2TBSA

Cold-adaption of enzymes: structural comparison between salmon and bovine trypsins
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
222
structure length
222
Chain Sequence
IVGGYECKAYSQAHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSDKLQCLNIPILSYSDCNDSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFSDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(serine proteinase)
molecule keywords TRYPSIN
publication title Cold adaption of enzymes: structural comparison between salmon and bovine trypsins.
pubmed doi rcsb
source organism Salmo salar
total genus 51
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tbsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2tbsA02
1SGCA 3RXGA 4YLQH 2PSYA 4JZEH 3M3VA 1SGTA 2ZG0H 3Q3YA 1QL8A 3U8TH 1FIWA 2ZU2A 1EJMA 1FY3A 4JYVH 4U2WA 4NZQA 1A1RA 5DP8A 1C2EA 1GBTA 1NRQH 2ANKH 1V2KT 4IW4E 3RXJA 4YOIA 1P11E 1RJXB 2UWPA 3GCOA 1F2SE 1P01A 1QL7A 2OTVA 2VB0A 1HAOH 1B0FA 2BX3A 1ELTA 2FMJA 2TGDA 1K28D 2JH6D 1FY8E 3S7KB 3OYPA 1ARBA 4H6TA 2FESH 1YPJH 1PQ5A 1KYNA 5T3HA 3KQCA 1S84A 4TY7A 3TITA 1O35A 3V12A 5DG6A 3LDXH 2VVCA 1UCYH 2PTCE 1L0ZA 1C1VH 1F92A 2ZNKH 3SV8A 2F9NA 1ETRH 3TNTA 1P09A 1HJAB 1MAXA 1YPMH 1LHFH 3P8FA 4AFSA 4VGCC 1AMHA 4JYTA 1TGCA 4ISOA 4WMEA 1RIWB 3T25A 3UUZA 1EAXA 3RLWH 3NWUA 1TRYA 1JRTA 2TGAA 4KTSA 1GBKA 1FPHH 1ELBA 2VWOA 4CH2B 4H42U 3SU4A 3LT3A 4NA7A 1IQGA 4LXBH 4ABIA 1G3EA 2ZECA 2PKAA 3BTEE 3IG6B 2F9VA 2JH5D 8KME2 1CA0C 1ZMJA 4DIHH 1OWEA 1A46H 3BTHE 1UVTH 1E35B 1KSNA 1GBAA 1MAYA 3LGUA 4XDEA 2G81E 2XNIA 1TRNA 3SV9A 3RXVA 4DG4A 2DE9A 4Y11E 1QA7A 2A4GA 1W0YH 1A5IA 1E38B 2JH0D 4ZAEA 1JBUH 2J92A 3QTOH 2C8WB 3A7XA 1EPTC 1HLTH 2BD2A 1WQVH 4I8KA 2ZTZA 1LMWB 3M61U 4WMDA 4WY3A 1BUIA 5EPNA 5C20A 4K1SA 1XX9A 3IWMA 5C2ZA 1FI8A 3MHWU 1GI8B 2HVXA 1SGQE 4ZKRU 5HGGA 2XWAA 2HRVA 3LIWA 2FTMA 2ZO3H 3SUDA 1E37B 1OKXA 1XVOA 1VCPA 1AHTH 4WVPE 1O2WA 3ZVEA 1V2VT 2QXGA 5JDUB 3B23B 5AVDA 1P2IA 1INCA 5T6DA 1NRPH 2ZEBA 2CMYA 1Q31A 3PLPA 3GDUA 3BTTE 2ESTE 3K2UA 2ZC9H 2XW9A 1C4U2 1O2ZA 2ZU5A 3JZ1B 4GVUA 1BTUA 1ZHRA 1K1NA 1SLVB 3SGBE 3LC5A 1TLDA 1GL1A 4FUEA 1GMDF 2QAAA 1VITG 3DT0H 2QA9E 4BANB 4LOYH 2A1DB 1IAUA 2WV4A 2PGQB 4MPWA 1RRKA 5JB8S 2BXTH 4CH8B 2ZDVH 1UTNA 2ZGJA 2BVSH 1O5FH 2FYQA 4UFFH 2Y81A 1UTJA 4GCHF 3ZYEA 2EI7A 1SB1H 3TU7H 3MO9A 1EATA 1MTNB 1NFYA 2W7UA 2ZQ2A 1XUFA 3SI3H 3MU5A 4X0WU 1Q2WA 1AVGH 3SNEA 1D3PB 4Y6DA 1HJAC 1BJUA 3PV4A 2ODQA 1RIWC 1HDTH 1LPKB 1O2SA 3SQHE 3MFJA 3TK5A 1AO5A 1LVOA 1DDJA 3EDXB 1A5HA 1O3KA 1W3CA 3GCTG 1C5WB 2OC1A 1C5LH 4F49A 1KLJH 1Z6JH 2JKHA 1HRTH 3V0XA 4F4OC 2ZF0H 4CR5A 1SQOA 3FZZA 4K3JA 1CT2E 1K1PA 1Z6EA 4X2YA 2GP9B 3H7TA 4ASHA 4ESTE 1DT2A 4XSKU 4BNRA 5DP6A 4X6PA 4D76A 4HGCA 1OPHB 3VB6A 1NFXA 3SORA 1JXPA 1NN6A 3SJ8A 2ZKSA 3RM2H 3GOVB 1J14A 4D9QA 1GJ9B 1SOZA 3SNBA 7ESTE 5EXLA 1IQIA 3DHKH 1OXGA 3PM3A 1NROH 4TYDA 4U01A 2NU1E 2HALA 3A87A 1Q3XA 5A2MH 2R0KA 4ABHA 2W7SA 2QC2A 5FXLA 1LKAA 1SHHB 5BRRE 3MO6A 1GI7B 1BTHH 2H2ZA 1BBRE 1GDUA 3U1JB 1VCWA 1MQ5A 1QTFA 1V2OT 1HAVB 5GCHF 2ODYB 3S7HB 3ZVDA 3BEFB 1C1SA 1C5NH 2OINA 3EYDA 3BTFE 1C5TA 5HYOA 1C5UA 1HCGA 1SGYE 1RTLA 4INKA 1GBDA 1VJ9U 3KF2A 2GZ8A 2HOBA 4ISIH 4HFPB 2Y5GA 4ZHMU 3MNSA 2A2QH 3KIDU 1V2NT 3ZZ5A 2PW8H 5L2ZH 2GT7A 1C2GA 3LGWA 3QWCH 1RTFB 1TGNA 3W95A 5JBCS 4WWYA 3M7QA 1QJ7B 4NSVA 1BDAA 1CSOE 2YNBA 1YC0A 4ZKNU 1UMAH 1ZTJA 3A83A 3M37A 2FDAA 1QB6A 3OTJE 4SGBE 1O3IA 3QN7A 1EZSC 2G4TA 3IITA 1DXWA 3BTME 3VEQB 4XBCA 1GCDA 1MTNC 2W26A 1G9IE 1BTYA 3R0FA 5CHAB 1K2I1 1O2TA 2F9UA 4Y0YE 4B76A 4DT7B 1OP8A 1DFPA 2BY8X 1TA6A 3TLOA 4ABAA 1AUTC 4YTAA 3KHVA 1MUEB 3STIA 2M5TA 3O8CA 1C5SA 4MLFB 5K7RA 1TNHA 1ZGVA 2R3UA 1V6DA 1K1JA 2Y6TA 4ABFA 1EAWA 3E90B 3RXFA 3AAVA 1JRSA 1TNGA 1OWHA 1J8AA 3MU8A 1A3BH 4LZ4B 2C8XB 1NTPA 1WBGB 5PTPA 1P2QA 3RM0H 4MG3A 1FXYA 2FWWA 2ZGHA 3MNXA 1ETTH 2ZDMA 2WUBA 2ZDNA 4NA9H 3ATMA 4CRFA 3JZ2B 1G3CA 5DP5A 2OQUA 2PR3A 2A7HA 3SN8A 2O8UA 4AG1A 2G5NA 1O3NA 4CHAB 9ESTA 1O3PB 2H6MA 4OGXA 4BXSA 1Z8IB 2BLQA 1S83A 4KGAA 1VJAU 2O8WA 2P59A 4XE4A 1WU1A 2BZ6H 1ZR0A 2PKAB 2BYAX 2VIPA 2Z9GA 1K9OE 1O5AB 1YPGH 3ATWA 1YCPH 1ZOMA 1C5XB 2STAE 3RMLH 2BX4A 1GBLA 2ZA5A 2ZFRH 2Q6FA 2BDIA 3F9EA 3FANA 1O2UA 2FYRA 1S0QA 2WPMS 1WAYB 3AVZA 3E1XB 4QT8C 3GY3A 2ANYA 1JWTA 3RXMA 5DP9A 2P3UB 1MZDA 2F9OA 4MNWA 2P94A 2TGPZ 3F6UH 1XXFA 2A7CA 1Z7KA 2P16A 2WPKS 3GY2A 4E7RG 5C5OA 2W5EA 1T8LA 3ATIA 1PQ7A 3A7ZA 1C5RA 4AFZA 1LDTT 1EZQA 1QCPA 4ABDA 1NT1A 2J38A 5EXNA 3B8JA 3LOXA 2ULLA 3QGJA 2SNVA 1NM6A 4A1TA 1BT7A 2R3YA 1C5PA 4GAWA 2V3HH 5J4SA 2JETB 1KDQA 1UVPA 4JK6A 1WOFA 1SGPE 3SBKA 2D26C 5E0GA 1THRH 3SNCA 2EA3A 1MTWA 3L6PA 1Y59T 4JZDH 4BAMB 4KKDA 2QY0B 1SVPA 3Q00A 1QY6A 1C1PA 1ZHPA 1Z1IA 1UCYK 3TH4H 2SGPE 4JZ1A 1VITF 1LKBA 3DUXH 1O3LA 2XBXA 1EQ9A 3TGJE 3A7YA 2BLWA 1RTKA 1YKTA 3LU9B 1FMGA 4GHQA 1UTKA 4AYYB 1KIGH 2Z3DA 1ARCA 1O2JA 3RMMH 3O8DA 3QUMP 4BXWA 5AFZH 3UNRA 3UOPA 1UK3A 2HNTC 2W3IA 3VPKA 3T28A 3LH1A 6CHAB 4BAQB 2BZAA 3TGIE 3ELAH 3GCHB 4ZHAA 1GI3A 1MD8A 1C5MD 3SJIA 2P93A 3TK9A 1HJ9A 3VB3A 4PROA 4Y0ZE 2F9PA 3DD2H 4FU9A 3NK8A 1TALA 1XKBC 3GCTF 2I6QA 1J15A 2AFQB 2ZTYA 3M5MA 1O3DA 2P95A 2XC4A 2Z9JA 1V2JT 5DK1A 1AZ8A 4D7GA 1NS3A 2O9QA 1BTPA 4CHAC 3HATH 4O03A 1QRWA 4X8TH 1EKBB 3QLPH 4JMYA 5C67A 1SGRE 4CRGA 2FOCA 2AGEX 3P17H 2UUJB 1GHXH 3KL6A 2DE8A 1SFQB 3ODDA 3PWBA 2VGCB 1A2CH 1DVAH 1NU9A 3LPRA 1IQLA 1MD7A 1W11U 4X1PU 1VITH 2ZHEH 4NSYA 2GDDA 2NU0E 3SNDA 4K1EA 3SHCH 3MWIU 4YT6H 4A92A 2ZWLH 2Y5FA 1GCTB 3EA7A 4WH6A 4OS6A 2ZCKP 5C3NA 5ETXA 2Q6DA 4U32A 2I6SA 2VVUA 1SG8B 5DP7A 5EW2H 3BTWE 4JCNA 4K1TA 1V2QT 5FPTA 1WCZA 1GJ6A 1GBFA 1ORFA 1TABE 2ZFQH 3P6ZB 5GIBA 2PSXA 2KAIB 3HK3B 3RMNH 1Y8TA 3RDZA 2F3CE 3QZRA 3Q3KA 1MU6B 1IQNA 1SOTA 4AN7A 5JB9S 1P3EA 4B73A 3CP7A 1FY1A 1SGFA 1ELGA 2ZDKA 1T4VH 4J1YA 4NZLA 3P8OA 2JETC 3ESTA 2CHAB 5F03A 1NO9H 1GHYH 1O2LA 4UE7H 1IHSH 4CREA 1RXPA 1KTSB 1C1TA 1WQSA 3FP6E 1D6RA 2BY7X 1W2KH 2PGBB 5FX6A 4XBBA 3PYHA 1NFUA 1LCYA 1O5EH 3UWIA 6ESTA 1Y3WA 2RA3A 5GPIB 2BMGB 1B0EA 2H5DA 2FOAA 5SGAE 3T5FH 1AVXA 4AB9A 3DA9B 4X8SH 5LPFA 3M3TA 4Y8XA 4B74A 1P2KA 3RXLA 4CRDA 3UPEA 2CXVA 1SGFG 2GV7A 1D3DB 4LK4A 1MCTA 6CHAC 4B2BA 2IJOB 3A85A 5EOKA 3RXEA 1ZMNA 2SGFE 4IMQA 3GCHC 1C1NA 1C2IA 2ZHQH 4KP0A 4Z6AH 2SFAA 2HWLB 1SGDE 3FZDA 4DCDA 5C1YA 1LHCH 1DSTA 3RXTA 1GVZA 5GXPA 4Y79A 1BMMH 1K22H 3MO3A 4OS5A 5DJ7A 1ABJH 1FV9A 2Z6BD 1O3EA 1O37A 3UNSA 4FUFA 2CF8H 1QQUA 2FP7B 2IN2A 2Q1JA 1HAXB 2FI5E 1DUEA 2BD7A 3QX5H 5JBAS 1GJDB 1D3TB 1KLTA 2RA0A 3B9FH 3RXDA 4A5TS 5HMAA 3TJOA 1ZSJA 1PYTC 1EJAA 3NUMA 1BHXB 3BIUH 1DUAA 2VGCC 1A61H 2J95A 5A8ZA 3SJOA 4I7YH 3NKKA 1PPCE 2AS9A 2FOFA 4X1SU 5A0CA 1FN8A 1Z8JB 1E36B 1PPFE 3U8RH 1AZZA 3T26A 1GHAG 1XM1A 4AGJA 1GBHA 1ACBE 1K21H 1LPGB 1V2WT 4JYUH 4DJZB 1MMJN 5EODA 4J2YB 1ZSKA 1JIRA 2CN0H 2J2UA 2FPZA 2R9PA 1GCTC 4H6SB 1S82A 5ESTE 3TH2H 1G37A 1V2PT 2EI6A 3ZZCA 1S6HA 1SBWA 2Y7ZA 3EQ0H 4MNYA 1BTWA 3BN9A 1TPAE 3A84A 3SUGA 3M7UA 2GCTB 2OUAA 3S69A 1MTUA 4UDWH 4NIXA 3BSQA 1SI5H 1C5YB 2P3FH 3PTNA 3P70B 1NRRH 1J17T 4NFEA 1MKXH 5EXMA 1EOLA 3LGIA 1WSSH 1NY22 1P2MA 1QB9A 1ELVA 3BTQE 3RXBA 5JBTA 1DSUA 4RKJB 1BOQA 5A8YA 2CHAC 5CMXH 3MU4A 5EGMA 3RP2A 2BDHA 1N8OB 4DURA 1PPZA 4R0IA 4WH8A 4E06H 1BBRK 4THNH 3FP8E 4D7FA 2ZFSA 4X1NU 1DY9A 1P02A 1XUKA 1B7XB 1GJCB 1MZAA 1SC8U 1UVOA 1EOJA 2PUQH 3BG8A 2A45B 3RXQA 3KQDA 1C5VA 2BD8A 3H5CB 2YOLA 3F9GA 1EZUC 2XCNA 1ZYOA 1KDQB 2VU8E 1LQEA 4AYVB 1W10U 3V7TA 1G3DA 1D6WA 2ALVA 4YLUA 1QURH 2WPLS 1B5GH 3A8BA 2V3OH 4NGAH 4X8UH 2G00A 3A82A 1ZZZA 3OSYA 3L33A 3GY4A 4ISHH 3ZZ7A 3O8BA 4BTIB 1BRCE 1NPMA 4CR9A 1UHBA 1PPGE 3HK6B 1FZZA 2P8OB 2AGIX 1C2LA 3T2NA 1S85A 3T27A 1QJ1B 1WYKA 1KTTB 2VJ1A 2BDAA 3Q77A 3OY5U 2FZZA 1UTPA 1YLCA 1GBBA 1C1MA 4RKOB 2BQ7B 2OXSA 1MH0A 3PTBA 1GVKB 3SU2A 2O8LA 1C1UH 1AD8H 3SGAE 3UOUA 3DFLA 1H8IH 2A7JA 1G32B 4ABJA 1IOEA 4FUCA 3MYWA 3K65B 2SGDE 1C9TA 1YCPK 4ZMAH 2BLOA 3L3TA 1OWDA 5EQSA 2P3TB 2J4IA 4O97A 4U30A 1O3OA 3D62A 1ELCA 3M35A 2R0LA 2H9TH 2G52A 3KN2A 1YF4A 4I8HA 2G4UA 4ABEA 1UVUH 1TX8A 4BAOB 1XUJA 2KAIA 2UUKB 1L2EA 2UUFB 2SGQE 3MMGA 4AOQA 2CJIA 1MU8B 2C93B 4B71A 5TJXA 4RN6A 2F9BH 5FHTA 1JMOH 4D9RA 3MTYA 1ANCA 3RXSA 4NWLA 5DO4H 1C1RA 1C2DA 2UUYA 5LPRA 3QO6A 5GWZA 1F0SA 2FI4E 2R2WU 3HPTB 2GCTC 3SJKA 8ESTE 1TBRH 2QGRA 4FVDA 4KTUA 4AORA 2XBWA 1T8NA 4Z0KA 1EAUA 3FVFB 5EQQA 1A0JA 2NU2E 3F9FA 4Q7ZA 3VB4A 2G8TA 3TVJB 4GSOA 1S5SA 3E0NB 2ZTXA 2ZP0H 2PTNA 4HI3A 1GBEA 1LVMA 2QIQA 3URDA 4A1XA 3AW0A 1N8OC 1WTHD 5HM9A 3D49H 1EP5A 2ZZUH 1QBNA 1TOCB 1TNKA 1HBTH 1ZJKA 5TCAA 1RS0A 2RCEA 3BEUA 3PB1E 2ILNA 1GJ5H 3VB7A 5F8ZA 2TRMA 3MOCA 3ATLA 1Z8GA 2PKSB 3SUFA 1OWKA 2ZPSA 3GDSA 3ZZ9A 1TGBA 3GISB 2ZU4A 1BBRH 1O3MA 3TH3H 8LPRA 1BRBE 3K6ZA 1C4Y2 2DUCA 4X6MA 1IQKA 5JPMH 2HGTH 3M36A 1O2KA 4MVNA 1MTVA 1ZTKA 2XC0A 5LH8A 1SGNE 1UTQA 5DKMA 5F8TA 4AFUA 4Y76A 1NRNH 4ZXXH 4TWYA 3RMOH 1J16A 3ZVGA 1VZQH 1OYTH 2HPQH 3EE0B 4O3TA 1ZPZA 4UFEH 1C2KA 2FLBH 1TAWA 4O9VA 1XUIA 2P8OC 1YPLH 3HGPA 3GYMA 3MH5A 1BTZA 1F7ZA 5E8EH 1V2MT 2QXIA 1XXDA 1VR1H 3UIRA 1W0ZU 5FX5A 1HAGE 3EA8A 5FPSA 1GDQA 1DOJA 3UR9A 1H9HE 2A4QA 4FUIA 3UY9A 2Q6GA 4Y10E 2WV5A 3VXFH 2ANMH 4BTTB 3GYLB 1Y3UA 2GT8A 1DM4B 1IQMA 1CGJE 2OC0A 1AWFH 2HNTF 5JYIA 1H4WA 1TB6H 1CHGA 1E0FD 1HB0B 4BOHA 3RUOA 5E0JA 2ZGCA 2TBSA 2B7DH 1TNJA 2XWBI 1VCQA 3NZIA 2PV9B 2A5IA 1O2XA 3MNCA 1ZMLA 2OC7A 1O2VA 2D8WA 3S0NA 3GDVA 3PLBA 4X1QU 2FS9A 1A0LA 1F0RA 2FI3E 3TJVA 4IN2A 1GHVH 1UJ1A 3ODFA 2HNTE 3RC5A 3ZV8A 1P06A 2AYWA 3KQBA 1UK4A 1O3GA 1EP6A 3SNAA 1GHAF 2EI8A 1DX5M 2OQ5A 1HYLA 3BTGE 1ZRKA 1TMBH 2BD9A 4ABBA 4E7NA 1A0HB 4ZROA 1GGDB 2FLRH 4NA8A 5I46H 4B75A 2Y5HA 3SO3A 3ZVBA 2Z9LA 1L4DA 1SSXA 2WUCA 2BVRH 2VWLA 3F1SB 2F83A 4R8TB 4CRAA 3SU0A 1RD3B 1KXAA 2FOHA 3ZZ6A 1H1BA 1LTOA 4FUGA 1C2JA 1TX7A 1G30B 3CS0A 5FAHA 4DIIH 1O2YA 1HAPH 3DFJA 2BM2A 2ZCLP 1VGCB 4YOGA 5TCCA 2C90B 1FNIA 1OS8A 2HLCA 3AAUA 2WINI 1AN1E 2PHBA 4MPVA 3RLYH 1DWDH 2XTTB 4H4FA 3GICB 1HIAA 2PKSC 1PYTD 3BG4B 1C5OH 2BQWB 2QF3A 3ATKA 1HXFH 1ANEA 1H9IE 1YPHC 3A7TA 1CQQA 2BY5X 1TONA 1C1QA 1GMHG 2FOEA 5BPEA 1AUJA 1OSSA 4OS1A 1BITA 1NRSH 1T31A 1TQ7B 4I8GA 3MH6A 1MBQA 1HGTH 3Q3XA 2BLVA 1C9PA 1TOMH 1WTGH 1TBZH 4TPIZ 4DVAU 4GUXA 2BVXH 3M3SA 1GI5A 3RXUA 2A2XH 1CU1A 1O2MA 1RFNA 4ZUHA 1F5KU 3U8OH 1LVYA 1IQHA 2PFEA 7GCHG 1MBMA 2BHGA 1BZXE 3SU3A 3A86A 1OOKB 3PWCA 4FUBA 1GHWH 1UHBB 2FODA 3UWJH 3ZVAA 1YPKH 5GDSH 3MU0A 1O2GH 5E2OA 1HFDA 3R3GB 5LGOA 1MKWH 2A32A 1SQAA 1O3HA 3BEIB 4B2CA 2GTBA 1TQ0B 1PPEE 3A80A 3MNBA 1TNIA 1O5GH 3ZZ4A 4AFQA 2A4RA 2GMTB 5FPYA 3RXRA 3SQEE 3SUEA 1HJ8A 1ANBA 1O3CA 2WPJS 1BQYA 2GZ9A 1NESE 1PQ8A 4NG9H 1ZHMA 3P8NA 1XUGA 1TRMA 1O30A 3I29A 3GY6A 4WJG2 4OS7A 3CS7A 4MQAA 1GBIA 1CE5A 1SFIA 4DY7B 1F0UA 3CENA 4OS4A 1V3XA 2LPRA 4AB8A 1QNJA 3QK1A 2J9NA 3UQVA 1O31A 3A81A 1HNEE 4I31A 1C5QA 1F0TA 1Y5UT 1GGDC 1FAXA 3V13A 3RXOA 2VIVA 2XRCA 4TPYA 2ODPA 2A31A 1ELAA 1GJBB 4MPXA 2AIQA 3ZZ8A 1TX6A 1AFEH 1SLWB 2Z9KA 1MKXK 4MTBA 1V2RT 4FUHA 1QR3E 4HZHA 3PMBB 4ZHLU 1W13U 4Q80A 6LPRA 1ZPBA 5B6OA 1O5DH 1W8BH 2H1UA 1AU8A 3LH3A 4NWKA 2ZPQA 4K5ZA 7LPRA 1HAYB 2ZHWH 1A5GH 1UCYE 2J34A 3MH7A 2YNAA 3M7TA 5CE1A 1DE7H 4IMZA 1VGCC 3A8DA 1GI6A 1F5LA 1MCVA 2O8TA 1DANH 4WXIA 5ESBA 2AMPA 1K1MA 1P04A 1L1GA 2ZFFH 3TPIZ 4CBOA 3ZZBA 1BA8B 2XBVA 1GI1A 2Y7XA 3UNQA 3BG4C 2BDYA 4X6OA 1UVSH 2WYGA 2ZDAH 5A8XA 4K8YA 3UREA 4FU7A 1P9SA 3A89A 5L6NH 2D2DA 2R2MB 3RXCA 1ESBA 3RXKA 5L30H 1BJVA 1D9IA 4IS5A 3E8LA 1CHOG 3C27B 6GCHG 1FLEE 2WPIS 1FY4A 1HV7A 1O2NA 1TFXA 4X8VH 4B1TA 2ZHDA 1BIOA 3LJOA 8GCHG 5IYTA 1YYY1 1O39A 3LKWA 1O2IA 2STBE 3K6YA 4I32A 1S0RA 1O5CB 4K60A 5AF9H 1MQ6A 2PWXA 1LHDH 1PJPA 3OY6U 3O8RA 2PLXA 2XXLA 3U69H 1YGCH 3RXHA 2V6NA 2B8OH 1YM0A 2CV3A 1TA2A 2NU3E 2OLGA 1YPEH 3TJNA 1G2MA 3URCA 1BB0B 2BOHB 1OP2A 1XUHA 3GCNA 1ELEE 2AERH 4NFFA 1UTOA 3STJA 3VB5A 1QL9A 1GWAA 3E91A 2IOTA 1O3FA 2OC8A 1Z71A 2A0QB 1GHBG 3SJ9A 4DOQA 3LC3A 1C2FA 4XOJA 3LONA 2VWMA 1IQFA 3S9CA 3ZV9A 2TPIZ 4GHTA 2ASUB 3SV7A 1GI2A 1TWXB 2FOBA 2GMTC 3RC4A 2QXHA 1O2QA 2QF0A 3ENSB 1ZLRA 1CGIE 2A4OA 3UFAA 3G01A 1ZTLA 5E0HA 3KCGH 1CA8B 4WMFA 2SGAA 1LVBA 1JOUB 3FAOA 1HAHH 4UONA 5AHGH 2OBOA 4X2WA 2GV6A 1LPZB 1QIXB 1DS2E 4AG2A 1KXBA 2TIOA 2AMQA 1H8DH 2CGAA 3ITIA 2B5TB 4ZH8A 1BMNH 4IC6A 9LPRA 2ZU3A 2IPHA 1FAKH 4FUJA 2Z3CA 3TNSA 1F5RA 1FUJA 1ZJDA 2QXJA 1GBCA 4YM9A 1BHXF 4FU8A 1O3BA 1O3AA 4ISLA 4YZUA 1ELFA 1P10A 3ZZ3A 3FFGA 3P8GA 5F6MA 1GDNA 2J94A 5HM2A 3E6PH 5JBBS 3H7OA 1C2HA 3MU1A 5FBEA 3KEEA 3TJUA 4X2XA 4BAHB 4NIYA 1G3BA 1K1IA 3V3MA 4E05H 3UQOA 4HTCH 2ZGBH 1JIMA 5A09A 3MH4A 3SU1A 3EAJA 5IDKA 5EU8A 3VGCB 5LPEA 3AW1A 1UK2A 2ANWA 2BDBA 4MNVA 1ZGIA 2BD5A 5T6FA 1THPB 1EJNA 2G5VA 1RGQA 2XCFA 3M5OA 2Y82A 1DICA 3U1IB 2C4FH 1W14U 4LZ1H 2FIRH 3U98H 3TGKE 3M5NA 3WY8A 2FS8A 3EGKH 1FIZA 4Y7BA 1QA0A 2FOMB 4X2VA 3T62A 3SHAH 2V35A 2ZPRA 1OWJA 3BTKE 1AB9B 2UWLA 1A4WH 1QBVH 1V2LT 3EA9A 3HKIB 1GMHF 1HIAB 2VNTA 1UTLM 5C5NA 3A7WA 3GY7A 2D1JA 1GBJA 1WUNH 1YBWA 3M5LA 3MI4A 1H9LB 4I8JA 1CO7E 5A0AE 1AKSA 1N1LA 2OBQA 4GLYA 2GKVE 2BXUH 1FQ3A 1V2TT 2K1QA 1O2OA 3W94A 1AI8H 1V2ST 4AGKA 5I25A 2WYJA 3GY5A 4YT7H 3RU4T 1C4V2 1T7CA 2GCHG 2VIWA 4AZ2B 1K1LA 3A7VA 4JZFH 1EX3A 1EB2A 2VIOA 2BD3A 3UTUH 1NC6A 1O2HA 1Y3XA 3PO1B 1GMCG 7GCHF 3D23A 1Y5BT 3BTDE 1G36A 2ZFTA 2XYAA 1DWEH 2FM2A 1GPZA 1SR5C 4MNXA 4AX9H 2BY9X 5EQRA 2BB4A 3S9AA 3KNXA 1Y5AT 3N7OA 2VINA 1PPBH 1BRUP 1SQTA 4UFDH 1GI0A 2ZCHP 1O3JA 1P0SH 1CGHA 4Q7XA 4ABGA 4MPUA 2G55A 4CBNA 1C2MA 1A3EH 1BMAA 1G2LA 1P05A 2AH4X 2AIPA 2QV1A 1ABIH 1J9CH 1EPTA 4IC5A 5FCRA 1V2UT 2QN5T 2QCYA 2BY6X 1LO6A 1O5BB 1GBMA 2GZ7A 2Y80A 3NXPA 1YP9A 1NU7B 1IQJA 1SLXB 5H4IB 1TGSZ 2RG3A 1FJSA 4RSPA 2NWNA 3NCLA 1K1OA 1DLKB 1Y3VA 5FCKA 2VIDA 1QGFA 2EEKA 4Y71A 1P8VC 5EG4A 1BCUH 1TPPA 1UTMA 1P9UA 3VFEA 4X1RU 2Z9IA 1XKAC 3BV9B 3LGVA 1AWHB 4OS2A 1GJ4H 1DWCH 2OCVB 2OP9A 2SNWA 1HAIH 1FN6A 1M9UA 2XBYA 3KGPA 3QDZB 1KXCA 4BTUB 1O33A 3PMJA 3ZZAA 3QGNB 3VGCC 4SGAE 1GJ8B 1ID5H 1C1WH 2F91A 1O0DH 1O36A 1P2NA 1EXFA 1EB1H 2FTLE 3P95A 2WPHS 4XBDA 5FBIA 1N6YA 1D4PB 1TMTH 1ESAA 3PMHB 3LGYA 1KLIH 1SL3A 1KXFA 1MTSA 3PMAB 1LHGH 1AE5A 2FOGA 1EASA 2GD4B 1HAZB 1T8OA 1AB9C 4ZKSU 1N6XA 3FP7E 1UO6A 4KTCA 1O34A 1AE8H 1CHOF 1BMLA 1GI9B 1TGTA 1GJ7B 4JZIA 2VWNA 5DGJA 4A7IB 6GCHF 1P2JA 1AIXH 1PPHE 2FEQH 3SU6A 8GCHF 2AGGX 2GVFA 4K2YA 5F8XA 1L4ZA 1DXPA 4NCYA 5EW1H 1P2OA 1CBWB 5EPYA 3T29A 4D8NA 3QTVH 4FXGH 4Q7YA 1FDPA 1TE0A 2B0FA 2ZQ1A 2GDEH 2Z7FE 4Y8ZA 5K0HA 4IN1A 1L1NA 3PO1C 4INHA 5L2YH 1MKWK 1LHEH 1ESTA 2FXRA 1T8MA 1E34B 3OX7U 2VH0A 1A7SA 2B9LA 2Z94A 2VVVA 4A1VA 1X7AC 3C1KA 3SV6A 2C8ZB 3UR6A 2BQ6B 1GHBF 3ZVFA 3RXAA 1YPHE 1HXEH 2THFB 4YOJA 1IQEA 1SMFE 1AVWA 1QB1A 1AY6H 1FPCH 1WV7H 3A8CA 3RU4D 4TY6A 1SHYA 1AFQB 1O2PA 4X6NA 3I77A 4YESB 2ZDLA 1XVMA 3U9AH 2Z3EA 3HKJB 3KQEA 4K69A 4Q2KA 4Y8YA 3S9BA 2O8MA 1AQ7A 2XC5A 4KELA 2H9HA 1BTXA 3RXPA 4A6LA 4FVBA 1W7GH 3F9HA 2BOKA 2OD3B 1HPGA 5HXFA 4BAKB 1GHZA 1DITH 1EZXC 1SLUB 3SI4H 2BD4A 3ZYDA 1ZPCA 3K9XB 2C8YB 3SV2H 1SGEE 1O32A 4DGJA 1T32A 5C1UA 5J4QA 4MDSA 3TIUA 2W3KA 4DW2U 2C3SA 3SOSA 1P12E 3E0PB 4OGYA 1P3CA 1DPOA 1GG6B 3SZNA 1ZRBA 1KXEA 1L1JA 2BTCE 3RXIA 1TPSA 1ANDA 2UWOA 1CVWH 3RC6A 2TGTA 2FX4A 1YCPM 2GGVB 1O2RA 2ZU1A 5GJ4B 1QFKH 1NFWA 5DP3A 2FO9A 2G51A 3SU5A 1QBOA 3ZVCA 1QRZA 5T6GA 4ISNA 1SPJA 2RDLA 1HUTH 4TWWA 2V0BA 3QZQA 1QRXA 4YO9A 2AEIH 1GMDG 1D3QB 2HPPH 2NU4E 3AASA 1TPOA 1W7XH 4Y7AA 2AMDA 1P03A 1PQAA 2ZI2H 1QQ4A 4GPGA 1C5ZB 1DWBH 1Z1JA 1ZSLA 3I78A 1CT0E 4GCHG 3E16B 1Z8RA 1C1OA 4XFQA 2A5KA 5AFYH 1TYNA 1GVLA 3ZZDA 1CBWC 4I8LA 4IGDA 1OWIA 3TK6A 1PFXC 4ZXYH 4NIVA 1T4UH 4UD9H 4O3UA 5CHAC 4B2AA 5G4BA 1O38A 3VXEH 3Q76A 3HGNA 5C1XA 3PLKA 1GL0E 5DP4A 4VGCB 1EUFA 2GCHF 1KY9A 5E2PA 1AKSB 4NIWA 4ZKOU 2ZGXH 4WXVA 3A88A 5ABWA 7KMEH 3E3TA 1OP0A 3RU4E 3SGQE 4UFGH 1GMCF 4INLA 1IHTH 1S81A 2LNCA 5A0BA 2BDGA 1GJAB 1GI4A 1W12U 2ZFPH 4I33A 1YLDA 3BIVH 1TBQH 1DLEA 1TIOA 1TNLA 2PUXB 4FUDA 1AFQC 4IBLH 1CA0B 1QHRB 2SGEE 3P92A 4CRCA 1BRAA 2VH6A 3BF6H 4M7GA 4K8BA 3LGTA 2ALPA 2ZIQH 1LQDB 1AGJA 1FONA 2H5CA 1S6FA 2VIQA 1FY5A 1U6QA 1NZQH 1OX1A 1Y3YA 4JK5A 1ETSH 4CRBA 2H9EH 1TMUH 1HAVA 3NPSA 1QJ6B 1DY8A 3GY8A 1CT4E 1EPTB 1THSH 2ZHFH 3PROA 1XMNB 1ELDE 2BDCA 2QYIA 1P57B 4WF8A 5GCHG 1SGIB 3F68H 1EAIA 2GX4A 4UEHH 3LJJA 2A5AA 3OU0A 1OYQA 3D65E 2FX6A 3SW2B 5DPAA 2CF9H 1GG6C 3A8AA 2EC9H 1KXDA
chains in the Genus database with same CATH superfamily
1SGCA 3RXGA 4YLQH 2PSYA 4JZEH 3M3VA 1SGTA 2ZG0H 3Q3YA 2KX4A 1QL8A 3U8TH 1FIWA 2ZU2A 3F0PA 1EJMA 2WHXA 1FY3A 4JYVH 4U2WA 4NZQA 1A1RA 5DP8A 1C2EA 1GBTA 1NRQH 1BMFD 2ANKH 1V2KT 4IW4E 3RXJA 4YOIA 1P11E 1RJXB 2UWPA 3GCOA 1F2SE 1P01A 1QL7A 2OTVA 2VB0A 1HAOH 1B0FA 2BX3A 1ELTA 2FMJA 2TGDA 1K28D 2JH6D 1FY8E 3S7KB 3OYPA 1ARBA 4H6TA 2FESH 1YPJH 1PQ5A 4ACBA 1KYNA 5T3HA 3KQCA 2W6ID 1W0JD 1S84A 4TY7A 3TITA 1O35A 3V12A 5DG6A 3LDXH 2VVCA 1UCYH 3VG8A 2PTCE 1L0ZA 1C1VH 1F92A 2ZNKH 3SV8A 2F9NA 1ETRH 3TNTA 1P09A 1HJAB 1MAXA 1YPMH 1LHFH 3P8FA 4AFSA 4VGCC 1AMHA 2J98A 1TGCA 4JYTA 4ISOA 4WMEA 1RIWB 3DSOA 3T25A 3UUZA 1EAXA 3RLWH 3NWUA 1TRYA 1JRTA 2TGAA 4KTSA 1GBKA 1FPHH 1ELBA 2VWOA 4CH2B 4H42U 2JIZD 3SU4A 3LT3A 4NA7A 2RFKC 2L74A 1IQGA 4LXBH 4ABIA 1G3EA 2ZECA 2PKAA 3BTEE 3IG6B 2F9VA 2JH5D 8KME2 1CA0C 1ZMJA 4DIHH 1OWEA 1A46H 3BTHE 1UVTH 1E35B 1KSNA 1GBAA 1MAYA 1UW7A 3LGUA 4XDEA 4XD7D 2G81E 2XNIA 1TRNA 3SV9A 3RXVA 4DG4A 2DE9A 4Y11E 1QA7A 2A4GA 4OM9A 1W0YH 1A5IA 1E38B 2JH0D 4ZAEA 1JBUH 2J92A 3QTOH 5EJLA 2C8WB 3A7XA 1EPTC 1HLTH 2BD2A 1WQVH 4I8KA 2ZTZA 1LMWB 2WSSD 3M61U 4WMDA 4WY3A 1BUIA 5EPNA 5C20A 4K1SA 1XX9A 3IWMA 5C2ZA 1FI8A 3N99A 3MHWU 1GI8B 2HVXA 1SGQE 4ZKRU 3OEHD 5HGGA 5EJ1A 2XWAA 2HRVA 3LIWA 2FTMA 2ZO3H 3SUDA 1E37B 1OKXA 1XVOA 1VCPA 1AHTH 4WVPE 1O2WA 3ZVEA 1V2VT 2QXGA 5JDUB 3B23B 5AVDA 1P2IA 1INCA 5T6DA 1NRPH 2ZEBA 2CMYA 1Q31A 3PLPA 3GDUA 3BTTE 2ESTE 3K2UA 2ZC9H 2XW9A 1C4U2 1O2ZA 2ZU5A 3JZ1B 4GVUA 2EQNA 2RDEA 1BTUA 1ZHRA 1K1NA 1SLVB 3SGBE 3LC5A 1TLDA 1GL1A 4FUEA 1GMDF 2QAAA 1VITG 3DT0H 2QA9E 5HKKD 4BANB 1S6LA 4LOYH 2A1DB 1IAUA 2WV4A 2PGQB 4MPWA 2QE7D 1RRKA 5JB8S 2BXTH 4CH8B 2ZDVH 1UTNA 2ZGJA 2BVSH 1O5FH 2FYQA 4UFFH 2Y81A 5C94A 1UTJA 4GCHF 3ZYEA 2EI7A 1SB1H 2KM0A 3TU7H 3MO9A 1EATA 1MTNB 1NFYA 2W7UA 2ZQ2A 1XUFA 3SI3H 3MU5A 4X0WU 1Q2WA 1AVGH 1YWUA 1D3PB 4Y6DA 3SNEA 1HJAC 1BJUA 1NBMD 3PV4A 2ODQA 1RIWC 1HDTH 1LPKB 1O2SA 3SQHE 3MFJA 3TK5A 1AO5A 1LVOA 2WPDD 1DDJA 3EDXB 1A5HA 1O3KA 1W3CA 3GCTG 1C5WB 2OC1A 1C5LH 4F49A 1KLJH 1Z6JH 2JKHA 1HRTH 3V0XA 4F4OC 2ZF0H 4CR5A 1SQOA 3FZZA 4K3JA 1CT2E 2IPQX 1K1PA 1Z6EA 4X2YA 2GP9B 3H7TA 4ASHA 4ESTE 1DT2A 4XSKU 4BNRA 5DP6A 4X6PA 3UB0A 4D76A 4HGCA 1OPHB 3VB6A 1NFXA 3SORA 1JXPA 1NN6A 3SJ8A 2ZKSA 2KZ4A 3RM2H 3GOVB 1J14A 2V3MA 4D9QA 1GJ9B 1SOZA 3SNBA 7ESTE 5EXLA 1IQIA 3DHKH 1OXGA 3PM3A 1NROH 4TYDA 4U01A 2NU1E 2HALA 3A87A 1H8ED 1Q3XA 5A2MH 2R0KA 4ABHA 2W7SA 2QC2A 5FXLA 1LKAA 1SHHB 5BRRE 3MO6A 1GI7B 1BTHH 2H2ZA 1BBRE 1GDUA 3U1JB 1VCWA 5HIYA 1MQ5A 1QTFA 1V2OT 1HAVB 5GCHF 2ODYB 3S7HB 3ZVDA 3BEFB 1C1SA 1C5NH 2OINA 3EYDA 3BTFE 1C5TA 5HYOA 1C5UA 1HCGA 1SGYE 1RTLA 3FOAA 3OE7D 4INKA 1GBDA 4P02A 1VJ9U 5C0TA 3DCLA 2GZ8A 3KF2A 2HOBA 4ISIH 4HFPB 2Y5GA 4ZHMU 3MNSA 2A2QH 3KIDU 1V2NT 3ZZ5A 2PW8H 5L2ZH 2GT7A 1C2GA 3LGWA 3QWCH 1RTFB 1TGNA 3W95A 5JBCS 4WWYA 3M7QA 1QJ7B 4NSVA 1BDAA 1CSOE 2YNBA 3NRLA 1YC0A 4ZKNU 1UMAH 1ZTJA 1NBME 3A83A 3M37A 2FDAA 1QB6A 3OTJE 4SGBE 1O3IA 3QN7A 1EZSC 2G4TA 3IITA 1DXWA 3BTME 3VEQB 4XBCA 1GCDA 1MTNC 2W26A 1G9IE 1BTYA 3R0FA 5GNDA 5CHAB 1K2I1 1O2TA 2F9UA 4Y0YE 4B76A 4DT7B 1OP8A 1DFPA 2BY8X 1TA6A 3TLOA 4ABAA 1AUTC 4YTAA 3KHVA 1MUEB 3STIA 2M5TA 3O8CA 1C5SA 4MLFB 5K7RA 1TNHA 5FL7D 1ZGVA 2R3UA 2K0QA 1V6DA 1K1JA 2Y6TA 4ABFA 1EAWA 3E90B 3RXFA 3AAVA 4B6EA 1JRSA 1TNGA 1OWHA 1J8AA 3MU8A 2VBCA 1A3BH 1YLNA 4LZ4B 2C8XB 1NTPA 1WBGB 5PTPA 1P2QA 2J98B 3RM0H 1SKYE 4MG3A 1FXYA 2FWWA 2ZGHA 3MNXA 1ETTH 2ZDMA 2WUBA 2ZDNA 4NA9H 3ATMA 4CRFA 3JZ2B 1G3CA 5DP5A 2OQUA 2PR3A 2A7HA 3SN8A 2O8UA 4AG1A 2G5NA 1O3NA 4CHAB 1E1QD 9ESTA 1O3PB 2H6MA 4OGXA 4TT3D 4BXSA 1Z8IB 2BLQA 1S83A 4KGAA 1VJAU 2O8WA 2P59A 4XE4A 1COWD 1WU1A 2BZ6H 1ZR0A 2PKAB 2BYAX 2VIPA 2Z9GA 1K9OE 1O5AB 1YPGH 2K8IA 1YCPH 3ATWA 1ZOMA 1C5XB 2STAE 3RMLH 2BX4A 1GBLA 2PP6A 2ZA5A 2ZFRH 2Q6FA 2BDIA 3F9EA 3FANA 1O2UA 2FYRA 1S0QA 2WPMS 1WAYB 3AVZA 3E1XB 4QT8C 3GY3A 2ANYA 1JWTA 3RXMA 5DP9A 2P3UB 1MZDA 2F9OA 4MNWA 2P94A 2TGPZ 3F6UH 1XXFA 2A7CA 1OHHD 1Z7KA 2P16A 2WPKS 3GY2A 4E7RG 5C5OA 2W5EA 1T8LA 3ATIA 3KYGA 2J97A 1PQ7A 3A7ZA 1C5RA 4AFZA 1LDTT 1EZQA 1QCPA 4ABDA 3WW7A 1NT1A 2J38A 5EXNA 3B8JA 3LOXA 2ULLA 3QGJA 2SNVA 1NM6A 4A1TA 1BT7A 2R3YA 2JJ1D 1C5PA 4GAWA 2V3HH 5J4SA 2JETB 1KDQA 1UVPA 4JK6A 1WOFA 1SGPE 3SBKA 2D26C 1W0KD 5E0GA 1THRH 3SNCA 2EA3A 1MTWA 3L6PA 1Y59T 4JZDH 4BAMB 4KKDA 2QY0B 1SVPA 3Q00A 1QY6A 1C1PA 1ZHPA 1Z1IA 1UCYK 1E79D 3TH4H 2SGPE 4JZ1A 1VITF 1LKBA 5HIZA 3DUXH 1O3LA 2XBXA 1EQ9A 3TGJE 3A7YA 2BLWA 1RTKA 1YKTA 3LU9B 1FMGA 4GHQA 1UTKA 4AYYB 1KIGH 2Z3DA 1ARCA 1O2JA 3RMMH 3O8DA 3QUMP 4BXWA 5AFZH 3UNRA 3UOPA 1UK3A 2HNTC 2W3IA 3VPKA 3T28A 3LH1A 6CHAB 4BAQB 2BZAA 3TGIE 3ELAH 3GCHB 4ZHAA 1GI3A 1MD8A 1C5MD 3SJIA 2P93A 3TK9A 1HJ9A 3VB3A 4PROA 4Y0ZE 2F9PA 3DD2H 4FU9A 3NK8A 1TALA 1XKBC 3GCTF 2I6QA 1J15A 2AFQB 2ZTYA 3M5MA 3F2GA 1O3DA 2P95A 2XC4A 2Z9JA 1V2JT 5DK1A 1AZ8A 4D7GA 1NS3A 2L6OA 2O9QA 1BTPA 4CHAC 1KMHB 3HATH 4O03A 1QRWA 4X8TH 1EKBB 3QLPH 4JMYA 5C67A 1SGRE 4CRGA 2FOCA 2AGEX 3AK5A 3P17H 2UUJB 1GHXH 3KL6A 2DE8A 1SFQB 3ODDA 4Q63A 3PWBA 2VGCB 1A2CH 1DVAH 2J5UA 1NU9A 3LPRA 1IQLA 1MD7A 1W11U 4X1PU 1VITH 2ZHEH 4NSYA 2GDDA 2NU0E 3SNDA 4K1EA 3SHCH 5C0UA 3MWIU 4YT6H 4A92A 2ZWLH 2Y5FA 1GCTB 3EA7A 4WH6A 4OS6A 2ZCKP 5C3NA 5ETXA 2Q6DA 4U32A 2I6SA 2VVUA 1SG8B 5DP7A 5EW2H 3BTWE 4JCNA 4K1TA 1V2QT 5FPTA 1WCZA 1GJ6A 1GBFA 1ORFA 1TABE 2ZFQH 3P6ZB 5GIBA 2PSXA 2KAIB 3HK3B 3RMNH 1Y8TA 3RDZA 2F3CE 3QZRA 3Q3KA 3MQKC 1MU6B 1IQNA 1SOTA 4AN7A 5JB9S 1P3EA 4B73A 3CP7A 1FY1A 1SGFA 1ELGA 2ZDKA 1T4VH 4J1YA 4NZLA 3P8OA 2JETC 3ESTA 2CHAB 5F03A 1NO9H 1GHYH 1O2LA 2KCAA 4UE7H 1IHSH 4CREA 1RXPA 1KTSB 1C1TA 1WQSA 3FP6E 1D6RA 2BY7X 1W2KH 2PGBB 5FX6A 4XBBA 3PYHA 1NFUA 1LCYA 1O5EH 3UWIA 6ESTA 1Y3WA 2RA3A 5GPIB 2BMGB 1B0EA 2H5DA 3FKSD 2FOAA 5SGAE 3T5FH 1AVXA 4AB9A 3DA9B 4X8SH 5LPFA 3M3TA 4Y8XA 4B74A 1P2KA 3RXLA 2F4LA 4CRDA 3UPEA 2CXVA 1SGFG 2GV7A 1D3DB 4LK4A 1MCTA 6CHAC 4B2BA 2IJOB 3A85A 5EOKA 3RXEA 1ZMNA 2SGFE 4IMQA 3GCHC 1C1NA 1C2IA 2ZHQH 4KP0A 4Z6AH 2SFAA 2HWLB 1SGDE 3FZDA 4DCDA 5C1YA 1LHCH 1DSTA 3RXTA 1GVZA 5GXPA 4Y79A 1BMMH 1K22H 3MO3A 4OS5A 5DJ7A 2JDID 1ABJH 1FV9A 2Z6BD 1O3EA 1O37A 3UNSA 4FUFA 2CF8H 1QQUA 2FP7B 2IN2A 2Q1JA 1HAXB 2FI5E 1DUEA 2BD7A 3QX5H 5JBAS 1GJDB 4RI0A 1D3TB 1KLTA 2RA0A 3B9FH 3RXDA 4A5TS 5HMAA 3TJOA 1ZSJA 1PYTC 1EJAA 3NUMA 1BHXB 3BIUH 1DUAA 2VGCC 1A61H 2J95A 5A8ZA 3SJOA 4I7YH 3NKKA 1PPCE 2AS9A 2FOFA 4X1SU 5A0CA 1FN8A 1Z8JB 1E36B 1PPFE 3U8RH 1AZZA 3T26A 1GHAG 1XM1A 4AGJA 1GBHA 1ACBE 1K21H 1LPGB 1V2WT 4JYUH 4DJZB 1MMJN 5EODA 4J2YB 1ZSKA 1JIRA 2CN0H 2J2UA 2FPZA 2R9PA 1GCTC 1WDIA 4H6SB 1S82A 5ESTE 3TH2H 1G37A 1V2PT 2EI6A 3ZZCA 1S6HA 1SBWA 2Y7ZA 3EQ0H 4MNYA 1BTWA 3BN9A 1TPAE 3A84A 3SUGA 3M7UA 2GCTB 2OUAA 3S69A 1MTUA 4UDWH 4NIXA 3BSQA 1SI5H 1C5YB 2P3FH 3PTNA 3P70B 1NRRH 1J17T 4NFEA 1MKXH 5EXMA 1EOLA 3LGIA 1WSSH 3WWBA 1NY22 1P2MA 1QB9A 1ELVA 3BTQE 4M9FA 3RXBA 5JBTA 5KECA 1DSUA 4RKJB 1BOQA 5A8YA 2CHAC 5CMXH 3MU4A 5EGMA 3RP2A 2BDHA 1N8OB 4DURA 1PPZA 4R0IA 4WH8A 4E06H 1BBRK 4THNH 3FP8E 4D7FA 2ZFSA 4X1NU 1DY9A 1P02A 1XUKA 1B7XB 1GJCB 1MZAA 1SC8U 1UVOA 1EOJA 2PUQH 3BG8A 2A45B 3RXQA 3KQDA 1C5VA 2JJ2D 2BD8A 3F0OA 3H5CB 2YOLA 3F9GA 1EZUC 2XCNA 1ZYOA 3OEED 1KDQB 1YY3A 2VU8E 1LQEA 4AYVB 1W10U 3V7TA 1G3DA 1D6WA 2ALVA 4YLUA 1QURH 2WPLS 1B5GH 3A8BA 2V3OH 4NGAH 4X8UH 2V7QD 2G00A 3A82A 1ZZZA 3OSYA 3L33A 3PV5A 3GY4A 4ISHH 3ZZ7A 3GS9A 3O8BA 4BTIB 1BRCE 1NPMA 4CR9A 1UHBA 3PRDA 1PPGE 3HK6B 1FZZA 2P8OB 2AGIX 1C2LA 3T2NA 1S85A 3T27A 3N7EA 1QJ1B 1WYKA 1KTTB 2VJ1A 2BDAA 3Q77A 3OY5U 2FZZA 1UTPA 1YLCA 1GBBA 1C1MA 4DT4A 2HLDD 4RKOB 2BQ7B 2OXSA 1MH0A 3PTBA 1GVKB 3SU2A 2O8LA 1C1UH 1AD8H 3SGAE 3OAAD 3UOUA 3DFLA 1H8IH 2A7JA 5B6LA 1G32B 4ABJA 1IOEA 4FUCA 3MYWA 3K65B 2SGDE 1C9TA 1YCPK 4ZMAH 2BLOA 3L3TA 1OWDA 5EQSA 2P3TB 2J4IA 4RT0A 4O97A 4U30A 1O3OA 3D62A 1ELCA 3M35A 2R0LA 2H9TH 2G52A 3KN2A 1YF4A 4I8HA 2G4UA 4ABEA 1UVUH 1TX8A 4BAOB 1XUJA 2KAIA 2UUKB 1WXRA 1L2EA 2UUFB 2SGQE 3MMGA 4AOQA 2CJIA 1MU8B 2KCOA 2C93B 4B71A 5TJXA 4RN6A 2F9BH 5FHTA 1JMOH 4D9RA 3MTYA 3F2FA 1ANCA 3RXSA 5EJZA 4NWLA 2WZQA 5DO4H 1C1RA 1C2DA 2UUYA 5LPRA 3QO6A 5GWZA 1F0SA 2FI4E 2R2WU 3HPTB 2GCTC 3SJKA 3F3BA 8ESTE 1TBRH 2QGRA 4FVDA 4KTUA 4AORA 2XBWA 1T8NA 4Z0KA 1EAUA 3FVFB 5EQQA 5IK2D 1A0JA 2NU2E 3F9FA 4Q7ZA 3VB4A 2G8TA 3TVJB 4GSOA 1S5SA 3E0NB 2ZTXA 2ZP0H 2PTNA 4HI3A 1GBEA 1LVMA 2QIQA 3URDA 4A1XA 3AW0A 1N8OC 1WTHD 5HM9A 3D49H 1EP5A 2ZZUH 1QBNA 1TOCB 1TNKA 1HBTH 1ZJKA 5TCAA 1RS0A 2RCEA 3BEUA 3PB1E 2ILNA 1GJ5H 3DSGA 3VB7A 5F8ZA 2TRMA 3MOCA 3ATLA 5DN6D 1Z8GA 2PKSB 3SUFA 1OWKA 2ZPSA 3GDSA 3ZZ9A 1TGBA 3GISB 2ZU4A 1BBRH 1O3MA 3TH3H 8LPRA 1BRBE 3K6ZA 1C4Y2 2DUCA 4X6MA 1IQKA 5JPMH 2HGTH 3M36A 1O2KA 4MVNA 1MTVA 1ZTKA 2XC0A 5LH8A 1SGNE 1UTQA 5DKMA 5F8TA 4AFUA 4Y76A 1NRNH 4ZXXH 4TWYA 3RMOH 1J16A 3ZVGA 1VZQH 1OYTH 2HPQH 3EE0B 4O3TA 1ZPZA 4UFEH 1C2KA 2FLBH 1TAWA 2EY4C 4O9VA 1XUIA 2P8OC 1YPLH 3HGPA 3FO8D 3GYMA 2QF4A 3MH5A 1BTZA 1F7ZA 5E8EH 1V2MT 2QXIA 1XXDA 1VR1H 3UIRA 1W0ZU 5FX5A 1HAGE 3EA8A 5FPSA 1GDQA 1DOJA 2WV9A 1H9HE 2A4QA 3UR9A 4FUIA 3UY9A 2Q6GA 4Y10E 2WV5A 3VXFH 2ANMH 3U28C 4BTTB 3GYLB 1Y3UA 2GT8A 1DM4B 1IQMA 1CGJE 2OC0A 2IJD1 1AWFH 2HNTF 5JYIA 1H4WA 1TB6H 1CHGA 1E0FD 1HB0B 4BOHA 2YMSB 3RUOA 5E0JA 2ZGCA 2TBSA 2B7DH 1TNJA 2XWBI 1VCQA 3NZIA 2PV9B 2A5IA 1O2XA 4AC9A 3MNCA 1ZMLA 2OC7A 1O2VA 2D8WA 3S0NA 3GDVA 3PLBA 4X1QU 2FS9A 1A0LA 1F0RA 2FI3E 2LELA 3TJVA 4IN2A 1GHVH 1UJ1A 3ODFA 2HNTE 3RC5A 3ZV8A 1P06A 2AYWA 3KQBA 1UK4A 1O3GA 1EP6A 3SNAA 1GHAF 2EI8A 1DX5M 2OQ5A 1HYLA 3BTGE 4YXWD 1ZRKA 1TMBH 2BD9A 3KYFA 4ABBA 4E7NA 1A0HB 4ZROA 1GGDB 2FLRH 4NA8A 5I46H 4B75A 2Y5HA 3SO3A 3ZVBA 2Z9LA 1L4DA 1SSXA 2WUCA 2BVRH 2VWLA 3F1SB 2F83A 4R8TB 4CRAA 3SU0A 1RD3B 1K0HA 1KXAA 2FOHA 3ZZ6A 1H1BA 1LTOA 4FUGA 2W6JD 1C2JA 1TX7A 1G30B 3CS0A 5FAHA 4DIIH 1O2YA 1HAPH 3DFJA 2BM2A 2ZCLP 1VGCB 4YOGA 5TCCA 2C90B 1FNIA 1OS8A 2HLCA 4FETA 3AAUA 2WINI 3OFND 1AN1E 2PHBA 4MPVA 3RLYH 1DWDH 2XTTB 4H4FA 3GICB 1HIAA 2PKSC 1PYTD 3BG4B 1C5OH 2BQWB 2QF3A 3N7DA 3ATKA 1HXFH 2KCYA 1ANEA 2KCPA 1H9IE 1YPHC 2XOKD 3A7TA 1CQQA 2BY5X 1TONA 1C1QA 1GMHG 2FOEA 5BPEA 1AUJA 1OSSA 4OS1A 2HVYB 1BITA 1NRSH 1T31A 1TQ7B 4I8GA 3MH6A 1MBQA 1HGTH 3Q3XA 2BLVA 1C9PA 1TOMH 1WTGH 1TBZH 4TPIZ 4DVAU 4GUXA 2GJGA 2BVXH 3M3SA 1GI5A 3RXUA 2A2XH 1CU1A 1O2MA 1RFNA 4ZUHA 1F5KU 3U8OH 1LVYA 1IQHA 2PFEA 7GCHG 4ASUD 4Q4LA 1MBMA 2BHGA 4P00A 1BZXE 3SU3A 3A86A 1OOKB 3PWCA 4FUBA 1GHWH 1UHBB 2FODA 3UWJH 3ZVAA 1YPKH 5GDSH 3MU0A 1O2GH 5E2OA 1HFDA 3R3GB 5LGOA 1MKWH 5T1VA 2A32A 2YMSC 1SQAA 1O3HA 3BEIB 4B2CA 2GTBA 1TQ0B 1PPEE 3A80A 3MNBA 1TNIA 1O5GH 3ZZ4A 4AFQA 2A4RA 2GMTB 5FPYA 3RXRA 3SQEE 3SUEA 1HJ8A 1ANBA 1O3CA 2WPJS 1BQYA 2GZ9A 1NESE 1PQ8A 4NG9H 1ZHMA 3P8NA 1XUGA 1TRMA 1O30A 3I29A 3GY6A 4WJG2 4OS7A 3CS7A 4MQAA 1GBIA 1CE5A 1SFIA 4DY7B 3KQ5A 1F0UA 3CENA 4OS4A 1V3XA 2LPRA 4AB8A 1QNJA 3QK1A 2J9NA 3UQVA 1O31A 3A81A 1HNEE 4I31A 1C5QA 1F0TA 1Y5UT 1GGDC 1FAXA 3V13A 3RXOA 2VIVA 2XRCA 4TPYA 2ODPA 2A31A 1ELAA 1GJBB 4MPXA 2AIQA 3ZZ8A 1TX6A 1AFEH 1SLWB 2Z9KA 1MKXK 4MTBA 1V2RT 4FUHA 1QR3E 4HZHA 3PMBB 4ZHLU 1W13U 4Q80A 6LPRA 2QF5A 1ZPBA 5B6OA 1O5DH 1W8BH 2H1UA 1AU8A 3LH3A 4NWKA 2ZPQA 4K5ZA 7LPRA 1HAYB 2ZHWH 2F43B 1A5GH 1UCYE 2J34A 3MH7A 2YNAA 3M7TA 5CE1A 1DE7H 4IMZA 1VGCC 3A8DA 1GI6A 4FOUC 1F5LA 1MCVA 2O8TA 4F48B 1DANH 4WXIA 5ESBA 2AMPA 1K1MA 1P04A 1L1GA 2ZFFH 3TPIZ 4CBOA 3ZZBA 2KR7A 1BA8B 2XBVA 1GI1A 2Y7XA 3UNQA 3BG4C 2BDYA 4X6OA 1UVSH 4XRNA 2WYGA 2ZDAH 5A8XA 4K8YA 3UREA 4FU7A 1P9SA 3A89A 5L6NH 2D2DA 2R2MB 3RXCA 1ESBA 3RXKA 5L30H 1BJVA 1D9IA 4IS5A 3E8LA 1CHOG 3C27B 6GCHG 1FLEE 2WPIS 1FY4A 1HV7A 1O2NA 1TFXA 4X8VH 4B1TA 5DSFA 2ZHDA 1BIOA 3LJOA 8GCHG 5IYTA 1YYY1 1O39A 3LKWA 3PV2A 1O2IA 2STBE 3K6YA 4I32A 1S0RA 1O5CB 4K60A 5AF9H 1MQ6A 2PWXA 1LHDH 1PJPA 3OY6U 3WWFA 2PLXA 2XXLA 3O8RA 3U69H 1YGCH 3RXHA 2V6NA 2B8OH 1YM0A 2CV3A 2LP6A 5KEDA 1TA2A 2NU3E 2OLGA 1YPEH 3TJNA 1G2MA 3URCA 1BB0B 2BOHB 1OP2A 1XUHA 3GCNA 1ELEE 2AERH 4NFFA 1UTOA 3STJA 3VB5A 1QL9A 1GWAA 2AHME 3E91A 2IOTA 1O3FA 2OC8A 1Z71A 2A0QB 1GHBG 3SJ9A 4DOQA 3LC3A 1C2FA 4XOJA 3LONA 2VWMA 1IQFA 3S9CA 3ZV9A 2TPIZ 4GHTA 2ASUB 3SV7A 1GI2A 1TWXB 2FOBA 2GMTC 3RC4A 2QXHA 1O2QA 2QF0A 3ENSB 1ZLRA 1CGIE 2A4OA 3UFAA 3G01A 1ZTLA 5E0HA 3KCGH 1CA8B 4WMFA 2SGAA 1LVBA 1JOUB 3FAOA 1HAHH 4UONA 5AHGH 2OBOA 4X2WA 2GV6A 1LPZB 1QIXB 1DS2E 4AG2A 1KXBA 2TIOA 2AMQA 1H8DH 2CGAA 3ITIA 2B5TB 4ZH8A 1BMNH 4IC6A 9LPRA 2ZU3A 2IPHA 1FAKH 4FUJA 2Z3CA 3TNSA 1F5RA 1FUJA 1ZJDA 3FN8A 2QXJA 1GBCA 3PRBA 1BHXF 4FU8A 4YM9A 1O3BA 1O3AA 4ISLA 4YZUA 1ELFA 1P10A 3ZZ3A 3FFGA 3P8GA 5F6MA 1GDNA 2J94A 1H8HD 5HM2A 3E6PH 5JBBS 2OK5A 3H7OA 1C2HA 3MU1A 5FBEA 3KEEA 3TJUA 4X2XA 4BAHB 4NIYA 5CDFE 1G3BA 1K1IA 3V3MA 4E05H 3UQOA 4HTCH 5C17A 2ZGBH 1JIMA 5A09A 3MH4A 3SU1A 3EAJA 5IDKA 5EU8A 3VGCB 5LPEA 3AW1A 1UK2A 2ANWA 2BDBA 4MNVA 1ZGIA 2BD5A 5T6FA 1THPB 1EJNA 2G5VA 1RGQA 2XCFA 3M5OA 2Y82A 1DICA 3U1IB 2C4FH 1W14U 4LZ1H 2FIRH 3U98H 3TGKE 3M5NA 3WY8A 2FS8A 3EGKH 1FIZA 4Y7BA 1QA0A 2FOMB 4X2VA 3T62A 3SHAH 2V35A 2ZPRA 1OWJA 3BTKE 1AB9B 2UWLA 1A4WH 1QBVH 1V2LT 3EA9A 3F2HA 3UAIC 3HKIB 1GMHF 1HIAB 2VNTA 1UTLM 5C5NA 3A7WA 3GY7A 2D1JA 1GBJA 1WUNH 1YBWA 3M5LA 3MI4A 1H9LB 4I8JA 1CO7E 5A0AE 4ACAA 1AKSA 1N1LA 2OBQA 4GLYA 3CNRA 2GKVE 2BXUH 1FQ3A 1V2TT 2K1QA 1O2OA 3W94A 1AI8H 1V2ST 4AGKA 5I25A 2WYJA 3GY5A 4YT7H 2M2AA 3RU4T 1C4V2 1MABB 1T7CA 2GCHG 2VIWA 4AZ2B 1K1LA 3A7VA 4JZFH 1EX3A 1EB2A 2VIOA 2BD3A 3UTUH 1NC6A 1O2HA 1Y3XA 3PO1B 1GMCG 7GCHF 3D23A 1Y5BT 3BTDE 1G36A 2ZFTA 2XYAA 1DWEH 1FX0B 2FM2A 1GPZA 1SR5C 4MNXA 4AX9H 2BY9X 5EQRA 2BB4A 3S9AA 4ZCNA 3KNXA 1Y5AT 3N7OA 2VINA 1PPBH 1BRUP 1SQTA 4UFDH 1GI0A 2ZCHP 1O3JA 1P0SH 1CGHA 4Q7XA 4ABGA 4MPUA 2G55A 4CBNA 1C2MA 1A3EH 1BMAA 2AIPA 1G2LA 1P05A 2AH4X 2QV1A 1ABIH 1J9CH 1EPTA 4IC5A 5FCRA 5CHBA 1V2UT 2QN5T 2QCYA 2BY6X 1LO6A 1O5BB 1GBMA 2GZ7A 2Y80A 3NXPA 1YP9A 1NU7B 3DSPA 1IQJA 1SLXB 5H4IB 1TGSZ 2RG3A 1FJSA 4RSPA 2NWNA 3NCLA 1K1OA 1DLKB 1Y3VA 5FCKA 4F55A 2VIDA 1QGFA 2EEKA 4Y71A 1P8VC 5EG4A 1BCUH 1TPPA 1UTMA 1P9UA 3VFEA 4X1RU 2Z9IA 1XKAC 3BV9B 3LGVA 1AWHB 4OS2A 1GJ4H 1DWCH 2OCVB 2OP9A 2SNWA 1HAIH 1FN6A 1M9UA 2XBYA 3KGPA 3QDZB 1KXCA 4BTUB 1O33A 3PMJA 3ZZAA 3QGNB 3VGCC 4SGAE 1GJ8B 1ID5H 1C1WH 2F91A 1O0DH 2YMSD 1O36A 1P2NA 1EXFA 1EB1H 2FTLE 3P95A 2WPHS 4XBDA 5FBIA 1N6YA 1D4PB 1TMTH 1ESAA 3PMHB 5KGOA 3LGYA 1KLIH 1SL3A 1KXFA 1MTSA 3PMAB 1LHGH 1AE5A 2FOGA 1EASA 2GD4B 1HAZB 1T8OA 1AB9C 4ZKSU 1N6XA 3FP7E 1UO6A 4KTCA 1O34A 1AE8H 4I86A 1CHOF 1BMLA 1GI9B 1TGTA 1GJ7B 4JZIA 2VWNA 5DGJA 4A7IB 6GCHF 1P2JA 1AIXH 1PPHE 2FEQH 3SU6A 8GCHF 2AGGX 2GVFA 4K2YA 5F8XA 1L4ZA 1DXPA 5EIYA 4NCYA 5EW1H 1P2OA 1CBWB 5EPYA 3T29A 4D8NA 3QTVH 4FXGH 4Q7YA 1FDPA 1TE0A 2B0FA 2ZQ1A 2GDEH 2Z7FE 4Y8ZA 5K0HA 4IN1A 1E1RD 1L1NA 3PO1C 4INHA 1MKWK 5L2YH 1LHEH 1ESTA 2FXRA 1T8MA 1E34B 3OX7U 3OTPA 2VH0A 1A7SA 2B9LA 2Z94A 2VVVA 4A1VA 1X7AC 3C1KA 3SV6A 2KFWA 2C8ZB 3UR6A 2BQ6B 1GHBF 3ZVFA 3RXAA 1YPHE 1HXEH 2THFB 4YOJA 1IQEA 1SMFE 1AVWA 1QB1A 1AY6H 1FPCH 1WV7H 3A8CA 3SYJA 3RU4D 4TY6A 1SHYA 1AFQB 1O2PA 4X6NA 3I77A 4YESB 2ZDLA 1XVMA 3U9AH 2Z3EA 3H09A 3HKJB 3KQEA 4K69A 4Q2KA 4Y8YA 4HG6A 3S9BA 2O8MA 1AQ7A 2XC5A 4KELA 2H9HA 2CK3D 1BTXA 3RXPA 4A6LA 4FVBA 1W7GH 3F9HA 2BOKA 2OD3B 1HPGA 5HXFA 4BAKB 1GHZA 1DITH 1EZXC 1SLUB 3SI4H 2BD4A 3ZYDA 1ZPCA 3K9XB 2C8YB 3SV2H 1SGEE 1EFRD 1O32A 4DGJA 1T32A 5C1UA 5J4QA 4MDSA 3TIUA 1QZ8A 2W3KA 4DW2U 2C3SA 3SOSA 2XNDD 1P12E 3E0PB 4OGYA 1P3CA 1DPOA 1GG6B 5F53A 3SZNA 1ZRBA 1SQRA 1KXEA 1L1JA 2BTCE 3RXIA 1TPSA 1ANDA 2UWOA 1CVWH 3RC6A 2TGTA 2FX4A 1YCPM 2GGVB 1O2RA 2ZU1A 5GJ4B 1QFKH 1NFWA 5DP3A 2FO9A 2G51A 3SU5A 1QBOA 3ZVCA 1QRZA 5T6GA 4ISNA 1SPJA 2RDLA 1HUTH 4TWWA 2V0BA 3QZQA 3ZIAD 1QRXA 4YO9A 3EE7A 2AEIH 1GMDG 1D3QB 2HPPH 2NU4E 3AASA 1TPOA 1W7XH 4Y7AA 2AMDA 1P03A 1PQAA 2ZI2H 1QQ4A 4GPGA 1C5ZB 1DWBH 1Z1JA 1ZSLA 3I78A 1CT0E 4GCHG 3E16B 1Z8RA 1C1OA 4XFQA 2A5KA 5AFYH 1TYNA 1GVLA 3ZZDA 1VKYA 1CBWC 4I8LA 4IGDA 1OWIA 3TK6A 1PFXC 4ZXYH 4NIVA 1T4UH 4UD9H 4O3UA 5CHAC 4B2AA 5G4BA 1O38A 3VXEH 3Q76A 3HGNA 5C1XA 3PLKA 1GL0E 5DP4A 4VGCB 1EUFA 2GCHF 3W1EA 1KY9A 5E2PA 1AKSB 4NIWA 4ZKOU 2ZGXH 4WXVA 3A88A 5ABWA 7KMEH 3E3TA 1OP0A 3RU4E 3SGQE 4UFGH 1GMCF 4INLA 1IHTH 1S81A 2LNCA 5A0BA 2BDGA 1GJAB 1GI4A 1W12U 2ZFPH 4I33A 4Z1MD 1YLDA 3BIVH 1TBQH 1DLEA 1TIOA 1TNLA 2PUXB 4FUDA 1AFQC 4IBLH 1CA0B 1QHRB 2SGEE 3P92A 4CRCA 1BRAA 4B6FA 2VH6A 3BF6H 4M7GA 4K8BA 4RT1A 3LGTA 2ALPA 2ZIQH 1LQDB 1AGJA 1FONA 2H5CA 1S6FA 2VIQA 1FY5A 1U6QA 3SZEA 1NZQH 1OX1A 1Y3YA 4JK5A 1ETSH 4CRBA 2H9EH 1TMUH 1HAVA 3NPSA 1QJ6B 1DY8A 3GY8A 1CT4E 1EPTB 1THSH 2ZHFH 3PROA 1XMNB 1ELDE 2BDCA 2QYIA 1P57B 4WF8A 5GCHG 1SGIB 3F68H 1EAIA 2GX4A 4UEHH 3LJJA 2A5AA 3OU0A 1OYQA 3D65E 2FX6A 3SW2B 5DPAA 2CF9H 1GG6C 3A8AA 4TSFD 2EC9H 1KXDA
chains in the Genus database with same CATH topology
1SGCA 3RXGA 4YLQH 2PSYA 4JZEH 3M3VA 1SGTA 2ZG0H 3Q3YA 1QL8A 3U8TH 1FIWA 2ZU2A 1EJMA 1FY3A 4JYVH 4U2WA 4NZQA 1A1RA 5DP8A 1C2EA 1GBTA 1NRQH 2ANKH 1V2KT 4IW4E 3RXJA 4YOIA 1P11E 1RJXB 2UWPA 3GCOA 1F2SE 1P01A 1QL7A 2OTVA 2VB0A 1HAOH 1B0FA 2BX3A 1ELTA 2FMJA 2TGDA 1K28D 2JH6D 1FY8E 3S7KB 3OYPA 1ARBA 4H6TA 2FESH 1YPJH 1PQ5A 1KYNA 5T3HA 3KQCA 1S84A 4TY7A 3TITA 1O35A 3V12A 5DG6A 3LDXH 2VVCA 1UCYH 2PTCE 1L0ZA 1C1VH 1F92A 2ZNKH 3SV8A 2F9NA 1ETRH 3TNTA 1P09A 1HJAB 1MAXA 1YPMH 1LHFH 3P8FA 4AFSA 4VGCC 1AMHA 4JYTA 1TGCA 4ISOA 4WMEA 1RIWB 3T25A 3UUZA 1EAXA 3RLWH 3NWUA 1TRYA 1JRTA 2TGAA 4KTSA 1GBKA 1FPHH 1ELBA 2VWOA 4CH2B 4H42U 3SU4A 3LT3A 4NA7A 1IQGA 4LXBH 4ABIA 1G3EA 2ZECA 2PKAA 3BTEE 3IG6B 2F9VA 2JH5D 8KME2 1CA0C 1ZMJA 4DIHH 1OWEA 1A46H 3BTHE 1UVTH 1E35B 1KSNA 1GBAA 1MAYA 3LGUA 4XDEA 2G81E 2XNIA 1TRNA 3SV9A 3RXVA 4DG4A 2DE9A 4Y11E 1QA7A 2A4GA 1W0YH 1A5IA 1E38B 2JH0D 4ZAEA 1JBUH 2J92A 3QTOH 2C8WB 3A7XA 1EPTC 1HLTH 2BD2A 1WQVH 4I8KA 2ZTZA 1LMWB 3M61U 4WMDA 4WY3A 1BUIA 5EPNA 5C20A 4K1SA 1XX9A 3IWMA 5C2ZA 1FI8A 3MHWU 1GI8B 2HVXA 1SGQE 4ZKRU 5HGGA 2XWAA 2HRVA 3LIWA 2FTMA 2ZO3H 3SUDA 1E37B 1OKXA 1XVOA 1VCPA 1AHTH 4WVPE 1O2WA 3ZVEA 1V2VT 2QXGA 5JDUB 3B23B 5AVDA 1P2IA 1INCA 5T6DA 1NRPH 2ZEBA 2CMYA 1Q31A 3PLPA 3GDUA 3BTTE 2ESTE 3K2UA 2ZC9H 2XW9A 1C4U2 1O2ZA 2ZU5A 3JZ1B 4GVUA 1BTUA 1ZHRA 1K1NA 1SLVB 3SGBE 3LC5A 1TLDA 1GL1A 4FUEA 1GMDF 2QAAA 1VITG 3DT0H 2QA9E 4BANB 4LOYH 2A1DB 1IAUA 2WV4A 2PGQB 4MPWA 1RRKA 5JB8S 2BXTH 4CH8B 2ZDVH 1UTNA 2ZGJA 2BVSH 1O5FH 2FYQA 4UFFH 2Y81A 1UTJA 4GCHF 3ZYEA 2EI7A 1SB1H 3TU7H 3MO9A 1EATA 1MTNB 1NFYA 2W7UA 2ZQ2A 1XUFA 3SI3H 3MU5A 4X0WU 1Q2WA 1AVGH 3SNEA 1D3PB 4Y6DA 1HJAC 1BJUA 3PV4A 2ODQA 1RIWC 1HDTH 1LPKB 1O2SA 3SQHE 3MFJA 3TK5A 1AO5A 1LVOA 1DDJA 3EDXB 1A5HA 1O3KA 1W3CA 3GCTG 1C5WB 2OC1A 1C5LH 4F49A 1KLJH 1Z6JH 2JKHA 1HRTH 3V0XA 4F4OC 2ZF0H 4CR5A 1SQOA 3FZZA 4K3JA 1CT2E 1K1PA 1Z6EA 4X2YA 2GP9B 3H7TA 4ASHA 4ESTE 1DT2A 4XSKU 4BNRA 5DP6A 4X6PA 4D76A 4HGCA 1OPHB 3VB6A 1NFXA 3SORA 1JXPA 1NN6A 3SJ8A 2ZKSA 3RM2H 3GOVB 1J14A 4D9QA 1GJ9B 1SOZA 3SNBA 7ESTE 5EXLA 1IQIA 3DHKH 1OXGA 3PM3A 1NROH 4TYDA 4U01A 2NU1E 2HALA 3A87A 1Q3XA 5A2MH 2R0KA 4ABHA 2W7SA 2QC2A 5FXLA 1LKAA 1SHHB 5BRRE 3MO6A 1GI7B 1BTHH 2H2ZA 1BBRE 1GDUA 3U1JB 1VCWA 1MQ5A 1QTFA 1V2OT 1HAVB 5GCHF 2ODYB 3S7HB 3ZVDA 3BEFB 1C1SA 1C5NH 2OINA 3EYDA 3BTFE 1C5TA 5HYOA 1C5UA 1HCGA 1SGYE 1RTLA 4INKA 1GBDA 1VJ9U 3KF2A 2GZ8A 2HOBA 4ISIH 4HFPB 2Y5GA 4ZHMU 3MNSA 2A2QH 3KIDU 1V2NT 3ZZ5A 2PW8H 5L2ZH 2GT7A 1C2GA 3LGWA 3QWCH 1RTFB 1TGNA 3W95A 5JBCS 4WWYA 3M7QA 1QJ7B 4NSVA 1BDAA 1CSOE 2YNBA 1YC0A 4ZKNU 1UMAH 1ZTJA 3A83A 3M37A 2FDAA 1QB6A 3OTJE 4SGBE 1O3IA 3QN7A 1EZSC 2G4TA 3IITA 1DXWA 3BTME 3VEQB 4XBCA 1GCDA 1MTNC 2W26A 1G9IE 1BTYA 3R0FA 5CHAB 1K2I1 1O2TA 2F9UA 4Y0YE 4B76A 4DT7B 1OP8A 1DFPA 2BY8X 1TA6A 3TLOA 4ABAA 1AUTC 4YTAA 3KHVA 1MUEB 3STIA 2M5TA 3O8CA 1C5SA 4MLFB 5K7RA 1TNHA 1ZGVA 2R3UA 1V6DA 1K1JA 2Y6TA 4ABFA 1EAWA 3E90B 3RXFA 3AAVA 1JRSA 1TNGA 1OWHA 1J8AA 3MU8A 1A3BH 4LZ4B 2C8XB 1NTPA 1WBGB 5PTPA 1P2QA 3RM0H 4MG3A 1FXYA 2FWWA 2ZGHA 3MNXA 1ETTH 2ZDMA 2WUBA 2ZDNA 4NA9H 3ATMA 4CRFA 3JZ2B 1G3CA 5DP5A 2OQUA 2PR3A 2A7HA 3SN8A 2O8UA 4AG1A 2G5NA 1O3NA 4CHAB 9ESTA 1O3PB 2H6MA 4OGXA 4BXSA 1Z8IB 2BLQA 1S83A 4KGAA 1VJAU 2O8WA 2P59A 4XE4A 1WU1A 2BZ6H 1ZR0A 2PKAB 2BYAX 2VIPA 2Z9GA 1K9OE 1O5AB 1YPGH 3ATWA 1YCPH 1ZOMA 1C5XB 2STAE 3RMLH 2BX4A 1GBLA 2ZA5A 2ZFRH 2Q6FA 2BDIA 3F9EA 3FANA 1O2UA 2FYRA 1S0QA 2WPMS 1WAYB 3AVZA 3E1XB 4QT8C 3GY3A 2ANYA 1JWTA 3RXMA 5DP9A 2P3UB 1MZDA 2F9OA 4MNWA 2P94A 2TGPZ 3F6UH 1XXFA 2A7CA 1Z7KA 2P16A 2WPKS 3GY2A 4E7RG 5C5OA 2W5EA 1T8LA 3ATIA 1PQ7A 3A7ZA 1C5RA 4AFZA 1LDTT 1EZQA 1QCPA 4ABDA 1NT1A 2J38A 5EXNA 3B8JA 3LOXA 2ULLA 3QGJA 2SNVA 1NM6A 4A1TA 1BT7A 2R3YA 1C5PA 4GAWA 2V3HH 5J4SA 2JETB 1KDQA 1UVPA 4JK6A 1WOFA 1SGPE 3SBKA 2D26C 5E0GA 1THRH 3SNCA 2EA3A 1MTWA 3L6PA 1Y59T 4JZDH 4BAMB 4KKDA 2QY0B 1SVPA 3Q00A 1QY6A 1C1PA 1ZHPA 1Z1IA 1UCYK 3TH4H 2SGPE 4JZ1A 1VITF 1LKBA 3DUXH 1O3LA 2XBXA 1EQ9A 3TGJE 3A7YA 2BLWA 1RTKA 1YKTA 3LU9B 1FMGA 4GHQA 1UTKA 4AYYB 1KIGH 2Z3DA 1ARCA 1O2JA 3RMMH 3O8DA 3QUMP 4BXWA 5AFZH 3UNRA 3UOPA 1UK3A 2HNTC 2W3IA 3VPKA 3T28A 3LH1A 6CHAB 4BAQB 2BZAA 3TGIE 3ELAH 3GCHB 4ZHAA 1GI3A 1MD8A 1C5MD 3SJIA 2P93A 3TK9A 1HJ9A 3VB3A 4PROA 4Y0ZE 2F9PA 3DD2H 4FU9A 3NK8A 1TALA 1XKBC 3GCTF 2I6QA 1J15A 2AFQB 2ZTYA 3M5MA 1O3DA 2P95A 2XC4A 2Z9JA 1V2JT 5DK1A 1AZ8A 4D7GA 1NS3A 2O9QA 1BTPA 4CHAC 3HATH 4O03A 1QRWA 4X8TH 1EKBB 3QLPH 4JMYA 5C67A 1SGRE 4CRGA 2FOCA 2AGEX 3P17H 2UUJB 1GHXH 3KL6A 2DE8A 1SFQB 3ODDA 3PWBA 2VGCB 1A2CH 1DVAH 1NU9A 3LPRA 1IQLA 1MD7A 1W11U 4X1PU 1VITH 2ZHEH 4NSYA 2GDDA 2NU0E 3SNDA 4K1EA 3SHCH 3MWIU 4YT6H 4A92A 2ZWLH 2Y5FA 1GCTB 3EA7A 4WH6A 4OS6A 2ZCKP 5C3NA 5ETXA 2Q6DA 4U32A 2I6SA 2VVUA 1SG8B 5DP7A 5EW2H 3BTWE 4JCNA 4K1TA 1V2QT 5FPTA 1WCZA 1GJ6A 1GBFA 1ORFA 1TABE 2ZFQH 3P6ZB 5GIBA 2PSXA 2KAIB 3HK3B 3RMNH 1Y8TA 3RDZA 2F3CE 3QZRA 3Q3KA 1MU6B 1IQNA 1SOTA 4AN7A 5JB9S 1P3EA 4B73A 3CP7A 1FY1A 1SGFA 1ELGA 2ZDKA 1T4VH 4J1YA 4NZLA 3P8OA 2JETC 3ESTA 2CHAB 5F03A 1NO9H 1GHYH 1O2LA 4UE7H 1IHSH 4CREA 1RXPA 1KTSB 1C1TA 1WQSA 3FP6E 1D6RA 2BY7X 1W2KH 2PGBB 5FX6A 4XBBA 3PYHA 1NFUA 1LCYA 1O5EH 3UWIA 6ESTA 1Y3WA 2RA3A 5GPIB 2BMGB 1B0EA 2H5DA 2FOAA 5SGAE 3T5FH 1AVXA 4AB9A 3DA9B 4X8SH 5LPFA 3M3TA 4Y8XA 4B74A 1P2KA 3RXLA 4CRDA 3UPEA 2CXVA 1SGFG 2GV7A 1D3DB 4LK4A 1MCTA 6CHAC 4B2BA 2IJOB 3A85A 5EOKA 3RXEA 1ZMNA 2SGFE 4IMQA 3GCHC 1C1NA 1C2IA 2ZHQH 4KP0A 4Z6AH 2SFAA 2HWLB 1SGDE 3FZDA 4DCDA 5C1YA 1LHCH 1DSTA 3RXTA 1GVZA 5GXPA 4Y79A 1BMMH 1K22H 3MO3A 4OS5A 5DJ7A 1ABJH 1FV9A 2Z6BD 1O3EA 1O37A 3UNSA 4FUFA 2CF8H 1QQUA 2FP7B 2IN2A 2Q1JA 1HAXB 2FI5E 1DUEA 2BD7A 3QX5H 5JBAS 1GJDB 1D3TB 1KLTA 2RA0A 3B9FH 3RXDA 4A5TS 5HMAA 3TJOA 1ZSJA 1PYTC 1EJAA 3NUMA 1BHXB 3BIUH 1DUAA 2VGCC 1A61H 2J95A 5A8ZA 3SJOA 4I7YH 3NKKA 1PPCE 2AS9A 2FOFA 4X1SU 5A0CA 1FN8A 1Z8JB 1E36B 1PPFE 3U8RH 1AZZA 3T26A 1GHAG 1XM1A 4AGJA 1GBHA 1ACBE 1K21H 1LPGB 1V2WT 4JYUH 4DJZB 1MMJN 5EODA 4J2YB 1ZSKA 1JIRA 2CN0H 2J2UA 2FPZA 2R9PA 1GCTC 4H6SB 1S82A 5ESTE 3TH2H 1G37A 1V2PT 2EI6A 3ZZCA 1S6HA 1SBWA 2Y7ZA 3EQ0H 4MNYA 1BTWA 3BN9A 1TPAE 3A84A 3SUGA 3M7UA 2GCTB 2OUAA 3S69A 1MTUA 4UDWH 4NIXA 3BSQA 1SI5H 1C5YB 2P3FH 3PTNA 3P70B 1NRRH 1J17T 4NFEA 1MKXH 5EXMA 1EOLA 3LGIA 1WSSH 1NY22 1P2MA 1QB9A 1ELVA 3BTQE 3RXBA 5JBTA 1DSUA 4RKJB 1BOQA 5A8YA 2CHAC 5CMXH 3MU4A 5EGMA 3RP2A 2BDHA 1N8OB 4DURA 1PPZA 4R0IA 4WH8A 4E06H 1BBRK 4THNH 3FP8E 4D7FA 2ZFSA 4X1NU 1DY9A 1P02A 1XUKA 1B7XB 1GJCB 1MZAA 1SC8U 1UVOA 1EOJA 2PUQH 3BG8A 2A45B 3RXQA 3KQDA 1C5VA 2BD8A 3H5CB 2YOLA 3F9GA 1EZUC 2XCNA 1ZYOA 1KDQB 2VU8E 1LQEA 4AYVB 1W10U 3V7TA 1G3DA 1D6WA 2ALVA 4YLUA 1QURH 2WPLS 1B5GH 3A8BA 2V3OH 4NGAH 4X8UH 2G00A 3A82A 1ZZZA 3OSYA 3L33A 3GY4A 4ISHH 3ZZ7A 3O8BA 4BTIB 1BRCE 1NPMA 4CR9A 1UHBA 1PPGE 3HK6B 1FZZA 2P8OB 2AGIX 1C2LA 3T2NA 1S85A 3T27A 1QJ1B 1WYKA 1KTTB 2VJ1A 2BDAA 3Q77A 3OY5U 2FZZA 1UTPA 1YLCA 1GBBA 1C1MA 4RKOB 2BQ7B 2OXSA 1MH0A 3PTBA 1GVKB 3SU2A 2O8LA 1C1UH 1AD8H 3SGAE 3UOUA 3DFLA 1H8IH 2A7JA 1G32B 4ABJA 1IOEA 4FUCA 3MYWA 3K65B 2SGDE 1C9TA 1YCPK 4ZMAH 2BLOA 3L3TA 1OWDA 5EQSA 2P3TB 2J4IA 4O97A 4U30A 1O3OA 3D62A 1ELCA 3M35A 2R0LA 2H9TH 2G52A 3KN2A 1YF4A 4I8HA 2G4UA 4ABEA 1UVUH 1TX8A 4BAOB 1XUJA 2KAIA 2UUKB 1L2EA 2UUFB 2SGQE 3MMGA 4AOQA 2CJIA 1MU8B 2C93B 4B71A 5TJXA 4RN6A 2F9BH 5FHTA 1JMOH 4D9RA 3MTYA 1ANCA 3RXSA 4NWLA 5DO4H 1C1RA 1C2DA 2UUYA 5LPRA 3QO6A 5GWZA 1F0SA 2FI4E 2R2WU 3HPTB 2GCTC 3SJKA 8ESTE 1TBRH 2QGRA 4FVDA 4KTUA 4AORA 2XBWA 1T8NA 4Z0KA 1EAUA 3FVFB 5EQQA 1A0JA 2NU2E 3F9FA 4Q7ZA 3VB4A 2G8TA 3TVJB 4GSOA 1S5SA 3E0NB 2ZTXA 2ZP0H 2PTNA 4HI3A 1GBEA 1LVMA 2QIQA 3URDA 4A1XA 3AW0A 1N8OC 1WTHD 5HM9A 3D49H 1EP5A 2ZZUH 1QBNA 1TOCB 1TNKA 1HBTH 1ZJKA 5TCAA 1RS0A 2RCEA 3BEUA 3PB1E 2ILNA 1GJ5H 3VB7A 5F8ZA 2TRMA 3MOCA 3ATLA 1Z8GA 2PKSB 3SUFA 1OWKA 2ZPSA 3GDSA 3ZZ9A 1TGBA 3GISB 2ZU4A 1BBRH 1O3MA