1BMAA

Benzyl methyl aminimide inhibitor complexed to porcine pancreatic elastase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title Interaction of a peptidomimetic aminimide inhibitor with elastase.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1995-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bmaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bmaA01
2RG3A 4JYUH 2A4QA 1PJPA 4R0IA 5LPRA 5E2OA 1AWFH 1ZHMA 2BHGA 1MKXH 1OPHB 1DPOA 1P2KA 1TGBA 3LH1A 4TY6A 1MH0A 1G2LA 5DJ7A 4CRBA 1FIWA 2VIDA 1ELEE 3GYLB 3SUDA 1GDUA 1M9UA 1OP0A 3T29A 5C1UA 2ZG0H 1D3QB 1OWEA 3SUFA 1UTPA 2ZDLA 1AB9B 2XYAA 2PKAA 2B9LA 2HNTE 4JK5A 4ABJA 3RXBA 3M3SA 4Y79A 1QNJA 3RXSA 1F92A 4IW4E 3UR6A 3NWUA 3WY8A 5FCKA 2GV7A 2BD8A 3MTYA 5T6GA 2VJ1A 2QN5T 4GPGA 4ZUHA 7LPRA 5JYIA 1G9IE 3ZV8A 2ODQA 5CHAC 3B9FH 1GHBG 3E6PH 1TX6A 5ABWA 1B0EA 1FN8A 3GISB 4NZQA 1LQEA 1FMGA 3RC4A 1P2NA 1E36B 2DE9A 4KTCA 1NN6A 2A5IA 1EP5A 1NPMA 6ESTA 3ZVGA 7GCHF 1MMJN 3AASA 4Y0ZE 2F9PA 3C27B 1XXFA 3TH3H 1BMAA 1GDQA 3A7WA 1BIOA 4U32A 1UMAH 3PO1B 2HRVA 4XBDA 2A2QH 3SV8A 4A5TS 1TOCB 3MMGA 1V2VT 1GBJA 4TPIZ 2J9NA 4KTSA 5GIBA 2OC7A 3T62A 2H9EH 1HPGA 4NSYA 3STIA 2DUCA 1THPB 5T3HA 2YNAA 3RM2H 3UNSA 3ODDA 2BD3A 4VGCB 2GMTC 3SU0A 3KQBA 2CHAB 1BRCE 2H5DA 1YPJH 3U8RH 1BBRK 2AFQB 4AORA 1DUAA 2I6SA 2BY8X 1G2MA 4XBBA 1S0QA 2ASUB 1AZZA 2GT8A 1BITA 1C5MD 2IJOB 1O35A 4CHAC 4FVBA 4YT7H 4Y0YE 1P05A 4UFDH 4GUXA 3A86A 1OWIA 1XUIA 1UJ1A 3QDZB 1Z71A 5DP4A 4K8YA 2Z94A 1KXEA 1C2HA 4X2WA 1E38B 2GCTC 4Z0KA 2VIQA 3IITA 8GCHF 3Q3KA 1XUGA 2G55A 2STBE 4AB9A 2GP9B 1O5CB 1UCYK 2SNVA 2WPMS 3BV9B 4X2YA 1T8OA 1TWXB 2R3UA 1WTGH 4AZ2B 5GJ4B 1GHWH 3RU4E 2TGTA 2A4GA 2GDEH 3E0PB 1FNIA 2CN0H 2ZDMA 1QA7A 1P3EA 1O3AA 2FI3E 4HTCH 4NFEA 5FBEA 1DWBH 1EPTC 1EASA 1VCWA 4Q2KA 1H4WA 3VFEA 4NSVA 3RXTA 1P02A 1V2ST 2UUJB 2OBQA 1LHEH 2CMYA 1N6YA 3TITA 1BTZA 1CBWC 5L2YH 3NUMA 5E0HA 1PQ8A 3K2UA 4E7RG 3RXPA 5K7RA 1G32B 1TQ7B 2J94A 4YLQH 1P57B 2FOFA 1SQOA 2IN2A 2F83A 4JYVH 8LPRA 4ZMAH 5C1YA 3QUMP 2SFAA 2TGDA 1GMCG 3DUXH 1DLEA 3VB5A 2D8WA 1SGRE 1SC8U 4FUEA 4DURA 3UFAA 1ID5H 4ABHA 2M5TA 1T31A 1GBCA 3HK3B 1TPAE 1C9TA 3UQVA 2AMPA 3BTFE 5K0HA 1E37B 4VGCC 1E0FD 1XUKA 2PSXA 1XVOA 1C5VA 1C2GA 1FLEE 4NIXA 3BF6H 2BY7X 3M5OA 3F9EA 4AYVB 3S9CA 3F9FA 3SU4A 3SJIA 4DY7B 2B5TB 1O5GH 3KEEA 3P6ZB 1SSXA 1UVOA 2QF0A 4H6TA 3AW0A 4K1EA 4NZLA 2C93B 5CE1A 1RJXB 3T28A 1Y3UA 3D49H 1P12E 2WYGA 3P8NA 3SU6A 1FONA 4B2AA 4ABAA 4ASHA 3RDZA 1DDJA 4WVPE 1TGCA 3A88A 1DWEH 3NZIA 3PM3A 4XDEA 3BSQA 3CS7A 3TK5A 4A1TA 2O9QA 3TGJE 1AQ7A 3BTTE 4I31A 2OTVA 1WOFA 1TBZH 1YLCA 1G3CA 3DFLA 3ATLA 4BNRA 3VGCC 1AZ8A 2ESTE 2FPZA 1A3EH 1CGIE 4B73A 1MTVA 2HGTH 3ZZ5A 4OGXA 3V0XA 2SGDE 4INHA 1OXGA 2HVXA 2QCYA 3R3GB 2F9UA 3MH7A 2GZ9A 3JZ1B 4YO9A 3TIUA 1O3KA 3ZZ4A 1FAKH 2EC9H 1L4ZA 2F9BH 2ZIQH 3ZYDA 1SPJA 2FYQA 2GTBA 1FY3A 3M61U 1EKBB 4JYTA 1HYLA 1HAZB 1F0UA 3KL6A 4Y7BA 2WV5A 3BTQE 2WPJS 5ETXA 1CGJE 1AVWA 1AGJA 1TA6A 1DY8A 3BTDE 2ZF0H 1BMMH 1TX7A 1ELDE 4Y11E 3RXVA 4UFGH 2BOHB 5T6DA 2FIRH 1NFXA 1K1LA 1O2XA 1FXYA 1FY1A 1YPLH 1UK4A 4CREA 1JBUH 3A8CA 3P8OA 4X8SH 2BD7A 3M37A 4CRAA 5EXLA 5A0CA 2P94A 4ZXYH 3RXKA 1SMFE 1UVUH 1FV9A 2F91A 3V3MA 2KAIB 1BBRH 3RXCA 1RGQA 4U2WA 4NIWA 1C5QA 2ZDNA 1D3DB 1O38A 3QGJA 3E16B 5DK1A 4WF8A 5E8EH 4K2YA 1LKAA 1K1MA 4I8JA 1A61H 1QL7A 1F0TA 1ZPBA 2P16A 5DP8A 4CR5A 3TGIE 1W10U 3PMHB 3RMNH 1SVPA 1YPKH 1GBTA 1HAXB 1ABJH 5JB9S 1MZDA 1IOEA 4WMEA 2UWPA 3M3VA 3MH4A 1WQSA 1QRXA 1V6DA 1A1RA 3U98H 3O8CA 1MTWA 3Q3XA 3BEFB 1W8BH 1MTNB 1HAOH 2ZTXA 1QTFA 1C1MA 1CT4E 1LHFH 1MAYA 3K6ZA 2RA3A 3ZZDA 1UCYH 1GBFA 2Y81A 5E0JA 4YLUA 1KXCA 2PKSB 2Z3DA 1BRAA 5CMXH 1CT0E 1S6FA 2PGQB 3S9BA 3A82A 1KIGH 2ANMH 1ANBA 1IQHA 1HAPH 2AS9A 3M36A 2P95A 5AF9H 3QK1A 3ZZ7A 3GCNA 1SLXB 1D4PB 3MNXA 5ESTE 3PMBB 1C2DA 4YTAA 5DG6A 3AAVA 2PSYA 2FI4E 1SBWA 1Y5UT 1D6WA 2BY9X 3A7VA 4Y8YA 3U1IB 2XC5A 1O3PB 2OUAA 1MKXK 4K60A 1OWJA 4HI3A 2HNTF 2Z7FE 1ORFA 1LHDH 2Q1JA 2BLOA 1HXFH 2G8TA 1WTHD 1Z8RA 3QTVH 1CHGA 3LGIA 4OS1A 2TIOA 2AGEX 1NS3A 3BTGE 1SLWB 2STAE 4MNYA 2CGAA 4I33A 4X8UH 3A7YA 1Y59T 1Y3VA 5A2MH 2KAIA 2J38A 2THFB 1OWHA 1GJ5H 3UWIA 4PROA 3TU7H 3QGNB 2PWXA 1TLDA 4FUDA 1DWDH 1C4U2 1EJMA 1QJ6B 1RS0A 4JZFH 5C5NA 1EUFA 2C90B 1ELFA 4YOGA 2Z9GA 3PROA 2BX4A 1NZQH 4X6NA 1YM0A 2ZZUH 1B5GH 1K2I1 3TPIZ 1ELGA 3SZNA 1NRPH 1GHAG 1PQAA 4IN1A 4YZUA 1JMOH 2VWNA 2ZEBA 1O3MA 2Q6GA 3RMOH 1GJAB 5FPSA 1N1LA 1NRNH 1OYQA 5C2ZA 1GBHA 2SGFE 1C5RA 5EG4A 2ZC9H 1MQ5A 2SGEE 2FTLE 1K1IA 3EE0B 4WJG2 1O3HA 3PWBA 3ZZCA 3RXHA 3PTBA 4BXSA 2XWAA 1BRUP 2PHBA 3LKWA 3W94A 3STJA 1O2IA 4INLA 4WMDA 2O8UA 3HKIB 2CF8H 1GHYH 1UCYE 2VIOA 3GY7A 3MI4A 3U1JB 5JB8S 5E2PA 1O3FA 2V35A 3GCTG 2XBYA 1MU6B 1WCZA 1ZTLA 1O5AB 3SNCA 1C1RA 1GL0E 1BHXB 4YOJA 1D3TB 3O8BA 4B74A 2ZFPH 2XXLA 3LONA 4AYYB 1HFDA 5GWZA 5L2ZH 1GJBB 2R2WU 3EQ0H 2VGCB 4NA8A 1UVSH 2ZQ1A 3JZ2B 4A7IB 4E06H 3KCGH 1HB0B 3L3TA 5EXNA 5I25A 1VCPA 2JH0D 1C1PA 3UOPA 5EQQA 1O2KA 3RC6A 1TNKA 5FPYA 1YCPK 1C4V2 3LGTA 2AERH 5C3NA 1DX5M 4IN2A 3ZZ6A 1W3CA 1GMDF 1W13U 1E34B 3LGUA 2Y5GA 1EB1H 1Z8GA 4BANB 2XTTB 1NC6A 2BM2A 2FOAA 1KXFA 4H4FA 1GBDA 3LJOA 1GCDA 3G01A 4BTUB 2FLRH 4X8VH 1E35B 2FP7B 2BB4A 3SV7A 1GCTC 1LCYA 2ZNKH 1HJAB 3BTEE 3GCHB 1O37A 3A85A 1LHCH 4Q80A 1J14A 1O2NA 2AYWA 3A7XA 4D7GA 6GCHF 1P2MA 2JETB 4OS7A 4ABGA 3BTWE 2H9TH 3OU0A 1CE5A 1C5OH 1J8AA 1FJSA 4BOHA 1XXDA 2J92A 3MU5A 2FZZA 1ELTA 2A7JA 2WPKS 4ZH8A 3BEIB 3CENA 2ZFQH 4MVNA 1MZAA 4CRDA 2XRCA 3VPKA 4BAHB 1Z6JH 3RXQA 2W7UA 3QWCH 2XBVA 1LPGB 1HLTH 2BQ6B 3DD2H 4B71A 2PGBB 2GX4A 3GDVA 4YESB 3CP7A 1QGFA 4RSPA 3M7QA 3PB1E 3GDUA 4MPVA 4MNVA 1SB1H 4WMFA 5J4QA 3L6PA 1TABE 1CHOG 1GG6C 3HKJB 1TBRH 3TVJB 1VGCB 8KME2 4FVDA 2EEKA 4ZHAA 1L1GA 4DIHH 2ODPA 1DXPA 1DM4B 1SFIA 4Y6DA 4FUGA 2NU1E 4DCDA 1ETSH 2BDGA 2C8YB 2H9HA 4IBLH 1ELAA 1H9IE 6CHAC 2VVUA 1BHXF 3ATKA 1C5LH 1LMWB 1XUJA 1T7CA 4MTBA 2BMGB 1P0SH 2YNBA 3HPTB 2PTCE 2HPPH 2FX6A 3K9XB 3KQCA 1FPCH 2ZTZA 1ZOMA 4LXBH 1T8LA 1O2MA 4MPXA 2O8WA 3VEQB 1NT1A 2ZWLH 5DPAA 3D65E 1BOQA 2O8MA 2HPQH 1AFQB 5DGJA 1UK2A 1QCPA 1MKWK 1OWDA 2VINA 2FX4A 3MO3A 2W5EA 3ENSB 1BA8B 5C1XA 1SQAA 3V7TA 2R2MB 1Q31A 1Y3YA 5A09A 1C5ZB 1O2WA 3B23B 4X1RU 5JPMH 3GY4A 3A84A 2AEIH 1A2CH 1O5BB 4OS4A 3TH4H 5AFZH 3SNBA 4CR9A 1JXPA 1NTPA 3UREA 3EDXB 4D9QA 1U6QA 5E0GA 1RD3B 3QZQA 3A81A 3MU0A 4FUHA 1GHZA 2D1JA 1KYNA 4KGAA 1PPHE 3SV9A 3SU5A 3GICB 1A5GH 3EA9A 1MAXA 3QX5H 2AMQA 5EGMA 3QLPH 3TLOA 5FPTA 2Z3CA 3ZVFA 1C5PA 3S69A 4ZHMU 4AFSA 1SLVB 3FZDA 1O2LA 1V2WT 1TRNA 3RXDA 3RXGA 2BZAA 3SNAA 3C1KA 3ELAH 1O3NA 2LNCA 4ZKNU 3ATIA 5ESBA 4BAMB 5LPEA 2EI7A 1V2OT 2A5KA 2AH4X 4Q7YA 5A8YA 1LDTT 2ZFSA 2BDCA 1FN6A 1KLJH 4NWLA 1TQ0B 1GHBF 2P8OB 3A80A 1HAVB 2XNIA 1YF4A 3LH3A 1IQEA 4K8BA 5C5OA 1IQGA 4I7YH 1FY4A 5GXPA 1V2MT 1ZYOA 2ZGCA 1PPFE 2W7SA 1HAYB 5HGGA 1HBTH 1AB9C 3M5MA 1O3IA 3PLBA 3O8DA 1YCPH 4IMZA 1JIMA 2ALVA 4X6MA 4ISLA 3P8FA 4MQAA 3EAJA 5C20A 4CBOA 2WINI 1N8OB 3A83A 1CA0B 1DSTA 2ZQ2A 2VWLA 1T32A 1MQ6A 1TRMA 2A0QB 3UY9A 1V2JT 2ZCLP 2A32A 1P06A 4AOQA 2SGQE 3U8TH 2ZI2H 1NFUA 5LPFA 1SI5H 2GZ7A 2OXSA 2PW8H 2Y7ZA 1ZMJA 1INCA 1L2EA 1O2VA 3W95A 1AN1E 1BTPA 1YKTA 3KQDA 1UTNA 2ZFRH 1LHGH 3SJOA 1NESE 3MU4A 1HAGE 3S7KB 1O2ZA 2FDAA 4IGDA 3RXEA 1BTYA 1THSH 1F2SE 1JRSA 3FFGA 5T6FA 2EA3A 1UVTH 2TRMA 2ZHFH 3LC5A 2OP9A 3OY5U 1ETRH 3FANA 3PO1C 1O39A 1BJVA 1AVGH 2RCEA 1EAWA 2G5NA 4E7NA 1L1NA 3S9AA 3RXUA 1NRQH 1PPGE 1QB6A 1DSUA 4WH6A 1GPZA 1ZTJA 1GBEA 4AFZA 1WV7H 2Z9IA 3M7UA 3SGBE 3E3TA 4D76A 1NRRH 4TYDA 1EX3A 1QBNA 2FOHA 2CHAC 1C5WB 2A5AA 2BYAX 1PPCE 1H9LB 3E1XB 1IQKA 1H1BA 1RTLA 1F0SA 1O30A 1GBAA 4ZROA 1AD8H 2BD9A 4DJZB 1A5IA 5FCRA 2GGVB 1EAIA 1BB0B 3Q00A 2BDYA 1TMTH 4DT7B 2ZGJA 3ODFA 1P01A 1TGTA 1ZTKA 1BZXE 2O8TA 2ZHEH 4IS5A 1UTLM 2BZ6H 3GY5A 3LT3A 1ZJKA 4I32A 1SR5C 5F8ZA 2VWMA 2VIVA 1TBQH 1LQDB 2PUQH 1IAUA 1V2UT 1VJ9U 2HLCA 3O8RA 4DOQA 5EPNA 1TNGA 1IQMA 1HCGA 1YPEH 1MTUA 3EYDA 4GSOA 4GHTA 4RN6A 1SQTA 5EXMA 1O2SA 1TE0A 1TFXA 1RIWB 2OLGA 1XKBC 4FU9A 2BTCE 2H1UA 1DFPA 3BTHE 1B7XB 1MKWH 1EZQA 1FAXA 4MPUA 1GVLA 1J9CH 2P59A 5AFYH 1L0ZA 3AVZA 3RU4D 3SHAH 4FXGH 1P09A 3SJKA 2Y5HA 1SGDE 3SW2B 4B76A 5EODA 3A8BA 4K3JA 4WXIA 1AWHB 1BCUH 4O3TA 1ZHPA 2ZHDA 4FUCA 2ZA5A 4JZIA 2GD4B 2GZ8A 1ZSJA 2BLQA 1Y5AT 1WAYB 2GCHG 1UO6A 1DXWA 3S7HB 1K1OA 4JZEH 1OWKA 1SL3A 4Q7XA 1HXEH 1YBWA 1DS2E 3BG4B 1TAWA 1X7AC 1LVOA 3E90B 2W26A 3TJNA 3V12A 2ZPQA 1AE8H 3PMJA 1P2OA 4TPYA 3UQOA 1O32A 2A2XH 4NCYA 2FOCA 2HWLB 1A46H 1JRTA 4O9VA 2FYRA 1O2UA 4WY3A 1SGQE 1YLDA 2UUFB 3ZZ8A 2Y82A 1PQ5A 1NRSH 1AUTC 2CV3A 4HZHA 2RDLA 1DY9A 1S85A 3HGNA 3RMLH 1XUHA 1AHTH 1AO5A 2BXUH 1GDNA 2G52A 4NG9H 1ZMNA 1MTSA 1RFNA 1O3DA 3UTUH 1C9PA 3GYMA 1HJ9A 1IHTH 4MDSA 1O2RA 2W3KA 1G3DA 1Y8TA 3MO9A 3ZVCA 2OCVB 2VWOA 3N7OA 4K1TA 1SGFA 1GJ4H 2OC0A 2FXRA 4RKOB 2WPHS 1NFYA 4Y7AA 1FIZA 4B2BA 3MU8A 4JCNA 1ANCA 1QQUA 2BQ7B 2QXIA 1C5SA 4ABIA 5JBAS 1TNLA 3Q77A 1O36A 2ZU3A 2ZTYA 1ZRBA 1ZSLA 1ZSKA 1Z8JB 1DITH 1YPHC 3LOXA 5TJXA 1S0RA 3UNQA 2FS9A 1OP2A 1Z1JA 2FI5E 2TBSA 2UUKB 4LZ4B 1NFWA 3LGYA 1HIAB 4ABBA 5FX6A 2AIPA 1V2RT 1CA8B 1AKSB 4SGBE 1UTJA 3LGWA 4FU7A 4ZKSU 1K1JA 4HFPB 4FUJA 1F5RA 2WV4A 2F9NA 3KIDU 1EOJA 1HAHH 3NKKA 4MLFB 3CS0A 3ZZ9A 4DGJA 3LJJA 1TYNA 2DE8A 3NCLA 4AX9H 5BPEA 4GAWA 2GT7A 1THRH 4MNWA 1A0LA 3UWJH 5F8XA 1UTKA 9LPRA 4Q7ZA 2ZU4A 4A6LA 1GBMA 3IG6B 3ZZ3A 1ELVA 1TPPA 2A4OA 2QAAA 1ZLRA 1EAXA 5LH8A 3E91A 1EJNA 2AGGX 5H4IB 3M5NA 1DE7H 1OYTH 1PYTD 3HGPA 4BAKB 4K69A 4YT6H 1WSSH 1GVZA 2VB0A 1A3BH 3OTJE 2R9PA 3TGKE 3VB4A 1QQ4A 2P3TB 3OX7U 2ZGBH 1KY9A 2ZKSA 3R0FA 5I46H 3U9AH 4CH2B 1ELCA 3PTNA 2XC4A 5DP7A 3SUGA 1JIRA 4ABEA 1C4Y2 1FZZA 1ANEA 3DHKH 1O2OA 2ULLA 1PPBH 1MTNC 2NU3E 2NWNA 1KSNA 1XVMA 3FVFB 1SG8B 2D26C 4X6PA 3A8DA 2PKSC 1VJAU 2R0LA 4J2YB 5BRRE 1T8MA 5FBIA 4IC5A 3GDSA 3RUOA 1IQJA 2QXJA 1LVMA 3SI4H 2OC8A 2AGIX 3ZYEA 4I8HA 1G36A 1O3EA 1V2LT 3M35A 4K5ZA 1SHHB 2FS8A 2TGPZ 1W14U 1P9SA 5IDKA 1V3XA 4ZKRU 2H5CA 2WPLS 4D8NA 1HIAA 4FUIA 4R8TB 3A7TA 1AKSA 1GI3A 2P93A 2VVVA 4AB8A 4AGKA 2G51A 1A7SA 1FY5A 1NU9A 4QT8C 4THNH 3ZZAA 1OKXA 1Z8IB 3GOVB 3M7TA 6GCHG 2WYJA 1W2KH 2UUYA 3A89A 4CRCA 2JH6D 4B1TA 1V2NT 1VITG 4XFQA 3MYWA 3DA9B 1O31A 2Z9JA 1LO6A 1IQIA 1GI0A 3SNDA 4UE7H 3QN7A 4I8GA 4INKA 1QB9A 3RLYH 1W11U 2WUBA 1TPSA 4B2CA 4DW2U 4WWYA 1QL8A 2ILNA 2QXGA 4KELA 1O3CA 1Q2WA 2CJIA 3FZZA 3P95A 4FU8A 1C2EA 1C1TA 1S6HA 2NU4E 1QBVH 3PV4A 2QF3A 4FUBA 4U30A 2XCNA 1EOLA 4NA7A 3Q76A 1GJ6A 1K28D 1D6RA 2V3OH 3MH6A 3SN8A 5CHAB 2J95A 3RXFA 1ZHRA 4Z6AH 1BMNH 1C1UH 2TPIZ 2VIPA 2Z9LA 1XX9A 3SQEE 3UPEA 4A1XA 4Y8XA 4AGJA 1BJUA 4H42U 3A8AA 3U8OH 1ABIH 2QXHA 2BX3A 2ZU1A 1IQLA 5TCAA 4J1YA 1SGEE 4ABDA 1O0DH 1ZGIA 1WU1A 1AU8A 1AIXH 5C67A 4X0WU 1RTFB 2FOBA 1GJ9B 5F6MA 2G4UA 3TNTA 3I77A 4LZ1H 1K9OE 2PTNA 1TNHA 1A5HA 1CSOE 2JKHA 2NU2E 3Q3YA 4MG3A 2ZFFH 1SOTA 1SGNE 1N6XA 2FO9A 1P11E 3MWIU 3NK8A 2XC0A 3VB6A 4BAOB 1C2LA 3RLWH 3ZV9A 2UWLA 5GCHF 2A7HA 2V6NA 2GMTB 1L4DA 4ISHH 3RXLA 1QJ1B 1W12U 1GI5A 1NY22 1P2IA 2C8XB 5A0AE 1EZXC 4MPWA 3F1SB 2P3FH 3RMMH 1PQ7A 1O33A 2BXTH 5EQSA 1YGCH 3QTOH 1AMHA 1O3OA 8ESTE 4CHAB 1GMHF 4D7FA 1WYKA 7GCHG 1IHSH 2VGCC 2FEQH 3P70B 3T26A 5A8XA 1H9HE 1SLUB 1HRTH 5JBTA 3E8LA 3SGAE 1QBOA 4TWYA 1MCVA 1C2JA 5A0BA 4U01A 1KXBA 3H7TA 2ZHWH 2GCTB 4UD9H 3TJUA 4AFQA 1GL1A 5AHGH 1W0YH 2PV9B 1FQ3A 1W7XH 3SOSA 1MBQA 1GI6A 4GLYA 1KLIH 1V2KT 1EZSC 1YPHE 1TONA 1YPMH 3L33A 4BAQB 3A7ZA 3KN2A 2Z3EA 2Y7XA 1SGTA 1QURH 4O03A 2SGPE 3GCHC 1HJAC 1CHOF 5DO4H 3KNXA 1AE5A 1EPTB 1GJ7B 2BD2A 4GCHF 5AVDA 4AG1A 1TNJA 5EW1H 1G37A 1DVAH 1PYTC 1QR3E 2JETC 2FODA 3TK6A 1EB2A 5JBCS 1BUIA 2C3SA 1J17T 3LIWA 2OINA 1TALA 2H6MA 1A0JA 1CBWB 2GVFA 4K1SA 5FHTA 8GCHG 1SGIB 4JZDH 1VITH 9ESTA 7KMEH 2SGAA 1BTUA 4RKJB 1P03A 3A87A 3SHCH 3VB3A 1C5NH 1GVKB 3RXRA 2BLVA 2ZP0H 3BIUH 1AUJA 3SU3A 2ZFTA 3TJOA 5HYOA 4TWWA 1VCQA 1VGCC 1S82A 2ZECA 1XUFA 1T4VH 1LVYA 1TPOA 5DKMA 1EXFA 1MBMA 4GVUA 2QGRA 4I8LA 3ATWA 2A45B 1KXDA 1C1SA 4X1PU 1YP9A 5PTPA 1WBGB 2JH5D 1XKAC 3T25A 1EZUC 5B6OA 3BG8A 3D62A 3AAUA 1P8VC 2G5VA 2YOLA 1AFEH 1ARCA 3UNRA 2C4FH 2FOMB 1MUEB 4AG2A 2XBXA 1HAIH 2B0FA 2RA0A 3F9GA 4OS5A 1F7ZA 2BVSH 4AN7A 1DICA 1DT2A 3VGCB 1UHBB 1NU7B 3T2NA 1O2PA 3P92A 4A92A 1OSSA 2D2DA 2QY0B 1AFQC 5HXFA 3PLPA 2OQUA 1G30B 1BRBE 3DFJA 1EPTA 1KTTB 3RXJA 3GCOA 1PPEE 3HATH 1RTKA 1O2YA 3ZZBA 4KTUA 3P17H 3SI3H 2PR3A 3SU2A 1UTOA 3FP7E 1P2QA 3F6UH 2EI6A 4WXVA 2C8ZB 2BD5A 1MD7A 2QYIA 1ZRKA 1GGDB 2J2UA 1GI9B 2Q6FA 2ZGHA 4KKDA 1C1NA 2J34A 1LPKB 3KF2A 2G81E 3F9HA 4LK4A 2A1DB 5GPIB 1TOMH 3RU4T 2ZPRA 2ZDAH 1C5UA 1PFXC 3MNSA 3URDA 1RRKA 1NROH 3SJ8A 3MU1A 1HAVA 2B7DH 4M7GA 2Z9KA 1TB6H 3BIVH 1SOZA 1CU1A 4XBCA 2G00A 5FXLA 1KLTA 2UWOA 1CO7E 3MH5A 3H7OA 1GJCB 3BTME 5L6NH 1ARBA 3B8JA 2P8OC 2CXVA 4D9RA 4IMQA 3I29A 2ANKH 5EU8A 1K1NA 1ZR0A 1P2JA 2GV6A 2BDAA 2P3UB 1CT2E 3TH2H 3PLKA 1Y3WA 2TGAA 4NA9H 3SV6A 3ZVAA 1C1VH 1W7GH 2Q6DA 1GI7B 1TGNA 2VVCA 4B75A 1GMCF 1YYY1 1LVBA 4JMYA 3UOUA 1Q3XA 1GBKA 1UHBA 3M3TA 5HM2A 2ZCKP 4WH8A 3GY3A 2R0KA 5J4SA 1PPZA 1RXPA 1ANDA 1GI4A 1N8OC 5JBBS 1CA0C 4CRFA 1O5EH 1P3CA 2SNWA 3BTKE 2BY5X 1DUEA 1T8NA 4X2VA 3T27A 1O3BA 3P8GA 2EI8A 2FOGA 3TK9A 1ETTH 1QRZA 1EATA 3TJVA 1O2TA 2NU0E 1J15A 3V13A 6LPRA 2B8OH 2IOTA 2VIWA 1K21H 1YPGH 5G4BA 1TX8A 1WQVH 4BTTB 1GBLA 1KDQB 1S83A 1TMBH 1JWTA 2G4TA 5HMAA 5FAHA 3ZVEA 1G3BA 1K1PA 1QHRB 2HALA 2HOBA 4KP0A 1O5DH 1IQFA 1OS8A 2A7CA 1C5YB 1HJ8A 3F68H 1WUNH 1B0FA 2VH0A 3KHVA 3RXAA 1ZPZA 1BTXA 1GGDC 3ZVBA 1QL9A 3QO6A 4Y8ZA 1C2FA 3PYHA 3VXFH 3S0NA 1GWAA 1ESBA 3MFJA 4UFFH 2FMJA 2Y80A 4CBNA 2BDIA 4NIYA 5A8ZA 2LPRA 3SUEA 3RC5A 1QIXB 3LPRA 1FY8E 1TIOA 1TGSZ 2OQ5A 2O8LA 3MNBA 5HM9A 1SGFG 2FESH 4TY7A 1BMLA 1TA2A 2R3YA 2VH6A 2Y6TA 2OBOA 1VZQH 3SGQE 3E0NB 5GDSH 2ZDVH 4NFFA 4AFUA 4SGAE 4DG4A 5L30H 1FPHH 2QA9E 2PFEA 4E05H 2BVXH 2XBWA 1UTMA 2OD3B 1C1QA 1QB1A 1BDAA 2W3IA 3LGVA 2AMDA 1O3GA 2F9VA 2GCHF 3GY6A 1LKBA 1GI8B 1TMUH 1O34A 2BD4A 4NIVA 1AVXA 1D9IA 1BTHH 3ESTA 1O2GH 1FDPA 2FWWA 2ANYA 4X8TH 2OC1A 1RIWC 1ELBA 1JOUB 1C2IA 1QY6A 2HNTC 3RXIA 4GHQA 1DWCH 2V0BA 1C2KA 4HGCA 1Z7KA 1EQ9A 3VXEH 4ISIH 4UDWH 4CRGA 2I6QA 1BTWA 1CQQA 3BN9A 1GI2A 1KDQA 5TCCA 1T4UH 4F49A 3FAOA 4NWKA 1BQYA 1Y5BT 3SJ9A 4H6SB 4FUFA 3HK6B 1SFQB 4X2XA 2ZCHP 1O3JA 1O2HA 2FLBH 3EGKH 4YM9A 5LGOA 4DIIH 1K22H 3LC3A 1ESAA 3BG4C 3FP6E 2QIQA 2QV1A 3I78A 3NPSA 4O97A 1GI1A 2XW9A 1ZGVA 3PWCA 2ZPSA 5JDUB 1F5LA 4UEHH 5EOKA 2WUCA 3RXOA 3H5CB 3MNCA 3SORA 2ZGXH 2BDHA 1S81A 1EJAA 1YC0A 1V2TT 4OGYA 2Y5FA 1HNEE 7ESTE 3GY8A 1P04A 1KXAA 1IQNA 1GCTB 3M5LA 1HDTH 4JK6A 1QA0A 1OOKB 1C1WH 3EA7A 4X1NU 2PLXA 1EAUA 1S5SA 3MOCA 1QJ7B 3LU9B 5DP9A 2XCFA 1L1JA 4CH8B 4Y76A 3LDXH 1BBRE 1MD8A 1OX1A 4MNXA 4OS6A 4ZAEA 4ZKOU 4XOJA 1BT7A 4ESTE 1DANH 4OS2A 3MHWU 3ITIA 1Z1IA 2CF9H 1UTQA 1SGYE 1GMDG 2BVRH 2PUXB 1ZJDA 1FUJA 5EQRA 2A4RA 1MCTA 4X1SU 1Z6EA 1A4WH 3D23A 4ZHLU 1OP8A 1TNIA 1V2QT 2V3HH 1MU8B 1AI8H 1GHXH 3DT0H 1QFKH 1KTSB 1J16A 3KQEA 1UVPA 3SBKA 1FI8A 1GG6B 2C8WB 2BOKA 4Y10E 3GY2A 1AY6H 3SNEA 4IC6A 5DP5A 1SGPE 1H8DH 2ZDKA 3UR9A 1DLKB 2BQWB 1GHVH 4BTIB 1O2JA 4A1VA 1P10A 2AIQA 5F03A 2J4IA 2FOEA 2ZU5A 1G3EA 3OSYA 1GHAF 1ESTA 4X1QU 1D3PB 6CHAB 4ISNA 4ZXXH 1C5XB 4UFEH 2VU8E 5EPYA 3EA8A 1GBBA 2H2ZA 4DVAU 5DP3A 2ANWA 4F4OC 1ZMLA 4YOIA 1C5TA 2A31A 2PKAB 1NM6A 2ALPA 3KGPA 1LTOA 2GDDA 2ZHQH 1CVWH 1F5KU 1SHYA 3QZRA 3ZVDA 1VR1H 1O2QA 3U69H 2XWBI 5SGAE 5GCHG 3RM0H 3GCTF 1XMNB 2ZO3H 4Y71A 3K65B 1P9UA 1HGTH 2BY6X 2K1QA 4JZ1A 1Y3XA 2ZU2A 1LPZB 4NGAH 1HV7A 1SGCA 3SU1A 1DOJA 4O3UA 1QRWA 2FTMA 1ACBE 1GMHG 1V2PT 3NXPA 3ATMA 3UUZA 1ZZZA 1TRYA 2BDBA 3AW1A 2ODYB 3RP2A 1F0RA 3PMAB 1GJDB 1H8IH 1S84A 3SQHE 1VITF 5FX5A 1O5FH 4XSKU 1GBIA 1UK3A 3TNSA 5IYTA 2VNTA 1A0HB 3SV2H 3SO3A 4I8KA 3K6YA 5EW2H 2F3CE 5DP6A 1CGHA 1EP6A 2F9OA 1C2MA 3FP8E 3UIRA 4ABFA 2WPIS 4XE4A 2QC2A 1YCPM 3URCA 3MO6A 2BLWA 2Z6BD 1HUTH 1W0ZU 3VB7A 3BEUA 4X6OA 2FM2A 3OYPA 3OY6U 3T5FH 4UONA 1XM1A 4ISOA 2IPHA 3RXMA 2GKVE 4GCHG 1O3LA 4BXWA 3IWMA 1C1OA 1ZPCA 5F8TA 4LOYH 1GJ8B 1NO9H
chains in the Genus database with same CATH superfamily
2RG3A 4JYUH 2A4QA 1PJPA 4R0IA 5LPRA 5E2OA 1AWFH 1ZHMA 2BHGA 1MKXH 1OPHB 1DPOA 1P2KA 1TGBA 3LH1A 4TY6A 1MH0A 1G2LA 5DJ7A 4CRBA 1FIWA 2VIDA 1ELEE 3GYLB 3SUDA 1GDUA 1M9UA 1OP0A 3T29A 5C1UA 2ZG0H 1D3QB 1OWEA 3SUFA 1UTPA 2ZDLA 1AB9B 2XYAA 2PKAA 2B9LA 2HNTE 3N99A 4JK5A 4ABJA 3RXBA 3M3SA 4Y79A 1QNJA 3NRLA 3RXSA 1F92A 4IW4E 3UR6A 3NWUA 3WY8A 5FCKA 2GV7A 2BD8A 3MTYA 5T6GA 2VJ1A 2QN5T 4GPGA 4ZUHA 7LPRA 5JYIA 1G9IE 3ZV8A 2ODQA 5CHAC 3B9FH 1GHBG 3E6PH 1TX6A 5ABWA 1B0EA 1FN8A 3GISB 4NZQA 1LQEA 1FMGA 3RC4A 1P2NA 1E36B 2DE9A 4KTCA 1NN6A 2A5IA 1EP5A 1NPMA 6ESTA 3ZVGA 7GCHF 1MMJN 3AASA 4Y0ZE 5C17A 2F9PA 3C27B 1XXFA 3TH3H 1BMAA 1GDQA 3A7WA 1BIOA 4U32A 1UMAH 3PO1B 2HRVA 4XBDA 2A2QH 3SV8A 4Q4LA 4A5TS 1TOCB 3MMGA 1V2VT 1GBJA 4TPIZ 2J9NA 4KTSA 5GIBA 2OC7A 3T62A 2H9EH 1HPGA 4NSYA 4TSFD 3STIA 2DUCA 1THPB 5T3HA 2YNAA 2M2AA 3N7DA 3RM2H 3UNSA 3ODDA 2BD3A 4VGCB 2GMTC 3SU0A 3KQBA 2CHAB 1BRCE 2H5DA 1YPJH 3U8RH 1BBRK 2AFQB 4AORA 1DUAA 2I6SA 2BY8X 1G2MA 4XBBA 1S0QA 2ASUB 1AZZA 2GT8A 1BITA 1C5MD 2IJOB 1O35A 4CHAC 4FVBA 4YT7H 4Y0YE 1P05A 4UFDH 2AHME 4GUXA 3A86A 1OWIA 1XUIA 1UJ1A 3QDZB 1Z71A 2HLDD 5DP4A 4K8YA 2Z94A 1KXEA 1C2HA 4X2WA 1E38B 2GCTC 4Z0KA 2VIQA 3IITA 8GCHF 3Q3KA 1XUGA 2G55A 2STBE 4AB9A 2GP9B 1O5CB 1UCYK 2SNVA 2WPMS 3BV9B 4X2YA 1T8OA 5KECA 1TWXB 2R3UA 1WTGH 4AZ2B 5GJ4B 1GHWH 3RU4E 2TGTA 2A4GA 2GDEH 3E0PB 1YWUA 1FNIA 2CN0H 1S6LA 2ZDMA 1QA7A 1P3EA 1O3AA 2FI3E 4HTCH 4NFEA 5FBEA 1DWBH 1EPTC 1EASA 1VCWA 4Q2KA 1H4WA 3VFEA 4NSVA 2RDEA 3RXTA 1P02A 1V2ST 2UUJB 2OBQA 1LHEH 2CMYA 1N6YA 3TITA 3FOAA 1BTZA 1CBWC 5L2YH 3NUMA 5E0HA 1PQ8A 3K2UA 4E7RG 3RXPA 5K7RA 1G32B 1TQ7B 2J94A 4YLQH 1P57B 2FOFA 1SQOA 2IN2A 2F83A 4JYVH 8LPRA 4ZMAH 5C1YA 3QUMP 1NBME 2SFAA 2TGDA 1GMCG 3DUXH 1DLEA 3VB5A 2D8WA 1SGRE 1SC8U 4FUEA 4DURA 3UFAA 1ID5H 4ABHA 2M5TA 1T31A 1GBCA 3HK3B 5HKKD 1TPAE 1C9TA 3UQVA 2AMPA 3BTFE 5K0HA 1E37B 3F2HA 4VGCC 1E0FD 1XUKA 2PSXA 1XVOA 1C5VA 1C2GA 1FLEE 4NIXA 3BF6H 2BY7X 3M5OA 3F9EA 4AYVB 3S9CA 3F9FA 3SU4A 3SJIA 4DY7B 2B5TB 1O5GH 2JDID 3KEEA 1SSXA 3P6ZB 1UVOA 2QF0A 4H6TA 3AW0A 4K1EA 4NZLA 2C93B 3ZIAD 5CE1A 1RJXB 3T28A 1Y3UA 3D49H 1P12E 2WYGA 3P8NA 3SU6A 1FONA 4B2AA 4ABAA 4ASHA 3RDZA 1DDJA 4WVPE 1TGCA 3A88A 1DWEH 3NZIA 3FKSD 3PM3A 4XDEA 3BSQA 3CS7A 3TK5A 4A1TA 2O9QA 3TGJE 1AQ7A 3BTTE 4I31A 2OTVA 1WOFA 1TBZH 1YLCA 1G3CA 3DFLA 3ATLA 4BNRA 3VGCC 1AZ8A 2ESTE 2FPZA 1A3EH 1CGIE 4B73A 1MTVA 2HGTH 3ZZ5A 4OGXA 3V0XA 2SGDE 4INHA 1OXGA 2HVXA 5B6LA 2QCYA 3R3GB 2F9UA 3MH7A 2GZ9A 3JZ1B 4YO9A 3TIUA 1O3KA 3ZZ4A 1FAKH 2EC9H 1L4ZA 2F9BH 2ZIQH 3ZYDA 1SPJA 2FYQA 2GTBA 1FY3A 3M61U 1EKBB 4JYTA 1HYLA 2KFWA 1HAZB 1F0UA 3KL6A 4Y7BA 2WV5A 3BTQE 2WPJS 5ETXA 1CGJE 1AVWA 1AGJA 1TA6A 1DY8A 3BTDE 2ZF0H 1BMMH 1TX7A 1ELDE 4Y11E 3RXVA 4UFGH 2BOHB 5T6DA 2FIRH 1NFXA 1K1LA 1O2XA 1FXYA 1FY1A 1YPLH 1UK4A 4CREA 1JBUH 3A8CA 3P8OA 4X8SH 2BD7A 3M37A 4CRAA 5EXLA 5A0CA 2P94A 4ZXYH 3RXKA 1SMFE 1UVUH 1FV9A 2F91A 3V3MA 2KAIB 1BBRH 3RXCA 1RGQA 4U2WA 4NIWA 1C5QA 2ZDNA 1D3DB 1O38A 3QGJA 3E16B 5DK1A 4WF8A 5E8EH 4K2YA 1LKAA 1K1MA 4I8JA 1A61H 1QL7A 1F0TA 1ZPBA 2P16A 5DP8A 4CR5A 3TGIE 1W10U 3PMHB 3RMNH 1SVPA 1YPKH 1GBTA 1HAXB 1ABJH 5JB9S 1MZDA 1IOEA 4WMEA 2UWPA 3M3VA 3MH4A 1WQSA 1QRXA 1V6DA 1A1RA 3U98H 3O8CA 1MTWA 2PP6A 2OK5A 3Q3XA 3BEFB 1W8BH 1MTNB 1HAOH 2ZTXA 1QTFA 1C1MA 1CT4E 1LHFH 1MAYA 4RT1A 2RFKC 1W0JD 3K6ZA 2RA3A 3ZZDA 1UCYH 1GBFA 2Y81A 5E0JA 4YLUA 1KXCA 2PKSB 2Z3DA 1BRAA 5CMXH 1CT0E 1S6FA 2PGQB 3S9BA 3A82A 1KIGH 2ANMH 1ANBA 1IQHA 1HAPH 2AS9A 3M36A 2P95A 5AF9H 3QK1A 3ZZ7A 3GCNA 1SLXB 1D4PB 3MNXA 5ESTE 3PMBB 1C2DA 4YTAA 5DG6A 3AAVA 2PSYA 2FI4E 2WV9A 1SBWA 1Y5UT 1D6WA 2BY9X 3A7VA 4Y8YA 3U1IB 2XC5A 5KGOA 1O3PB 1E79D 1MKXK 2OUAA 4K60A 1OWJA 4HI3A 2HNTF 2Z7FE 1ORFA 1LHDH 2Q1JA 2BLOA 1HXFH 2G8TA 1WTHD 1Z8RA 2IPQX 1CHGA 3LGIA 3QTVH 4OS1A 5KEDA 2TIOA 2AGEX 1NS3A 3BTGE 1SLWB 2STAE 4MNYA 2CGAA 4I33A 4X8UH 3A7YA 1Y59T 1Y3VA 5A2MH 2KAIA 2J38A 2THFB 1OWHA 1SQRA 1GJ5H 3UWIA 4PROA 3TU7H 3QGNB 2PWXA 1TLDA 4FUDA 1DWDH 3PRDA 1C4U2 1EJMA 1QJ6B 1RS0A 4JZFH 5C5NA 4Q63A 1EUFA 2C90B 1ELFA 4YOGA 2Z9GA 3PROA 2BX4A 1NZQH 2W6JD 4X6NA 1YM0A 1W0KD 2ZZUH 2QF4A 1B5GH 1K2I1 3TPIZ 1ELGA 3SZNA 1NRPH 2J98B 1GHAG 1PQAA 4IN1A 4YZUA 1JMOH 2VWNA 2ZEBA 1O3MA 2Q6GA 3FN8A 3RMOH 3OTPA 1GJAB 5FPSA 1N1LA 1NRNH 2IJD1 1OYQA 3WWBA 1GBHA 5C2ZA 1E1RD 2SGFE 1C5RA 5EG4A 2ZC9H 1MQ5A 2SGEE 2FTLE 1K1IA 3EE0B 4WJG2 1O3HA 3GS9A 3PWBA 3ZZCA 3RXHA 3PTBA 4BXSA 2XWAA 1BRUP 2PHBA 3LKWA 3W94A 3STJA 1O2IA 4INLA 4WMDA 2O8UA 3HKIB 2CF8H 1GHYH 1UCYE 2VIOA 3GY7A 3MI4A 3U1JB 5JB8S 5E2PA 1O3FA 2V35A 3GCTG 2XBYA 1MU6B 1WCZA 1ZTLA 1O5AB 3SNCA 1C1RA 3SZEA 1WXRA 1GL0E 1BHXB 4YOJA 1D3TB 3O8BA 4B74A 2ZFPH 2XXLA 3LONA 4AYYB 1HFDA 5GWZA 5L2ZH 1GJBB 2R2WU 3EQ0H 2VGCB 4NA8A 1UVSH 2ZQ1A 3JZ2B 4A7IB 4E06H 3KCGH 1HB0B 3L3TA 5EXNA 4TT3D 5I25A 1VCPA 2JH0D 1C1PA 3UOPA 5EQQA 1O2KA 3RC6A 1TNKA 5FPYA 1YCPK 1C4V2 3LGTA 1K0HA 2AERH 5C3NA 1DX5M 4IN2A 3ZZ6A 1W3CA 1GMDF 1W13U 1E34B 3LGUA 2Y5GA 1EB1H 1Z8GA 4BANB 2XTTB 1NC6A 2BM2A 2FOAA 1KXFA 4H4FA 1GBDA 3LJOA 1GCDA 3G01A 4BTUB 2FLRH 4X8VH 1E35B 2FP7B 2BB4A 3SV7A 1GCTC 1LCYA 2ZNKH 1HJAB 3BTEE 3GCHB 1O37A 3A85A 1LHCH 4Q80A 1J14A 1O2NA 2AYWA 3F2FA 3A7XA 4D7GA 4FETA 6GCHF 1P2MA 2JETB 4OS7A 5DN6D 2J98A 4ABGA 3BTWE 2H9TH 3OU0A 1CE5A 1C5OH 1J8AA 1FJSA 4BOHA 1XXDA 2J92A 3MU5A 2FZZA 1ELTA 3OE7D 2A7JA 2WPKS 4ZH8A 3BEIB 3CENA 2ZFQH 4MVNA 1MZAA 4CRDA 2XRCA 2KM0A 1QZ8A 3VPKA 4BAHB 4F48B 1Z6JH 3RXQA 2W7UA 3QWCH 2XBVA 1LPGB 1HLTH 2BQ6B 3DD2H 4B71A 2PGBB 2GX4A 2K0QA 3GDVA 4YESB 3CP7A 1QGFA 4RSPA 3M7QA 3PB1E 3GDUA 4MPVA 4MNVA 1SB1H 4WMFA 5J4QA 3L6PA 1TABE 1CHOG 1GG6C 3HKJB 2L6OA 1TBRH 5GNDA 3TVJB 1VGCB 8KME2 4FVDA 2EEKA 4ZHAA 1L1GA 4DIHH 1WDIA 2ODPA 1DXPA 1DM4B 1SFIA 4Y6DA 4FUGA 2NU1E 2JJ2D 4DCDA 1ETSH 2BDGA 2C8YB 2H9HA 4IBLH 1ELAA 1H9IE 5F53A 6CHAC 2VVUA 1BHXF 3ATKA 1C5LH 1LMWB 1XUJA 1T7CA 4MTBA 2BMGB 1P0SH 2YNBA 3HPTB 2PTCE 2HPPH 2FX6A 3K9XB 3KQCA 1FPCH 2ZTZA 1ZOMA 4RT0A 4LXBH 1T8LA 1O2MA 4MPXA 2O8WA 3VEQB 1NT1A 2ZWLH 5DPAA 3D65E 1BOQA 2O8MA 2HPQH 3PV2A 1AFQB 5DGJA 1UK2A 1QCPA 1MKWK 1OWDA 2VINA 2FX4A 3MO3A 2W5EA 3ENSB 1BA8B 1UW7A 3AK5A 5C1XA 1SQAA 3V7TA 2R2MB 1Q31A 1Y3YA 5A09A 1C5ZB 1O2WA 3B23B 4X1RU 5JPMH 3GY4A 3A84A 2AEIH 1A2CH 1O5BB 4OS4A 3TH4H 5AFZH 3SNBA 4CR9A 1JXPA 1NTPA 3UREA 3EDXB 4D9QA 1U6QA 5E0GA 1RD3B 3QZQA 3A81A 3MU0A 4FUHA 1GHZA 2D1JA 1KYNA 4KGAA 1PPHE 3SV9A 3SU5A 3GICB 1A5GH 3EA9A 1MAXA 3QX5H 2AMQA 2KCAA 2YMSB 5EGMA 3QLPH 3TLOA 5FPTA 2Z3CA 3ZVFA 1C5PA 3S69A 4ZHMU 4AFSA 1SLVB 2LELA 3FZDA 1O2LA 1V2WT 1TRNA 3RXDA 3RXGA 2BZAA 3SNAA 3C1KA 3ELAH 1O3NA 2LNCA 4ZKNU 3ATIA 5ESBA 4BAMB 5LPEA 2EI7A 1V2OT 2A5KA 2AH4X 4Q7YA 5A8YA 1LDTT 2ZFSA 2BDCA 1FN6A 3WWFA 1KLJH 4NWLA 1TQ0B 1GHBF 2P8OB 3A80A 1HAVB 2XNIA 1YF4A 2K8IA 3CNRA 3LH3A 1IQEA 4K8BA 5C5OA 1IQGA 4I7YH 1FY4A 5GXPA 1V2MT 1ZYOA 2XOKD 2ZGCA 1PPFE 2W7SA 1HAYB 5HGGA 1HBTH 1AB9C 3M5MA 1O3IA 3PLBA 3O8DA 1YCPH 4IMZA 1JIMA 2ALVA 4X6MA 2WSSD 3KYGA 4ISLA 3P8FA 4MQAA 5T1VA 3EAJA 5C20A 4CBOA 2WINI 1N8OB 3A83A 1CA0B 1DSTA 2ZQ2A 2VWLA 1T32A 1MQ6A 1TRMA 2A0QB 3UY9A 1V2JT 2ZCLP 2A32A 1P06A 4AOQA 2SGQE 3U8TH 2ZI2H 1NFUA 5LPFA 1SI5H 2GZ7A 3PRBA 2OXSA 2PW8H 2Y7ZA 1ZMJA 1INCA 1L2EA 1O2VA 3W95A 1AN1E 1BTPA 1YKTA 3KQDA 1UTNA 2ZFRH 1LHGH 3SJOA 4RI0A 1NESE 3MU4A 1HAGE 3S7KB 1O2ZA 2FDAA 4IGDA 3RXEA 2EY4C 1BTYA 1THSH 1F2SE 1JRSA 3FFGA 5T6FA 2EA3A 1UVTH 2TRMA 2ZHFH 3LC5A 2OP9A 3OY5U 1ETRH 3FANA 3PO1C 1O39A 1BJVA 2V3MA 1AVGH 2RCEA 1EAWA 2G5NA 4E7NA 1L1NA 3S9AA 3RXUA 1NRQH 2KR7A 1PPGE 1QB6A 1DSUA 4WH6A 1GPZA 1ZTJA 1GBEA 4AFZA 1WV7H 2Z9IA 3M7UA 3SGBE 3E3TA 4D76A 1NRRH 4TYDA 1EX3A 1QBNA 2FOHA 4B6FA 2CHAC 1C5WB 2A5AA 2BYAX 1PPCE 1H9LB 3F0PA 3E1XB 1IQKA 1H1BA 1RTLA 1F0SA 1O30A 1GBAA 4ZROA 1AD8H 2BD9A 4DJZB 1A5IA 5FCRA 2GGVB 1EAIA 1BB0B 3Q00A 2BDYA 1TMTH 2QF5A 2ZGJA 4DT7B 3ODFA 1P01A 1TGTA 1ZTKA 1BZXE 2O8TA 2ZHEH 4IS5A 1UTLM 2BZ6H 3GY5A 3LT3A 1ZJKA 3F3BA 4I32A 1SR5C 3WW7A 5F8ZA 2VWMA 2VIVA 1TBQH 1LQDB 2PUQH 1IAUA 1V2UT 1VJ9U 2HLCA 3O8RA 4DOQA 5EPNA 2WPDD 1TNGA 1IQMA 1HCGA 1YPEH 1MTUA 3EYDA 4GSOA 4GHTA 4RN6A 1SQTA 5EXMA 1O2SA 1TE0A 1TFXA 1RIWB 2OLGA 1XKBC 4FU9A 2BTCE 2H1UA 1DFPA 3BTHE 3U28C 1B7XB 1MKWH 1EZQA 1FAXA 2EQNA 4MPUA 1GVLA 1J9CH 2P59A 5AFYH 1L0ZA 3AVZA 4ASUD 3RU4D 3SHAH 4FXGH 1P09A 3SJKA 2Y5HA 1SGDE 3SW2B 4B76A 3F2GA 5EODA 3A8BA 4K3JA 3OEED 4WXIA 1AWHB 1BCUH 4O3TA 1ZHPA 2ZHDA 4FUCA 2ZA5A 4JZIA 2GD4B 2GZ8A 1ZSJA 2BLQA 1Y5AT 1WAYB 2GCHG 1UO6A 5CHBA 1DXWA 3S7HB 1K1OA 4JZEH 1OWKA 1SL3A 4Q7XA 1HXEH 1YBWA 1DS2E 3BG4B 1TAWA 1X7AC 1LVOA 3E90B 2W26A 3TJNA 3V12A 2ZPQA 1AE8H 3PMJA 1P2OA 4TPYA 1NBMD 3UQOA 2J97A 1O32A 2A2XH 4NCYA 2FOCA 2HWLB 1A46H 1JRTA 4O9VA 2FYRA 1O2UA 4WY3A 1SGQE 1YLDA 2UUFB 3ZZ8A 2Y82A 1PQ5A 1NRSH 1AUTC 2CV3A 4HZHA 2RDLA 1DY9A 1S85A 3HGNA 3RMLH 1XUHA 1AHTH 1AO5A 2BXUH 1GDNA 2G52A 4NG9H 1ZMNA 1MTSA 5IK2D 2VBCA 1RFNA 1O3DA 3UTUH 1C9PA 3GYMA 1HJ9A 1IHTH 4MDSA 1O2RA 2W3KA 1G3DA 1Y8TA 2V7QD 3MO9A 3ZVCA 2OCVB 2VWOA 3N7OA 4K1TA 1SGFA 1GJ4H 2OC0A 2FXRA 4RKOB 2WPHS 1NFYA 4Y7AA 1FIZA 4B2BA 3MU8A 4JCNA 1ANCA 1QQUA 2BQ7B 2QXIA 1C5SA 4ABIA 5JBAS 1TNLA 3Q77A 5HIYA 1O36A 2ZU3A 2ZTYA 1ZRBA 1ZSLA 1ZSKA 1Z8JB 1DITH 1YPHC 3LOXA 5TJXA 1S0RA 2KZ4A 3UNQA 2FS9A 4XRNA 1OP2A 1Z1JA 4F55A 2FI5E 2TBSA 2UUKB 4LZ4B 1NFWA 3LGYA 1HIAB 4ABBA 5FX6A 2AIPA 1V2RT 1CA8B 1AKSB 4SGBE 1UTJA 3LGWA 4FU7A 4ZKSU 1K1JA 4HFPB 4FUJA 1F5RA 2WV4A 2F9NA 3KIDU 1EOJA 1HAHH 3NKKA 4MLFB 3CS0A 3ZZ9A 4DGJA 3LJJA 1TYNA 2DE8A 3NCLA 4AX9H 5BPEA 4GAWA 3KYFA 2GT7A 2QE7D 1THRH 4MNWA 1A0LA 3UWJH 5F8XA 1UTKA 9LPRA 4Q7ZA 2ZU4A 4A6LA 1GBMA 3IG6B 3ZZ3A 1ELVA 1TPPA 2A4OA 2QAAA 1ZLRA 1EAXA 5LH8A 3E91A 1EJNA 2AGGX 5H4IB 3M5NA 2WHXA 1DE7H 1OYTH 1PYTD 3HGPA 4ACAA 4BAKB 4K69A 4YT6H 1WSSH 5CDFE 1GVZA 2VB0A 1A3BH 3OTJE 2R9PA 3TGKE 3VB4A 2J5UA 1QQ4A 2P3TB 3OX7U 2ZGBH 1KY9A 2ZKSA 3R0FA 5I46H 3U9AH 4CH2B 1ELCA 3PTNA 2XC4A 5DP7A 3SUGA 1JIRA 4ABEA 1C4Y2 1FZZA 1ANEA 3DHKH 1O2OA 2ULLA 1PPBH 1MTNC 2NU3E 2NWNA 1KSNA 1XVMA 3FVFB 1SG8B 2D26C 4X6PA 3A8DA 2PKSC 1VJAU 2R0LA 4J2YB 5BRRE 1COWD 1T8MA 5FBIA 4IC5A 3GDSA 3RUOA 1IQJA 2QXJA 1LVMA 3SI4H 2OC8A 2AGIX 3ZYEA 4I8HA 1G36A 1O3EA 1V2LT 3M35A 3UAIC 4K5ZA 1SHHB 2FS8A 2TGPZ 1W14U 1P9SA 5IDKA 1V3XA 4ZKRU 2H5CA 2WPLS 4D8NA 1H8ED 1HIAA 4FUIA 4R8TB 3A7TA 1AKSA 1GI3A 2P93A 2VVVA 4AB8A 4AGKA 2G51A 1A7SA 1FY5A 1NU9A 4QT8C 4THNH 3ZZAA 1OKXA 1Z8IB 3GOVB 3M7TA 4YXWD 6GCHG 2WYJA 1W2KH 2UUYA 3A89A 4CRCA 2JH6D 4B1TA 1V2NT 1VITG 4XFQA 3MYWA 3DA9B 1O31A 2Z9JA 1LO6A 1IQIA 1GI0A 3SNDA 4UE7H 3QN7A 4I8GA 4INKA 1KMHB 1QB9A 3RLYH 1W11U 2WUBA 1TPSA 4B2CA 4DW2U 4WWYA 1QL8A 2ILNA 2JJ1D 2QXGA 4KELA 1O3CA 1Q2WA 3OAAD 2CJIA 3FZZA 3P95A 4FU8A 1C2EA 1C1TA 1S6HA 2NU4E 1QBVH 3PV4A 2QF3A 4FUBA 4U30A 2XCNA 1EOLA 4NA7A 3Q76A 1GJ6A 1K28D 1D6RA 2V3OH 3MH6A 3SN8A 5CHAB 2J95A 3RXFA 1ZHRA 4Z6AH 1BMNH 1C1UH 2TPIZ 2VIPA 2Z9LA 1XX9A 3SQEE 5EJLA 3UPEA 4A1XA 4Y8XA 4AGJA 1BJUA 4H42U 3A8AA 3U8OH 1ABIH 2QXHA 2BX3A 2ZU1A 1IQLA 5TCAA 4J1YA 3OFND 1SGEE 4ABDA 1O0DH 1ZGIA 1WU1A 1OHHD 1AU8A 2YMSD 1AIXH 5C67A 4X0WU 1RTFB 2FOBA 1GJ9B 5F6MA 2G4UA 3TNTA 3I77A 4LZ1H 1K9OE 2PTNA 1TNHA 1A5HA 3PV5A 1CSOE 2JKHA 2NU2E 3Q3YA 4HG6A 4MG3A 2ZFFH 3DSOA 1SOTA 1SGNE 1N6XA 2FO9A 1P11E 3MWIU 3NK8A 2XC0A 3VB6A 4BAOB 1C2LA 3RLWH 3ZV9A 2UWLA 5GCHF 2A7HA 2V6NA 2GMTB 1L4DA 4ISHH 3RXLA 1QJ1B 1W12U 1GI5A 1NY22 1P2IA 2C8XB 5A0AE 1EZXC 4MPWA 3F1SB 2P3FH 3RMMH 1PQ7A 1O33A 2BXTH 5EQSA 1YGCH 3QTOH 1AMHA 1O3OA 8ESTE 4CHAB 1GMHF 4D7FA 1WYKA 7GCHG 1IHSH 2VGCC 2FEQH 3P70B 3T26A 5A8XA 1H9HE 1SLUB 1HRTH 5JBTA 3E8LA 3SGAE 1QBOA 4TWYA 1MCVA 1C2JA 5A0BA 4U01A 1KXBA 3H7TA 2ZHWH 2GCTB 4FOUC 4UD9H 3TJUA 4AFQA 1GL1A 5AHGH 1W0YH 2PV9B 1FQ3A 3KQ5A 1W7XH 1YLNA 3SOSA 1MBQA 1GI6A 4GLYA 1KLIH 1V2KT 4XD7D 1EZSC 1YPHE 1TONA 1YPMH 3L33A 4BAQB 3A7ZA 3KN2A 2Z3EA 2Y7XA 1SGTA 1QURH 4O03A 2SGPE 3GCHC 1HJAC 1CHOF 5DO4H 2WZQA 3KNXA 2KX4A 1AE5A 1EPTB 1GJ7B 2BD2A 4GCHF 5AVDA 4AG1A 1TNJA 5EW1H 1G37A 1DVAH 1PYTC 1QR3E 2JETC 2FODA 3TK6A 1EB2A 5JBCS 1BUIA 2C3SA 1J17T 3LIWA 2OINA 1TALA 1E1QD 2H6MA 1A0JA 1CBWB 2GVFA 4K1SA 5FHTA 8GCHG 1SGIB 4JZDH 1VITH 9ESTA 7KMEH 2SGAA 1BTUA 4RKJB 2KCOA 1P03A 3A87A 3SHCH 3VB3A 1C5NH 1GVKB 3RXRA 2BLVA 2ZP0H 1SKYE 3BIUH 1AUJA 3SU3A 2ZFTA 3TJOA 5HYOA 4TWWA 1VCQA 2XNDD 1VGCC 2F4LA 1S82A 2ZECA 1XUFA 1T4VH 1LVYA 1TPOA 5DKMA 1EXFA 1MBMA 4GVUA 2QGRA 4ZCNA 4I8LA 3ATWA 2A45B 1KXDA 1C1SA 4X1PU 1YP9A 3SYJA 5PTPA 1WBGB 2CK3D 2JH5D 1XKAC 3T25A 5C0TA 1EZUC 5B6OA 3BG8A 3D62A 3AAUA 1P8VC 2G5VA 2LP6A 2YOLA 1AFEH 1ARCA 3UNRA 2C4FH 2FOMB 1MUEB 4AG2A 2XBXA 1HAIH 2B0FA 2KCPA 2RA0A 3F9GA 4OS5A 1F7ZA 2BVSH 4AN7A 1DICA 1DT2A 3VGCB 1UHBB 1NU7B 3T2NA 1O2PA 3P92A 4A92A 1OSSA 2D2DA 2QY0B 1AFQC 5HXFA 3PLPA 2OQUA 5FL7D 1G30B 1BRBE 3DFJA 1EPTA 1KTTB 3RXJA 3GCOA 1PPEE 3HATH 1RTKA 1O2YA 3ZZBA 2JIZD 4KTUA 3P17H 3SI3H 4B6EA 2PR3A 3SU2A 1UTOA 3FP7E 1P2QA 3F6UH 2EI6A 4WXVA 2C8ZB 1H8HD 2BD5A 5EIYA 1MD7A 1EFRD 2QYIA 1ZRKA 1GGDB 2J2UA 1GI9B 2Q6FA 2ZGHA 4KKDA 1C1NA 2J34A 1LPKB 3KF2A 2G81E 3F9HA 4LK4A 2A1DB 5GPIB 1TOMH 3RU4T 2YMSC 2ZPRA 2ZDAH 1C5UA 1PFXC 3MNSA 3URDA 1RRKA 1NROH 3SJ8A 3MU1A 1HAVA 2B7DH 4M7GA 2Z9KA 1TB6H 3BIVH 1SOZA 1CU1A 4XBCA 2G00A 5FXLA 1KLTA 2UWOA 1CO7E 3MH5A 3H7OA 1GJCB 3BTME 5EJ1A 5L6NH 1ARBA 3B8JA 3DCLA 2P8OC 2CXVA 4D9RA 1MABB 4IMQA 3I29A 2ANKH 5EU8A 4AC9A 1K1NA 1ZR0A 1P2JA 2GV6A 2BDAA 2P3UB 1CT2E 3TH2H 3PLKA 1Y3WA 2TGAA 4NA9H 3SV6A 3ZVAA 1C1VH 1W7GH 2Q6DA 1GI7B 1TGNA 2VVCA 4B75A 1GMCF 1YYY1 1LVBA 4JMYA 5EJZA 3UOUA 1Q3XA 1GBKA 1UHBA 3M3TA 5HM2A 2ZCKP 4WH8A 3GY3A 2R0KA 5J4SA 1PPZA 1RXPA 1ANDA 1GI4A 1N8OC 5JBBS 1CA0C 4CRFA 1O5EH 4I86A 1P3CA 2SNWA 3BTKE 2BY5X 3H09A 1DUEA 1T8NA 4X2VA 3T27A 1O3BA 3P8GA 2EI8A 2FOGA 3TK9A 1ETTH 4OM9A 1QRZA 1EATA 4DT4A 3TJVA 1O2TA 2NU0E 1J15A 3V13A 6LPRA 2B8OH 2IOTA 2VIWA 1K21H 1YPGH 5G4BA 1TX8A 1BMFD 1WQVH 4BTTB 1GBLA 1KDQB 1S83A 1TMBH 1JWTA 2G4TA 5HMAA 5FAHA 3ZVEA 1G3BA 1K1PA 1QHRB 2HALA 2HOBA 4KP0A 1O5DH 1IQFA 1OS8A 2A7CA 1C5YB 1HJ8A 3F68H 1WUNH 1B0FA 2VH0A 3KHVA 3RXAA 1ZPZA 1BTXA 1GGDC 3ZVBA 1QL9A 3QO6A 4Y8ZA 1C2FA 3PYHA 3VXFH 3S0NA 1GWAA 1ESBA 3MFJA 3OEHD 4UFFH 2FMJA 2Y80A 3DSGA 4CBNA 3EE7A 2BDIA 4NIYA 5A8ZA 2LPRA 3SUEA 3RC5A 1QIXB 3LPRA 1FY8E 1TIOA 1TGSZ 2OQ5A 2L74A 2O8LA 3MNBA 5HM9A 1SGFG 2FESH 4TY7A 1BMLA 1TA2A 2R3YA 2VH6A 2Y6TA 2OBOA 3VG8A 1VZQH 3SGQE 3E0NB 5GDSH 2ZDVH 4NFFA 4AFUA 4SGAE 4DG4A 5L30H 1FPHH 2QA9E 2PFEA 4E05H 2BVXH 5C94A 2XBWA 1UTMA 2OD3B 1C1QA 1QB1A 1BDAA 2W3IA 3LGVA 2AMDA 1O3GA 2F9VA 2GCHF 3GY6A 1LKBA 1GI8B 1TMUH 1O34A 2BD4A 4NIVA 1AVXA 1D9IA 1BTHH 3ESTA 4P02A 1O2GH 1FDPA 2FWWA 2ANYA 4X8TH 2OC1A 1RIWC 1ELBA 1JOUB 1C2IA 1QY6A 2HNTC 3RXIA 4GHQA 1DWCH 2V0BA 1C2KA 4HGCA 1Z7KA 1EQ9A 3VXEH 4ISIH 4UDWH 4CRGA 2I6QA 1BTWA 1CQQA 3BN9A 1GI2A 1KDQA 5TCCA 1T4UH 4F49A 3FAOA 4NWKA 1BQYA 1Y5BT 3SJ9A 4H6SB 4FUFA 3HK6B 1SFQB 4X2XA 2ZCHP 1O3JA 1O2HA 2FLBH 3EGKH 4YM9A 3F0OA 5LGOA 4DIIH 1K22H 3LC3A 1ESAA 3BG4C 3FP6E 2QIQA 2QV1A 3I78A 3NPSA 4O97A 1GI1A 2XW9A 1ZGVA 3PWCA 5C0UA 2ZPSA 5HIZA 5JDUB 1F5LA 4UEHH 5EOKA 2WUCA 3RXOA 3H5CB 3MNCA 3SORA 2ZGXH 2BDHA 1S81A 1EJAA 1YC0A 1V2TT 4OGYA 4ACBA 2Y5FA 1HNEE 7ESTE 3GY8A 1P04A 1KXAA 1IQNA 1GCTB 3M5LA 1HDTH 4JK6A 1QA0A 1OOKB 1C1WH 3EA7A 4X1NU 2PLXA 1EAUA 1S5SA 3MOCA 1QJ7B 3LU9B 5DP9A 2XCFA 1L1JA 4CH8B 4Y76A 3LDXH 1BBRE 1MD8A 1OX1A 4MNXA 4OS6A 4ZAEA 2KCYA 5DSFA 4ZKOU 4XOJA 1BT7A 4ESTE 1DANH 4OS2A 3MHWU 3ITIA 1Z1IA 2CF9H 1UTQA 1SGYE 1GMDG 2BVRH 2PUXB 1ZJDA 1FUJA 5EQRA 2A4RA 1MCTA 4X1SU 1Z6EA 1A4WH 3D23A 4ZHLU 1OP8A 1TNIA 1V2QT 2V3HH 1MU8B 1AI8H 1GHXH 3DT0H 1QFKH 1KTSB 3FO8D 1J16A 3KQEA 1UVPA 3SBKA 1FI8A 1GG6B 2HVYB 2C8WB 2BOKA 4Y10E 3GY2A 1AY6H 3SNEA 4IC6A 5DP5A 1SGPE 1H8DH 2ZDKA 3UR9A 1DLKB 2BQWB 1GHVH 4BTIB 1O2JA 4A1VA 1P10A 2AIQA 5F03A 3DSPA 2J4IA 2FOEA 2ZU5A 1G3EA 3OSYA 1GHAF 1ESTA 4X1QU 1D3PB 2W6ID 6CHAB 4ISNA 4ZXXH 1C5XB 4UFEH 2VU8E 5EPYA 3EA8A 1GBBA 2H2ZA 4DVAU 5DP3A 1FX0B 2ANWA 4F4OC 1ZMLA 4YOIA 1C5TA 2A31A 2PKAB 4M9FA 1NM6A 2ALPA 3MQKC 3KGPA 1LTOA 2GDDA 2ZHQH 1CVWH 1F5KU 1VKYA 1SHYA 3QZRA 3N7EA 3ZVDA 1VR1H 1O2QA 3U69H 2XWBI 5SGAE 2F43B 5GCHG 3RM0H 4P00A 3GCTF 1XMNB 2ZO3H 4Y71A 3K65B 1P9UA 1HGTH 2GJGA 2BY6X 3UB0A 2K1QA 4JZ1A 1Y3XA 2ZU2A 1LPZB 4NGAH 1HV7A 1SGCA 3SU1A 1DOJA 4O3UA 1QRWA 2FTMA 1ACBE 1GMHG 1V2PT 3NXPA 3ATMA 3UUZA 1ZZZA 1TRYA 2BDBA 3AW1A 2ODYB 3RP2A 1F0RA 3PMAB 4Z1MD 1GJDB 1H8IH 1S84A 3SQHE 1VITF 5FX5A 1O5FH 4XSKU 1GBIA 1UK3A 3TNSA 5IYTA 2VNTA 1A0HB 3SV2H 3SO3A 4I8KA 3K6YA 5EW2H 2F3CE 5DP6A 1CGHA 1EP6A 2F9OA 1C2MA 3FP8E 3UIRA 4ABFA 2WPIS 4XE4A 1YY3A 2QC2A 1YCPM 3URCA 3MO6A 3W1EA 2BLWA 2Z6BD 1HUTH 1W0ZU 3VB7A 3BEUA 4X6OA 2FM2A 3OYPA 3OY6U 3T5FH 4UONA 1XM1A 4ISOA 2IPHA 3RXMA 2GKVE 4GCHG 1O3LA 4BXWA 3IWMA 1C1OA 1ZPCA 5F8TA 4LOYH 1GJ8B 1NO9H
chains in the Genus database with same CATH topology
2RG3A 4JYUH 2A4QA 1PJPA 4R0IA 5LPRA 5E2OA 1AWFH 1ZHMA 2BHGA 1MKXH 1OPHB 1DPOA 1P2KA 1TGBA 3LH1A 4TY6A 1MH0A 1G2LA 5DJ7A 4CRBA 1FIWA 2VIDA 1ELEE 3GYLB 3SUDA 1GDUA 1M9UA 1OP0A 3T29A 5C1UA 2ZG0H 1D3QB 1OWEA 3SUFA 1UTPA 2ZDLA 1AB9B 2XYAA 2PKAA 2B9LA 2HNTE 4JK5A 4ABJA 3RXBA 3M3SA 4Y79A 1QNJA 3RXSA 1F92A 4IW4E 3UR6A 3NWUA 3WY8A 5FCKA 2GV7A 2BD8A 3MTYA 5T6GA 2VJ1A 2QN5T 4GPGA 4ZUHA 7LPRA 5JYIA 1G9IE 3ZV8A 2ODQA 5CHAC 3B9FH 1GHBG 3E6PH 1TX6A 5ABWA 1B0EA 1FN8A 3GISB 4NZQA 1LQEA 1FMGA 3RC4A 1P2NA 1E36B 2DE9A 4KTCA 1NN6A 2A5IA 1EP5A 1NPMA 6ESTA 3ZVGA 7GCHF 1MMJN 3AASA 4Y0ZE 2F9PA 3C27B 1XXFA 3TH3H 1BMAA 1GDQA 3A7WA 1BIOA 4U32A 1UMAH 3PO1B 2HRVA 4XBDA 2A2QH 3SV8A 4A5TS 1TOCB 3MMGA 1V2VT 1GBJA 4TPIZ 2J9NA 4KTSA 5GIBA 2OC7A 3T62A 2H9EH 1HPGA 4NSYA 3STIA 2DUCA 1THPB 5T3HA 2YNAA 3RM2H 3UNSA 3ODDA 2BD3A 4VGCB 2GMTC 3SU0A 3KQBA 2CHAB 1BRCE 2H5DA 1YPJH 3U8RH 1BBRK 2AFQB 4AORA 1DUAA 2I6SA 2BY8X 1G2MA 4XBBA 1S0QA 2ASUB 1AZZA 2GT8A 1BITA 1C5MD 2IJOB 1O35A 4CHAC 4FVBA 4YT7H 4Y0YE 1P05A 4UFDH 4GUXA 3A86A 1OWIA 1XUIA 1UJ1A 3QDZB 1Z71A 5DP4A 4K8YA 2Z94A 1KXEA 1C2HA 4X2WA 1E38B 2GCTC 4Z0KA 2VIQA 3IITA 8GCHF 3Q3KA 1XUGA 2G55A 2STBE 4AB9A 2GP9B 1O5CB 1UCYK 2SNVA 2WPMS 3BV9B 4X2YA 1T8OA 1TWXB 2R3UA 1WTGH 4AZ2B 5GJ4B 1GHWH 3RU4E 2TGTA 2A4GA 2GDEH 3E0PB 1FNIA 2CN0H 2ZDMA 1QA7A 1P3EA 1O3AA 2FI3E 4HTCH 4NFEA 5FBEA 1DWBH 1EPTC 1EASA 1VCWA 4Q2KA 1H4WA 3VFEA 4NSVA 3RXTA 1P02A 1V2ST 2UUJB 2OBQA 1LHEH 2CMYA 1N6YA 3TITA 1BTZA 1CBWC 5L2YH 3NUMA 5E0HA 1PQ8A 3K2UA 4E7RG 3RXPA 5K7RA 1G32B 1TQ7B 2J94A 4YLQH 1P57B 2FOFA 1SQOA 2IN2A 2F83A 4JYVH 8LPRA 4ZMAH 5C1YA 3QUMP 2SFAA 2TGDA 1GMCG 3DUXH 1DLEA 3VB5A 2D8WA 1SGRE 1SC8U 4FUEA 4DURA 3UFAA 1ID5H 4ABHA 2M5TA 1T31A 1GBCA 3HK3B 1TPAE 1C9TA 3UQVA 2AMPA 3BTFE 5K0HA 1E37B 4VGCC 1E0FD 1XUKA 2PSXA 1XVOA 1C5VA 1C2GA 1FLEE 4NIXA 3BF6H 2BY7X 3M5OA 3F9EA 4AYVB 3S9CA 3F9FA 3SU4A 3SJIA 4DY7B 2B5TB 1O5GH 3KEEA 3P6ZB 1SSXA 1UVOA 2QF0A 4H6TA 3AW0A 4K1EA 4NZLA 2C93B 5CE1A 1RJXB 3T28A 1Y3UA 3D49H 1P12E 2WYGA 3P8NA 3SU6A 1FONA 4B2AA 4ABAA 4ASHA 3RDZA 1DDJA 4WVPE 1TGCA 3A88A 1DWEH 3NZIA 3PM3A 4XDEA 3BSQA 3CS7A 3TK5A 4A1TA 2O9QA 3TGJE 1AQ7A 3BTTE 4I31A 2OTVA 1WOFA 1TBZH 1YLCA 1G3CA 3DFLA 3ATLA 4BNRA 3VGCC 1AZ8A 2ESTE 2FPZA 1A3EH 1CGIE 4B73A 1MTVA 2HGTH 3ZZ5A 4OGXA 3V0XA 2SGDE 4INHA 1OXGA 2HVXA 2QCYA 3R3GB 2F9UA 3MH7A 2GZ9A 3JZ1B 4YO9A 3TIUA 1O3KA 3ZZ4A 1FAKH 2EC9H 1L4ZA 2F9BH 2ZIQH 3ZYDA 1SPJA 2FYQA 2GTBA 1FY3A 3M61U 1EKBB 4JYTA 1HYLA 1HAZB 1F0UA 3KL6A 4Y7BA 2WV5A 3BTQE 2WPJS 5ETXA 1CGJE 1AVWA 1AGJA 1TA6A 1DY8A 3BTDE 2ZF0H 1BMMH 1TX7A 1ELDE 4Y11E 3RXVA 4UFGH 2BOHB 5T6DA 2FIRH 1NFXA 1K1LA 1O2XA 1FXYA 1FY1A 1YPLH 1UK4A 4CREA 1JBUH 3A8CA 3P8OA 4X8SH 2BD7A 3M37A 4CRAA 5EXLA 5A0CA 2P94A 4ZXYH 3RXKA 1SMFE 1UVUH 1FV9A 2F91A 3V3MA 2KAIB 1BBRH 3RXCA 1RGQA 4U2WA 4NIWA 1C5QA 2ZDNA 1D3DB 1O38A 3QGJA 3E16B 5DK1A 4WF8A 5E8EH 4K2YA 1LKAA 1K1MA 4I8JA 1A61H 1QL7A 1F0TA 1ZPBA 2P16A 5DP8A 4CR5A 3TGIE 1W10U 3PMHB 3RMNH 1SVPA 1YPKH 1GBTA 1HAXB 1ABJH 5JB9S 1MZDA 1IOEA 4WMEA 2UWPA 3M3VA 3MH4A 1WQSA 1QRXA 1V6DA 1A1RA 3U98H 3O8CA 1MTWA 3Q3XA 3BEFB 1W8BH 1MTNB 1HAOH 2ZTXA 1QTFA 1C1MA 1CT4E 1LHFH 1MAYA 3K6ZA 2RA3A 3ZZDA 1UCYH 1GBFA 2Y81A 5E0JA 4YLUA 1KXCA 2PKSB 2Z3DA 1BRAA 5CMXH 1CT0E 1S6FA 2PGQB 3S9BA 3A82A 1KIGH 2ANMH 1ANBA 1IQHA 1HAPH 2AS9A 3M36A 2P95A 5AF9H 3QK1A 3ZZ7A 3GCNA 1SLXB 1D4PB 3MNXA 5ESTE 3PMBB 1C2DA 4YTAA 5DG6A 3AAVA 2PSYA 2FI4E 1SBWA 1Y5UT 1D6WA 2BY9X 3A7VA 4Y8YA 3U1IB 2XC5A 1O3PB 2OUAA 1MKXK 4K60A 1OWJA 4HI3A 2HNTF 2Z7FE 1ORFA 1LHDH 2Q1JA 2BLOA 1HXFH 2G8TA 1WTHD 1Z8RA 3QTVH 1CHGA 3LGIA 4OS1A 2TIOA 2AGEX 1NS3A 3BTGE 1SLWB 2STAE 4MNYA 2CGAA 4I33A 4X8UH 3A7YA 1Y59T 1Y3VA 5A2MH 2KAIA 2J38A 2THFB 1OWHA 1GJ5H 3UWIA 4PROA 3TU7H 3QGNB 2PWXA 1TLDA 4FUDA 1DWDH 1C4U2 1EJMA 1QJ6B 1RS0A 4JZFH 5C5NA 1EUFA 2C90B 1ELFA 4YOGA 2Z9GA 3PROA 2BX4A 1NZQH 4X6NA 1YM0A 2ZZUH 1B5GH 1K2I1 3TPIZ 1ELGA 3SZNA 1NRPH 1GHAG 1PQAA 4IN1A 4YZUA 1JMOH 2VWNA 2ZEBA 1O3MA 2Q6GA 3RMOH 1GJAB 5FPSA 1N1LA 1NRNH 1OYQA 5C2ZA 1GBHA 2SGFE 1C5RA 5EG4A 2ZC9H 1MQ5A 2SGEE 2FTLE 1K1IA 3EE0B 4WJG2 1O3HA 3PWBA 3ZZCA 3RXHA 3PTBA 4BXSA 2XWAA 1BRUP 2PHBA 3LKWA 3W94A 3STJA 1O2IA 4INLA 4WMDA 2O8UA 3HKIB 2CF8H 1GHYH 1UCYE 2VIOA 3GY7A 3MI4A 3U1JB 5JB8S 5E2PA 1O3FA 2V35A 3GCTG 2XBYA 1MU6B 1WCZA 1ZTLA 1O5AB 3SNCA 1C1RA 1GL0E 1BHXB 4YOJA 1D3TB 3O8BA 4B74A 2ZFPH 2XXLA 3LONA 4AYYB 1HFDA 5GWZA 5L2ZH 1GJBB 2R2WU 3EQ0H 2VGCB 4NA8A 1UVSH 2ZQ1A 3JZ2B 4A7IB 4E06H 3KCGH 1HB0B 3L3TA 5EXNA 5I25A 1VCPA 2JH0D 1C1PA 3UOPA 5EQQA 1O2KA 3RC6A 1TNKA 5FPYA 1YCPK 1C4V2 3LGTA 2AERH 5C3NA 1DX5M 4IN2A 3ZZ6A 1W3CA 1GMDF 1W13U 1E34B 3LGUA 2Y5GA 1EB1H 1Z8GA 4BANB 2XTTB 1NC6A 2BM2A 2FOAA 1KXFA 4H4FA 1GBDA 3LJOA 1GCDA 3G01A 4BTUB 2FLRH 4X8VH 1E35B 2FP7B 2BB4A 3SV7A 1GCTC 1LCYA 2ZNKH 1HJAB 3BTEE 3GCHB 1O37A 3A85A 1LHCH 4Q80A 1J14A 1O2NA 2AYWA 3A7XA 4D7GA 6GCHF 1P2MA 2JETB 4OS7A 4ABGA 3BTWE 2H9TH 3OU0A 1CE5A 1C5OH 1J8AA 1FJSA 4BOHA 1XXDA 2J92A 3MU5A 2FZZA 1ELTA 2A7JA 2WPKS 4ZH8A 3BEIB 3CENA 2ZFQH 4MVNA 1MZAA 4CRDA 2XRCA 3VPKA 4BAHB 1Z6JH 3RXQA 2W7UA 3QWCH 2XBVA 1LPGB 1HLTH 2BQ6B 3DD2H 4B71A 2PGBB 2GX4A 3GDVA 4YESB 3CP7A 1QGFA 4RSPA 3M7QA 3PB1E 3GDUA 4MPVA 4MNVA 1SB1H 4WMFA 5J4QA 3L6PA 1TABE 1CHOG 1GG6C 3HKJB 1TBRH 3TVJB 1VGCB 8KME2 4FVDA 2EEKA 4ZHAA 1L1GA 4DIHH 2ODPA 1DXPA 1DM4B 1SFIA 4Y6DA 4FUGA 2NU1E 4DCDA 1ETSH 2BDGA 2C8YB 2H9HA 4IBLH 1ELAA 1H9IE 6CHAC 2VVUA 1BHXF 3ATKA 1C5LH 1LMWB 1XUJA 1T7CA 4MTBA 2BMGB 1P0SH 2YNBA 3HPTB 2PTCE 2HPPH 2FX6A 3K9XB 3KQCA 1FPCH 2ZTZA 1ZOMA 4LXBH 1T8LA 1O2MA 4MPXA 2O8WA 3VEQB 1NT1A 2ZWLH 5DPAA 3D65E 1BOQA 2O8MA 2HPQH 1AFQB 5DGJA 1UK2A 1QCPA 1MKWK 1OWDA 2VINA 2FX4A 3MO3A 2W5EA 3ENSB 1BA8B 5C1XA 1SQAA 3V7TA 2R2MB 1Q31A 1Y3YA 5A09A 1C5ZB 1O2WA 3B23B 4X1RU 5JPMH 3GY4A 3A84A 2AEIH 1A2CH 1O5BB 4OS4A 3TH4H 5AFZH 3SNBA 4CR9A 1JXPA 1NTPA 3UREA 3EDXB 4D9QA 1U6QA 5E0GA 1RD3B 3QZQA 3A81A 3MU0A 4FUHA 1GHZA 2D1JA 1KYNA 4KGAA 1PPHE 3SV9A 3SU5A 3GICB 1A5GH 3EA9A 1MAXA 3QX5H 2AMQA 5EGMA 3QLPH 3TLOA 5FPTA 2Z3CA 3ZVFA 1C5PA 3S69A 4ZHMU 4AFSA 1SLVB 3FZDA 1O2LA 1V2WT 1TRNA 3RXDA 3RXGA 2BZAA 3SNAA 3C1KA 3ELAH 1O3NA 2LNCA 4ZKNU 3ATIA 5ESBA 4BAMB 5LPEA 2EI7A 1V2OT 2A5KA 2AH4X 4Q7YA 5A8YA 1LDTT 2ZFSA 2BDCA 1FN6A 1KLJH 4NWLA 1TQ0B 1GHBF 2P8OB 3A80A 1HAVB 2XNIA 1YF4A 3LH3A 1IQEA 4K8BA 5C5OA 1IQGA 4I7YH 1FY4A 5GXPA 1V2MT 1ZYOA 2ZGCA 1PPFE 2W7SA 1HAYB 5HGGA 1HBTH 1AB9C 3M5MA 1O3IA 3PLBA 3O8DA 1YCPH 4IMZA 1JIMA 2ALVA 4X6MA 4ISLA 3P8FA 4MQAA 3EAJA 5C20A 4CBOA 2WINI 1N8OB 3A83A 1CA0B 1DSTA 2ZQ2A 2VWLA 1T32A 1MQ6A 1TRMA 2A0QB 3UY9A 1V2JT 2ZCLP 2A32A 1P06A 4AOQA 2SGQE 3U8TH 2ZI2H 1NFUA 5LPFA 1SI5H 2GZ7A 2OXSA 2PW8H 2Y7ZA 1ZMJA 1INCA 1L2EA 1O2VA 3W95A 1AN1E 1BTPA 1YKTA 3KQDA 1UTNA 2ZFRH 1LHGH 3SJOA 1NESE 3MU4A 1HAGE 3S7KB 1O2ZA 2FDAA 4IGDA 3RXEA 1BTYA 1THSH 1F2SE 1JRSA 3FFGA 5T6FA 2EA3A 1UVTH 2TRMA 2ZHFH 3LC5A 2OP9A 3OY5U 1ETRH 3FANA 3PO1C 1O39A 1BJVA 1AVGH 2RCEA 1EAWA 2G5NA 4E7NA 1L1NA 3S9AA 3RXUA 1NRQH 1PPGE 1QB6A 1DSUA 4WH6A 1GPZA 1ZTJA 1GBEA 4AFZA 1WV7H 2Z9IA 3M7UA 3SGBE 3E3TA 4D76A 1NRRH 4TYDA 1EX3A 1QBNA 2FOHA 2CHAC 1C5WB 2A5AA 2BYAX 1PPCE 1H9LB 3E1XB 1IQKA 1H1BA 1RTLA 1F0SA 1O30A 1GBAA 4ZROA 1AD8H 2BD9A 4DJZB 1A5IA 5FCRA 2GGVB 1EAIA 1BB0B 3Q00A 2BDYA 1TMTH 4DT7B 2ZGJA 3ODFA 1P01A 1TGTA 1ZTKA 1BZXE 2O8TA 2ZHEH 4IS5A 1UTLM 2BZ6H 3GY5A 3LT3A 1ZJKA 4I32A 1SR5C 5F8ZA 2VWMA 2VIVA 1TBQH 1LQDB 2PUQH 1IAUA 1V2UT 1VJ9U 2HLCA 3O8RA 4DOQA 5EPNA 1TNGA 1IQMA 1HCGA 1YPEH 1MTUA 3EYDA 4GSOA 4GHTA 4RN6A 1SQTA 5EXMA 1O2SA 1TE0A 1TFXA 1RIWB 2OLGA 1XKBC 4FU9A 2BTCE 2H1UA 1DFPA 3BTHE 1B7XB 1MKWH 1EZQA 1FAXA 4MPUA 1GVLA 1J9CH 2P59A 5AFYH 1L0ZA 3AVZA 3RU4D 3SHAH 4FXGH 1P09A 3SJKA 2Y5HA 1SGDE 3SW2B 4B76A 5EODA 3A8BA 4K3JA 4WXIA 1AWHB 1BCUH 4O3TA 1ZHPA 2ZHDA 4FUCA 2ZA5A 4JZIA 2GD4B 2GZ8A 1ZSJA 2BLQA 1Y5AT 1WAYB 2GCHG 1UO6A 1DXWA 3S7HB 1K1OA 4JZEH 1OWKA 1SL3A 4Q7XA 1HXEH 1YBWA 1DS2E 3BG4B 1TAWA 1X7AC 1LVOA 3E90B