2Q6GA

Crystal structure of sars-cov main protease h41a mutant in complex with an n-terminal substrate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
305
structure length
305
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRAVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of two coronavirus main proteases: implications for substrate binding and antiviral drug design.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords severe acute respiratory syndrome coronavirus (SARS-CoV)
total genus 82
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2q6gA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2q6gA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2q6gA02
1QTFA 3QN7A 3EA7A 2XXLA 1XXFA 3LKWA 4MDSA 1LO6A 4INLA 4ZKSU 1D6RA 1QL9A 1K9OE 3SO3A 4I8JA 2ZDNA 1GJBB 3PYHA 1O3AA 1SVPA 1C2LA 1XM1A 1VR1H 2OQ5A 2Z9IA 3T27A 1KDQB 1DLKB 3L33A 2STBE 3UY9A 2ZC9H 2FOHA 4B76A 2YNAA 4CH8B 3OX7U 1AFQC 3TJUA 3HK3B 3PB1E 4VGCC 4A5TS 2BY8X 1AUTC 2J2UA 1V2VT 3BTEE 3GCTG 1IHSH 3QK1A 4BAHB 2NWNA 3VB3A 1GBFA 1O2QA 2STAE 4UFFH 2WUCA 1O3JA 3BG4C 1GDQA 2Y5HA 4B71A 2ZGXH 2A7JA 3A86A 3ZZCA 3RXFA 1UTNA 4LXBH 2VIOA 3SOSA 2ZZUH 1OP0A 5EG4A 5E2OA 7LPRA 1QJ7B 4FVBA 4ZXXH 1ZPZA 3RXAA 3UUZA 1C5LH 4IC6A 1TONA 1DWDH 4GCHG 2SGAA 3QTVH 1G3DA 3VB4A 2G55A 6ESTA 3I29A 4E06H 1O2IA 3SW2B 3F68H 4A1VA 2ZDMA 3BTFE 3DFJA 2WV4A 4I7YH 1HJ9A 1IQKA 1ESTA 3RMMH 3GOVB 2XYAA 3GISB 1GI3A 3UIRA 2GV7A 3BIVH 1WBGB 2FYRA 2V0BA 3F9HA 1GI2A 3PM3A 2P93A 4I32A 3E1XB 4B74A 1ELTA 4MNWA 1NU9A 2UWLA 2XWBI 2UUFB 3TH2H 2FOEA 2HGTH 3UTUH 1GHBF 1HIAA 1MCVA 1AU8A 3ATLA 5HXFA 2A32A 1DWBH 1NC6A 4UD9H 1TRMA 1FAXA 1V2LT 1EP6A 4JYTA 4ABDA 2G4TA 3KF2A 2ZA5A 4R8TB 1V2UT 1XUIA 5CE1A 1AVGH 1XUGA 2C93B 3H7OA 1OS8A 1T32A 1TNHA 1BRCE 3SQEE 2BOKA 1TGNA 3RXEA 1KDQA 1BA8B 3NUMA 5AHGH 1UTQA 1O3MA 1ZTJA 3QX5H 4NIVA 4OS5A 4X6OA 1YP9A 4JZEH 4Z0KA 1J9CH 1SC8U 3SJ9A 4TYDA 4ZMAH 2ZGHA 5JBBS 3SGQE 5CHAB 1P02A 1PPFE 3SJIA 5FCKA 8ESTE 4Q7YA 3AVZA 1SQTA 1MU6B 1XMNB 4YM9A 1AZ8A 1GHYH 2ZDAH 3V0XA 1PPHE 1UVUH 1AUJA 5EQSA 1AFEH 2HWLB 2PGBB 5DP6A 3VGCB 1BDAA 1P09A 4ABBA 2J34A 1AIXH 3M3VA 4XBCA 5F8ZA 2AMQA 2VWLA 1FY5A 3HK6B 4NZQA 1O33A 3CP7A 4KTSA 4ISOA 1DM4B 2QXHA 3PMHB 2D8WA 5J4QA 3NXPA 3GY8A 4Q7XA 4XOJA 3ZZ8A 1T8NA 4Y8YA 3BTHE 2Z6BD 5GXPA 2ZQ1A 5EW1H 5AF9H 2GCTB 1QRZA 1SGTA 2FOFA 1C4U2 1QJ1B 3O8RA 1SGDE 1L1NA 4WWYA 1AMHA 2C8WB 1F7ZA 2HLCA 1P05A 1BRUP 4X1NU 3RXLA 2BY6X 2DE8A 1XUJA 3HGPA 3QTOH 1EASA 4WF8A 1K1MA 1KXDA 4K8YA 1GHVH 1GJ4H 3RXQA 1O2UA 2ODPA 2BDGA 1EZSC 3VPKA 3RXTA 1VGCB 4WH6A 2BD2A 2Z3DA 2YOLA 1TB6H 2BX4A 1PYTC 3EA8A 2JKHA 1ANDA 2V3HH 2F9OA 3RXGA 1MQ5A 1B0FA 2NU4E 1SSXA 1S82A 4AN7A 1LHFH 1EJAA 3EQ0H 1NS3A 2IN2A 3M5LA 5AFZH 1HYLA 3ZZ6A 1GJ8B 5F8TA 5GPIB 3E6PH 6CHAB 1G2LA 5I46H 1GMCF 1Z6EA 1S81A 3EGKH 1CHOG 1AVXA 1OOKB 4AOQA 3R0FA 1V2ST 1ZHMA 4IBLH 4I8HA 4X8SH 4RKOB 1HIAB 1EPTC 1O2PA 1VITF 4YLQH 3EBNA 1BTZA 1NO9H 5FCRA 2GX4A 1GMDF 2A4QA 1ZMJA 2K7XA 1TNKA 3OTJE 1GI8B 2DUCA 4OS2A 1GMHF 1TPPA 4D7GA 3QZRA 3ZZDA 3IITA 1CO7E 1C2FA 3GY3A 3RXRA 1VITH 2GCHF 3MH5A 2HVXA 2ZFTA 2ALPA 1BRBE 1SLVB 1HGTH 3PROA 3S69A 1O3GA 2VINA 3MH6A 3PLBA 1SR5C 3ATIA 4RSPA 1DLEA 1PPBH 5F03A 4MNYA 2TGAA 1F0TA 1UTLM 2BX3A 2TPIZ 1MBQA 1GI1A 1TMTH 1YKTA 1GJ5H 1NU7B 2J9NA 3L3TA 2ODQA 2FTLE 1OYTH 3SV8A 3K9XB 1B5GH 2A45B 4ABEA 2VU8E 1WYKA 1S6HA 1Y3WA 4R0IA 3ITIA 4CRCA 2UUYA 2UUJB 3RXKA 3SNCA 1S0QA 1Z8JB 3HGNA 5C1YA 1BQYA 3QUMP 2C8ZB 4U01A 1W0ZU 3QZQA 2BD5A 1AE5A 1SGQE 3V13A 2Q6GA 2A1DB 2BQ6B 5CHAC 4CRGA 1UTKA 3BTGE 5A0CA 2K1QA 2KAIA 3DD2H 1GBLA 1V2NT 1MTSA 4WXVA 3A87A 3WY8A 1YPHC 1TBZH 4WMFA 1AZZA 1L1GA 1SGFG 3PO1C 1ETTH 1O39A 4RKJB 4YTAA 3OU0A 2AYWA 2ZPSA 4D9RA 1UO6A 2OD3B 2P94A 2RG3A 3MTYA 1VCWA 2BLVA 2OUAA 3RU4E 1C5ZB 2OTVA 1UTJA 1TGTA 3NZIA 2CHAC 2WYJA 1FXYA 3SZNA 1FIWA 3A89A 3AAUA 2FLRH 4ZHLU 2FOAA 3A8BA 1AWHB 1SGEE 4O3TA 1O2XA 2A5AA 1FZZA 2KAIB 1KLIH 1SMFE 2QF3A 1L0ZA 1QA7A 2BDIA 4Y71A 2BOHB 1SOTA 4Q2KA 3SORA 1JOUB 1ZGVA 1GMHG 1P8VC 1FY8E 1TNJA 1PPGE 3SU4A 2A31A 5CMXH 6GCHG 3F9EA 1LTOA 1W7GH 2QA9E 2XC4A 4NA8A 4OGXA 4BTUB 1T31A 2BD3A 4IGDA 1TMUH 1Y3UA 4NFEA 3RMLH 4MPUA 1GBAA 2R3UA 1Z7KA 1RD3B 1C9TA 2OQUA 3ZYDA 2FZZA 1O5FH 2BDAA 4THNH 3A81A 1GHZA 2XC5A 4CBNA 3ODDA 1HJAC 1NFXA 1W12U 1GHWH 2IOTA 2Q6DA 3ZZBA 4HGCA 3LDXH 2VJ1A 3VB7A 2ZECA 4INHA 4E05H 3CS0A 1DE7H 1C5QA 3D49H 4I8GA 2SGFE 3W95A 2GDDA 3JZ1B 2LIZA 1GG6C 4KTUA 7KMEH 1EQ9A 1AFQB 1PPCE 1WCZA 1J15A 2BHGA 2GT8A 4HFPB 1HPGA 1BMLA 3RXDA 2R2WU 5G4BA 4MPWA 1O3CA 1OP8A 3KQEA 1JRTA 1LHCH 1ANEA 2JETC 1C1RA 4UFDH 2P8OB 1YBWA 1HRTH 1AKSA 3FFGA 1EZUC 1B7XB 1DANH 3GDSA 5AFYH 2BD4A 1P06A 1A0JA 1MBMA 3A83A 4NSYA 2VWMA 1CQQA 2RA0A 1Y5AT 2HNTE 1THRH 1ESAA 3GYLB 1P0SH 3SI3H 1YM0A 1C2KA 1IQIA 1TNLA 2FOGA 4ISNA 5T6GA 3F9GA 1V2PT 1GI6A 1NFWA 5ESTE 1SGIB 3E3TA 1ANBA 1GI4A 1FNIA 1GJCB 2BVSH 4QT8C 3A84A 5DP4A 5A8YA 4ZHMU 4Y0YE 2Z9JA 1O5GH 2B7DH 1TGCA 3S7HB 4CR5A 1O3EA 4JZDH 2GMTB 3RXPA 2BXTH 4Y7BA 2AFQB 4I33A 3U9AH 4Y10E 1VZQH 3ZVBA 1INCA 2FOMB 4Y7AA 1O2SA 2HPQH 1O32A 1FJSA 1EKBB 2ZO3H 3EE0B 1P3EA 1P9UA 1YPHE 4ZKRU 1A5GH 2O8LA 3RM0H 3SHCH 1AHTH 1T4UH 1RJXB 2WPKS 3LJOA 3M37A 1QJ6B 1O0DH 2FIRH 2XW9A 2Z3EA 2Z7FE 3KQBA 1EX3A 1P57B 4U30A 1YCPK 1TA6A 3T2NA 3S0NA 1V2KT 2G52A 2VIDA 4X1SU 1O3OA 3ATWA 1LMWB 1Q3XA 1QBNA 1C1VH 3D23A 1QL8A 1C1MA 3MU5A 3NCLA 2ZI2H 1K28D 4H42U 5B6OA 2Y5GA 3LH1A 2ZF0H 3GYMA 3GY2A 3PV4A 4NG9H 5GCHG 4A1TA 1BT7A 4ISLA 2A2XH 1G30B 1MD8A 1FV9A 1V2TT 2AGIX 1MTNC 1GGDC 3ZVCA 1O5CB 3U8OH 4AORA 1TYNA 3TK6A 3EDXB 4X6MA 3A82A 2BXUH 3BEFB 2THFB 1C1OA 4CRAA 3LH3A 2ZDKA 3RC6A 1IQHA 1SGFA 5HMAA 3A8AA 2Z9LA 3L6PA 4FU9A 3KHVA 4JCNA 3SV6A 1F2SE 3UWJH 4MPXA 3VB6A 1W14U 2OC1A 1TQ7B 2ZEBA 2CN0H 1Z1JA 3K65B 1ZJDA 3A7VA 2XCNA 1UK3A 1NFYA 3SJKA 1JRSA 1QB6A 1QB1A 1DY9A 2QN5T 3M7QA 1BJUA 3MU0A 1ABIH 4ABHA 1GJ7B 1SPJA 2ZHWH 3O8CA 3TPIZ 2AERH 1V3XA 2F83A 1SG8B 1C1WH 4GAWA 1A46H 2OLGA 5HM9A 1FPHH 1GDNA 2GP9B 2R3YA 1PJPA 1Q31A 1FN6A 2PV9B 4UFEH 5DPAA 1GJDB 4DURA 3ATKA 1O2JA 1BOQA 2J92A 2FS8A 1N6YA 5E8EH 5GWZA 5C1UA 1DUAA 1DWEH 2QF0A 5JPMH 5LPRA 2FX4A 1HNEE 3TU7H 2VWOA 1O3LA 3S9BA 9LPRA 3TGIE 1CGIE 3SBKA 2P3FH 3AW1A 3AAVA 1LHEH 3STIA 3H7TA 1UMAH 1Z8RA 1RRKA 3RLYH 3RMOH 2H9EH 3JZ2B 2BDYA 2JH0D 3LC3A 2A7HA 3UQVA 4ESTE 1UVPA 2BY5X 5EODA 1LVBA 3DUXH 1BRAA 1ELBA 4ZUHA 1HUTH 3BEIB 2P3UB 1RTLA 1UJ1A 4KGAA 2H5DA 1QA0A 1X7AC 4I8LA 3SUDA 3TGKE 1IHTH 2ZCHP 3KIDU 1CHOF 4LK4A 1GVKB 1MTWA 1O2VA 2BZAA 3LOXA 5DP8A 1C5VA 2Q1JA 3SNAA 3ZYEA 1D3TB 3MU4A 1GWAA 1T8LA 5DG6A 1V2QT 5T6DA 2G4UA 4YT6H 3MO3A 2HALA 1OKXA 1ELFA 1A0LA 5FPSA 1A5HA 1H9IE 3URDA 1V2OT 1C9PA 1EXFA 4A1XA 1YGCH 2BDBA 3HATH 4Z6AH 2ZFPH 1DSUA 4RN6A 4IMQA 5DP5A 3GY6A 1BTUA 1V6DA 2LPRA 4BAMB 1P12E 4BXSA 8GCHG 1LVYA 1C4Y2 1YCPH 3VXEH 1C1QA 4NIWA 2WPMS 1EUFA 1GVLA 3GICB 4DGJA 1O2YA 3RXVA 1XUFA 1VITG 3SU1A 2GCTC 4O97A 1YPJH 3FP7E 4F4OC 2PFEA 1THPB 3ZVFA 2PSXA 2F9UA 5I25A 4FXGH 5JYIA 4JMYA 3VFEA 1C2DA 1SGNE 1UCYH 2SGQE 2JETB 2HNTC 1VGCC 1O3HA 3GDVA 1BTPA 3ZVEA 3VB5A 1TLDA 1A4WH 1T8OA 1YYY1 3AW0A 2FXRA 3ZZ4A 5E0GA 4Q80A 4LZ1H 1KTTB 1PPEE 4D7FA 1O36A 1ZZZA 4NGAH 2WYGA 4ABGA 4DCDA 1HAVB 5JBTA 2FEQH 2PWXA 1ZR0A 4ZKOU 1ZOMA 3U1JB 5FAHA 2SGPE 1MKXH 1O38A 3EAJA 1A3EH 4IS5A 6GCHF 1MTVA 4XE4A 3ZZAA 2V35A 1VJ9U 1ZJKA 2JH5D 4WJG2 4X2VA 4CRBA 1AD8H 1C5PA 3A88A 2ALVA 1LDTT 2Z9GA 2ANKH 3PMBB 1FUJA 3BTQE 1C2JA 2CMYA 3KNXA 3F6UH 2ZNKH 2GDEH 1ELAA 3RXCA 2CGAA 1E34B 1O34A 5T6FA 1TX7A 3GY4A 4IW4E 2V3OH 1V2RT 2P95A 1THSH 4MVNA 7ESTE 2O8MA 3UNSA 2FI4E 1O3BA 4YOGA 4DW2U 1ZSJA 3LC5A 3M5OA 4BAOB 2QYIA 1DX5M 1UTMA 2WINI 1ZHRA 2F91A 3LU9B 4KTCA 1WOFA 3S9CA 1AQ7A 1YLCA 1OXGA 1ARBA 1XKAC 4I31A 1C2HA 1D3DB 3B9FH 1GPZA 1OSSA 3SJOA 2PTNA 4XFQA 4OS6A 4UFGH 2QXJA 1ZPBA 3SNDA 3LJJA 1IOEA 3VEQB 1EATA 1WQVH 1SLWB 1FDPA 1XUHA 3A8CA 1AI8H 1K22H 3RXHA 1G3EA 1JBUH 4NSVA 1O2OA 7GCHG 1P2OA 1SFIA 1DICA 4B75A 1CBWB 3U1IB 2A2QH 2OXSA 3E16B 1W7XH 1GBTA 2C4FH 1BMMH 3T62A 1CT0E 1SGYE 3LONA 2WPJS 3Q00A 5J4SA 1C5XB 2FESH 2GZ8A 1NFUA 4Y76A 1DXWA 1WTHD 3P8FA 1IQGA 4KKDA 2Y6TA 3RU4D 1FLEE 4ZHAA 2SGDE 4AFQA 1BTHH 1HAXB 3BTME 3GCNA 1UVTH 1CA0B 3SUFA 1C2EA 3TNSA 1OWHA 3BG4B 2Z94A 2HNTF 3T29A 1TGSZ 1NROH 2IPHA 1VJAU 2OC8A 3MNBA 1G36A 5ABWA 1ZHPA 1S85A 2FMJA 5BPEA 1GBHA 2XRCA 5FX5A 4B2BA 1MZAA 4DIHH 1P2MA 1C5OH 1TPOA 2W7UA 4WMEA 1UVSH 1O3DA 4FU7A 2ZDVH 1TOMH 2PHBA 5GDSH 3MOCA 2VIWA 5T3HA 1C5YB 4WXIA 1KXAA 1IQLA 1ZPCA 1UTPA 4NCYA 3FAOA 4X6NA 2ZHEH 1O2HA 1HAPH 2ZWLH 3RXOA 2QXIA 3TK5A 3MNSA 1ZRBA 2PLXA 1SQAA 1Z71A 3IWMA 2ZFFH 1BIOA 2PKAB 2VVUA 1TPAE 2ZTZA 3SV9A 1YPKH 1MU8B 3SNBA 2XNIA 3A7ZA 1Y8TA 1AY6H 1OWJA 4MPVA 5H4IB 4BNRA 3BG8A 1P11E 2RA3A 2PTCE 2J4IA 2ZTYA 2SGEE 2B5TB 1ZYOA 1UCYE 2ZFRH 3K2UA 2BY7X 4X8VH 2CV3A 1TE0A 4DY7B 4TWYA 4JYVH 1AKSB 1GBIA 3ELAH 3Q77A 4JK6A 1KXBA 4CRDA 2A0QB 3FVFB 1LQDB 1TPSA 1C5UA 4I8KA 1MKXK 2CF9H 1SHYA 1TRYA 3RMNH 2Y7ZA 5LGOA 1ZTLA 4A7IB 5GCHF 3QDZB 1YF4A 1KSNA 1GJ6A 2DE9A 3HKIB 2Y80A 4OS7A 4KELA 3TITA 1FMGA 2J38A 1NM6A 3RU4T 1PFXC 4GSOA 1ESBA 2J94A 3LGWA 1N1LA 1EPTB 3QLPH 5E0JA 5FX6A 3DHKH 3PMJA 3PTBA 3MHWU 4JZ1A 1C1UH 2P16A 5AVDA 1NRNH 2WUBA 5C5NA 3GCHB 2BY9X 1DY8A 1MQ6A 1EAIA 1T7CA 1UVOA 4B73A 4IMZA 4XSKU 1HJAB 3ZV9A 3A7XA 1VCPA 4TWWA 1DVAH 2XBWA 4FVDA 2ODYB 1W13U 4ISHH 1O3KA 1K1NA 2ULLA 1LKBA 4FUFA 1Z8GA 2PW8H 1LHGH 1EOJA 1QQUA 3E0NB 3ENSB 4F49A 2PKAA 3DA9B 4ISIH 2ZPRA 3UR9A 3GCHC 3FZDA 1EAXA 2RDLA 1O35A 1QBOA 5EU8A 2G00A 1C5RA 2B8OH 2GMTC 4Y79A 4FUJA 2XBXA 5A0BA 1FAKH 2A5IA 3RC4A 4X2WA 2C90B 3A7TA 3HPTB 1SLUB 3I78A 3P8NA 3ZVGA 2WPIS 2Q6FA 4FUIA 4YESB 1OX1A 8KME2 2HRVA 1CGJE 1GDUA 2ZFSA 1AB9B 3LT3A 3C1KA 3RP2A 4XBBA 2JH6D 4PROA 2ZHDA 3VXFH 3FP6E 2VH6A 2QC2A 1UK4A 4GLYA 1KY9A 1P10A 3ZZ3A 2R2MB 1H1BA 3SQHE 2A4GA 1U6QA 1IAUA 2F9BH 1O5AB 2ZHFH 2VH0A 2W5EA 3CS7A 1NESE 3MYWA 2A4RA 2A4OA 2P8OC 1T4VH 1DT2A 2NU3E 1JWTA 3LGVA 1XX9A 1YLDA 5L30H 4KP0A 1CU1A 2RCEA 2BTCE 1Y3XA 4AB9A 1YPMH 2BZ6H 1GBKA 1MZDA 1ZMNA 5K0HA 1EB1H 1HDTH 2AGGX 1MTUA 1ID5H 1KLTA 3ESTA 1MAXA 2SFAA 1BTYA 1DITH 4ASHA 6LPRA 1RFNA 3TJOA 4MNXA 4OS4A 3SUEA 3T26A 1LHDH 4NWKA 1C2GA 4X8TH 1MKWK 1MUEB 1MCTA 3ZZ5A 1P2KA 2FO9A 4ZAEA 2BVXH 2C8YB 1AO5A 2QV1A 3MNXA 5TJXA 1D3PB 3SGAE 1CA8B 1GHAG 1F5KU 1SGCA 1ZSLA 4FUGA 1W2KH 2AMDA 2PSYA 3MMGA 1J8AA 1O3FA 2ZQ2A 3MH4A 3LPRA 1IQEA 1TQ0B 1HBTH 1TAWA 1N6XA 4ABFA 1W11U 1ELGA 1KXEA 3TLOA 5TCCA 1QNJA 1GBJA 3GCTF 1L4DA 1O2ZA 2ZU5A 1F5RA 3OY6U 5FPYA 2BM2A 3RXSA 2ANMH 1ABJH 1MMJN 3KL6A 2ANYA 1CT4E 3A80A 4NIYA 3LGYA 2FWWA 3P6ZB 4B1TA 3K6ZA 2J95A 1BUIA 1XXDA 5GIBA 3S7KB 1GBEA 4WVPE 4E7RG 3UWIA 1V2JT 2BMGB 1BITA 1NY22 4UONA 1LPKB 1CT2E 3A85A 1BMAA 2FS9A 3TGJE 1O5BB 4ZROA 1O2NA 3STJA 3OYPA 3T28A 2ESTE 3BTDE 1C2MA 3P8GA 1ELEE 4UE7H 4ZH8A 3PMAB 1ANCA 1GBCA 1FQ3A 1PQ7A 4FUDA 2P59A 1G3CA 3UPEA 2EI7A 1HXFH 2QY0B 5EXMA 2GGVB 3SN8A 2Z9KA 1HB0B 2B9LA 1ZGIA 1RGQA 4Y6DA 4HTCH 1GHAF 4XDEA 1C5WB 2Z3CA 3ZVDA 1NZQH 2D1JA 2H6MA 3M3SA 1ZSKA 4D9QA 2M5TA 1GI5A 3ZV8A 2PGQB 1S0RA 1OWKA 4K5ZA 1C5SA 1EB2A 1FY3A 3RXUA 8LPRA 2R9PA 1RXPA 1P3CA 2FP7B 3GY7A 2OBQA 5C3NA 3T25A 2ZGJA 3UOUA 5C2ZA 1O37A 2BD9A 3RM2H 1QQ4A 4ABJA 1Y3YA 2ZG0H 2O9QA 2PKSB 5JB8S 1H9LB 1JIMA 3RXIA 2D2DA 2UWPA 3BIUH 4O03A 4B2AA 3SV7A 2LNCA 1A0HB 4BAKB 1A3BH 2H2ZA 3SU5A 2EI6A 1BMNH 4K60A 1PQ5A 1UHBA 4U32A 4XBDA 1O2RA 4FUEA 1GCTB 2H1UA 3A7WA 2AEIH 1MH0A 1DPOA 3SV2H 3OSYA 2FTMA 1QRWA 1PPZA 5F6MA 1BCUH 1TRNA 2EEKA 6CHAC 1H4WA 1JIRA 4O3UA 2XCFA 4H4FA 4NWLA 1GCDA 5FBEA 3QWCH 4AG1A 3SHAH 3QGNB 1NN6A 1F92A 1KIGH 2OC0A 3U98H 3E91A 5HM2A 2FM2A 1BTXA 2GZ9A 1TALA 2W3KA 3EA9A 1O30A 1SQOA 4CHAB 1A1RA 1LQEA 2O8WA 5L2YH 1QL7A 3BEUA 4JZFH 3TVJB 3KQDA 3Q3XA 1TA2A 2ZU3A 1O31A 2VIPA 3TH3H 1K1LA 1O2GH 3A7YA 1TX6A 1BJVA 3PLKA 3PWCA 1KXFA 1LKAA 2QAAA 1K1JA 2PUXB 3RXBA 4BANB 2ZPQA 2UWOA 1GL0E 1DS2E 1K21H 1SFQB 3MI4A 1Y5UT 1W3CA 1YPEH 3M61U 3FZZA 2ZU1A 1P03A 1O3IA 2W7SA 3KQCA 3SU3A 1EPTA 2H9HA 5FHTA 3E90B 4NFFA 1A5IA 1ELVA 4GCHF 4H6TA 3N7OA 4DVAU 5L2ZH 1N8OB 1EZXC 1OYQA 1SB1H 3KN2A 1HLTH 4CR9A 3U8TH 1H8IH 1H8DH 1GJAB 1TGBA 1HV7A 2O8TA 2AIPA 1EJMA 2VWNA 3VGCC 2YNBA 2OP9A 4TPYA 2CHAB 4AX9H 3P17H 1TX8A 2GTBA 2ZFQH 1O2WA 1S83A 2R0LA 3NPSA 3SI4H 1C1NA 1C5NH 1OP2A 5EPYA 4DIIH 3BF6H 2I6SA 4BAQB 1MD7A 5EGMA 1C1SA 2VGCB 4GVUA 3ZZ9A 4OS1A 1W10U 4MNVA 1V2WT 2TRMA 4MG3A 3MO9A 4GPGA 1MAYA 2ZCKP 4TY7A 4JZIA 1RTKA 2ZCLP 4LZ4B 4X6PA 4INKA 1DUEA 1D3QB 1SOZA 3BV9B 1RIWB 2OINA 2ZU2A 4CBOA 4D76A 2XWAA 1D4PB 1WU1A 1RTFB 4NA9H 5EOKA 5DJ7A 3TH4H 3NK8A 3MH7A 1W8BH 1DDJA 2Y81A 3PWBA 2BLWA 4YOJA 2TGPZ 5E2PA 1F5LA 2BYAX 2B0FA 1Y59T 3ATMA 4GHTA 4JYUH 3V7TA 1TABE 3G01A 1B0EA 1HAGE 1CBWC 1GVZA 1A7SA 4K1EA 2ZP0H 4TY6A 5ESBA 1LVMA 5LH8A 3BN9A 2IJOB 3MWIU 1CA0C 3M35A 3LGUA 2BQ7B 1E36B 1G32B 1XVOA 4K3JA 3M3TA 1SBWA 1EJNA 1M9UA 5IDKA 5HGGA 3E0PB 1HCGA 1P2QA 5DKMA 1GHBG 2ZKSA 3EYDA 1GBDA 5EW2H 1FI8A 1P2IA 3O8DA 2G51A 1UCYK 1SI5H 2EC9H 2ANWA 4WH8A 1SHHB 3O8BA 1BBRE 1EOLA 1NRQH 5DGJA 1HAYB 5F8XA 4X1PU 2GV6A 1Z6JH 1Y3VA 1TNGA 1WV7H 2AH4X 2PR3A 2VNTA 3S9AA 1ELCA 5C5OA 1S6FA 1GHXH 1GMCG 2ASUB 4FUCA 5E0HA 2ZTXA 1O2LA 1MTNB 2QXGA 2FYQA 1WAYB 2FLBH 2XTTB 4FUBA 4DJZB 4M7GA 1Y5BT 4E7NA 3M5MA 1GMDG 2F9VA 1HAZB 5A8ZA 2XC0A 1N8OC 2CJIA 2FOBA 3HKJB 3KGPA 3KCGH 3SUGA 1FIZA 3P8OA 5LPFA 1TNIA 1P2JA 1WTGH 4UDWH 3SU0A 1RIWC 1XUKA 1F0RA 1LPGB 4AGKA 2C3SA 1J16A 4A6LA 1FPCH 1NRPH 3F1SB 2V6NA 2D26C 1G2MA 2ZGCA 3Q3YA 2EA3A 1IQJA 1OWIA 4Q7ZA 1BTWA 2BB4A 4A92A 4GHQA 3MO6A 1D6WA 1ETRH 3DT0H 4Y0ZE 4VGCB 4J1YA 1K1PA 3TJNA 2VB0A 3SU6A 2QIQA 3FP8E 3LIWA 1LVOA 3F9FA 1BZXE 1CHGA 1CVWH 1DWCH 1O5EH 2HPPH 1TWXB 3LGTA 1C5MD 2TBSA 4ABIA 3BTKE 1FY4A 4HZHA 4ABAA 2QCYA 4BXWA 4YLUA 1L4ZA 3ZVAA 1AVWA 1LCYA 2F3CE 2BVRH 1OWDA 2FI5E 2I6QA 1J14A 1S84A 1NT1A 5DP9A 4GUXA 2WPHS 2GCHG 4ZXYH 8GCHF 3A8DA 1ZRKA 1SL3A 1EAWA 2HOBA 5FBIA 1EP5A 1BHXB 1C2IA 3M7UA 3BSQA 4IN2A 1YC0A 4K1SA 3UFAA 2VVVA 3U8RH 2XBVA 3UNQA 1BHXF 4Y8ZA 1V2MT 4TPIZ 1T8MA 2ILNA 4BOHA 1FONA 4K1TA 1ARCA 4X8UH 2TIOA 1DXPA 1WUNH 1TBQH 5BRRE 4AG2A 1QFKH 3LGIA 3SJ8A 5A8XA 4X2XA 1WQSA 3RXMA 3M36A 2PKSC 2QGRA 4LOYH 4DT7B 1QR3E 2SNWA 3DFLA 4Y11E 2ZDLA 4IN1A 4UEHH 1O2KA 1HXEH 3BTWE 3R3GB 3P70B 2ZHQH 3B23B 1HJ8A 1O5DH 1TOCB 4YOIA 1ZLRA 1G3BA 1XVMA 4MLFB 2GD4B 1L2EA 1ORFA 1QY6A 1IQNA 1LPZB 3URCA 4NZLA 3RLWH 3UOPA 1AWFH 1TMBH 1O3PB 2XBYA 4CRFA 3D62A 3UQOA 4FU8A 1W0YH 4AFZA 4X0WU 3E8LA 2PUQH 4YZUA 5DP7A 1GBBA 4AGJA 5TCAA 1QCPA 1G37A 3QO6A 1S5SA 1TFXA 5DP3A 1E35B 1AN1E 2CF8H 2W26A 5ETXA 1HFDA 4CREA 4ZKNU 1GI0A 1P9SA 5JB9S 5DO4H 3RDZA 1D9IA 2VVCA 3K6YA 4J2YB 1SGRE 4D8NA 2W3IA 1GJ9B 3FANA 1BBRH 5IYTA 7GCHF 2AIQA 3NWUA 1K2I1 1NRRH 1ZTKA 4K69A 5C20A 4WY3A 1MKWH 1ACBE 1OPHB 2F9NA 1P04A 3BTTE 2G8TA 2GKVE 1C1PA 1IQFA 1RS0A 4AB8A 1QRXA 2OC7A 3GDUA 2ZGBH 3TNTA 1O2MA 2OBOA 2Y7XA 9ESTA 3SU2A 5EXLA 2NU0E 4Y8XA 1CGHA 2FX6A 2BLQA 4X2YA 2O8UA 1WSSH 1ETSH 3U69H 2BDHA 3RXJA 1EZQA 2GZ7A 5FPTA 1DOJA 3SNEA 4AFSA 1UK2A 4DG4A 1SGPE 3PO1B 3ZZ7A 3OY5U 1PYTD 2FPZA 2VGCC 3QGJA 1TBRH 3V3MA 5LPEA 5DK1A 1YPGH 2FI3E 2GVFA 3TJVA 3UR6A 5C1XA 1QB9A 3RC5A 3C27B 2C8XB 4AYYB 1A61H 4WMDA 2WPLS 2BD7A 1K1IA 3H5CB 1E37B 1L1JA 1O2TA 4IC5A 1O3NA 3GCOA 5PTPA 1H9HE 1DFPA 1F0SA 1QURH 2NU2E 2Y5FA 2VIQA 4K2YA 4BTTB 1Z8IB 1G9IE 2BLOA 1C5TA 2EI8A 2TGTA 1BB0B 2A7CA 4SGAE 2G5NA 2G5VA 3MU8A 2NU1E 1EAUA 2H5CA 4NA7A 5GJ4B 1GI9B 4YT7H 5HYOA 3IG6B 1NTPA 2AGEX 3AASA 1BBRK 2R0KA 4AZ2B 1DSTA 5EPNA 2SNVA 2BQWB 1SLXB 4JK5A 1KLJH 1E38B 1GGDB 1GI7B 1OWEA 3Q76A 3UNRA 1IQMA 1NRSH 1K1OA 1C1TA 4MTBA 3I77A 4OGYA 1PQAA 1JXPA 1JMOH 4CH2B 1UTOA 4YO9A 2AS9A 1KYNA 1QGFA 2G81E 3CENA 5EQQA 2TGDA 1ZMLA 1HAHH 4H6SB 5JBAS 5JBCS 5JDUB 1UHBB 4AFUA 1J17T 1HAVA 1E0FD 2BDCA 5EXNA 4CHAC 1KTSB 5A2MH 1QBVH 3TIUA 1F0UA 1AGJA 1CSOE 3M5NA 3GY5A 1GBMA 1AE8H 3UREA 4K8BA 5A09A 4U2WA 3KEEA 3MNCA 3B8JA 2CXVA 4BTIB 1HAOH 3W94A 2Y82A 1HAIH 3MU1A 1GL1A 4SGBE 3T5FH 1KXCA 1XKBC 1P2NA 1FN8A 2OCVB 3NKKA 4X1QU 4DOQA 1GCTC 2BD8A 5C67A 3PLPA 5L6NH 4AYVB 2GT7A 1YCPM 2VIVA 2ZU4A 1VCQA 1PQ8A 4O9VA 3M7TA 5SGAE 1P01A 3D65E 5A0AE 1Q2WA 2ZIQH 1FY1A 4B2CA 1QHRB 2UUKB 1C4V2 3ODFA 2FDAA 5K7RA 3Q3KA 4NIXA 1Z1IA 1A2CH 1TIOA 2H9TH 3RUOA 3PTNA 2WV5A 4FUHA 1NPMA 1AB9C 1ELDE 2FODA 1CE5A 5FXLA 3V12A 2AMPA 3TK9A 4X1RU 4HI3A 4MQAA 2P3TB 3MFJA 3SGBE 1GG6B 5EQRA 1QIXB 3P92A 2FOCA 2A5KA 3P95A 1YPLH 2F9PA
chains in the Genus database with same CATH superfamily
1QTFA 3QN7A 3EA7A 2XXLA 1XXFA 3LKWA 4MDSA 1LO6A 4I86A 4INLA 4ZKSU 1D6RA 1QL9A 1K9OE 3SO3A 4I8JA 2ZDNA 1GJBB 3PYHA 1O3AA 1SVPA 1C2LA 1XM1A 1VR1H 2OQ5A 2Z9IA 3T27A 1KDQB 3WWBA 1DLKB 3L33A 2STBE 3UY9A 2ZC9H 2FOHA 4B76A 2YNAA 4CH8B 3OX7U 1AFQC 3TJUA 3HK3B 3PB1E 4VGCC 4A5TS 2BY8X 1AUTC 2J2UA 1V2VT 2QF5A 3BTEE 2KM0A 3GCTG 1IHSH 3QK1A 4BAHB 2NWNA 3VB3A 1GBFA 1O2QA 2STAE 4UFFH 2WUCA 1O3JA 3BG4C 1GDQA 3PRBA 2Y5HA 4B71A 2ZGXH 2WV9A 2A7JA 3A86A 3ZZCA 3RXFA 1UTNA 4LXBH 2VIOA 3SOSA 2ZZUH 1OP0A 5EG4A 5E2OA 7LPRA 5T1VA 1QJ7B 4FVBA 4ZXXH 1ZPZA 3RXAA 3UUZA 1C5LH 4IC6A 1TONA 1DWDH 4GCHG 2SGAA 3QTVH 1G3DA 3VB4A 2G55A 6ESTA 3I29A 4E06H 1O2IA 3SW2B 3F68H 4A1VA 2ZDMA 4RT1A 3BTFE 3DFJA 2WV4A 4I7YH 1HJ9A 1IQKA 1ESTA 3RMMH 3GOVB 2XYAA 3GISB 1GI3A 3UIRA 2GV7A 3BIVH 4Q4LA 1WBGB 2FYRA 2V0BA 3F9HA 1GI2A 3PM3A 2P93A 4I32A 3E1XB 4B74A 1ELTA 4MNWA 1NU9A 2UWLA 2XWBI 2UUFB 3TH2H 2FOEA 2HGTH 3UTUH 1GHBF 1HIAA 1MCVA 3PV2A 1AU8A 3ATLA 5HXFA 2A32A 1DWBH 1NC6A 4UD9H 1TRMA 1FAXA 1V2LT 1EP6A 4JYTA 4ABDA 2G4TA 3KF2A 2ZA5A 4R8TB 2GJGA 1V2UT 1XUIA 5CE1A 1AVGH 1XUGA 2KX4A 2C93B 3H7OA 1OS8A 1T32A 1TNHA 1BRCE 3SQEE 2BOKA 1TGNA 3RXEA 1KDQA 1BA8B 3NUMA 5AHGH 1UTQA 1O3MA 1ZTJA 3QX5H 4NIVA 4OS5A 4OM9A 4X6OA 1YP9A 4JZEH 4Z0KA 2HLDD 1J9CH 1SC8U 3SJ9A 4TYDA 4ZMAH 2ZGHA 5JBBS 3SGQE 5CHAB 1P02A 1PPFE 3SJIA 5FCKA 8ESTE 4Q7YA 3AVZA 1SQTA 1MU6B 1XMNB 4YM9A 1AZ8A 1GHYH 2ZDAH 3V0XA 1PPHE 1UVUH 1AUJA 5EQSA 1AFEH 2HWLB 2PGBB 5DP6A 3VGCB 1BDAA 1P09A 4ABBA 2J34A 1AIXH 3M3VA 4XBCA 5F8ZA 2AMQA 2VWLA 1FY5A 3HK6B 4NZQA 2EY4C 1O33A 3CP7A 4KTSA 4ISOA 1DM4B 2QXHA 3PMHB 2D8WA 5J4QA 3NXPA 3GY8A 4Q7XA 4XOJA 3ZZ8A 1T8NA 4Y8YA 3BTHE 2Z6BD 5GXPA 2ZQ1A 5EW1H 5AF9H 2GCTB 1QRZA 1SGTA 5HKKD 2FOFA 1C4U2 1QJ1B 3O8RA 1SGDE 1L1NA 4WWYA 1AMHA 2C8WB 1F7ZA 2HLCA 2LELA 1P05A 1BRUP 4X1NU 3RXLA 2BY6X 2DE8A 1XUJA 3HGPA 3QTOH 1EASA 4WF8A 1K1MA 1KXDA 4K8YA 1GHVH 1GJ4H 3RXQA 1O2UA 2ODPA 2BDGA 1EZSC 3VPKA 3RXTA 2WHXA 1VGCB 4WH6A 2BD2A 2Z3DA 2YOLA 3DSOA 1TB6H 2BX4A 1W0JD 1PYTC 3EA8A 2JKHA 1ANDA 2V3HH 2F9OA 3RXGA 1MQ5A 1B0FA 2NU4E 1SSXA 1S82A 4AN7A 1LHFH 1EJAA 2QE7D 3EQ0H 1NS3A 2IN2A 3M5LA 5AFZH 1HYLA 3ZZ6A 1GJ8B 5F8TA 5GPIB 3E6PH 6CHAB 1G2LA 5I46H 1GMCF 1Z6EA 1S81A 3EGKH 1CHOG 1AVXA 1OOKB 4AOQA 3R0FA 1V2ST 1ZHMA 4IBLH 4I8HA 4X8SH 4RKOB 1HIAB 1EPTC 1O2PA 1VITF 4YLQH 3EBNA 1BTZA 1NO9H 5FCRA 2GX4A 1GMDF 2A4QA 1ZMJA 2K7XA 1TNKA 3OTJE 1GI8B 2DUCA 4OS2A 1GMHF 1TPPA 4D7GA 3QZRA 3ZZDA 3IITA 1CO7E 1C2FA 3GY3A 3RXRA 1VITH 2GCHF 3MH5A 2HVXA 2OK5A 2ZFTA 2ALPA 1BRBE 1SLVB 1HGTH 3PROA 3S69A 1O3GA 2VINA 3MH6A 3PLBA 1SR5C 3ATIA 4RSPA 1DLEA 1PPBH 5F03A 4MNYA 2TGAA 1F0TA 1UTLM 2BX3A 2TPIZ 1MBQA 1TMTH 1GI1A 1COWD 1YKTA 1GJ5H 1NU7B 2J9NA 3L3TA 2ODQA 2FTLE 1OYTH 3SV8A 3K9XB 1B5GH 2A45B 4ABEA 2VU8E 5C94A 1WYKA 1S6HA 1Y3WA 4R0IA 3ITIA 4CRCA 2UUYA 2UUJB 3RXKA 3SNCA 1S0QA 1Z8JB 3HGNA 5C1YA 1BQYA 2KFWA 3QUMP 2C8ZB 4U01A 1KMHB 1W0ZU 3QZQA 2BD5A 1AE5A 2YMSD 1SGQE 3V13A 2Q6GA 2A1DB 2BQ6B 5CHAC 4CRGA 1UTKA 3OEHD 3BTGE 5A0CA 1QZ8A 2K1QA 2KAIA 3DD2H 1GBLA 1V2NT 1MTSA 5IK2D 4WXVA 3A87A 3WY8A 1YPHC 1TBZH 4WMFA 1AZZA 1L1GA 1SGFG 3PO1C 1ETTH 1O39A 4RKJB 4YTAA 3OU0A 2AYWA 2ZPSA 4D9RA 1UO6A 4HG6A 2OD3B 2P94A 2RG3A 3MTYA 1VCWA 2BLVA 2OUAA 3RU4E 1C5ZB 2OTVA 1UTJA 1TGTA 3NZIA 2CHAC 2WYJA 1FXYA 3SZNA 1FIWA 3A89A 3AAUA 2FLRH 4ZHLU 2FOAA 5EJ1A 3A8BA 1AWHB 1SGEE 4O3TA 1O2XA 2A5AA 1FZZA 2KAIB 1KLIH 1SMFE 2QF3A 1L0ZA 1QA7A 2BDIA 4Y71A 2BOHB 1SOTA 4Q2KA 3SORA 1JOUB 1ZGVA 1GMHG 1P8VC 1FY8E 1TNJA 1PPGE 3SU4A 2A31A 5CMXH 6GCHG 3F9EA 1LTOA 3N7DA 1W7GH 2QA9E 2XC4A 4NA8A 4OGXA 4BTUB 1T31A 2BD3A 4IGDA 1TMUH 1Y3UA 4NFEA 3RMLH 4MPUA 1GBAA 4B6FA 2R3UA 1Z7KA 1RD3B 1C9TA 2OQUA 3ZYDA 2V3MA 2FZZA 1O5FH 2VBCA 2BDAA 4THNH 3A81A 1GHZA 2XC5A 2V7QD 5GNDA 3ODDA 1HJAC 4CBNA 1NFXA 1W12U 1GHWH 2IOTA 2Q6DA 3ZZBA 4HGCA 3LDXH 2VJ1A 3VB7A 2ZECA 4INHA 4E05H 3CS0A 1DE7H 1C5QA 3D49H 4I8GA 2SGFE 3W95A 2GDDA 3JZ1B 2LIZA 1GG6C 4KTUA 7KMEH 1EQ9A 1AFQB 1PPCE 1WCZA 1J15A 2BHGA 2GT8A 4HFPB 1HPGA 1BMLA 3RXDA 2R2WU 5G4BA 4MPWA 1O3CA 1OP8A 3KQEA 1JRTA 4ZCNA 1LHCH 1ANEA 2JETC 1C1RA 4UFDH 2P8OB 1YBWA 1HRTH 1AKSA 3FFGA 1EZUC 1B7XB 1DANH 3GDSA 5AFYH 2BD4A 1P06A 1W0KD 1A0JA 1MBMA 3A83A 4NSYA 2VWMA 1CQQA 3F2GA 2RA0A 1Y5AT 2HNTE 1THRH 1ESAA 3GYLB 1P0SH 3SI3H 1YM0A 1C2KA 1IQIA 1TNLA 2FOGA 4ISNA 5T6GA 3F9GA 1V2PT 1GI6A 1NFWA 5ESTE 1SGIB 3E3TA 4Q63A 1ANBA 1GI4A 1FNIA 1GJCB 2BVSH 4QT8C 3A84A 5DP4A 5A8YA 4ZHMU 4Y0YE 2Z9JA 1O5GH 2B7DH 1TGCA 3OFND 3S7HB 4CR5A 1O3EA 4JZDH 2GMTB 3RXPA 2BXTH 4Y7BA 2AFQB 4ACAA 4I33A 3U9AH 4Y10E 1VZQH 3ZVBA 1INCA 2FOMB 4Y7AA 1O2SA 5FL7D 2HPQH 3OTPA 1O32A 1FJSA 1EKBB 2ZO3H 3EE0B 1P3EA 1P9UA 1YPHE 4ZKRU 1A5GH 2O8LA 3RM0H 3SHCH 1AHTH 1T4UH 1RJXB 2WPKS 3LJOA 3M37A 1QJ6B 1O0DH 2FIRH 2XW9A 2Z3EA 2Z7FE 3KQBA 1EX3A 1P57B 4U30A 1YCPK 1TA6A 3T2NA 3S0NA 1V2KT 2G52A 2VIDA 4X1SU 1O3OA 3ATWA 1LMWB 1Q3XA 1QBNA 1C1VH 3FN8A 3D23A 1QL8A 1C1MA 3MU5A 3NCLA 2ZI2H 1K28D 1EFRD 4H42U 5B6OA 2Y5GA 3LH1A 2ZF0H 1BMFD 3GYMA 3GY2A 3PV4A 4NG9H 5GCHG 4A1TA 1BT7A 4ISLA 2A2XH 2K0QA 1G30B 1MD8A 1FV9A 1V2TT 2AGIX 1MTNC 1GGDC 3ZVCA 1O5CB 3U8OH 4AORA 1TYNA 3TK6A 3EDXB 4X6MA 3A82A 2BXUH 3BEFB 2THFB 1C1OA 4CRAA 3LH3A 5F53A 2ZDKA 1SQRA 3RC6A 1IQHA 1SGFA 5HMAA 3A8AA 2Z9LA 3L6PA 4FU9A 3KHVA 4JCNA 1WDIA 3SV6A 1F2SE 3UWJH 4MPXA 3VB6A 1W14U 2IJD1 2OC1A 1TQ7B 2ZEBA 2CN0H 1Z1JA 3K65B 1ZJDA 3A7VA 2XCNA 1UK3A 1NFYA 3SJKA 1JRSA 1QB6A 1QB1A 1DY9A 2QN5T 3M7QA 1BJUA 3MU0A 1ABIH 4ABHA 1GJ7B 1SPJA 2ZHWH 3O8CA 3TPIZ 2AERH 1V3XA 2F83A 1SG8B 1C1WH 4GAWA 1A46H 3N99A 2OLGA 5HM9A 1FPHH 1GDNA 2GP9B 2R3YA 5DN6D 1PJPA 1Q31A 3WW7A 3MQKC 1FN6A 2PV9B 4UFEH 5DPAA 1NBMD 3UAIC 1GJDB 1YY3A 4DURA 3ATKA 1O2JA 1BOQA 3KYGA 2J92A 2FS8A 1N6YA 5E8EH 5GWZA 5C1UA 1DUAA 1DWEH 2QF0A 5JPMH 5LPRA 2FX4A 1HNEE 3TU7H 2VWOA 1O3LA 3S9BA 9LPRA 3TGIE 1CGIE 3SBKA 2P3FH 3AW1A 3AAVA 1LHEH 3STIA 3H7TA 1UMAH 5KEDA 1Z8RA 1RRKA 3RLYH 3RMOH 2H9EH 3JZ2B 2BDYA 2JH0D 3LC3A 2A7HA 3UQVA 4ESTE 1NBME 1UVPA 2BY5X 5EODA 1LVBA 3DUXH 1BRAA 1ELBA 4ZUHA 1HUTH 3BEIB 2P3UB 1RTLA 1UJ1A 4KGAA 2H5DA 1QA0A 1X7AC 4I8LA 3SUDA 3TGKE 1IHTH 2ZCHP 3KIDU 1CHOF 4LK4A 1GVKB 1MTWA 1O2VA 2BZAA 3LOXA 5DP8A 1C5VA 2Q1JA 3SNAA 3ZYEA 1D3TB 3MU4A 5KECA 1GWAA 1T8LA 5DG6A 1V2QT 5T6DA 2G4UA 4YT6H 3MO3A 2HALA 1OKXA 1ELFA 1A0LA 2KZ4A 5FPSA 1A5HA 1H9IE 3URDA 1V2OT 1C9PA 3SYJA 1EXFA 4A1XA 1YGCH 2BDBA 3HATH 4Z6AH 2ZFPH 1DSUA 3VG8A 4RN6A 4IMQA 3PRDA 5DP5A 3GY6A 1BTUA 1V6DA 2LPRA 4BAMB 1P12E 4BXSA 8GCHG 1LVYA 1C4Y2 1YCPH 3VXEH 1C1QA 4NIWA 2WPMS 1EUFA 1GVLA 3GICB 4DGJA 1O2YA 3RXVA 1XUFA 1VITG 3SU1A 2GCTC 4O97A 1YPJH 3FP7E 4F4OC 2PFEA 1THPB 3ZVFA 2PSXA 2F9UA 5I25A 4FXGH 5JYIA 4FETA 4JMYA 3VFEA 1C2DA 1SGNE 1UCYH 2SGQE 3N7EA 2JETB 2HNTC 1VGCC 1O3HA 3GDVA 1BTPA 3ZVEA 3VB5A 1TLDA 1A4WH 1T8OA 1YYY1 3AW0A 2FXRA 3ZZ4A 5E0GA 4Q80A 4LZ1H 1KTTB 1PPEE 4D7FA 1O36A 1ZZZA 1MABB 4NGAH 2WYGA 4ABGA 4DCDA 1HAVB 5JBTA 2FEQH 2PWXA 1ZR0A 4ZKOU 1ZOMA 3U1JB 5FAHA 2SGPE 1MKXH 1O38A 3EAJA 1A3EH 4IS5A 6GCHF 1MTVA 4XE4A 3ZZAA 2V35A 1VJ9U 1ZJKA 2JH5D 4WJG2 4X2VA 4CRBA 1AD8H 1C5PA 3A88A 2ALVA 1LDTT 2Z9GA 2ANKH 2L74A 3PMBB 1FUJA 3BTQE 1C2JA 2CMYA 2F4LA 3KNXA 3F6UH 2ZNKH 2GDEH 1ELAA 3RXCA 2CGAA 1E34B 1O34A 5T6FA 1TX7A 3GY4A 4IW4E 3FKSD 2V3OH 1V2RT 2P95A 1THSH 4MVNA 7ESTE 2O8MA 3UNSA 2FI4E 1O3BA 4YOGA 4DW2U 1ZSJA 3LC5A 3M5OA 4BAOB 1DX5M 1UTMA 1E79D 2QYIA 2WINI 1ZHRA 2F91A 4P02A 3LU9B 4KTCA 1WOFA 3S9CA 1AQ7A 1YLCA 1OXGA 1ARBA 1XKAC 4I31A 1C2HA 1D3DB 3B9FH 1GPZA 1OSSA 3SJOA 2PTNA 4XFQA 4OS6A 4UFGH 2QXJA 1ZPBA 3SNDA 3LJJA 1IOEA 3VEQB 1EATA 1WQVH 1SLWB 1FDPA 1XUHA 3A8CA 1AI8H 1K22H 3RXHA 1G3EA 1JBUH 4NSVA 1O2OA 7GCHG 1P2OA 1SFIA 1DICA 4B75A 1CBWB 3U1IB 2A2QH 3H09A 2OXSA 3E16B 1W7XH 1GBTA 2C4FH 1BMMH 3T62A 1CT0E 1SGYE 2KCPA 3LONA 2WPJS 3Q00A 5J4SA 5C17A 1C5XB 2FESH 2GZ8A 1NFUA 4Y76A 1DXWA 1WTHD 3P8FA 1IQGA 4KKDA 2Y6TA 3RU4D 1FLEE 4ZHAA 2SGDE 4AFQA 1BTHH 1HAXB 3BTME 3GCNA 1UVTH 1CA0B 3SUFA 1C2EA 3TNSA 1OWHA 3BG4B 2Z94A 2HNTF 3T29A 1TGSZ 1NROH 2IPHA 1VJAU 2OC8A 3MNBA 1G36A 5ABWA 1ZHPA 1S85A 3FOAA 2FMJA 5BPEA 1GBHA 2XRCA 5FX5A 4B2BA 1MZAA 4DIHH 1P2MA 2M2AA 1C5OH 2WPDD 1TPOA 2W7UA 4WMEA 1UVSH 1O3DA 5CHBA 4FU7A 3WWFA 2ZDVH 1TOMH 3ZIAD 2PHBA 5GDSH 3MOCA 2VIWA 5T3HA 1C5YB 4WXIA 1KXAA 1IQLA 1ZPCA 1UTPA 4NCYA 3FAOA 4X6NA 2ZHEH 1O2HA 1HAPH 2ZWLH 3RXOA 1UW7A 2QXIA 3TK5A 3MNSA 3PV5A 1ZRBA 2PLXA 1SQAA 3F0OA 1Z71A 3IWMA 2ZFFH 1BIOA 2PKAB 2VVUA 1TPAE 2ZTZA 3SV9A 1YPKH 1MU8B 3SNBA 2XNIA 3A7ZA 1Y8TA 1AY6H 1OWJA 4MPVA 5H4IB 4BNRA 3BG8A 1P11E 2RA3A 2PTCE 2J4IA 2ZTYA 2SGEE 2B5TB 1ZYOA 1UCYE 2ZFRH 3K2UA 2BY7X 4X8VH 2CV3A 1TE0A 4DY7B 4TWYA 4JYVH 1AKSB 1GBIA 3ELAH 3Q77A 4JK6A 1KXBA 4CRDA 2A0QB 3FVFB 1LQDB 2JJ1D 1TPSA 1C5UA 4I8KA 1MKXK 2CF9H 1SHYA 1TRYA 2YMSB 3RMNH 2Y7ZA 5LGOA 1ZTLA 4A7IB 5GCHF 3QDZB 1YF4A 1KSNA 1GJ6A 2DE9A 3HKIB 2Y80A 4OS7A 2HVYB 4KELA 3TITA 1FMGA 2J38A 1NM6A 3RU4T 1PFXC 4GSOA 1ESBA 2J94A 3LGWA 1N1LA 1EPTB 3QLPH 5E0JA 5FX6A 3GS9A 3DHKH 3PMJA 3PTBA 3MHWU 4JZ1A 1C1UH 2P16A 4TSFD 5AVDA 1NRNH 2WUBA 5C5NA 3GCHB 2BY9X 1DY8A 1MQ6A 1EAIA 1T7CA 1UVOA 4B73A 2J98A 4IMZA 4XSKU 1HJAB 3ZV9A 3A7XA 1VCPA 4TWWA 1DVAH 2XBWA 4FVDA 2ODYB 1W13U 3EE7A 3F0PA 4ISHH 1O3KA 1K1NA 2ULLA 1LKBA 3W1EA 4YXWD 4FUFA 1Z8GA 2PW8H 1LHGH 1EOJA 1QQUA 3E0NB 3ENSB 4F49A 2PKAA 3DA9B 4ISIH 2ZPRA 3UR9A 3GCHC 3FZDA 1EAXA 2RDLA 1O35A 1QBOA 5EU8A 2G00A 1C5RA 2B8OH 2GMTC 4Y79A 4FUJA 2XBXA 5A0BA 1FAKH 2A5IA 3RC4A 4X2WA 2C90B 3A7TA 3HPTB 1SLUB 3I78A 3P8NA 3ZVGA 2WPIS 2Q6FA 4FUIA 4YESB 1OX1A 8KME2 2HRVA 1CGJE 1GDUA 2ZFSA 1AB9B 3LT3A 3C1KA 3RP2A 4XBBA 2JH6D 4PROA 2ZHDA 3VXFH 3FP6E 2VH6A 2QC2A 1UK4A 4GLYA 1KY9A 1P10A 3ZZ3A 2R2MB 1H1BA 5EJLA 3SQHE 2A4GA 1U6QA 1IAUA 2F9BH 1O5AB 2ZHFH 2VH0A 2W5EA 3CS7A 1NESE 3MYWA 2A4RA 4B6EA 2A4OA 2P8OC 1T4VH 1DT2A 2NU3E 1JWTA 3LGVA 1XX9A 1YLDA 5L30H 4KP0A 1CU1A 2RCEA 2BTCE 1Y3XA 4AB9A 1YPMH 2BZ6H 1GBKA 1MZDA 1ZMNA 5K0HA 1EB1H 1HDTH 2AGGX 1MTUA 2JJ2D 1ID5H 1KLTA 3ESTA 1MAXA 2SFAA 1BTYA 1DITH 2J98B 3FO8D 4ASHA 6LPRA 1RFNA 3TJOA 4MNXA 4OS4A 3SUEA 3T26A 1LHDH 4NWKA 1C2GA 4DT4A 4X8TH 1MKWK 1MUEB 2F43B 1MCTA 3ZZ5A 1P2KA 2FO9A 4ZAEA 2BVXH 2C8YB 1AO5A 2QV1A 3MNXA 5TJXA 1D3PB 3SGAE 1CA8B 1GHAG 1F5KU 1SGCA 1ZSLA 4FUGA 1W2KH 2AMDA 2PSYA 3MMGA 1J8AA 1O3FA 2ZQ2A 3MH4A 3LPRA 1IQEA 1TQ0B 1HBTH 1TAWA 1N6XA 4ABFA 1W11U 1ELGA 1KXEA 3TLOA 5TCCA 1QNJA 1GBJA 3GCTF 1K0HA 1L4DA 1O2ZA 2ZU5A 1F5RA 3OY6U 5FPYA 2BM2A 3RXSA 2ANMH 1ABJH 1MMJN 3KL6A 2ANYA 1CT4E 3A80A 4NIYA 3LGYA 2FWWA 3P6ZB 4B1TA 3K6ZA 2J95A 1BUIA 1XXDA 5GIBA 3S7KB 5HIYA 1GBEA 4WVPE 4E7RG 3UWIA 1V2JT 2BMGB 3DSGA 1BITA 1NY22 3UB0A 4UONA 1LPKB 1CT2E 3A85A 1BMAA 2FS9A 3TGJE 1O5BB 4ZROA 2XNDD 1O2NA 3STJA 3OYPA 3T28A 2ESTE 3BTDE 1C2MA 3P8GA 1ELEE 4UE7H 4RT0A 4ZH8A 3PMAB 1ANCA 1GBCA 1FQ3A 1PQ7A 4FUDA 2P59A 1G3CA 3UPEA 2EI7A 1HXFH 2QY0B 5EXMA 2GGVB 3SN8A 2Z9KA 1HB0B 2B9LA 1ZGIA 1RGQA 4Y6DA 4HTCH 1GHAF 4XDEA 1C5WB 2Z3CA 3ZVDA 1NZQH 2D1JA 2H6MA 3M3SA 1ZSKA 4D9QA 2M5TA 1GI5A 3ZV8A 1OHHD 2PGQB 1S0RA 1OWKA 4K5ZA 1C5SA 1EB2A 1FY3A 2XOKD 3RXUA 8LPRA 2R9PA 1RXPA 1P3CA 2FP7B 3GY7A 2OBQA 5C3NA 3T25A 2ZGJA 3UOUA 5C2ZA 1O37A 2BD9A 3RM2H 1QQ4A 4ABJA 1Y3YA 2ZG0H 2O9QA 2PKSB 5JB8S 1H9LB 1JIMA 3OAAD 3RXIA 2D2DA 2UWPA 3BIUH 4O03A 4B2AA 3SV7A 2LNCA 1A0HB 4BAKB 1A3BH 2H2ZA 1E1RD 3SU5A 2EI6A 1BMNH 4K60A 1PQ5A 1UHBA 4U32A 4XBDA 1O2RA 4FUEA 1GCTB 2H1UA 2KCAA 3A7WA 2AEIH 1MH0A 1DPOA 3SV2H 3OSYA 2FTMA 1QRWA 5KGOA 1PPZA 5F6MA 1BCUH 1TRNA 2EEKA 6CHAC 1H4WA 1JIRA 4O3UA 2XCFA 3F2HA 4H4FA 2RFKC 4NWLA 1GCDA 5FBEA 3QWCH 4AG1A 3SHAH 3QGNB 1NN6A 1F92A 1KIGH 2OC0A 3U98H 3E91A 5HM2A 2FM2A 1BTXA 2GZ9A 1TALA 2W3KA 3EA9A 1O30A 1SQOA 4CHAB 1A1RA 1LQEA 2O8WA 5L2YH 1QL7A 3BEUA 4JZFH 4M9FA 3TVJB 3KQDA 1SKYE 3Q3XA 1TA2A 2ZU3A 1O31A 2VIPA 3TH3H 2KR7A 1K1LA 1O2GH 3A7YA 1TX6A 1BJVA 3PLKA 3PWCA 1KXFA 1LKAA 2QAAA 1K1JA 2PUXB 3RXBA 4BANB 2ZPQA 2UWOA 1GL0E 1DS2E 1K21H 1SFQB 3MI4A 1Y5UT 1W3CA 1YPEH 3M61U 2K8IA 3FZZA 2ZU1A 1P03A 1O3IA 2W7SA 2PP6A 3KQCA 3SU3A 1EPTA 2H9HA 5FHTA 3E90B 4NFFA 1A5IA 1ELVA 4GCHF 4H6TA 3N7OA 4DVAU 5L2ZH 1N8OB 1EZXC 1OYQA 1SB1H 1H8ED 3KN2A 1HLTH 4CR9A 3U8TH 1H8IH 1H8DH 1GJAB 1TGBA 1HV7A 2O8TA 2AIPA 1EJMA 2VWNA 3VGCC 2YNBA 2OP9A 4TPYA 2CHAB 4AX9H 3P17H 1TX8A 2LP6A 2GTBA 3DCLA 2ZFQH 1O2WA 1S83A 2R0LA 3NPSA 3SI4H 1C1NA 1C5NH 1OP2A 5EPYA 4DIIH 3BF6H 2I6SA 4BAQB 1MD7A 5EGMA 1C1SA 5EJZA 2VGCB 4GVUA 3ZZ9A 4OS1A 4XRNA 1W10U 4MNVA 1V2WT 2TRMA 4MG3A 3MO9A 4GPGA 1MAYA 2ZCKP 4TY7A 4JZIA 1RTKA 2ZCLP 1H8HD 4LZ4B 4X6PA 4INKA 1DUEA 1D3QB 1SOZA 3BV9B 1RIWB 2OINA 2ZU2A 4CBOA 4D76A 2XWAA 1D4PB 1WU1A 1RTFB 4NA9H 5EOKA 5DJ7A 3TH4H 3NK8A 3MH7A 1W8BH 1DDJA 2Y81A 3PWBA 2BLWA 4YOJA 2TGPZ 5E2PA 5C0UA 1F5LA 2JIZD 2BYAX 4XD7D 2B0FA 1Y59T 3ATMA 4GHTA 4JYUH 3V7TA 1TABE 3G01A 1B0EA 1HAGE 1CBWC 1GVZA 1A7SA 4K1EA 2ZP0H 4TY6A 5ESBA 1LVMA 5LH8A 3BN9A 2IJOB 3MWIU 1CA0C 3M35A 3LGUA 2BQ7B 1E36B 1G32B 1XVOA 4K3JA 3M3TA 1SBWA 1EJNA 1M9UA 5IDKA 5HGGA 3E0PB 1HCGA 1P2QA 5DKMA 1GHBG 2ZKSA 3EYDA 1GBDA 5EW2H 1FI8A 1P2IA 4TT3D 3O8DA 2G51A 1UCYK 1SI5H 2EC9H 2ANWA 4WH8A 1SHHB 3O8BA 1BBRE 1EOLA 1NRQH 5DGJA 1HAYB 5F8XA 4X1PU 2GV6A 1Z6JH 1Y3VA 1TNGA 1WV7H 2AH4X 2PR3A 2VNTA 1S6LA 3OE7D 1ELCA 5C5OA 3S9AA 1S6FA 1GHXH 1GMCG 2ASUB 4FUCA 5E0HA 2ZTXA 1O2LA 1MTNB 2QXGA 4P00A 2FYQA 1WAYB 2FLBH 2XTTB 4FUBA 4DJZB 4M7GA 1Y5BT 4E7NA 3NRLA 3M5MA 1GMDG 4AC9A 2F9VA 1HAZB 5A8ZA 2XC0A 1N8OC 2CJIA 2FOBA 3HKJB 3KGPA 3KCGH 3SUGA 1FIZA 3P8OA 5LPFA 1TNIA 1P2JA 1WTGH 4UDWH 3SU0A 1RIWC 1XUKA 1F0RA 1LPGB 4AGKA 2C3SA 1J16A 4A6LA 1FPCH 1NRPH 3F1SB 2V6NA 2KCOA 2D26C 1G2MA 2ZGCA 3Q3YA 2EA3A 1IQJA 1OWIA 4Q7ZA 1BTWA 2BB4A 4A92A 4GHQA 3MO6A 1D6WA 1ETRH 3DT0H 4Y0ZE 4VGCB 1FX0B 4J1YA 1K1PA 3TJNA 2VB0A 3SU6A 2QIQA 3FP8E 3LIWA 1LVOA 3F9FA 1BZXE 1CHGA 1CVWH 1DWCH 1O5EH 2HPPH 1TWXB 3LGTA 1C5MD 2TBSA 4ABIA 3BTKE 2J5UA 2IPQX 1FY4A 4HZHA 4ABAA 2QCYA 4BXWA 4YLUA 1L4ZA 3ZVAA 1AVWA 1LCYA 2F3CE 2BVRH 1OWDA 2KCYA 2FI5E 2I6QA 1J14A 1S84A 1NT1A 5DP9A 4GUXA 2WPHS 2GCHG 4ZXYH 5DSFA 8GCHF 3A8DA 1ZRKA 1SL3A 1EAWA 2HOBA 5FBIA 1EP5A 1BHXB 1C2IA 3M7UA 3BSQA 4IN2A 1YC0A 4K1SA 3UFAA 2VVVA 3DSPA 3U8RH 2XBVA 3UNQA 1BHXF 4Y8ZA 1V2MT 4TPIZ 1T8MA 2ILNA 4BOHA 1FONA 4K1TA 5C0TA 4RI0A 1ARCA 4X8UH 2TIOA 1DXPA 1E1QD 1WUNH 1TBQH 5BRRE 4AG2A 1YLNA 1QFKH 4F48B 3LGIA 3SJ8A 5A8XA 4X2XA 1WQSA 3RXMA 3M36A 2PKSC 2QGRA 4LOYH 4DT7B 1QR3E 2SNWA 3DFLA 4Y11E 2ZDLA 1WXRA 4IN1A 4UEHH 1O2KA 1HXEH 3BTWE 3R3GB 3P70B 2ZHQH 3B23B 1HJ8A 1O5DH 1TOCB 4YOIA 1ZLRA 1G3BA 1XVMA 4MLFB 3F2FA 2GD4B 1L2EA 1ORFA 1QY6A 1IQNA 2CK3D 1LPZB 3URCA 4NZLA 3RLWH 3UOPA 1AWFH 3SZEA 1TMBH 1O3PB 2XBYA 4CRFA 3D62A 3UQOA 4FU8A 1W0YH 4AFZA 4X0WU 3E8LA 2PUQH 4YZUA 5DP7A 1GBBA 4AGJA 5TCAA 4F55A 1QCPA 1G37A 3QO6A 1S5SA 1TFXA 5DP3A 1E35B 1AN1E 2CF8H 2WZQA 2W26A 5ETXA 1HFDA 4CREA 4ZKNU 1GI0A 1P9SA 5JB9S 5DO4H 3RDZA 4ASUD 1D9IA 2W6ID 2VVCA 3K6YA 4J2YB 1SGRE 4D8NA 2W3IA 1GJ9B 3FANA 1BBRH 5IYTA 7GCHF 2AIQA 3NWUA 1K2I1 1NRRH 1ZTKA 4K69A 5C20A 4WY3A 1MKWH 4FOUC 4Z1MD 1ACBE 1OPHB 2F9NA 1P04A 3BTTE 2EQNA 5HIZA 2G8TA 2GKVE 1C1PA 1IQFA 1RS0A 4AB8A 1QRXA 2OC7A 3GDUA 2ZGBH 3TNTA 1O2MA 2OBOA 2Y7XA 9ESTA 3SU2A 5EXLA 2NU0E 4Y8XA 1CGHA 2FX6A 2BLQA 4X2YA 2O8UA 1WSSH 1ETSH 3U69H 2BDHA 3RXJA 1EZQA 2GZ7A 5FPTA 1DOJA 3SNEA 4ACBA 4AFSA 1UK2A 4DG4A 1SGPE 3PO1B 3ZZ7A 3OY5U 1PYTD 2FPZA 2VGCC 3QGJA 1TBRH 3V3MA 5LPEA 5DK1A 1YPGH 2FI3E 2GVFA 3TJVA 1VKYA 3UR6A 5C1XA 1QB9A 3RC5A 3C27B 2C8XB 4AYYB 1A61H 4WMDA 2WPLS 2BD7A 1K1IA 3H5CB 1E37B 3F3BA 1L1JA 1O2TA 4IC5A 1O3NA 3GCOA 5PTPA 2W6JD 1H9HE 1DFPA 1F0SA 1QURH 2NU2E 2Y5FA 2VIQA 4K2YA 4BTTB 1Z8IB 1G9IE 2BLOA 1C5TA 2EI8A 2TGTA 1BB0B 2A7CA 4SGAE 2G5NA 2G5VA 3MU8A 2NU1E 1EAUA 2H5CA 4NA7A 5GJ4B 1GI9B 4YT7H 5HYOA 3AK5A 3IG6B 1NTPA 2AGEX 3AASA 1BBRK 2R0KA 4AZ2B 1DSTA 5EPNA 3KQ5A 3CNRA 2SNVA 1YWUA 2BQWB 1SLXB 4JK5A 1KLJH 1E38B 1GGDB 1GI7B 1OWEA 3Q76A 3UNRA 1IQMA 2J97A 1NRSH 1K1OA 1C1TA 4MTBA 3I77A 4OGYA 3U28C 1PQAA 1JXPA 1JMOH 4CH2B 1UTOA 4YO9A 2AS9A 1KYNA 1QGFA 2G81E 3CENA 5EQQA 2TGDA 1ZMLA 3KYFA 1HAHH 4H6SB 5JBAS 5JBCS 5JDUB 1UHBB 5CDFE 2AHME 5EIYA 4AFUA 1J17T 1HAVA 1E0FD 2BDCA 5EXNA 4CHAC 1KTSB 5A2MH 1QBVH 3TIUA 1F0UA 1AGJA 1CSOE 3M5NA 3GY5A 1GBMA 1AE8H 3UREA 4K8BA 5A09A 4U2WA 3KEEA 3MNCA 3B8JA 2CXVA 4BTIB 1HAOH 3W94A 2Y82A 1HAIH 3MU1A 1GL1A 4SGBE 3T5FH 1KXCA 1XKBC 1P2NA 1FN8A 2OCVB 3NKKA 4X1QU 2YMSC 4DOQA 1GCTC 2BD8A 5C67A 2QF4A 3PLPA 5L6NH 4AYVB 2GT7A 1YCPM 2VIVA 3OEED 2ZU4A 1VCQA 1PQ8A 4O9VA 3M7TA 5SGAE 1P01A 3D65E 5A0AE 1Q2WA 2ZIQH 1FY1A 4B2CA 1QHRB 2UUKB 1C4V2 3ODFA 2FDAA 5K7RA 3Q3KA 4NIXA 1Z1IA 1A2CH 1TIOA 2H9TH 3RUOA 3PTNA 2WV5A 4FUHA 1NPMA 1AB9C 1ELDE 2FODA 2RDEA 1CE5A 5FXLA 3V12A 5B6LA 2AMPA 2L6OA 3TK9A 4X1RU 4HI3A 4MQAA 2P3TB 3MFJA 2JDID 2WSSD 3SGBE 1GG6B 5EQRA 1QIXB 3P92A 2FOCA 2A5KA 3P95A 1YPLH 2F9PA
chains in the Genus database with same CATH topology
1QTFA 3QN7A 3EA7A 2XXLA 1XXFA 3LKWA 4MDSA 1LO6A 4INLA 4ZKSU 1D6RA 1QL9A 1K9OE 3SO3A 4I8JA 2ZDNA 1GJBB 3PYHA 1O3AA 1SVPA 1C2LA 1XM1A 1VR1H 2OQ5A 2Z9IA 3T27A 1KDQB 1DLKB 3L33A 2STBE 3UY9A 2ZC9H 2FOHA 4B76A 2YNAA 4CH8B 3OX7U 1AFQC 3TJUA 3HK3B 3PB1E 4VGCC 4A5TS 2BY8X 1AUTC 2J2UA 1V2VT 3BTEE 3GCTG 1IHSH 3QK1A 4BAHB 2NWNA 3VB3A 1GBFA 1O2QA 2STAE 4UFFH 2WUCA 1O3JA 3BG4C 1GDQA 2Y5HA 4B71A 2ZGXH 2A7JA 3A86A 3ZZCA 3RXFA 1UTNA 4LXBH 2VIOA 3SOSA 2ZZUH 1OP0A 5EG4A 5E2OA 7LPRA 1QJ7B 4FVBA 4ZXXH 1ZPZA 3RXAA 3UUZA 1C5LH 4IC6A 1TONA 1DWDH 4GCHG 2SGAA 3QTVH 1G3DA 3VB4A 2G55A 6ESTA 3I29A 4E06H 1O2IA 3SW2B 3F68H 4A1VA 2ZDMA 3BTFE 3DFJA 2WV4A 4I7YH 1HJ9A 1IQKA 1ESTA 3RMMH 3GOVB 2XYAA 3GISB 1GI3A 3UIRA 2GV7A 3BIVH 1WBGB 2FYRA 2V0BA 3F9HA 1GI2A 3PM3A 2P93A 4I32A 3E1XB 4B74A 1ELTA 4MNWA 1NU9A 2UWLA 2XWBI 2UUFB 3TH2H 2FOEA 2HGTH 3UTUH 1GHBF 1HIAA 1MCVA 1AU8A 3ATLA 5HXFA 2A32A 1DWBH 1NC6A 4UD9H 1TRMA 1FAXA 1V2LT 1EP6A 4JYTA 4ABDA 2G4TA 3KF2A 2ZA5A 4R8TB 1V2UT 1XUIA 5CE1A 1AVGH 1XUGA 2C93B 3H7OA 1OS8A 1T32A 1TNHA 1BRCE 3SQEE 2BOKA 1TGNA 3RXEA 1KDQA 1BA8B 3NUMA 5AHGH 1UTQA 1O3MA 1ZTJA 3QX5H 4NIVA 4OS5A 4X6OA 1YP9A 4JZEH 4Z0KA 1J9CH 1SC8U 3SJ9A 4TYDA 4ZMAH 2ZGHA 5JBBS 3SGQE 5CHAB 1P02A 1PPFE 3SJIA 5FCKA 8ESTE 4Q7YA 3AVZA 1SQTA 1MU6B 1XMNB 4YM9A 1AZ8A 1GHYH 2ZDAH 3V0XA 1PPHE 1UVUH 1AUJA 5EQSA 1AFEH 2HWLB 2PGBB 5DP6A 3VGCB 1BDAA 1P09A 4ABBA 2J34A 1AIXH 3M3VA 4XBCA 5F8ZA 2AMQA 2VWLA 1FY5A 3HK6B 4NZQA 1O33A 3CP7A 4KTSA 4ISOA 1DM4B 2QXHA 3PMHB 2D8WA 5J4QA 3NXPA 3GY8A 4Q7XA 4XOJA 3ZZ8A 1T8NA 4Y8YA 3BTHE 2Z6BD 5GXPA 2ZQ1A 5EW1H 5AF9H 2GCTB 1QRZA 1SGTA 2FOFA 1C4U2 1QJ1B 3O8RA 1SGDE 1L1NA 4WWYA 1AMHA 2C8WB 1F7ZA 2HLCA 1P05A 1BRUP 4X1NU 3RXLA 2BY6X 2DE8A 1XUJA 3HGPA 3QTOH 1EASA 4WF8A 1K1MA 1KXDA 4K8YA 1GHVH 1GJ4H 3RXQA 1O2UA 2ODPA 2BDGA 1EZSC 3VPKA 3RXTA 1VGCB 4WH6A 2BD2A 2Z3DA 2YOLA 1TB6H 2BX4A 1PYTC 3EA8A 2JKHA 1ANDA 2V3HH 2F9OA 3RXGA 1MQ5A 1B0FA 2NU4E 1SSXA 1S82A 4AN7A 1LHFH 1EJAA 3EQ0H 1NS3A 2IN2A 3M5LA 5AFZH 1HYLA 3ZZ6A 1GJ8B 5F8TA 5GPIB 3E6PH 6CHAB 1G2LA 5I46H 1GMCF 1Z6EA 1S81A 3EGKH 1CHOG 1AVXA 1OOKB 4AOQA 3R0FA 1V2ST 1ZHMA 4IBLH 4I8HA 4X8SH 4RKOB 1HIAB 1EPTC 1O2PA 1VITF 4YLQH 3EBNA 1BTZA 1NO9H 5FCRA 2GX4A 1GMDF 2A4QA 1ZMJA 2K7XA 1TNKA 3OTJE 1GI8B 2DUCA 4OS2A 1GMHF 1TPPA 4D7GA 3QZRA 3ZZDA 3IITA 1CO7E 1C2FA 3GY3A 3RXRA 1VITH 2GCHF 3MH5A 2HVXA 2ZFTA 2ALPA 1BRBE 1SLVB 1HGTH 3PROA 3S69A 1O3GA 2VINA 3MH6A 3PLBA 1SR5C 3ATIA 4RSPA 1DLEA 1PPBH 5F03A 4MNYA 2TGAA 1F0TA 1UTLM 2BX3A 2TPIZ 1MBQA 1GI1A 1TMTH 1YKTA 1GJ5H 1NU7B 2J9NA 3L3TA 2ODQA 2FTLE 1OYTH 3SV8A 3K9XB 1B5GH 2A45B 4ABEA 2VU8E 1WYKA 1S6HA 1Y3WA 4R0IA 3ITIA 4CRCA 2UUYA 2UUJB 3RXKA 3SNCA 1S0QA 1Z8JB 3HGNA 5C1YA 1BQYA 3QUMP 2C8ZB 4U01A 1W0ZU 3QZQA 2BD5A 1AE5A 1SGQE 3V13A 2Q6GA 2A1DB 2BQ6B 5CHAC 4CRGA 1UTKA 3BTGE 5A0CA 2K1QA 2KAIA 3DD2H 1GBLA 1V2NT 1MTSA 4WXVA 3A87A 3WY8A 1YPHC 1TBZH 4WMFA 1AZZA 1L1GA 1SGFG 3PO1C 1ETTH 1O39A 4RKJB 4YTAA 3OU0A 2AYWA 2ZPSA 4D9RA 1UO6A 2OD3B 2P94A 2RG3A 3MTYA 1VCWA 2BLVA 2OUAA 3RU4E 1C5ZB 2OTVA 1UTJA 1TGTA 3NZIA 2CHAC 2WYJA 1FXYA 3SZNA 1FIWA 3A89A 3AAUA 2FLRH 4ZHLU 2FOAA 3A8BA 1AWHB 1SGEE 4O3TA 1O2XA 2A5AA 1FZZA 2KAIB 1KLIH 1SMFE 2QF3A 1L0ZA 1QA7A 2BDIA 4Y71A 2BOHB 1SOTA 4Q2KA 3SORA 1JOUB 1ZGVA 1GMHG 1P8VC 1FY8E 1TNJA 1PPGE 3SU4A 2A31A 5CMXH 6GCHG 3F9EA 1LTOA 1W7GH 2QA9E 2XC4A 4NA8A 4OGXA 4BTUB 1T31A 2BD3A 4IGDA 1TMUH 1Y3UA 4NFEA 3RMLH 4MPUA 1GBAA 2R3UA 1Z7KA 1RD3B 1C9TA 2OQUA 3ZYDA 2FZZA 1O5FH 2BDAA 4THNH 3A81A 1GHZA 2XC5A 4CBNA 3ODDA 1HJAC 1NFXA 1W12U 1GHWH 2IOTA 2Q6DA 3ZZBA 4HGCA 3LDXH 2VJ1A 3VB7A 2ZECA 4INHA 4E05H 3CS0A 1DE7H 1C5QA 3D49H 4I8GA 2SGFE 3W95A 2GDDA 3JZ1B 2LIZA 1GG6C 4KTUA 7KMEH 1EQ9A 1AFQB 1PPCE 1WCZA 1J15A 2BHGA 2GT8A 4HFPB 1HPGA 1BMLA 3RXDA 2R2WU 5G4BA 4MPWA 1O3CA 1OP8A 3KQEA 1JRTA 1LHCH 1ANEA 2JETC 1C1RA 4UFDH 2P8OB 1YBWA 1HRTH 1AKSA 3FFGA 1EZUC 1B7XB 1DANH 3GDSA 5AFYH 2BD4A 1P06A 1A0JA 1MBMA 3A83A 4NSYA 2VWMA 1CQQA 2RA0A 1Y5AT 2HNTE 1THRH 1ESAA 3GYLB 1P0SH 3SI3H 1YM0A 1C2KA 1IQIA 1TNLA 2FOGA 4ISNA 5T6GA 3F9GA 1V2PT 1GI6A 1NFWA 5ESTE 1SGIB 3E3TA 1ANBA 1GI4A 1FNIA 1GJCB 2BVSH 4QT8C 3A84A 5DP4A 5A8YA 4ZHMU 4Y0YE 2Z9JA 1O5GH 2B7DH 1TGCA 3S7HB 4CR5A 1O3EA 4JZDH 2GMTB 3RXPA 2BXTH 4Y7BA 2AFQB 4I33A 3U9AH 4Y10E 1VZQH 3ZVBA 1INCA 2FOMB 4Y7AA 1O2SA 2HPQH 1O32A 1FJSA 1EKBB 2ZO3H 3EE0B 1P3EA 1P9UA 1YPHE 4ZKRU 1A5GH 2O8LA 3RM0H 3SHCH 1AHTH 1T4UH 1RJXB 2WPKS 3LJOA 3M37A 1QJ6B 1O0DH 2FIRH 2XW9A 2Z3EA 2Z7FE 3KQBA 1EX3A 1P57B 4U30A 1YCPK 1TA6A 3T2NA 3S0NA 1V2KT 2G52A 2VIDA 4X1SU 1O3OA 3ATWA 1LMWB 1Q3XA 1QBNA 1C1VH 3D23A 1QL8A 1C1MA 3MU5A 3NCLA 2ZI2H 1K28D 4H42U 5B6OA 2Y5GA 3LH1A 2ZF0H 3GYMA 3GY2A 3PV4A 4NG9H 5GCHG 4A1TA 1BT7A 4ISLA 2A2XH 1G30B 1MD8A 1FV9A 1V2TT 2AGIX 1MTNC 1GGDC 3ZVCA 1O5CB 3U8OH 4AORA 1TYNA 3TK6A 3EDXB 4X6MA 3A82A 2BXUH 3BEFB 2THFB 1C1OA 4CRAA 3LH3A 2ZDKA 3RC6A 1IQHA 1SGFA 5HMAA 3A8AA 2Z9LA 3L6PA 4FU9A 3KHVA 4JCNA 3SV6A 1F2SE 3UWJH 4MPXA 3VB6A 1W14U 2OC1A 1TQ7B 2ZEBA 2CN0H 1Z1JA 3K65B 1ZJDA 3A7VA 2XCNA 1UK3A 1NFYA 3SJKA 1JRSA 1QB6A 1QB1A 1DY9A 2QN5T 3M7QA 1BJUA 3MU0A 1ABIH 4ABHA 1GJ7B 1SPJA 2ZHWH 3O8CA 3TPIZ 2AERH 1V3XA 2F83A 1SG8B 1C1WH 4GAWA 1A46H 2OLGA 5HM9A 1FPHH 1GDNA 2GP9B 2R3YA 1PJPA 1Q31A 1FN6A 2PV9B 4UFEH 5DPAA 1GJDB 4DURA 3ATKA 1O2JA 1BOQA 2J92A 2FS8A 1N6YA 5E8EH 5GWZA 5C1UA 1DUAA 1DWEH 2QF0A 5JPMH 5LPRA 2FX4A 1HNEE 3TU7H 2VWOA 1O3LA 3S9BA 9LPRA 3TGIE 1CGIE 3SBKA 2P3FH 3AW1A 3AAVA 1LHEH 3STIA 3H7TA 1UMAH 1Z8RA 1RRKA 3RLYH 3RMOH 2H9EH 3JZ2B 2BDYA 2JH0D 3LC3A 2A7HA 3UQVA 4ESTE 1UVPA 2BY5X 5EODA 1LVBA 3DUXH 1BRAA 1ELBA 4ZUHA 1HUTH 3BEIB 2P3UB 1RTLA 1UJ1A 4KGAA 2H5DA 1QA0A 1X7AC 4I8LA 3SUDA 3TGKE 1IHTH 2ZCHP 3KIDU 1CHOF 4LK4A 1GVKB 1MTWA 1O2VA 2BZAA 3LOXA 5DP8A 1C5VA 2Q1JA 3SNAA 3ZYEA 1D3TB 3MU4A 1GWAA 1T8LA 5DG6A 1V2QT 5T6DA 2G4UA 4YT6H 3MO3A 2HALA 1OKXA 1ELFA 1A0LA 5FPSA 1A5HA 1H9IE 3URDA 1V2OT 1C9PA 1EXFA 4A1XA 1YGCH 2BDBA 3HATH 4Z6AH 2ZFPH 1DSUA 4RN6A 4IMQA 5DP5A 3GY6A 1BTUA 1V6DA 2LPRA 4BAMB 1P12E 4BXSA 8GCHG 1LVYA 1C4Y2 1YCPH 3VXEH 1C1QA 4NIWA 2WPMS 1EUFA 1GVLA 3GICB 4DGJA 1O2YA 3RXVA 1XUFA 1VITG 3SU1A 2GCTC 4O97A 1YPJH 3FP7E 4F4OC 2PFEA 1THPB 3ZVFA 2PSXA 2F9UA 5I25A 4FXGH 5JYIA 4JMYA 3VFEA 1C2DA 1SGNE 1UCYH 2SGQE 2JETB 2HNTC 1VGCC 1O3HA 3GDVA 1BTPA 3ZVEA 3VB5A 1TLDA 1A4WH 1T8OA 1YYY1 3AW0A 2FXRA 3ZZ4A 5E0GA 4Q80A 4LZ1H 1KTTB 1PPEE 4D7FA 1O36A 1ZZZA 4NGAH 2WYGA 4ABGA 4DCDA 1HAVB 5JBTA 2FEQH 2PWXA 1ZR0A 4ZKOU 1ZOMA 3U1JB 5FAHA 2SGPE 1MKXH 1O38A 3EAJA 1A3EH 4IS5A 6GCHF 1MTVA 4XE4A 3ZZAA 2V35A 1VJ9U 1ZJKA 2JH5D 4WJG2 4X2VA 4CRBA 1AD8H 1C5PA 3A88A 2ALVA 1LDTT 2Z9GA 2ANKH 3PMBB 1FUJA 3BTQE 1C2JA 2CMYA 3KNXA 3F6UH 2ZNKH 2GDEH 1ELAA 3RXCA 2CGAA 1E34B 1O34A 5T6FA 1TX7A 3GY4A 4IW4E 2V3OH 1V2RT 2P95A 1THSH 4MVNA 7ESTE 2O8MA 3UNSA 2FI4E 1O3BA 4YOGA 4DW2U 1ZSJA 3LC5A 3M5OA 4BAOB 2QYIA 1DX5M 1UTMA 2WINI 1ZHRA 2F91A 3LU9B 4KTCA 1WOFA 3S9CA 1AQ7A 1YLCA 1OXGA 1ARBA 1XKAC 4I31A 1C2HA 1D3DB 3B9FH 1GPZA 1OSSA 3SJOA 2PTNA 4XFQA 4OS6A 4UFGH 2QXJA 1ZPBA 3SNDA 3LJJA 1IOEA 3VEQB 1EATA 1WQVH 1SLWB 1FDPA 1XUHA 3A8CA 1AI8H 1K22H 3RXHA 1G3EA 1JBUH 4NSVA 1O2OA 7GCHG 1P2OA 1SFIA 1DICA 4B75A 1CBWB 3U1IB 2A2QH 2OXSA 3E16B 1W7XH 1GBTA 2C4FH 1BMMH 3T62A 1CT0E 1SGYE 3LONA 2WPJS 3Q00A 5J4SA 1C5XB 2FESH 2GZ8A 1NFUA 4Y76A 1DXWA 1WTHD 3P8FA 1IQGA 4KKDA 2Y6TA 3RU4D 1FLEE 4ZHAA 2SGDE 4AFQA 1BTHH 1HAXB 3BTME 3GCNA 1UVTH 1CA0B 3SUFA 1C2EA 3TNSA 1OWHA 3BG4B 2Z94A 2HNTF 3T29A 1TGSZ 1NROH 2IPHA 1VJAU 2OC8A 3MNBA 1G36A 5ABWA 1ZHPA 1S85A 2FMJA 5BPEA 1GBHA 2XRCA 5FX5A 4B2BA 1MZAA 4DIHH 1P2MA 1C5OH 1TPOA 2W7UA 4WMEA 1UVSH 1O3DA 4FU7A 2ZDVH 1TOMH 2PHBA 5GDSH 3MOCA 2VIWA 5T3HA 1C5YB 4WXIA 1KXAA 1IQLA 1ZPCA 1UTPA 4NCYA 3FAOA 4X6NA 2ZHEH 1O2HA 1HAPH 2ZWLH 3RXOA 2QXIA 3TK5A 3MNSA 1ZRBA 2PLXA 1SQAA 1Z71A 3IWMA 2ZFFH 1BIOA 2PKAB 2VVUA 1TPAE 2ZTZA 3SV9A 1YPKH 1MU8B 3SNBA 2XNIA