1O3DA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3dA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3dA02
1W7GH 2QXGA 4NIXA 4BAHB 1ZPBA 2BDIA 3BEFB 3U8OH 1KYNA 1PPEE 2WPKS 2BDAA 3MWIU 3MO6A 1BHXF 5FBEA 3SJIA 3TJUA 3M3SA 3MNCA 1VJAU 5L2YH 2FOEA 2XWBI 3EA7A 1KTSB 2PSXA 1C5PA 1YGCH 2PKSC 3H7OA 1HV7A 3ZZ7A 1G3CA 4CRGA 4YT6H 2BOKA 1O3LA 1O2UA 1J16A 4AORA 1P05A 1QNJA 2QA9E 3F9GA 1GCDA 4X1RU 1HAGE 1HAVB 3ZVCA 5DP4A 5JPMH 1ZZZA 1Z1JA 4IN1A 2OLGA 2TGAA 2SNWA 3KEEA 1TOCB 1TRMA 4MLFB 2HPQH 3UNQA 1BMMH 3GDSA 1VJ9U 1O32A 2WV5A 4U01A 1HBTH 4YLQH 5HYOA 1O3OA 1DFPA 3A7TA 1QQUA 1OXGA 1ANBA 4TPIZ 1H4WA 3KL6A 1AKSB 4O97A 1X7AC 1NESE 1NT1A 3SUEA 3PTBA 3ZVEA 4IGDA 2BY8X 2ZDLA 4FUHA 1ABIH 1ARBA 1XX9A 4HGCA 3TJNA 1C4U2 1KXCA 2XCNA 1CT2E 2ZPRA 4D76A 4K8BA 3QZRA 3BTHE 4UFGH 1CT0E 1D4PB 3QWCH 1P57B 4B1TA 3GCHC 1H8DH 1D3DB 3TH2H 1JBUH 1DE7H 2C3SA 2YNBA 4JYUH 1G32B 4KGAA 5T6FA 1EAUA 1P10A 5A0CA 3RXHA 1HXEH 5FCRA 4GCHF 3GICB 4JZDH 2ZHFH 1NRNH 4R0IA 1O3NA 5L2ZH 1AVWA 1AI8H 5DJ7A 2V6NA 1UCYE 4YLUA 2QF3A 5EQQA 1WSSH 1FUJA 1Y5UT 3PM3A 2XC0A 2GT7A 1C5RA 3RM2H 3M5MA 3NZIA 2WUBA 4KTCA 1PQ7A 5E2PA 1S83A 2R3YA 1SLUB 7GCHF 3RUOA 8KME2 3MO3A 4BTIB 5FBIA 3H7TA 3M3VA 1XM1A 1BTHH 1P8VC 1O2YA 2QIQA 3GCTF 3PMAB 2G4UA 1MZDA 4DJZB 1PQ8A 1TFXA 3U8TH 1BZXE 1M9UA 1MCTA 1DICA 1EPTB 1K1JA 1MTUA 1ZMLA 4MTBA 2BD5A 1HAOH 1Z71A 2G51A 3ZZDA 4X6MA 1YPJH 1TPSA 1GMCG 4AFQA 1ZMJA 2XCFA 1UK2A 4O9VA 1ZTLA 1C2JA 5DKMA 1V2JT 3KCGH 4ABBA 1EX3A 4VGCC 1G3EA 1SGNE 2VIDA 4D7GA 1C4Y2 1D6WA 1ELVA 1O30A 5EGMA 1N1LA 1F5LA 3KF2A 4Z0KA 1DY8A 3ITIA 2VWOA 4ISHH 1N6XA 1SI5H 1DWDH 1TAWA 3VGCC 2B5TB 3AVZA 1QCPA 2ZC9H 1AFEH 5GWZA 3RMLH 1C1VH 5K0HA 3VGCB 1DUEA 1GDUA 3JZ1B 3L3TA 2BOHB 2PHBA 1E37B 3ELAH 5B6OA 1NRPH 4I32A 3SORA 1EJAA 3FZZA 2Q1JA 4AYYB 2I6SA 5A8ZA 1GI6A 1D3QB 1D9IA 3TPIZ 4X8VH 4A1VA 2J95A 1NN6A 1KLJH 2ODQA 2J94A 3ZVGA 1VCQA 1C5YB 1TALA 5F03A 2PR3A 2R2WU 2AEIH 1C2MA 1UHBB 2OC8A 3W94A 1F0UA 2VVCA 3BV9B 1T4VH 1V2RT 1UTJA 2QYIA 3UREA 4ZXXH 1A4WH 1KLTA 3S7HB 4WMFA 1OYTH 3RM0H 1DSTA 1O5AB 1THPB 1TOMH 3ZZ8A 1MTNB 1MMJN 2A4RA 4WMDA 6ESTA 1TGSZ 4WXIA 1BJUA 2SGAA 2UUFB 5I46H 1EATA 2BLQA 5LPRA 1NPMA 3PMBB 3VB6A 1O3CA 3M3TA 1AO5A 1ZJKA 1ZHPA 2TGDA 2Q6GA 5GJ4B 1UTNA 7GCHG 5I25A 3BEIB 2ZCHP 1CA8B 2ZQ1A 1AVXA 3FFGA 1ESBA 1EAWA 1MAXA 4UFEH 5E0GA 1K28D 3P8NA 1GBMA 4JZIA 1T8MA 3BIUH 1AIXH 1C2HA 1AGJA 2PSYA 1HXFH 5CMXH 2FWWA 4I8HA 5GCHF 1QL9A 4A5TS 2XYAA 3SI3H 2QN5T 3PLKA 1K1NA 2AERH 1LPKB 3EDXB 1OX1A 4NWKA 1W13U 4IMQA 1YC0A 3T2NA 1ZOMA 3M61U 3SW2B 3FP7E 2FS9A 1TX7A 2VVVA 1AUTC 2ZDKA 4FUCA 1GHAG 2VB0A 4MPUA 5EXLA 1KXDA 3TK5A 4UDWH 4GLYA 2AS9A 3MH5A 2STBE 2QF0A 2SNVA 2BXTH 4OS5A 2LNCA 2BM2A 4TWWA 1FNIA 2XNIA 3ZZ6A 1UTOA 2C8ZB 2HPPH 1G30B 2G81E 1YF4A 4DCDA 3S69A 1GHBG 1MTVA 4Y11E 3BN9A 2FI4E 3RXBA 3RP2A 5DP6A 1A5IA 3S9CA 4A7IB 5C1YA 1BRBE 2ZPSA 2GCHF 5C5NA 2Y5FA 4CREA 1AB9C 1GBTA 2FEQH 1YP9A 4X2XA 4MVNA 1SSXA 3TITA 5AVDA 2H5DA 2VNTA 3LGIA 1BTPA 1JIRA 1MKXK 4ABAA 4NA7A 1BBRK 4CH2B 4FUFA 1HAHH 2QXIA 4XOJA 4X2YA 1O2NA 4ESTE 1RTKA 1OPHB 3KGPA 1C5UA 1HLTH 2GP9B 1FJSA 1S6HA 1LMWB 3A7WA 3ZZ3A 1SMFE 1FN6A 3PROA 3LIWA 1DOJA 4X8SH 3ZVBA 3O8CA 1C5NH 1GHAF 2B0FA 1YPLH 2HGTH 1IQEA 2BQWB 2QCYA 3IITA 3QUMP 3T27A 5DP5A 1UCYK 1AKSA 4FU8A 2F9NA 1SGYE 4Q7XA 1MBMA 3HGNA 3P6ZB 1C5XB 1K1LA 1E35B 3A7VA 1A46H 1ZTJA 2VIWA 1DS2E 3GY2A 1TYNA 2VU8E 2ZGXH 2IJOB 1PPFE 3TVJB 1BBRH 3HGPA 1AUJA 1FY1A 3GY8A 2GVFA 3TGJE 1ZMNA 2IOTA 3PWBA 1YYY1 3QGJA 3GDVA 1L0ZA 1HJAB 2AMDA 1FXYA 2FZZA 3U69H 1DX5M 4B2AA 2CGAA 5EG4A 1KXBA 3DUXH 3OX7U 1SGTA 1A7SA 3Q76A 1WCZA 1GBJA 1FQ3A 1GWAA 3E8LA 2WUCA 4D8NA 4NIYA 4B75A 1FV9A 1MD7A 1XUIA 2H9TH 5LPEA 2NU1E 1C5MD 4RSPA 3CS7A 2W3KA 4CH8B 2A32A 1PPCE 2W7UA 2YNAA 2ZHQH 3Q00A 1C5OH 3M5OA 3ODFA 4LOYH 1P02A 1NFUA 4FUJA 1QBNA 3GYMA 3Q3XA 1K22H 1TE0A 1Y3YA 2BDGA 1OWKA 4DOQA 4OS2A 4ABJA 2UWLA 3SV7A 4NFEA 1V2OT 1DPOA 3PB1E 3OSYA 3LU9B 2C90B 2G5VA 1A0LA 1G3DA 4X1NU 1BMNH 3GCOA 3RU4D 1MKWH 1YCPM 1DITH 1IQIA 5ETXA 1ANEA 1WUNH 3ZZ5A 3ESTA 4YT7H 3TH3H 3SZNA 1HJ9A 1F5RA 1MQ5A 1OSSA 2ZU4A 1BB0B 1NZQH 2O8MA 3EYDA 1QURH 3TGKE 2BZ6H 1FZZA 2ALPA 1LHEH 2FODA 1SOTA 1CHOG 2YOLA 1C1TA 1GJ9B 1UTKA 3SJ8A 3UUZA 1UK4A 1BTXA 3SNBA 1A5GH 3SU2A 1DY9A 3ZZ9A 1TX8A 3RXAA 2BD4A 3E3TA 1C1WH 4VGCB 5G4BA 2F9PA 2WYJA 3A81A 1QBOA 4CRBA 2VGCC 3BTQE 2Z3EA 1O2LA 2R9PA 5T6DA 1IAUA 2O8TA 1T8NA 1S82A 1SGRE 1DT2A 1KSNA 1F7ZA 4NIWA 1O3AA 4H42U 2FP7B 4K3JA 2O8WA 1SL3A 2RA3A 3IWMA 2GV6A 4GPGA 1EP6A 1HFDA 5HM9A 3NUMA 3QTVH 3UWIA 2H5CA 4FU9A 1FONA 2P8OB 1TGTA 1S85A 1UVUH 2BVRH 3SU5A 1PQAA 3U9AH 3AAVA 3STIA 3ZZBA 1GBBA 1BMLA 5EW1H 1AWHB 2BLOA 3SOSA 1Q2WA 1TBRH 1AY6H 1QA0A 3AW1A 5DP3A 2TGPZ 3LH3A 4JYVH 2D8WA 2Q6DA 1W7XH 1G2LA 1O2WA 2CHAB 3T5FH 2ZFTA 3U1IB 4KELA 1EAXA 1AZZA 1GVZA 1KXEA 2PTNA 1GBDA 1Y3UA 4Y7AA 5GXPA 4Y6DA 4LK4A 1V2MT 1K1IA 3SQEE 3VXFH 1LKAA 1PPBH 1TGCA 4UE7H 3MU8A 2AIPA 3T62A 2F9OA 4CR9A 1IQJA 4UEHH 1ZHMA 8ESTE 4GVUA 4RN6A 2VWMA 4IC6A 1HJAC 4AN7A 3BTME 2HNTC 3MU5A 4HFPB 2WPHS 1B0EA 1PQ5A 4MG3A 4B74A 1EJNA 1CGHA 3GY7A 5LH8A 1O2RA 1A1RA 4M7GA 1AD8H 4ISIH 1FDPA 1O5FH 2OTVA 3T26A 2IN2A 1OS8A 1S81A 2ZFPH 4JK5A 2VH6A 4A92A 3BTTE 2Y82A 2VWNA 1EJMA 2ZTZA 3T28A 3RXQA 2A7JA 3MU4A 1O5CB 1HCGA 2GZ9A 2WPMS 2XBYA 1LVMA 1FAXA 3U8RH 1J17T 4J1YA 4F49A 1YLDA 3V7TA 4BAMB 2FM2A 1BTZA 1GI2A 1QGFA 2ZECA 2ZDAH 4OS1A 3SV9A 1O5DH 2QXJA 3V0XA 5AFYH 1LTOA 5C3NA 5CE1A 2H6MA 3PMHB 1OP8A 1IQNA 1TLDA 1O2MA 2BDYA 3EAJA 1BA8B 1GI8B 4DIHH 3CS0A 4K60A 2SGPE 3RXLA 2A4QA 1ESTA 3GY4A 1GBIA 2NU0E 4X8TH 4JYTA 4ZKNU 2A45B 1E36B 5H4IB 1RIWB 2EC9H 4YESB 1V2WT 2ZI2H 1W12U 4WH8A 1HNEE 1K1MA 2OC7A 1O3MA 4UD9H 3ZV9A 1AMHA 1WTHD 2W3IA 2XTTB 3QLPH 2BQ6B 1F0RA 1P03A 3LC3A 3O8BA 1GBFA 4Y71A 3OTJE 3EQ0H 5CHAC 3Q77A 4AOQA 2AMPA 4XBCA 1O3FA 1QRWA 1XUKA 3F1SB 3M37A 3QN7A 4TYDA 2O8UA 2XXLA 4WF8A 3RMNH 3SQHE 1K1PA 1EOLA 1Y8TA 1HIAB 4DW2U 1C1RA 4O03A 4Y76A 2B7DH 2FLBH 2K1QA 3V12A 4YOGA 3TJOA 1C2IA 1NFXA 3M5NA 4F4OC 2ZDMA 1L4DA 2H2ZA 1Y5AT 3MO9A 1JOUB 3LDXH 3TGIE 2Y5GA 4DIIH 1EOJA 2ZO3H 1C2LA 3RXRA 1FN8A 1SFIA 4AFUA 3RXDA 5HGGA 3RLYH 1NY22 4A1XA 1EAIA 1C1UH 1SHHB 1Z1IA 1VCPA 3RMOH 2VIOA 3ZVAA 1LCYA 3DT0H 2XBXA 1DDJA 1UJ1A 2D26C 1IHTH 3PWCA 1YBWA 4GUXA 2A0QB 1QJ7B 3BIVH 4BNRA 1SHYA 2ZGJA 4X6OA 4CBOA 4BXWA 1QRZA 4BAKB 3A8BA 1QRXA 4SGAE 3D23A 1O39A 1U6QA 4NG9H 3TU7H 3URCA 1GCTC 5TCAA 2A1DB 3D65E 1O3EA 1QJ1B 4D7FA 2CHAC 2EI8A 2VVUA 2FOCA 2FYQA 1TRNA 1EKBB 1HJ8A 1CVWH 2AGGX 1C2EA 1ZSKA 1C5VA 4FUGA 1KLIH 1W3CA 1CQQA 2PKAA 1SBWA 4XBBA 5EQSA 4NA9H 4R8TB 1N8OC 3I29A 2ZA5A 1UMAH 1XUFA 2V3OH 3MOCA 1ZR0A 4NWLA 1MU6B 5A0BA 3O8RA 4X1QU 1A3BH 4U32A 2HWLB 1GJBB 2FDAA 2QXHA 1TONA 3S7KB 3PYHA 5E0JA 4ABHA 2Z3CA 4ZKSU 2BX4A 1LQEA 4NSYA 5JBAS 1ABJH 1D3PB 1P2OA 4ABGA 4B73A 1XUJA 3HK6B 4ZUHA 1BMAA 2Y7ZA 3TK6A 1C1SA 1CBWC 4WY3A 1UK3A 4X1SU 1EPTA 2BVXH 3T29A 4WWYA 1DWBH 1OWHA 4FXGH 5EOKA 4CR5A 3C27B 2XC5A 3LGVA 1L1GA 1BTWA 4Q80A 1FAKH 2AFQB 4AB8A 2G00A 3D62A 4NA8A 1C2KA 5IYTA 2R3UA 1IHSH 2Z9JA 1G3BA 2A7CA 2QY0B 4B2BA 1KXFA 2P16A 3UOUA 1LVYA 2BLVA 1EUFA 5FPTA 1NU9A 1ETSH 1TMUH 1MTSA 4ZHAA 1S6FA 3MNXA 1EPTC 2NU3E 4RKJB 1PPZA 1T4UH 5HMAA 1LDTT 1LHDH 3KHVA 3LJOA 1K21H 2BY7X 3LOXA 4OS4A 3RXCA 5LGOA 1O35A 1C1OA 3PMJA 1AHTH 2Z9LA 5FX6A 4WH6A 3SNDA 2PKSB 2CMYA 4BXSA 5FCKA 1GBAA 3NWUA 1ZSLA 4ZAEA 1QHRB 5HM2A 3RXKA 1YPGH 1V2VT 1L4ZA 1F0SA 1WQSA 1RTFB 2ZPQA 1DWEH 2XRCA 1CSOE 1Z8GA 4FUDA 2ALVA 2J92A 1SGIB 1HYLA 3MYWA 2UWPA 1GI1A 2THFB 1DSUA 1C5LH 5FHTA 2P3FH 5TCCA 1ELBA 3QX5H 1H9LB 1WV7H 3SU0A 4JZ1A 3U98H 3BTGE 1JRTA 1ZGVA 4GSOA 1THSH 4MPXA 4WJG2 3A80A 3LH1A 3MI4A 1SLVB 2SGDE 1ELCA 1Z6JH 2ZIQH 1ANDA 4BTTB 5JBCS 1MAYA 1O2GH 6CHAC 5T3HA 1ELGA 1KIGH 1XVOA 3IG6B 2HRVA 3LKWA 1DWCH 2ZCKP 1SGCA 1W10U 3VFEA 5JB9S 4DG4A 4BAQB 2ZHWH 3MU1A 3UNSA 3LONA 1PYTC 4Y79A 3GY6A 4E06H 1EASA 1TA6A 4ABIA 1SGFA 4KTUA 2FIRH 4X0WU 1P9UA 1DUAA 2WPJS 1TB6H 2Z7FE 1LHFH 3Q3YA 4FUEA 1GJ7B 1FMGA 1N8OB 1GCTB 3RXPA 1T8OA 1V2UT 5DK1A 3BG4B 3PTNA 2UUYA 1WAYB 2GMTC 1NFWA 4CHAC 3VB7A 7KMEH 4LZ1H 1HRTH 1NRRH 5FPSA 2FX4A 2BQ7B 2WPIS 2KAIB 3D49H 3BG4C 1TNJA 1G2MA 2A4OA 4X8UH 3SGAE 3UR6A 2ZDVH 2CF8H 3MNBA 5EU8A 1GMHF 2IPHA 1C1NA 2JETB 1UVPA 1SC8U 3F9EA 3A87A 2J2UA 5JDUB 1VITF 4BAOB 1B7XB 7LPRA 3NPSA 1EZUC 1GBLA 3HKJB 4ZHLU 5E8EH 4K5ZA 5JBBS 2XBWA 3S9BA 4CRAA 1GPZA 1O2HA 1H9HE 5GCHG 1E0FD 1JXPA 2OBOA 4IN2A 4ASHA 3SV8A 2C8YB 2UUJB 1MD8A 4AG1A 2BVSH 8GCHF 1HGTH 2VINA 8LPRA 1RD3B 5A09A 3I77A 1O2IA 2GT8A 2I6QA 2ZGBH 4I8GA 1INCA 1IQHA 3PV4A 1MU8B 3BTDE 2ZGCA 2W5EA 3C1KA 1J9CH 5DG6A 2AGEX 4IC5A 5JBTA 1PJPA 3DFLA 4ISOA 1V2KT 2VGCB 1W11U 4Q2KA 3P70B 3T25A 2FMJA 1BITA 3FP6E 1C5ZB 1GI3A 1UTMA 1NRQH 2A5AA 1GGDB 1GDQA 2J34A 1VITH 1SOZA 3RXFA 1GMHG 9LPRA 3RXIA 1SG8B 1WU1A 1ETTH 1GI4A 3ZV8A 1UTLM 1Z8JB 3ATWA 4IBLH 1Y3WA 1TWXB 2Y5HA 2BD8A 5F8ZA 1O33A 1LHCH 1MQ6A 3RXSA 3SUFA 3UIRA 3S9AA 3LT3A 2V35A 4KTSA 5C5OA 3BTWE 1P2IA 3SI4H 5K7RA 3NK8A 1XUHA 1TNKA 1XKAC 2CF9H 4H4FA 3K2UA 3HKIB 3LGTA 1SGQE 1N6YA 1O2PA 1V2NT 1TRYA 1O5BB 1WTGH 2A5IA 1O31A 3F68H 1T31A 2BDBA 1JMOH 2D1JA 4FUIA 5C2ZA 1O3HA 4TWYA 3E91A 4ABEA 1G37A 3SO3A 3PLPA 1RRKA 3E0PB 2JH5D 5FX5A 4IMZA 1TMBH 5AHGH 2PGQB 1UCYH 2WV4A 1BDAA 1HAPH 3LGYA 2JKHA 1NRSH 1DLEA 1HDTH 1Y5BT 2WINI 1Y3XA 2Q6FA 1FY4A 4I8KA 1HAIH 3BTKE 4FVBA 3BSQA 1VGCB 1MTNC 1VITG 1SGDE 4GCHG 3SU3A 4AX9H 3BTEE 1MH0A 4NZQA 1GI7B 2F83A 2H9EH 3UTUH 1SQOA 1DXPA 3SNCA 5A8XA 2P93A 1O2QA 1VGCC 1GG6B 2ZTYA 2J4IA 1PPHE 1AE5A 1A5HA 1QR3E 2ZZUH 1AFQB 3K6YA 2G5NA 3B23B 1EZQA 8GCHG 1HPGA 4CRFA 3ZZ4A 2SGFE 3A7ZA 1GI5A 2FS8A 2BD9A 4GHQA 3RMMH 2FX6A 1PYTD 2OQUA 2ANYA 3W95A 4CRCA 1H9IE 2P3UB 2AH4X 3A84A 1E34B 2BB4A 1ZGIA 2H1UA 3NCLA 1O3DA 1V2QT 1OYQA 1C9TA 4I8LA 1C2FA 3SV2H 2PUXB 1BRUP 2ILNA 1FIZA 2AIQA 2VIQA 3FZDA 4ZROA 4AB9A 2ULLA 1CE5A 1C9PA 1ARCA 1KDQB 1FI8A 1H8IH 2OP9A 3OY5U 2OC0A 1L1JA 5BRRE 2DE9A 1GI9B 1BUIA 5DP9A 1P09A 2HNTF 2ZDNA 1GDNA 1V2ST 2BDHA 1B0FA 5EPNA 1KY9A 1OWIA 3A88A 4Z6AH 3A8DA 3GDUA 1O5EH 2WYGA 2JH6D 4XFQA 2ZGHA 4TY6A 2FPZA 4AG2A 5ABWA 2ZHEH 4ZKOU 1O34A 3ATLA 3SU4A 3TNSA 1OP2A 3F6UH 3R0FA 2PWXA 2VIVA 4I8JA 3DFJA 3N7OA 1LVOA 4K8YA 3GY3A 4TPYA 3E90B 4OS7A 3B9FH 2ZQ2A 1P12E 1GBEA 1ELTA 1C5WB 1ZLRA 2G55A 2SGQE 5IDKA 4KKDA 2UUKB 1ZPCA 3VEQB 1SFQB 1LO6A 3A8CA 1P2NA 4SGBE 4AYVB 1W2KH 1ELEE 4LXBH 2ZP0H 5PTPA 2VIPA 1ZRKA 1SB1H 3UOPA 2Y7XA 1QQ4A 1XXDA 4K1TA 2F9BH 2EI7A 3ENSB 2AYWA 5DP7A 4A1TA 2TPIZ 4WVPE 1UHBA 1WBGB 5DO4H 1UO6A 6CHAB 1F2SE 5HXFA 3RXUA 3EA8A 1BT7A 2VH0A 1C5TA 3V3MA 2XW9A 1Z8IB 1TIOA 1OWEA 1W8BH 3K9XB 3TLOA 3CP7A 5C1XA 5LPFA 1J15A 2EI6A 3QTOH 4MPVA 2NWNA 1BRAA 1FPHH 2B9LA 1ACBE 4K1SA 1TNGA 4UFFH 3GCHB 1THRH 1BBRE 1A0HB 1P06A 2BXUH 1K2I1 4E05H 1MTWA 3SGBE 2GV7A 1SQAA 2Z9KA 1LPGB 1F0TA 5AFZH 1GJDB 3A85A 2GMTB 3URDA 2GCHG 3VPKA 2GCTC 3SV6A 2JH0D 1O5GH 2XWAA 2M5TA 4OGXA 3RC6A 1HAVA 3B8JA 1HAXB 3GCTG 1CHOF 3OYPA 1V6DA 4NSVA 2DE8A 2TRMA 3NKKA 2JETC 1TBQH 4NGAH 4INKA 2ZNKH 3I78A 3ATKA 3KN2A 4H6TA 5GIBA 3RXTA 1RJXB 1KDQA 2OUAA 1O2KA 3SNAA 1GG6C 1A3EH 2BHGA 3ZZCA 1YPMH 1FY5A 1CBWB 1TPAE 1GMCF 1NROH 2ZU1A 2A7HA 1GL0E 1YPEH 3SN8A 4FU7A 4DVAU 3MH6A 4YO9A 4O3UA 1PFXC 3M36A 1CO7E 1YPHE 2J9NA 1BOQA 4ISLA 3P8GA 2O9QA 4NIVA 1GHBF 2CJIA 2QAAA 1O2VA 3A82A 2Z94A 5FAHA 4ISNA 3TNTA 1UVTH 1YCPH 1AU8A 3M35A 4I7YH 2GDDA 2HALA 3U1JB 3SBKA 5JB8S 1P3EA 4Q7YA 2OD3B 4YTAA 2VWLA 4OS6A 1O3GA 1AB9B 5F8TA 5EW2H 2XBVA 1OKXA 2P95A 1P9SA 1LQDB 3KQDA 5BPEA 1B5GH 1OOKB 1YPHC 4B2CA 1UTPA 2GGVB 2ZG0H 1CHGA 3MMGA 1XXFA 2FOGA 1KXAA 3SJKA 1LPZB 1Q3XA 1QL7A 2G4TA 5CHAB 5E0HA 4ZH8A 2EEKA 2PV9B 4JK6A 3VB5A 3SUGA 2P94A 3SNEA 1GGDC 2H9HA 1O2JA 1P2KA 1GHVH 3UNRA 4MDSA 3PO1C 5A2MH 1DANH 5C67A 1SR5C 4XDEA 4U30A 2FTMA 1GBKA 3ZZAA 1WOFA 1IQMA 2R0LA 4X2VA 3HPTB 1C2GA 1HUTH 1AVGH 3F9HA 4QT8C 4B71A 1XKBC 5ESBA 1O3JA 1P0SH 2ZWLH 5FXLA 2GZ8A 4AFSA 1SPJA 4JZEH 5EPYA 4FVDA 2BY5X 1XVMA 3Q3KA 2F9VA 6GCHF 4NZLA 2ZFSA 3LGWA 3A86A 1TPPA 2BYAX 3DA9B 6GCHG 1JRSA 1DLKB 3E0NB 4JCNA 3AAUA 2HLCA 2XC4A 3K6ZA 2PKAB 1J8AA 2GZ7A 3VB4A 2ZU5A 1LHGH 2A2QH 4NFFA 1GHYH 1O3IA 2A31A 1HB0B 2Y6TA 2Z9GA 4HZHA 4E7NA 3EA9A 1EP5A 2OXSA 2OCVB 2RDLA 4DURA 3F9FA 3P17H 1QJ6B 2NU2E 3RU4E 3TIUA 3ZVFA 5A0AE 3ZYDA 1O2TA 4MNXA 1VZQH 2BTCE 3WY8A 1TABE 1ZTKA 5TJXA 1UTQA 1WQVH 4CHAB 1NFYA 3SJ9A 3TH4H 2ZU2A 3M7UA 1GBCA 4WXVA 3RLWH 1QFKH 3RXGA 2B8OH 3HK3B 3P95A 2C8WB 4Y0ZE 2CXVA 2TBSA 4YOIA 1NS3A 3GISB 1ZPZA 5C20A 1MZAA 1TNHA 1ESAA 1CA0C 2RCEA 1QL8A 2BD2A 2V0BA 1TNIA 2J38A 1GJAB 1T32A 2G8TA 1TMTH 3AW0A 4KP0A 3VB3A 5F6MA 5J4SA 1O37A 3BG8A 1TPOA 2PUQH 2ZU3A 1J14A 3LGUA 1Z8RA 3ATMA 4Y7BA 2PTCE 3OY6U 3DD2H 2A4GA 1P3CA 3LPRA 1XUGA 5DGJA 2FOMB 3GY5A 1AE8H 4J2YB 4NCYA 1ELAA 1S5SA 1UVOA 3ZVDA 4WMEA 2SGEE 4PROA 2TGTA 5L6NH 4U2WA 4K69A 2BLWA 1E38B 2D2DA 1OWJA 1V3XA 4CRDA 1S0QA 2PW8H 2STAE 4BANB 1FLEE 3QK1A 2CV3A 1RIWC 1RGQA 4D9QA 1FY3A 1AQ7A 2OINA 2HNTE 5SGAE 1EQ9A 3S0NA 4BOHA 4DGJA 1TBZH 3E16B 1C1PA 1SVPA 1AZ8A 1QB1A 2Y81A 1GJCB 1NU7B 3EE0B 1DVAH 4X6PA 2BMGB 1IOEA 1C2DA 2NU4E 2ZKSA 3E6PH 1O3KA 1SGPE 3KQEA 2HVXA 1HIAA 3ODDA 2C8XB 1RXPA 1JIMA 4A6LA 1C4V2 2BZAA 2ESTE 1T7CA 4DY7B 4THNH 3RU4T 2ASUB 4AFZA 3SHCH 3FAOA 1S84A 1K1OA 3PO1B 1ETRH 3RDZA 2FOHA 5GDSH 2QGRA 2BY9X 1O2ZA 1O2OA 4Y8XA 4ZMAH 2FLRH 3A89A 3P8FA 2ZF0H 3MNSA 1ZRBA 2F9UA 3SHAH 2FTLE 3UPEA 1ANCA 4XSKU 3UFAA 1W14U 1MKXH 2ANMH 3BEUA 1BCUH 4UFDH 1A2CH 1O2XA 4OGYA 4H6SB 1HAZB 3RXMA 2C4FH 3MH7A 4O3TA 3HATH 4MNYA 1BHXB 1P2JA 1ZHRA 3QDZB 1BTYA 3MTYA 1OWDA 5F8XA 1ZSJA 1PPGE 1C5SA 2FYRA 3STJA 3SJOA 2KAIA 4AZ2B 1RTLA 2AMQA 3RXOA 1MKWK 2P59A 1EB2A 1IQGA 3UR9A 3LJJA 3KQBA 3AASA 2GCTB 1IQFA 4ABDA 3BTFE 2AGIX 5J4QA 1EZXC 1Q31A 1YM0A 2Z6BD 1ELFA 2Z9IA 1Y59T 4B76A 3RC4A 2GD4B 1G36A 3SU6A 1TGNA 1CGIE 2O8LA 3DHKH 1NTPA 1AFQC 2FI3E 1BRCE 4Q7ZA 1FPCH 3TJVA 2Y80A 4Y10E 1DXWA 2ZFFH 3JZ2B 2F3CE 2GKVE 1EB1H 4YZUA 2GX4A 5DP8A 5L30H 1MCVA 4ABFA 3NXPA 3A8AA 1SLWB 2RG3A 4HI3A 1P11E 1QA7A 5EODA 3CENA 4MNWA 5GPIB 1Z7KA 1SGEE 3GOVB 2BD3A 3MHWU 1YLCA 5DPAA 1CA0B 1ZJDA 1Y3VA 3RXJA 1O2SA 4X6NA 4TY7A 2F91A 2PLXA 5T6GA 1GBHA 2TIOA 3BF6H 4I33A 1S0RA 1AWFH 3GYLB 2ZCLP 1O38A 4IW4E 4ZXYH 5C1UA 1GMDF 4Y8ZA 1EZSC 2GTBA 3RXVA 3A83A 1V2PT 4FUBA 3O8DA 1AN1E 1ID5H 2OQ5A 2VJ1A 4Y8YA 1TGBA 1V2TT 1ZYOA 3L6PA 1EXFA 3EGKH 3A7XA 3UY9A 5E2OA 1C1QA 3KIDU 4UONA 4INLA 4DT7B 3LC5A 1NM6A 1T8LA 2ANKH 4MQAA 2HOBA 2FOBA 2SFAA 4RKOB 1A0JA 2BX3A 1TQ0B 2R2MB 2P8OC 1OP0A 2W26A 3ZYEA 1GJ6A 2ZHDA 3K65B 2FOAA 5ESTE 1L2EA 1C1MA 4K2YA 2FOFA 1IQLA 5A8YA 3FVFB 2BDCA 4GAWA 2FESH 4X1PU 1GL1A 4YOJA 1TX6A 4MNVA 4IS5A 1DM4B 3MH4A 1H1BA 1IQKA 2FO9A 1LKBA 1YCPK 1BJVA 1NC6A 2ODYB 2ZEBA 2OC1A 1ORFA 1HAYB 2ZFRH 3UQOA 2UWOA 1GI0A 1W0ZU 3L33A 1VCWA 1GJ4H 1MBQA 1SLXB 2A5KA 3RXEA 1RFNA 3GCNA 1P2QA 4YM9A 1SGFG 1GHWH 1O3BA 2A2XH 4Y0YE 3SGQE 1GHZA 1O36A 4HTCH 3FANA 1LVBA 3M5LA 1QTFA 2PGBB 1V2LT 3G01A 3MU0A 1GJ8B 3KQCA 1D6RA 4INHA 1GMDG 2EA3A 1C5QA 3UWJH 4MPWA 1RS0A 2PFEA 4I31A 1WYKA 4E7RG 5JYIA 2FXRA 4GHTA 3SU1A 1TA2A 3A7YA 1TNLA 3QGNB 3KNXA 2BD7A 3FP8E 3H5CB 4XBDA 4JZFH 1P2MA 4ZHMU 3V13A 2RA0A 1F92A 1KTTB 1O0DH 3QO6A 9ESTA 4JMYA 1D3TB 2ANWA 1FY8E 1YPKH 4AGJA 2ODPA 2R0KA 3VXEH 1QBVH 4X2WA 6LPRA 4LZ4B 1BTUA 1YKTA 3M7TA 4K1EA 2G52A 2ZTXA 1XMNB 4AGKA 2OBQA 2ZFQH 5FPYA 7ESTE 3QZQA 1CGJE 3UQVA 1CU1A 1P01A 2QV1A 1NO9H 1W0YH 3M7QA 4D9RA 1CT4E 1ELDE 1QB9A 1GVLA 3SUDA 3ATIA 1P04A 1A61H 1QIXB 3TK9A 1SQTA 3E1XB 3PLBA 1K9OE 2W7SA 2BY6X 5EXNA 3RC5A 1O3PB 5EQRA 1JWTA 1VR1H 3P92A 1TQ7B 4XE4A 1Z6EA 3OU0A 1L1NA 2Z3DA 1F5KU 3P8OA 2QC2A 2FI5E 4ZKRU 1UVSH 1QB6A 2V3HH 2WPLS 1FIWA 1MUEB 2LPRA 1GJ5H 1GHXH 2DUCA 2P3TB 2CN0H 1BIOA 1GVKB 1BQYA 5AF9H 1G9IE 2C93B 4CBNA 4BTUB 3R3GB 3MFJA 1QY6A 5EXMA 2GDEH
chains in the Genus database with same CATH superfamily
1W7GH 2QXGA 4NIXA 4BAHB 1ZPBA 2BDIA 3BEFB 3U8OH 1KYNA 1PPEE 2WPKS 2BDAA 3MWIU 3MO6A 1BHXF 5FBEA 3SJIA 4F55A 3TJUA 3M3SA 3MNCA 1VJAU 5L2YH 2FOEA 2XWBI 3EA7A 1KTSB 2PSXA 1C5PA 1YGCH 2PKSC 3H7OA 1HV7A 3ZZ7A 1G3CA 4CRGA 4YT6H 2BOKA 1O3LA 3DSGA 5B6LA 1SKYE 1O2UA 1J16A 4AORA 5CDFE 1P05A 1QNJA 2QA9E 3F9GA 1GCDA 4X1RU 1HAGE 1HAVB 3ZVCA 5DP4A 5JPMH 1ZZZA 1Z1JA 4IN1A 2OLGA 2TGAA 2SNWA 3KEEA 1TOCB 1TRMA 2KCAA 3OEHD 4MLFB 2HPQH 3UNQA 1BMMH 3GDSA 1VJ9U 1O32A 2WV5A 4U01A 1HBTH 4YLQH 5HYOA 1O3OA 1DFPA 3A7TA 1QQUA 1OXGA 1ANBA 4TPIZ 1H4WA 3KL6A 1AKSB 4O97A 1X7AC 1NESE 1NT1A 3SUEA 3PTBA 3ZVEA 4IGDA 2BY8X 2ZDLA 4P00A 4FUHA 1ABIH 1ARBA 1XX9A 4HGCA 3TJNA 1C4U2 1KXCA 2W6ID 1CT2E 2XCNA 2ZPRA 4D76A 4K8BA 3QZRA 3BTHE 4UFGH 1CT0E 1D4PB 3QWCH 1P57B 4B1TA 3FO8D 3GCHC 1H8DH 1D3DB 3TH2H 1JBUH 1DE7H 2C3SA 2YNBA 4JYUH 1G32B 4KGAA 5T6FA 1EAUA 1P10A 5A0CA 3RXHA 1HXEH 5FCRA 4GCHF 3GICB 4JZDH 2ZHFH 1NRNH 4R0IA 1O3NA 5L2ZH 1AVWA 1AI8H 5DJ7A 2V6NA 1UCYE 4YLUA 2QF3A 5EQQA 1WSSH 3OE7D 1FUJA 1Y5UT 3PM3A 2XC0A 2GT7A 1C5RA 3RM2H 5HKKD 3M5MA 3NZIA 2WUBA 4KTCA 1PQ7A 5E2PA 1S83A 2R3YA 1SLUB 7GCHF 3RUOA 8KME2 3MO3A 4BTIB 1E1QD 5FBIA 3H7TA 3M3VA 1XM1A 1BTHH 1P8VC 1O2YA 2QIQA 3GCTF 3PMAB 2G4UA 5CHBA 1COWD 1MZDA 4DJZB 2V3MA 1PQ8A 1TFXA 3U8TH 1BZXE 1M9UA 1MCTA 1DICA 1EPTB 1K1JA 1MTUA 1ZMLA 4MTBA 2BD5A 1HAOH 1Z71A 2G51A 3ZZDA 4X6MA 1YPJH 1TPSA 1GMCG 4AFQA 1ZMJA 2XCFA 1UK2A 4O9VA 1ZTLA 1C2JA 2XOKD 5DKMA 1V2JT 3KCGH 4ABBA 1EX3A 4VGCC 1G3EA 1SGNE 2VIDA 4D7GA 1C4Y2 1D6WA 1ELVA 1O30A 5EGMA 1WDIA 1N1LA 1F5LA 3KF2A 4Z0KA 1DY8A 3ITIA 2VWOA 4RT1A 4ISHH 1N6XA 1SI5H 1DWDH 1TAWA 3VGCC 2B5TB 3AVZA 1QCPA 2ZC9H 1AFEH 5GWZA 3RMLH 1C1VH 3F2FA 5K0HA 3VGCB 1DUEA 1GDUA 3JZ1B 3L3TA 2BOHB 2PHBA 1E37B 3ELAH 5B6OA 1NRPH 2J98A 4I32A 1EJAA 3SORA 3FZZA 2Q1JA 4AYYB 2I6SA 5A8ZA 1GI6A 1D3QB 3F2HA 1D9IA 3TPIZ 4X8VH 4A1VA 2J95A 1NN6A 2IPQX 1KLJH 2ODQA 2J94A 3ZVGA 1VCQA 1C5YB 1TALA 5F03A 2PR3A 2R2WU 2AEIH 1C2MA 1UHBB 2OC8A 3W94A 2QF4A 1F0UA 2VVCA 3BV9B 1T4VH 1V2RT 1UTJA 2QYIA 3UREA 4ZXXH 1A4WH 1KLTA 3S7HB 4WMFA 1OYTH 3RM0H 1DSTA 1O5AB 1THPB 2PP6A 1TOMH 3ZZ8A 1MTNB 1MMJN 2A4RA 4WMDA 6ESTA 1TGSZ 4WXIA 1BJUA 2SGAA 2UUFB 5I46H 1EATA 2BLQA 5LPRA 1NPMA 3PMBB 3VB6A 1O3CA 3M3TA 1AO5A 1ZJKA 1ZHPA 2TGDA 2Q6GA 5GJ4B 1UTNA 7GCHG 5I25A 3BEIB 2ZCHP 1CA8B 2ZQ1A 1AVXA 3FFGA 1ESBA 1EAWA 1MAXA 4UFEH 5E0GA 1K28D 3P8NA 5C17A 1GBMA 4JZIA 1T8MA 3BIUH 1AIXH 1C2HA 1AGJA 2PSYA 1HXFH 5CMXH 2FWWA 4I8HA 5GCHF 1QL9A 4A5TS 2XYAA 3SI3H 1KMHB 2QN5T 3PLKA 1K1NA 2AERH 1LPKB 3EDXB 1OX1A 4NWKA 1W13U 4IMQA 1YC0A 3T2NA 1ZOMA 3M61U 3SW2B 3FP7E 2FS9A 1TX7A 2VVVA 1AUTC 2ZDKA 4FUCA 1GHAG 2VB0A 4MPUA 5EXLA 1KXDA 3TK5A 4UDWH 4GLYA 2AS9A 3MH5A 2STBE 2QF0A 2SNVA 2BXTH 4OS5A 2LNCA 2BM2A 4TWWA 1FNIA 2XNIA 3ZZ6A 1UTOA 2C8ZB 2HPPH 1G30B 2G81E 1YF4A 4DCDA 2KCYA 1K0HA 3S69A 1GHBG 1MTVA 4Y11E 5KECA 3BN9A 2FI4E 3RXBA 3UAIC 3RP2A 5EJ1A 5DP6A 1A5IA 3S9CA 4A7IB 2YMSB 5C1YA 1BRBE 2ZPSA 2GCHF 5C5NA 2Y5FA 4CREA 1AB9C 1GBTA 2FEQH 1YP9A 2YMSD 4X2XA 4MVNA 1SSXA 3TITA 3UB0A 5AVDA 2H5DA 2VNTA 2YMSC 3LGIA 1BTPA 5HIYA 1JIRA 1MKXK 4ABAA 4NA7A 1BBRK 4CH2B 4FUFA 1HAHH 2QXIA 4XOJA 4X2YA 1O2NA 4ESTE 1RTKA 1OPHB 3KGPA 1C5UA 1HLTH 2GP9B 1FJSA 1S6HA 1LMWB 3A7WA 3ZZ3A 1SMFE 1FN6A 3PROA 3LIWA 1DOJA 4X8SH 3ZVBA 3O8CA 1C5NH 1GHAF 2B0FA 3N99A 1YPLH 2HGTH 1IQEA 2BQWB 2QCYA 3IITA 3QUMP 3T27A 5DP5A 1UCYK 1AKSA 4FU8A 2F9NA 1SGYE 4Q7XA 1MBMA 3HGNA 3P6ZB 1C5XB 1K1LA 1E35B 3A7VA 1A46H 1ZTJA 2VIWA 3SYJA 1DS2E 3GY2A 1TYNA 2VU8E 2ZGXH 2IJOB 1PPFE 3TVJB 1BBRH 3HGPA 1VKYA 1AUJA 1FY1A 3GY8A 2GVFA 3TGJE 1ZMNA 2IOTA 3PWBA 1YYY1 3QGJA 3GDVA 1L0ZA 1HJAB 2AMDA 1FXYA 2FZZA 3U69H 1DX5M 4B2AA 2CGAA 5EG4A 1KXBA 3DUXH 3OX7U 1SGTA 1A7SA 3Q76A 1WCZA 1GBJA 1FQ3A 1GWAA 3E8LA 1YLNA 2WUCA 4D8NA 2WSSD 4NIYA 4B75A 1FV9A 2LP6A 2KR7A 1MD7A 1XUIA 2H9TH 5LPEA 2NU1E 1C5MD 4RSPA 3CS7A 2W3KA 4CH8B 2A32A 1PPCE 2W7UA 2YNAA 2ZHQH 3Q00A 1C5OH 3M5OA 3ODFA 4LOYH 4Q63A 1P02A 1NFUA 2QE7D 4FUJA 1QBNA 3GYMA 3Q3XA 1K22H 1TE0A 1Y3YA 2BDGA 1OWKA 4DOQA 4OS2A 4ABJA 2UWLA 3SV7A 4NFEA 1V2OT 1DPOA 3PB1E 5T1VA 3OSYA 3LU9B 2C90B 2G5VA 1A0LA 1G3DA 4X1NU 1BMNH 3GCOA 3RU4D 2EQNA 1MKWH 1YCPM 1DITH 1IQIA 5ETXA 1ANEA 4B6EA 1WUNH 3ZZ5A 3ESTA 4YT7H 3TH3H 3SZNA 1HJ9A 1F5RA 1MQ5A 1OSSA 2ZU4A 1BB0B 1NZQH 2O8MA 3EYDA 1QURH 3TGKE 2BZ6H 1FZZA 2ALPA 1LHEH 2FODA 1SOTA 1CHOG 2YOLA 1C1TA 1GJ9B 1UTKA 3SJ8A 3UUZA 1UK4A 1BTXA 3SNBA 1EFRD 1A5GH 3SU2A 1DY9A 3ZZ9A 1TX8A 3RXAA 2BD4A 3E3TA 1C1WH 4VGCB 5G4BA 2F9PA 2WYJA 3A81A 1BMFD 1QBOA 4CRBA 2VGCC 3BTQE 2Z3EA 1O2LA 2R9PA 5T6DA 1IAUA 2O8TA 1T8NA 1S82A 1SGRE 1DT2A 1KSNA 1F7ZA 4NIWA 3W1EA 1O3AA 4H42U 2FP7B 4K3JA 2O8WA 1SL3A 2RA3A 3IWMA 2GV6A 4GPGA 2QF5A 1EP6A 1HFDA 5HM9A 3NUMA 3QTVH 3UWIA 2H5CA 4FU9A 1FONA 2P8OB 1TGTA 1S85A 1UVUH 2KM0A 2BVRH 3SU5A 1PQAA 3U9AH 3AAVA 3STIA 3ZZBA 1GBBA 1BMLA 5EW1H 1AWHB 2BLOA 3SOSA 1Q2WA 1TBRH 2CK3D 2HVYB 4ACAA 1AY6H 1QA0A 3AW1A 5DP3A 2TGPZ 3LH3A 4JYVH 2D8WA 3GS9A 3OEED 2Q6DA 1W7XH 1G2LA 1O2WA 2CHAB 3T5FH 4HG6A 2ZFTA 3U1IB 4KELA 1EAXA 4DT4A 1AZZA 1GVZA 1KXEA 2PTNA 1GBDA 1Y3UA 4Y7AA 5GXPA 4Y6DA 4LK4A 1V2MT 1K1IA 3SQEE 3VXFH 1LKAA 1PPBH 1TGCA 4UE7H 3MU8A 2AIPA 3T62A 2F9OA 4CR9A 1IQJA 4UEHH 1ZHMA 8ESTE 4GVUA 4RN6A 2VWMA 4IC6A 1HJAC 4AN7A 3BTME 3N7EA 2HNTC 5C0UA 3MU5A 4HFPB 2WPHS 1B0EA 1PQ5A 4MG3A 4B74A 1EJNA 1CGHA 2K8IA 3GY7A 5LH8A 1O2RA 1A1RA 4M7GA 1AD8H 4ISIH 1FDPA 1O5FH 2OTVA 3T26A 2IN2A 1OS8A 1S81A 2ZFPH 4JK5A 2VH6A 4A92A 3BTTE 2Y82A 2VWNA 1EJMA 2ZTZA 3T28A 3RXQA 2A7JA 3MU4A 1O5CB 1HCGA 2GZ9A 2WPMS 2XBYA 1LVMA 1FAXA 4RI0A 3U8RH 1J17T 3F3BA 4F49A 4J1YA 1YLDA 3V7TA 4BAMB 2FM2A 1BTZA 1GI2A 1QGFA 2ZECA 2ZDAH 4OS1A 3SV9A 1O5DH 2QXJA 3V0XA 5AFYH 1LTOA 5C3NA 5CE1A 2H6MA 3PMHB 1OP8A 1IQNA 1TLDA 1O2MA 2BDYA 3EAJA 1BA8B 1GI8B 4DIHH 3CS0A 4K60A 2SGPE 3RXLA 2A4QA 1ESTA 3GY4A 1GBIA 2NU0E 4X8TH 4JYTA 4ZKNU 2A45B 1E36B 5H4IB 1RIWB 2EC9H 4YESB 1V2WT 2ZI2H 1W12U 4WH8A 1HNEE 1K1MA 2OC7A 1O3MA 4UD9H 3ZV9A 1AMHA 1WTHD 2W3IA 2XTTB 3QLPH 2BQ6B 1F0RA 1P03A 3LC3A 3O8BA 1GBFA 4Y71A 3OTJE 3EQ0H 5CHAC 3Q77A 4AOQA 2AMPA 4XBCA 1O3FA 1QRWA 1XUKA 3F1SB 3M37A 3QN7A 1YWUA 4TYDA 2O8UA 2XXLA 4WF8A 3RMNH 3SQHE 1K1PA 1EOLA 1Y8TA 1HIAB 4DW2U 1C1RA 4O03A 4Y76A 5DSFA 2B7DH 2FLBH 2K1QA 3V12A 4YOGA 3TJOA 1C2IA 3PRDA 1NFXA 3M5NA 4F4OC 2ZDMA 1L4DA 2H2ZA 1Y5AT 3MO9A 1JOUB 3LDXH 3TGIE 2Y5GA 4DIIH 1EOJA 2ZO3H 1C2LA 3RXRA 1FN8A 1SFIA 2KX4A 4AFUA 3RXDA 5HGGA 3RLYH 1NY22 4A1XA 3OTPA 1EAIA 1C1UH 1SHHB 1Z1IA 2KCPA 1VCPA 3RMOH 2VIOA 3ZVAA 1LCYA 3DT0H 1DDJA 1UJ1A 2XBXA 2D26C 1IHTH 3PWCA 1YBWA 4GUXA 2A0QB 1QJ7B 3BIVH 4BNRA 1SHYA 2ZGJA 4X6OA 4CBOA 4BXWA 1QRZA 4BAKB 3A8BA 1QRXA 4SGAE 3D23A 1O39A 1U6QA 4NG9H 3TU7H 3URCA 1GCTC 5TCAA 1OHHD 2A1DB 3D65E 1O3EA 1QJ1B 4D7FA 2CHAC 2EI8A 2VVUA 2FOCA 2FYQA 3MQKC 1TRNA 1EKBB 1HJ8A 1CVWH 2AGGX 1C2EA 1ZSKA 3NRLA 1C5VA 4FUGA 1KLIH 1W3CA 1CQQA 2PKAA 1SBWA 4XBBA 5EQSA 4NA9H 4R8TB 1N8OC 3I29A 2ZA5A 1UMAH 1XUFA 2V3OH 3MOCA 1ZR0A 1H8HD 4NWLA 1MU6B 5A0BA 3O8RA 4X1QU 1A3BH 4U32A 1NBMD 2HWLB 3PRBA 1GJBB 2FDAA 2QXHA 1TONA 3S7KB 3PYHA 5E0JA 4ABHA 2Z3CA 4ZKSU 2BX4A 1LQEA 4NSYA 5JBAS 1ABJH 1D3PB 1P2OA 4ABGA 4B73A 1XUJA 3HK6B 4ZUHA 1BMAA 2Y7ZA 3TK6A 1C1SA 1CBWC 4WY3A 1UK3A 4X1SU 1EPTA 2BVXH 3T29A 4WWYA 1DWBH 1OWHA 4FXGH 5EOKA 4CR5A 3C27B 2XC5A 3DSOA 3LGVA 4ZCNA 1L1GA 1BTWA 4Q80A 1FAKH 2AFQB 4AB8A 2G00A 3D62A 4NA8A 1C2KA 5IYTA 2R3UA 1IHSH 2Z9JA 1G3BA 2A7CA 2QY0B 4B2BA 5FL7D 1KXFA 2P16A 3UOUA 1LVYA 2BLVA 1EUFA 5FPTA 1NU9A 1ETSH 1TMUH 1MTSA 4ZHAA 1S6FA 3MNXA 1EPTC 2NU3E 4RKJB 1PPZA 1T4UH 5HMAA 1LDTT 1LHDH 3KHVA 3LJOA 1K21H 2BY7X 3LOXA 4OS4A 3RXCA 5LGOA 1O35A 1C1OA 3PMJA 1AHTH 2Z9LA 5FX6A 4WH6A 3SNDA 2PKSB 2CMYA 4BXSA 5FCKA 1GBAA 3NWUA 1ZSLA 4ZAEA 1QHRB 5HM2A 3RXKA 1YPGH 1V2VT 1L4ZA 1F0SA 1WQSA 1RTFB 2ZPQA 1DWEH 2XRCA 1CSOE 1Z8GA 4FUDA 2ALVA 2J92A 1SGIB 1HYLA 3MYWA 2UWPA 1GI1A 2THFB 1DSUA 1C5LH 5FHTA 2P3FH 5TCCA 1ELBA 3QX5H 1H9LB 1WV7H 3SU0A 4JZ1A 3U98H 3BTGE 1JRTA 1ZGVA 4GSOA 1THSH 4MPXA 4WJG2 3A80A 3LH1A 3MI4A 1SLVB 2SGDE 1ELCA 1Z6JH 2ZIQH 1ANDA 4BTTB 5JBCS 1MAYA 1O2GH 6CHAC 5T3HA 1ELGA 1KIGH 1XVOA 3IG6B 2HRVA 3LKWA 1DWCH 2ZCKP 1SGCA 1W10U 3VFEA 5JB9S 4DG4A 4BAQB 2IJD1 2ZHWH 3MU1A 3LONA 3UNSA 1PYTC 4Y79A 3GY6A 4E06H 1EASA 1TA6A 4ABIA 1SGFA 4KTUA 2FIRH 4X0WU 1P9UA 1MABB 1DUAA 2WPJS 1TB6H 2Z7FE 1LHFH 3Q3YA 4FUEA 1GJ7B 1FMGA 1N8OB 1GCTB 3RXPA 1T8OA 1V2UT 2AHME 5DK1A 3BG4B 3PTNA 2UUYA 1WAYB 2GMTC 2KFWA 1NFWA 2XNDD 4CHAC 3VB7A 7KMEH 4LZ1H 1HRTH 1NRRH 5FPSA 2FX4A 2BQ7B 2WPIS 2KAIB 3D49H 3BG4C 1TNJA 1G2MA 2A4OA 4X8UH 3SGAE 3UR6A 2M2AA 2ZDVH 2CF8H 3MNBA 5EU8A 1GMHF 2IPHA 1C1NA 2JETB 1UVPA 2J97A 1SC8U 3F9EA 3A87A 2J2UA 5JDUB 1VITF 4BAOB 1B7XB 7LPRA 3NPSA 1W0KD 1EZUC 1GBLA 3HKJB 4ZHLU 5E8EH 4K5ZA 5JBBS 2XBWA 3S9BA 3PV5A 4CRAA 1GPZA 1O2HA 1H9HE 5GCHG 1E0FD 1JXPA 2OBOA 4IN2A 4ASHA 3SV8A 2C8YB 2UUJB 1MD8A 4AG1A 2BVSH 8GCHF 1HGTH 2VINA 8LPRA 1RD3B 5A09A 3I77A 1O2IA 2GT8A 2I6QA 2ZGBH 4I8GA 1INCA 1IQHA 3PV4A 1MU8B 3BTDE 2ZGCA 2W5EA 3C1KA 1J9CH 5DG6A 2AGEX 4IC5A 5JBTA 1PJPA 3DFLA 4ISOA 1V2KT 2VGCB 1W11U 4Q2KA 3P70B 3T25A 2FMJA 1BITA 3FP6E 1C5ZB 1GI3A 1UTMA 1NRQH 2A5AA 1GGDB 1GDQA 2J34A 4I86A 1VITH 1SOZA 3RXFA 1GMHG 9LPRA 3RXIA 1SG8B 1WU1A 4ASUD 1ETTH 1GI4A 3ZV8A 1UTLM 1Z8JB 3ATWA 5HIZA 4IBLH 1Y3WA 1TWXB 2Y5HA 2BD8A 5F8ZA 1O33A 1LHCH 1MQ6A 3RXSA 3SUFA 3UIRA 3S9AA 3LT3A 2V35A 4KTSA 5C5OA 3BTWE 1P2IA 3SI4H 5K7RA 3NK8A 1XUHA 1TNKA 1XKAC 2CF9H 4H4FA 3K2UA 3HKIB 5IK2D 3LGTA 1SGQE 1N6YA 1O2PA 1V2NT 1TRYA 1O5BB 1WTGH 2A5IA 1O31A 3F68H 1T31A 2BDBA 1JMOH 2D1JA 4FUIA 5C2ZA 1O3HA 2RDEA 3E91A 3H09A 1G37A 4TWYA 3SO3A 4ABEA 3PLPA 1RRKA 3E0PB 2JH5D 5FX5A 4IMZA 3FKSD 1TMBH 5AHGH 2PGQB 1UCYH 2WV4A 1BDAA 1HAPH 3LGYA 2KCOA 2JKHA 1NRSH 3WWBA 1DLEA 1HDTH 1Y5BT 2WINI 1Y3XA 2Q6FA 1FY4A 4I8KA 1HAIH 3BTKE 4FVBA 3BSQA 1VGCB 1MTNC 1VITG 1SGDE 4GCHG 3SU3A 4AX9H 3ZIAD 3BTEE 1MH0A 4NZQA 1GI7B 5EJZA 2F83A 2H9EH 3UTUH 1SQOA 1DXPA 3SNCA 5A8XA 2P93A 1O2QA 1S6LA 1VGCC 1GG6B 2ZTYA 2J4IA 4ACBA 1PPHE 1AE5A 1A5HA 1QR3E 2JDID 2ZZUH 1AFQB 3K6YA 2G5NA 3B23B 1EZQA 8GCHG 1HPGA 4CRFA 3ZZ4A 3WW7A 2SGFE 3A7ZA 1GI5A 2FS8A 2BD9A 4GHQA 3RMMH 2FX6A 1PYTD 2OQUA 2ANYA 3W95A 4CRCA 1H9IE 2P3UB 2AH4X 3A84A 2OK5A 1E34B 2BB4A 1ZGIA 2H1UA 3NCLA 1O3DA 1V2QT 1OYQA 1C9TA 4I8LA 1C2FA 3SV2H 2PUXB 1BRUP 2ILNA 1FIZA 2AIQA 2VIQA 3FZDA 5C94A 4ZROA 4AB9A 2ULLA 1CE5A 1C9PA 1ARCA 1KDQB 1FI8A 1H8IH 2OP9A 3OY5U 2OC0A 1L1JA 5BRRE 2DE9A 1GI9B 1BUIA 5DP9A 1P09A 2HNTF 2ZDNA 1GDNA 1V2ST 2BDHA 1B0FA 5EPNA 1KY9A 1OWIA 3A88A 4Z6AH 4P02A 3A8DA 3GDUA 1O5EH 2WYGA 2JH6D 4F48B 4XFQA 2ZGHA 4TY6A 2FPZA 4AG2A 5ABWA 2ZHEH 4ZKOU 1O34A 3ATLA 3SU4A 3TNSA 1OP2A 3F6UH 3R0FA 2PWXA 2VIVA 4I8JA 3DFJA 3N7OA 1LVOA 4K8YA 3GY3A 4TPYA 3E90B 4OS7A 3B9FH 2ZQ2A 1P12E 1GBEA 1ELTA 1C5WB 1ZLRA 2G55A 2SGQE 5IDKA 4KKDA 2UUKB 1ZPCA 3VEQB 1SFQB 1LO6A 3A8CA 1P2NA 4SGBE 4AYVB 4XRNA 1W2KH 1ELEE 4LXBH 2ZP0H 5PTPA 2VIPA 5EJLA 1ZRKA 1SB1H 3UOPA 2Y7XA 1QQ4A 1XXDA 4K1TA 2F9BH 2EI7A 3ENSB 2AYWA 5DP7A 4A1TA 2TPIZ 2WV9A 2J98B 4WVPE 1UHBA 1WBGB 5DO4H 1UO6A 6CHAB 1F2SE 5HXFA 3RXUA 1WXRA 3EA8A 3F0PA 3SZEA 1BT7A 2VH0A 1C5TA 3V3MA 2XW9A 1Z8IB 1TIOA 1OWEA 1W8BH 3K9XB 3TLOA 3CP7A 5C1XA 3KYFA 1J15A 5LPFA 2EI6A 3QTOH 4MPVA 2NWNA 4B6FA 1BRAA 1FPHH 2B9LA 1ACBE 4K1SA 1TNGA 4UFFH 3GCHB 1THRH 1BBRE 1A0HB 1P06A 2BXUH 1K2I1 4E05H 1MTWA 3SGBE 2GV7A 1SQAA 2Z9KA 1LPGB 1F0TA 5AFZH 1GJDB 3A85A 2GMTB 3URDA 2GCHG 3VPKA 2GCTC 3SV6A 2JH0D 1O5GH 2XWAA 2M5TA 4OGXA 3RC6A 1HAVA 3B8JA 1HAXB 3GCTG 1CHOF 3OYPA 1V6DA 4NSVA 2DE8A 2TRMA 3NKKA 4FOUC 2JETC 1TBQH 4NGAH 4INKA 2ZNKH 3I78A 3ATKA 3KN2A 4H6TA 5GIBA 3RXTA 1RJXB 1KDQA 2OUAA 1O2KA 3SNAA 1GG6C 1A3EH 2BHGA 3ZZCA 1YPMH 1FY5A 1CBWB 1TPAE 1GMCF 1NROH 2ZU1A 2A7HA 1GL0E 4RT0A 1YPEH 3SN8A 4FU7A 4DVAU 3MH6A 4YO9A 4O3UA 1PFXC 3M36A 1CO7E 1YPHE 2J9NA 1BOQA 4ISLA 3P8GA 2O9QA 3OFND 4NIVA 1GHBF 2CJIA 2QAAA 1O2VA 3A82A 2Z94A 5FAHA 4ISNA 3TNTA 1UVTH 1YCPH 1AU8A 3M35A 4I7YH 2GDDA 2HALA 3U1JB 3SBKA 5JB8S 1P3EA 4Q7YA 2OD3B 4YTAA 2VWLA 4OS6A 1O3GA 1AB9B 5F8TA 5EW2H 2XBVA 1OKXA 2P95A 1P9SA 2HLDD 1LQDB 3KQDA 5BPEA 1B5GH 1OOKB 1YPHC 4B2CA 2L6OA 1UTPA 2GGVB 2ZG0H 1CHGA 3MMGA 1XXFA 2FOGA 1KXAA 3SJKA 1LPZB 1Q3XA 1QL7A 2G4TA 5CHAB 5E0HA 4ZH8A 2EEKA 2PV9B 4JK6A 3VB5A 3SUGA 2P94A 3SNEA 1GGDC 2H9HA 1O2JA 1P2KA 1GHVH 3UNRA 4MDSA 3PO1C 5A2MH 1DANH 2L74A 5C67A 1SR5C 4XDEA 4U30A 2FTMA 1GBKA 3ZZAA 1WOFA 2R0LA 1IQMA 2F43B 3HPTB 4X2VA 1C2GA 1HUTH 1AVGH 3F9HA 4QT8C 2GJGA 4B71A 1XKBC 5ESBA 1O3JA 1P0SH 2ZWLH 5FXLA 1QZ8A 2EY4C 2GZ8A 4AFSA 1SPJA 4JZEH 5EPYA 4FVDA 2BY5X 1XVMA 3Q3KA 2F9VA 6GCHF 4NZLA 4FETA 2ZFSA 3LGWA 3A86A 1TPPA 2BYAX 3DA9B 6GCHG 2LELA 1JRSA 3F2GA 1DLKB 3E0NB 4JCNA 3AAUA 2HLCA 2XC4A 3K6ZA 2PKAB 1J8AA 2GZ7A 3VB4A 2ZU5A 1LHGH 2A2QH 4NFFA 1GHYH 1O3IA 2A31A 1HB0B 2Y6TA 2V7QD 2Z9GA 4HZHA 4E7NA 3EA9A 1SQRA 1EP5A 2OXSA 2OCVB 2RDLA 4DURA 3F9FA 3P17H 1QJ6B 2NU2E 3RU4E 3TIUA 3ZVFA 5A0AE 3ZYDA 1O2TA 4MNXA 1VZQH 3FOAA 2BTCE 3WY8A 1TABE 1ZTKA 5TJXA 1UTQA 1WQVH 4CHAB 1NFYA 3SJ9A 2W6JD 2ZU2A 3TH4H 3M7UA 2J5UA 1GBCA 4WXVA 3RLWH 5KEDA 1QFKH 4XD7D 3RXGA 2B8OH 3HK3B 3P95A 2C8WB 4Y0ZE 2CXVA 2TBSA 4YOIA 1NS3A 3GISB 1ZPZA 5C20A 1MZAA 1TNHA 1ESAA 1CA0C 2RCEA 1QL8A 2BD2A 2V0BA 1TNIA 2J38A 1GJAB 1T32A 2G8TA 1TMTH 3AW0A 4KP0A 3VB3A 5F6MA 4M9FA 5J4SA 1O37A 3BG8A 1TPOA 2PUQH 2ZU3A 1J14A 3LGUA 1UW7A 1Z8RA 3ATMA 4Y7BA 2PTCE 3OY6U 3WWFA 3DD2H 2A4GA 1P3CA 3LPRA 1XUGA 5DGJA 4TSFD 2FOMB 3GY5A 1AE8H 4J2YB 4NCYA 1ELAA 1S5SA 1UVOA 3ZVDA 4WMEA 2SGEE 4PROA 2TGTA 5L6NH 4U2WA 4K69A 2BLWA 1E38B 2D2DA 4TT3D 1OWJA 1V3XA 4CRDA 1S0QA 2PW8H 2STAE 4BANB 1FLEE 3QK1A 2CV3A 1RIWC 4YXWD 1RGQA 4D9QA 1FY3A 1AQ7A 3KYGA 2OINA 3EE7A 2HNTE 5SGAE 1EQ9A 3S0NA 4BOHA 4DGJA 1TBZH 3E16B 1C1PA 1SVPA 1AZ8A 1QB1A 2Y81A 1GJCB 1NU7B 3EE0B 1DVAH 4X6PA 2BMGB 1IOEA 1C2DA 2NU4E 2ZKSA 3E6PH 1O3KA 1SGPE 3KQEA 3PV2A 2HVXA 1HIAA 2KZ4A 3ODDA 5DN6D 2C8XB 1RXPA 3AK5A 2WZQA 2F4LA 3FN8A 1JIMA 4A6LA 1C4V2 2BZAA 2ESTE 1T7CA 4DY7B 4THNH 3RU4T 2ASUB 4AFZA 3SHCH 3FAOA 1S84A 1K1OA 3PO1B 1ETRH 3RDZA 2FOHA 5GDSH 2QGRA 2BY9X 1O2ZA 3DCLA 1O2OA 4Y8XA 4ZMAH 2FLRH 3CNRA 3A89A 3P8FA 2ZF0H 3MNSA 1ZRBA 2F9UA 3SHAH 2FTLE 3UPEA 1ANCA 4XSKU 3UFAA 1W14U 1MKXH 2ANMH 3BEUA 1BCUH 4UFDH 1A2CH 1O2XA 4OGYA 4H6SB 1HAZB 5GNDA 3RXMA 2C4FH 3MH7A 4O3TA 3HATH 4MNYA 1BHXB 1P2JA 1ZHRA 3QDZB 1BTYA 3MTYA 1OWDA 5F8XA 1ZSJA 1PPGE 3KQ5A 1C5SA 2FYRA 3STJA 3SJOA 2KAIA 4AZ2B 1RTLA 2AMQA 3RXOA 1MKWK 2P59A 1EB2A 5KGOA 1IQGA 3UR9A 3LJJA 3KQBA 3AASA 2GCTB 1IQFA 4ABDA 3BTFE 2AGIX 4AC9A 5J4QA 1EZXC 1Q31A 1YM0A 2Z6BD 1ELFA 2Z9IA 1Y59T 4B76A 3RC4A 2GD4B 1G36A 3SU6A 1TGNA 1CGIE 2O8LA 3DHKH 1NTPA 1AFQC 2FI3E 4OM9A 1FX0B 1BRCE 4Q7ZA 1FPCH 3TJVA 2Y80A 4Y10E 1DXWA 3U28C 2ZFFH 3JZ2B 2F3CE 2GKVE 1EB1H 4YZUA 2GX4A 5DP8A 5L30H 1MCVA 4ABFA 3NXPA 3A8AA 1SLWB 2RG3A 4HI3A 1P11E 2JJ1D 1QA7A 5EODA 3CENA 4MNWA 5GPIB 1Z7KA 1SGEE 3GOVB 2BD3A 3MHWU 5F53A 1YLCA 5DPAA 1CA0B 1ZJDA 1Y3VA 3RXJA 1O2SA 4X6NA 4TY7A 2F91A 2PLXA 3DSPA 5T6GA 1GBHA 2TIOA 3BF6H 4I33A 1S0RA 1AWFH 3GYLB 2ZCLP 1O38A 4IW4E 1H8ED 4ZXYH 5C1UA 1GMDF 4Y8ZA 1EZSC 2GTBA 3RXVA 3A83A 1V2PT 4FUBA 3O8DA 1AN1E 1ID5H 2OQ5A 2VJ1A 4Y8YA 1TGBA 1V2TT 1ZYOA 3L6PA 3N7DA 1EXFA 3EGKH 3A7XA 3UY9A 5E2OA 1C1QA 3KIDU 4UONA 4INLA 4DT7B 3LC5A 1NM6A 4Q4LA 1T8LA 3VG8A 2ANKH 4MQAA 2HOBA 2FOBA 2SFAA 4RKOB 1A0JA 2BX3A 1TQ0B 2R2MB 2P8OC 1OP0A 2W26A 3ZYEA 1GJ6A 2ZHDA 3K65B 2FOAA 5ESTE 5C0TA 1L2EA 1C1MA 4K2YA 2FOFA 1IQLA 5A8YA 3FVFB 5EIYA 2BDCA 4GAWA 2FESH 4X1PU 1GL1A 4YOJA 1TX6A 4MNVA 4IS5A 1DM4B 3MH4A 3OAAD 1H1BA 1IQKA 2FO9A 1LKBA 1YCPK 1BJVA 1NC6A 2ODYB 2ZEBA 2OC1A 1ORFA 1HAYB 2ZFRH 3UQOA 2UWOA 1GI0A 1W0ZU 3L33A 1VCWA 1GJ4H 1MBQA 1SLXB 2A5KA 3RXEA 1RFNA 3GCNA 1P2QA 4YM9A 1SGFG 1GHWH 1O3BA 2A2XH 4Y0YE 3SGQE 1GHZA 1O36A 4HTCH 3FANA 1LVBA 3M5LA 1QTFA 2PGBB 1V2LT 3G01A 1E79D 1GJ8B 3MU0A 3KQCA 1D6RA 4INHA 1GMDG 2EA3A 1C5QA 3UWJH 4MPWA 2PFEA 1RS0A 4I31A 1WYKA 4E7RG 5JYIA 2FXRA 4GHTA 3SU1A 1TA2A 3A7YA 1TNLA 3QGNB 3KNXA 2BD7A 3FP8E 3H5CB 4XBDA 4JZFH 1P2MA 4ZHMU 3V13A 1YY3A 2RA0A 1F92A 1KTTB 1O0DH 3QO6A 9ESTA 4JMYA 1D3TB 2ANWA 1FY8E 1YPKH 4AGJA 2ODPA 2R0KA 3VXEH 1QBVH 4X2WA 6LPRA 4LZ4B 1BTUA 1YKTA 3M7TA 4K1EA 2G52A 2ZTXA 1XMNB 4AGKA 2OBQA 2VBCA 2ZFQH 5FPYA 7ESTE 3QZQA 1CGJE 3UQVA 1E1RD 1CU1A 1P01A 1W0JD 1NO9H 1W0YH 2QV1A 3M7QA 4Z1MD 4D9RA 1CT4E 1ELDE 1QB9A 1GVLA 3SUDA 3ATIA 1P04A 1A61H 1QIXB 3TK9A 1SQTA 3E1XB 3PLBA 1K9OE 2W7SA 2BY6X 5EXNA 3RC5A 2RFKC 1O3PB 5EQRA 1JWTA 1VR1H 2JJ2D 3P92A 1TQ7B 4XE4A 1Z6EA 3OU0A 1L1NA 2Z3DA 1NBME 1F5KU 2K0QA 3P8OA 2WPDD 2QC2A 2FI5E 4ZKRU 1UVSH 1QB6A 2V3HH 2WPLS 1FIWA 1MUEB 2JIZD 2WHXA 2LPRA 1GJ5H 1GHXH 2DUCA 2P3TB 2CN0H 1BIOA 1GVKB 1BQYA 5AF9H 1G9IE 2C93B 4CBNA 4BTUB 3F0OA 3R3GB 3MFJA 1QY6A 5EXMA 2GDEH
chains in the Genus database with same CATH topology
1W7GH 2QXGA 4NIXA 4BAHB 1ZPBA 2BDIA 3BEFB 3U8OH 1KYNA 1PPEE 2WPKS 2BDAA 3MWIU 3MO6A 1BHXF 5FBEA 3SJIA 3TJUA 3M3SA 3MNCA 1VJAU 5L2YH 2FOEA 2XWBI 3EA7A 1KTSB 2PSXA 1C5PA 1YGCH 2PKSC 3H7OA 1HV7A 3ZZ7A 1G3CA 4CRGA 4YT6H 2BOKA 1O3LA 1O2UA 1J16A 4AORA 1P05A 1QNJA 2QA9E 3F9GA 1GCDA 4X1RU 1HAGE 1HAVB 3ZVCA 5DP4A 5JPMH 1ZZZA 1Z1JA 4IN1A 2OLGA 2TGAA 2SNWA 3KEEA 1TOCB 1TRMA 4MLFB 2HPQH 3UNQA 1BMMH 3GDSA 1VJ9U 1O32A 2WV5A 4U01A 1HBTH 4YLQH 5HYOA 1O3OA 1DFPA 3A7TA 1QQUA 1OXGA 1ANBA 4TPIZ 1H4WA 3KL6A 1AKSB 4O97A 1X7AC 1NESE 1NT1A 3SUEA 3PTBA 3ZVEA 4IGDA 2BY8X 2ZDLA 4FUHA 1ABIH 1ARBA 1XX9A 4HGCA 3TJNA 1C4U2 1KXCA 2XCNA 1CT2E 2ZPRA 4D76A 4K8BA 3QZRA 3BTHE 4UFGH 1CT0E 1D4PB 3QWCH 1P57B 4B1TA 3GCHC 1H8DH 1D3DB 3TH2H 1JBUH 1DE7H 2C3SA 2YNBA 4JYUH 1G32B 4KGAA 5T6FA 1EAUA 1P10A 5A0CA 3RXHA 1HXEH 5FCRA 4GCHF 3GICB 4JZDH 2ZHFH 1NRNH 4R0IA 1O3NA 5L2ZH 1AVWA 1AI8H 5DJ7A 2V6NA 1UCYE 4YLUA 2QF3A 5EQQA 1WSSH 1FUJA 1Y5UT 3PM3A 2XC0A 2GT7A 1C5RA 3RM2H 3M5MA 3NZIA 2WUBA 4KTCA 1PQ7A 5E2PA 1S83A 2R3YA 1SLUB 7GCHF 3RUOA 8KME2 3MO3A 4BTIB 5FBIA 3H7TA 3M3VA 1XM1A 1BTHH 1P8VC 1O2YA 2QIQA 3GCTF 3PMAB 2G4UA 1MZDA 4DJZB 1PQ8A 1TFXA 3U8TH 1BZXE 1M9UA 1MCTA 1DICA 1EPTB 1K1JA 1MTUA 1ZMLA 4MTBA 2BD5A 1HAOH 1Z71A 2G51A 3ZZDA 4X6MA 1YPJH 1TPSA 1GMCG 4AFQA 1ZMJA 2XCFA 1UK2A 4O9VA 1ZTLA 1C2JA 5DKMA 1V2JT 3KCGH 4ABBA 1EX3A 4VGCC 1G3EA 1SGNE 2VIDA 4D7GA 1C4Y2 1D6WA 1ELVA 1O30A 5EGMA 1N1LA 1F5LA 3KF2A 4Z0KA 1DY8A 3ITIA 2VWOA 4ISHH 1N6XA 1SI5H 1DWDH 1TAWA 3VGCC 2B5TB 3AVZA 1QCPA 2ZC9H 1AFEH 5GWZA 3RMLH 1C1VH 5K0HA 3VGCB 1DUEA 1GDUA 3JZ1B 3L3TA 2BOHB 2PHBA 1E37B 3ELAH 5B6OA 1NRPH 4I32A 3SORA 1EJAA 3FZZA 2Q1JA 4AYYB 2I6SA 5A8ZA 1GI6A 1D3QB 1D9IA 3TPIZ 4X8VH 4A1VA 2J95A 1NN6A 1KLJH 2ODQA 2J94A 3ZVGA 1VCQA 1C5YB 1TALA 5F03A 2PR3A 2R2WU 2AEIH 1C2MA 1UHBB 2OC8A 3W94A 1F0UA 2VVCA 3BV9B 1T4VH 1V2RT 1UTJA 2QYIA 3UREA 4ZXXH 1A4WH 1KLTA 3S7HB 4WMFA 1OYTH 3RM0H 1DSTA 1O5AB 1THPB 1TOMH 3ZZ8A 1MTNB 1MMJN 2A4RA 4WMDA 6ESTA 1TGSZ 4WXIA 1BJUA 2SGAA 2UUFB 5I46H 1EATA 2BLQA 5LPRA 1NPMA 3PMBB 3VB6A 1O3CA 3M3TA 1AO5A 1ZJKA 1ZHPA 2TGDA 2Q6GA 5GJ4B 1UTNA 7GCHG 5I25A 3BEIB 2ZCHP 1CA8B 2ZQ1A 1AVXA 3FFGA 1ESBA 1EAWA 1MAXA 4UFEH 5E0GA 1K28D 3P8NA 1GBMA 4JZIA 1T8MA 3BIUH 1AIXH 1C2HA 1AGJA 2PSYA 1HXFH 5CMXH 2FWWA 4I8HA 5GCHF 1QL9A 4A5TS 2XYAA 3SI3H 2QN5T 3PLKA 1K1NA 2AERH 1LPKB 3EDXB 1OX1A 4NWKA 1W13U 4IMQA 1YC0A 3T2NA 1ZOMA 3M61U 3SW2B 3FP7E 2FS9A 1TX7A 2VVVA 1AUTC 2ZDKA 4FUCA 1GHAG 2VB0A 4MPUA 5EXLA 1KXDA 3TK5A 4UDWH 4GLYA 2AS9A 3MH5A 2STBE 2QF0A 2SNVA 2BXTH 4OS5A 2LNCA 2BM2A 4TWWA 1FNIA 2XNIA 3ZZ6A 1UTOA 2C8ZB 2HPPH 1G30B 2G81E 1YF4A 4DCDA 3S69A 1GHBG 1MTVA 4Y11E 3BN9A 2FI4E 3RXBA 3RP2A 5DP6A 1A5IA 3S9CA 4A7IB 5C1YA 1BRBE 2ZPSA 2GCHF 5C5NA 2Y5FA 4CREA 1AB9C 1GBTA 2FEQH 1YP9A 4X2XA 4MVNA 1SSXA 3TITA 5AVDA 2H5DA 2VNTA 3LGIA 1BTPA 1JIRA 1MKXK 4ABAA 4NA7A 1BBRK 4CH2B 4FUFA 1HAHH 2QXIA 4XOJA 4X2YA 1O2NA 4ESTE 1RTKA 1OPHB 3KGPA 1C5UA 1HLTH 2GP9B 1FJSA 1S6HA 1LMWB 3A7WA 3ZZ3A 1SMFE 1FN6A 3PROA 3LIWA 1DOJA 4X8SH 3ZVBA 3O8CA 1C5NH 1GHAF 2B0FA 1YPLH 2HGTH 1IQEA 2BQWB 2QCYA 3IITA 3QUMP 3T27A 5DP5A 1UCYK 1AKSA 4FU8A 2F9NA 1SGYE 4Q7XA 1MBMA 3HGNA 3P6ZB 1C5XB 1K1LA 1E35B 3A7VA 1A46H 1ZTJA 2VIWA 1DS2E 3GY2A 1TYNA 2VU8E 2ZGXH 2IJOB 1PPFE 3TVJB 1BBRH 3HGPA 1AUJA 1FY1A 3GY8A 2GVFA 3TGJE 1ZMNA 2IOTA 3PWBA 1YYY1 3QGJA 3GDVA 1L0ZA 1HJAB 2AMDA 1FXYA 2FZZA 3U69H 1DX5M 4B2AA 2CGAA 5EG4A 1KXBA 3DUXH 3OX7U 1SGTA 1A7SA 3Q76A 1WCZA 1GBJA 1FQ3A 1GWAA 3E8LA 2WUCA 4D8NA 4NIYA 4B75A 1FV9A 1MD7A 1XUIA 2H9TH 5LPEA 2NU1E 1C5MD 4RSPA 3CS7A 2W3KA 4CH8B 2A32A 1PPCE 2W7UA 2YNAA 2ZHQH 3Q00A 1C5OH 3M5OA 3ODFA 4LOYH 1P02A 1NFUA 4FUJA 1QBNA 3GYMA 3Q3XA 1K22H 1TE0A 1Y3YA 2BDGA 1OWKA 4DOQA 4OS2A 4ABJA 2UWLA 3SV7A 4NFEA 1V2OT 1DPOA 3PB1E 3OSYA 3LU9B 2C90B 2G5VA 1A0LA 1G3DA 4X1NU 1BMNH 3GCOA 3RU4D 1MKWH 1YCPM 1DITH 1IQIA 5ETXA 1ANEA 1WUNH 3ZZ5A 3ESTA 4YT7H 3TH3H 3SZNA 1HJ9A 1F5RA 1MQ5A 1OSSA 2ZU4A 1BB0B 1NZQH 2O8MA 3EYDA 1QURH 3TGKE 2BZ6H 1FZZA 2ALPA 1LHEH 2FODA 1SOTA 1CHOG 2YOLA 1C1TA 1GJ9B 1UTKA 3SJ8A 3UUZA 1UK4A 1BTXA 3SNBA 1A5GH 3SU2A 1DY9A 3ZZ9A 1TX8A 3RXAA 2BD4A 3E3TA 1C1WH 4VGCB 5G4BA 2F9PA 2WYJA 3A81A 1QBOA 4CRBA 2VGCC 3BTQE 2Z3EA 1O2LA 2R9PA 5T6DA 1IAUA 2O8TA 1T8NA 1S82A 1SGRE 1DT2A 1KSNA 1F7ZA 4NIWA 1O3AA 4H42U 2FP7B 4K3JA 2O8WA 1SL3A 2RA3A 3IWMA 2GV6A 4GPGA 1EP6A 1HFDA 5HM9A 3NUMA 3QTVH 3UWIA 2H5CA 4FU9A 1FONA 2P8OB 1TGTA 1S85A 1UVUH 2BVRH 3SU5A 1PQAA 3U9AH 3AAVA 3STIA 3ZZBA 1GBBA 1BMLA 5EW1H 1AWHB 2BLOA 3SOSA 1Q2WA 1TBRH 1AY6H 1QA0A 3AW1A 5DP3A 2TGPZ 3LH3A 4JYVH 2D8WA 2Q6DA 1W7XH 1G2LA 1O2WA 2CHAB 3T5FH 2ZFTA 3U1IB 4KELA 1EAXA 1AZZA 1GVZA 1KXEA 2PTNA 1GBDA 1Y3UA 4Y7AA 5GXPA 4Y6DA 4LK4A 1V2MT 1K1IA 3SQEE 3VXFH 1LKAA 1PPBH 1TGCA 4UE7H 3MU8A 2AIPA 3T62A 2F9OA 4CR9A 1IQJA 4UEHH 1ZHMA 8ESTE 4GVUA 4RN6A 2VWMA 4IC6A 1HJAC 4AN7A 3BTME 2HNTC 3MU5A 4HFPB 2WPHS 1B0EA 1PQ5A 4MG3A 4B74A 1EJNA 1CGHA 3GY7A 5LH8A 1O2RA 1A1RA 4M7GA 1AD8H 4ISIH 1FDPA 1O5FH 2OTVA 3T26A 2IN2A 1OS8A 1S81A 2ZFPH 4JK5A 2VH6A 4A92A 3BTTE 2Y82A 2VWNA 1EJMA 2ZTZA 3T28A 3RXQA 2A7JA 3MU4A 1O5CB 1HCGA 2GZ9A 2WPMS 2XBYA 1LVMA 1FAXA 3U8RH 1J17T 4J1YA 4F49A 1YLDA 3V7TA 4BAMB 2FM2A 1BTZA 1GI2A 1QGFA 2ZECA 2ZDAH 4OS1A 3SV9A 1O5DH 2QXJA 3V0XA 5AFYH 1LTOA 5C3NA 5CE1A 2H6MA 3PMHB 1OP8A 1IQNA 1TLDA 1O2MA 2BDYA 3EAJA 1BA8B 1GI8B 4DIHH 3CS0A 4K60A 2SGPE 3RXLA 2A4QA 1ESTA 3GY4A 1GBIA 2NU0E 4X8TH 4JYTA 4ZKNU 2A45B 1E36B 5H4IB 1RIWB 2EC9H 4YESB 1V2WT 2ZI2H 1W12U 4WH8A 1HNEE 1K1MA 2OC7A 1O3MA 4UD9H 3ZV9A 1AMHA 1WTHD 2W3IA 2XTTB 3QLPH 2BQ6B 1F0RA 1P03A 3LC3A 3O8BA 1GBFA 4Y71A 3OTJE 3EQ0H 5CHAC 3Q77A 4AOQA 2AMPA 4XBCA 1O3FA 1QRWA 1XUKA 3F1SB 3M37A 3QN7A 4TYDA 2O8UA 2XXLA 4WF8A 3RMNH 3SQHE 1K1PA 1EOLA 1Y8TA 1HIAB 4DW2U 1C1RA 4O03A 4Y76A 2B7DH 2FLBH 2K1QA 3V12A 4YOGA 3TJOA 1C2IA 1NFXA 3M5NA 4F4OC 2ZDMA 1L4DA 2H2ZA 1Y5AT 3MO9A 1JOUB 3LDXH 3TGIE 2Y5GA 4DIIH 1EOJA 2ZO3H 1C2LA 3RXRA 1FN8A 1SFIA 4AFUA 3RXDA 5HGGA 3RLYH 1NY22 4A1XA 1EAIA 1C1UH 1SHHB 1Z1IA 1VCPA 3RMOH 2VIOA 3ZVAA 1LCYA 3DT0H 2XBXA 1DDJA 1UJ1A 2D26C 1IHTH 3PWCA 1YBWA 4GUXA 2A0QB 1QJ7B 3BIVH 4BNRA 1SHYA 2ZGJA 4X6OA 4CBOA 4BXWA 1QRZA 4BAKB 3A8BA 1QRXA 4SGAE 3D23A 1O39A 1U6QA 4NG9H 3TU7H 3URCA 1GCTC 5TCAA 2A1DB 3D65E 1O3EA 1QJ1B 4D7FA 2CHAC 2EI8A 2VVUA 2FOCA 2FYQA 1TRNA 1EKBB 1HJ8A 1CVWH 2AGGX 1C2EA 1ZSKA 1C5VA 4FUGA 1KLIH 1W3CA 1CQQA 2PKAA 1SBWA 4XBBA 5EQSA 4NA9H 4R8TB 1N8OC 3I29A 2ZA5A 1UMAH 1XUFA 2V3OH 3MOCA 1ZR0A 4NWLA 1MU6B 5A0BA 3O8RA 4X1QU 1A3BH 4U32A 2HWLB 1GJBB 2FDAA 2QXHA 1TONA 3S7KB 3PYHA 5E0JA 4ABHA 2Z3CA 4ZKSU 2BX4A 1LQEA 4NSYA 5JBAS 1ABJH 1D3PB 1P2OA 4ABGA 4B73A 1XUJA 3HK6B 4ZUHA 1BMAA 2Y7ZA 3TK6A 1C1SA 1CBWC 4WY3A 1UK3A 4X1SU 1EPTA 2BVXH 3T29A 4WWYA 1DWBH 1OWHA 4FXGH 5EOKA 4CR5A 3C27B 2XC5A 3LGVA 1L1GA 1BTWA 4Q80A 1FAKH 2AFQB 4AB8A 2G00A 3D62A 4NA8A 1C2KA 5IYTA 2R3UA 1IHSH 2Z9JA 1G3BA 2A7CA 2QY0B 4B2BA 1KXFA 2P16A 3UOUA 1LVYA 2BLVA 1EUFA 5FPTA 1NU9A 1ETSH 1TMUH 1MTSA 4ZHAA 1S6FA 3MNXA 1EPTC 2NU3E 4RKJB 1PPZA 1T4UH 5HMAA 1LDTT 1LHDH 3KHVA 3LJOA 1K21H 2BY7X 3LOXA 4OS4A 3RXCA 5LGOA 1O35A 1C1OA 3PMJA 1AHTH 2Z9LA 5FX6A 4WH6A 3SNDA 2PKSB 2CMYA 4BXSA 5FCKA 1GBAA 3NWUA 1ZSLA 4ZAEA 1QHRB 5HM2A 3RXKA 1YPGH 1V2VT 1L4ZA 1F0SA 1WQSA 1RTFB 2ZPQA 1DWEH 2XRCA 1CSOE 1Z8GA 4FUDA 2ALVA 2J92A 1SGIB 1HYLA 3MYWA 2UWPA 1GI1A 2THFB 1DSUA 1C5LH 5FHTA 2P3FH 5TCCA 1ELBA 3QX5H 1H9LB 1WV7H 3SU0A 4JZ1A 3U98H 3BTGE 1JRTA 1ZGVA 4GSOA 1THSH 4MPXA 4WJG2 3A80A 3LH1A 3MI4A 1SLVB 2SGDE 1ELCA 1Z6JH 2ZIQH 1ANDA 4BTTB 5JBCS 1MAYA 1O2GH 6CHAC 5T3HA 1ELGA 1KIGH 1XVOA 3IG6B 2HRVA 3LKWA 1DWCH 2ZCKP 1SGCA 1W10U 3VFEA 5JB9S 4DG4A 4BAQB 2ZHWH 3MU1A 3UNSA 3LONA 1PYTC 4Y79A 3GY6A 4E06H 1EASA 1TA6A 4ABIA 1SGFA 4KTUA 2FIRH 4X0WU 1P9UA 1DUAA 2WPJS 1TB6H 2Z7FE 1LHFH 3Q3YA 4FUEA 1GJ7B 1FMGA 1N8OB 1GCTB 3RXPA 1T8OA 1V2UT 5DK1A 3BG4B 3PTNA 2UUYA 1WAYB 2GMTC 1NFWA 4CHAC 3VB7A 7KMEH 4LZ1H 1HRTH 1NRRH 5FPSA 2FX4A 2BQ7B 2WPIS