1BMAA

Benzyl methyl aminimide inhibitor complexed to porcine pancreatic elastase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Chymotrypsin-like elastase family member 1
publication title Interaction of a peptidomimetic aminimide inhibitor with elastase.
pubmed rcsb
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1995-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bmaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bmaA01
4Y6DA 1LVOA 1QTFA 1ELTA 2ZWLH 5DP3A 1TGBA 4ZAEA 1IAUA 2BM2A 2QCYA 1P2KA 1TNJA 1ID5H 3SJ8A 2FIRH 1BTHH 2ZDKA 2BX4A 2C4FH 3FANA 1B7XB 1T31A 3BTHE 1CGJE 5EXNA 3F9GA 5A0AE 3A81A 1AKSB 3P8NA 1SQTA 4NCYA 1P12E 1D9IA 4WMDA 3ZZ5A 1BQYA 1H9IE 1TGSZ 4NSVA 2XXLA 2VINA 1EAWA 1PPEE 3B8JA 4K60A 3EGKH 3TGJE 1Z8GA 3PWBA 2F9OA 1N8OC 5PTPA 1K1JA 2BLVA 3GOVB 1K1MA 5G4BA 3JZ1B 1SI5H 3SGAE 1AE5A 1NC6A 1LHEH 1O2OA 2F9NA 3SQEE 3UUZA 1NZQH 3TLOA 2WINI 4BAKB 1C5MD 3RXVA 2HNTE 1V2WT 4AGKA 1KTSB 1KDQB 3LGUA 1GJAB 1P2QA 1O2QA 1ZTJA 3UR9A 3TNTA 1UK3A 2PSXA 1O2UA 1NO9H 1Y3VA 1NROH 3S9CA 1D3PB 2ZEBA 1OKXA 2O8MA 1CBWB 3RC4A 4X6MA 4WMFA 1S82A 3E90B 2CGAA 1L1NA 1V2NT 3M5MA 4WH8A 2ZNKH 5EXMA 2SGEE 1ZMJA 2IN2A 5C67A 2SNWA 1GBHA 1GJ9B 1GBBA 1K28D 1P09A 2C3SA 2VWLA 1TWXB 2P8OB 3L3TA 4JYUH 5FXLA 1NFXA 1SMFE 4R8TB 4AYYB 3KEEA 2IJOB 1SOZA 3LGTA 4VGCB 4I32A 3S9BA 2F9VA 1WSSH 1ANBA 1P3CA 1ACBE 3PMBB 3QWCH 4B74A 2Y7XA 3EYDA 1F92A 4O3TA 5ESTE 2QXGA 1GHYH 1P06A 5FPTA 2HLCA 1XUJA 1CO7E 2CF8H 1EUFA 3PWCA 4K69A 1T8LA 5TJXA 5A09A 2PUXB 1V2RT 1LPZB 3GY7A 4FUHA 2BZ6H 2DE8A 1GMCF 1RIWC 3LONA 1DFPA 2ZHWH 4FU7A 2BXUH 3VGCC 3UQVA 4X1PU 1IQMA 2FOGA 2CHAB 1FDPA 2P93A 1UO6A 3UNSA 5JBTA 4DW2U 2BX3A 1MD8A 2FX6A 4Y10E 3ZVGA 4O97A 1GI1A 3T62A 1T4VH 2B5TB 4KGAA 2DE9A 5DP6A 4D9RA 1MBQA 3MU5A 1EZQA 1OWEA 2AMDA 4BOHA 3BN9A 2FOEA 2GMTC 3LGWA 1MKXH 3UQOA 1DOJA 3L33A 2STBE 1BBRK 5HYOA 1A5IA 1O3CA 4JZIA 2VIOA 3RM2H 2PR3A 1J14A 4XBDA 2FI3E 1TPSA 1WOFA 5LPRA 3SO3A 3HKJB 2AEIH 4IC5A 3M3TA 3A88A 3PROA 4PROA 1AU8A 1C2KA 1DITH 1QR3E 3S7KB 4Q2KA 1F2SE 1ANDA 1C5SA 2R9PA 1GMDF 1YPGH 3E16B 3SU1A 1EP5A 1G3EA 3ELAH 1GHWH 1XX9A 4Y7AA 1OS8A 1C2JA 3OYPA 1GPZA 1ZSJA 1BB0B 3SV9A 1IQEA 2A7JA 4AZ2B 2G00A 2ZFPH 1SLUB 4Y0YE 3HKIB 1TPPA 2HVXA 4O3UA 4XE4A 3RU4E 1O3IA 2GCHF 1W13U 1P3EA 1THSH 2JH0D 3OX7U 2HRVA 2R0KA 4XFQA 3MU0A 1Y3XA 2QY0B 1O3DA 2VJ1A 1O3OA 3A86A 1MTWA 3ATIA 3ATMA 4ISLA 2ZFQH 1TOCB 2AIQA 2OC1A 4Z0KA 1AUTC 1C5ZB 1XKBC 2ZIQH 1DSUA 1SVPA 3EAJA 1KXCA 1AE8H 5LH8A 1C2HA 2JH6D 4CH8B 1T8OA 3SNEA 1V2LT 1C5RA 2PLXA 2ZDMA 1G32B 1KLJH 1CHOG 1XUKA 1O2MA 4Y8YA 4K1EA 4AG2A 5FPSA 1W0ZU 1UCYE 1ZR0A 4CHAC 2QXHA 2CV3A 4THNH 1TPOA 3CP7A 2CXVA 2V3HH 1TIOA 2R3UA 4OGXA 1QBVH 4WF8A 3A84A 4LZ4B 2PSYA 2W26A 1UVPA 2ZI2H 3BTKE 5E0JA 3RXDA 2STAE 2D8WA 3RXAA 4GCHF 4BAMB 2SGDE 3K9XB 3BTFE 3U98H 2P3TB 3GY4A 1G30B 1N8OB 2BDYA 1SQOA 4WXVA 3A89A 1JRTA 5T6DA 3NUMA 2ZDVH 3MTYA 5EXLA 1EQ9A 4FXGH 4MTBA 4OS2A 4AB9A 2YOLA 1G36A 2LNCA 1IHSH 2VH0A 2WYGA 4A92A 4MPUA 4AN7A 4ZXXH 3QO6A 4KKDA 2FOBA 3BIUH 1F0SA 2XCNA 4AFQA 1YPHC 1HJAB 1AHTH 1SSXA 3MH6A 2XCFA 4IBLH 3V13A 1Y3YA 1NN6A 3CS0A 3M7QA 1HIAB 1GBEA 2BLWA 4H42U 1GBKA 1D3QB 1ARBA 1O5CB 2XWBI 1MD7A 2I6QA 1N6YA 5F8TA 5L2YH 3LJOA 2GTBA 3TJVA 4BTUB 3E3TA 1O2GH 3AW0A 4ZHAA 1GI0A 4WMEA 3RXKA 1HAHH 5AFYH 4F49A 1MTVA 2G4UA 1GVLA 2PKAA 4U30A 3C1KA 3CENA 4I33A 2ZFTA 4NZQA 1NFYA 1A5HA 3HGPA 4AG1A 2BQ6B 1HBTH 2B8OH 2D26C 3SJOA 3A80A 3SNBA 3MU4A 1IQLA 3F1SB 3MNBA 5TCAA 3T28A 1OYQA 2ALPA 1JIRA 3A87A 1WU1A 2TRMA 4M7GA 1UCYK 1ARCA 1RIWB 1YPJH 2O8UA 3SU6A 1KY9A 2ZU2A 1FLEE 3VGCB 3B23B 1EAIA 2BQ7B 3EQ0H 5BRRE 3IG6B 1ZPZA 5E2PA 2BD4A 2GDEH 4K1SA 3NZIA 1Z8JB 1C4U2 1HAXB 1VITG 2WV4A 1IOEA 3OY5U 1ZPCA 1DXWA 1V2TT 1NY22 1W14U 2BVXH 3DFLA 2ANMH 1ETTH 2Z3CA 2ZCHP 3NWUA 2FWWA 1A7SA 4Y71A 1W10U 5A8XA 4YT6H 3OU0A 3SI4H 3KL6A 2H1UA 3SV2H 2GMTB 3VPKA 1OPHB 1ELAA 1HFDA 2ODQA 3L6PA 4A1VA 3RMLH 3A7VA 4OS1A 1YPHE 3AAUA 2VVCA 1C5UA 3KQCA 1TMTH 1QJ1B 1PQ5A 2PGQB 3FZDA 2J34A 1ZGIA 1ZZZA 3NPSA 4Y11E 1J9CH 1FUJA 3BTTE 5DJ7A 3RC6A 3BEIB 4NIXA 3I77A 4ABFA 1JOUB 1ZRBA 4DGJA 1NPMA 3MU1A 1Y5BT 1XUFA 1VR1H 1C1WH 3SU0A 4GHTA 2UWOA 3PO1B 1GMCG 2A7HA 4DIHH 2UUFB 1EPTA 1YBWA 2ZPRA 3LC5A 3UNQA 3H7TA 3QZRA 2ZGJA 3BEFB 2A2XH 1GJ4H 3RXLA 3ZZ9A 2ZGHA 1P2MA 1L4DA 2ZFSA 3MOCA 2AMQA 3UREA 2G5VA 1K1NA 1E38B 1HNEE 2Y82A 3LOXA 1O35A 2BY7X 3UOUA 5DPAA 3SNDA 1HJ9A 2A5KA 3RXSA 4CREA 3P70B 2W7SA 2ZU1A 4UEHH 4UD9H 2BTCE 1BRCE 3BIVH 2ZKSA 4CRBA 2A0QB 2C8WB 4MDSA 2YNAA 1QB1A 1U6QA 1SGFG 1ORFA 4CHAB 2BD5A 1K1LA 1MCTA 1CE5A 1K22H 2ANWA 2VIPA 1CT4E 3C27B 1JRSA 3MO9A 1GMDG 1XUIA 2HGTH 3H5CB 3FP8E 1P02A 1DT2A 4K5ZA 1L1GA 2GT7A 1MZAA 1ANCA 3SV6A 4B2BA 4ABIA 1S0RA 1EJMA 3KHVA 3QTVH 1AKSA 1Z8IB 1VZQH 3QGNB 1F5KU 2WUCA 3ZZAA 3BTQE 4BTTB 3KQEA 4MNVA 4GAWA 3TNSA 1DANH 3W94A 4B2CA 3SUEA 3SW2B 1BJUA 1CA0B 4SGBE 1LMWB 4LK4A 3UNRA 1EXFA 1BTPA 2UUYA 4DVAU 1C1SA 3KIDU 2D2DA 4NIWA 1ELVA 5E0HA 4OGYA 1KDQA 2ANYA 1BTYA 5DP4A 4IW4E 2QGRA 4NA9H 5JYIA 4B73A 1A3BH 2FESH 2F91A 1MBMA 2FYQA 5E0GA 2UWPA 1YP9A 1SHYA 3Q76A 2GZ9A 1KXEA 1LO6A 2OC0A 2VVUA 1N6XA 1ETRH 1SFQB 2ZFFH 5B6OA 8GCHG 1MQ5A 2ALVA 3TK5A 1CHOF 3OY6U 5JBAS 1GHBF 2J92A 3LIWA 1LVYA 2Z6BD 1QBNA 1LVBA 3TU7H 4D7GA 3AAVA 4UFGH 2UWLA 1CVWH 2R2WU 1RS0A 3KGPA 5JBCS 2HWLB 2GP9B 2ZU5A 3O8DA 1C5TA 4YESB 2SGQE 1G2LA 2XC5A 4CRDA 2XTTB 1GI3A 2V0BA 3QGJA 1BJVA 3QK1A 1LHGH 6LPRA 1UHBB 4D76A 1OP2A 1AN1E 1O3NA 2OP9A 1SGPE 1YGCH 1TRYA 1GI9B 3DUXH 1MTNC 5F8ZA 4ABGA 1C1RA 3N7OA 3VB3A 3SORA 1C5NH 3QUMP 4HTCH 4ASHA 2ZDNA 1EOLA 4UONA 1TFXA 2ESTE 3U8RH 1W7XH 3KNXA 1H8IH 1KXBA 1UTJA 3GY3A 4JZFH 3SNAA 3V3MA 3MH5A 9ESTA 1DUAA 4TWYA 5EODA 1NRPH 3BEUA 2OD3B 1Q31A 1LPGB 3QN7A 2O8WA 3P8OA 2K1QA 4BAOB 1QGFA 2ZFRH 5C2ZA 5FBEA 1C1UH 1HAIH 1RTKA 3NK8A 4GHQA 2BYAX 1AGJA 1MCVA 1UTQA 2QXIA 3LH1A 1ZOMA 3M35A 1EB1H 1CHGA 4ABHA 4XSKU 1B0EA 1E35B 1GI7B 2H9EH 5C3NA 2IOTA 1HJ8A 1HLTH 1WQVH 5JBBS 1G3DA 1AMHA 6ESTA 2FZZA 5TCCA 3T5FH 1P2OA 1SPJA 5GXPA 1O31A 2NU3E 1QCPA 3FZZA 3JZ2B 3MFJA 4FU9A 1Z6EA 4FUEA 1C1OA 3KQDA 4ABEA 5FBIA 2BY5X 1YLDA 2RCEA 4E05H 3HATH 5T3HA 4ESTE 2NU0E 1C1PA 3UTUH 1OWIA 2H9HA 3K2UA 3NXPA 4U01A 5HM2A 5JB8S 4I8LA 1ZJKA 1BBRE 1SGTA 4MPXA 2ZCLP 3ZZ4A 1AB9C 2Q1JA 5AVDA 4NIVA 1GHAG 1A3EH 6GCHG 2RA0A 4UFFH 1VITF 1O3AA 3G01A 1DWBH 1L1JA 1HAPH 3A7YA 3TH2H 2VH6A 3D49H 2HALA 1XM1A 2ZGBH 1GVZA 2H5CA 1GHZA 4HGCA 4BXSA 5C1XA 1YCPH 2BDBA 1DICA 1GBCA 3E8LA 4CR5A 4DT7B 3LGYA 1CGHA 1K1OA 3SHCH 2JETC 1G37A 3VEQB 1E34B 3TVJB 1GI5A 4ZHMU 2QF0A 4DOQA 1PYTD 3RMMH 1TBRH 4FUJA 1V3XA 3BG8A 5LGOA 2BDHA 5CMXH 3FVFB 2OC8A 4UE7H 2FDAA 1KXAA 1C5VA 4QT8C 1P10A 3P95A 5FAHA 1UJ1A 3SV8A 2Z3DA 2VU8E 3VFEA 5GJ4B 5C1YA 2WPIS 3LKWA 2OTVA 2BY6X 1S5SA 3RP2A 3SU4A 2FTLE 3MNSA 3R3GB 4CRFA 1WUNH 1HGTH 1DLEA 4GPGA 1RXPA 2ZQ2A 3K65B 1WCZA 1LKBA 5EQQA 1E37B 1C1VH 1FI8A 2ULLA 1O34A 4RKJB 2WPLS 1RFNA 2OXSA 3GY5A 3M5OA 3D62A 3DA9B 4Z6AH 2Q6GA 1W11U 4IN2A 1H8DH 2OC7A 4AGJA 1EZSC 5C5OA 2QYIA 1HAVB 2P59A 1NU9A 2GCTC 5DO4H 1TX8A 3RMOH 1TOMH 3V0XA 4A1TA 3DFJA 4FUDA 1S6HA 2JH5D 3T29A 2BOKA 2I6SA 2A4OA 1TBZH 1NFUA 1LDTT 7KMEH 1A0JA 3BTDE 1DDJA 1HIAA 5J4QA 3ZZBA 1FAKH 2FTMA 1QA0A 5FX5A 2J9NA 1C2FA 1AI8H 1VGCC 2VIWA 3GYMA 1CSOE 4B75A 1ZMLA 1P11E 5DP5A 3FP6E 1WV7H 4JZDH 1AO5A 2FEQH 5F03A 1GG6C 3EA9A 1C5WB 1G2MA 1O5FH 1A4WH 1GI4A 3UOPA 4AFUA 1BMLA 3PMJA 3Q77A 1W0YH 4WWYA 3IITA 4ABBA 4ABJA 1YM0A 1MMJN 1S84A 1ZJDA 4WXIA 1C1TA 3S7HB 1SGRE 4WY3A 3GICB 5CHAC 2P3FH 1TNIA 5HGGA 4A6LA 1MTNB 3GY8A 3MH7A 1GJ8B 1OP0A 1DS2E 1SGNE 3BTME 3GDVA 1H9HE 1AFEH 3RU4T 3E1XB 1C5YB 3DT0H 3LGVA 1G3BA 1EX3A 1GJ7B 1TQ7B 4NA8A 3M3VA 1F7ZA 1O2VA 1C5XB 1RRKA 1KYNA 2QC2A 4ISNA 5GWZA 5ESBA 2Z7FE 1LQEA 1FPHH 3BG4C 3RXUA 2KAIB 3MMGA 2ZTZA 1GCTC 1P03A 1GDUA 2P95A 1HCGA 2XYAA 1SLVB 1T8MA 3PYHA 1GHBG 4Y8XA 4BNRA 1F5RA 1L2EA 8GCHF 3TH3H 3PMAB 3ITIA 3ZZ7A 1ZMNA 4NFFA 1CT0E 4MG3A 2BLOA 2ODPA 3F9HA 1ZTKA 1FMGA 1FY1A 1TRNA 1J17T 3A8AA 2FOHA 2QIQA 4AORA 3RXMA 3HK3B 3F6UH 3QLPH 3E6PH 1OP8A 2ZA5A 1O2HA 3EE0B 3VB5A 5J4SA 2R0LA 3ZVEA 3A8CA 4BXWA 3GCHC 3PB1E 1MZDA 4I8GA 1NESE 1AB9B 2WUBA 3E91A 1EATA 4JZ1A 1V2VT 1SL3A 2FXRA 2AIPA 3TGKE 3STJA 4AFSA 3UFAA 4Y76A 3LU9B 4MQAA 1SGFA 3M5LA 1BIOA 2QAAA 2WV5A 3E0PB 4ZMAH 1OWHA 5E2OA 2A4RA 1HXFH 5EW2H 1ETSH 2O8LA 1FXYA 2YNBA 2ZPSA 1HPGA 2ZQ1A 3U8TH 1O39A 3PM3A 1G9IE 1GDNA 1QBOA 4JMYA 1SLXB 3VXEH 2BDCA 3ZYEA 5HXFA 3KCGH 2JETB 3EA8A 2V35A 5ABWA 4NGAH 4Q7YA 4MPWA 1YKTA 3LPRA 2ZPQA 4TWWA 2C8ZB 1MAYA 1THPB 1ZRKA 7ESTE 5A8ZA 1WTHD 2B0FA 1BTZA 1BA8B 2H2ZA 2Y81A 1PPHE 1C4V2 3GY6A 3SI3H 2ZO3H 1IQHA 4MNXA 1DLKB 1BUIA 4B76A 1Z7KA 1IQIA 3RMNH 1GBFA 1BMAA 1J16A 4OS5A 1EPTC 3F9EA 2ZECA 2Y80A 5A8YA 1TNKA 5DG6A 2RG3A 3MO6A 3PLBA 2GDDA 2P3UB 3MWIU 3ATWA 3T2NA 3MYWA 5FX6A 1GHAF 5DP7A 6GCHF 4CRCA 4IS5A 1SGIB 3ZZ6A 2VIQA 4Q80A 1XMNB 3PTNA 3GCTF 1E0FD 1PPBH 4X2WA 1BITA 1NM6A 1E36B 1LQDB 1O5AB 1P0SH 1ZHPA 1XUGA 2AS9A 5A0BA 5K0HA 2C8YB 3RXHA 1WBGB 4BAHB 1A2CH 1CGIE 1HDTH 4ZKNU 1IQGA 1GBTA 4CRAA 2WPMS 3VXFH 1UVTH 2WPJS 2GKVE 1VGCB 1OOKB 3NCLA 1QFKH 3KQBA 2IPHA 3ZYDA 1GG6B 5AFZH 3A7TA 2AGIX 2J4IA 4K3JA 2VGCC 1Q3XA 1TA6A 2V6NA 5C5NA 2XBVA 3SU2A 1DX5M 2H6MA 1O30A 3FP7E 4Y79A 1IQJA 1BCUH 3AASA 4U2WA 1ELCA 2W3KA 1O38A 2NU4E 3TJUA 4YOJA 3SGBE 5GCHF 1AY6H 4BAQB 5CHAB 2FODA 1UHBA 1F0RA 2AH4X 4MNWA 5EQSA 1UVOA 1A5GH 1C2MA 1PPZA 3SUDA 1MKXK 2VWNA 1XVMA 2EA3A 3SUFA 1B5GH 4GUXA 1O2WA 2QV1A 4WJG2 1TE0A 1S81A 5FCRA 1OWKA 2FOMB 1CA8B 3BG4B 3U9AH 1TGNA 3P6ZB 2A45B 1AUJA 1QIXB 3Q00A 3ATKA 3MI4A 3MH4A 1GBAA 1JMOH 3A7ZA 1P2IA 4X2YA 2BMGB 5A0CA 1DY9A 2XC0A 5T6FA 1IHTH 1ZSKA 2ZP0H 4ZKRU 1PPGE 5EPYA 1UTNA 1O0DH 1KIGH 1SHHB 1Q2WA 4I8KA 3SUGA 1VCWA 1BTWA 4CH2B 2P8OC 1BDAA 2BD9A 1BTUA 1KLTA 1GGDC 1VCQA 1TYNA 3M7TA 4NWLA 2G55A 2GT8A 1GBDA 4KTCA 4ZHLU 1AFQC 1S83A 1EZUC 3RXJA 4IC6A 5AF9H 4CBNA 4X0WU 1HV7A 4TYDA 4AB8A 2G52A 1NS3A 4DCDA 1WYKA 4IMQA 1ELGA 3URDA 2QN5T 3TJNA 3MU8A 4WH6A 1VJ9U 1GHVH 3GCHB 1QRXA 5DK1A 5LPEA 1O33A 3FAOA 1K1PA 2A5IA 3A85A 2R3YA 4K8BA 2CJIA 1BOQA 5IYTA 2FLRH 1HB0B 2OQ5A 4ZH8A 1T4UH 1BTXA 3A8DA 1AIXH 2BVRH 2PUQH 4SGAE 2ZCKP 2ANKH 4YZUA 2ZU3A 3ZVAA 4D9QA 1O2JA 4I31A 4X8VH 4MPVA 1EB2A 1FZZA 1MKWH 3KN2A 3UIRA 4H6TA 2OQUA 1JWTA 1D4PB 3SJIA 4X1SU 4ZKOU 4KTUA 1OX1A 1QJ6B 1HYLA 1H1BA 1O3LA 1OWJA 3RLYH 4NSYA 3V12A 1P04A 2BHGA 1GCDA 1LKAA 1YCPM 1A1RA 2J2UA 2TGTA 1YPMH 2ODYB 4INLA 1ELDE 1MTUA 3TGIE 4AOQA 2BY9X 1QL7A 1O5DH 1IQNA 3ZZDA 3UY9A 1TGTA 1SB1H 2FI4E 4JYTA 1NRSH 3ZVDA 4NFEA 1O3BA 2GD4B 3GDUA 5I46H 1O2XA 1V2UT 2ZF0H 1EAUA 2BQWB 3ENSB 1ELBA 1JXPA 2ASUB 2A1DB 1J8AA 1UVUH 1D3DB 1WTGH 1K9OE 1UTOA 2R2MB 1O2RA 1O3FA 3BTEE 1HAZB 4B2AA 1YYY1 1O2ZA 2ZDLA 4MVNA 1QHRB 3RXBA 5L30H 4BTIB 1HAGE 2A31A 3EA7A 3M7UA 2SNVA 1QRWA 3RXOA 1PQ8A 3RXFA 1LVMA 3IWMA 5FCKA 1Y5AT 4ISHH 4WVPE 3O8BA 1X7AC 5JB9S 4X6OA 5DGJA 1YPKH 5JDUB 1HAVA 1YPEH 1ZGVA 5HM9A 3SGQE 1KSNA 2RA3A 2Y7ZA 2ZGCA 2ZHDA 1Y8TA 4OS6A 7GCHF 4B1TA 1GL0E 2O9QA 4JZEH 3KF2A 1Y59T 1FY8E 1V2ST 1O3GA 2Z9IA 1PPCE 1VCPA 2BVSH 3T25A 1VITH 2FOFA 1O3JA 3RXGA 1L0ZA 3QDZB 4X8SH 2VGCB 1K21H 3LC3A 1O37A 3AW1A 4TY7A 2G51A 3GCNA 3ESTA 4YOGA 3CS7A 1XKAC 1AVXA 1GVKB 2C93B 3HK6B 2BXTH 4I7YH 1FY5A 1A61H 1Z1JA 5GPIB 3VB7A 1DPOA 4UDWH 1GJ6A 1ABIH 3RLWH 3TH4H 3ZVBA 4GLYA 1C1NA 5EQRA 4ZUHA 3ODFA 1F0TA 2G5NA 5FPYA 4RSPA 4RKOB 5BPEA 2TIOA 3ZZ8A 1WQSA 1MQ6A 5K7RA 1DE7H 3GCTG 1QJ7B 3GCOA 1QRZA 2CMYA 4HFPB 1T7CA 1FONA 2VIDA 2G81E 1MUEB 1O5BB 1UCYH 3GY2A 3MO3A 1FY4A 1UTPA 2JKHA 3QZQA 1QQ4A 2XBXA 2TPIZ 3K6YA 2Y6TA 1DSTA 2OCVB 1AZZA 5DP8A 4Y8ZA 3V7TA 1HJAC 4FVBA 2KAIA 2FOCA 4ZROA 1A46H 3GYLB 1MTSA 3Q3YA 1EP6A 3Q3XA 1XXFA 4X8UH 3T27A 3BTGE 4KELA 1ZTLA 4X6PA 1S0QA 3H7OA 1LHFH 1GBIA 4NG9H 1RD3B 1QL9A 3SQHE 3U8OH 1PYTC 1S6FA 1RGQA 1GGDB 3RXIA 1C9PA 1TAWA 1FIZA 1LPKB 2XBWA 2Y5GA 3UPEA 3SJKA 1AFQB 1V2QT 3RXQA 4KP0A 3TPIZ 5A2MH 1W8BH 2QA9E 1SG8B 2Z3EA 4IN1A 5GCHG 5T6GA 1YLCA 1O32A 2O8TA 1EJAA 1FNIA 1GMHG 1C9TA 4AFZA 3RU4D 1Y3UA 2D1JA 3P8GA 3RXCA 4XBBA 3M5NA 4YM9A 1P9SA 3ZVFA 2A7CA 1TONA 6CHAC 5LPFA 2SGAA 4IMZA 2CN0H 4UFEH 2Y5HA 4KTSA 2BD3A 1V2JT 3PLPA 1FV9A 3SNCA 3ATLA 2FP7B 5EW1H 1TB6H 1DWEH 2OBQA 1BMMH 3D65E 1GJDB 1KXDA 3SJ9A 1C5PA 1F5LA 1C2EA 1V6DA 3LDXH 1ELFA 2A2QH 1CU1A 3AVZA 3RXTA 2VIVA 1C2DA 1ZHMA 2TBSA 1ZPBA 4MLFB 2XNIA 1F0UA 4X2VA 1RTLA 1AZ8A 2XC4A 1BHXF 8ESTE 4JK5A 1SGYE 2VNTA 4X1QU 2VWMA 2XWAA 1C2LA 1C5LH 1TPAE 1JIMA 3RXEA 2BLQA 1ABJH 1C1MA 1D6RA 2H5DA 3ZV9A 5DP9A 1A0HB 1TRMA 2ZC9H 4LZ1H 3M37A 3LT3A 4YLUA 2ZTYA 2BD8A 1MU6B 4H6SB 1UVSH 2QXJA 9LPRA 1QB9A 4CBOA 2AERH 2Y5FA 3RUOA 2SFAA 1O2IA 3PTBA 3P8FA 2HPPH 3PO1C 2W3IA 2XRCA 3LGIA 1RJXB 5F6MA 1QY6A 1TGCA 1XXDA 3A8BA 1Z1IA 1ZYOA 1ESTA 2A4QA 1LHCH 1IQFA 4FVDA 1EOJA 5EOKA 1EZXC 1MKWK 4NZLA 3T26A 4JK6A 1SGCA 1FIWA 2ZTXA 2FI5E 1BZXE 1OYTH 3S9AA 1V2MT 2Z9KA 1MAXA 2ZG0H 1PPFE 1PFXC 1QA7A 1TNLA 2F9PA 1C5OH 1QB6A 1FAXA 2PTCE 2SGPE 1BT7A 1NRQH 4FUBA 1LHDH 1O3EA 2QF3A 2CF9H 3SBKA 5EU8A 1TQ0B 3SOSA 1GJCB 1P2JA 2ZHEH 1DXPA 2BD2A 1GJ5H 4JCNA 2ILNA 1HRTH 2ZZUH 4CR9A 5F8XA 1KTTB 4FUGA 3I29A 1B0FA 2FLBH 1Z6JH 4A5TS 1FQ3A 2PV9B 1OWDA 2B9LA 2P94A 4A1XA 2C90B 1TALA 1O3KA 3NKKA 2PHBA 4XDEA 1SR5C 4YTAA 1XUHA 2H9TH 1D6WA 3TK9A 4IGDA 2VVVA 4O9VA 4F4OC 1TABE 3ZZCA 2AFQB 1HUTH 2FOAA 1G3CA 4Y0ZE 1EASA 1NRNH 2VB0A 1CT2E 3ZZ3A 2B7DH 2Z9GA 1TNGA 2PWXA 1P01A 2OUAA 3PMHB 2PTNA 3PV4A 3TIUA 3HGNA 4DG4A 1AVGH 1CA0C 1FN6A 2OINA 4TPYA 1UTKA 1SGDE 2LPRA 1W2KH 1O5EH 3FFGA 4FUIA 1JBUH 1Y5UT 7GCHG 4AX9H 3A7WA 3F9FA 1WAYB 2GV7A 4OS4A 5GIBA 8KME2 4GVUA 3O8CA 1IQKA 2P16A 4X1NU 3SU3A 3I78A 1UTLM 2F3CE 2G8TA 3RXPA 2PKSC 1UTMA 2NU1E 1C4Y2 3TJOA 1UK2A 2BDIA 2FX4A 2UUJB 1BRAA 2J38A 4X1RU 3EDXB 1ZHRA 1P57B 1GBJA 2G4TA 3M61U 4LXBH 3SZNA 1QNJA 2HPQH 5HMAA 1TX6A 3PLKA 4LOYH 4FU8A 4TPIZ 1TMUH 1TNHA 4R0IA 1J15A 2TGAA 2WPHS 3HPTB 1SBWA 4ABDA 1AD8H 1S85A 1ZLRA 3LH3A 3DD2H 1CQQA 7LPRA 4Q7ZA 6CHAB 2BDGA 1AQ7A 1SC8U 1YCPK 4ZKSU 4INKA 2EC9H 3SU5A 4RN6A 1DWDH 1SGQE 1FN8A 2V3OH 1SGEE 4FUFA 1Y3WA 2GCTB 3R0FA 2C8XB 1C1QA 3SV7A 1KXFA 1AVWA 4E7NA 2F9BH 1HAOH 1YF4A 1DUEA 1VJAU 2FPZA 1C5QA 1DY8A 2FS8A 1NFWA 3GDSA 3A82A 1GWAA 2Z94A 1T8NA 1O2SA 4ABAA 1PQ7A 2BOHB 2Q6DA 2XW9A 2VWOA 2ZU4A 4K1TA 4B71A 4JYVH 4UFDH 1BMNH 4NA7A 1D3TB 1ELEE 1ESBA 4J2YB 1EKBB 4ZXYH 2F83A 2BZAA 1GI8B 3SHAH 4X2XA 5EGMA 2FM2A 2WPKS 4K2YA 3D23A 1GBMA 2NU2E 2PGBB 1W12U 2OBOA 4A7IB 1GI6A 2ZHFH 3BSQA 1RTFB 2GV6A 1GMHF 1QQUA 3DHKH 1W3CA 2Q6FA 3RM0H 3VB4A 2WYJA 4Q7XA 2ZHQH 4ISIH 5ETXA 1BHXB 1DWCH 2FS9A 4YOIA 1GL1A 3OSYA 1NU7B 1TX7A 4XOJA 3S0NA 4OS7A 3VB6A 3RDZA 3ODDA 3O8RA 4E7RG 2TGDA 2EI6A 3URCA 1NRRH 2PW8H 4INHA 1YPLH 3LJJA 2GGVB 1GCTB 4TY6A 4YLQH 3GISB 2ZDAH 2GX4A 5FHTA 4GSOA 4CRGA 4HZHA 1CBWC 1KLIH 2RDLA 1C2IA 1GBLA 1THRH 2BDAA 1TA2A 2FYRA 1L4ZA 2AGEX 2TGPZ 2NWNA 3MNXA 4YT7H 5AHGH 2UUKB 3RC5A 1GI2A 5C1UA 1P2NA 2M5TA 3BF6H 1O5GH 5GDSH 1O3PB 2PKAB 3SN8A 2EI8A 3RXRA 4XBCA 1OXGA 5CE1A 3WY8A 4X6NA 3ZVCA 2BY8X 1SFIA 4VGCC 4NWKA 5JPMH 2GVFA 2GZ8A 2Z9JA 2BD7A 1INCA 2FMJA 1P05A 1TLDA 3MHWU 1GDQA 1DVAH 4ISOA 1Z71A 2PFEA 1BBRH 1PJPA 1LTOA 1P9UA 5EPNA 3W95A 1O2PA 1YC0A 2Z9LA 2OLGA 3U1JB 3OTJE 3A7XA 4NIYA 3QTOH 2XBYA 2EEKA 3K6ZA 2GZ7A 3A83A 1NTPA 3TITA 4HI3A 1GJBB 1O36A 1C2GA 1FPCH 1AWHB 1ZSLA 1O2YA 8LPRA 1FY3A 3QX5H 1SQAA 2CHAC 2F9UA 2GCHG 3Q3KA 5C20A 1V2KT 1EAXA 2J94A 5SGAE 1H4WA 5E8EH 3B9FH 4X8TH 1AWFH 1MH0A 3U1IB 1H9LB 2W5EA 5DKMA 5L2ZH 4K8YA 4I8HA 5L6NH 5I25A 3F68H 4D7FA 1ANEA 1O2TA 1O3HA 2HNTF 1SOTA 5H4IB 1HXEH 4Y7BA 3BTWE 4U32A 2PKSB 2SGFE 2DUCA 3U69H 1BRBE 1ESAA 2THFB 1OSSA 1TMBH 2W7UA 3UWJH 4D8NA 2EI7A 2AYWA 4FUCA 1O3MA 4E06H 1UMAH 2ZGXH 4BANB 1A0LA 2HOBA 4AYVB 1GHXH 3TK6A 3S69A 1EPTB 1MU8B 2AMPA 4DIIH 1V2PT 1UK4A 2HNTC 5IDKA 1TBQH 4GCHG 3UR6A 1QURH 1K1IA 2A4GA 1M9UA 1K2I1 1O2KA 4H4FA 3UWIA 1BRUP 1Z8RA 1PQAA 3MNCA 4J1YA 4DJZB 3E0NB 3STIA 4I8JA 1T32A 1DM4B 2J95A 3ZV8A 1LCYA 1O2NA 1HAYB 1O2LA 2FO9A 1W7GH 3P17H 4O03A 4YO9A 1SLWB 1V2OT 3M36A 2A32A 4MNYA 2BB4A 3M3SA 3P92A 1EJNA 1QL8A 2A5AA 2AGGX 5EG4A 4DURA 1NT1A 1P8VC 3BV9B 4DY7B 1XVOA 1FJSA 1N1LA
chains in the Genus database with same CATH superfamily
4Y6DA 1LVOA 1QTFA 1ELTA 2ZWLH 5DP3A 1TGBA 4ZAEA 1IAUA 2BM2A 2QCYA 4P02A 1P2KA 1TNJA 1ID5H 3SJ8A 2FIRH 1BTHH 2ZDKA 2BX4A 2C4FH 3FANA 1B7XB 1T31A 3BTHE 1CGJE 5EXNA 3F9GA 5A0AE 3A81A 1AKSB 3P8NA 1SQTA 4NCYA 1P12E 1D9IA 2JJ1D 4WMDA 3ZZ5A 1BQYA 1H9IE 1TGSZ 4NSVA 2XXLA 2VINA 1EAWA 1PPEE 3B8JA 4K60A 3EGKH 3TGJE 1Z8GA 3PWBA 2F9OA 1N8OC 5PTPA 1K1JA 2BLVA 3GOVB 1K1MA 5G4BA 3JZ1B 1SI5H 3SGAE 1AE5A 1NC6A 1LHEH 1O2OA 2F9NA 3SQEE 3UUZA 1NZQH 3TLOA 2WINI 5DSFA 1C5MD 4BAKB 3RXVA 2HNTE 1V2WT 4AGKA 1KTSB 1KDQB 3LGUA 1GJAB 1P2QA 1O2QA 1ZTJA 3UR9A 3TNTA 1UK3A 2PSXA 1O2UA 1NO9H 1Y3VA 1NROH 3S9CA 1D3PB 2ZEBA 3FO8D 1OKXA 2O8MA 1CBWB 3RC4A 4X6MA 4WMFA 1S82A 3E90B 2CGAA 1L1NA 1V2NT 3M5MA 4WH8A 2ZNKH 5EXMA 2SGEE 1ZMJA 2IN2A 5C67A 2SNWA 1GBHA 1GJ9B 1GBBA 1K28D 1P09A 2C3SA 2VWLA 1TWXB 2P8OB 3L3TA 4JYUH 5FXLA 1NFXA 1SMFE 4R8TB 4AYYB 3KEEA 2IJOB 1SOZA 3LGTA 4VGCB 4I32A 3S9BA 2F9VA 1WSSH 1ANBA 1P3CA 1ACBE 3PMBB 3QWCH 4B74A 2Y7XA 3EYDA 1F92A 4O3TA 5ESTE 2QXGA 1GHYH 1P06A 5FPTA 2HLCA 1XUJA 1CO7E 2CF8H 1EUFA 3FKSD 3PWCA 4K69A 1T8LA 5TJXA 5A09A 2PUXB 1V2RT 1LPZB 3GY7A 4FUHA 2BZ6H 2DE8A 1GMCF 1RIWC 3LONA 1DFPA 2ZHWH 4FU7A 2BXUH 3VGCC 3UQVA 4X1PU 1IQMA 2FOGA 2CHAB 1FDPA 2P93A 1UO6A 3UNSA 5JBTA 4DW2U 2BX3A 1MD8A 2FX6A 4Y10E 3ZVGA 4O97A 5C0UA 1GI1A 3T62A 1T4VH 2B5TB 4RT0A 4KGAA 2V3MA 2DE9A 5DP6A 4D9RA 1MBQA 3MU5A 1EZQA 1OWEA 2AMDA 4BOHA 3BN9A 2FOEA 2GMTC 3LGWA 1MKXH 3UQOA 1DOJA 3L33A 2STBE 1BBRK 5HYOA 1A5IA 3AK5A 1O3CA 2WZQA 4JZIA 2VIOA 3RM2H 2PR3A 1J14A 4XBDA 2FI3E 1TPSA 1WOFA 5LPRA 3SO3A 3HKJB 2AEIH 2K0QA 4IC5A 3M3TA 3A88A 2RDEA 3PROA 4PROA 1AU8A 1C2KA 1DITH 1QR3E 3SZEA 3S7KB 4Q2KA 1F2SE 1ANDA 1C5SA 2R9PA 3MQKC 1GMDF 1YPGH 3E16B 3SU1A 1EP5A 2K8IA 1G3EA 3ELAH 1GHWH 1XX9A 2KCOA 4Y7AA 1OS8A 1C2JA 3OYPA 1GPZA 1ZSJA 1BB0B 1NBMD 3SV9A 1IQEA 2A7JA 4AZ2B 2G00A 2ZFPH 1SLUB 4Y0YE 3HKIB 1TPPA 2HVXA 4O3UA 4XE4A 3RU4E 1O3IA 2GCHF 1W13U 1P3EA 3UB0A 1THSH 2CK3D 2JH0D 1MABB 3OX7U 2HRVA 2R0KA 4XFQA 3MU0A 1Y3XA 2QY0B 1O3DA 2VJ1A 1O3OA 3A86A 1MTWA 3ATIA 3ATMA 4ISLA 2ZFQH 1TOCB 2AIQA 2OC1A 4Z0KA 1AUTC 1C5ZB 1XKBC 2ZIQH 1DSUA 1SVPA 3EAJA 1KXCA 1AE8H 5LH8A 1C2HA 2JH6D 4CH8B 1T8OA 3SNEA 1V2LT 1C5RA 2PLXA 2ZDMA 1G32B 1KLJH 3DSPA 1CHOG 1XUKA 1O2MA 4Y8YA 4K1EA 4AG2A 5FPSA 1W0ZU 1UCYE 1ZR0A 4CHAC 2QXHA 2CV3A 4THNH 1TPOA 3CP7A 2CXVA 2V3HH 1TIOA 2R3UA 4OGXA 1QBVH 4WF8A 3A84A 4LZ4B 2PSYA 2W26A 1UVPA 2ZI2H 3BTKE 5E0JA 3RXDA 2STAE 2D8WA 3RXAA 4GCHF 4BAMB 2SGDE 3K9XB 3BTFE 3U98H 2P3TB 3GY4A 1G30B 1N8OB 2BDYA 1SQOA 4WXVA 3A89A 1JRTA 5T6DA 3NUMA 2ZDVH 3MTYA 5EXLA 1EQ9A 4FXGH 4MTBA 4OS2A 4AB9A 2YOLA 2VBCA 1G36A 2LNCA 1IHSH 2VH0A 2WYGA 4A92A 4MPUA 4AN7A 4ZXXH 3QO6A 4KKDA 2FOBA 3BIUH 1F0SA 2XCNA 4AFQA 1YPHC 3FN8A 2L6OA 1HJAB 1AHTH 1SSXA 3MH6A 2XCFA 4IBLH 4OM9A 3V13A 1Y3YA 1NN6A 3CS0A 3M7QA 1HIAB 1GBEA 2BLWA 4H42U 1GBKA 1D3QB 1ARBA 1O5CB 2XWBI 1MD7A 2I6QA 1N6YA 5F8TA 5L2YH 3LJOA 2GTBA 3TJVA 4BTUB 3E3TA 1O2GH 3AW0A 4ZHAA 1GI0A 4WMEA 3RXKA 2IJD1 1HAHH 5AFYH 4F49A 1MTVA 2G4UA 1GVLA 2PKAA 4U30A 3C1KA 3CENA 4I33A 2ZFTA 5T1VA 4NZQA 1NFYA 1A5HA 3HGPA 4AG1A 2BQ6B 1HBTH 2B8OH 2D26C 3SJOA 3A80A 3SNBA 3MU4A 1IQLA 3F1SB 3MNBA 5TCAA 3T28A 1OYQA 2ALPA 1JIRA 3A87A 1WU1A 2TRMA 4M7GA 1UCYK 1ARCA 1RIWB 1YPJH 2O8UA 3SU6A 1KY9A 2ZU2A 1FLEE 3VGCB 3B23B 1OHHD 5CHBA 1EAIA 2BQ7B 3EQ0H 2YMSC 5KGOA 5BRRE 3IG6B 1ZPZA 5E2PA 2BD4A 2GDEH 4K1SA 3NZIA 1Z8JB 1C4U2 1HAXB 1VITG 2L74A 2WV4A 1IOEA 3OY5U 1ZPCA 1DXWA 1V2TT 1NY22 1W14U 2BVXH 2QE7D 2ANMH 1ETTH 2Z3CA 2ZCHP 3DFLA 2FWWA 1A7SA 4Y71A 1W10U 5A8XA 4YT6H 3OU0A 3SI4H 3KL6A 2H1UA 3SV2H 2GMTB 3VPKA 1OPHB 1ELAA 5DN6D 1HFDA 2ODQA 3L6PA 4A1VA 3RMLH 3A7VA 4OS1A 1YPHE 3AAUA 2VVCA 1C5UA 3KQCA 1TMTH 1QJ1B 1PQ5A 2PGQB 3FZDA 2J34A 1ZGIA 1ZZZA 3NPSA 4Y11E 1J9CH 1FUJA 3BTTE 5DJ7A 3RC6A 3BEIB 4F55A 4NIXA 3I77A 4ABFA 1JOUB 1ZRBA 4DGJA 1NPMA 3MU1A 1Y5BT 1XUFA 1VR1H 1C1WH 3UAIC 3SU0A 4GHTA 2UWOA 3PO1B 1GMCG 2A7HA 4DIHH 2UUFB 1EPTA 1YBWA 2ZPRA 3LC5A 3UNQA 3H7TA 3QZRA 2ZGJA 3GS9A 3BEFB 2A2XH 1GJ4H 3RXLA 3ZZ9A 2ZGHA 1P2MA 1L4DA 2ZFSA 3MOCA 2AMQA 3UREA 2G5VA 5CDFE 1K1NA 1E38B 1HNEE 2Y82A 3LOXA 1O35A 2BY7X 3UOUA 3H09A 5DPAA 3SNDA 1HJ9A 2A5KA 3RXSA 4CREA 3P70B 2W7SA 2ZU1A 4UEHH 4UD9H 2BTCE 1BRCE 3BIVH 2ZKSA 2JJ2D 4CRBA 2A0QB 2C8WB 2GJGA 4MDSA 2YNAA 1QB1A 1U6QA 1SGFG 5C94A 1ORFA 4CHAB 2BD5A 1K1LA 1MCTA 1CE5A 1K22H 2ANWA 2VIPA 1CT4E 3C27B 3U28C 1JRSA 3MO9A 1GMDG 1XUIA 2F43B 2HGTH 3H5CB 3FP8E 1P02A 1DT2A 4K5ZA 1L1GA 2GT7A 1MZAA 1ANCA 3SV6A 5EIYA 4B2BA 4ABIA 1S0RA 1EJMA 3KHVA 3QTVH 1AKSA 1Z8IB 2XOKD 1VZQH 3QGNB 1F5KU 2WUCA 3ZZAA 3BTQE 4BTTB 3KQEA 4MNVA 4GAWA 3TNSA 1DANH 3W94A 4B2CA 5EJ1A 3SUEA 3SW2B 1BJUA 1CA0B 4SGBE 1LMWB 4LK4A 3UNRA 1EXFA 1BTPA 2UUYA 4DVAU 5HIYA 1C1SA 3KIDU 2D2DA 4NIWA 1ELVA 5E0HA 4OGYA 1KDQA 2ANYA 1BTYA 5DP4A 4IW4E 2QGRA 4NA9H 5JYIA 2KX4A 4B73A 1A3BH 2FESH 3KYFA 2F91A 1MBMA 2FYQA 5E0GA 2UWPA 1YP9A 1SHYA 3Q76A 3N99A 2GZ9A 1KXEA 1LO6A 2OC0A 2VVUA 1N6XA 1ETRH 1SFQB 2ZFFH 5B6OA 8GCHG 1MQ5A 2ALVA 3TK5A 1CHOF 3OY6U 5JBAS 1GHBF 2J92A 3LIWA 2J97A 1LVYA 2Z6BD 1QBNA 1LVBA 3TU7H 4D7GA 3AAVA 4UFGH 2UWLA 1CVWH 2R2WU 1RS0A 3KGPA 5JBCS 2HWLB 2GP9B 2ZU5A 3O8DA 1C5TA 4YESB 2SGQE 1G2LA 2XC5A 4CRDA 2XTTB 1GI3A 2V0BA 3QGJA 1BJVA 3QK1A 1LHGH 6LPRA 1UHBB 4D76A 1OP2A 1AN1E 1O3NA 2OP9A 1SGPE 1YGCH 1TRYA 1EFRD 1GI9B 3DUXH 1MTNC 2YMSB 5F8ZA 4ABGA 1C1RA 3N7OA 3VB3A 3SORA 1C5NH 1KMHB 3QUMP 4HTCH 4ASHA 2ZDNA 1EOLA 4UONA 1TFXA 2ESTE 3U8RH 1W7XH 3F2FA 3KNXA 1H8IH 1KXBA 1UTJA 3GY3A 4JZFH 3SNAA 3V3MA 3MH5A 9ESTA 1DUAA 4TWYA 5EODA 1NRPH 3BEUA 2OD3B 1Q31A 1LPGB 3QN7A 2O8WA 3P8OA 2K1QA 4BAOB 1QGFA 2ZFRH 5C2ZA 5FBEA 1K0HA 1C1UH 1HAIH 1RTKA 3NK8A 4GHQA 2BYAX 1AGJA 1MCVA 1UTQA 2QXIA 3LH1A 1ZOMA 3M35A 1EB1H 1CHGA 4ABHA 4XSKU 1B0EA 1E35B 1GI7B 5FL7D 2H9EH 5C3NA 2IOTA 1HJ8A 1HLTH 1WQVH 5JBBS 1G3DA 1AMHA 6ESTA 2FZZA 5TCCA 3T5FH 1P2OA 1SPJA 2PP6A 5GXPA 1O31A 2NU3E 1QCPA 3FZZA 3JZ2B 3MFJA 4FU9A 1Z6EA 4FUEA 1C1OA 3KQDA 4ABEA 5FBIA 2BY5X 1YLDA 2RCEA 4E05H 3HATH 5T3HA 4ESTE 2NU0E 1C1PA 3UTUH 1OWIA 2H9HA 3K2UA 3NXPA 4U01A 5HM2A 5JB8S 2WSSD 4I8LA 1ZJKA 1BBRE 1SGTA 4MPXA 2ZCLP 3ZZ4A 1AB9C 2Q1JA 5AVDA 4NIVA 1GHAG 1A3EH 6GCHG 2RA0A 4UFFH 1VITF 1O3AA 3G01A 1DWBH 1L1JA 1HAPH 3A7YA 3TH2H 2VH6A 3D49H 2HALA 1XM1A 2ZGBH 4B6EA 1GVZA 2H5CA 1GHZA 4HGCA 4BXSA 5C1XA 1YCPH 2BDBA 1DICA 1GBCA 3E8LA 4CR5A 4DT7B 3LGYA 1CGHA 1K1OA 3SHCH 2JETC 1G37A 3VEQB 1E34B 1YLNA 2V7QD 3TVJB 1GI5A 4ZHMU 2QF0A 4DOQA 1PYTD 3RMMH 1TBRH 4FUJA 1V3XA 3EE7A 3BG8A 5LGOA 2BDHA 5CMXH 3FVFB 2OC8A 4HG6A 4UE7H 2FDAA 1KXAA 1C5VA 4QT8C 1P10A 3P95A 3F3BA 5FAHA 1UJ1A 3SV8A 2Z3DA 2VU8E 3VFEA 5GJ4B 5C1YA 2WPIS 3LKWA 2OTVA 2BY6X 1S5SA 3RP2A 3SU4A 2FTLE 3MNSA 3R3GB 1S6LA 4CRFA 1WUNH 1HGTH 1DLEA 4GPGA 1RXPA 2ZQ2A 3K65B 1WCZA 1LKBA 5EQQA 4RI0A 1E37B 2F4LA 1C1VH 1FI8A 2ULLA 1O34A 2XNDD 4RKJB 2WPLS 1RFNA 2OXSA 3GY5A 3M5OA 1WXRA 3D62A 3DA9B 4Z6AH 2Q6GA 1W11U 4IN2A 1H8DH 2OC7A 1FX0B 4AGJA 1UW7A 1EZSC 5C5OA 2QYIA 1HAVB 2P59A 1NU9A 2GCTC 5DO4H 1TX8A 4FOUC 3RMOH 1TOMH 3V0XA 4A1TA 3DFJA 4FUDA 1S6HA 2JH5D 3T29A 2BOKA 2I6SA 2A4OA 1TBZH 1NFUA 1LDTT 7KMEH 1A0JA 3BTDE 1DDJA 1HIAA 5J4QA 3KYGA 3ZZBA 1FAKH 4ACAA 2FTMA 1QA0A 5FX5A 4M9FA 2OK5A 2J9NA 1C2FA 1AI8H 1VGCC 3F2HA 2VIWA 3GYMA 1CSOE 4B75A 1ZMLA 1P11E 5DP5A 3FP6E 5HIZA 1WV7H 4JZDH 1AO5A 2FEQH 5F03A 1GG6C 3EA9A 1C5WB 1G2MA 1O5FH 1A4WH 1GI4A 3UOPA 4AFUA 1BMLA 3PMJA 3Q77A 1W0YH 4WWYA 3IITA 4ABBA 4ABJA 1YM0A 1MMJN 1S84A 1ZJDA 4WXIA 1C1TA 3S7HB 1SGRE 4WY3A 3GICB 5B6LA 5CHAC 2P3FH 1TNIA 5HGGA 4A6LA 1MTNB 3GY8A 3MH7A 1GJ8B 1OP0A 2QF4A 1DS2E 1SGNE 3BTME 3GDVA 1H9HE 1AFEH 3RU4T 3E1XB 1C5YB 3DT0H 3LGVA 1G3BA 1EX3A 1GJ7B 1TQ7B 4NA8A 3M3VA 1E79D 1F7ZA 1O2VA 1C5XB 1RRKA 1KYNA 3NRLA 2QC2A 4ISNA 5GWZA 5ESBA 2Z7FE 1LQEA 1FPHH 3BG4C 3RXUA 2KAIB 3MMGA 2ZTZA 1GCTC 1P03A 1GDUA 2P95A 1HCGA 2XYAA 1SLVB 2WPDD 1T8MA 3PYHA 1GHBG 4Y8XA 4BNRA 1F5RA 1L2EA 2EY4C 8GCHF 3TH3H 3PMAB 3ITIA 3ZZ7A 1ZMNA 4NFFA 2KFWA 1CT0E 4MG3A 2BLOA 2ODPA 3F9HA 1ZTKA 1FMGA 1FY1A 1TRNA 1J17T 3A8AA 2FOHA 2QIQA 4AORA 2EQNA 3RXMA 3HK3B 3F6UH 3QLPH 3E6PH 1OP8A 4Q4LA 2ZA5A 1O2HA 3EE0B 3VB5A 5J4SA 1WDIA 2R0LA 3ZVEA 3A8CA 4BXWA 3GCHC 3PB1E 1MZDA 4I8GA 1NESE 5IK2D 1AB9B 2WUBA 3E91A 1EATA 4JZ1A 1V2VT 1SL3A 2FXRA 2AIPA 3TGKE 3STJA 4AFSA 1SKYE 4Y76A 3UFAA 3LU9B 4MQAA 1SGFA 3M5LA 1NBME 1BIOA 2QAAA 2WV5A 3E0PB 4ZMAH 1OWHA 5E2OA 2A4RA 1HXFH 5EW2H 1ETSH 2O8LA 1FXYA 2YNBA 2ZPSA 1HPGA 2ZQ1A 3U8TH 1O39A 3PM3A 1G9IE 1GDNA 1QBOA 4JMYA 1SLXB 3VXEH 2BDCA 3ZYEA 5HXFA 3KCGH 2JETB 3EA8A 2V35A 5ABWA 4NGAH 4Q7YA 4MPWA 1YKTA 3LPRA 2ZPQA 4TWWA 2C8ZB 1MAYA 1THPB 1ZRKA 2J98B 7ESTE 5A8ZA 1WTHD 2B0FA 4TSFD 1BTZA 1BA8B 2H2ZA 2Y81A 1PPHE 1C4V2 3GY6A 3SI3H 2ZO3H 1IQHA 4MNXA 1DLKB 1BUIA 1QZ8A 4B76A 1Z7KA 1IQIA 3RMNH 1GBFA 1BMAA 1J16A 4OS5A 1EPTC 2HVYB 3F9EA 2ZECA 2Y80A 5A8YA 1TNKA 5DG6A 2RG3A 3MO6A 3PLBA 2GDDA 2P3UB 3MWIU 3ATWA 3T2NA 3MYWA 5FX6A 1GHAF 5DP7A 6GCHF 4CRCA 4IS5A 1SGIB 3ZZ6A 2VIQA 4Q80A 1XMNB 3PTNA 3GCTF 1E0FD 1PPBH 4X2WA 1BITA 1NM6A 1E36B 1LQDB 1O5AB 1P0SH 1ZHPA 1XUGA 2AS9A 5A0BA 5K0HA 2C8YB 3RXHA 1WBGB 4BAHB 1A2CH 1CGIE 1HDTH 4ZKNU 1IQGA 1GBTA 4CRAA 2WPMS 3VXFH 1UVTH 2WPJS 2GKVE 1VGCB 1OOKB 3NCLA 1QFKH 3KQBA 2IPHA 3ZYDA 1GG6B 5AFZH 3A7TA 2AGIX 2J4IA 4K3JA 2VGCC 1Q3XA 1TA6A 2V6NA 5C5NA 2XBVA 4YXWD 3SU2A 1DX5M 2H6MA 1O30A 3FP7E 4Y79A 1IQJA 1BCUH 3OEED 3AASA 3F0OA 4U2WA 1ELCA 2W3KA 1O38A 2NU4E 3TJUA 4YOJA 3SGBE 5GCHF 1AY6H 4BAQB 5CHAB 5C17A 2FODA 1UHBA 1F0RA 2AH4X 2W6ID 4MNWA 5EQSA 1UVOA 1A5GH 1C2MA 1PPZA 3SUDA 1MKXK 2VWNA 1XVMA 2EA3A 3SUFA 1B5GH 4GUXA 1O2WA 2QV1A 4WJG2 1TE0A 5EJLA 1S81A 5FCRA 1OWKA 2FOMB 1CA8B 3BG4B 3U9AH 1TGNA 3P6ZB 2A45B 1AUJA 1QIXB 3Q00A 3ATKA 3MI4A 3MH4A 1GBAA 1JMOH 3A7ZA 1P2IA 4X2YA 2BMGB 5A0CA 1DY9A 2XC0A 5T6FA 1IHTH 1ZSKA 2ZP0H 4ZKRU 1PPGE 4P00A 5EPYA 1UTNA 1O0DH 1KIGH 1SHHB 1Q2WA 4I8KA 3SUGA 1VCWA 1BTWA 4CH2B 2P8OC 1BDAA 2BD9A 1BTUA 1KLTA 5EJZA 1GGDC 1VCQA 1TYNA 3M7TA 4NWLA 2G55A 2GT8A 4ZCNA 1GBDA 4KTCA 4ZHLU 1AFQC 1S83A 1EZUC 3RXJA 4IC6A 5AF9H 4CBNA 4X0WU 1HV7A 4TYDA 4AB8A 2G52A 1NS3A 2WV9A 4DCDA 1WYKA 4IMQA 1ELGA 3URDA 4ACBA 2QN5T 3TJNA 3MU8A 4WH6A 3WW7A 1VJ9U 1GHVH 3GCHB 1QRXA 5DK1A 5LPEA 1O33A 3FAOA 1K1PA 2A5IA 3A85A 2R3YA 4K8BA 2CJIA 1BOQA 5IYTA 2FLRH 1HB0B 2OQ5A 4ZH8A 1T4UH 1BTXA 3A8DA 1AIXH 2BVRH 2PUQH 4SGAE 2ZCKP 2ANKH 4YZUA 1E1RD 2ZU3A 3ZVAA 4D9QA 1O2JA 2KM0A 4I31A 4X8VH 4MPVA 1EB2A 1FZZA 1MKWH 3KN2A 3UIRA 4H6TA 2OQUA 1JWTA 3OAAD 1D4PB 3SJIA 4X1SU 4ZKOU 4KTUA 1OX1A 1QJ6B 1HYLA 1H1BA 1O3LA 1OWJA 3RLYH 4NSYA 3V12A 1P04A 2BHGA 1GCDA 1LKAA 1YCPM 1A1RA 2J2UA 2TGTA 1YPMH 2ODYB 4INLA 1ELDE 1MTUA 3TGIE 4AOQA 1W0JD 2BY9X 1QL7A 1O5DH 1IQNA 3ZZDA 3UY9A 1TGTA 1SB1H 2FI4E 4JYTA 1NRSH 3ZVDA 3CNRA 1O3BA 2GD4B 3GDUA 4NFEA 5I46H 1O2XA 1V2UT 2ZF0H 1EAUA 2BQWB 3ENSB 1ELBA 1JXPA 2ASUB 2A1DB 1J8AA 1UVUH 1D3DB 1WTGH 1K9OE 1UTOA 2R2MB 1O2RA 1O3FA 3BTEE 1HAZB 4B2AA 1YYY1 1O2ZA 2ZDLA 4MVNA 4F48B 1QHRB 3RXBA 5L30H 4BTIB 1HAGE 2A31A 3EA7A 3M7UA 2SNVA 1QRWA 3RXOA 1PQ8A 3RXFA 1LVMA 4RT1A 3IWMA 5FCKA 1Y5AT 4B6FA 1YY3A 4ISHH 4WVPE 3O8BA 1X7AC 5JB9S 4X6OA 5DGJA 1YPKH 5JDUB 1HAVA 1YPEH 1ZGVA 5HM9A 3SGQE 1KSNA 2RA3A 2Y7ZA 2ZGCA 2ZHDA 1Y8TA 4OS6A 7GCHF 4B1TA 1GL0E 2O9QA 4JZEH 3KF2A 1Y59T 1FY8E 1V2ST 1O3GA 2Z9IA 1PPCE 1VCPA 2W6JD 2BVSH 3T25A 1VITH 2FOFA 1O3JA 3RXGA 1L0ZA 3QDZB 4X8SH 2VGCB 1K21H 3LC3A 1O37A 3AW1A 4TY7A 2G51A 3GCNA 3ESTA 4YOGA 3CS7A 1XKAC 1AVXA 1GVKB 2C93B 3HK6B 2BXTH 2HLDD 4I7YH 1FY5A 1A61H 1Z1JA 5GPIB 3VB7A 1DPOA 4UDWH 1GJ6A 1ABIH 3RLWH 3TH4H 3ZVBA 4GLYA 1C1NA 5EQRA 4ZUHA 3ODFA 2JDID 5C0TA 1F0TA 2G5NA 5FPYA 4RSPA 3DSGA 4RKOB 5BPEA 1YWUA 2TIOA 3ZZ8A 2KCAA 1WQSA 1MQ6A 5K7RA 1DE7H 3GCTG 1QJ7B 3GCOA 1QRZA 2CMYA 4HFPB 1T7CA 1FONA 3F0PA 2VIDA 2G81E 1MUEB 1O5BB 1UCYH 3GY2A 3MO3A 1FY4A 1UTPA 2JKHA 3QZQA 1QQ4A 2XBXA 2TPIZ 3K6YA 2Y6TA 1DSTA 2OCVB 1AZZA 5DP8A 4Y8ZA 3V7TA 1HJAC 4FVBA 2KAIA 2FOCA 4ZROA 1A46H 3GYLB 1MTSA 3Q3YA 1EP6A 3Q3XA 1XXFA 4X8UH 3T27A 3BTGE 4KELA 1ZTLA 4Q63A 4X6PA 1S0QA 3H7OA 1LHFH 1GBIA 4NG9H 1RD3B 1QL9A 3SQHE 3U8OH 1PYTC 1S6FA 2KCYA 1RGQA 3PRBA 1GGDB 3RXIA 1C9PA 2RFKC 1TAWA 1FIZA 1LPKB 2XBWA 2Y5GA 3UPEA 3F2GA 4FETA 3SJKA 1AFQB 1V2QT 3RXQA 4KP0A 3TPIZ 5A2MH 1W8BH 2QA9E 1SG8B 2Z3EA 4IN1A 5GCHG 5T6GA 2KCPA 1YLCA 1O32A 2O8TA 1EJAA 1FNIA 1GMHG 1C9TA 4AFZA 3RU4D 1Y3UA 2D1JA 3P8GA 3RXCA 4XBBA 3M5NA 4YM9A 1P9SA 3ZVFA 2A7CA 1TONA 6CHAC 2WHXA 5LPFA 2SGAA 4IMZA 2CN0H 4UFEH 2Y5HA 3OTPA 4KTSA 2BD3A 1V2JT 3PLPA 1FV9A 3SNCA 3ATLA 2FP7B 5EW1H 4I86A 1TB6H 1DWEH 2OBQA 1BMMH 3SYJA 3D65E 1GJDB 1KXDA 3SJ9A 1C5PA 1F5LA 1C2EA 1V6DA 3LDXH 1ELFA 2A2QH 1CU1A 3AVZA 3RXTA 2VIVA 1C2DA 1ZHMA 2TBSA 1ZPBA 4MLFB 3PV2A 2XNIA 1F0UA 4X2VA 1RTLA 1AZ8A 2XC4A 1BHXF 8ESTE 4JK5A 1SGYE 2VNTA 4X1QU 2VWMA 2XWAA 1C2LA 1C5LH 1TPAE 1JIMA 3RXEA 2LELA 2BLQA 1ABJH 1C1MA 1D6RA 2J98A 2H5DA 3ZV9A 5DP9A 1H8ED 1A0HB 1TRMA 2ZC9H 4LZ1H 3M37A 3LT3A 3FOAA 4YLUA 2ZTYA 2BD8A 1MU6B 4H6SB 1UVSH 4Z1MD 2QXJA 9LPRA 1QB9A 4CBOA 2AERH 2Y5FA 3RUOA 2SFAA 1O2IA 3PTBA 3P8FA 2HPPH 3PO1C 2W3IA 2XRCA 3LGIA 1RJXB 5F6MA 1QY6A 1TGCA 1XXDA 3A8BA 1Z1IA 1ZYOA 4ASUD 3DSOA 1ESTA 2A4QA 1LHCH 1IQFA 4FVDA 1EOJA 5EOKA 1EZXC 1MKWK 4NZLA 3T26A 3WWBA 4JK6A 1SGCA 1FIWA 2ZTXA 2FI5E 1BZXE 1OYTH 3S9AA 1V2MT 2Z9KA 1MAXA 2ZG0H 1PPFE 1PFXC 1QA7A 1TNLA 2F9PA 1C5OH 1QB6A 1FAXA 2PTCE 2SGPE 1BT7A 3PV5A 1NRQH 4FUBA 1LHDH 1O3EA 2QF3A 2CF9H 3SBKA 5EU8A 1H8HD 1TQ0B 1GJCB 3OEHD 3SOSA 1P2JA 2ZHEH 1DXPA 2BD2A 1GJ5H 4JCNA 2ILNA 1HRTH 2ZZUH 4CR9A 5F8XA 1KTTB 4FUGA 3I29A 1COWD 1B0FA 2FLBH 1Z6JH 4A5TS 1FQ3A 2PV9B 1OWDA 2B9LA 2P94A 4A1XA 2C90B 1TALA 1O3KA 3NKKA 2PHBA 4XDEA 1SR5C 4YTAA 1XUHA 2H9TH 1D6WA 3TK9A 4IGDA 2AHME 2VVVA 4O9VA 4F4OC 1TABE 3ZZCA 2AFQB 1HUTH 2FOAA 1G3CA 4Y0ZE 1EASA 1NRNH 2VB0A 1CT2E 3ZZ3A 2B7DH 2Z9GA 1TNGA 2PWXA 1P01A 2OUAA 3PMHB 2PTNA 3PV4A 3TIUA 3HGNA 4DG4A 1AVGH 1CA0C 1FN6A 2OINA 4TPYA 1UTKA 1SGDE 2LPRA 1W2KH 3N7DA 1O5EH 3FFGA 4FUIA 3W1EA 1JBUH 1Y5UT 7GCHG 1E1QD 4AX9H 3A7WA 3F9FA 1WAYB 2GV7A 4OS4A 5GIBA 8KME2 4GVUA 3O8CA 1IQKA 2P16A 2IPQX 4X1NU 3SU3A 3I78A 1UTLM 2F3CE 2G8TA 3RXPA 2PKSC 1UTMA 2NU1E 1C4Y2 3TJOA 1UK2A 2BDIA 2FX4A 2UUJB 1BRAA 2J38A 4X1RU 3EDXB 1ZHRA 1P57B 1GBJA 2G4TA 3M61U 4LXBH 3SZNA 1QNJA 2HPQH 5HMAA 1TX6A 3PLKA 4LOYH 4FU8A 4TPIZ 1TMUH 1TNHA 4R0IA 1J15A 2TGAA 2WPHS 3HPTB 1SBWA 4ABDA 1AD8H 1S85A 1ZLRA 3LH3A 3DD2H 1CQQA 7LPRA 4Q7ZA 6CHAB 2BDGA 1AQ7A 1SC8U 1YCPK 4ZKSU 4INKA 2EC9H 3SU5A 4RN6A 1DWDH 1SGQE 1FN8A 2YMSD 2V3OH 1SGEE 4FUFA 1Y3WA 2GCTB 3R0FA 2C8XB 1C1QA 3SV7A 1KXFA 1AVWA 3VG8A 4E7NA 2F9BH 1HAOH 5F53A 1YF4A 1DUEA 1VJAU 2FPZA 1C5QA 1DY8A 2KZ4A 2FS8A 2M2AA 1NFWA 3GDSA 4XRNA 3A82A 1GWAA 2Z94A 3PRDA 1T8NA 1O2SA 4ABAA 1PQ7A 2BOHB 2Q6DA 2XW9A 2VWOA 1SQRA 2ZU4A 4K1TA 4B71A 4JYVH 4UFDH 1BMNH 4NA7A 1D3TB 1ELEE 1ESBA 4J2YB 1EKBB 4ZXYH 2F83A 2BZAA 1GI8B 3SHAH 3WWFA 4X2XA 5EGMA 2FM2A 1BMFD 2WPKS 4K2YA 3D23A 1GBMA 2NU2E 2PGBB 1W12U 2OBOA 4A7IB 1GI6A 2ZHFH 3BSQA 1RTFB 2GV6A 1GMHF 1QQUA 3DHKH 1W3CA 2Q6FA 3RM0H 3VB4A 2WYJA 4Q7XA 2ZHQH 4ISIH 5ETXA 1BHXB 1DWCH 2FS9A 4YOIA 1GL1A 3OSYA 2KR7A 1NU7B 1TX7A 4XOJA 3S0NA 4OS7A 3VB6A 3RDZA 3ODDA 3O8RA 4E7RG 2TGDA 2EI6A 3URCA 1NRRH 2PW8H 4INHA 1YPLH 3LJJA 2GGVB 1GCTB 4TY6A 4YLQH 3GISB 2ZDAH 2GX4A 2QF5A 5FHTA 4GSOA 4CRGA 4HZHA 1CBWC 3N7EA 1KLIH 2RDLA 1C2IA 1GBLA 1THRH 2BDAA 1TA2A 2FYRA 1L4ZA 2AGEX 2TGPZ 2NWNA 3MNXA 4YT7H 5HKKD 5AHGH 2UUKB 3RC5A 1GI2A 3DCLA 1P2NA 5C1UA 2M5TA 3BF6H 1O5GH 5GDSH 1O3PB 2PKAB 3SN8A 2EI8A 3RXRA 4XBCA 1OXGA 5CE1A 3WY8A 4X6NA 3ZVCA 2BY8X 1SFIA 4VGCC 4NWKA 5JPMH 2GVFA 2GZ8A 2Z9JA 3KQ5A 2BD7A 1INCA 2FMJA 1P05A 1TLDA 3MHWU 1GDQA 1DVAH 4ISOA 1Z71A 1BBRH 1LTOA 1PJPA 1P9UA 2PFEA 5EPNA 3W95A 1O2PA 1YC0A 2Z9LA 2OLGA 3U1JB 3OTJE 3A7XA 4NIYA 3QTOH 2XBYA 2EEKA 3K6ZA 3OE7D 2GZ7A 3A83A 1NTPA 3TITA 4XD7D 4HI3A 4DT4A 1GJBB 1O36A 1C2GA 1FPCH 1AWHB 1ZSLA 1O2YA 8LPRA 1FY3A 3QX5H 1SQAA 2CHAC 2F9UA 2GCHG 3Q3KA 5C20A 1V2KT 1EAXA 2J94A 5SGAE 1H4WA 5E8EH 5GNDA 3B9FH 4X8TH 1AWFH 1MH0A 3NWUA 3U1IB 3ZIAD 1H9LB 2W5EA 5DKMA 5L2ZH 4K8YA 4I8HA 5L6NH 5I25A 3F68H 4D7FA 1ANEA 1O2TA 1O3HA 2HNTF 1SOTA 5H4IB 1HXEH 2JIZD 4Y7BA 2J5UA 3BTWE 4U32A 2PKSB 2SGFE 2DUCA 3U69H 1BRBE 1ESAA 2THFB 1OSSA 1TMBH 2W7UA 3UWJH 4D8NA 2EI7A 2AYWA 1VKYA 4FUCA 1O3MA 4E06H 1UMAH 2LP6A 2ZGXH 4BANB 1A0LA 2HOBA 4AYVB 1GHXH 3TK6A 3S69A 1EPTB 1MU8B 2AMPA 4DIIH 1V2PT 1UK4A 2HNTC 5IDKA 1TBQH 4GCHG 3UR6A 1QURH 1K1IA 2A4GA 1M9UA 1K2I1 1O2KA 4H4FA 3UWIA 1BRUP 1Z8RA 3OFND 1PQAA 3MNCA 4J1YA 4DJZB 3E0NB 3STIA 4I8JA 1T32A 1W0KD 1DM4B 2J95A 3ZV8A 1LCYA 5KECA 1O2NA 1HAYB 4AC9A 1O2LA 2FO9A 1W7GH 3P17H 4O03A 4YO9A 1SLWB 1V2OT 3M36A 2A32A 4MNYA 2BB4A 3M3SA 4TT3D 3P92A 1EJNA 1QL8A 2A5AA 2AGGX 5EG4A 4DURA 1NT1A 1P8VC 3BV9B 4DY7B 1XVOA 1FJSA 5KEDA 1N1LA
chains in the Genus database with same CATH topology
4Y6DA 1LVOA 1QTFA 1ELTA 2ZWLH 5DP3A 1TGBA 4ZAEA 1IAUA 2BM2A 2QCYA 1P2KA 1TNJA 1ID5H 3SJ8A 2FIRH 1BTHH 2ZDKA 2BX4A 2C4FH 3FANA 1B7XB 1T31A 3BTHE 1CGJE 5EXNA 3F9GA 5A0AE 3A81A 1AKSB 3P8NA 1SQTA 4NCYA 1P12E 1D9IA 4WMDA 3ZZ5A 1BQYA 1H9IE 1TGSZ 4NSVA 2XXLA 2VINA 1EAWA 1PPEE 3B8JA 4K60A 3EGKH 3TGJE 1Z8GA 3PWBA 2F9OA 1N8OC 5PTPA 1K1JA 2BLVA 3GOVB 1K1MA 5G4BA 3JZ1B 1SI5H 3SGAE 1AE5A 1NC6A 1LHEH 1O2OA 2F9NA 3SQEE 3UUZA 1NZQH 3TLOA 2WINI 4BAKB 1C5MD 3RXVA 2HNTE 1V2WT 4AGKA 1KTSB 1KDQB 3LGUA 1GJAB 1P2QA 1O2QA 1ZTJA 3UR9A 3TNTA 1UK3A 2PSXA 1O2UA 1NO9H 1Y3VA 1NROH 3S9CA 1D3PB 2ZEBA 1OKXA 2O8MA 1CBWB 3RC4A 4X6MA 4WMFA 1S82A 3E90B 2CGAA 1L1NA 1V2NT 3M5MA 4WH8A 2ZNKH 5EXMA 2SGEE 1ZMJA 2IN2A 5C67A 2SNWA 1GBHA 1GJ9B 1GBBA 1K28D 1P09A 2C3SA 2VWLA 1TWXB 2P8OB 3L3TA 4JYUH 5FXLA 1NFXA 1SMFE 4R8TB 4AYYB 3KEEA 2IJOB 1SOZA 3LGTA 4VGCB 4I32A 3S9BA 2F9VA 1WSSH 1ANBA 1P3CA 1ACBE 3PMBB 3QWCH 4B74A 2Y7XA 3EYDA 1F92A 4O3TA 5ESTE 2QXGA 1GHYH 1P06A 5FPTA 2HLCA 1XUJA 1CO7E 2CF8H 1EUFA 3PWCA 4K69A 1T8LA 5TJXA 5A09A 2PUXB 1V2RT 1LPZB 3GY7A 4FUHA 2BZ6H 2DE8A 1GMCF 1RIWC 3LONA 1DFPA 2ZHWH 4FU7A 2BXUH 3VGCC 3UQVA 4X1PU 1IQMA 2FOGA 2CHAB 1FDPA 2P93A 1UO6A 3UNSA 5JBTA 4DW2U 2BX3A 1MD8A 2FX6A 4Y10E 3ZVGA 4O97A 1GI1A 3T62A 1T4VH 2B5TB 4KGAA 2DE9A 5DP6A 4D9RA 1MBQA 3MU5A 1EZQA 1OWEA 2AMDA 4BOHA 3BN9A 2FOEA 2GMTC 3LGWA 1MKXH 3UQOA 1DOJA 3L33A 2STBE 1BBRK 5HYOA 1A5IA 1O3CA 4JZIA 2VIOA 3RM2H 2PR3A 1J14A 4XBDA 2FI3E 1TPSA 1WOFA 5LPRA 3SO3A 3HKJB 2AEIH 4IC5A 3M3TA 3A88A 3PROA 4PROA 1AU8A 1C2KA 1DITH 1QR3E 3S7KB 4Q2KA 1F2SE 1ANDA 1C5SA 2R9PA 1GMDF 1YPGH 3E16B 3SU1A 1EP5A 1G3EA 3ELAH 1GHWH 1XX9A 4Y7AA 1OS8A 1C2JA 3OYPA 1GPZA 1ZSJA 1BB0B 3SV9A 1IQEA 2A7JA 4AZ2B 2G00A 2ZFPH 1SLUB 4Y0YE 3HKIB 1TPPA 2HVXA 4O3UA 4XE4A 3RU4E 1O3IA 2GCHF 1W13U 1P3EA 1THSH 2JH0D 3OX7U 2HRVA 2R0KA 4XFQA 3MU0A 1Y3XA 2QY0B 1O3DA 2VJ1A 1O3OA 3A86A 1MTWA 3ATIA 3ATMA 4ISLA 2ZFQH 1TOCB 2AIQA 2OC1A 4Z0KA 1AUTC 1C5ZB 1XKBC 2ZIQH 1DSUA 1SVPA 3EAJA 1KXCA 1AE8H 5LH8A 1C2HA 2JH6D 4CH8B 1T8OA 3SNEA 1V2LT 1C5RA 2PLXA 2ZDMA 1G32B 1KLJH 1CHOG 1XUKA 1O2MA 4Y8YA 4K1EA 4AG2A 5FPSA 1W0ZU 1UCYE 1ZR0A 4CHAC 2QXHA 2CV3A 4THNH 1TPOA 3CP7A 2CXVA 2V3HH 1TIOA 2R3UA 4OGXA 1QBVH 4WF8A 3A84A 4LZ4B 2PSYA 2W26A 1UVPA 2ZI2H 3BTKE 5E0JA 3RXDA 2STAE 2D8WA 3RXAA 4GCHF 4BAMB 2SGDE 3K9XB 3BTFE 3U98H 2P3TB 3GY4A 1G30B 1N8OB 2BDYA 1SQOA 4WXVA 3A89A 1JRTA 5T6DA 3NUMA 2ZDVH 3MTYA 5EXLA 1EQ9A 4FXGH 4MTBA 4OS2A 4AB9A 2YOLA 1G36A 2LNCA 1IHSH 2VH0A 2WYGA 4A92A 4MPUA 4AN7A 4ZXXH 3QO6A 4KKDA 2FOBA 3BIUH 1F0SA 2XCNA 4AFQA 1YPHC 1HJAB 1AHTH 1SSXA 3MH6A 2XCFA 4IBLH 3V13A 1Y3YA 1NN6A 3CS0A 3M7QA 1HIAB 1GBEA 2BLWA 4H42U 1GBKA 1D3QB 1ARBA 1O5CB 2XWBI 1MD7A 2I6QA 1N6YA 5F8TA 5L2YH 3LJOA 2GTBA 3TJVA 4BTUB 3E3TA 1O2GH 3AW0A 4ZHAA 1GI0A 4WMEA 3RXKA 1HAHH 5AFYH 4F49A 1MTVA 2G4UA 1GVLA 2PKAA 4U30A 3C1KA 3CENA 4I33A 2ZFTA 4NZQA 1NFYA 1A5HA 3HGPA 4AG1A 2BQ6B 1HBTH 2B8OH 2D26C 3SJOA 3A80A 3SNBA 3MU4A 1IQLA 3F1SB 3MNBA 5TCAA 3T28A 1OYQA 2ALPA 1JIRA 3A87A 1WU1A 2TRMA 4M7GA 1UCYK 1ARCA 1RIWB 1YPJH 2O8UA 3SU6A 1KY9A 2ZU2A 1FLEE 3VGCB 3B23B 1EAIA 2BQ7B 3EQ0H 5BRRE 3IG6B 1ZPZA 5E2PA 2BD4A 2GDEH 4K1SA 3NZIA 1Z8JB 1C4U2 1HAXB 1VITG 2WV4A 1IOEA 3OY5U 1ZPCA 1DXWA 1V2TT 1NY22 1W14U 2BVXH 3DFLA 2ANMH 1ETTH 2Z3CA 2ZCHP 3NWUA 2FWWA 1A7SA 4Y71A 1W10U 5A8XA 4YT6H 3OU0A 3SI4H 3KL6A 2H1UA 3SV2H 2GMTB 3VPKA 1OPHB 1ELAA 1HFDA 2ODQA 3L6PA 4A1VA 3RMLH 3A7VA 4OS1A 1YPHE 3AAUA 2VVCA 1C5UA 3KQCA 1TMTH 1QJ1B 1PQ5A 2PGQB 3FZDA 2J34A 1ZGIA 1ZZZA 3NPSA 4Y11E 1J9CH 1FUJA 3BTTE 5DJ7A 3RC6A 3BEIB 4NIXA 3I77A 4ABFA 1JOUB 1ZRBA 4DGJA 1NPMA 3MU1A 1Y5BT 1XUFA 1VR1H 1C1WH 3SU0A 4GHTA 2UWOA 3PO1B 1GMCG 2A7HA 4DIHH 2UUFB 1EPTA 1YBWA 2ZPRA 3LC5A 3UNQA 3H7TA 3QZRA 2ZGJA 3BEFB 2A2XH 1GJ4H 3RXLA 3ZZ9A 2ZGHA 1P2MA 1L4DA 2ZFSA 3MOCA 2AMQA 3UREA 2G5VA 1K1NA 1E38B 1HNEE 2Y82A 3LOXA 1O35A 2BY7X 3UOUA 5DPAA 3SNDA 1HJ9A 2A5KA 3RXSA 4CREA 3P70B 2W7SA 2ZU1A 4UEHH 4UD9H 2BTCE 1BRCE 3BIVH 2ZKSA 4CRBA 2A0QB 2C8WB 4MDSA 2YNAA 1QB1A 1U6QA 1SGFG 1ORFA 4CHAB 2BD5A 1K1LA 1MCTA 1CE5A 1K22H 2ANWA 2VIPA 1CT4E 3C27B 1JRSA 3MO9A 1GMDG 1XUIA 2HGTH 3H5CB 3FP8E 1P02A 1DT2A 4K5ZA 1L1GA 2GT7A 1MZAA 1ANCA 3SV6A 4B2BA 4ABIA 1S0RA 1EJMA 3KHVA 3QTVH 1AKSA 1Z8IB 1VZQH 3QGNB 1F5KU 2WUCA 3ZZAA 3BTQE 4BTTB 3KQEA 4MNVA 4GAWA 3TNSA 1DANH 3W94A 4B2CA 3SUEA 3SW2B 1BJUA 1CA0B 4SGBE 1LMWB 4LK4A 3UNRA 1EXFA 1BTPA 2UUYA 4DVAU 1C1SA 3KIDU 2D2DA 4NIWA 1ELVA 5E0HA 4OGYA 1KDQA 2ANYA 1BTYA 5DP4A 4IW4E 2QGRA 4NA9H 5JYIA 4B73A 1A3BH 2FESH 2F91A 1MBMA 2FYQA 5E0GA 2UWPA 1YP9A 1SHYA 3Q76A 2GZ9A 1KXEA 1LO6A 2OC0A 2VVUA 1N6XA 1ETRH 1SFQB 2ZFFH 5B6OA 8GCHG 1MQ5A 2ALVA 3TK5A 1CHOF 3OY6U 5JBAS 1GHBF 2J92A 3LIWA 1LVYA 2Z6BD 1QBNA 1LVBA 3TU7H 4D7GA 3AAVA 4UFGH 2UWLA 1CVWH 2R2WU 1RS0A 3KGPA 5JBCS 2HWLB 2GP9B 2ZU5A 3O8DA 1C5TA 4YESB 2SGQE 1G2LA 2XC5A 4CRDA 2XTTB 1GI3A 2V0BA 3QGJA 1BJVA 3QK1A 1LHGH 6LPRA 1UHBB 4D76A 1OP2A 1AN1E 1O3NA 2OP9A 1SGPE 1YGCH 1TRYA 1GI9B 3DUXH 1MTNC 5F8ZA 4ABGA 1C1RA 3N7OA 3VB3A 3SORA 1C5NH 3QUMP 4HTCH 4ASHA 2ZDNA 1EOLA 4UONA 1TFXA 2ESTE 3U8RH 1W7XH 3KNXA 1H8IH 1KXBA 1UTJA 3GY3A 4JZFH 3SNAA 3V3MA 3MH5A 9ESTA 1DUAA 4TWYA 5EODA 1NRPH 3BEUA 2OD3B 1Q31A 1LPGB 3QN7A 2O8WA 3P8OA 2K1QA 4BAOB 1QGFA 2ZFRH 5C2ZA 5FBEA 1C1UH 1HAIH 1RTKA 3NK8A 4GHQA 2BYAX 1AGJA 1MCVA 1UTQA 2QXIA 3LH1A 1ZOMA 3M35A 1EB1H 1CHGA 4ABHA 4XSKU 1B0EA 1E35B 1GI7B 2H9EH 5C3NA 2IOTA 1HJ8A 1HLTH 1WQVH 5JBBS 1G3DA 1AMHA 6ESTA 2FZZA 5TCCA 3T5FH 1P2OA 1SPJA 5GXPA 1O31A 2NU3E 1QCPA 3FZZA 3JZ2B 3MFJA 4FU9A 1Z6EA 4FUEA 1C1OA 3KQDA 4ABEA 5FBIA 2BY5X 1YLDA 2RCEA 4E05H 3HATH 5T3HA 4ESTE 2NU0E 1C1PA 3UTUH 1OWIA 2H9HA 3K2UA 3NXPA 4U01A 5HM2A 5JB8S 4I8LA 1ZJKA 1BBRE 1SGTA 4MPXA 2ZCLP 3ZZ4A 1AB9C 2Q1JA 5AVDA 4NIVA 1GHAG 1A3EH 6GCHG 2RA0A 4UFFH 1VITF 1O3AA 3G01A 1DWBH 1L1JA 1HAPH 3A7YA 3TH2H 2VH6A 3D49H 2HALA 1XM1A 2ZGBH 1GVZA 2H5CA 1GHZA 4HGCA 4BXSA 5C1XA 1YCPH 2BDBA 1DICA 1GBCA 3E8LA 4CR5A 4DT7B 3LGYA 1CGHA 1K1OA 3SHCH 2JETC 1G37A 3VEQB 1E34B 3TVJB 1GI5A 4ZHMU 2QF0A 4DOQA 1PYTD 3RMMH 1TBRH 4FUJA 1V3XA 3BG8A 5LGOA 2BDHA 5CMXH 3FVFB 2OC8A 4UE7H 2FDAA 1KXAA 1C5VA 4QT8C 1P10A 3P95A 5FAHA 1UJ1A 3SV8A 2Z3DA 2VU8E 3VFEA 5GJ4B 5C1YA 2WPIS 3LKWA 2OTVA 2BY6X 1S5SA 3RP2A 3SU4A 2FTLE 3MNSA 3R3GB 4CRFA 1WUNH 1HGTH 1DLEA 4GPGA 1RXPA 2ZQ2A 3K65B 1WCZA 1LKBA 5EQQA 1E37B 1C1VH 1FI8A 2ULLA 1O34A 4RKJB 2WPLS 1RFNA 2OXSA 3GY5A 3M5OA 3D62A 3DA9B 4Z6AH 2Q6GA 1W11U 4IN2A 1H8DH 2OC7A 4AGJA 1EZSC 5C5OA 2QYIA 1HAVB 2P59A 1NU9A 2GCTC 5DO4H 1TX8A 3RMOH 1TOMH 3V0XA 4A1TA 3DFJA 4FUDA 1S6HA 2JH5D 3T29A 2BOKA 2I6SA 2A4OA 1TBZH 1NFUA 1LDTT 7KMEH 1A0JA 3BTDE 1DDJA 1HIAA 5J4QA 3ZZBA 1FAKH 2FTMA 1QA0A 5FX5A 2J9NA 1C2FA 1AI8H 1VGCC 2VIWA 3GYMA 1CSOE 4B75A 1ZMLA 1P11E 5DP5A 3FP6E 1WV7H 4JZDH 1AO5A 2FEQH 5F03A 1GG6C 3EA9A 1C5WB 1G2MA 1O5FH 1A4WH 1GI4A 3UOPA 4AFUA 1BMLA 3PMJA 3Q77A 1W0YH 4WWYA 3IITA 4ABBA 4ABJA 1YM0A 1MMJN 1S84A 1ZJDA 4WXIA 1C1TA 3S7HB 1SGRE 4WY3A 3GICB 5CHAC 2P3FH 1TNIA 5HGGA 4A6LA 1MTNB 3GY8A 3MH7A 1GJ8B 1OP0A 1DS2E 1SGNE 3BTME 3GDVA 1H9HE 1AFEH 3RU4T 3E1XB 1C5YB 3DT0H 3LGVA 1G3BA 1EX3A 1GJ7B 1TQ7B 4NA8A 3M3VA 1F7ZA 1O2VA 1C5XB 1RRKA 1KYNA 2QC2A 4ISNA 5GWZA 5ESBA 2Z7FE 1LQEA 1FPHH 3BG4C 3RXUA 2KAIB 3MMGA 2ZTZA 1GCTC 1P03A 1GDUA 2P95A 1HCGA 2XYAA 1SLVB 1T8MA 3PYHA 1GHBG 4Y8XA 4BNRA 1F5RA 1L2EA 8GCHF 3TH3H 3PMAB 3ITIA 3ZZ7A 1ZMNA 4NFFA 1CT0E 4MG3A 2BLOA 2ODPA 3F9HA 1ZTKA 1FMGA 1FY1A 1TRNA 1J17T 3A8AA 2FOHA 2QIQA 4AORA 3RXMA 3HK3B 3F6UH 3QLPH 3E6PH 1OP8A 2ZA5A 1O2HA 3EE0B 3VB5A 5J4SA 2R0LA 3ZVEA 3A8CA 4BXWA 3GCHC 3PB1E 1MZDA 4I8GA 1NESE 1AB9B 2WUBA 3E91A 1EATA 4JZ1A 1V2VT 1SL3A 2FXRA 2AIPA 3TGKE 3STJA 4AFSA 3UFAA 4Y76A 3LU9B 4MQAA 1SGFA 3M5LA 1BIOA 2QAAA 2WV5A 3E0PB 4ZMAH 1OWHA 5E2OA 2A4RA 1HXFH 5EW2H 1ETSH 2O8LA 1FXYA 2YNBA 2ZPSA 1HPGA 2ZQ1A 3U8TH 1O39A 3PM3A 1G9IE 1GDNA 1QBOA 4JMYA 1SLXB 3VXEH 2BDCA 3ZYEA 5HXFA 3KCGH 2JETB 3EA8A 2V35A 5ABWA 4NGAH 4Q7YA 4MPWA