1BMAA

Benzyl methyl aminimide inhibitor complexed to porcine pancreatic elastase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title Interaction of a peptidomimetic aminimide inhibitor with elastase.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1995-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bmaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bmaA01
5GPIB 1A5HA 4TPIZ 3N7OA 1RXPA 5DJ7A 4YT6H 2VGCC 1GDUA 2GTBA 2ZFFH 3MO6A 2PTCE 4DW2U 2O8WA 3V13A 5FX5A 1EJAA 1GMHF 2AGEX 4A1XA 1SMFE 3F9GA 2F9VA 1L4DA 1YYY1 1VCWA 4CRDA 2R3UA 2VWLA 4MPWA 4GHQA 3T29A 3F9FA 5FBIA 3ZV8A 3ZZ5A 4K1SA 3GCNA 1DXWA 4AFUA 1UCYE 2ZDNA 4DGJA 1DVAH 1VR1H 4NIVA 2WPMS 3DFLA 1AB9B 2QF0A 4ZKSU 5J4QA 4NSYA 1ELBA 1TPPA 1O3PB 1GI6A 5F8TA 4OGYA 3SGBE 1MUEB 4ZXXH 4BXSA 1KTSB 2AMDA 3WY8A 1PPCE 4MPVA 3TK6A 2D1JA 3QZRA 1NS3A 5A8ZA 4DIHH 2TGTA 1BRBE 1VGCC 4TWWA 5HGGA 3BTHE 4K3JA 1QFKH 2ZU3A 2AIQA 1FI8A 3VGCB 1Z6JH 2HNTC 1OP0A 1TMBH 4HZHA 4K5ZA 5JBTA 2B9LA 4UD9H 3VB5A 1UJ1A 3DHKH 3SO3A 1O2VA 1TNGA 3PO1B 5K7RA 1IQEA 1BRUP 3STJA 4Y7AA 1UTMA 4IW4E 2ZU4A 1C9TA 7LPRA 4X8VH 4A1TA 1E35B 3RXUA 1AU8A 1BJUA 1SOZA 2EI7A 2B0FA 1VITH 3LOXA 3A84A 4U32A 2G51A 1NFYA 3KF2A 3O8BA 3SOSA 2XBYA 1CGIE 2BD2A 2PUQH 2XC5A 4B73A 5JB8S 2BXTH 4IN1A 1GDQA 1V2ST 1SGEE 4JK6A 3R0FA 3TNTA 3AASA 2R0KA 2ZGCA 3Q3XA 3TH3H 5BPEA 3RC5A 1P10A 2ZDLA 4CREA 3A87A 1QRZA 1NRRH 1O2MA 1ARBA 1Z8JB 1K28D 1TLDA 3MMGA 1GMCF 1ZMNA 1KDQA 5FCKA 2FP7B 1CHOG 1K21H 1N8OC 1OWIA 2BDYA 5GCHF 1ZHRA 3SV9A 3RXRA 1SL3A 1G37A 3RXKA 5A8XA 3GCTF 1EX3A 2W3KA 1QIXB 1N1LA 1F7ZA 2C90B 2J4IA 1P06A 2ZDAH 4JZDH 1G2MA 3BIUH 4UEHH 2CV3A 3C27B 1K1IA 1C5TA 1XUJA 2BZAA 3SNBA 1UCYH 3FANA 3SI4H 5L2YH 2GCTB 4R0IA 4CBOA 3UUZA 3MU0A 2OINA 1AZZA 1LPGB 4MQAA 1QL7A 2ZHDA 3MNSA 1NRNH 2FODA 3S7HB 4ABEA 3H5CB 2NU2E 3D65E 1ZGIA 1D6RA 3SV8A 2CHAC 1RRKA 3A81A 3NK8A 4KGAA 4SGAE 3ZZ9A 3GYMA 1P12E 1NFWA 2XWAA 1C4Y2 1YCPH 2FS9A 1GI9B 1P9UA 1EASA 2W7SA 1Y3XA 5A0AE 1HAYB 3EE0B 1EP5A 2KAIB 2NU0E 2PKSB 2OUAA 7KMEH 2XC4A 4H6TA 4NCYA 5EG4A 2A31A 1GHZA 3ZZ4A 1FQ3A 1UO6A 3BTQE 5C1UA 3BIVH 2P8OB 5AF9H 4U2WA 1VJAU 1LHFH 1Q31A 2OP9A 3TVJB 3ZZAA 3PWCA 5F6MA 1EB2A 3MU5A 4UFDH 5DK1A 3S69A 1HYLA 1NTPA 4DT7B 5C67A 1RTFB 1OXGA 1W14U 2CMYA 3TJVA 4CBNA 2O8LA 1MZAA 1SLXB 1MZDA 4AYVB 5H4IB 1LVMA 4AFZA 3RXEA 4E05H 1V2RT 1FZZA 3MTYA 3SU5A 1KY9A 1O5GH 3PMJA 3E0NB 2WPIS 1C9PA 2NU4E 1KXDA 2A7HA 2ZG0H 5SGAE 1FLEE 3SJKA 1A0LA 2KAIA 1GHYH 4MLFB 2BD9A 2Z9KA 2FOHA 1K1NA 5EXLA 4D8NA 2BLVA 2G4TA 1O3HA 3GDUA 4NFFA 2ZPQA 2R3YA 1TOMH 3M3VA 3MI4A 4YT7H 1HJ9A 3RMOH 3K2UA 1G9IE 4YOJA 2RCEA 1IQGA 3F1SB 3RMMH 3BTKE 1YM0A 2A5KA 2C8ZB 2BDHA 3RXMA 1YPMH 2FS8A 2FO9A 1B7XB 1JRSA 3GY2A 3RXQA 3EA8A 3NCLA 2Y80A 4B75A 1UHBB 1OP2A 1G30B 1W12U 1C2MA 3TH4H 4Q7YA 1GBEA 2F9NA 4GCHF 1GJ5H 4K1TA 1Q3XA 1GWAA 3D49H 1L1NA 1XVOA 2HNTE 4NA9H 1LPZB 2XRCA 1OSSA 5AFZH 3SUDA 4I7YH 3OY5U 1NRSH 8GCHG 1BTWA 2ZPSA 3BF6H 4Y6DA 1PJPA 5DO4H 1C1QA 1GJBB 1NN6A 2ULLA 4Q80A 2Q1JA 1KSNA 2PWXA 3A7XA 1UVSH 1SHYA 4DOQA 3A7YA 1G2LA 2FOFA 4Y8XA 3QUMP 2J95A 1ESBA 1P0SH 5DPAA 6CHAC 1ID5H 1FMGA 6LPRA 1BIOA 3FP8E 3QX5H 1GCTC 2FX4A 3GDSA 5JB9S 4NIXA 3SGAE 1UTKA 4THNH 3GCHC 3P95A 4GLYA 5GXPA 9ESTA 1BBRK 1IQMA 4XE4A 3QK1A 1AKSA 1SVPA 4I8KA 4UDWH 3DD2H 2BY7X 5JDUB 1TB6H 1VITF 1BTUA 2AMPA 3ATKA 4TPYA 5A2MH 3TJOA 2A4RA 3MNCA 1UHBA 3TK9A 1O3OA 1C1NA 1PPZA 4ZXYH 1RTLA 4ZHMU 4DVAU 4X8SH 2BMGB 3QTOH 1PPEE 4H6SB 3B9FH 4AGJA 5HMAA 4A1VA 3I29A 2C93B 5ETXA 1H8IH 1EOLA 1THSH 2GV7A 2TRMA 5K0HA 3BG8A 1AVWA 3RXFA 1SQAA 4X6OA 4FU9A 1GHBG 4MNVA 1QB6A 1FDPA 4X2YA 3VFEA 4K60A 1C4U2 4B1TA 5E8EH 3LU9B 1JOUB 3Q76A 2A4GA 3BTEE 7GCHF 1SGDE 1PQ8A 2QAAA 3TK5A 8ESTE 2VIDA 1HPGA 2XBXA 4Q7ZA 1CQQA 3RXHA 1BUIA 4CRAA 4X6NA 2BM2A 4A7IB 2SGEE 1TBZH 2XCNA 4BANB 4UFGH 4Y79A 2G52A 1Y3WA 1TNHA 1XUGA 2ZZUH 3ZVEA 3LC5A 3RXIA 2G4UA 4YOGA 1WOFA 2XW9A 1NT1A 2FOGA 4JZIA 2RA3A 2FOEA 4Y10E 3RU4E 1Z1IA 3ATWA 4IGDA 2ALVA 4O3UA 2C8XB 3PYHA 4NFEA 1GI5A 4QT8C 2P16A 1ZSJA 2Q6GA 1S84A 3O8CA 3TGKE 4X2VA 3UIRA 5FAHA 2CXVA 2AMQA 3QLPH 1J9CH 1GHAG 2H9TH 1BQYA 1FIZA 2W5EA 4BAQB 1FAXA 3M5OA 3AAUA 2B5TB 2O8TA 1IQHA 4DIIH 1W3CA 3T2NA 2UUFB 3RXLA 2BVXH 4CHAC 1T4VH 3CP7A 2CGAA 2ILNA 4YESB 1DUEA 1ABJH 2ZWLH 1AHTH 5JYIA 3H7TA 1O3MA 3LGVA 3MNBA 4FU7A 3PB1E 3RXJA 1O0DH 2A7JA 1GGDB 1CT2E 2SGQE 3HK3B 2RA0A 5F8XA 2G5NA 1V2OT 1HAVA 2ALPA 2A45B 1SGTA 1BTPA 6GCHF 3GISB 3SU6A 4WY3A 3HGPA 5FX6A 1V2KT 1XUKA 1QBNA 3LT3A 1NZQH 2SFAA 1C2DA 2UWPA 4J1YA 1C2GA 5E2OA 4GUXA 1KXEA 1MU8B 1HJAC 1G3EA 3EDXB 1O38A 1TRMA 1IQFA 2PSXA 1OYTH 1QURH 1SGRE 3I77A 1TGSZ 3TJNA 1S5SA 2ZDVH 1FN6A 1C2JA 2C8WB 2VWMA 1O2LA 5FXLA 1EATA 1XX9A 4NWKA 1FY3A 1GMHG 2VGCB 1PYTC 4U01A 3OTJE 3ENSB 1QCPA 2BTCE 1BA8B 2ZGBH 4AG2A 1SQTA 1TYNA 2QXJA 1O2RA 1LQDB 4OGXA 1HV7A 4I8JA 1VZQH 3RU4T 2Z3EA 5J4SA 3M5MA 8LPRA 1SI5H 4OS5A 1MAXA 1X7AC 4CRBA 3P8GA 1AI8H 1DT2A 2ODPA 1MKXH 1SLUB 2HLCA 1F0UA 1FY8E 9LPRA 1RS0A 4XDEA 3LGTA 1HIAA 5HM2A 1HBTH 1P2KA 2Q6DA 2FMJA 1OS8A 5DP4A 1DDJA 3LDXH 2ZEBA 2ZFRH 3RP2A 1XM1A 2V3OH 4R8TB 2ZF0H 2ZNKH 1P11E 1O2XA 2EA3A 2ESTE 1BHXF 3ITIA 1AO5A 3HK6B 3RDZA 3CS0A 3MH7A 1RD3B 2Y7XA 1C5UA 4AX9H 4X1NU 1VGCB 3K6ZA 3O8RA 2AERH 3RM2H 1MBQA 4K8BA 1GI2A 4DJZB 1YKTA 3AVZA 3L3TA 1LHDH 5F8ZA 2VU8E 1Y3YA 1E37B 2QF3A 1KLJH 3CENA 1PQ7A 1F5RA 3P17H 1EP6A 2A4QA 2OBOA 2C8YB 4X2XA 1WV7H 5FPTA 5LPRA 2SNVA 1ESAA 2P3TB 4XSKU 2WPHS 1ZRBA 1SGIB 1CVWH 1C5NH 2THFB 4TY6A 4O3TA 2GKVE 1QB9A 3GY6A 2G81E 5LPEA 3RXGA 1SHHB 3BG4C 3GY3A 3KCGH 3RLWH 1GHVH 1O3DA 1E34B 4D9RA 1TX8A 1L1GA 2ZCHP 3LC3A 4AZ2B 1P2MA 1MKWK 1XVMA 1MTVA 5HM9A 2FOBA 2RDLA 3HKJB 3BTFE 1KLIH 1P3CA 2JH5D 3A7TA 1AE5A 1ZPCA 4X6PA 2CN0H 5FCRA 4Y71A 3UTUH 3E3TA 1F0TA 4Y7BA 2V6NA 5GCHG 1EAWA 3LONA 1BTXA 3G01A 1C1VH 1EKBB 1XKBC 3GCTG 5PTPA 1C2FA 1K1LA 2H2ZA 3VB6A 1NC6A 1BB0B 1EXFA 5EODA 4BAKB 4CH2B 1WTGH 1AIXH 1OWEA 3SU2A 2FWWA 2ZCLP 1EJNA 2GV6A 1P01A 3MFJA 3RXCA 3M7UA 3A8CA 2V35A 1DITH 3E8LA 2D8WA 1DFPA 2AGGX 1HAHH 1ANDA 1TRYA 1QBOA 3SJIA 4BTTB 2BX4A 1C2IA 3VPKA 2XWBI 1AQ7A 1SBWA 4BAHB 2Y7ZA 3QGNB 4X0WU 3SJ8A 2UUJB 3RXPA 1KDQB 2Z94A 3EAJA 3V0XA 1O3CA 1GBLA 1B5GH 2CHAB 2UUYA 1A4WH 3F68H 2GMTC 4H4FA 2HNTF 2ZU1A 1HXFH 2FESH 1BMAA 1IAUA 2XC0A 5FHTA 1TGCA 3A86A 2PV9B 5JPMH 3AW0A 2J2UA 4ZUHA 3SUEA 2YNAA 5T6DA 2HWLB 5LH8A 2ANKH 1W7GH 2G8TA 4RKJB 3MO3A 4BNRA 1W2KH 1AFQC 2VH6A 1SSXA 1TMTH 3HGNA 1EQ9A 3SNDA 2GCHG 1J14A 3B23B 3M36A 3ZZ7A 2K1QA 2H9EH 1FONA 1HAPH 3Q3YA 2QXGA 2JKHA 3P70B 1SQOA 1LMWB 2FYRA 2PW8H 4FXGH 1S6FA 3FAOA 1O3KA 2F91A 1J16A 1DS2E 1H9IE 2OC1A 2VVUA 3HPTB 1WU1A 2FTLE 1HNEE 4B2CA 3LH3A 1P03A 1P8VC 1O2ZA 2F9UA 3FFGA 3S9AA 2FIRH 4KTCA 3SNCA 5I25A 1G3BA 4WF8A 3RXOA 5CMXH 2GZ7A 2BVRH 1Y5BT 3A83A 3SN8A 3QN7A 1C5MD 1SPJA 2HOBA 2WPLS 1MQ6A 4ABDA 3TGIE 1ZJKA 1KLTA 3KNXA 1DLKB 1P2NA 1NROH 1ESTA 4BTIB 3S0NA 3MO9A 1H1BA 1CA0B 2P94A 5DG6A 1NESE 4NZLA 3ZVDA 2HPQH 3A89A 1Y5AT 1RIWB 1MH0A 3A82A 2ZU2A 3UWIA 1HUTH 3PLKA 3A8BA 3K6YA 1AB9C 1BTHH 1SC8U 2P95A 1AZ8A 3BTDE 1LKBA 1ELCA 4XBBA 3ELAH 1A61H 1FY5A 4WMDA 4RN6A 1DICA 1KXCA 1KXFA 2QN5T 2AFQB 2JH6D 4ABFA 3IG6B 4D7FA 1GBTA 3UQVA 1FN8A 1YCPK 1BT7A 2H5DA 1WBGB 1T8OA 2GP9B 5TJXA 3M5LA 1NFUA 3VGCC 1WAYB 4VGCB 2AYWA 4LOYH 3FP6E 1Y3UA 1QGFA 3ATIA 3SV2H 2CJIA 3K65B 4CRGA 2GD4B 3PO1C 1ELDE 1MCTA 1A7SA 3NXPA 1IHTH 3ATMA 2OC8A 1FY1A 3P8OA 1TGTA 2W26A 1GMDF 1XXDA 1EPTC 2GDDA 2TGDA 2ZKSA 2BB4A 4HTCH 2V0BA 1TABE 3EQ0H 5EU8A 2FTMA 1ZLRA 3KQBA 1O5BB 1K2I1 3GCHB 3LGYA 1VITG 3LJJA 3GICB 4WJG2 1AWFH 1O31A 1DY8A 1UVUH 5GDSH 1BTYA 4FUJA 3F9HA 2BQ7B 3A7ZA 2ZPRA 2A2XH 3W95A 1GBBA 1GVLA 2PSYA 3LPRA 2TBSA 1Z8IB 3UNRA 2YNBA 4TYDA 3DUXH 1S0QA 4B2BA 2QXHA 1YC0A 2J38A 3E90B 3M7QA 2TIOA 4XBDA 1ZGVA 2SNWA 4FUFA 1GBCA 4NGAH 2ZFSA 5ESBA 1ELFA 3BTGE 2WYGA 7GCHG 4O97A 1CBWB 1AKSB 1BMMH 1TFXA 3PROA 4BTUB 3GY8A 1EZXC 1MD7A 1D6WA 2FX6A 5LGOA 1TGBA 1O5EH 1FXYA 2GCTC 2QC2A 4Q7XA 1TX7A 3M61U 3VXFH 3C1KA 1PYTD 1ANBA 1A5GH 2FZZA 1QA7A 3IWMA 5EXNA 3V3MA 4MNWA 3RMNH 1UVOA 5FBEA 2ZA5A 4UONA 3DFJA 4KELA 1BMLA 2ZP0H 4YM9A 1UTLM 1O2YA 1P02A 1PPHE 1TPSA 1TBQH 3W94A 3F9EA 3ODDA 3BTME 2P3UB 2PKSC 4KTSA 2VB0A 4AFSA 1SGYE 1O5AB 1AY6H 1LDTT 1MTNB 3SNEA 3PV4A 1TNLA 1V2MT 1ABIH 1QNJA 2WPJS 4U30A 1OWKA 1SGFA 4Y0YE 4IC6A 4ISLA 4MPXA 2PFEA 2OBQA 3U98H 1FPHH 3EGKH 1C5WB 5FPSA 4ISHH 3SW2B 1NM6A 2GVFA 3ATLA 1JRTA 3BN9A 1O2KA 2ZHFH 2IN2A 4WH6A 3RXSA 1DY9A 1YBWA 2FPZA 1IHSH 2W7UA 2BD8A 3SJOA 1KTTB 1V6DA 2DUCA 1O3IA 1DANH 5T6FA 1N6YA 2BY9X 1C5LH 3SORA 5EQRA 2QGRA 4JYTA 1D3PB 1TWXB 2VIVA 2OXSA 4WMFA 4BOHA 3U69H 1O2IA 4RKOB 3M3TA 1GBJA 5BRRE 1A3BH 4NIWA 2WUBA 2CF8H 1C1WH 1EJMA 1A5IA 4ABBA 4AG1A 1HLTH 1YPLH 2ODYB 4K8YA 3LGWA 1MD8A 4D7GA 2BLQA 3ZZ3A 2ZU5A 4ABGA 2Y5FA 3UWJH 1JIRA 1W13U 3TJUA 4ZH8A 1HAIH 1HDTH 1ZSLA 1GBKA 1HAVB 2AIPA 1SGQE 2ZQ2A 4A6LA 4OS6A 1YLCA 1QJ7B 4ISOA 2BY6X 2XXLA 2VWNA 1O2SA 1ANCA 5GIBA 3QO6A 4DG4A 1O30A 1YP9A 2BYAX 3TGJE 1C5PA 2WV4A 2O8UA 4D9QA 1O3NA 3KIDU 1NU9A 2Z3DA 1GVZA 4UFFH 1O3FA 1JWTA 3TLOA 1AUJA 5F03A 4OS2A 1A46H 3MU4A 2FEQH 1TA6A 4PROA 3NUMA 1V2UT 1UTQA 2BOKA 4WH8A 2H6MA 1BCUH 2AS9A 2FLRH 5AHGH 2VWOA 2H5CA 1NRQH 2FLBH 1BHXB 1P2IA 1QA0A 3PTNA 1GG6B 3KHVA 1GI7B 1LPKB 2Z9LA 2R0LA 3OY6U 3LH1A 1C5SA 3BV9B 1TE0A 4Y0ZE 1XKAC 4YZUA 2UUKB 3ZVAA 4MTBA 1L4ZA 1OPHB 3SUGA 5C20A 1T32A 4CR5A 1GDNA 2ZDKA 1RJXB 2H1UA 1K1PA 1V2LT 4IMZA 4X1QU 3TNSA 1HIAB 1V3XA 3ZZ6A 4J2YB 1OYQA 2YOLA 4YLUA 1CSOE 2FI5E 1BDAA 2Y81A 5A8YA 3FZZA 1ZPZA 4AFQA 2ZC9H 4ABIA 2C3SA 4JCNA 4YTAA 3NPSA 4KP0A 2JETB 1TNJA 2ZGHA 1TQ7B 1H8DH 3UR6A 1NO9H 2BY8X 1G3CA 3TITA 1EZSC 1ETSH 1KXAA 1RTKA 4JMYA 2GZ8A 1MCVA 2HGTH 4ZKRU 4B2AA 5DP7A 1C1PA 1SGCA 3IITA 1AE8H 2UWOA 2IOTA 1GI1A 1CA8B 1CU1A 1O39A 1SGPE 3ZVCA 3GOVB 1G32B 1TGNA 1T31A 1THRH 1C5OH 4CR9A 2NU1E 1UTPA 1KIGH 1ANEA 4GAWA 1ZYOA 4O9VA 1LHGH 1V2PT 2ZECA 3P92A 1O2GH 1GJ6A 4NZQA 4KTUA 2STBE 3MOCA 1GBMA 4AB8A 1O3BA 1J8AA 7ESTE 3S9CA 3RXBA 1O2HA 4FUCA 3SHAH 1TNKA 1DWBH 2Z3CA 1GJ4H 3MNXA 3RLYH 2LPRA 1F0SA 1P09A 8KME2 1TPOA 1JIMA 3RM0H 1S81A 5DGJA 1AUTC 3D62A 3PLBA 4NA8A 4X1SU 3UPEA 4ABJA 1BTZA 2FM2A 2R2WU 5EQSA 5GJ4B 1O2QA 2F9PA 1O34A 3GYLB 1ZHPA 3O8DA 4MPUA 2BD3A 1O5DH 4NWLA 3QZQA 2WPKS 1ELVA 3GY4A 4WXIA 4Y8ZA 1Z71A 3A8DA 1H9LB 5L2ZH 2GMTB 2BLWA 3RU4D 4A92A 4IMQA 3PWBA 1O2OA 4ABHA 1F0RA 1DPOA 2Z7FE 1O36A 2GZ9A 3BEFB 3GCOA 2GGVB 1YPEH 1GJDB 2HPPH 1EAXA 1ORFA 5EPNA 2EI6A 2Y5HA 4ZHAA 2QIQA 4LXBH 1GBHA 1O3LA 2BX3A 1L0ZA 2VIWA 5E0HA 4AGKA 1MQ5A 1L2EA 2QYIA 3L33A 1E36B 2ZFPH 3SU3A 4B74A 3V12A 3U8TH 1GBIA 4UFEH 3SGQE 3QTVH 5C1YA 1Z8RA 2PKAA 1ZR0A 2DE8A 5C5OA 5EXMA 1DM4B 1OWJA 4AYYB 2OC0A 3T25A 3SZNA 1DE7H 1GMCG 1A0HB 2BD5A 3ZZBA 1Z7KA 3T5FH 1NPMA 1GJ7B 3PTBA 1GVKB 3VB4A 4DURA 3E6PH 1V2NT 5DP6A 3UOUA 3K9XB 4Z6AH 2Z9JA 2BQWB 1GBAA 1DWDH 1N8OB 4DY7B 5IDKA 4INKA 3ZVGA 1PQ5A 1GCDA 2BQ6B 4Y76A 1S6HA 2VVCA 1TAWA 1ZHMA 3TPIZ 1SLWB 3PM3A 3SU4A 1V2JT 2NWNA 5CHAC 4F4OC 3NZIA 2ANWA 2SGDE 1S82A 2VH0A 2LNCA 3RXTA 1HCGA 3NKKA 5A0CA 2HRVA 1T8NA 1GBDA 2TGPZ 3BEUA 3E16B 1C5RA 1MTSA 2FYQA 4MDSA 1C5YB 3OX7U 1WUNH 3ZZ8A 3BSQA 3MYWA 2J34A 1CO7E 2BDBA 1T8MA 2ZO3H 4ZROA 2GT8A 3SU1A 3R3GB 3ODFA 3SQHE 1DSTA 1C1OA 1SFQB 2STAE 3E91A 4AB9A 4ESTE 2PR3A 3U8OH 1NRPH 4H42U 5ESTE 1C5ZB 2ZI2H 1QR3E 2ZFTA 3D23A 3KN2A 5L30H 4K2YA 3JZ2B 4K69A 1DOJA 1YCPM 3A8AA 2VJ1A 1XUHA 4FUHA 3V7TA 1TX6A 2OCVB 2VINA 4FUGA 5I46H 2P93A 1D9IA 1ZRKA 1GJCB 1YPJH 1FPCH 2SGPE 3UFAA 1BJVA 1MU6B 1GMDG 3BTWE 1SLVB 4B71A 1F5LA 5C3NA 1UTJA 1A0JA 2F9OA 1O2WA 1EB1H 2H9HA 1A3EH 3QWCH 1ZPBA 2BD4A 1O5CB 2ZQ1A 1HAXB 1Z8GA 1EPTB 1F2SE 2ZIQH 3T26A 2PHBA 2F83A 1GL1A 4E7NA 1EZUC 3SNAA 4AORA 4ZMAH 1AGJA 1GL0E 1BMNH 2TGAA 2QA9E 4CH8B 3SUFA 1DXPA 4AN7A 3ZVFA 4I8GA 2GDEH 3LIWA 2I6SA 5B6OA 1V2WT 2P3FH 1FY4A 3M3SA 1SFIA 1BRCE 3AW1A 4OS7A 4FUIA 1DWEH 3KL6A 2G00A 1QB1A 1CE5A 1P04A 2VIQA 1P2QA 4GHTA 1P2JA 3FZDA 3L6PA 1SOTA 2ZHEH 1PFXC 5E0GA 4B76A 1W0YH 3URDA 1THPB 1UVPA 4ZAEA 3U1IB 1UCYK 2XCFA 1J17T 1VCQA 2BHGA 4JZEH 3ZYDA 1ARCA 3KQDA 1GBFA 4O03A 4YOIA 1UK3A 1D3TB 1PPGE 1YLDA 3UQOA 4INHA 4GCHG 4ZKNU 2BDCA 4D76A 3OYPA 1EPTA 1F92A 1SR5C 4FUBA 3TIUA 4XBCA 4TY7A 1IQIA 2NU3E 2ZTXA 2P59A 4Y11E 3A7VA 2Z9GA 4GVUA 3Q3KA 1V2VT 1W7XH 4AOQA 2BD7A 1BZXE 4CRCA 2WUCA 1AWHB 1A1RA 1T4UH 3RXVA 3JZ1B 1C5XB 2OD3B 1LVOA 3HKIB 1QHRB 1ZTKA 2V3HH 4GPGA 1M9UA 2AEIH 4A5TS 3STIA 2BDAA 4I31A 1XXFA 4I8LA 3ZZCA 1C5QA 6CHAB 1ELTA 2A4OA 1DWCH 2VIPA 1SB1H 1GCTB 1W8BH 5T6GA 2QCYA 5JBCS 1LCYA 2A32A 2FDAA 3GY5A 4IN2A 2R2MB 1GI4A 1D3DB 1BBRE 4I33A 1HAGE 3GDVA 4FUDA 4NG9H 2GCHF 3A7WA 3RXAA 1P57B 1OX1A 5IYTA 2PTNA 2QY0B 3SV7A 2ZDMA 1QJ1B 2I6QA 4SGBE 3KEEA 4HI3A 1MBMA 5DP3A 5EQQA 4I8HA 1DUAA 4ISNA 1UMAH 3PMHB 5DKMA 4JYVH 4X8TH 3P6ZB 1SGFG 1K22H 2EC9H 5G4BA 1Y8TA 4IC5A 4JYUH 3FVFB 4IBLH 2XBVA 1W11U 1TQ0B 3UREA 1CGJE 1CHOF 3MH5A 1CHGA 1YF4A 2PGQB 4IS5A 3A85A 1RFNA 1V2TT 1AVGH 1C2HA 1VJ9U 1CA0C 4X1PU 1O35A 1GJ8B 3KQCA 3VXEH 1EAUA 2OLGA 5JBAS 3U8RH 1RIWC 1O2PA 4Y8YA 2FI4E 1A2CH 3E0PB 4X1RU 1C1UH 1ETTH 2AGIX 3EA9A 2BVSH 1GI8B 2WINI 1K9OE 2QXIA 2F3CE 1E0FD 2ZFQH 1L1JA 1QQ4A 1ZOMA 3MU8A 4GSOA 3SBKA 5EW2H 1ACBE 2ANMH 3P8FA 1EOJA 2R9PA 3GY7A 1P9SA 1QBVH 2VIOA 3TH2H 2RG3A 1HFDA 1S85A 4Z0KA 1HRTH 1W10U 1K1OA 1IOEA 2O8MA 1LHEH 2G55A 1F5KU 3OU0A 4CRFA 4VGCC 5A09A 2PLXA 1O2JA 1LTOA 2FOAA 1DLEA 3B8JA 3M37A 1PQAA 5DP9A 2FOMB 2P8OC 2OC7A 1LHCH 3M35A 4X2WA 1Y3VA 3LGUA 1IQLA 2M5TA 3VB3A 1KXBA 1AD8H 1S83A 4I32A 3OSYA 1GI3A 4ASHA 4INLA 4CHAB 1XUFA 2B7DH 2BZ6H 3DT0H 4LK4A 1INCA 5EW1H 2D26C 3I78A 3MHWU 4MG3A 3SQEE 2GT7A 2O9QA 1B0FA 2ZHQH 1QTFA 6GCHG 2C4FH 1BBRH 3P8NA 3UR9A 5AVDA 4BAMB 3MU1A 1OKXA 3BTTE 1TMUH 4NIYA 3SHCH 1GHWH 4E06H 1LVYA 1LKAA 1OP8A 3LKWA 4MVNA 1EAIA 1VCPA 2ZGXH 2XTTB 2SGAA 1TRNA 4YLQH 1HB0B 1OWHA 1WTHD 2BY5X 3RC6A 3DA9B 1Q2WA 1EUFA 1ZMLA 2ODQA 1YPHC 1FAKH 4DCDA 3MWIU 1GHXH 2OTVA 2ANYA 1HJAB 5FPYA 3ZYEA 2CF9H 6ESTA 2BDIA 1S0RA 1AFEH 1H4WA 1FV9A 2F9BH 4MNYA 5ABWA 1YGCH 5JBBS 2D2DA 1O3EA 2EI8A 1CT0E 1E38B 1TIOA 2ZTYA 1C1MA 1CBWC 1MTUA 1ELEE 4WXVA 1O33A 4ZKOU 1JBUH 4NSVA 2Y6TA 1BITA 2UWLA 1DX5M 1QRWA 2ZGJA 4XFQA 4Q2KA 5T3HA 1Z6EA 2IJOB 1OWDA 2BLOA 4UE7H 5A0BA 1ZTLA 1O37A 2FI3E 2SGFE 1FNIA 1IQJA 1PPBH 1TNIA 3ZV9A 2WV5A 1O2UA 3LJOA 3PMAB 4F49A 4ABAA 3A80A 3PLPA 4XOJA 4HGCA 4JZ1A 3ZVBA 3E1XB 2Z6BD 4BXWA 3PMBB 1TBRH 1C2KA 2ASUB 1BRAA 2VVVA 1IQKA 1H9HE 1P2OA 1G36A 4YO9A 4MNXA 4JZFH 4NA7A 1WSSH 8GCHF 3T62A 1HAZB 1TONA 2HVXA 1ZTJA 1FJSA 5AFYH 1LVBA 1GJAB 4LZ1H 1MTNC 1V2QT 1Z1JA 2J9NA 5E2PA 2XYAA 2AH4X 1QJ6B 1O2NA 1GPZA 4KKDA 1LO6A 4HFPB 1U6QA 3KQEA 3UY9A 1W0ZU 1XUIA 3URCA 2PGBB 3ZZDA 3RMLH 1XMNB 1CT4E 3FP7E 1QQUA 1WQVH 5EOKA 2XBWA 3S9BA 2Z9IA 1QL9A 1LQEA 2EEKA 3MH6A 3H7OA 1ETRH 1UTNA 1NY22 1T8LA 3VB7A 3VEQB 4BAOB 1AMHA 2ZCKP 2J92A 1Y5UT 1O32A 3BG4B 4FUEA 1B0EA 2HALA 2WYJA 1MTWA 3SI3H 1AVXA 5C5NA 1TALA 4WVPE 1TPAE 1C1TA 3T27A 3BEIB 1QY6A 2VNTA 3Q77A 3F6UH 1YPKH 1O3JA 1YPGH 1OOKB 2Y5GA 1O5FH 2BOHB 1UTOA 5EGMA 3EA7A 1SG8B 2Y82A 5TCAA 4JK5A 4M7GA 1GHBF 1EZQA 1HXEH 4E7RG 4X6MA 2W3IA 1AN1E 2J94A 2A0QB 3UOPA 1ZSKA 1NFXA 2A2QH 2JH0D 1D4PB 1J15A 3EYDA 3AAVA 3KGPA 2Q6FA 3Q00A 2IPHA 3UNQA 1WYKA 1DSUA 3UNSA 2A1DB 3SJ9A 5HYOA 1MKXK 1Y59T 3M7TA 1FIWA 5GWZA 4RSPA 2GX4A 5L6NH 1HAOH 2PKAB 1TA2A 5CHAB 2OQ5A 1ZMJA 2PUXB 2A5IA 1D3QB 1MMJN 2B8OH 4TWYA 1WQSA 4FVDA 2FXRA 1O3GA 2A7CA 3NWUA 1JXPA 3RUOA 2QV1A 5HXFA 2TPIZ 3ESTA 5CE1A 1GI0A 1SGNE 3CS7A 5LPFA 2ZTZA 3U1JB 3RC4A 1ELAA 1N6XA 3HATH 1O3AA 3MH4A 1UK4A 1C4V2 1C2EA 1P3EA 1GG6C 1GHAF 4LZ4B 1HGTH 1KYNA 1NU7B 2G5VA 3A88A 3S7KB 4OS4A 5DP5A 5EPYA 2BDGA 4X8UH 5DP8A 1HJ8A 4ISIH 1C5VA 2DE9A 5C1XA 1ZZZA 1AFQB 1GGDC 1ZJDA 3QDZB 4WMEA 1RGQA 1PPFE 1C1RA 4WWYA 1QRXA 2FOCA 4FVBA 1C2LA 2ZHWH 1QL8A 3SU0A 3U9AH 1GJ9B 1ELGA 3RXDA 3SV6A 1YPHE 1C1SA 1MAYA 1CGHA 1UVTH 2JETC 1JMOH 1UK2A 4FU8A 1FUJA 5E0JA 5TCCA 3TU7H 1G3DA 4OS1A 3T28A 1K1JA 2BXUH 2OQUA 1P05A 1O2TA 1T7CA 2XNIA 3LGIA 1MKWH 4ZHLU 1TOCB 1K1MA 5C2ZA 3QGJA 2A5AA 1BOQA 3M5NA 4K1EA 1IQNA 1WCZA
chains in the Genus database with same CATH superfamily
5GPIB 1A5HA 4TPIZ 3N7OA 1RXPA 5DJ7A 4YT6H 2VGCC 1GDUA 2GTBA 2ZFFH 3MO6A 2PTCE 4DW2U 2O8WA 3V13A 3N7DA 5FX5A 1EJAA 1GMHF 2AGEX 4A1XA 1SMFE 3F9GA 2F9VA 1L4DA 1YYY1 1VCWA 4CRDA 2R3UA 2VWLA 4MPWA 4GHQA 3T29A 3F9FA 5FBIA 3ZV8A 3ZZ5A 4K1SA 3GCNA 1DXWA 4AFUA 1UCYE 2ZDNA 4DGJA 1DVAH 1VR1H 4NIVA 2WPMS 3DFLA 1AB9B 2QF0A 4ZKSU 5J4QA 4NSYA 1ELBA 1TPPA 3FO8D 1O3PB 1GI6A 5F8TA 4OGYA 3SGBE 1MUEB 1VKYA 4ZXXH 4BXSA 1KTSB 2AMDA 3WY8A 1PPCE 4MPVA 3TK6A 2D1JA 3QZRA 1NS3A 2YMSC 5A8ZA 4DIHH 2TGTA 1BRBE 1VGCC 4TWWA 5HGGA 3BTHE 4K3JA 1QFKH 2ZU3A 2AIQA 1FI8A 3VGCB 1Z6JH 2HNTC 1OP0A 1TMBH 4HZHA 4K5ZA 5JBTA 2B9LA 4UD9H 3VB5A 1UJ1A 3DHKH 3SO3A 5F53A 1O2VA 1TNGA 3PO1B 5K7RA 1IQEA 1BRUP 3STJA 4Y7AA 1UTMA 4IW4E 2ZU4A 1C9TA 7LPRA 4X8VH 4A1TA 1E35B 3RXUA 1AU8A 3VG8A 1BJUA 1SOZA 2EI7A 2B0FA 1VITH 3LOXA 3A84A 4U32A 2G51A 1NFYA 3KF2A 3O8BA 3SOSA 2XBYA 4F48B 1CGIE 2BD2A 2PUQH 2XC5A 4B73A 5JB8S 2BXTH 4IN1A 1GDQA 1V2ST 1SGEE 4JK6A 3R0FA 3TNTA 3AASA 2R0KA 2ZGCA 3Q3XA 3TH3H 5BPEA 2XNDD 3RC5A 1P10A 2ZDLA 4CREA 3A87A 1QRZA 1NRRH 1O2MA 1ARBA 2V7QD 1Z8JB 1K28D 3KQ5A 1TLDA 3MMGA 1GMCF 1ZMNA 1KDQA 2W6ID 5FCKA 2CK3D 2FP7B 1CHOG 1K21H 1N8OC 1OWIA 2BDYA 5GCHF 1ZHRA 1NBME 3SV9A 3RXRA 1SL3A 1G37A 3RXKA 5A8XA 3GCTF 1EX3A 2W3KA 1QIXB 1N1LA 1F7ZA 2C90B 2J4IA 1P06A 2ZDAH 4JZDH 1G2MA 3BIUH 4UEHH 3N7EA 2CV3A 3C27B 1K1IA 1C5TA 1XUJA 2BZAA 3SNBA 1UCYH 3FANA 3SI4H 5L2YH 2GCTB 4R0IA 4CBOA 3UUZA 3MU0A 2OINA 1AZZA 1LPGB 4MQAA 1QL7A 2ZHDA 3MNSA 1NRNH 2FODA 3S7HB 4ABEA 3H5CB 2NU2E 3D65E 1ZGIA 1D6RA 3SV8A 2CHAC 1RRKA 3A81A 3NK8A 4KGAA 4SGAE 3ZZ9A 3GYMA 1P12E 4YXWD 1NFWA 2XWAA 1C4Y2 1YCPH 2FS9A 1GI9B 1P9UA 1EASA 2W7SA 1Y3XA 5A0AE 1HAYB 3EE0B 1EP5A 2KAIB 2NU0E 2JIZD 2PKSB 2OUAA 7KMEH 2JJ1D 2XC4A 4H6TA 4NCYA 5EG4A 2A31A 1GHZA 3ZZ4A 1FQ3A 1UO6A 3BTQE 3DCLA 5C1UA 1COWD 3BIVH 2P8OB 5AF9H 4U2WA 1VJAU 1LHFH 1Q31A 2AHME 2OP9A 3TVJB 3ZZAA 3PWCA 5F6MA 1EB2A 3MU5A 4UFDH 5DK1A 3S69A 1HYLA 1NTPA 4FETA 4DT7B 5C67A 1RTFB 1OXGA 1W14U 3KYFA 2CMYA 3TJVA 4CBNA 2O8LA 1MZAA 1SLXB 4ASUD 4RI0A 1MZDA 4AYVB 5H4IB 1LVMA 4AFZA 3RXEA 1K0HA 4E05H 1V2RT 1FZZA 2QF4A 3MTYA 3SU5A 1KY9A 1O5GH 3PMJA 3E0NB 2WPIS 1C9PA 2NU4E 1KXDA 2A7HA 2ZG0H 5SGAE 1FLEE 3SJKA 2LELA 1A0LA 2KAIA 1GHYH 4MLFB 2BD9A 2Z9KA 2FOHA 1K1NA 5EXLA 4D8NA 2BLVA 2G4TA 1O3HA 3GDUA 4NFFA 2ZPQA 2R3YA 3F2HA 1TOMH 3M3VA 3MI4A 4YT7H 1HJ9A 3RMOH 3K2UA 1G9IE 4YOJA 2RCEA 1IQGA 3F1SB 3RMMH 3BTKE 1YM0A 2A5KA 2C8ZB 2BDHA 3RXMA 1YPMH 2FS8A 2FO9A 1B7XB 1JRSA 3GY2A 3RXQA 3EA8A 3NCLA 2Y80A 4B75A 1UHBB 1OP2A 1G30B 1W12U 1C2MA 3TH4H 4Q7YA 1GBEA 2F9NA 4GCHF 1YLNA 1GJ5H 4K1TA 1Q3XA 3OEED 1GWAA 3D49H 1L1NA 1XVOA 2HNTE 4NA9H 1WDIA 1LPZB 2XRCA 1OSSA 2JJ2D 5AFZH 3SUDA 4I7YH 3OY5U 1NRSH 3UB0A 8GCHG 1BTWA 2ZPSA 3BF6H 4Y6DA 1PJPA 5DO4H 1C1QA 1GJBB 1NN6A 2ULLA 4Q80A 2Q1JA 1KSNA 2PWXA 3A7XA 1UVSH 1SHYA 4DOQA 3A7YA 1G2LA 5C0TA 2FOFA 4Y8XA 3QUMP 2J95A 1ESBA 1P0SH 5DPAA 6CHAC 1ID5H 1FMGA 6LPRA 1BIOA 3FP8E 3QX5H 1GCTC 2FX4A 3GDSA 5JB9S 4NIXA 3SGAE 1UTKA 4THNH 3GCHC 3P95A 4GLYA 5GXPA 2K0QA 9ESTA 1BBRK 1IQMA 4XE4A 3QK1A 1AKSA 1SVPA 4I8KA 4UDWH 3DD2H 2BY7X 5JDUB 1TB6H 1VITF 1BTUA 2AMPA 3ATKA 4TPYA 5A2MH 3TJOA 2A4RA 3MNCA 1UHBA 3TK9A 1O3OA 1C1NA 1PPZA 4ZXYH 1RTLA 4ZHMU 4DVAU 4X8SH 2BMGB 3QTOH 1PPEE 4H6SB 3B9FH 4AGJA 5HMAA 4A1VA 3I29A 2C93B 5ETXA 1H8IH 1EOLA 1THSH 2GV7A 2TRMA 5K0HA 3BG8A 1AVWA 3RXFA 1SQAA 4X6OA 4FU9A 1GHBG 4MNVA 1QB6A 1FDPA 4X2YA 3VFEA 4K60A 1C4U2 4B1TA 5E8EH 3LU9B 1JOUB 3Q76A 2A4GA 3BTEE 7GCHF 1SGDE 1PQ8A 2QAAA 3TK5A 8ESTE 2VIDA 1HPGA 2QF5A 2M2AA 2XBXA 4Q7ZA 1CQQA 3RXHA 1BUIA 4CRAA 4X6NA 2BM2A 4A7IB 2SGEE 1TBZH 2XCNA 4BANB 4UFGH 4Y79A 2G52A 1Y3WA 2JDID 1TNHA 1XUGA 2ZZUH 3ZVEA 3LC5A 3RXIA 2G4UA 4YOGA 1WOFA 2XW9A 1NT1A 2FOGA 4JZIA 2RA3A 2FOEA 4Z1MD 4Y10E 3RU4E 1Z1IA 3ATWA 4IGDA 2ALVA 4O3UA 2C8XB 3PYHA 4NFEA 1GI5A 4QT8C 2P16A 1ZSJA 2Q6GA 1S84A 3O8CA 3TGKE 4X2VA 3UIRA 5FAHA 2CXVA 2AMQA 3QLPH 1J9CH 1GHAG 2H9TH 1BQYA 1FIZA 2W5EA 4BAQB 1FAXA 3M5OA 5HIYA 3AAUA 2B5TB 2O8TA 1IQHA 4DIIH 1W3CA 3T2NA 2UUFB 3RXLA 2BVXH 4CHAC 1T4VH 3CP7A 2CGAA 2ILNA 4YESB 1DUEA 1ABJH 2ZWLH 1AHTH 5JYIA 3H7TA 1O3MA 3LGVA 3MNBA 4FU7A 3PB1E 3RXJA 1O0DH 2A7JA 1GGDB 1CT2E 2SGQE 3HK3B 2RA0A 5F8XA 2G5NA 2J98B 1V2OT 1HAVA 2ALPA 2A45B 1SGTA 1BTPA 6GCHF 3GISB 3SU6A 4WY3A 3HGPA 5FX6A 3F2FA 1V2KT 2OK5A 1XUKA 1QBNA 3LT3A 1NZQH 2SFAA 1C2DA 2UWPA 4J1YA 1C2GA 5E2OA 4GUXA 1KXEA 1MU8B 1HJAC 1G3EA 3EDXB 1O38A 1TRMA 1IQFA 2PSXA 1OYTH 1QURH 1SGRE 3I77A 1TGSZ 3TJNA 1S5SA 2ZDVH 1FN6A 1C2JA 2C8WB 2VWMA 1O2LA 5FXLA 1EATA 1XX9A 4ACAA 4NWKA 1FY3A 1GMHG 2VGCB 1PYTC 5CHBA 4U01A 3OTJE 3ENSB 1QCPA 2BTCE 1BA8B 2ZGBH 4AG2A 1SQTA 1TYNA 2QXJA 1O2RA 1LQDB 4OGXA 1HV7A 4I8JA 1VZQH 3RU4T 2XOKD 2Z3EA 5J4SA 3M5MA 8LPRA 1SI5H 4OS5A 1MAXA 1X7AC 4CRBA 3P8GA 1AI8H 1DT2A 2J5UA 2J97A 2ODPA 1MKXH 1SLUB 2HLCA 1F0UA 1FY8E 9LPRA 1RS0A 4XDEA 3LGTA 1HIAA 5HM2A 1HBTH 1P2KA 2Q6DA 4ACBA 2FMJA 1OS8A 5DP4A 1DDJA 3LDXH 2ZEBA 2ZFRH 3RP2A 1XM1A 2V3OH 4HG6A 5EJ1A 4R8TB 2EQNA 2ZF0H 2ZNKH 4B6EA 1P11E 1O2XA 2EA3A 2ESTE 1BHXF 3ITIA 1AO5A 3HK6B 3RDZA 3CS0A 3MH7A 1RD3B 2Y7XA 1C5UA 1OHHD 4AX9H 4X1NU 1VGCB 3K6ZA 3O8RA 2AERH 3RM2H 1MBQA 4K8BA 1GI2A 4DJZB 1YKTA 3AVZA 3L3TA 1LHDH 5F8ZA 2VU8E 1Y3YA 1E37B 2QF3A 1KLJH 3CENA 1PQ7A 1F5RA 3P17H 1EP6A 2A4QA 2OBOA 4RT1A 2C8YB 4X2XA 1WV7H 5KGOA 5FPTA 5LPRA 4FOUC 2SNVA 1ESAA 2P3TB 4XSKU 2WPHS 1ZRBA 1SGIB 2IJD1 1CVWH 1C5NH 2KX4A 2THFB 4TY6A 4O3TA 2GKVE 1QB9A 3GY6A 2G81E 5LPEA 3RXGA 1SHHB 3BG4C 3GY3A 3KCGH 3RLWH 1GHVH 5IK2D 1O3DA 1UW7A 1E34B 4D9RA 1TX8A 1L1GA 2ZCHP 3LC3A 4AZ2B 1P2MA 1MKWK 1XVMA 1MTVA 5HM9A 2FOBA 2RDLA 3HKJB 3BTFE 1KLIH 1P3CA 2JH5D 3A7TA 1AE5A 1ZPCA 4X6PA 2CN0H 5FCRA 4Y71A 3UTUH 3E3TA 5FL7D 1F0TA 4Y7BA 2V6NA 5GCHG 1EAWA 3LONA 1BTXA 3G01A 1C1VH 1EKBB 1XKBC 3GCTG 5PTPA 1C2FA 1K1LA 2H2ZA 3VB6A 1NC6A 1BB0B 1EXFA 5EODA 4BAKB 4CH2B 1WTGH 1AIXH 1OWEA 3SU2A 2FWWA 2ZCLP 1EJNA 2GV6A 1P01A 3MFJA 3RXCA 3M7UA 3A8CA 2V35A 1DITH 3E8LA 2D8WA 1DFPA 2AGGX 1HAHH 1ANDA 1TRYA 1QBOA 3SJIA 4BTTB 2BX4A 1C2IA 3VPKA 2XWBI 1AQ7A 1SBWA 4BAHB 2Y7ZA 3QGNB 4X0WU 3SJ8A 2UUJB 3RXPA 1KDQB 2Z94A 3EAJA 3V0XA 1O3CA 1GBLA 1B5GH 2CHAB 2UUYA 1A4WH 3F68H 2GMTC 4H4FA 2HNTF 2ZU1A 1HXFH 2FESH 1BMAA 1IAUA 2XC0A 5FHTA 1TGCA 2KCAA 3A86A 2PV9B 5JPMH 3AW0A 2J2UA 4ZUHA 5CDFE 3SUEA 2YNAA 5T6DA 2HWLB 5LH8A 2ANKH 1W7GH 2G8TA 4RKJB 3MO3A 4BNRA 1W2KH 1AFQC 2VH6A 1SSXA 1TMTH 3HGNA 1EQ9A 3SNDA 2GCHG 1J14A 3B23B 3M36A 3ZZ7A 2K1QA 2H9EH 1FONA 1HAPH 3Q3YA 2QXGA 2JKHA 3P70B 1SQOA 1LMWB 2FYRA 2PW8H 4FXGH 1S6FA 3FAOA 1O3KA 2F91A 1J16A 1DS2E 1H9IE 2OC1A 2VVUA 3HPTB 1WU1A 2FTLE 1HNEE 2KZ4A 4B2CA 3LH3A 1P03A 1P8VC 1O2ZA 2F9UA 3FFGA 3S9AA 2FIRH 4KTCA 3SNCA 5I25A 1G3BA 4WF8A 3RXOA 5CMXH 2GZ7A 2BVRH 1Y5BT 3A83A 3SN8A 3QN7A 1C5MD 1SPJA 2HOBA 2WPLS 1MQ6A 4ABDA 3TGIE 1ZJKA 1KLTA 3KNXA 1DLKB 1P2NA 2PP6A 1NROH 1ESTA 4BTIB 3S0NA 3MO9A 1H1BA 1CA0B 2P94A 5DG6A 1NESE 4NZLA 3ZVDA 2HPQH 3A89A 1Y5AT 1RIWB 1MH0A 3A82A 2ZU2A 3UWIA 1HUTH 3PLKA 3A8BA 3K6YA 1AB9C 1BTHH 1SC8U 2P95A 2WSSD 1AZ8A 3BTDE 3FN8A 1LKBA 2KCOA 1ELCA 2WPDD 4XBBA 3ELAH 1A61H 1FY5A 4WMDA 4RN6A 3PV5A 1DICA 1KXCA 1KXFA 2QN5T 2W6JD 2AFQB 2JH6D 4ABFA 3IG6B 4D7FA 1GBTA 3UQVA 1FN8A 1YCPK 1BT7A 2H5DA 1WBGB 1T8OA 2GP9B 5TJXA 2WHXA 3M5LA 1NFUA 3VGCC 1WAYB 3OTPA 2AYWA 4VGCB 4LOYH 3FP6E 1Y3UA 1QGFA 3ATIA 3SV2H 2CJIA 3K65B 4CRGA 2GD4B 3PO1C 1ELDE 1MCTA 1A7SA 3NXPA 1IHTH 3ATMA 2OC8A 1FY1A 3P8OA 3EE7A 1TGTA 2W26A 1GMDF 1XXDA 1EPTC 2GDDA 2TGDA 2ZKSA 2BB4A 4HTCH 2V0BA 1TABE 3EQ0H 5EU8A 2FTMA 1ZLRA 3KQBA 1O5BB 3FOAA 1K2I1 3GCHB 3LGYA 1VITG 3LJJA 3GICB 4WJG2 1AWFH 1O31A 1DY8A 1UVUH 5GDSH 1BTYA 4FUJA 3F9HA 2BQ7B 3A7ZA 2ZPRA 2A2XH 3W95A 1GBBA 1GVLA 2PSYA 3LPRA 2TBSA 1Z8IB 3UNRA 2YNBA 3N99A 4TYDA 1BMFD 3DUXH 5DN6D 1S0QA 4B2BA 2QXHA 1YC0A 2J38A 3E90B 3M7QA 2TIOA 4XBDA 1ZGVA 2SNWA 4FUFA 1GBCA 4NGAH 2ZFSA 5ESBA 1ELFA 3BTGE 2WYGA 3MQKC 7GCHG 4O97A 1CBWB 1AKSB 1BMMH 1TFXA 3PROA 4BTUB 3GY8A 1EZXC 1MD7A 1D6WA 2FX6A 5LGOA 1TGBA 1O5EH 1FXYA 2GCTC 2QC2A 4Q7XA 1TX7A 3M61U 3VXFH 3C1KA 1PYTD 1ANBA 1A5GH 2FZZA 1QA7A 1NBMD 3IWMA 5EXNA 3WW7A 3V3MA 4MNWA 3RMNH 1UVOA 5FBEA 2ZA5A 4UONA 3DFJA 4KELA 1BMLA 2ZP0H 4YM9A 1UTLM 1E1QD 1O2YA 1P02A 1PPHE 1TPSA 1TBQH 3W94A 3F9EA 3ODDA 3BTME 2P3UB 2PKSC 4KTSA 2VB0A 1W0JD 5GNDA 4AFSA 1SGYE 3NRLA 1O5AB 1AY6H 1LDTT 1MTNB 2HLDD 3SNEA 3PV4A 3SZEA 1TNLA 1V2MT 1ABIH 1QNJA 2WPJS 4U30A 1OWKA 1SGFA 4Y0YE 4IC6A 4ISLA 4MPXA 2PFEA 2OBQA 3U98H 1FPHH 3EGKH 1C5WB 5FPSA 4ISHH 3SW2B 1NM6A 2GVFA 3ATLA 1JRTA 3BN9A 1O2KA 2ZHFH 2IN2A 4WH6A 3RXSA 1DY9A 1YBWA 2FPZA 1IHSH 2W7UA 2BD8A 3SJOA 1KTTB 1V6DA 2DUCA 1O3IA 1DANH 5T6FA 1N6YA 2BY9X 1C5LH 5EJZA 3SORA 5EQRA 3DSPA 2QGRA 4JYTA 2KCYA 1D3PB 1TWXB 2VIVA 2OXSA 4WMFA 4BOHA 3U69H 1O2IA 4RKOB 3M3TA 1GBJA 5BRRE 1A3BH 4NIWA 2WUBA 2CF8H 1C1WH 1EJMA 1A5IA 4ABBA 4AG1A 1HLTH 1YPLH 2ODYB 4K8YA 3LGWA 1MD8A 4D7GA 5T1VA 2BLQA 3ZZ3A 2ZU5A 4ABGA 2Y5FA 2L74A 3UWJH 1JIRA 1W13U 2RDEA 3TJUA 4ZH8A 1HAIH 1HDTH 1ZSLA 1GBKA 1HAVB 2AIPA 1SGQE 2ZQ2A 4A6LA 4OS6A 1YLCA 1QJ7B 4ISOA 2BY6X 2XXLA 2VWNA 1O2SA 1ANCA 5GIBA 3QO6A 4DG4A 1O30A 1YP9A 2BYAX 3TGJE 1YWUA 4M9FA 1C5PA 2WV4A 2O8UA 4D9QA 1O3NA 3KIDU 1NU9A 2Z3DA 1GVZA 4UFFH 1O3FA 1JWTA 4XD7D 3TLOA 1AUJA 5F03A 4OS2A 1A46H 3MU4A 2FEQH 1TA6A 4PROA 3NUMA 1V2UT 1UTQA 2BOKA 4WH8A 2H6MA 1BCUH 2AS9A 2FLRH 5AHGH 2VWOA 2H5CA 1NRQH 2FLBH 1BHXB 1P2IA 1YY3A 1QA0A 5HKKD 1H8ED 3PTNA 1GG6B 3KHVA 2YMSD 1GI7B 1LPKB 2KR7A 2Z9LA 2R0LA 3OY6U 3LH1A 1C5SA 3BV9B 1TE0A 4Y0ZE 1XKAC 4YZUA 2UUKB 3ZVAA 4MTBA 1L4ZA 1OPHB 3SUGA 5C20A 1T32A 4CR5A 1GDNA 2ZDKA 1RJXB 2H1UA 1K1PA 1V2LT 4IMZA 4X1QU 3TNSA 1HIAB 1V3XA 3ZZ6A 4J2YB 1OYQA 2YOLA 4YLUA 1S6LA 3DSGA 1CSOE 2VBCA 2FI5E 1BDAA 2Y81A 5A8YA 3FZZA 1ZPZA 4AFQA 2ZC9H 4ABIA 2C3SA 4JCNA 4YTAA 3NPSA 4KP0A 2JETB 1TNJA 2ZGHA 1TQ7B 1H8DH 3UR6A 1NO9H 2BY8X 1G3CA 3TITA 1EZSC 1ETSH 1KXAA 1RTKA 4JMYA 2GZ8A 1MCVA 2HGTH 4ZKRU 5KEDA 4B2AA 5DP7A 1C1PA 1SGCA 3IITA 1AE8H 2UWOA 2IOTA 1GI1A 1CA8B 1CU1A 4XRNA 1O39A 1SGPE 3ZVCA 3GOVB 1G32B 1TGNA 1T31A 1THRH 1C5OH 4CR9A 1QZ8A 2NU1E 1UTPA 1KIGH 1ANEA 4GAWA 1ZYOA 4O9VA 1LHGH 1V2PT 2GJGA 2ZECA 3P92A 1O2GH 1GJ6A 4TSFD 4NZQA 4KTUA 2STBE 3MOCA 1GBMA 4AB8A 1O3BA 1J8AA 5HIZA 7ESTE 3S9CA 3RXBA 1O2HA 4FUCA 3SHAH 1TNKA 1DWBH 2Z3CA 1GJ4H 3MNXA 3RLYH 2LPRA 1F0SA 1P09A 8KME2 1E1RD 1JIMA 1TPOA 3RM0H 1S81A 5DGJA 1MABB 1AUTC 3D62A 3PLBA 4NA8A 4X1SU 3UPEA 4ABJA 1BTZA 2FM2A 2R2WU 5EQSA 5GJ4B 1O2QA 2F9PA 1O34A 3GYLB 2YMSB 1ZHPA 3O8DA 4MPUA 2BD3A 1O5DH 4NWLA 3QZQA 2WPKS 1ELVA 3GY4A 4WXIA 4Y8ZA 1Z71A 3A8DA 1H9LB 5L2ZH 2GMTB 2BLWA 3RU4D 4DT4A 4A92A 4IMQA 3PWBA 1O2OA 4ABHA 1F0RA 1DPOA 2Z7FE 1O36A 2GZ9A 3BEFB 3GCOA 2GGVB 1YPEH 1GJDB 2HPPH 1EAXA 1ORFA 5EPNA 2EI6A 2Y5HA 4ZHAA 2QIQA 4LXBH 3OAAD 1GBHA 1O3LA 2BX3A 1L0ZA 2VIWA 5E0HA 4AGKA 1MQ5A 1L2EA 2QYIA 3L33A 1E36B 2ZFPH 3SU3A 4B74A 3V12A 3U8TH 1GBIA 3PRBA 1H8HD 2LP6A 4UFEH 4B6FA 4ZCNA 3SGQE 3QTVH 2L6OA 5C1YA 1Z8RA 2PKAA 1ZR0A 2DE8A 5C5OA 5EXMA 4Q4LA 1DM4B 1OWJA 4AYYB 2OC0A 3T25A 3SZNA 1DE7H 1GMCG 1A0HB 2BD5A 3ZZBA 1Z7KA 3T5FH 1NPMA 1GJ7B 3PTBA 1GVKB 3VB4A 4DURA 3E6PH 1V2NT 5DP6A 3UOUA 3K9XB 4Z6AH 2Z9JA 2BQWB 1GBAA 1DWDH 1N8OB 4DY7B 5IDKA 4INKA 3ZVGA 1PQ5A 1GCDA 2BQ6B 4Y76A 2IPQX 1S6HA 2VVCA 1TAWA 1ZHMA 3F2GA 3TPIZ 1SLWB 3PM3A 3SU4A 1V2JT 2NWNA 5CHAC 4F4OC 3NZIA 2ANWA 2SGDE 1S82A 2VH0A 2LNCA 3RXTA 3F3BA 1HCGA 3NKKA 5A0CA 2HRVA 1T8NA 1GBDA 2TGPZ 3BEUA 3E16B 1C5RA 1MTSA 2FYQA 4MDSA 1C5YB 3OX7U 1WUNH 3ZZ8A 3BSQA 3MYWA 2J34A 1CO7E 2BDBA 2KCPA 1T8MA 2ZO3H 4ZROA 2GT8A 3SU1A 3R3GB 3ODFA 3CNRA 3SQHE 1DSTA 1C1OA 1SFQB 2STAE 3E91A 4AB9A 4ESTE 2PR3A 3U8OH 1NRPH 4H42U 5ESTE 1C5ZB 2ZI2H 3FKSD 1QR3E 2ZFTA 3D23A 3KN2A 5L30H 4K2YA 3JZ2B 4K69A 1DOJA 1YCPM 3A8AA 2VJ1A 1XUHA 4FUHA 3V7TA 3ZIAD 1TX6A 2OCVB 2VINA 4FUGA 5I46H 2P93A 1D9IA 1ZRKA 1GJCB 1YPJH 5C17A 1FPCH 2SGPE 3UFAA 1BJVA 1MU6B 1GMDG 3BTWE 1SLVB 4B71A 1F5LA 5C3NA 2KM0A 1UTJA 1A0JA 2F9OA 1O2WA 1EB1H 2H9HA 1A3EH 3QWCH 1ZPBA 2BD4A 1O5CB 2ZQ1A 1HAXB 1Z8GA 1EPTB 1F2SE 2ZIQH 3T26A 2PHBA 2F83A 1GL1A 3H09A 4E7NA 1EZUC 3SNAA 4AORA 4ZMAH 1AGJA 1GL0E 1BMNH 2TGAA 2QA9E 4CH8B 3SUFA 1DXPA 4AN7A 3ZVFA 4I8GA 2GDEH 3LIWA 2I6SA 5B6OA 1V2WT 2P3FH 1FY4A 3M3SA 1SFIA 1BRCE 3AW1A 4OS7A 4FUIA 1DWEH 3KL6A 4F55A 2G00A 1QB1A 1CE5A 3OEHD 1P04A 2VIQA 1P2QA 4GHTA 1P2JA 1WXRA 3FZDA 3L6PA 1SOTA 2ZHEH 1PFXC 5E0GA 4B76A 1W0YH 3URDA 1THPB 2RFKC 1UVPA 4ZAEA 3U1IB 1UCYK 2XCFA 1J17T 1VCQA 2BHGA 3U28C 4JZEH 3ZYDA 1ARCA 3KQDA 1SKYE 3AK5A 1GBFA 4O03A 4YOIA 1UK3A 1D3TB 1PPGE 1YLDA 3UQOA 4INHA 4GCHG 4ZKNU 2BDCA 4D76A 3OYPA 1EPTA 1F92A 1SQRA 1SR5C 4FUBA 3TIUA 4XBCA 4TY7A 1IQIA 2NU3E 2ZTXA 2P59A 4Y11E 3A7VA 2Z9GA 4GVUA 3W1EA 3Q3KA 1V2VT 1W7XH 4AOQA 2BD7A 1BZXE 4CRCA 2WUCA 1AWHB 1A1RA 1T4UH 3RXVA 3JZ1B 1C5XB 2OD3B 1LVOA 3HKIB 1QHRB 1ZTKA 2V3HH 4GPGA 1M9UA 2AEIH 4A5TS 3STIA 2BDAA 4I31A 1XXFA 4I8LA 3ZZCA 1C5QA 6CHAB 1ELTA 2A4OA 1DWCH 4AC9A 4Q63A 2VIPA 1SB1H 1GCTB 1W8BH 5T6GA 2QCYA 5JBCS 1LCYA 2A32A 2FDAA 3GY5A 4IN2A 2R2MB 1GI4A 1D3DB 1BBRE 4I33A 1HAGE 3GDVA 4FUDA 4P00A 4NG9H 2GCHF 3A7WA 3RXAA 1P57B 1OX1A 5IYTA 2PTNA 2QY0B 3SV7A 2ZDMA 1QJ1B 2I6QA 4SGBE 3KEEA 4HI3A 1MBMA 5DP3A 5EQQA 4I8HA 1DUAA 4ISNA 1UMAH 3PMHB 5DKMA 4JYVH 4X8TH 3P6ZB 1E79D 1SGFG 1K22H 2EC9H 5G4BA 1Y8TA 2V3MA 4IC5A 4JYUH 3FVFB 4IBLH 2XBVA 1W11U 5C94A 1TQ0B 3UREA 1CGJE 1CHOF 3MH5A 1CHGA 1YF4A 2PGQB 4IS5A 3SYJA 3A85A 1RFNA 1V2TT 1AVGH 1C2HA 1VJ9U 1CA0C 4X1PU 1O35A 1GJ8B 3KQCA 3VXEH 1EAUA 2OLGA 5JBAS 3U8RH 1RIWC 1O2PA 4Y8YA 2FI4E 1A2CH 3E0PB 4X1RU 1C1UH 1ETTH 2AGIX 3EA9A 2BVSH 1GI8B 2WINI 1K9OE 2QXIA 2F3CE 1E0FD 2ZFQH 1L1JA 1QQ4A 1ZOMA 3PRDA 3MU8A 4GSOA 3SBKA 5EW2H 1ACBE 2ANMH 3P8FA 1EOJA 2R9PA 2HVYB 3GY7A 1P9SA 1W0KD 1QBVH 2VIOA 3TH2H 2RG3A 1HFDA 1S85A 4Z0KA 1HRTH 1W10U 1K1OA 1IOEA 4I86A 2O8MA 1LHEH 2G55A 1F5KU 3OU0A 4CRFA 4VGCC 5A09A 2PLXA 1O2JA 1LTOA 2FOAA 1DLEA 3B8JA 3M37A 1PQAA 5DP9A 2FOMB 2P8OC 2OC7A 1LHCH 3M35A 4X2WA 1Y3VA 3LGUA 1IQLA 2M5TA 3VB3A 1KXBA 1AD8H 1S83A 4I32A 3OSYA 1GI3A 4ASHA 4INLA 4CHAB 1XUFA 2B7DH 2BZ6H 3DT0H 4LK4A 1INCA 5EW1H 2D26C 3WWFA 3I78A 5KECA 2EY4C 3MHWU 4MG3A 3SQEE 2GT7A 2O9QA 1B0FA 2ZHQH 1QTFA 6GCHG 2C4FH 1BBRH 3P8NA 3UR9A 5AVDA 4BAMB 3MU1A 1OKXA 3BTTE 1TMUH 4NIYA 3SHCH 1GHWH 3UAIC 4E06H 1LVYA 1LKAA 1OP8A 3LKWA 4MVNA 1EAIA 1VCPA 2ZGXH 2XTTB 2SGAA 1TRNA 2F43B 4YLQH 1HB0B 1OWHA 1WTHD 2BY5X 3RC6A 3DA9B 1Q2WA 1EUFA 1ZMLA 2ODQA 1YPHC 1FAKH 4DCDA 2QE7D 3MWIU 1GHXH 2OTVA 2ANYA 1HJAB 5FPYA 3ZYEA 2CF9H 1EFRD 6ESTA 2BDIA 1S0RA 1AFEH 1H4WA 1FV9A 2F9BH 4MNYA 5ABWA 1YGCH 5JBBS 2D2DA 1O3EA 2EI8A 1CT0E 1E38B 1TIOA 2ZTYA 1C1MA 1CBWC 1MTUA 4TT3D 1ELEE 4WXVA 1O33A 4ZKOU 3DSOA 1JBUH 4NSVA 2Y6TA 1BITA 2UWLA 1DX5M 1QRWA 2ZGJA 4XFQA 4Q2KA 5T3HA 1Z6EA 2IJOB 2K8IA 1OWDA 2BLOA 2WZQA 4UE7H 1ZTLA 1O37A 2FI3E 2SGFE 5A0BA 3OFND 1FNIA 1IQJA 1PPBH 1TNIA 3PV2A 3ZV9A 2WV5A 1O2UA 3LJOA 3PMAB 4F49A 4ABAA 3A80A 3OE7D 3PLPA 4XOJA 4HGCA 4JZ1A 3ZVBA 3E1XB 2Z6BD 4BXWA 3PMBB 1TBRH 1C2KA 2ASUB 4RT0A 1BRAA 2VVVA 1IQKA 1H9HE 1P2OA 1G36A 4YO9A 4MNXA 4JZFH 4NA7A 1WSSH 8GCHF 3T62A 1HAZB 1TONA 2HVXA 1ZTJA 1FJSA 5AFYH 1LVBA 1GJAB 4LZ1H 1MTNC 1V2QT 1Z1JA 2J9NA 5E2PA 2XYAA 2AH4X 1QJ6B 1O2NA 1GPZA 4KKDA 1LO6A 4HFPB 1U6QA 3KQEA 3UY9A 1W0ZU 3F0OA 1XUIA 3URCA 2PGBB 3ZZDA 3RMLH 1XMNB 3WWBA 1CT4E 3FP7E 1QQUA 1WQVH 5EOKA 2XBWA 3S9BA 2Z9IA 1QL9A 1LQEA 2EEKA 1KMHB 3MH6A 3H7OA 5EIYA 1ETRH 1UTNA 5C0UA 1NY22 1T8LA 3VB7A 3VEQB 3KYGA 4BAOB 1AMHA 2ZCKP 4OM9A 2J92A 1Y5UT 1O32A 3BG4B 4FUEA 1B0EA 2HALA 2WYJA 1MTWA 3SI3H 1AVXA 5C5NA 1TALA 4WVPE 1TPAE 1C1TA 3T27A 3BEIB 1QY6A 2VNTA 3Q77A 3F6UH 1YPKH 1O3JA 1YPGH 1OOKB 2Y5GA 1O5FH 2BOHB 1UTOA 5EGMA 3EA7A 1SG8B 2Y82A 5TCAA 4JK5A 5EJLA 4M7GA 1GHBF 1EZQA 1HXEH 5B6LA 4E7RG 4X6MA 2W3IA 1AN1E 2J94A 2A0QB 3UOPA 1ZSKA 1NFXA 2A2QH 2JH0D 1D4PB 1J15A 3EYDA 3AAVA 3KGPA 2Q6FA 3Q00A 2IPHA 3UNQA 1WYKA 1DSUA 3UNSA 2A1DB 3SJ9A 2WV9A 5HYOA 1MKXK 1Y59T 3M7TA 1FIWA 5GWZA 4RSPA 2GX4A 5L6NH 1HAOH 2PKAB 1TA2A 5CHAB 2OQ5A 1ZMJA 2PUXB 2A5IA 1D3QB 1MMJN 2B8OH 4TWYA 1WQSA 4FVDA 2FXRA 1O3GA 2A7CA 3NWUA 1JXPA 3RUOA 2QV1A 5HXFA 2TPIZ 3ESTA 5CE1A 1GI0A 2J98A 1SGNE 3CS7A 5LPFA 2ZTZA 3U1JB 3RC4A 1ELAA 1N6XA 3HATH 1O3AA 3MH4A 1UK4A 1C4V2 1FX0B 1C2EA 1P3EA 1GG6C 1GHAF 4LZ4B 1HGTH 1KYNA 1NU7B 4P02A 3GS9A 2G5VA 3A88A 3S7KB 4OS4A 5DP5A 5EPYA 2BDGA 4X8UH 5DP8A 1HJ8A 4ISIH 1C5VA 2DE9A 5C1XA 1ZZZA 1AFQB 1GGDC 1ZJDA 2F4LA 3QDZB 4WMEA 1RGQA 1PPFE 1C1RA 4WWYA 1QRXA 2FOCA 4FVBA 1C2LA 2ZHWH 1QL8A 3SU0A 3U9AH 1GJ9B 1ELGA 5DSFA 3RXDA 3SV6A 1YPHE 1C1SA 3F0PA 1MAYA 1CGHA 1UVTH 2JETC 1JMOH 1UK2A 4FU8A 1FUJA 5E0JA 5TCCA 3TU7H 1G3DA 4OS1A 3T28A 1K1JA 2BXUH 2OQUA 1P05A 1O2TA 1T7CA 2XNIA 3LGIA 1MKWH 4ZHLU 1TOCB 1K1MA 5C2ZA 2KFWA 3QGJA 2A5AA 1BOQA 3M5NA 4K1EA 1IQNA 1WCZA
chains in the Genus database with same CATH topology
5GPIB 1A5HA 4TPIZ 3N7OA 1RXPA 5DJ7A 4YT6H 2VGCC 1GDUA 2GTBA 2ZFFH 3MO6A 2PTCE 4DW2U 2O8WA 3V13A 5FX5A 1EJAA 1GMHF 2AGEX 4A1XA 1SMFE 3F9GA 2F9VA 1L4DA 1YYY1 1VCWA 4CRDA 2R3UA 2VWLA 4MPWA 4GHQA 3T29A 3F9FA 5FBIA 3ZV8A 3ZZ5A 4K1SA 3GCNA 1DXWA 4AFUA 1UCYE 2ZDNA 4DGJA 1DVAH 1VR1H 4NIVA 2WPMS 3DFLA 1AB9B 2QF0A 4ZKSU 5J4QA 4NSYA 1ELBA 1TPPA 1O3PB 1GI6A 5F8TA 4OGYA 3SGBE 1MUEB 4ZXXH 4BXSA 1KTSB 2AMDA 3WY8A 1PPCE 4MPVA 3TK6A 2D1JA 3QZRA 1NS3A 5A8ZA 4DIHH 2TGTA 1BRBE 1VGCC 4TWWA 5HGGA 3BTHE 4K3JA 1QFKH 2ZU3A 2AIQA 1FI8A 3VGCB 1Z6JH 2HNTC 1OP0A 1TMBH 4HZHA 4K5ZA 5JBTA 2B9LA 4UD9H 3VB5A 1UJ1A 3DHKH 3SO3A 1O2VA 1TNGA 3PO1B 5K7RA 1IQEA 1BRUP 3STJA 4Y7AA 1UTMA 4IW4E 2ZU4A 1C9TA 7LPRA 4X8VH 4A1TA 1E35B 3RXUA 1AU8A 1BJUA 1SOZA 2EI7A 2B0FA 1VITH 3LOXA 3A84A 4U32A 2G51A 1NFYA 3KF2A 3O8BA 3SOSA 2XBYA 1CGIE 2BD2A 2PUQH 2XC5A 4B73A 5JB8S 2BXTH 4IN1A 1GDQA 1V2ST 1SGEE 4JK6A 3R0FA 3TNTA 3AASA 2R0KA 2ZGCA 3Q3XA 3TH3H 5BPEA 3RC5A 1P10A 2ZDLA 4CREA 3A87A 1QRZA 1NRRH 1O2MA 1ARBA 1Z8JB 1K28D 1TLDA 3MMGA 1GMCF 1ZMNA 1KDQA 5FCKA 2FP7B 1CHOG 1K21H 1N8OC 1OWIA 2BDYA 5GCHF 1ZHRA 3SV9A 3RXRA 1SL3A 1G37A 3RXKA 5A8XA 3GCTF 1EX3A 2W3KA 1QIXB 1N1LA 1F7ZA 2C90B 2J4IA 1P06A 2ZDAH 4JZDH 1G2MA 3BIUH 4UEHH 2CV3A 3C27B 1K1IA 1C5TA 1XUJA 2BZAA 3SNBA 1UCYH 3FANA 3SI4H 5L2YH 2GCTB 4R0IA 4CBOA 3UUZA 3MU0A 2OINA 1AZZA 1LPGB 4MQAA 1QL7A 2ZHDA 3MNSA 1NRNH 2FODA 3S7HB 4ABEA 3H5CB 2NU2E 3D65E 1ZGIA 1D6RA 3SV8A 2CHAC 1RRKA 3A81A 3NK8A 4KGAA 4SGAE 3ZZ9A 3GYMA 1P12E 1NFWA 2XWAA 1C4Y2 1YCPH 2FS9A 1GI9B 1P9UA 1EASA 2W7SA 1Y3XA 5A0AE 1HAYB 3EE0B 1EP5A 2KAIB 2NU0E 2PKSB 2OUAA 7KMEH 2XC4A 4H6TA 4NCYA 5EG4A 2A31A 1GHZA 3ZZ4A 1FQ3A 1UO6A 3BTQE 5C1UA 3BIVH 2P8OB 5AF9H 4U2WA 1VJAU 1LHFH 1Q31A 2OP9A 3TVJB 3ZZAA 3PWCA 5F6MA 1EB2A 3MU5A 4UFDH 5DK1A 3S69A 1HYLA 1NTPA 4DT7B 5C67A 1RTFB 1OXGA 1W14U 2CMYA 3TJVA 4CBNA 2O8LA 1MZAA 1SLXB 1MZDA 4AYVB 5H4IB 1LVMA 4AFZA 3RXEA 4E05H 1V2RT 1FZZA 3MTYA 3SU5A 1KY9A 1O5GH 3PMJA 3E0NB 2WPIS 1C9PA 2NU4E 1KXDA 2A7HA 2ZG0H 5SGAE 1FLEE 3SJKA 1A0LA 2KAIA 1GHYH 4MLFB 2BD9A 2Z9KA 2FOHA 1K1NA 5EXLA 4D8NA 2BLVA 2G4TA 1O3HA 3GDUA 4NFFA 2ZPQA 2R3YA 1TOMH 3M3VA 3MI4A 4YT7H 1HJ9A 3RMOH 3K2UA 1G9IE 4YOJA 2RCEA 1IQGA 3F1SB 3RMMH 3BTKE 1YM0A 2A5KA 2C8ZB 2BDHA 3RXMA 1YPMH 2FS8A 2FO9A 1B7XB 1JRSA 3GY2A 3RXQA 3EA8A 3NCLA 2Y80A 4B75A 1UHBB 1OP2A 1G30B 1W12U 1C2MA 3TH4H 4Q7YA 1GBEA 2F9NA 4GCHF 1GJ5H 4K1TA 1Q3XA 1GWAA 3D49H 1L1NA 1XVOA 2HNTE 4NA9H 1LPZB 2XRCA 1OSSA 5AFZH 3SUDA 4I7YH 3OY5U 1NRSH 8GCHG 1BTWA 2ZPSA 3BF6H 4Y6DA 1PJPA 5DO4H 1C1QA 1GJBB 1NN6A 2ULLA 4Q80A 2Q1JA 1KSNA 2PWXA 3A7XA 1UVSH 1SHYA 4DOQA 3A7YA 1G2LA 2FOFA 4Y8XA 3QUMP 2J95A 1ESBA 1P0SH 5DPAA 6CHAC 1ID5H 1FMGA 6LPRA 1BIOA 3FP8E 3QX5H 1GCTC 2FX4A 3GDSA 5JB9S 4NIXA 3SGAE 1UTKA 4THNH 3GCHC 3P95A 4GLYA 5GXPA 9ESTA 1BBRK 1IQMA 4XE4A 3QK1A 1AKSA 1SVPA 4I8KA 4UDWH 3DD2H 2BY7X 5JDUB 1TB6H 1VITF 1BTUA 2AMPA 3ATKA 4TPYA 5A2MH 3TJOA 2A4RA 3MNCA 1UHBA 3TK9A 1O3OA 1C1NA 1PPZA 4ZXYH 1RTLA 4ZHMU 4DVAU 4X8SH 2BMGB 3QTOH 1PPEE 4H6SB 3B9FH 4AGJA 5HMAA 4A1VA 3I29A 2C93B 5ETXA 1H8IH 1EOLA 1THSH 2GV7A 2TRMA 5K0HA 3BG8A 1AVWA 3RXFA 1SQAA 4X6OA 4FU9A 1GHBG 4MNVA 1QB6A 1FDPA 4X2YA 3VFEA 4K60A 1C4U2 4B1TA 5E8EH 3LU9B 1JOUB 3Q76A 2A4GA 3BTEE 7GCHF 1SGDE 1PQ8A 2QAAA 3TK5A 8ESTE 2VIDA 1HPGA 2XBXA 4Q7ZA 1CQQA 3RXHA 1BUIA 4CRAA 4X6NA 2BM2A 4A7IB 2SGEE 1TBZH 2XCNA 4BANB 4UFGH 4Y79A 2G52A 1Y3WA 1TNHA 1XUGA 2ZZUH 3ZVEA 3LC5A 3RXIA 2G4UA 4YOGA 1WOFA 2XW9A 1NT1A 2FOGA 4JZIA 2RA3A 2FOEA 4Y10E 3RU4E 1Z1IA 3ATWA 4IGDA 2ALVA 4O3UA 2C8XB 3PYHA 4NFEA 1GI5A 4QT8C 2P16A 1ZSJA 2Q6GA 1S84A 3O8CA 3TGKE 4X2VA 3UIRA 5FAHA 2CXVA 2AMQA 3QLPH 1J9CH 1GHAG 2H9TH 1BQYA 1FIZA 2W5EA 4BAQB 1FAXA 3M5OA 3AAUA 2B5TB 2O8TA 1IQHA 4DIIH 1W3CA 3T2NA 2UUFB 3RXLA 2BVXH 4CHAC 1T4VH 3CP7A 2CGAA 2ILNA 4YESB 1DUEA 1ABJH 2ZWLH 1AHTH 5JYIA 3H7TA 1O3MA 3LGVA 3MNBA 4FU7A 3PB1E 3RXJA 1O0DH 2A7JA 1GGDB 1CT2E 2SGQE 3HK3B 2RA0A 5F8XA 2G5NA 1V2OT 1HAVA 2ALPA 2A45B 1SGTA 1BTPA 6GCHF 3GISB 3SU6A 4WY3A 3HGPA 5FX6A 1V2KT 1XUKA 1QBNA 3LT3A 1NZQH 2SFAA 1C2DA 2UWPA 4J1YA 1C2GA 5E2OA 4GUXA 1KXEA 1MU8B 1HJAC 1G3EA 3EDXB 1O38A 1TRMA 1IQFA 2PSXA 1OYTH 1QURH 1SGRE 3I77A 1TGSZ 3TJNA 1S5SA 2ZDVH 1FN6A 1C2JA 2C8WB 2VWMA 1O2LA 5FXLA 1EATA 1XX9A 4NWKA 1FY3A 1GMHG 2VGCB 1PYTC 4U01A 3OTJE 3ENSB 1QCPA 2BTCE 1BA8B 2ZGBH 4AG2A 1SQTA 1TYNA 2QXJA 1O2RA 1LQDB 4OGXA 1HV7A 4I8JA 1VZQH 3RU4T 2Z3EA 5J4SA 3M5MA 8LPRA 1SI5H 4OS5A 1MAXA 1X7AC 4CRBA 3P8GA 1AI8H 1DT2A 2ODPA 1MKXH 1SLUB 2HLCA 1F0UA 1FY8E 9LPRA 1RS0A 4XDEA 3LGTA 1HIAA 5HM2A 1HBTH 1P2KA 2Q6DA 2FMJA 1OS8A 5DP4A 1DDJA 3LDXH 2ZEBA 2ZFRH 3RP2A 1XM1A 2V3OH 4R8TB 2ZF0H 2ZNKH 1P11E 1O2XA 2EA3A 2ESTE 1BHXF 3ITIA 1AO5A 3HK6B 3RDZA 3CS0A 3MH7A 1RD3B 2Y7XA 1C5UA 4AX9H 4X1NU 1VGCB 3K6ZA 3O8RA 2AERH 3RM2H 1MBQA 4K8BA 1GI2A 4DJZB 1YKTA 3AVZA 3L3TA 1LHDH 5F8ZA 2VU8E 1Y3YA 1E37B 2QF3A 1KLJH 3CENA 1PQ7A 1F5RA 3P17H 1EP6A 2A4QA 2OBOA 2C8YB 4X2XA 1WV7H 5FPTA 5LPRA 2SNVA 1ESAA 2P3TB 4XSKU 2WPHS 1ZRBA 1SGIB 1CVWH 1C5NH 2THFB 4TY6A 4O3TA 2GKVE 1QB9A 3GY6A 2G81E 5LPEA 3RXGA 1SHHB 3BG4C 3GY3A 3KCGH 3RLWH 1GHVH 1O3DA 1E34B 4D9RA 1TX8A 1L1GA 2ZCHP 3LC3A 4AZ2B 1P2MA 1MKWK 1XVMA 1MTVA 5HM9A 2FOBA 2RDLA 3HKJB 3BTFE 1KLIH 1P3CA 2JH5D 3A7TA 1AE5A 1ZPCA 4X6PA 2CN0H 5FCRA 4Y71A 3UTUH 3E3TA 1F0TA 4Y7BA 2V6NA 5GCHG 1EAWA 3LONA 1BTXA 3G01A 1C1VH 1EKBB 1XKBC 3GCTG 5PTPA 1C2FA 1K1LA 2H2ZA 3VB6A 1NC6A 1BB0B 1EXFA 5EODA 4BAKB 4CH2B 1WTGH 1AIXH 1OWEA 3SU2A 2FWWA 2ZCLP 1EJNA 2GV6A 1P01A 3MFJA 3RXCA 3M7UA 3A8CA 2V35A 1DITH 3E8LA 2D8WA 1DFPA 2AGGX 1HAHH 1ANDA 1TRYA 1QBOA 3SJIA 4BTTB 2BX4A 1C2IA 3VPKA 2XWBI 1AQ7A 1SBWA 4BAHB 2Y7ZA 3QGNB 4X0WU 3SJ8A 2UUJB 3RXPA 1KDQB 2Z94A 3EAJA 3V0XA 1O3CA 1GBLA 1B5GH 2CHAB 2UUYA 1A4WH 3F68H 2GMTC 4H4FA 2HNTF 2ZU1A 1HXFH 2FESH 1BMAA 1IAUA 2XC0A 5FHTA 1TGCA 3A86A 2PV9B 5JPMH 3AW0A 2J2UA 4ZUHA 3SUEA 2YNAA 5T6DA 2HWLB 5LH8A 2ANKH 1W7GH 2G8TA 4RKJB 3MO3A 4BNRA 1W2KH 1AFQC 2VH6A 1SSXA 1TMTH 3HGNA 1EQ9A 3SNDA 2GCHG 1J14A 3B23B 3M36A 3ZZ7A 2K1QA 2H9EH 1FONA 1HAPH 3Q3YA 2QXGA 2JKHA 3P70B 1SQOA 1LMWB 2FYRA 2PW8H 4FXGH 1S6FA 3FAOA 1O3KA 2F91A 1J16A 1DS2E 1H9IE 2OC1A 2VVUA 3HPTB 1WU1A 2FTLE 1HNEE 4B2CA 3LH3A 1P03A 1P8VC 1O2ZA 2F9UA 3FFGA 3S9AA 2FIRH 4KTCA 3SNCA 5I25A 1G3BA 4WF8A 3RXOA 5CMXH 2GZ7A 2BVRH 1Y5BT 3A83A 3SN8A 3QN7A 1C5MD 1SPJA 2HOBA 2WPLS 1MQ6A 4ABDA 3TGIE 1ZJKA 1KLTA 3KNXA 1DLKB 1P2NA 1NROH 1ESTA 4BTIB 3S0NA 3MO9A 1H1BA 1CA0B 2P94A 5DG6A 1NESE 4NZLA 3ZVDA 2HPQH 3A89A 1Y5AT 1RIWB 1MH0A 3A82A 2ZU2A 3UWIA 1HUTH 3PLKA 3A8BA 3K6YA 1AB9C 1BTHH 1SC8U 2P95A 1AZ8A 3BTDE 1LKBA 1ELCA 4XBBA 3ELAH 1A61H 1FY5A 4WMDA 4RN6A 1DICA 1KXCA 1KXFA 2QN5T 2AFQB 2JH6D 4ABFA 3IG6B 4D7FA 1GBTA 3UQVA 1FN8A 1YCPK 1BT7A 2H5DA 1WBGB 1T8OA 2GP9B 5TJXA 3M5LA 1NFUA 3VGCC 1WAYB 4VGCB 2AYWA 4LOYH 3FP6E 1Y3UA 1QGFA 3ATIA 3SV2H 2CJIA 3K65B 4CRGA 2GD4B 3PO1C 1ELDE 1MCTA 1A7SA 3NXPA 1IHTH 3ATMA 2OC8A 1FY1A 3P8OA 1TGTA 2W26A 1GMDF 1XXDA 1EPTC 2GDDA 2TGDA 2ZKSA 2BB4A 4HTCH 2V0BA 1TABE 3EQ0H 5EU8A 2FTMA 1ZLRA 3KQBA 1O5BB 1K2I1 3GCHB 3LGYA 1VITG 3LJJA 3GICB 4WJG2 1AWFH 1O31A 1DY8A 1UVUH 5GDSH 1BTYA 4FUJA 3F9HA 2BQ7B 3A7ZA 2ZPRA 2A2XH 3W95A 1GBBA 1GVLA 2PSYA 3LPRA 2TBSA 1Z8IB 3UNRA 2YNBA 4TYDA 3DUXH 1S0QA 4B2BA 2QXHA 1YC0A 2J38A 3E90B 3M7QA 2TIOA 4XBDA 1ZGVA 2SNWA 4FUFA 1GBCA 4NGAH 2ZFSA 5ESBA 1ELFA 3BTGE 2WYGA 7GCHG 4O97A 1CBWB 1AKSB 1BMMH 1TFXA 3PROA 4BTUB 3GY8A 1EZXC 1MD7A 1D6WA 2FX6A 5LGOA 1TGBA 1O5EH 1FXYA 2GCTC 2QC2A 4Q7XA 1TX7A 3M61U 3VXFH 3C1KA 1PYTD 1ANBA 1A5GH 2FZZA 1QA7A 3IWMA 5EXNA 3V3MA 4MNWA 3RMNH 1UVOA 5FBEA 2ZA5A 4UONA 3DFJA 4KELA 1BMLA 2ZP0H 4YM9A 1UTLM 1O2YA 1P02A 1PPHE 1TPSA 1TBQH 3W94A 3F9EA 3ODDA 3BTME 2P3UB 2PKSC 4KTSA 2VB0A 4AFSA 1SGYE 1O5AB 1AY6H 1LDTT 1MTNB 3SNEA 3PV4A 1TNLA 1V2MT 1ABIH 1QNJA 2WPJS 4U30A 1OWKA 1SGFA 4Y0YE 4IC6A 4ISLA 4MPXA 2PFEA 2OBQA 3U98H 1FPHH 3EGKH 1C5WB 5FPSA 4ISHH 3SW2B 1NM6A 2GVFA 3ATLA 1JRTA 3BN9A 1O2KA 2ZHFH