 1O37A 2Z3DA 5K7RA 1VGCC 1CSOE 2GMTC 1CBWC 3MH7A 1ORFA 5FCKA 1V2KT 2FTMA 2QXIA 3VB6A 1DUEA 3VPKA 1MU6B 1VCPA 2J94A 4ZKNU 3Q00A 2Y5GA 1AE8H 3L6PA 2XRCA 1OYTH 4OGYA 2P3TB 4Y0ZE 2WUBA 2EC9H 3UTUH 3BEUA 4AYYB 1O3KA 4WXIA 4A7IB 1C4V2 3BSQA 3EDXB 1CBWB 2ZFQH 1BTXA 1K9OE 2QA9E 4GHQA 4UD9H 4X2WA 1AN1E 3NPSA 3A7WA 2WPHS 2Y7ZA 1GI2A 2OP9A 2C8ZB 1PPBH 1BTZA 2ANKH 2BZAA 1KXDA 3RDZA 1GGDC 1ELGA 1MTNC 3TJOA 3SV9A 2ZFTA 4WY3A 1YC0A 3DFJA 2ZU3A 3RXOA 3UIRA 2A7JA 3W94A 3A7TA 5JB9S 1VZQH 1BOQA 2TGPZ 2R2WU 1G36A 3QX5H 4NFEA 2FODA 2F3CE 3FZDA 1PFXC 4NWKA 1J14A 1XUJA 1FV9A 3S9AA 1BTHH 2BXUH 1W0ZU 1NFUA 1SOTA 4JZEH 4H6TA 1AY6H 1QBOA 4BAHB 1CHOG 5DGJA 1ANDA 1O32A 3F9FA 1LVBA 3K6ZA 1GVZA 1O3BA 1YLCA 1PQ8A 3VB7A 5A09A 5EW1H 1K28D 2FO9A 4UFGH 1WTHD 3Q3KA 2VH0A 1O2VA 3OY6U 1GHXH 2VGCC 4GSOA 1GG6B 5FBIA 3UOUA 2H9HA 1ZTKA 3MH5A 1PPGE 4ABAA 2PSXA 1J17T 3KNXA 4NA9H 3E0PB 3NWUA 4LXBH 4MPVA 4WXVA 4DG4A 4X6MA 2FXRA 1J16A 2SGQE 2BZ6H 4CR5A 3PLPA 1SLUB 3MFJA 4WF8A 3A86A 1DLEA 5HYOA 1QTFA 1PPFE 4NA7A 4MTBA 1KDQA 2GCTB 3NCLA 2J38A 3VXFH 5LPRA 3V0XA 4H6SB 1FZZA 1ZJKA 3K6YA 2FOHA 4OS7A 2R3UA 3VGCB 1SQAA 2HPQH 1MKWK 1MTVA 1KXBA 1NU9A 1OYQA 4GPGA 1O3DA 3BTQE 1NRQH 3UWIA 2Z9JA 4XBBA 2ZPQA 3L33A 4DJZB 3VFEA 4ABDA 2BD2A 1C1WH 1YP9A 3KQBA 3ZV9A 4BTIB 3E6PH 3TGKE 1F0SA 1ELFA 2BY6X 3LJJA 5L2ZH 1MU8B 4MPUA 4LZ1H 1GBFA 3TLOA 3EYDA 1LHGH 1C5XB 2ASUB 2FX6A 2GZ7A 4WVPE 4FU9A 2G5VA 1G2MA 1Z8RA 3MO6A 2HPPH 1Z1JA 3SGAE 1TYNA 2OTVA 4AG2A 2B7DH 2BLOA 1UK2A 3NXPA 1CQQA 3PM3A 3ZVEA 2EI6A 3BG8A 3LC5A 1YM0A 3TITA 3RXRA 2D26C 2CXVA 1QBNA 4YT6H 3M5OA 1NC6A 5AF9H 4ABHA 2BM2A 1HBTH 1ELEE 1EZUC 2ZGJA 1AVWA 1B0FA 4ISIH 3STJA 4GUXA 3EGKH 1FI8A 5DP6A 1YCPM 2WPJS 4WH6A 3MH4A 4FUFA 4X1NU 4INHA 1GPZA 1SFIA 3MNCA 3A8CA 2PHBA 4ISNA 1T8NA 1O30A 3RLYH 2JH6D 3I77A 4GVUA 5I25A 4MPXA 4E05H 1DANH 4I8GA 3TGIE 1C5RA 3AAUA 4ISHH 3SJ8A 2TBSA 3BTEE 1DWBH 3T28A 4BANB 3LGWA 4JYVH 2LPRA 5HGGA 1C1OA 2Q6DA 1EXFA 3ATIA 1UTLM 2XW9A 4DY7B 1C2FA 1TFXA 8GCHG 1A5IA 2GV7A 1LHFH 3MMGA 1V2JT 4YLQH 3TH2H 1HXFH 1YPGH 3AW1A 1O0DH 4KELA 2AEIH 3EE0B 1WQSA 1QL9A 5EPNA 2QGRA 1HUTH 5FBEA 2WV4A 1PJPA 1THPB 3MU4A 4ZMAH 2O8UA 5JPMH 3DT0H 5CMXH 2QC2A 3SJOA 1TMBH 3LH3A 2UWLA 2GVFA 1EJAA 2Y81A 2BQWB 3H7TA 2ZCKP 4Y8YA 1TBRH 2GV6A 3UQOA 5F6MA 2V3OH 1O3AA 4BAQB 1MZDA 2BD4A 1OOKB 3KQCA 1AGJA 2GT7A 1AZZA 4H4FA 4MNWA 3D62A 1NRRH 2QXHA 1D3TB 2OCVB 2BD8A 1YPLH 2FOMB 1C2JA 2GD4B 3MNXA 4ZROA 5DP9A 4JK6A 1O35A 3U8TH 5L2YH 2FS8A 3E16B 4B2BA 9ESTA 1D6WA 4K5ZA 4Q7ZA 2UWPA 5F8XA 1SVPA 1O3MA 1P2QA 2FOCA 3T27A 3Q3YA 1FY8E 1TOMH 1V3XA 2ZDLA 1P9UA 2BYAX 2P8OC 1EZQA 4Y10E 3RXFA 3MU1A 3DD2H 5EXNA 4NIYA 5T6DA 3BEFB 3V13A 1HJ8A 2FEQH 1VCQA 1P06A 2ZO3H 1KLTA 1ZOMA 2ZTZA 1ELDE 1YPEH 1TPSA 4OS2A 2OD3B 1JIMA 1ANBA 2PUXB 1OWDA 1AVGH 2ZGHA 1GJ4H 2W5EA 1C5LH 1ANCA 1YPKH 3SZNA 1DWCH 2XCFA 4ABEA 1W12U 3BG4C 3RXEA 4B76A 1TOCB 1GDQA 1S82A 1V2LT 2GCHF 1TONA 2BY7X 2AMPA 4AB9A 1XVOA 2FM2A 3U8RH 2OQUA 3A7ZA 1ELBA 4MPWA 2BY9X 1T32A 2ALPA 1DPOA 2A1DB 4IN2A 1P02A 5HMAA 1P05A 1O39A 2ZDMA 1NS3A 1DWEH 3T5FH 3TIUA 4B1TA 1ELAA 5TJXA 3LOXA 4GCHG 3GY5A 3DA9B 3UUZA 2ALVA 1DXWA 2CGAA 1GMCG 1SGFG 3E3TA 4X8VH 1O2SA 3SHAH 1MCTA 1FUJA 4MNYA 4UEHH 3KF2A 4VGCC 2OC8A 3ZZCA 1P8VC 4NFFA 2BVRH 2GZ8A 4E7RG 1OWIA 4Y7AA 1MKXK 1C5UA 3O8CA 1RJXB 1W3CA 2A7HA 1J8AA 2VIOA 1UTJA 2WUCA 1DXPA 4A1XA 1SLVB 2PKSC 3OTJE 2GP9B 4Z0KA 1G3DA 1YYY1 3K2UA 2W3IA 2D2DA 2FDAA 5EQRA 1OWJA 3RM0H 4IGDA 4X6PA 1P3CA 1E34B 1XUHA 1D3PB 3ZVFA 1Z8IB 1DY9A 3A7VA 1HAGE 1CT4E 2Z6BD 2RG3A 3PLBA 1NZQH 1V2RT 3TU7H 8ESTE 3U69H 3L3TA 3E90B 3JZ2B 1C1VH 5C3NA 1SHHB 4NSVA 1BMNH 3ATWA 3GY6A 5C1XA 3RXDA 3MTYA 3A89A 3URDA 1Y3XA 4WMDA 1QHRB 4RSPA 2ZHFH 2NU4E 1BZXE 1DE7H 1GJ7B 3LKWA 1O2UA 1YKTA 1T7CA 3SUFA 2LNCA 2ZU5A 2D1JA 1GJAB 1HAPH 1QR3E 3EA7A 1L4DA 4CRGA 1KDQB 1UVPA 1TBZH 2OC0A 1QRXA 1PYTD 4ZH8A 2B8OH 1ZMLA 1LHDH 3HGNA 4A5TS 3QK1A 3A85A 3GDSA 3HK3B 4AYVB 4H42U 4D8NA 2PV9B 3PTBA 1E37B 3DUXH 1HDTH 2O9QA 3LU9B 2ZDVH 3SNCA 1IAUA 1O3PB 1TE0A 1TAWA 4JZ1A 1O2HA 4B2CA 1AMHA 2ZQ1A 3RP2A 2YNBA 2AGIX 2BDAA 1V6DA 3RXCA 3UNSA 1GBCA 3VXEH 1ARCA 5ESBA 1KTSB 4AFUA 3BTWE 3SW2B 3N7OA 1KLIH 1HV7A 3MU5A 2OUAA 1O3NA 3A83A 3PO1B 1AWHB 1SGCA 3C1KA 1AKSB 5DP7A 1GI0A 2A4GA 2CV3A 3SGBE 1IOEA 3S7HB 5B6OA 5J4QA 1XVMA 4AGJA 1V2WT 4CHAC 3HK6B 1LPKB 2GMTB 2R0KA 3GCTG 4Y11E 1LTOA 5SGAE 4I7YH 2O8LA 2VWMA 4Q7YA 1Y3VA 1AUTC 2A0QB 1ETSH 3BV9B 4IC6A 2FP7B 4TYDA 4CRFA 1GG6C 3ZZ5A 1S84A 2PGQB 1TQ0B 2OBQA 4O03A 3SORA 5HXFA 3LGVA 2GTBA 1FLEE 1ZZZA 4I31A 2TIOA 3RXKA 3F9GA 2HNTC 2XTTB 4Q2KA 1H8IH 3AVZA 1SGFA 1SI5H 3IITA 4A6LA 1H4WA 3A81A 1SLWB 1P09A 3RC6A 2BDCA 2V6NA 1IQLA 2DE9A 1BHXB 1W7XH 3M3SA 1O2MA 2ULLA 4ZKRU 1RRKA 1H9HE 1S83A 1OSSA 1N8OB 1O38A 3PMBB 1C2IA 1S0QA 1ANEA 2FPZA 1Y3YA 3P8NA 3RXIA 2IPHA 2FI4E 4MDSA 3ELAH 1HJAC 5TCCA 2BD9A 4CBOA 3RC5A 5JB8S 1GMDF 3M3TA 3R0FA 4ZUHA 3RXTA 1GI4A 1P04A 2H9EH 3TNTA 1XUIA 2ZDAH 4QT8C 1GMHG 1S85A 4Y71A 1CHGA 1TNGA 2JKHA 2J9NA 2Y7XA 1RD3B 5F8ZA 4KTSA 2AIPA 4CRCA 2Z9IA 1KY9A 5GPIB 6ESTA 1QA7A 3M5LA 4Y7BA 1CGJE 2AYWA 2H1UA 1ZPBA 2J4IA 3B9FH 5E0HA 5GCHG 3LJOA 2BDGA 4K60A 2OLGA 1RTFB 2RA0A 1GCTC 2ZECA 2QXGA 1O34A 1SHYA 5CE1A 3V12A 1BA8B 1GI9B 4WMEA 2VVUA 1C5QA 4NZLA 4TY7A 1LDTT 6GCHG 5A8ZA 3OY5U 2IOTA 2J95A 3K65B 5JBBS 1HAVA 1WAYB 1IQFA 1UJ1A 2VH6A 2XCNA 5C1UA 1QJ6B 4JZFH 1ZMJA 3F9HA 3FFGA 2IJOB 1WU1A 2ZA5A 1MTUA 3TK9A 4ZKOU 3GOVB 4BAMB 2GCHG 4FUIA 1GI3A 3LONA 4ISLA 1GMHF 1IHTH 4WH8A 5LPFA 1K1OA 2STBE 3A8BA 1S6FA 1G3EA 1XXFA 1UK3A 3M7UA 3SI3H 1KYNA 4ZHMU 4CREA 2PKAB 1G2LA 1YCPK 1LHCH 2BOHB 2HVXA 3ZV8A 3MI4A 1YCPH 1GL0E 1JBUH 1DVAH 1S81A 5E2OA 1BTYA 1O36A 4X2YA 2C4FH 1DSTA 5TCAA 5LGOA 1BQYA 2NU2E 1BITA 4OS5A 1NTPA 3V7TA 3BTHE 1TX6A 1HIAB 5GDSH 1SBWA 2Z9KA 5FCRA 3AAVA 1O31A 4X1SU 1GHVH 5FPYA 3PV4A 1E35B 1Z71A 7GCHG 1GVLA 3V3MA 1CVWH 3MYWA 3QWCH 1G30B 1S6HA 1QFKH 4LOYH 3RXLA 1C1TA 4AN7A 4DGJA 1C2MA 1V2VT 2BLQA 1NFWA 1H9LB 4I8JA 1EX3A 3RUOA 3GCTF 1TNHA 3SBKA 3TK6A 4GCHF 3RXSA 1QQ4A 1ZMNA 4NIVA 1P12E 4FXGH 1EPTA 3ZVCA 1BDAA 2GZ9A 3GISB 6CHAC 4SGBE 1O2LA 2NU3E 2Z9GA 1GBIA 2AMQA 2W7UA 1AFQB 2FZZA 3O8RA 1DLKB 3P6ZB 2GGVB 4RKJB 1ZHRA 2ODYB 5A0BA 3KHVA 2AIQA 4X8SH 2SGAA 4ZHAA 1W14U 3DHKH 1MTWA 2UUFB 1HJ9A 1FIZA 4GAWA 5C5NA 2CF8H 1GJCB 2Z3EA 1Q31A 3TJVA 3QTVH 2VU8E 1EB1H 1OWHA 2A45B 7ESTE 4ZKSU 2WPLS 1V2OT 1VITF 2DE8A 2SNVA 3ZZ8A 2TPIZ 3PYHA 3SOSA 1TWXB 2ZHEH 2ILNA 5T3HA 1AB9C 1P2OA 3F68H 1TPOA 4BXWA 3CS0A 3E0NB 1JMOH 1N6XA 1OP8A 2H6MA 5PTPA 5FAHA 1GI8B 1Y5UT 1O5BB 1RGQA 1X7AC 4NG9H 4ZXYH 2WYGA 2R3YA 3TH4H 3ODFA 1EUFA 1BUIA 1HNEE 4B2AA 2VINA 1ZSKA 1JWTA 1PYTC 1Z6JH 2YNAA 5ABWA 1P57B 5I46H 1F7ZA 2AFQB 4KGAA 4UFDH 4RKOB 3TJNA 3GCOA 4K8YA 1C9TA 3UPEA 5BRRE 2VWOA 3PROA 4K8BA 1NRNH 1OX1A 5T6GA 3RXUA 4BAKB 3ZZ4A 1S0RA 4SGAE 1THRH 3SV7A 3IG6B 1EZXC 1TX8A 1QRWA 3OX7U 4OS6A 1O3FA 5DPAA 4AX9H 1HPGA 2CHAC 5CHAC 4TPYA 4X1QU 3ZVDA 1TPPA 1XMNB 2QCYA 3SUGA 1YLDA 3PLKA 1FAKH 1LCYA 2P94A 1AVXA 2FYRA 1C5OH 3SNEA 1AKSA 2OXSA 4I8HA 5EPYA 2ODQA 1WYKA 3S69A 5DK1A 1XUGA 5JBAS 4HTCH 2FYQA 1CE5A 1TLDA 1UVOA 1ZLRA 1MQ6A 3ZZBA 2FTLE 1Z1IA 1AI8H 1AWFH 5AHGH 1O3LA 1K1LA 5DP8A 3ZZ7A 4TWWA 3BG4B 4Y8XA 3SQEE 2A2XH 3SU6A 1LQEA 1SG8B 1VJ9U 1HAIH 4UFFH 1YPMH 3RU4E 1WV7H 3MOCA 5E2PA 2WV5A 3KEEA 1UTQA 2ZNKH 2D8WA 5L30H 1C5MD 1ZHPA 3MNSA 4D9QA 5GIBA 4LK4A 1BJUA 1GBTA 2CMYA 2W7SA 2ZF0H 2ZGCA 5DKMA 4XBCA 2J2UA 5C5OA 4CRDA 4I33A 1GBLA 4ZAEA 1HB0B 1AO5A 1C1NA 1ZHMA 3QGJA 3BTKE 4D7GA 3ITIA 1ZRKA 3AW0A 4PROA 1JIRA 1TRMA 1HRTH 5DP3A 4B71A 1P2KA 2H5CA 2B0FA 1GI5A 1VITG 2VJ1A 1P11E 1O3IA 1TBQH 1KXCA 1UTMA 2C8WB 4FUCA 1MTNB 3F9EA 1OP2A 1MZAA 1F0RA 2O8MA 2BX4A 2FI3E 4HI3A 4UDWH 4HGCA 4ZHLU 4MLFB 4NIWA 1HAXB 1UO6A 1L4ZA 1BHXF 3BEIB 1TGBA 2HGTH 2ODPA 1CO7E 1RS0A 1F0TA 3BN9A 4THNH 3A88A 3UR6A 4MNVA 2WYJA 4MQAA 2GCTC 1QNJA 2XYAA 1P2MA 3FAOA 3D65E 5A8YA 2FOEA 3VGCC 2QXJA 3IWMA 3LIWA 1GHAF 5EQSA 3NUMA 1ZRBA 2AMDA 4NA8A 1MTSA 1GMCF 1OXGA 5EW2H 5GWZA 1SGNE 4Q80A 1O5AB 1GCDA 1YPJH 1N6YA 3KL6A 1OP0A 1GMDG 2PW8H
chains in the Genus database with same CATH superfamily
4O3UA 1D6RA 3GY3A 3SU1A 3O8DA 1TX7A 4Y79A 4YZUA 4CH8B 1C2HA 1ACBE 1ELCA 3K9XB 4IN1A 3M5NA 3LGIA 5B6LA 2JETC 2WPIS 3RMOH 3S9BA 1TNKA 1SC8U 3SU4A 4KTUA 1MUEB 1WCZA 1V2NT 4NSYA 1EASA 1T4VH 3BTME 1GBHA 3KGPA 1EP5A 1S5SA 6LPRA 1BRAA 1NPMA 2R9PA 2Y6TA 3M7QA 1QJ7B 3OEHD 3UREA 4YT7H 1QGFA 1SQOA 2BLWA 1HAVB 1LO6A 2FX4A 3P70B 5EODA 4X6OA 4FOUC 2JIZD 3KIDU 1B0EA 1ESBA 1ZYOA 3QUMP 1O2RA 2ZDNA 5F03A 1AB9B 4YESB 1C2LA 2ZFFH 1GGDB 3PB1E 5DP5A 3RMLH 1TIOA 4NIXA 3P17H 1AE5A 1NRSH 2CF9H 1QZ8A 4X2VA 4IC5A 3QN7A 1BBRE 2FWWA 3U8OH 1GJBB 3A7XA 2FLBH 3UR9A 4DT4A 2QY0B 9LPRA 2Y82A 1GJ6A 2ZZUH 1G37A 3F6UH 1O3OA 1XKBC 2FOBA 4CH2B 1V2ST 2JH5D 2KAIB 4LZ4B 3BTDE 4B75A 1O3EA 1O5GH 4NGAH 1NFXA 1SQTA 2BY5X 5KECA 1P2IA 3MO3A 1EPTB 2Z94A 3RC4A 2VIQA 1NY22 2BMGB 3PMHB 4FVBA 2AHME 2ZIQH 4JZIA 3P8GA 1MBQA 2TRMA 1AU8A 4FU7A 1O2GH 4CRBA 3SU3A 2VB0A 1BTWA 3EA9A 1NO9H 4KKDA 2CJIA 1BIOA 3RLWH 1BTUA 1KMHB 4YLUA 4A1TA 5DP4A 2OINA 1V2QT 2VIPA 2G4UA 1O2ZA 1ELVA 5GJ4B 1AQ7A 1DFPA 1J15A 1W7GH 1UHBA 5HKKD 4IBLH 1Z8JB 1SGEE 2ZI2H 2F9VA 2ZP0H 2NWNA 5J4SA 1C5SA 3VEQB 3RXAA 1NN6A 1P9SA 2EI8A 1E1RD 4P02A 3S0NA 2IJD1 2O8TA 2TGAA 1MH0A 3U1IB 2ZHDA 3HGPA 1FPHH 3B23B 3Q76A 3TK5A 3LGYA 1QL7A 1AD8H 1GI1A 2C90B 2BDYA 4AORA 1ELTA 1IQEA 1SFQB 3BTFE 1GHBG 3MWIU 4IW4E 1C1SA 2QE7D 4WMFA 2F9OA 1H9IE 2Y5FA 2YOLA 2G81E 3RXHA 2XC0A 4FU8A 4K2YA 1O2JA 1GHAG 1UCYE 4R8TB 1TNJA 1UMAH 4CR9A 3ODDA 3F0OA 1FY5A 1TGCA 8GCHF 1K1NA 3SJ9A 2EEKA 5KEDA 1WUNH 3PO1C 4FUEA 1CGIE 4YOIA 1GBMA 1FNIA 5EG4A 4MVNA 1GI7B 3CP7A 3FP6E 4OS4A 4YTAA 5AVDA 2BVXH 3ZYDA 1FY1A 1UVUH 3NKKA 2ZU1A 3LH1A 3SV2H 4K69A 2ZHWH 4JYUH 1W13U 1C5TA 1FDPA 3ESTA 6CHAB 2G51A 5JDUB 1D4PB 1DWDH 1ESTA 1UVSH 2P16A 2YMSD 1P10A 3SJKA 2GX4A 1QB9A 1AFQC 1GJ8B 2BY8X 3RU4D 2H2ZA 3SNBA 3GY7A 2W3KA 1MAYA 3JZ1B 2XWBI 4UFEH 4TWYA 2WINI 2K1QA 4D7FA 3M36A 1K21H 1ZPZA 2QYIA 3NZIA 1MCVA 5ETXA 3A82A 3GDVA 4JZDH 5FX5A 1E36B 2EA3A 2OC7A 4UONA 4ISOA 3ZVBA 1QA0A 3PV5A 2BTCE 1GHWH 4XDEA 1L1JA 2O8WA 2OQ5A 4A92A 1K1MA 2IPQX 2ZQ2A 2KR7A 3KYFA 5DJ7A 1RIWB 3CENA 4VGCB 1A5HA 3URCA 1EB2A 3P95A 1YY3A 3HKIB 3T25A 1CT2E 1TALA 3SU0A 3GCHB 1XX9A 2H9TH 1K1JA 1C1MA 2BXTH 2QAAA 3RXVA 3QZRA 3HPTB 5FX6A 2VIVA 1MD8A 1RIWC 5EGMA 2ZU4A 1FJSA 3R3GB 3FKSD 1OHHD 1MBMA 1FIWA 1A3EH 4K1TA 4OGXA 2FS9A 2WV9A 1GHYH 1GHZA 1ID5H 1LVMA 2ZEBA 1A4WH 5AFYH 3SU2A 2HVYB 2JJ1D 1XKAC 3SNAA 1O5EH 4WJG2 3LGTA 5C2ZA 1GWAA 2BX3A 1SSXA 2F9BH 3S9CA 8KME2 1LKAA 3A87A 2SGEE 1O3CA 1AZ8A 1W0KD 2PGBB 3TPIZ 5HM9A 1QQUA 1KTTB 2JETB 3DSGA 1P2NA 1HYLA 2NU0E 4U30A 1KIGH 1TABE 1DSUA 3BIVH 1GBJA 1K2I1 1QIXB 1WSSH 3WY8A 5DG6A 1EAWA 3FP7E 2W6JD 5H4IB 1Q2WA 1MMJN 2BD7A 1C1UH 1FY4A 2G5NA 2ANYA 2F43B 4KP0A 1BMFD 1Y8TA 2Y5HA 1SR5C 4IMQA 1A0LA 1CA0C 2WHXA 1RFNA 1ZPCA 4AB8A 4DW2U 1A61H 3UFAA 1ABJH 2Q6GA 4M7GA 2PKSB 3UOPA 4J1YA 4GLYA 1GBBA 1GJDB 2GKVE 1D3QB 3M5MA 1ARBA 2P8OB 3KCGH 4JCNA 2ESTE 1E79D 1SLXB 1LMWB 3DSOA 3ZZAA 1COWD 3QTOH 3T2NA 3GY2A 1TRNA 4AZ2B 1XUKA 2HOBA 1C2KA 3ATLA 2XNIA 2Z7FE 2G4TA 2YMSB 3F3BA 3UWJH 1L1GA 2VIWA 1WBGB 1IQJA 4E7NA 1CGHA 5EXLA 3E8LA 3QDZB 4FUDA 2P3UB 4CBNA 1P01A 5FPSA 4AOQA 1UVTH 4RN6A 1QJ1B 3M37A 1VCWA 1GJ5H 3F1SB 3OAAD 1J9CH 1LPZB 1RXPA 1MKXH 2VGCB 3PRBA 4ABJA 1TGSZ 5KGOA 4X2XA 3GCNA 1GBKA 3ZZDA 1P03A 2F83A 3P92A 4XOJA 2CHAB 2F9NA 5DO4H 2STAE 2DUCA 1V2PT 4M9FA 1YGCH 4DURA 1VJAU 3UNRA 3MU0A 2HWLB 1G9IE 1IQHA 2P95A 1DICA 1TGTA 1TB6H 1O5DH 3EA8A 4IS5A 1W2KH 2FESH 3KQEA 5CHAB 4MG3A 1O2WA 1SGIB 3EQ0H 4NWLA 4BTUB 3M61U 1IQGA 3CNRA 4ZXXH 1BMLA 1DM4B 3GYLB 3RXPA 1ZSLA 2A7CA 5E0GA 2G55A 2ZHQH 1NT1A 3QZQA 4YOGA 3RMNH 2ZFRH 1EOJA 4CRAA 4FUGA 4BNRA 2VWLA 1NESE 2HNTF 1C1QA 2W26A 3STIA 2UWOA 2XBWA 2J5UA 2Y80A 4DVAU 3PV2A 1B7XB 2HLCA 1O3HA 1SGYE 1ESAA 1TA2A 2R2MB 3Q77A 1QL8A 3SO3A 3MHWU 3MO9A 2KX4A 2PR3A 5IDKA 2JH0D 1PQ7A 3SN8A 4F4OC 4RI0A 1Y3UA 4U2WA 2ZC9H 3SJIA 1C1PA 1NFYA 1M9UA 3O8BA 2KAIA 1BBRK 1WOFA 3U98H 1SPJA 3T29A 1W0YH 4ABBA 3OSYA 1QBVH 2ZPRA 1GBDA 2A31A 2BDBA 2IN2A 5EQQA 3U1JB 5G4BA 3RXQA 4O3TA 4XRNA 1DT2A 1C2GA 2PWXA 4Z1MD 4AFQA 2CK3D 1TRYA 1GBEA 2R0LA 3TGJE 2QF4A 5T6FA 2KCYA 2ZGBH 1RTLA 5JBTA 2A32A 1H1BA 4X6NA 4NZQA 2B9LA 3E1XB 4Y76A 4BAOB 1EPTC 3BIUH 1ETRH 1HAHH 3GYMA 1HLTH 1ZR0A 3B8JA 3BTTE 3FOAA 3M7TA 5E8EH 1O2PA 2ZTXA 1F92A 3VB5A 3G01A 2FOFA 1BRUP 1BMAA 1Y59T 1HAYB 2XXLA 1A1RA 1LVYA 2VIDA 2Z3CA 2V3HH 1FN8A 3FANA 1H8DH 1IQIA 4Y8ZA 3T62A 2F9PA 1XM1A 2XBYA 2BHGA 2PUQH 2ZCHP 3P8OA 2A2QH 5C94A 2GDDA 2ANWA 5JYIA 1EAIA 1GI6A 1HAZB 1DOJA 3LC3A 1LQDB 1C5NH 1O2IA 2OBOA 4O97A 1GJ9B 5C1YA 1TNIA 1C5PA 2F91A 3P8FA 2NU1E 1HIAA 2PTCE 3WWBA 1WTGH 2L6OA 5GXPA 2BQ6B 5EU8A 4A1VA 1SL3A 4MNXA 1BT7A 1KSNA 2ZWLH 1SMFE 1TGNA 2RA3A 1E38B 2HNTE 2C3SA 2AGGX 1QCPA 2TGDA 1O2NA 2QN5T 2ZPSA 3OYPA 5L6NH 1T8LA 5EXMA 2I6QA 3A84A 5C20A 4JYTA 2ZGXH 4IMZA 1MD7A 2GT8A 2BVSH 2HALA 3ZYEA 2SFAA 1O3GA 3PRDA 3S7KB 1FN6A 3ZZ6A 2XNDD 4XSKU 1JRSA 3SV8A 1F5KU 3T26A 1EATA 3VB4A 2AH4X 2ZTYA 1FAXA 3U9AH 3GY4A 4NCYA 3A7YA 1GHBF 1OWEA 1F2SE 1UTNA 4DIIH 1F5LA 1TNLA 5EOKA 1U6QA 3FP8E 3QGNB 5FHTA 1YBWA 2VBCA 2A5AA 2J34A 2A4OA 4B74A 3UNQA 3I29A 1INCA 1O5CB 4X1PU 1IHSH 1OPHB 1P3EA 1XUFA 1WQVH 5EJ1A 1UCYK 1T8MA 1UTKA 4Z6AH 1E1QD 2XC4A 1NU7B 4ABIA 5LPEA 3PMJA 2V0BA 5ESTE 2P59A 2XC5A 1CHOF 1SOZA 5EIYA 3H5CB 1N1LA 4F55A 4AGKA 1XXDA 3M3VA 3LGUA 1OKXA 1UHBB 4I8LA 4YO9A 1BRCE 3A8DA 4UE7H 1T4UH 3UAIC 1YF4A 3UY9A 2RCEA 3ZZ9A 4ZCNA 2EI7A 4XBDA 4O9VA 3RM2H 3GY8A 4U01A 4AFZA 1HJAB 4D76A 1C4U2 4DIHH 1OS8A 2Q1JA 2M2AA 3KN2A 2ANMH 1HXEH 1ZGVA 2ZCLP 1KXFA 1T31A 3GS9A 1EAXA 4TY6A 3CS7A 1UK4A 1C5YB 1YPHC 1ZSJA 8LPRA 1LHEH 1P2JA 2FI5E 1OWKA 3GDUA 1A7SA 4E06H 1A0HB 1ETTH 1YPHE 5C0TA 1C5ZB 2FIRH 5AFZH 2ZU2A 1GBAA 1IQKA 4B73A 1PPZA 1Z6EA 1PPHE 2Q6FA 3VB3A 4FUBA 1O3JA 3F2HA 1TQ7B 4FUHA 7LPRA 7KMEH 1EZSC 2SNWA 3TVJB 3ENSB 1DDJA 2VWNA 1BJVA 4INLA 2ZFPH 4ABGA 1IQMA 1PPEE 1MKWH 1BRBE 4XE4A 1E0FD 3Q3XA 4F49A 5HM2A 1TPAE 1JOUB 2A5KA 2QF0A 1V2TT 1Y5BT 3UQVA 1LKBA 2QF3A 3C27B 3PWCA 1O2QA 1GDUA 1G32B 2PFEA 5C67A 4BOHA 1GVKB 3RXBA 1UCYH 1SGTA 3HKJB 1TMTH 3RU4T 4K3JA 1SGDE 3N7DA 5F8TA 1RTKA 2F9UA 1BCUH 1O2OA 2I6SA 1TMUH 1EFRD 1G3CA 2ZFSA 1G3BA 3A80A 4YOJA 2C93B 3E91A 1NROH 2ZG0H 1KXAA 1K1IA 1AUJA 1FONA 4JK5A 2QIQA 2FMJA 1K1PA 4KTCA 4X0WU 1QB1A 4I32A 1UTOA 2OC1A 3A8AA 2J92A 4JMYA 1SB1H 3OTPA 1DUAA 5LH8A 1CA0B 1HFDA 1FMGA 1A46H 4U32A 3SU5A 1O2KA 1O2XA 1DS2E 2ZDKA 2B5TB 3ZVAA 1A0JA 2TGTA 1GDNA 2WPMS 3RXJA 2FOGA 3LPRA 4FVDA 1C5WB 1A3BH 1PQAA 2A4RA 1HGTH 1P0SH 1ABIH 1FPCH 1JXPA 1T8OA 3H7OA 7GCHF 1IQNA 1SGQE 2M5TA 2PKAA 2UUJB 3LT3A 4Y0YE 3PMAB 4K1SA 2GJGA 2FLRH 4X8TH 1FQ3A 4YM9A 2BDHA 5FXLA 2QV1A 1Y5AT 4DT7B 2BD3A 1MQ5A 3RXGA 2XBXA 1C2DA 1VGCB 2SGPE 1KXEA 2JJ2D 3FZZA 4AFSA 3TNSA 2OK5A 1QRZA 4X8UH 1ZTJA 3PWBA 1ZGIA 5A2MH 2RDLA 2F4LA 2G8TA 1C4Y2 4TPIZ 4XFQA 3W95A 4J2YB 1GL1A 2J98A 3TJUA 1LPGB 4BXSA 5BPEA 1D9IA 1O5FH 4HZHA 1B5GH 1EOLA 1ZTLA 2PLXA 1K22H 1DITH 1D3DB 1CA8B 1O2TA 1C2EA 3SQHE 5K0HA 3I78A 2Z9LA 1W10U 2UUYA 4I8KA 2QF5A 1CU1A 2AGEX 3DFLA 1CT0E 1BMMH 1N8OC 2A4QA 4K1EA 2VNTA 1AHTH 1QB6A 1L1NA 1THSH 2BOKA 2GDEH 4X1RU 2P93A 4R0IA 2CN0H 2SGDE 3SUDA 1F0UA 5A0AE 1V2MT 1HCGA 1UTPA 5A8XA 1L0ZA 3OU0A 4GHTA 3MH6A 3FVFB 6GCHF 3MU8A 2XOKD 1HAOH 2BDIA 4FUJA 4CHAB 1VKYA 2G52A 1C1RA 1VITH 3SV6A 1V2UT 1KLJH 2XBVA 1Z8GA 1PQ5A 2WPKS 1NBME 4DCDA 3RXMA 1JRTA 5GCHF 2WZQA 1EKBB 3SNDA 1LVOA 2VVVA 1BBRH 3MNBA 1QURH 1EJNA 3LDXH 1C9PA 1GCTB 4OS1A 2AERH 3NK8A 3KQDA 3GICB 1MAXA 4Y6DA 4WWYA 2THFB 1QY6A 1L2EA 1NRPH 3SHCH 1O2YA 3SI4H 1W11U 3SUEA 2AS9A 1A2CH 1SGPE 4BTTB 3ZVGA 1F5RA 4D9RA 2V35A 2BD5A 3TH3H 1TA6A 2XWAA 3ATMA 3RMMH 2G00A 1Y3WA 1W8BH 2HRVA 3BF6H 5IYTA 4ESTE 4INKA 5A0CA 1ZJDA 3ZZ3A 1EJMA 1BB0B 3D23A 3HATH 3BTGE 1FXYA 3AASA 1C5VA 2A5IA 1AIXH 2VVCA 2BLVA 4Q7XA 4ASHA 1EAUA 1EP6A 2UUKB 1FY3A 5FPTA 2BQ7B 3QO6A 4AG1A 2BB4A 1NM6A 5JBCS 4HFPB 3QLPH 1A5GH 1O33A 1PPCE 5IK2D 2ZKSA 2P3FH 1DX5M 1VR1H 3ATKA 5E0JA 2H5DA 4ABFA 1SGRE 2SGFE 3PTNA 1DY8A 2C8XB 1Q3XA 1BTPA 2FOAA 3M35A 3SGQE 3WW7A 1Z7KA 2PSYA 1EQ9A 2PTNA 1SQRA 3GCHC 2C8YB 1AFEH 3D49H 4DOQA 3EAJA 1O37A 2Z3DA 5K7RA 1VGCC 3OFND 1CSOE 2GMTC 1CBWC 3MH7A 1ORFA 1UW7A 5FCKA 1V2KT 2FTMA 2QXIA 3VB6A 1DUEA 3VPKA 1MU6B 1VCPA 1YWUA 2J94A 4ZKNU 3Q00A 2Y5GA 1AE8H 3L6PA 2XRCA 1OYTH 4OGYA 2P3TB 4Y0ZE 2WUBA 2EC9H 3UTUH 5EJLA 3BEUA 4AYYB 1O3KA 4WXIA 4A7IB 1C4V2 3BSQA 3EDXB 1CBWB 2ZFQH 1BTXA 1K9OE 1W0JD 2QA9E 4GHQA 4UD9H 4X2WA 1AN1E 3OE7D 3NPSA 3A7WA 2WPHS 2Y7ZA 1GI2A 2OP9A 2C8ZB 1PPBH 1BTZA 2ANKH 2BZAA 1KXDA 3RDZA 1GGDC 1ELGA 1MTNC 3TJOA 3SV9A 2ZFTA 4WY3A 1YC0A 3DFJA 2ZU3A 3RXOA 3UIRA 2A7JA 5HIZA 3W94A 3A7TA 5JB9S 1VZQH 1BOQA 2TGPZ 2R2WU 1G36A 3QX5H 4NFEA 2FODA 2F3CE 3FZDA 1PFXC 4NWKA 1J14A 1XUJA 1FV9A 3S9AA 1BTHH 2BXUH 1W0ZU 1NFUA 1SOTA 4JZEH 4H6TA 1AY6H 1QBOA 4BAHB 1CHOG 1S6LA 1ANDA 1O32A 3F9FA 5DGJA 1LVBA 3K6ZA 1GVZA 1O3BA 1YLCA 1PQ8A 3VB7A 5A09A 5EW1H 1K28D 2FO9A 4UFGH 1WTHD 3Q3KA 2VH0A 1O2VA 3OY6U 1GHXH 2VGCC 4TT3D 4GSOA 1GG6B 5FBIA 3UOUA 2H9HA 1ZTKA 3MH5A 1PPGE 4ABAA 2PSXA 3N99A 1J17T 2KCOA 3KNXA 4NA9H 2PP6A 3E0PB 3NWUA 4LXBH 4MPVA 4WXVA 4DG4A 4X6MA 2FXRA 1J16A 2SGQE 2BZ6H 4CR5A 3PLPA 1SLUB 3MFJA 4WF8A 3A86A 1DLEA 5HYOA 4OM9A 1QTFA 1PPFE 1WXRA 4NA7A 4MTBA 1KDQA 2GCTB 3NCLA 2J38A 3VXFH 5LPRA 3V0XA 4H6SB 1FZZA 1ZJKA 3K6YA 2FOHA 4OS7A 2R3UA 3VGCB 1SQAA 2HPQH 3VG8A 1MKWK 1MTVA 1KXBA 1NU9A 1OYQA 4GPGA 1O3DA 3BTQE 1NRQH 3UWIA 2Z9JA 3N7EA 4XBBA 2ZPQA 3L33A 4DJZB 3VFEA 4ABDA 2BD2A 1C1WH 1YP9A 3KQBA 3SYJA 3ZV9A 4BTIB 3E6PH 3TGKE 1F0SA 1ELFA 2BY6X 3LJJA 5L2ZH 1MU8B 4MPUA 4LZ1H 1GBFA 3TLOA 3EYDA 1LHGH 1C5XB 2ASUB 2FX6A 2GZ7A 4WVPE 4B6FA 4FU9A 2G5VA 3KYGA 3W1EA 1G2MA 1Z8RA 3MO6A 2HPPH 1Z1JA 3SGAE 1TYNA 2OTVA 4AG2A 2B7DH 2BLOA 5C0UA 1UK2A 3NXPA 1CQQA 3PM3A 3ZVEA 2EI6A 3BG8A 3LC5A 1YM0A 3TITA 3RXRA 1YLNA 2D26C 2CXVA 2KCPA 1QBNA 4YT6H 3M5OA 2EQNA 1NC6A 5AF9H 4ABHA 2BM2A 1HBTH 1ELEE 1EZUC 2ZGJA 1AVWA 4Q4LA 1B0FA 4ISIH 3STJA 4GUXA 3EGKH 1FI8A 5DP6A 1YCPM 2WPJS 4TSFD 4WH6A 3MH4A 4FUFA 3EE7A 4X1NU 4INHA 1GPZA 1SFIA 3MNCA 4I86A 3A8CA 2PHBA 4B6EA 4ISNA 1T8NA 1O30A 3RLYH 2JH6D 3I77A 4GVUA 5I25A 4MPXA 4E05H 1DANH 4I8GA 3TGIE 1C5RA 3AAUA 4ISHH 3SJ8A 2TBSA 3BTEE 1DWBH 5DN6D 3T28A 4BANB 3LGWA 4JYVH 2LPRA 5HGGA 1C1OA 2Q6DA 1EXFA 3ATIA 1UTLM 2XW9A 4DY7B 1C2FA 1TFXA 4ACBA 8GCHG 1A5IA 2GV7A 1LHFH 3MMGA 1V2JT 4YLQH 3TH2H 1HXFH 4RT0A 1YPGH 3AW1A 1O0DH 4KELA 2AEIH 3EE0B 1WQSA 1QL9A 5EPNA 2QGRA 1HUTH 5FBEA 2WV4A 1PJPA 1THPB 3MU4A 2J97A 4ZMAH 2O8UA 5JPMH 3DT0H 2V3MA 2QC2A 3SJOA 5CMXH 1TMBH 3LH3A 2UWLA 2WSSD 2RFKC 2GVFA 1EJAA 3DSPA 2Y81A 2BQWB 3H7TA 2ZCKP 4Y8YA 1TBRH 2GV6A 3UQOA 5F6MA 2V3OH 1O3AA 4BAQB 3KQ5A 1MZDA 2BD4A 1OOKB 3KQCA 1AGJA 2GT7A 1AZZA 4H4FA 4MNWA 3D62A 1NRRH 2QXHA 1D3TB 2OCVB 2BD8A 1YPLH 2FOMB 1C2JA 2GD4B 3MNXA 4ZROA 5DP9A 4JK6A 1O35A 3U8TH 5L2YH 2FS8A 3E16B 4B2BA 9ESTA 1D6WA 4K5ZA 4Q7ZA 2UWPA 5F8XA 1SVPA 1O3MA 1P2QA 2FOCA 3T27A 3Q3YA 1FY8E 1TOMH 1V3XA 2ZDLA 1P9UA 2BYAX 2P8OC 1EZQA 4Y10E 3RXFA 3MU1A 3DD2H 5EXNA 5T1VA 4NIYA 5T6DA 3BEFB 3V13A 1HJ8A 2FEQH 1VCQA 1P06A 2ZO3H 1KLTA 1ZOMA 2ZTZA 1ELDE 1YPEH 1TPSA 4OS2A 2OD3B 1JIMA 1ANBA 2PUXB 1OWDA 1AVGH 2ZGHA 1GJ4H 2W5EA 1C5LH 1ANCA 1YPKH 3SZNA 1DWCH 1H8ED 2XCFA 5F53A 2JDID 4ABEA 1W12U 3BG4C 3RXEA 4B76A 1TOCB 1GDQA 5FL7D 1S82A 1V2LT 2GCHF 4ASUD 1TONA 2BY7X 2AMPA 4AB9A 1XVOA 2FM2A 3U8RH 2OQUA 3A7ZA 3UB0A 1ELBA 4MPWA 2BY9X 4HG6A 1T32A 2ALPA 1DPOA 2A1DB 4IN2A 1P02A 5HMAA 1P05A 1O39A 2ZDMA 1NS3A 1DWEH 3T5FH 3TIUA 5GNDA 1ELAA 5TJXA 4B1TA 3LOXA 4GCHG 3GY5A 3DA9B 3UUZA 2ALVA 1DXWA 2CGAA 1GMCG 1SGFG 3E3TA 4X8VH 5EJZA 1O2SA 3SHAH 1MCTA 1FUJA 4MNYA 4UEHH 3KF2A 4VGCC 2OC8A 3ZZCA 1P8VC 4NFFA 2BVRH 2YMSC 2GZ8A 4E7RG 1OWIA 4Y7AA 1MKXK 1C5UA 3O8CA 1RJXB 1W3CA 2A7HA 1J8AA 2VIOA 3MQKC 1UTJA 2WUCA 1DXPA 4A1XA 1SLVB 2PKSC 3OTJE 2GP9B 4Z0KA 1G3DA 1YYY1 3K2UA 2W3IA 2D2DA 2FDAA 5EQRA 1OWJA 3RM0H 4AC9A 4IGDA 4X6PA 1P3CA 1E34B 1XUHA 1D3PB 3ZVFA 1Z8IB 1DY9A 3A7VA 1HAGE 1CT4E 2Z6BD 2RG3A 1K0HA 3PLBA 1NZQH 1V2RT 3TU7H 8ESTE 3U69H 3L3TA 3E90B 3JZ2B 1C1VH 5C3NA 1SHHB 4P00A 4NSVA 1BMNH 3ATWA 3GY6A 5C1XA 3RXDA 5C17A 3MTYA 3A89A 3URDA 1Y3XA 4WMDA 1QHRB 4RSPA 2ZHFH 2NU4E 1BZXE 1DE7H 1GJ7B 3LKWA 1O2UA 1YKTA 1T7CA 3SUFA 2LNCA 2LP6A 2ZU5A 2D1JA 1GJAB 1HAPH 1QR3E 3EA7A 1L4DA 4CRGA 1KDQB 1UVPA 1TBZH 2OC0A 1QRXA 1PYTD 4ZH8A 2B8OH 1ZMLA 1LHDH 3HGNA 4A5TS 3QK1A 3A85A 3GDSA 3HK3B 4AYVB 4H42U 3SZEA 4D8NA 2PV9B 3PTBA 1E37B 3DUXH 3ZIAD 1HDTH 2O9QA 3LU9B 2ZDVH 3SNCA 1IAUA 1O3PB 1TE0A 1TAWA 4JZ1A 1O2HA 4B2CA 1AMHA 2ZQ1A 3RP2A 2YNBA 2AGIX 2BDAA 1V6DA 3RXCA 3UNSA 1GBCA 3VXEH 3F0PA 1ARCA 5ESBA 1KTSB 4AFUA 3BTWE 3SW2B 3N7OA 1KLIH 1HV7A 2KCAA 3MU5A 2OUAA 1O3NA 3A83A 3PO1B 1AWHB 1SGCA 3C1KA 1AKSB 5DP7A 1GI0A 2A4GA 2CV3A 3SGBE 1IOEA 3S7HB 5B6OA 5J4QA 1XVMA 4AGJA 1V2WT 4CHAC 3HK6B 1LPKB 2GMTB 2R0KA 3GCTG 4Y11E 1LTOA 5SGAE 4I7YH 2O8LA 2VWMA 4Q7YA 1Y3VA 1AUTC 2A0QB 1ETSH 3BV9B 4IC6A 2FP7B 3F2GA 4TYDA 4CRFA 1GG6C 3ZZ5A 1S84A 2PGQB 1TQ0B 2OBQA 4O03A 3SORA 5HXFA 3LGVA 2GTBA 1FLEE 1ZZZA 2KM0A 4I31A 2TIOA 3RXKA 3F9GA 2HNTC 2XTTB 4Q2KA 1H8IH 3AVZA 1SGFA 1SI5H 3IITA 4A6LA 1H4WA 3A81A 1SLWB 1P09A 3RC6A 2BDCA 2V6NA 1IQLA 2DE9A 1BHXB 1W7XH 3M3SA 1O2MA 2ULLA 4ZKRU 1RRKA 1H9HE 1S83A 1OSSA 1N8OB 1O38A 3PMBB 2J98B 1C2IA 3DCLA 1S0QA 1ANEA 2FPZA 1Y3YA 1NBMD 3P8NA 3RXIA 2IPHA 2FI4E 4MDSA 3ELAH 1HJAC 5TCCA 2BD9A 3FN8A 4CBOA 3RC5A 5JB8S 1GMDF 2L74A 3M3TA 3R0FA 4ZUHA 3RXTA 1GI4A 1P04A 2H9EH 2KFWA 3TNTA 1XUIA 2ZDAH 4QT8C 1GMHG 1S85A 4Y71A 1CHGA 1TNGA 2JKHA 2J9NA 2Y7XA 1RD3B 5F8ZA 4KTSA 2AIPA 4CRCA 2Z9IA 1KY9A 5GPIB 6ESTA 1QA7A 3M5LA 4Y7BA 1CGJE 2AYWA 2H1UA 1ZPBA 2J4IA 3B9FH 5E0HA 5GCHG 3LJOA 2BDGA 4K60A 2OLGA 1RTFB 2RA0A 1GCTC 2ZECA 2QXGA 1O34A 1SHYA 5CE1A 3V12A 1BA8B 1GI9B 4WMEA 2VVUA 1C5QA 4NZLA 4TY7A 1LDTT 6GCHG 5A8ZA 3OY5U 2IOTA 2J95A 3K65B 5JBBS 2HLDD 1HAVA 1WAYB 3H09A 1IQFA 1UJ1A 2VH6A 2XCNA 5C1UA 4RT1A 1QJ6B 4JZFH 1ZMJA 3F9HA 3FFGA 2IJOB 1WU1A 2ZA5A 1MTUA 3TK9A 4ZKOU 3GOVB 4BAMB 2GCHG 4FUIA 1GI3A 3LONA 4ISLA 1GMHF 1IHTH 4WH8A 5LPFA 1K1OA 2STBE 3A8BA 1S6FA 1G3EA 1XXFA 1UK3A 3M7UA 3SI3H 1KYNA 4ZHMU 4CREA 2PKAB 1G2LA 1YCPK 1SKYE 1LHCH 2BOHB 2HVXA 3ZV8A 2LELA 3MI4A 1YCPH 1GL0E 1JBUH 1DVAH 1S81A 5E2OA 1BTYA 1O36A 4X2YA 2C4FH 1DSTA 5TCAA 5LGOA 1BQYA 2NU2E 1BITA 4OS5A 1NTPA 3V7TA 3BTHE 1TX6A 1HIAB 5GDSH 1SBWA 2Z9KA 5FCRA 3AAVA 4YXWD 1O31A 4X1SU 1GHVH 5FPYA 3PV4A 3WWFA 1E35B 1Z71A 7GCHG 1GVLA 3V3MA 3F2FA 1CVWH 3MYWA 3QWCH 1G30B 1S6HA 1QFKH 4LOYH 3RXLA 1C1TA 4AN7A 4DGJA 1C2MA 1V2VT 2BLQA 1NFWA 1H9LB 4I8JA 1EX3A 3RUOA 3GCTF 1TNHA 3SBKA 3TK6A 4GCHF 3RXSA 1QQ4A 1ZMNA 4NIVA 1P12E 4FXGH 1EPTA 3ZVCA 1BDAA 2GZ9A 3GISB 6CHAC 4SGBE 1O2LA 2NU3E 2Z9GA 1GBIA 2AMQA 2W6ID 2W7UA 1AFQB 1H8HD 1MABB 2FZZA 3O8RA 1DLKB 3P6ZB 2GGVB 4RKJB 1ZHRA 2ODYB 5A0BA 3KHVA 1WDIA 2AIQA 4X8SH 2SGAA 4ZHAA 1W14U 3DHKH 1MTWA 2UUFB 1HJ9A 1FIZA 4GAWA 5C5NA 2CF8H 1GJCB 2Z3EA 1Q31A 3TJVA 3QTVH 2VU8E 2WPDD 1EB1H 1OWHA 2A45B 7ESTE 4ZKSU 2WPLS 1V2OT 1VITF 2DE8A 2SNVA 3ZZ8A 3AK5A 2TPIZ 3PYHA 3SOSA 1TWXB 2ZHEH 2ILNA 5T3HA 1AB9C 1P2OA 2EY4C 3F68H 1TPOA 4BXWA 3CS0A 3E0NB 1JMOH 1N6XA 4FETA 1OP8A 2H6MA 5PTPA 5FAHA 1GI8B 1Y5UT 1O5BB 5HIYA 1RGQA 1X7AC 4NG9H 4ZXYH 2WYGA 2R3YA 3TH4H 3ODFA 1EUFA 1BUIA 1HNEE 2K0QA 4B2AA 2VINA 1ZSKA 1JWTA 1PYTC 1Z6JH 2YNAA 5ABWA 1P57B 5I46H 1F7ZA 2AFQB 4KGAA 4UFDH 4RKOB 3TJNA 3GCOA 4K8YA 1C9TA 2RDEA 3UPEA 5BRRE 2VWOA 3PROA 4K8BA 3FO8D 1NRNH 1OX1A 5T6GA 3RXUA 4BAKB 3ZZ4A 1S0RA 4SGAE 1THRH 4XD7D 3SV7A 3IG6B 1EZXC 1TX8A 1QRWA 3OX7U 4OS6A 1O3FA 5DPAA 4AX9H 1HPGA 2KZ4A 2CHAC 5CHAC 4TPYA 4X1QU 3ZVDA 1TPPA 1XMNB 2QCYA 3SUGA 1YLDA 3PLKA 1FAKH 1LCYA 2P94A 1AVXA 2FYRA 1C5OH 3SNEA 1AKSA 2OXSA 4I8HA 5EPYA 2ODQA 1WYKA 3S69A 5DK1A 1XUGA 5JBAS 4HTCH 2FYQA 3U28C 1CE5A 1TLDA 1UVOA 1ZLRA 1MQ6A 3ZZBA 2FTLE 1Z1IA 1AI8H 1AWFH 5AHGH 1O3LA 1K1LA 5DP8A 3ZZ7A 4TWWA 3BG4B 4Y8XA 3SQEE 2A2XH 3SU6A 1LQEA 1SG8B 1VJ9U 1HAIH 4UFFH 1YPMH 3RU4E 1WV7H 3MOCA 5E2PA 2WV5A 3KEEA 1UTQA 2ZNKH 2D8WA 5L30H 1C5MD 1ZHPA 3MNSA 4D9QA 3OEED 5CDFE 4ACAA 5GIBA 4LK4A 1BJUA 1GBTA 2CMYA 2W7SA 2ZF0H 2ZGCA 5DKMA 4XBCA 2J2UA 5C5OA 4CRDA 4I33A 1GBLA 4ZAEA 1HB0B 1AO5A 2K8IA 1C1NA 1ZHMA 3QGJA 3BTKE 4D7GA 5CHBA 3ITIA 1ZRKA 3AW0A 4PROA 1JIRA 1TRMA 1HRTH 5DP3A 4B71A 1P2KA 2H5CA 2B0FA 1GI5A 5DSFA 1VITG 2VJ1A 1P11E 1O3IA 1TBQH 3NRLA 1KXCA 1UTMA 2C8WB 4FUCA 1MTNB 3F9EA 1OP2A 1MZAA 1F0RA 2O8MA 2BX4A 2FI3E 4HI3A 2V7QD 4UDWH 4HGCA 4ZHLU 4MLFB 4NIWA 1HAXB 1UO6A 1L4ZA 1BHXF 3BEIB 1TGBA 2HGTH 2ODPA 1CO7E 1RS0A 1F0TA 3BN9A 4THNH 3A88A 3UR6A 4MNVA 2WYJA 4MQAA 2GCTC 1QNJA 2XYAA 4F48B 1P2MA 3FAOA 3D65E 5A8YA 4Q63A 2FOEA 3VGCC 2QXJA 3IWMA 3LIWA 1GHAF 5EQSA 3NUMA 1FX0B 1ZRBA 2AMDA 4NA8A 1MTSA 1GMCF 1OXGA 5EW2H 5GWZA 1SGNE 4Q80A 1O5AB 1GCDA 1YPJH 1N6YA 3KL6A 1OP0A 1GMDG 2PW8H
chains in the Genus database with same CATH topology
4O3UA 1D6RA 3GY3A 3SU1A 3O8DA 1TX7A 4Y79A 4YZUA 4CH8B 1C2HA 1ACBE 1ELCA 3K9XB 4IN1A 3M5NA 3LGIA 2JETC 2WPIS 3RMOH 3S9BA 1TNKA 1SC8U 3SU4A 4KTUA 1MUEB 1WCZA 1V2NT 4NSYA 1EASA 1T4VH 3BTME 1GBHA 3KGPA 1EP5A 1S5SA 6LPRA 1BRAA 1NPMA 2R9PA 2Y6TA 3M7QA 1QJ7B 3UREA 4YT7H 1QGFA 1SQOA 2BLWA 1HAVB 1LO6A 2FX4A 3P70B 5EODA 4X6OA 3KIDU 1B0EA 1ESBA 1ZYOA 3QUMP 1O2RA 2ZDNA 5F03A 1AB9B 4YESB 1C2LA 2ZFFH 1GGDB 3PB1E 5DP5A 3RMLH 1TIOA 4NIXA 3P17H 1AE5A 1NRSH 2CF9H 4X2VA 4IC5A 3QN7A 1BBRE 2FWWA 3U8OH 1GJBB 3A7XA 2FLBH 3UR9A 2QY0B 9LPRA 2Y82A 1GJ6A 2ZZUH 1G37A 3F6UH 1O3OA 1XKBC 2FOBA 4CH2B 1V2ST 2JH5D 2KAIB 4LZ4B 3BTDE 4B75A 1O3EA 1O5GH 4NGAH 1NFXA 1SQTA 2BY5X 1P2IA 3MO3A 1EPTB 2Z94A 3RC4A 2VIQA 1NY22 2BMGB 3PMHB 4FVBA 2ZIQH 4JZIA 3P8GA 1MBQA 2TRMA 1AU8A 4FU7A 1O2GH 4CRBA 3SU3A 2VB0A 1BTWA 3EA9A 1NO9H 4KKDA 2CJIA 1BIOA 3RLWH 1BTUA 4YLUA 4A1TA 5DP4A 2OINA 1V2QT 2VIPA 2G4UA 1O2ZA 1ELVA 5GJ4B 1AQ7A 1DFPA 1J15A 1W7GH 1UHBA 4IBLH 1Z8JB 1SGEE 2ZI2H 2F9VA 2ZP0H 2NWNA 5J4SA 1C5SA 3VEQB 3RXAA 1NN6A 1P9SA 2EI8A 3S0NA 2O8TA 2TGAA 1MH0A 3U1IB 2ZHDA 3HGPA 1FPHH 3B23B 3Q76A 3TK5A 3LGYA 1QL7A 1AD8H 1GI1A 2C90B 2BDYA 4AORA 1ELTA 1IQEA 1SFQB 3BTFE 1GHBG 3MWIU 4IW4E 1C1SA 4WMFA 2F9OA 1H9IE 2Y5FA 2YOLA 2G81E 3RXHA 2XC0A 4FU8A 4K2YA 1O2JA 1GHAG 1UCYE 4R8TB 1TNJA 1UMAH 4CR9A 3ODDA 1FY5A 1TGCA 8GCHF 1K1NA 3SJ9A 2EEKA 1WUNH 3PO1C 4FUEA 1CGIE 4YOIA 1GBMA 1FNIA 5EG4A 4MVNA 1GI7B 3CP7A 3FP6E 4OS4A 4YTAA 5AVDA 2BVXH 3ZYDA 1FY1A 1UVUH 3NKKA 2ZU1A 3LH1A 3SV2H 4K69A 2ZHWH 4JYUH 1W13U 1C5TA 1FDPA 3ESTA 6CHAB 2G51A 5JDUB 1D4PB 1DWDH 1ESTA 1UVSH 2P16A 1P10A 3SJKA 2GX4A 1QB9A 1AFQC 1GJ8B 2BY8X 3RU4D 2H2ZA 3SNBA 3GY7A 2W3KA 1MAYA 3JZ1B 2XWBI 4UFEH 4TWYA 2WINI 2K1QA 4D7FA 3M36A 1K21H 1ZPZA 2QYIA 3NZIA 1MCVA 5ETXA 3A82A 3GDVA 4JZDH 5FX5A 1E36B 2EA3A 2OC7A 4UONA 4ISOA 3ZVBA 1QA0A 2BTCE 1GHWH 4XDEA 1L1JA 2O8WA 2OQ5A 4A92A 1K1MA 2ZQ2A 5DJ7A 1RIWB 3CENA 4VGCB 1A5HA 3URCA 1EB2A 3P95A 3HKIB 3T25A 1CT2E 1TALA 3SU0A 3GCHB 1XX9A 2H9TH 1K1JA 1C1MA 2BXTH 2QAAA 3RXVA 3QZRA 3HPTB 5FX6A 2VIVA 1MD8A 1RIWC 5EGMA 2ZU4A 1FJSA 3R3GB 1MBMA 1FIWA 1A3EH 4K1TA 4OGXA 2FS9A 1GHYH 1GHZA 1ID5H 1LVMA 2ZEBA 1A4WH 5AFYH 3SU2A 1XKAC 3SNAA 1O5EH 4WJG2 3LGTA 5C2ZA 1GWAA 2BX3A 1SSXA 2F9BH 3S9CA 8KME2 1LKAA 3A87A 2SGEE 1O3CA 1AZ8A 2PGBB 3TPIZ 5HM9A 1QQUA 1KTTB 2JETB 1P2NA 1HYLA 2NU0E 4U30A 1KIGH 1TABE 1DSUA 3BIVH 1GBJA 1K2I1 1QIXB 1WSSH 3WY8A 5DG6A 1EAWA 3FP7E 5H4IB 1Q2WA 1MMJN 2BD7A 1C1UH 1FY4A 2G5NA 2ANYA 4KP0A 1Y8TA 2Y5HA 1SR5C 4IMQA 1A0LA 1CA0C 1RFNA 1ZPCA 4AB8A 4DW2U 1A61H 3UFAA 1ABJH 2Q6GA 4M7GA 2PKSB 3UOPA 4J1YA 4GLYA 1GBBA 1GJDB 2GKVE 1D3QB 3M5MA 1ARBA 2P8OB 3KCGH 4JCNA 2ESTE 1SLXB 3ZZAA 1LMWB 3QTOH 3T2NA 3GY2A 1TRNA 4AZ2B 1XUKA 2HOBA 1C2KA 3ATLA 2XNIA 2Z7FE 2G4TA 3UWJH 1L1GA 2VIWA 1WBGB 1IQJA 4E7NA 1CGHA 5EXLA 3E8LA 3QDZB 4FUDA 2P3UB 4CBNA 1P01A 5FPSA 4AOQA 1UVTH 4RN6A 1QJ1B 3M37A 1VCWA 1GJ5H 3F1SB 1J9CH 1LPZB 1RXPA 1MKXH 2VGCB 4ABJA 1TGSZ 4X2XA 3GCNA 1GBKA 3ZZDA 1P03A 2F83A 3P92A 4XOJA 2CHAB 2F9NA 5DO4H 2STAE 2DUCA 1V2PT 1YGCH 4DURA 1VJAU 3UNRA 3MU0A 2HWLB 1G9IE 1IQHA 2P95A 1DICA 1TGTA 1TB6H 1O5DH 3EA8A 4IS5A 1W2KH 2FESH 3KQEA 5CHAB 4MG3A 1O2WA 1SGIB 3EQ0H 4NWLA 4BTUB 3M61U 1IQGA 4ZXXH 1BMLA 1DM4B 3GYLB 3RXPA 1ZSLA 2A7CA 5E0GA 2G55A 2ZHQH 1NT1A 3QZQA 4YOGA 3RMNH 2ZFRH 1EOJA 4CRAA 4FUGA 4BNRA 2VWLA 1NESE 2HNTF 1C1QA 2W26A 3STIA 2UWOA 2XBWA 2Y80A 4DVAU 1B7XB 2HLCA 1O3HA 1SGYE 1ESAA 1TA2A 2R2MB 3Q77A 1QL8A 3SO3A 3MHWU 3MO9A 2PR3A 5IDKA 2JH0D 1PQ7A 3SN8A 4F4OC 1Y3UA 4U2WA 2ZC9H 3SJIA 1C1PA 1NFYA 1M9UA 3O8BA 2KAIA 1BBRK 1WOFA 3U98H 1SPJA 3T29A 1W0YH 4ABBA 3OSYA 1QBVH 2ZPRA 1GBDA 2A31A 2BDBA 2IN2A 5EQQA 3U1JB 5G4BA 3RXQA 4O3TA 1DT2A 1C2GA 2PWXA 4AFQA 1TRYA 1GBEA 2R0LA 3TGJE 5T6FA 2ZGBH 1RTLA 5JBTA 2A32A 1H1BA 4X6NA 4NZQA 2B9LA 3E1XB 4Y76A 4BAOB 1EPTC 3BIUH 1ETRH 1HAHH 3GYMA 1HLTH 1ZR0A 3B8JA 3BTTE 3M7TA 5E8EH 1O2PA 2ZTXA 1F92A 3VB5A 3G01A 2FOFA 1BRUP 1BMAA 1Y59T 1HAYB 2XXLA 1A1RA 1LVYA 2VIDA 2Z3CA 2V3HH 1FN8A 3FANA 1H8DH 1IQIA 4Y8ZA 3T62A 2F9PA 1XM1A 2XBYA 2BHGA 2PUQH 2ZCHP 3P8OA 2A2QH 2GDDA 2ANWA 5JYIA 1EAIA 1GI6A 1HAZB 1DOJA 3LC3A 1LQDB 1C5NH 1O2IA 2OBOA 4O97A 1GJ9B 5C1YA 1TNIA 1C5PA 2F91A 3P8FA 2NU1E 1HIAA 2PTCE 1WTGH 5GXPA 2BQ6B 5EU8A 4A1VA 1SL3A 4MNXA 1BT7A 1KSNA 2ZWLH 1SMFE 1TGNA 2RA3A 1E38B 2HNTE 2C3SA 2AGGX 1QCPA 2TGDA 1O2NA 2QN5T 2ZPSA 3OYPA 5L6NH 1T8LA 5EXMA 2I6QA 3A84A 5C20A 4JYTA 2ZGXH 4IMZA 1MD7A 2GT8A 2BVSH 2HALA 3ZYEA 2SFAA 1O3GA 3S7KB 1FN6A 3ZZ6A 4XSKU 1JRSA 3SV8A 1F5KU 3T26A 1EATA 3VB4A 2AH4X 2ZTYA 1FAXA 3U9AH 3GY4A 4NCYA 3A7YA 1GHBF 1OWEA 1F2SE 1UTNA 4DIIH 1F5LA 1TNLA 5EOKA 1U6QA 3FP8E 3QGNB 5FHTA 1YBWA 2A5AA 2J34A 2A4OA 4B74A 3UNQA 3I29A 1INCA 1O5CB 4X1PU 1IHSH 1OPHB 1P3EA 1XUFA 1WQVH 1UCYK 1T8MA 1UTKA 4Z6AH 2XC4A 1NU7B 4ABIA 5LPEA 3PMJA 2V0BA 5ESTE 2P59A 2XC5A 1CHOF 1SOZA 3H5CB 1N1LA 4AGKA 1XXDA 3M3VA 3LGUA 1OKXA 1UHBB 4I8LA 4YO9A 1BRCE 3A8DA 4UE7H 1T4UH 1YF4A 3UY9A 2RCEA 3ZZ9A 2EI7A 4XBDA 4O9VA 3RM2H 3GY8A 4U01A 4AFZA 1HJAB 4D76A 1C4U2 4DIHH 1OS8A 2Q1JA 3KN2A 2ANMH 1HXEH 1ZGVA 2ZCLP 1KXFA 1T31A 1EAXA 4TY6A 3CS7A 1UK4A 1C5YB 1YPHC 1ZSJA 8LPRA 1LHEH 1P2JA 2FI5E 1OWKA 3GDUA 1A7SA 4E06H 1A0HB 1ETTH 1YPHE 1C5ZB 2FIRH 5AFZH 2ZU2A 1GBAA 1IQKA 4B73A 1PPZA 1Z6EA 1PPHE 2Q6FA 3VB3A 4FUBA 1O3JA 1TQ7B 4FUHA 7LPRA 7KMEH 1EZSC 2SNWA 3TVJB 3ENSB 1DDJA 2VWNA 1BJVA 4INLA 2ZFPH 4ABGA 1IQMA 1PPEE 1MKWH 1BRBE 4XE4A 1E0FD 3Q3XA 4F49A 5HM2A 1TPAE 1JOUB 2A5KA 2QF0A 1V2TT 1Y5BT 3UQVA 1LKBA 2QF3A 3C27B 3PWCA 1O2QA 1GDUA 1G32B 2PFEA 5C67A 4BOHA 1GVKB 3RXBA 1UCYH 1SGTA 3HKJB 1TMTH 3RU4T 4K3JA 1SGDE 5F8TA 1RTKA 2F9UA 1BCUH 1O2OA 2I6SA 1TMUH 1G3CA 2ZFSA 1G3BA 3A80A 4YOJA 2C93B 3E91A 1NROH 2ZG0H 1KXAA 1K1IA 1AUJA 1FONA 4JK5A 2QIQA 2FMJA 1K1PA 4KTCA 4X0WU 1QB1A 4I32A 1UTOA 2OC1A 3A8AA 2J92A 4JMYA 1SB1H 1DUAA 5LH8A 1CA0B 1HFDA 1FMGA 1A46H 4U32A 3SU5A 1O2KA 1O2XA 1DS2E 2ZDKA 2B5TB 3ZVAA 1A0JA 2TGTA 1GDNA 2WPMS 3RXJA 2FOGA 3LPRA 4FVDA 1C5WB 1A3BH 1PQAA 2A4RA 1HGTH 1P0SH 1ABIH 1FPCH 1JXPA 1T8OA 3H7OA 7GCHF 1IQNA 1SGQE 2M5TA 2PKAA 2UUJB 3LT3A 4Y0YE 3PMAB 4K1SA 2FLRH 4X8TH 1FQ3A 4YM9A 2BDHA 5FXLA 2QV1A 1Y5AT 4DT7B 2BD3A 1MQ5A 3RXGA 2XBXA 1C2DA 1VGCB 2SGPE 1KXEA 3FZZA 4AFSA 3TNSA 5A2MH 1QRZA 4X8UH 1ZTJA 3PWBA 1ZGIA 2RDLA 2G8TA 1C4Y2 4TPIZ 4XFQA 3W95A 4J2YB 1GL1A 4BXSA 3TJUA 1LPGB 5BPEA 1D9IA 1O5FH 4HZHA 1B5GH 1EOLA 1ZTLA 2PLXA 1K22H 1DITH 1D3DB 1CA8B 1O2TA 1C2EA 3SQHE 5K0HA 3I78A 2Z9LA 1W10U 2UUYA 4I8KA 1CU1A 2AGEX 3DFLA 1CT0E 1BMMH 1N8OC 2A4QA 4K1EA 2VNTA 1AHTH 1QB6A 1L1NA 1THSH 2BOKA 2GDEH 4X1RU 2P93A 4R0IA 2CN0H 2SGDE 3SUDA 1F0UA 5A0AE 1V2MT 1HCGA 1UTPA 5A8XA 1L0ZA 3OU0A 4GHTA 3MH6A 3FVFB 6GCHF 3MU8A 1HAOH 2BDIA 4FUJA 4CHAB 2G52A 1C1RA 1VITH 3SV6A 1V2UT 1KLJH 2XBVA 1Z8GA 1PQ5A 2WPKS 4DCDA 3RXMA 1JRTA 5GCHF 1EKBB 3SNDA 1LVOA 2VVVA 1BBRH 3MNBA 1QURH 1EJNA 3LDXH 1C9PA 1GCTB 4OS1A 2AERH 3NK8A 3KQDA 3GICB 1MAXA 4Y6DA 4WWYA 2THFB 1QY6A 1L2EA 1NRPH 3SHCH 1O2YA 3SI4H 1W11U 3SUEA 2AS9A 1A2CH 1SGPE 4BTTB 3ZVGA 1F5RA 4D9RA 2V35A 2BD5A 3TH3H 1TA6A 2XWAA 3ATMA 3RMMH 2G00A 1Y3WA 1W8BH 2HRVA 3BF6H 5IYTA 4ESTE 4INKA 5A0CA 1ZJDA 3ZZ3A 1EJMA 1BB0B 3D23A 3HATH 3BTGE 1FXYA 3AASA 1C5VA 2A5IA 1AIXH 2VVCA 2BLVA 4Q7XA 4ASHA 1EAUA 1EP6A 2UUKB 1FY3A 5FPTA 2BQ7B 3QO6A 4AG1A 2BB4A 1NM6A 5JBCS 4HFPB 3QLPH 1A5GH 1O33A 1PPCE 2ZKSA 2P3FH 1DX5M 1VR1H 3ATKA 5E0JA 2H5DA 4ABFA 1SGRE 2SGFE 3PTNA 1DY8A 2C8XB 1Q3XA 1BTPA 2FOAA 3M35A 3SGQE 1Z7KA 2PSYA 1EQ9A 2PTNA 3GCHC 2C8YB 1AFEH 3D49H 4DOQA 3EAJA 1O37A 2Z3DA 5K7RA 1VGCC 1CSOE 2GMTC 1CBWC 3MH7A 1ORFA 5FCKA 1V2KT 2FTMA 2QXIA 3VB6A 1DUEA 3VPKA 1MU6B 1VCPA 2J94A 4ZKNU 3Q00A 2Y5GA 1AE8H 3L6PA 2XRCA 1OYTH 4OGYA 2P3TB 4Y0ZE 2WUBA 2EC9H 3UTUH 3BEUA 4AYYB 1O3KA 4WXIA 4A7IB 1C4V2 3BSQA 3EDXB 1CBWB 2ZFQH 1BTXA 1K9OE 2QA9E 4GHQA 4UD9H 4X2WA 1AN1E 3NPSA 3A7WA 2WPHS 2Y7ZA 1GI2A 2OP9A 2C8ZB 1PPBH 1BTZA 2ANKH 2BZAA 1KXDA 3RDZA 1GGDC 1ELGA 1MTNC 3TJOA 3SV9A 2ZFTA 4WY3A 1YC0A