2Q6GA

Crystal structure of sars-cov main protease h41a mutant in complex with an n-terminal substrate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
305
structure length
305
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRAVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords severe acute respiratory syndrome coronavirus (SARS-CoV)
publication title Structures of two coronavirus main proteases: implications for substrate binding and antiviral drug design.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 82
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2q6gA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2q6gA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2q6gA02
2GDEH 3NCLA 2UWLA 5EQSA 1ABIH 1C5UA 2ANKH 2A45B 3EA8A 1C5MD 1BITA 1HAHH 3T25A 3GY6A 3GCOA 5CE1A 3ATIA 3C27B 2B8OH 1Y3YA 4VGCB 2HNTC 3UR9A 3RXPA 1SC8U 2ZTYA 4CBNA 3FP8E 4H42U 4Q7YA 1XUHA 2YOLA 1F5KU 3P92A 2IOTA 1P10A 1Y3UA 2ANWA 1A3BH 1IOEA 2ZDVH 1GI8B 1OS8A 4JK5A 1D4PB 2STAE 4TPIZ 2FS9A 5JDUB 5B6OA 2J9NA 1N1LA 4WH6A 4X8VH 1OXGA 2EI7A 1CT4E 3FP6E 3GDUA 1Z8JB 3MH5A 3P8FA 1L1GA 2PUQH 1NT1A 1GDNA 3EE0B 3RLYH 2AIQA 3GYMA 2ZGJA 1ELAA 2ZFRH 1FIZA 2AFQB 4I31A 1YYY1 3M36A 3WY8A 3IITA 1JOUB 4MG3A 2UUKB 1SB1H 2A1DB 3SU6A 2VIVA 2BDAA 1U6QA 1DT2A 4CRGA 1W7XH 2BLVA 3TGIE 1YP9A 1C2KA 1DFPA 1TNLA 2HPQH 2JH0D 1O2IA 5TJXA 1NFXA 4NCYA 1ZTLA 2B9LA 3F9GA 2ZEBA 1YM0A 1JRTA 4RN6A 1C2FA 1HGTH 3U9AH 2GP9B 2HNTF 3UTUH 1UTLM 3MO9A 1ACBE 3BSQA 4Y76A 3FZZA 1RTFB 3STIA 3SJ9A 1MBQA 3RXGA 4X2WA 3MI4A 1VJ9U 4X2XA 1SGNE 2H5CA 4RSPA 3NK8A 3GCTF 4GHTA 2R2MB 2QXIA 3RXRA 4ISHH 1UHBB 3Q3YA 4U2WA 2C93B 1S84A 2Z94A 1J9CH 1SGFA 1HPGA 3P95A 1KTTB 1MAYA 4NZLA 1AWFH 2BDCA 2W7UA 1FMGA 1C1VH 1GBAA 1DS2E 1RGQA 2HRVA 2FLRH 1BQYA 1HUTH 1IQHA 1F0SA 1WAYB 1QL8A 1ZPZA 2OUAA 4JZIA 2QC2A 2VIQA 1GGDB 1W0ZU 1FY3A 3H7TA 1P57B 3ZZ4A 1O2ZA 3T62A 1GMHG 2EI6A 3RC4A 3EAJA 4Y0ZE 1C2LA 3RXEA 1P0SH 1SGYE 4ZXYH 1RS0A 2G81E 4Y8YA 1B7XB 1FI8A 2C8YB 2FOMB 5IDKA 1AE8H 2G8TA 2QXJA 4CR5A 3KQBA 1QL9A 3RXKA 1P2JA 5A09A 1CSOE 1WUNH 4FUCA 1CA0C 3QTVH 2F3CE 2R9PA 4DG4A 3URDA 1NC6A 1V2LT 1ZR0A 3RXTA 3RXJA 3ZYEA 3BTWE 1AUJA 1ZYOA 3RXDA 5C2ZA 3NWUA 1IHSH 2D8WA 3KQCA 1ZRKA 1T4UH 1HRTH 1LVMA 2UUJB 4K8YA 5GXPA 3Q3XA 2BDYA 1FIWA 1VGCB 3DFJA 1EXFA 1C5WB 1V2QT 1RFNA 1P2OA 3SNAA 1O33A 2OCVB 1XM1A 4IN2A 2BLWA 1QRXA 1A7SA 1O3EA 1AKSA 3OY6U 1DWBH 2BY8X 1NFWA 1THSH 1C2DA 4O03A 1GBMA 1ZTJA 2HWLB 2JH6D 4ASHA 4OS7A 2CN0H 1SI5H 2ZKSA 1GBKA 4UFGH 3LONA 3KCGH 1SLXB 3K6ZA 1NFYA 3DHKH 2BHGA 4NSVA 3SV7A 3UREA 2QF3A 1O34A 4UFDH 4BTTB 3K65B 4LK4A 5EW1H 1C2GA 2CHAB 3HGNA 1LHEH 2XC4A 1AO5A 1F0UA 1BUIA 2OXSA 2Y5GA 3A7WA 1Q3XA 1EAIA 2C8WB 3HATH 4XE4A 3HK3B 1KDQB 3SNBA 4AFSA 1KSNA 1P8VC 3KL6A 3MU8A 3JZ1B 2VB0A 4XBBA 2AGIX 1HIAB 4IMQA 2GX4A 1MKXH 3RXFA 5EXMA 1V6DA 3MH7A 1FUJA 3RMOH 1O5AB 3A7YA 4MPVA 1YPHE 1F5LA 2WYGA 2FO9A 1MKWK 3T5FH 1C5RA 1AFEH 1W0YH 1AVXA 4TWWA 4Q80A 1F0RA 1PPBH 1ZPBA 1BTXA 4FUJA 1EZUC 3BN9A 1QRWA 5FCRA 2J92A 2WV5A 4FUHA 5DP8A 2Y7ZA 1KXDA 1DVAH 5F03A 3P8NA 4ZMAH 3AW0A 1GBEA 1C2JA 3BTME 2FEQH 2ZNKH 3AVZA 1P2QA 2A7HA 3TJNA 1B5GH 3FFGA 1TX8A 2BD3A 2AIPA 1LVOA 1GJBB 1LQDB 2VIPA 4FU8A 4CH2B 1BTZA 1QB9A 5LGOA 2FOBA 3IG6B 1D6RA 1Y5BT 1K1PA 2G4TA 3U98H 2WYJA 1GDQA 4O3TA 1BRCE 1GMDG 1O37A 5T3HA 1W11U 1PPHE 1ZMJA 3TH3H 1ELTA 3QK1A 2Z3CA 3LIWA 3RC5A 1C2HA 4OS4A 3IWMA 1EX3A 2I6SA 4JZDH 1QQ4A 5J4QA 3SGBE 1XKBC 3M61U 1TNKA 3GISB 4K3JA 2OTVA 1TPPA 3URCA 2AYWA 1O3CA 4CBOA 1HAGE 2VWMA 1Y3VA 1J16A 1A3EH 3UFAA 1V3XA 3MH6A 5K7RA 1O2MA 9LPRA 3PWCA 2P59A 3S69A 5L30H 1EZQA 2EA3A 2ODQA 3M5NA 2TGAA 1C1QA 1ZMLA 3W94A 2OQUA 4YLUA 1ZZZA 2FS8A 5DP7A 1QJ6B 4ZKOU 1HAIH 3E16B 1EB1H 2ZU2A 1UTMA 2UUYA 3UWJH 1SOTA 3CS7A 4JYVH 1YPEH 3E8LA 4INLA 1SGFG 3I77A 3A8CA 3MNCA 1BOQA 4I8KA 2BX4A 4WMFA 4GCHG 1QGFA 3GY4A 4MNYA 1FAXA 3HKJB 1TE0A 2FODA 2PFEA 4AB8A 1CE5A 8ESTE 1DXWA 2GZ9A 1L4DA 1Z8IB 2Z3EA 3F1SB 4NIXA 1UJ1A 1SQAA 1T4VH 2BLQA 2H5DA 2ZQ1A 5PTPA 1FN8A 5HMAA 2A4QA 2AGGX 2WUBA 3E3TA 4D8NA 1VITH 3TJVA 1C4U2 1XKAC 3LKWA 4AORA 4PROA 2I6QA 2V35A 4ISLA 5DP5A 5JBAS 4ABAA 1IQEA 1FV9A 4U32A 1QBOA 4THNH 1BMLA 1BHXF 2BM2A 3BF6H 3TNTA 3GICB 4JK6A 3SUFA 1T32A 1EASA 3Q3KA 5IYTA 2SNVA 1WBGB 2VWLA 2GGVB 4HTCH 1GBIA 2PSYA 3UOUA 2GVFA 3TVJB 1S0QA 1IAUA 2ZCLP 3QDZB 1JIMA 4R8TB 5EXNA 1AUTC 2WPJS 2WPHS 1UK3A 4ZXXH 1AVWA 3I78A 1C5PA 3U69H 1YPJH 4X1QU 2KAIB 2GCTC 3RC6A 1H4WA 3LC5A 1H9IE 1GGDC 3KGPA 5TCCA 3T29A 3M5MA 1G3DA 1IQJA 3SW2B 4BOHA 4HFPB 3ESTA 4WY3A 1C5ZB 1TWXB 3CP7A 2VNTA 2XCNA 2BD9A 1CA0B 2VIWA 4AX9H 3LJOA 1L4ZA 2GKVE 4UEHH 4X8SH 3C1KA 1ZOMA 3ATLA 1C1RA 1GVLA 2JETC 4AFZA 1OKXA 5A0AE 1E36B 2O8MA 4BTIB 1XUKA 1SGIB 1ARBA 4D9QA 5FX6A 5F8ZA 1YF4A 4Q7ZA 4YESB 1BTHH 1TA2A 3VB7A 4X6PA 3LGIA 3E91A 1C9TA 2J95A 4K2YA 4WMDA 1P01A 1ID5H 1AHTH 3V12A 3RDZA 1TRMA 2SGEE 1ETRH 4B75A 1O31A 1O2PA 4K5ZA 1YC0A 1TNIA 1CU1A 4AN7A 2BDIA 2XRCA 2IN2A 2AMDA 1HNEE 5JB8S 2P94A 1SQTA 5JBCS 3MU4A 4CREA 4Z6AH 4XBDA 2VVCA 4OS5A 3QGJA 5A8ZA 3LGUA 1MKXK 3Q76A 3GCHC 3A8AA 1IQIA 3D23A 1SL3A 3QTOH 1QJ1B 1HAXB 5DO4H 1LMWB 3RMLH 1ZPCA 1A5IA 4IN1A 4OS1A 2HOBA 1FAKH 5JPMH 2OBQA 1G9IE 3GY7A 1ESBA 1O5EH 2WPMS 3UWIA 1DY9A 1TGTA 1O2KA 2ZO3H 2FI5E 4CHAC 1EJAA 2QYIA 3K6YA 2ZA5A 1CGIE 1UTKA 3CENA 2ALVA 3VB3A 1AIXH 2F9PA 1P9UA 2ZHQH 1BTWA 3O8BA 3BTKE 4F4OC 3LGTA 1MU6B 2ZFPH 4TWYA 2PKSC 1DWCH 2QIQA 1DSTA 1DXPA 1WOFA 2A31A 5GCHG 1GMHF 1F2SE 2A2QH 1H9HE 1PYTC 4WJG2 1GHAG 2SNWA 1CT2E 3PMJA 3VXEH 4WMEA 1L0ZA 1QNJA 5A8YA 1ARCA 4NIYA 5FPSA 1RJXB 1E0FD 4ZHMU 1SBWA 2VWOA 4O9VA 1QRZA 3LDXH 1QBNA 1SVPA 3EA7A 5E2PA 1ELBA 1BMNH 3RU4D 2PHBA 2ZECA 5AVDA 1O5BB 1OWIA 3M7UA 8LPRA 1A61H 3FZDA 4K1SA 1KXCA 2P3UB 3A87A 1OWDA 1TB6H 5F6MA 1LKBA 1THRH 1Z71A 1EP6A 4B76A 1NU7B 5FHTA 1MKWH 2HGTH 5DJ7A 1HAOH 1ZSKA 4CRBA 1BTPA 1OPHB 1V2TT 1FY5A 1ANCA 3ZZAA 4HZHA 2FOHA 1HXFH 3SJKA 2BQ7B 2XCFA 5G4BA 1AY6H 4YZUA 1TNHA 1EUFA 3OX7U 1B0EA 3SU2A 1BHXB 2H9HA 4ZHLU 1OYQA 1L1JA 1UK2A 1EAXA 4I8LA 1CGHA 1DPOA 2GZ7A 3HKIB 5ABWA 1FPHH 4MPUA 3SNCA 3A7ZA 4UFFH 4UONA 4XBCA 1UCYK 4X1PU 4YOIA 4WXVA 5EG4A 1LPKB 2W3KA 4RKOB 4KTSA 1DSUA 3SV2H 3ZZDA 3SO3A 3O8CA 1KTSB 5BRRE 3PLBA 1UK4A 1RTKA 1W2KH 1GCTC 1Q31A 3UPEA 4IGDA 1GG6C 2P8OC 1KLIH 2AEIH 4Q2KA 1V2PT 1CGJE 1FN6A 1TQ7B 4UD9H 1YCPH 2ZFQH 1FY1A 1TX7A 1C9PA 4ISNA 3W95A 1OYTH 4Y7AA 2R0LA 1HFDA 3SI4H 1GJAB 2UWPA 2BVXH 2V3HH 3RP2A 3EDXB 2R2WU 4AG1A 1MUEB 1ELGA 4BAMB 4ZKNU 4D9RA 1C5NH 2BQWB 1GI3A 1C1UH 3PLPA 5I25A 4ABFA 3GOVB 1C5LH 1BBRK 1S83A 1AU8A 1IQFA 3BTTE 3UUZA 1MU8B 4MPWA 2Q6DA 5A0CA 1PQ8A 1UMAH 3BTGE 4UDWH 1AN1E 1MZAA 1YCPM 4FUGA 3T28A 1C1WH 1TIOA 1O2NA 3MHWU 3ZZ8A 3SI3H 3T27A 3SN8A 2ZIQH 3MO6A 1HJAC 3A8DA 2ODPA 3GY3A 1YLCA 4MNVA 3GYLB 1C2EA 1NTPA 2GCTB 4NIVA 1Y5UT 1GMDF 1P09A 2FM2A 3KEEA 4TYDA 2LNCA 1ESTA 2F9NA 3LJJA 1QY6A 2SGFE 1A0JA 1O3IA 2BMGB 1UTQA 1AMHA 1HJ9A 4BAHB 1ELVA 2ZF0H 1TONA 1P12E 4K1TA 3VB4A 2FMJA 2XYAA 2CGAA 5K0HA 5LPEA 4LZ4B 2Z9GA 1PFXC 1CBWC 1EQ9A 3RXLA 1UTJA 2ZU5A 2JETB 2PWXA 2ULLA 4ZHAA 2PLXA 5T6FA 4X8TH 1XVOA 5C5NA 1J15A 5AHGH 2Q1JA 4MDSA 1YPMH 1EZSC 4WH8A 2BB4A 4E7RG 4OGYA 4CRFA 2H1UA 3VFEA 1G3BA 2TRMA 3ENSB 3M3SA 1A0HB 1O2VA 5FX5A 1OWHA 1QB6A 3QLPH 1MCTA 2O8WA 4I7YH 1NESE 3U1JB 3RM0H 4XDEA 7LPRA 4I8JA 1C4Y2 2ZDMA 4AGJA 1TALA 4IC6A 4GCHF 5ESBA 3MTYA 1FDPA 2A4RA 2R0KA 4DT7B 3T2NA 1O2SA 4KGAA 3RU4E 1DLKB 5FAHA 2J38A 1QURH 1C2MA 1ZSJA 5JYIA 2VJ1A 3SJIA 2A2XH 1YKTA 1O3BA 4Y10E 2BX3A 5TCAA 2J34A 4Y8XA 1RRKA 1IQGA 4AZ2B 3GCHB 2XWAA 1EPTA 2EEKA 1P2IA 3FVFB 2THFB 1YPKH 1SR5C 1DUAA 2FOGA 2QCYA 2GTBA 2OP9A 4YOGA 1LKAA 5EW2H 2D26C 1MH0A 1NS3A 1D9IA 1SGPE 2VGCB 1W3CA 1SGRE 5GIBA 3A7TA 4X8UH 1G3CA 1ZMNA 4CHAB 2ZDLA 2SGQE 2QGRA 2RA0A 3QGNB 4DIIH 4X1NU 2ZHWH 1ELEE 1C5OH 2W26A 2FX4A 1SMFE 3NXPA 1HDTH 1MQ6A 1P3CA 2VH6A 3ZZ3A 4ABDA 2GMTC 1HB0B 3MU5A 2QF0A 4TPYA 1Z1JA 4O97A 2PKSB 1OWKA 1TPAE 1LCYA 3FAOA 3M5OA 4OS2A 4FVBA 1T7CA 1TA6A 4YT6H 4X6NA 1QJ7B 2CXVA 2RCEA 1O5CB 2BDBA 1O5DH 2PKAA 1SLWB 1Z7KA 2R3YA 3A83A 1IHTH 4FUIA 2WPIS 1Y3WA 4KTCA 1AE5A 2BXTH 3O8RA 1O38A 1P04A 4FXGH 3U8RH 1KY9A 3E0NB 1EOLA 2STBE 3M7TA 1P2MA 3LGYA 1EOJA 5DGJA 4TY7A 4JYTA 1E37B 3E6PH 1HAPH 4WF8A 1JIRA 4M7GA 3BG8A 4H6TA 1XX9A 1BMMH 5A8XA 2TGTA 2Q6FA 3OSYA 4BAQB 2G00A 3TK5A 2PGQB 2AH4X 1Y3XA 1G2LA 6LPRA 2FI3E 3PMHB 3KHVA 3RXSA 1P05A 1V2UT 1FLEE 1GJ7B 4Q7XA 2OC7A 1Z8GA 4Z0KA 3A84A 1GI2A 5FXLA 5BPEA 3AW1A 2CV3A 3P8OA 3D49H 2NU4E 2XW9A 1DDJA 3A82A 3HGPA 1CVWH 1HAVA 1V2NT 1FJSA 4ESTE 1MTSA 3MMGA 1FZZA 2PV9B 4ABEA 1ETSH 2BYAX 2GV7A 1WQVH 2XXLA 1YCPK 2PTNA 1GJCB 1H8IH 4FU7A 3P8GA 1O3JA 1P9SA 1G36A 3RXMA 2BD2A 1WCZA 3ZVCA 1DM4B 5J4SA 1IQMA 2BQ6B 2ZDKA 1H9LB 1GI5A 3MWIU 1SHHB 1RTLA 2DE9A 3LH3A 1A5HA 3TITA 2HNTE 2OC8A 4X6OA 2AMQA 1EAWA 1GCTB 4WWYA 4ABHA 4Y79A 1O3MA 3BEFB 1MZDA 1GG6B 3UQVA 2ANMH 2P8OB 1K1IA 5A0BA 4DOQA 4H6SB 3RXVA 1NFUA 3KQDA 1GJ9B 1QIXB 2D2DA 3L3TA 2ZCHP 1O2TA 1GBHA 1GHZA 4AGKA 2ANYA 3PWBA 3STJA 2B0FA 3UOPA 3NUMA 1LHDH 2FX6A 2FOFA 1ELCA 3TK9A 1C1PA 1ELDE 1G32B 3NZIA 4GUXA 1VCPA 4BXSA 4CH8B 1HCGA 4NGAH 2F9BH 1BIOA 1OOKB 2SGDE 1GVZA 2G5NA 3ZVBA 1SFIA 1MMJN 1V2ST 5LH8A 5GCHF 1O2QA 1D6WA 2V6NA 2G51A 3M3VA 1MTWA 1UCYH 1GHAF 3SV8A 2SGAA 6CHAC 4MPXA 2QY0B 3S9AA 1GI0A 5EQQA 2OD3B 2Y6TA 3RLWH 3RXAA 1G37A 2ZP0H 3U8OH 1K28D 2ESTE 4I8GA 4BANB 1GJ8B 1LVBA 2BDHA 2BZ6H 1BRUP 1HJAB 2EI8A 1TQ0B 2RA3A 3OU0A 1O3LA 1V2WT 4ABIA 2ZHEH 2F9UA 3H5CB 5GWZA 1GJ4H 1MCVA 3U1IB 1HXEH 1CO7E 1W14U 2K1QA 2VVVA 4XOJA 4E7NA 1W8BH 1MBMA 1TBZH 3SOSA 5A2MH 3T26A 3ATKA 3SU1A 1VR1H 2HALA 2BVRH 2Y5FA 1Q2WA 1JMOH 1WSSH 1SFQB 1KYNA 1E38B 4RKJB 5DK1A 1UHBA 1BBRH 4INKA 3SUGA 1CBWB 1PJPA 1P3EA 2BTCE 1AGJA 1MQ5A 2ASUB 7ESTE 1S6FA 2PSXA 1O32A 4A92A 3B9FH 5FPTA 1GHBG 4F49A 3TGKE 4A1XA 2RDLA 1GI9B 1JRSA 1LO6A 4AFQA 5FBIA 1THPB 1OWEA 2XC0A 4FVDA 4IC5A 3LC3A 3PMAB 1UVOA 2BD8A 2XBWA 4KKDA 3HK6B 1RXPA 1S0RA 3VGCC 1HV7A 4DVAU 1XXFA 8KME2 2ZU4A 3UY9A 3LU9B 1OP0A 3RMNH 3TPIZ 2A7CA 2QN5T 1AKSB 2Y5HA 1DUEA 1ZRBA 1K2I1 2XTTB 3S7KB 1MTVA 2FYRA 1SOZA 1SGDE 3H7OA 1Y59T 1H1BA 1GBFA 2WPLS 4YLQH 4GHQA 4Y0YE 1QA7A 1CA8B 1GBCA 1TBRH 3MH4A 4JZ1A 1FXYA 2ZU1A 1GWAA 1WV7H 1GHWH 1FNIA 1NY22 2DE8A 4OS6A 2Q6GA 1L2EA 4LZ1H 3R0FA 3UNSA 3PMBB 3SBKA 3QWCH 1C4V2 1O30A 2ZC9H 1A4WH 4XFQA 1A5GH 2OBOA 5EPNA 2Z9IA 2PGBB 3RXQA 2ZTZA 3TGJE 2FDAA 3PB1E 1VITG 4D7GA 3DUXH 2VGCC 2AERH 2LPRA 2RG3A 2GMTB 3AAUA 4X1SU 2W5EA 1UVSH 4D76A 1D3PB 3QUMP 1NRSH 1AZZA 2QXHA 2Z9KA 1TFXA 2BLOA 1ZHPA 3K9XB 1O3AA 1OP8A 5FBEA 1N8OC 5DKMA 2Y7XA 1BZXE 2TIOA 1AD8H 1YPHC 2CMYA 3F6UH 1GJ6A 1C5SA 4JCNA 2VWNA 5F8XA 3LT3A 2PR3A 3HPTB 3DA9B 2GDDA 1BRBE 4MQAA 1K21H 1AFQB 3SU3A 3UIRA 2FWWA 4DIHH 3GCNA 4HGCA 5CHAC 1YLDA 2XBVA 1ZTKA 1F0TA 1KDQA 1DE7H 1ZJKA 2V0BA 3SV6A 5C67A 2D1JA 2GT8A 2FLBH 3TU7H 1V2VT 1DY8A 4ZKRU 2C8ZB 1XVMA 3GDSA 3ZZBA 1HIAA 2Y81A 3G01A 1UCYE 2TBSA 2Z7FE 3CS0A 4YO9A 1AQ7A 5GJ4B 3MU0A 2FI4E 3BTQE 2C4FH 3QX5H 2DUCA 4XSKU 1SGCA 2C8XB 3ZZ5A 3VXFH 4DY7B 5ETXA 1YPGH 5C5OA 1KXFA 2AMPA 3LOXA 1S85A 4K8BA 1TGBA 1Y8TA 2ZQ2A 2QA9E 4IMZA 2Z9LA 4SGAE 5EGMA 1CHGA 3BG4C 2YNAA 4CRAA 1PPZA 3PTNA 1P02A 1QCPA 5EODA 1S82A 3M35A 1W12U 3PROA 4UE7H 2TPIZ 1SPJA 4NIWA 3SU0A 1TABE 1GJ5H 5C3NA 3AAVA 1GPZA 2TGDA 3K2UA 3ODFA 3ZVEA 1ETTH 2GD4B 1OWJA 2G52A 1AVGH 2ZGCA 3EYDA 1UTPA 1TRYA 1V2KT 3A88A 2ZDNA 5HXFA 1A2CH 2BY7X 1BBRE 1ELFA 2BOKA 3ELAH 4J2YB 1GHVH 1GI1A 2GCHG 3F9FA 2ZPQA 4CR9A 2GZ8A 1K1JA 4I32A 4B73A 4FUDA 3SNDA 3UR6A 1NRPH 4GAWA 2H2ZA 4DJZB 4B1TA 1H8DH 2OLGA 3L6PA 1HJ8A 2GT7A 2B7DH 3SU4A 7GCHG 2FOCA 4O3UA 5C1YA 2Z9JA 4NFEA 1LDTT 3MO3A 1WTGH 1GBBA 3RXIA 3UNRA 3S7HB 4IW4E 4GVUA 1LHGH 1VCQA 1AWHB 3ZV9A 4A1VA 5HM2A 1P2NA 1SLUB 6CHAB 1C1MA 2P3FH 1MAXA 1MD8A 2O8TA 1NZQH 4U01A 1PYTD 2F9OA 2G4UA 2QAAA 1TGNA 3NPSA 3KQEA 1TGSZ 4NWLA 5EPYA 4ZKSU 4Y8ZA 1JWTA 1XUFA 2ZWLH 4B2BA 2CF9H 2ZHDA 2ZZUH 5EOKA 1O2OA 1ZHRA 4DGJA 3PO1C 1DOJA 3AASA 6GCHF 1ZSLA 4CRDA 1PPEE 3A89A 1QBVH 1XUJA 1JBUH 3KNXA 1C5XB 3TIUA 4YOJA 2HVXA 3ATMA 1FY4A 2M5TA 3BTFE 1O39A 3SGAE 5HYOA 1XMNB 8GCHG 1GL1A 3NKKA 1J14A 5FPYA 1NN6A 1ZJDA 3OYPA 1GJDB 3ZVDA 1D3QB 1BCUH 1PPGE 4DCDA 1GBLA 5DG6A 2BY5X 1ORFA 1ZGVA 1GDUA 4MNWA 1O3GA 3EA9A 2ILNA 2BOHB 4BTUB 1ZLRA 4X0WU 1E34B 3TH4H 1NO9H 4KELA 4X2VA 5DP4A 1AB9C 3ATWA 5C20A 5AF9H 4JYUH 1FONA 1O2RA 3MNXA 2GV6A 1TMBH 2H9TH 3VGCB 1IQLA 3U8TH 2KAIA 3SV9A 1HAYB 1O3OA 1T8MA 2VH0A 2IPHA 3RXCA 2XWBI 4JZFH 4A5TS 5E0GA 2FXRA 1GMCF 2F83A 3MOCA 2QV1A 4MLFB 4WXIA 4YTAA 3A7XA 2ZG0H 4MVNA 3MFJA 2VU8E 2H6MA 1O35A 2A5KA 3D65E 2J2UA 3ITIA 1EPTC 3SORA 5AFYH 4K60A 1RIWB 5E8EH 1F92A 1NU9A 1FPCH 1WU1A 2PTCE 1TPSA 4AYVB 5T6DA 1ANDA 1NRQH 2ZPRA 1G30B 2ZDAH 4LXBH 3TH2H 4ZROA 1EKBB 1UVPA 1Z1IA 3ZYDA 1KXEA 3PYHA 1HBTH 2FIRH 3RXUA 4A7IB 1LHCH 1F5RA 3SJOA 1GHXH 1TRNA 1O3PB 2A7JA 4FUBA 1O3NA 1VCWA 3Q00A 4K69A 4AOQA 1GVKB 1FY8E 2BDGA 5AFZH 2BXUH 1KXBA 2Y80A 2FP7B 1V2OT 1N8OB 1PQ7A 4B2AA 2SGPE 1KLTA 5LPRA 1UTOA 4WVPE 1D3TB 1DITH 5ESTE 1QQUA 2XBYA 4ZAEA 1P2KA 2P16A 4Y11E 1BB0B 4X6MA 1EZXC 5HM9A 2P95A 1O2YA 3ZZCA 1YPLH 1FQ3A 1K1NA 4NSYA 2XBXA 3A81A 2O8UA 3R3GB 1UO6A 2P93A 3OY5U 3V0XA 3GY2A 1XUGA 4GPGA 5L6NH 1K9OE 1LQEA 5I46H 1KLJH 5CHAB 4Y6DA 3PTBA 3SUEA 3MNSA 1D3DB 5T6GA 4ZH8A 1QL7A 4H4FA 4FUFA 2J4IA 4A6LA 2ZI2H 1GHBF 2FZZA 1KXAA 2A0QB 1SLVB 1AFQC 1LPZB 1O2GH 6GCHG 1ABJH 3B8JA 2BD4A 2ZFFH 3F68H 3ODDA 3SQHE 2ZPSA 1E35B 2C90B 4JZEH 2ZGHA 3B23B 3QZRA 1LVYA 2G5VA 1N6XA 3SU5A 1W10U 4MTBA 3M7QA 3S9CA 5EXLA 5GPIB 4YM9A 4IS5A 1O3DA 2ODYB 2HLCA 5L2ZH 3GCTG 3BG4B 3VEQB 3DD2H 1UVTH 2AGEX 2FOAA 2UUFB 2JH5D 3P70B 1EP5A 2O9QA 4J1YA 1A0LA 1GI6A 3O8DA 5HGGA 4FUEA 4ABJA 1C5TA 1O2XA 2FOEA 4NZQA 3OTJE 1TPOA 2J94A 4B74A 1UVUH 1V2MT 2AS9A 1QFKH 1P03A 3KIDU 1YBWA 1O2LA 1TMUH 1LTOA 3ZVGA 1MTNC 3P17H 1ESAA 3LH1A 2B5TB 2Z6BD 2BY9X 3TJOA 1OP2A 3VB6A 3Q77A 1TOMH 1TBQH 3V3MA 2OQ5A 2JKHA 2ZHFH 1HAZB 1BT7A 2XC5A 4VGCC 1SG8B 2A5AA 1CHOF 2C3SA 4HI3A 1GBJA 3LGWA 1VITF 1WYKA 1INCA 1Y5AT 4K1EA 1PPCE 4ISIH 1SSXA 2H9EH 5DP3A 1C1NA 3EQ0H 5C1UA 3N7OA 4LOYH 1DWEH 5EQRA 2FPZA 3TNSA 1GMCG 3BTDE 2CF8H 2HPPH 4TY6A 1IQKA 1W7GH 3DFLA 4D7FA 1YGCH 4MNXA 3A7VA 3M37A 1PQAA 1N6YA 1TLDA 4ABBA 3E1XB 4YT7H 2ZTXA 2WPKS 2QXGA 4AB9A 4ZUHA 1S5SA 2W7SA 3BIVH 1Z6JH 5E2OA 4AG2A 5F8TA 1DWDH 5DP9A 3ZZ9A 3GY8A 3LGVA 1G2MA 4X1RU 1NRNH 1SGEE 1DLEA 2VINA 3PO1B 5E0HA 1T31A 4GLYA 3RM2H 5L2YH 2NU0E 4UFEH 5EU8A 1C1SA 2V3OH 1C5VA 1TOCB 1P06A 1O0DH 1BTYA 2FESH 1NM6A 1J17T 1XXDA 3UQOA 2FTLE 3VB5A 3MU1A 2BVSH 3BIUH 3D62A 1B0FA 4I33A 3A80A 3ZZ7A 3FP7E 1MTUA 2CJIA 1WTHD 2ZGXH 3L33A 2W3IA 3RMMH 1O3KA 2FTMA 4NWKA 1S6HA 2ZU3A 1C5YB 3RU4T 2EC9H 2BD5A 1GI4A 1BTUA 3P6ZB 1ZGIA 1VZQH 2VIOA 1O36A 2VIDA 5DPAA 1O2HA 4E05H 5H4IB 3TLOA 1O3FA 5LPFA 1T8NA 3SJ8A 4ISOA 1EB2A 1AB9B 1GHYH 1NRRH 3A85A 3RUOA 1O5GH 3S9BA 1EAUA 4U30A 2YNBA 3V7TA 3SNEA 3VPKA 3DT0H 2O8LA 3MYWA 1WQSA 2ZGBH 3M5LA 1O2JA 1V2RT 1AI8H 1GBTA 3UNQA 2BD7A 1BDAA 2A5IA 3TK6A 1TAWA 3E90B 1M9UA 1ANEA 3BEIB 1MD7A 1F7ZA 9ESTA 4R0IA 1X7AC 2OC0A 1HLTH 1QR3E 2GCHF 1GBDA 4BAKB 3M3TA 5SGAE 4B71A 3MNBA 4E06H 2LIZA 2R3UA 2A4GA 1J8AA 4KP0A 1BMAA 1PQ5A 2ALPA 1QTFA 1UTNA 1GI7B 7GCHF 4QT8C 2A4OA 5JB9S 1C1OA 1SGTA 3QZQA 1EPTB 4CRCA 1DANH 3PV4A 3ZZ6A 1O3HA 4A1TA 1JXPA 2F9VA 1SQOA 1EJNA 1TX6A 1OSSA 2PUXB 3QO6A 3V13A 4INHA 1DICA 7KMEH 3LPRA 2PW8H 3RXHA 3GY5A 4NA9H 1CQQA 3PM3A 3A86A 1QHRB 1GCDA 3PLKA 2NWNA 2IJOB 1RIWC 4GSOA 1AZ8A 4Y71A 2NU1E 2WUCA 3S0NA 3E0PB 4NFFA 4B2CA 3EGKH 1BRAA 5GDSH 1TMTH 2WINI 2K7XA 1LHFH 1VGCC 2UWOA 1C1TA 2BY6X 3BTHE 3RXBA 1T8OA 2BZAA 1Z8RA 1S81A 1TNGA 2ZFSA 1CHOG 3F9EA 1C5QA 4BAOB 5E0JA 1LPGB 5FCKA 1SGQE 1QB1A 1Z6EA 6ESTA 1P11E 1A1RA 1TNJA 4BNRA 4OGXA 1L1NA 4SGBE 1G3EA 3TJUA 1GL0E 2ZCKP 1ZHMA 2ZFTA 2WV4A 1DX5M 2PKAB 4FU9A 4NG9H 2FYQA 5JBTA 1T8LA 8GCHF 3ZVFA 1KIGH 3KF2A 5C1XA 1TYNA 4NA8A 1EJMA 3KN2A 1K1OA 1NPMA 4Y7BA 3BEUA 4BXWA 4DW2U 5DP6A 1XUIA 3SGQE 2OINA 4DURA 3ZV8A 3RXOA 2CHAC 4I8HA 2NU2E 2TGPZ 2VVUA 3I29A 2A32A 3QN7A 1OX1A 1NROH 1EATA 4NA7A 3ZVAA 2Z3DA 4IBLH 3SHCH 1RD3B 3JZ2B 3SQEE 3F9HA 1BJVA 1CT0E 1PPFE 3SUDA 5JBBS 1K1LA 4AFUA 4JMYA 1BA8B 3SHAH 1SHYA 1BJUA 1K22H 1TGCA 2Y82A 2OC1A 3A8BA 4X2YA 5CMXH 1HYLA 4ABGA 1V2JT 1C2IA 1K1MA 2G55A 2F91A 1O2WA 1QA0A 1HAVB 4AYYB 2SFAA 3BTEE 4KTUA 1A46H 1VJAU 1IQNA 1W13U 2NU3E 3EBNA 2P3TB 2XNIA 3SZNA 1O5FH 3GDVA 3BV9B 3FANA 1ANBA 1O2UA 1MTNB
chains in the Genus database with same CATH superfamily
2GDEH 3NCLA 2UWLA 5EQSA 1ABIH 1C5UA 2ANKH 2A45B 3EA8A 1C5MD 1BITA 1HAHH 3T25A 3GY6A 3GCOA 5CE1A 3ATIA 3C27B 2B8OH 1Y3YA 4VGCB 2HNTC 3UR9A 3RXPA 1SC8U 2ZTYA 4CBNA 3FP8E 4H42U 4Q7YA 1XUHA 2YOLA 1F5KU 3P92A 2IOTA 1P10A 1Y3UA 2ANWA 1A3BH 1IOEA 2ZDVH 1GI8B 1OS8A 4JK5A 1D4PB 2STAE 4TPIZ 2FS9A 5JDUB 5B6OA 2J9NA 1N1LA 4WH6A 4X8VH 1OXGA 2EI7A 1CT4E 3FP6E 3GDUA 1Z8JB 3MH5A 3P8FA 1L1GA 2PUQH 1NT1A 1GDNA 3EE0B 3RLYH 2AIQA 3GYMA 2ZGJA 1ELAA 2ZFRH 1FIZA 2V3MA 2AFQB 4I31A 1YYY1 3M36A 3WY8A 3IITA 1JOUB 4MG3A 2UUKB 1SB1H 2A1DB 3SU6A 2VIVA 2XOKD 2BDAA 1U6QA 1DT2A 4CRGA 1W7XH 2BLVA 3TGIE 1YP9A 1C2KA 1DFPA 1TNLA 2HPQH 2JH0D 1O2IA 5TJXA 1NFXA 4NCYA 1ZTLA 2B9LA 3F9GA 2ZEBA 1YM0A 1JRTA 4RN6A 1C2FA 1HGTH 3U9AH 2GP9B 2HNTF 3UTUH 1UTLM 3MO9A 1ACBE 3BSQA 4Y76A 3FZZA 1RTFB 3STIA 3SJ9A 1MBQA 3RXGA 4X2WA 3MI4A 1VJ9U 4X2XA 1SGNE 2H5CA 4RSPA 3NK8A 3GCTF 4GHTA 2R2MB 2QXIA 3RXRA 4ISHH 1UHBB 3Q3YA 1FX0B 4U2WA 2C93B 1S84A 2Z94A 1J9CH 1SGFA 1HPGA 3P95A 1KTTB 1MAYA 4NZLA 1AWFH 2BDCA 2W7UA 1FMGA 1C1VH 1EFRD 1GBAA 2EQNA 1DS2E 3SYJA 1RGQA 2HRVA 2FLRH 1BQYA 1HUTH 1IQHA 1F0SA 1WAYB 1QL8A 1ZPZA 5EJZA 2OUAA 4JZIA 2QC2A 2VIQA 1GGDB 1W0ZU 1FY3A 3H7TA 1P57B 3ZZ4A 1O2ZA 3T62A 1GMHG 2EI6A 3RC4A 3EAJA 4Y0ZE 1C2LA 3RXEA 1P0SH 1SGYE 4ZXYH 1RS0A 2G81E 4Y8YA 1B7XB 1FI8A 2C8YB 2FOMB 5IDKA 1AE8H 2G8TA 2K0QA 2QXJA 4CR5A 3KQBA 1QL9A 5CDFE 3N99A 4I86A 3RXKA 1P2JA 5A09A 1CSOE 3PV2A 1WUNH 4FUCA 1CA0C 3QTVH 2F3CE 2R9PA 4DG4A 3URDA 1NC6A 1V2LT 1ZR0A 3RXTA 3RXJA 3ZYEA 3BTWE 1AUJA 1ZYOA 3RXDA 5C2ZA 2EY4C 3NWUA 1IHSH 2D8WA 3KQCA 1ZRKA 1T4UH 1HRTH 1LVMA 2UUJB 4K8YA 5GXPA 3Q3XA 2BDYA 1FIWA 1VGCB 3DFJA 1EXFA 1C5WB 1V2QT 1RFNA 1P2OA 3SNAA 1O33A 2OCVB 1XM1A 4IN2A 2BLWA 1QRXA 1A7SA 1O3EA 1AKSA 3OY6U 1DWBH 3UAIC 2BY8X 1NFWA 1THSH 1C2DA 4O03A 1GBMA 1ZTJA 2HWLB 2JH6D 4ASHA 2IJD1 2CN0H 3EE7A 4OS7A 1SI5H 2ZKSA 1GBKA 4UFGH 3FOAA 3LONA 2WSSD 1SLXB 3KCGH 5HIYA 3K6ZA 1NFYA 3DHKH 2BHGA 4NSVA 3SV7A 3UREA 2QF3A 3WWBA 1O34A 2VBCA 4UFDH 4BTTB 3K65B 4LK4A 5EW1H 1C2GA 2CHAB 3HGNA 1LHEH 2XC4A 1AO5A 1F0UA 1BUIA 3CNRA 2OXSA 2Y5GA 3A7WA 4FOUC 1Q3XA 1EAIA 2C8WB 3HATH 4XE4A 3HK3B 1KDQB 3SNBA 4ACBA 1KSNA 4AFSA 1P8VC 3KL6A 3MU8A 3JZ1B 3N7DA 2VB0A 4XBBA 3GS9A 2AGIX 1HIAB 4IMQA 2GX4A 1MKXH 3RXFA 5EXMA 1V6DA 3MH7A 1FUJA 3VG8A 3RMOH 1O5AB 3A7YA 4MPVA 2AHME 1YPHE 1F5LA 2WYGA 2FO9A 1MKWK 3T5FH 1C5RA 1AFEH 1W0YH 3N7EA 1AVXA 4TWWA 4Q80A 1F0RA 1PPBH 1ZPBA 1E79D 1BTXA 4FUJA 1EZUC 3BN9A 1QRWA 5FCRA 2J92A 2WV5A 4FUHA 5DP8A 2Y7ZA 1KXDA 1DVAH 5F03A 3P8NA 4ZMAH 2KZ4A 3AW0A 1GBEA 1C2JA 3BTME 2FEQH 2YMSC 2ZNKH 3AVZA 1P2QA 2A7HA 3TJNA 1B5GH 3FFGA 1TX8A 2BD3A 2AIPA 1LVOA 1GJBB 1LQDB 2VIPA 4FU8A 4CH2B 1BTZA 1QB9A 5LGOA 2FOBA 3IG6B 1D6RA 1Y5BT 1K1PA 2G4TA 3U98H 2WYJA 1GDQA 4O3TA 1BRCE 1GMDG 1O37A 5T3HA 1W11U 1PPHE 1ZMJA 3TH3H 1ELTA 3QK1A 2Z3CA 3LIWA 3RC5A 1C2HA 4OS4A 3IWMA 1EX3A 2I6SA 4JZDH 1QQ4A 5J4QA 3SGBE 1XKBC 3M61U 3OEHD 1TNKA 3GISB 4K3JA 2OTVA 1TPPA 3URCA 2AYWA 1O3CA 4CBOA 1HAGE 2VWMA 1Y3VA 1J16A 1A3EH 3UFAA 1V3XA 3MH6A 5K7RA 1O2MA 9LPRA 3PWCA 2P59A 3S69A 5L30H 1EZQA 2EA3A 2ODQA 3M5NA 2TGAA 1C1QA 1ZMLA 3W94A 2OQUA 2KX4A 4YLUA 1ZZZA 2FS8A 5DP7A 1QJ6B 4ZKOU 1HAIH 3E16B 1EB1H 2ZU2A 1UTMA 2UUYA 3UWJH 1SOTA 3CS7A 3WW7A 4JYVH 1YPEH 3E8LA 4INLA 1SGFG 3I77A 3A8CA 3MNCA 3AK5A 1BOQA 5C0TA 4I8KA 2BX4A 4WMFA 4GCHG 1QGFA 3GY4A 4MNYA 1FAXA 3HKJB 1TE0A 2FODA 2PFEA 4AB8A 1CE5A 8ESTE 1DXWA 2GZ9A 1L4DA 1Z8IB 2Z3EA 3F1SB 4NIXA 1UJ1A 1SQAA 1T4VH 2BLQA 2H5DA 2ZQ1A 2CK3D 5PTPA 1FN8A 3OEED 5HMAA 2A4QA 2AGGX 2WUBA 3E3TA 4D8NA 4OM9A 1VITH 3TJVA 1C4U2 1XKAC 3LKWA 4AORA 4PROA 2I6QA 2V35A 4ISLA 5DP5A 5JBAS 4ABAA 1IQEA 1FV9A 4U32A 1QBOA 5GNDA 4THNH 1BMLA 1BHXF 2BM2A 3BF6H 3F2HA 3TNTA 3GICB 4JK6A 3SUFA 1T32A 1EASA 3Q3KA 5IYTA 2SNVA 1WBGB 2VWLA 2GGVB 4HTCH 1GBIA 2PSYA 3UOUA 2GVFA 3TVJB 1S0QA 1IAUA 1W0JD 2ZCLP 3QDZB 1JIMA 4R8TB 5EXNA 1AUTC 2WPJS 2WPHS 1UK3A 4ZXXH 2F43B 1AVWA 3I78A 1C5PA 2W6ID 3U69H 1SQRA 1YPJH 4X1QU 2KAIB 2GCTC 3RC6A 1H4WA 3LC5A 1H9IE 1GGDC 3KGPA 5TCCA 3T29A 3M5MA 2W6JD 1G3DA 1IQJA 3SW2B 4BOHA 4HFPB 3ESTA 4WY3A 1C5ZB 1TWXB 3CP7A 2VNTA 2XCNA 2BD9A 1CA0B 2VIWA 4AX9H 3LJOA 1L4ZA 2GKVE 4UEHH 4X8SH 3C1KA 1ZOMA 3ATLA 1C1RA 1GVLA 2JETC 4AFZA 1OKXA 5A0AE 1E36B 2O8MA 4BTIB 5B6LA 1XUKA 1SGIB 1ARBA 4D9QA 5FX6A 5F8ZA 1YF4A 4Q7ZA 4YESB 1BTHH 1TA2A 3VB7A 4X6PA 3LGIA 3E91A 1C9TA 2J95A 4K2YA 4WMDA 1P01A 1ID5H 1YWUA 1AHTH 3V12A 3RDZA 1TRMA 2SGEE 1ETRH 4B75A 1O31A 1O2PA 4K5ZA 1YC0A 1TNIA 1CU1A 4AN7A 2BDIA 2XRCA 2IN2A 2AMDA 1HNEE 5JB8S 2P94A 1SQTA 5JBCS 3F2FA 3MU4A 3OAAD 4CREA 4Z6AH 3UB0A 4XBDA 2VVCA 4OS5A 3QGJA 5A8ZA 3LGUA 1MKXK 3Q76A 3GCHC 3A8AA 1IQIA 3D23A 1SL3A 3QTOH 1QJ1B 5DSFA 1HAXB 5DO4H 1LMWB 3RMLH 1ZPCA 1A5IA 4IN1A 4OS1A 2HOBA 1FAKH 5JPMH 2OBQA 1G9IE 3GY7A 1ESBA 1O5EH 2WPMS 3UWIA 1DY9A 1TGTA 1O2KA 2ZO3H 2FI5E 4CHAC 1EJAA 2QYIA 3K6YA 2WHXA 2ZA5A 1CGIE 1UTKA 3CENA 2ALVA 3VB3A 1AIXH 4P00A 2F9PA 1P9UA 2ZHQH 1BTWA 3O8BA 3BTKE 4F4OC 3LGTA 1MU6B 2ZFPH 4TWYA 2PKSC 1DWCH 2QIQA 1DSTA 1DXPA 1WOFA 2A31A 5GCHG 1GMHF 1F2SE 2A2QH 1H9HE 1PYTC 4WJG2 1GHAG 2KR7A 2SNWA 1CT2E 3PMJA 3VXEH 4WMEA 1L0ZA 1QNJA 2YMSB 5A8YA 1ARCA 4NIYA 5FPSA 1RJXB 1E0FD 4ZHMU 4F55A 1SBWA 2VWOA 4O9VA 1QRZA 3LDXH 1QBNA 1SVPA 3EA7A 5E2PA 1ELBA 1BMNH 3RU4D 2PHBA 2ZECA 5AVDA 1O5BB 4AC9A 1OWIA 3M7UA 8LPRA 1A61H 3FZDA 4K1SA 1KXCA 2P3UB 3A87A 1OWDA 1TB6H 5F6MA 1LKBA 1THRH 1Z71A 1EP6A 4B76A 1NU7B 5FHTA 1MKWH 2HGTH 5DJ7A 1HAOH 1ZSKA 4CRBA 1BTPA 1OPHB 1V2TT 2WZQA 1FY5A 1ANCA 1WXRA 3ZZAA 4HZHA 2FOHA 1HXFH 1OHHD 3SJKA 2BQ7B 2XCFA 5G4BA 1AY6H 4YZUA 1TNHA 1EUFA 3OX7U 2KFWA 1B0EA 3SU2A 1BHXB 2H9HA 4ZHLU 1OYQA 1L1JA 1UK2A 1EAXA 4I8LA 1CGHA 1DPOA 2GZ7A 3HKIB 5ABWA 1FPHH 4MPUA 3SNCA 3A7ZA 4UFFH 4UONA 4XBCA 1UCYK 4X1PU 4YOIA 4WXVA 5EG4A 1LPKB 2W3KA 4RKOB 4KTSA 1DSUA 3SV2H 3ZZDA 4P02A 3SO3A 5KEDA 3O8CA 1KTSB 5BRRE 3PLBA 1UK4A 1RTKA 2L74A 1W2KH 1GCTC 1Q31A 3UPEA 4IGDA 1GG6C 2JJ1D 1KLIH 2AEIH 2P8OC 4Q2KA 1V2PT 1CGJE 1FN6A 1TQ7B 4UD9H 1YCPH 2ZFQH 1FY1A 3FN8A 1TX7A 1C9PA 4ISNA 3W95A 1OYTH 4Y7AA 2R0LA 1HFDA 3SI4H 1GJAB 2UWPA 2BVXH 2V3HH 3RP2A 3EDXB 2R2WU 4AG1A 1MUEB 1ELGA 4BAMB 4ZKNU 4D9RA 3W1EA 1C5NH 2BQWB 1GI3A 1C1UH 3PLPA 5I25A 4ABFA 3GOVB 1C5LH 1BBRK 1S83A 1AU8A 1IQFA 3OE7D 3KYGA 3BTTE 3UUZA 1MU8B 4MPWA 2Q6DA 5A0CA 1PQ8A 1UMAH 3BTGE 4UDWH 1AN1E 1MZAA 5HKKD 1YCPM 4FUGA 3T28A 1C1WH 1TIOA 1O2NA 3MHWU 3ZZ8A 3SI3H 3T27A 2J98A 3SN8A 2ZIQH 3MO6A 1HJAC 3A8DA 2ODPA 3GY3A 1YLCA 4MNVA 3GYLB 1C2EA 1NTPA 2GCTB 4NIVA 1Y5UT 1GMDF 1P09A 2FM2A 3KEEA 4TYDA 2LNCA 1ESTA 2F9NA 2HVYB 3LJJA 1QY6A 2SGFE 1A0JA 1O3IA 2BMGB 1UTQA 1AMHA 1HJ9A 4BAHB 1ELVA 2ZF0H 1TONA 4TSFD 4ZCNA 1P12E 4K1TA 3VB4A 2FMJA 2XYAA 2GJGA 2CGAA 5K0HA 5LPEA 4LZ4B 2Z9GA 1PFXC 2KCAA 1CBWC 1EQ9A 3RXLA 1UTJA 2ZU5A 2JETB 2PWXA 3U28C 2ULLA 4ZHAA 2PLXA 5T6FA 4X8TH 1XVOA 5C5NA 1J15A 5AHGH 2Q1JA 4MDSA 1YPMH 1EZSC 4WH8A 2BB4A 4E7RG 4OGYA 4CRFA 2H1UA 3VFEA 1G3BA 2TRMA 3ENSB 3ZIAD 3M3SA 1A0HB 1O2VA 5FX5A 1OWHA 1QB6A 2QF5A 1MCTA 2O8WA 3QLPH 4I7YH 1NESE 3U1JB 3RM0H 4XDEA 7LPRA 4I8JA 1C4Y2 2ZDMA 4AGJA 1TALA 4IC6A 4GCHF 5ESBA 3MTYA 1FDPA 2A4RA 4XD7D 3DSOA 2R0KA 4DT7B 3T2NA 1O2SA 4KGAA 3RU4E 1DLKB 5C17A 5FAHA 2J38A 1QURH 1E1RD 1C2MA 1ZSJA 5JYIA 2VJ1A 3SJIA 3NRLA 2A2XH 1YKTA 1O3BA 4Y10E 2BX3A 5TCAA 2J34A 4Y8XA 1RRKA 1IQGA 4AZ2B 3GCHB 2XWAA 1EPTA 5EJ1A 2EEKA 1P2IA 3FVFB 2THFB 1YPKH 1WDIA 1SR5C 1DUAA 2FOGA 2QCYA 2GTBA 2OP9A 4YOGA 1LKAA 5EW2H 3KQ5A 2D26C 1MH0A 1NS3A 1D9IA 5C0UA 1SGPE 2VGCB 1W3CA 1SGRE 5GIBA 3A7TA 4X8UH 1G3CA 1ZMNA 4CHAB 2ZDLA 2SGQE 2QGRA 2RA0A 3QGNB 4DIIH 4X1NU 2ZHWH 1ELEE 1C5OH 2K8IA 2W26A 2FX4A 1SMFE 3NXPA 1HDTH 5EIYA 1MQ6A 1P3CA 2VH6A 3ZZ3A 4ABDA 2GMTC 1HB0B 3MU5A 2QF0A 4TPYA 1Z1JA 4O97A 2PKSB 1OWKA 1TPAE 2XNDD 1LCYA 3FAOA 3M5OA 4OS2A 4FVBA 1T7CA 1TA6A 4YT6H 4X6NA 1QJ7B 2CXVA 2RCEA 1O5CB 2BDBA 1O5DH 2PKAA 1SLWB 1Z7KA 2R3YA 3A83A 1IHTH 4FUIA 2WPIS 1Y3WA 4KTCA 1AE5A 2BXTH 3O8RA 1O38A 1P04A 4FXGH 3U8RH 1KY9A 3E0NB 1EOLA 2STBE 3M7TA 1P2MA 3LGYA 1EOJA 1UW7A 5DGJA 4TY7A 5C94A 4JYTA 1E37B 3E6PH 1HAPH 4WF8A 1JIRA 4M7GA 3BG8A 4H6TA 1XX9A 4ASUD 1BMMH 5A8XA 2TGTA 2Q6FA 3OSYA 4BAQB 2G00A 3TK5A 2PGQB 2AH4X 1Y3XA 1G2LA 6LPRA 2FI3E 3PMHB 3KHVA 3RXSA 1P05A 1V2UT 1FLEE 1GJ7B 4Q7XA 2OC7A 1Z8GA 4Z0KA 3A84A 4DT4A 1GI2A 5FXLA 5BPEA 3AW1A 2CV3A 2RDEA 3P8OA 3D49H 2NU4E 2XW9A 3DCLA 1DDJA 3A82A 4XRNA 3HGPA 1CVWH 1HAVA 1V2NT 1FJSA 4ESTE 1MTSA 3MMGA 1FZZA 2PV9B 4ABEA 1ETSH 2BYAX 2GV7A 1WQVH 2XXLA 1YCPK 2PTNA 1GJCB 1H8IH 4FU7A 3P8GA 1O3JA 1P9SA 1G36A 3RXMA 2BD2A 1WCZA 3ZVCA 1DM4B 5J4SA 1IQMA 2BQ6B 2ZDKA 1H9LB 5KGOA 3MQKC 1GI5A 3MWIU 1SHHB 1RTLA 2DE9A 3LH3A 1A5HA 3TITA 2HNTE 2OC8A 1MABB 4X6OA 2AMQA 1EAWA 1GCTB 4WWYA 4ABHA 4Y79A 1O3MA 3BEFB 1MZDA 1GG6B 3UQVA 2ANMH 2P8OB 1K1IA 5A0BA 2LELA 4DOQA 4H6SB 3RXVA 1NFUA 3KQDA 1GJ9B 1QIXB 2D2DA 3L3TA 2ZCHP 1O2TA 1GBHA 1GHZA 4AGKA 2ANYA 3PWBA 3STJA 2B0FA 3UOPA 3NUMA 1LHDH 2FX6A 2J97A 2FOFA 1ELCA 3TK9A 1C1PA 1ELDE 1G32B 3NZIA 4GUXA 1VCPA 4BXSA 4CH8B 1HCGA 4NGAH 2F9BH 1BIOA 1OOKB 2SGDE 1GVZA 2G5NA 3ZVBA 1SFIA 1MMJN 1V2ST 5LH8A 5GCHF 1O2QA 1D6WA 2V6NA 2G51A 3M3VA 1MTWA 1UCYH 1GHAF 3SV8A 2SGAA 6CHAC 4MPXA 2QY0B 3S9AA 1GI0A 5EQQA 2OD3B 2Y6TA 3RLWH 3RXAA 1G37A 2ZP0H 3U8OH 1K28D 2ESTE 2YMSD 4I8GA 1GJ8B 4BANB 1LVBA 4Z1MD 2BDHA 2BZ6H 1BRUP 1HJAB 2EI8A 1TQ0B 2RA3A 3OU0A 1O3LA 1V2WT 4ABIA 2ZHEH 2F9UA 3H5CB 5GWZA 2V7QD 1GJ4H 1MCVA 3U1IB 1HXEH 1CO7E 1W14U 2K1QA 2VVVA 4XOJA 4E7NA 1W8BH 1MBMA 1TBZH 3SOSA 5A2MH 3T26A 3ATKA 3SU1A 1VR1H 2HALA 2BVRH 2Y5FA 1Q2WA 1JMOH 1WSSH 1SFQB 1KYNA 1E38B 4RKJB 5DK1A 1UHBA 1BBRH 4INKA 3SUGA 1CBWB 1PJPA 1P3EA 2BTCE 1AGJA 1MQ5A 2ASUB 7ESTE 1S6FA 2PSXA 1O32A 4A92A 3B9FH 5FPTA 1GHBG 3PRDA 4F49A 3TGKE 2QF4A 4A1XA 2HLDD 1W0KD 2RDLA 1GI9B 1JRSA 1LO6A 4AFQA 5FBIA 1THPB 1OWEA 2XC0A 4FVDA 4IC5A 3LC3A 3PMAB 1UVOA 2BD8A 2XBWA 4KKDA 3HK6B 1RXPA 5T1VA 1S0RA 1H8HD 3VGCC 1HV7A 4DVAU 1XXFA 8KME2 2ZU4A 3UY9A 3LU9B 1OP0A 3RMNH 3TPIZ 1KMHB 2A7CA 2QN5T 1AKSB 4Q4LA 2Y5HA 1DUEA 1ZRBA 1K2I1 2KCPA 2XTTB 3S7KB 1MTVA 2FYRA 1SOZA 1SGDE 3H7OA 1Y59T 1H1BA 1GBFA 2WPLS 4YLQH 4GHQA 4Y0YE 1QA7A 1CA8B 1GBCA 1TBRH 3MH4A 4JZ1A 1FXYA 2ZU1A 2JDID 1GWAA 1WV7H 1GHWH 2PP6A 1FNIA 1NY22 2DE8A 4OS6A 2Q6GA 1L2EA 4LZ1H 3R0FA 3UNSA 3PMBB 3SBKA 3QWCH 1C4V2 1O30A 2ZC9H 1A4WH 4XFQA 1A5GH 2OBOA 5EPNA 2Z9IA 2PGBB 3RXQA 2ZTZA 3TGJE 2FDAA 3PB1E 1VITG 4D7GA 3DUXH 2VGCC 2AERH 2LPRA 2RG3A 2GMTB 3AAUA 4X1SU 2W5EA 1UVSH 4D76A 1D3PB 3QUMP 1NRSH 1AZZA 2QXHA 1BMFD 2Z9KA 1TFXA 2BLOA 1ZHPA 3K9XB 1O3AA 1OP8A 5FBEA 1N8OC 5DKMA 2Y7XA 1BZXE 2TIOA 1AD8H 1YPHC 2CMYA 3F6UH 1GJ6A 1C5SA 4JCNA 2VWNA 5F8XA 3LT3A 2PR3A 3HPTB 2F4LA 2WPDD 3DA9B 2GDDA 1BRBE 4MQAA 1K21H 1AFQB 3SU3A 3UIRA 2FWWA 4DIHH 3F0PA 3GCNA 4HGCA 5CHAC 1YLDA 2XBVA 1ZTKA 1F0TA 1KDQA 1DE7H 1ZJKA 2V0BA 3F2GA 3SV6A 5C67A 2D1JA 2GT8A 2FLBH 3TU7H 1V2VT 1DY8A 4ZKRU 2C8ZB 1XVMA 3GDSA 3ZZBA 1HIAA 2Y81A 3G01A 1UCYE 2TBSA 2Z7FE 3CS0A 4YO9A 1AQ7A 5GJ4B 3MU0A 2FI4E 3BTQE 2C4FH 3QX5H 2DUCA 4XSKU 1SGCA 2C8XB 3ZZ5A 3VXFH 4DY7B 5ETXA 1YPGH 5C5OA 1KXFA 2AMPA 3FO8D 3LOXA 1S85A 4K8BA 1TGBA 1Y8TA 2ZQ2A 2QA9E 4F48B 4IMZA 2Z9LA 4SGAE 5EGMA 1CHGA 3BG4C 2YNAA 4CRAA 1PPZA 3PTNA 1P02A 1QCPA 5EODA 1S82A 3M35A 1W12U 3PROA 4UE7H 2TPIZ 1SPJA 1COWD 4NIWA 3SU0A 1TABE 1GJ5H 5C3NA 3AAVA 1GPZA 2TGDA 3K2UA 3ODFA 3ZVEA 1ETTH 2GD4B 1OWJA 2G52A 3F0OA 1AVGH 2ZGCA 3EYDA 1UTPA 1TRYA 1V2KT 3A88A 2ZDNA 5HXFA 1A2CH 2BY7X 1BBRE 1ELFA 2BOKA 3ELAH 4J2YB 1GHVH 1GI1A 2GCHG 3F9FA 2ZPQA 4CR9A 2GZ8A 2J5UA 1K1JA 4I32A 4B73A 4FUDA 3SNDA 3UR6A 2LP6A 1NRPH 4GAWA 2H2ZA 4DJZB 4B1TA 1H8DH 2OLGA 4HG6A 3L6PA 1HJ8A 2GT7A 2B7DH 3SU4A 7GCHG 2FOCA 4O3UA 5C1YA 2Z9JA 4NFEA 1LDTT 3MO3A 1WTGH 1GBBA 3RXIA 3UNRA 3S7HB 4IW4E 4GVUA 3PV5A 1LHGH 1VCQA 1AWHB 2RFKC 3ZV9A 4A1VA 4Q63A 5HM2A 5HIZA 1P2NA 1SLUB 6CHAB 1K0HA 1C1MA 2P3FH 1MAXA 1MD8A 2O8TA 1NZQH 4U01A 5IK2D 1PYTD 2F9OA 2G4UA 2QAAA 1TGNA 3NPSA 3KQEA 1TGSZ 4NWLA 5EPYA 4ZKSU 4Y8ZA 1JWTA 1XUFA 2ZWLH 4B2BA 3DSGA 2CF9H 2ZHDA 5EJLA 2ZZUH 5EOKA 1O2OA 1ZHRA 3SZEA 4DGJA 3PO1C 1DOJA 3AASA 6GCHF 1ZSLA 4CRDA 1VKYA 1PPEE 3A89A 1QBVH 1XUJA 1JBUH 3KNXA 1C5XB 3TIUA 4YOJA 2HVXA 3ATMA 2M2AA 1FY4A 2M5TA 3BTFE 2L6OA 1O39A 3F3BA 3SGAE 5HYOA 1XMNB 8GCHG 1GL1A 3NKKA 1J14A 5FPYA 1NN6A 2WV9A 1ZJDA 3OYPA 1GJDB 3ZVDA 1D3QB 1BCUH 5CHBA 1PPGE 4DCDA 1GBLA 1YY3A 5DG6A 2BY5X 1ORFA 1ZGVA 1GDUA 4MNWA 1O3GA 3EA9A 2ILNA 2BOHB 4BTUB 1ZLRA 4X0WU 1E34B 3TH4H 1NO9H 4KELA 4X2VA 5DP4A 1AB9C 3ATWA 5C20A 5AF9H 4JYUH 2JIZD 1FONA 1O2RA 3MNXA 2GV6A 1TMBH 2H9TH 3VGCB 1IQLA 3U8TH 2KAIA 4RI0A 3SV9A 1HAYB 1O3OA 1T8MA 2VH0A 2IPHA 3RXCA 2XWBI 4JZFH 4A5TS 5E0GA 2FXRA 1GMCF 2F83A 3MOCA 2IPQX 2QV1A 4MLFB 4WXIA 4YTAA 4TT3D 3A7XA 2ZG0H 4MVNA 3MFJA 2VU8E 3FKSD 2H6MA 1O35A 2A5KA 3D65E 2J2UA 3ITIA 1EPTC 3SORA 5AFYH 4K60A 1RIWB 5E8EH 1F92A 1NU9A 1FPCH 1WU1A 2PTCE 1TPSA 4AYVB 5T6DA 1ANDA 1NRQH 2ZPRA 1G30B 2ZDAH 4LXBH 3TH2H 4ZROA 1EKBB 1UVPA 1Z1IA 3ZYDA 4YXWD 1KXEA 3PYHA 1HBTH 2FIRH 3RXUA 4A7IB 1LHCH 1F5RA 3SJOA 1GHXH 1TRNA 1O3PB 2A7JA 4FUBA 1O3NA 1VCWA 3Q00A 4K69A 4AOQA 1GVKB 1FY8E 2BDGA 5AFZH 2BXUH 1KXBA 2Y80A 2FP7B 1V2OT 1N8OB 1PQ7A 4B2AA 2SGPE 1KLTA 1QZ8A 5LPRA 1UTOA 4WVPE 1D3TB 1DITH 5ESTE 1QQUA 2XBYA 4ZAEA 1P2KA 2P16A 4Y11E 1BB0B 4X6MA 1EZXC 5HM9A 2P95A 1O2YA 3ZZCA 1YPLH 1FQ3A 1K1NA 4NSYA 2XBXA 3A81A 2O8UA 3R3GB 1UO6A 2P93A 3OY5U 3V0XA 3GY2A 1XUGA 4GPGA 5L6NH 1K9OE 1LQEA 5I46H 1KLJH 5CHAB 1NBMD 4Y6DA 3PTBA 3SUEA 3MNSA 1D3DB 4B6FA 5T6GA 4ZH8A 1QL7A 4FETA 4H4FA 4FUFA 2J4IA 4A6LA 2ZI2H 1GHBF 2FZZA 1KXAA 2A0QB 1SLVB 1AFQC 1LPZB 1O2GH 6GCHG 1ABJH 3B8JA 2BD4A 2ZFFH 3F68H 3ODDA 3SQHE 2ZPSA 1E35B 2C90B 4JZEH 2ZGHA 3B23B 3QZRA 1LVYA 2G5VA 1N6XA 3SU5A 1W10U 4ACAA 4MTBA 3M7QA 3S9CA 5EXLA 5GPIB 4YM9A 4IS5A 1O3DA 2ODYB 2HLCA 5L2ZH 3GCTG 3BG4B 3VEQB 3DD2H 1UVTH 4RT0A 2AGEX 2FOAA 2UUFB 3PRBA 2JH5D 3P70B 1EP5A 1H8ED 2O9QA 4J1YA 1A0LA 1GI6A 3O8DA 5HGGA 4FUEA 4ABJA 1C5TA 1O2XA 2FOEA 4NZQA 5F53A 3OTJE 1TPOA 2J94A 4B74A 1UVUH 1V2MT 2AS9A 1QFKH 1P03A 3KIDU 1YBWA 1O2LA 1TMUH 1LTOA 3ZVGA 3OFND 1MTNC 3P17H 1ESAA 3LH1A 2B5TB 2Z6BD 2BY9X 3TJOA 1OP2A 3VB6A 3Q77A 1TOMH 1TBQH 3V3MA 2OQ5A 2JKHA 2ZHFH 1HAZB 1BT7A 2XC5A 4VGCC 1SG8B 2A5AA 1CHOF 2C3SA 4HI3A 1GBJA 3LGWA 1VITF 1WYKA 1INCA 1Y5AT 4K1EA 1PPCE 4ISIH 1SSXA 2H9EH 5DP3A 1C1NA 3EQ0H 5C1UA 3N7OA 4LOYH 1DWEH 5EQRA 2FPZA 3TNSA 1GMCG 3BTDE 2CF8H 2HPPH 4TY6A 1IQKA 1W7GH 3DFLA 4D7FA 1YGCH 4MNXA 3A7VA 3M37A 1PQAA 1N6YA 1TLDA 4ABBA 3E1XB 4YT7H 2ZTXA 2WPKS 2QXGA 4AB9A 4ZUHA 1S5SA 2W7SA 3BIVH 1Z6JH 5E2OA 4AG2A 5F8TA 1DWDH 5DP9A 3ZZ9A 3GY8A 3LGVA 1G2MA 3DSPA 4X1RU 1NRNH 1SGEE 1DLEA 2VINA 3PO1B 5E0HA 1T31A 4GLYA 3RM2H 5L2YH 2NU0E 4UFEH 5EU8A 1C1SA 2J98B 2V3OH 1C5VA 1TOCB 1P06A 1O0DH 1BTYA 2FESH 1NM6A 1J17T 1XXDA 3UQOA 2FTLE 3VB5A 3MU1A 2BVSH 3BIUH 3D62A 1B0FA 4I33A 3A80A 5KECA 3ZZ7A 3FP7E 1MTUA 2CJIA 1WTHD 2JJ2D 2ZGXH 3L33A 2W3IA 3RMMH 1O3KA 2FTMA 4NWKA 1S6HA 2ZU3A 1C5YB 3RU4T 5DN6D 2EC9H 2BD5A 1GI4A 1BTUA 3P6ZB 1ZGIA 5FL7D 1VZQH 2VIOA 1O36A 2VIDA 5DPAA 1O2HA 4E05H 5H4IB 3TLOA 1O3FA 2OK5A 1T8NA 5LPFA 3SJ8A 4ISOA 1EB2A 1AB9B 1GHYH 1NRRH 3A85A 3RUOA 1O5GH 3S9BA 1EAUA 4U30A 2YNBA 3V7TA 3OTPA 3SNEA 3VPKA 3DT0H 2O8LA 3MYWA 1WQSA 2ZGBH 3M5LA 1O2JA 1V2RT 1AI8H 1GBTA 3UNQA 2BD7A 1BDAA 2A5IA 3TK6A 1TAWA 3E90B 1M9UA 1ANEA 3BEIB 1MD7A 1F7ZA 9ESTA 4R0IA 1X7AC 2OC0A 1HLTH 1QR3E 2GCHF 1GBDA 4BAKB 3M3TA 5SGAE 1NBME 4B71A 3MNBA 4E06H 2LIZA 2R3UA 3WWFA 2A4GA 1J8AA 4KP0A 1E1QD 1BMAA 1PQ5A 2ALPA 1QTFA 1UTNA 1GI7B 7GCHF 4QT8C 2A4OA 5JB9S 1C1OA 1SGTA 3QZQA 1EPTB 4CRCA 1DANH 3PV4A 3ZZ6A 1O3HA 4A1TA 4M9FA 1JXPA 2F9VA 1SQOA 1EJNA 1TX6A 1OSSA 2PUXB 3KYFA 3QO6A 3V13A 4INHA 1DICA 7KMEH 3LPRA 2PW8H 3RXHA 3GY5A 4NA9H 2KM0A 1CQQA 3PM3A 3A86A 1QHRB 1GCDA 3PLKA 2NWNA 2IJOB 1RIWC 4GSOA 1AZ8A 4Y71A 2NU1E 2WUCA 3S0NA 3E0PB 4NFFA 4B2CA 3EGKH 1BRAA 4B6EA 1SKYE 5GDSH 1TMTH 2WINI 2K7XA 1LHFH 1VGCC 2UWOA 1C1TA 2BY6X 3BTHE 3RXBA 1T8OA 2BZAA 1Z8RA 1S81A 1TNGA 2ZFSA 1CHOG 3F9EA 1C5QA 4BAOB 5E0JA 1LPGB 5FCKA 1SGQE 1QB1A 2KCYA 1Z6EA 6ESTA 1P11E 1A1RA 1TNJA 4BNRA 4OGXA 1L1NA 4SGBE 1G3EA 3TJUA 1GL0E 2ZCKP 1ZHMA 2ZFTA 2WV4A 1DX5M 2PKAB 4FU9A 4NG9H 2FYQA 5JBTA 1T8LA 8GCHF 3ZVFA 1KIGH 3KF2A 5C1XA 1TYNA 4NA8A 1S6LA 1EJMA 3KN2A 1K1OA 1NPMA 4Y7BA 3BEUA 4BXWA 4DW2U 5DP6A 1XUIA 3SGQE 2OINA 4DURA 3ZV8A 3RXOA 2CHAC 4I8HA 2NU2E 2TGPZ 2VVUA 3I29A 2A32A 3QN7A 1OX1A 2KCOA 3H09A 1NROH 1EATA 4NA7A 4RT1A 3ZVAA 2Z3DA 4IBLH 3SHCH 2QE7D 1RD3B 3JZ2B 3SQEE 3F9HA 1BJVA 1CT0E 1PPFE 3SUDA 5JBBS 1K1LA 4AFUA 1YLNA 4JMYA 1BA8B 3SHAH 1SHYA 1BJUA 1K22H 1TGCA 2Y82A 2OC1A 3A8BA 4X2YA 5CMXH 1HYLA 4ABGA 1V2JT 1C2IA 1K1MA 2G55A 2F91A 1O2WA 1QA0A 1HAVB 4AYYB 2SFAA 3BTEE 4KTUA 1A46H 1VJAU 1IQNA 1W13U 2NU3E 3EBNA 2P3TB 2XNIA 3SZNA 1O5FH 3GDVA 3BV9B 3FANA 1ANBA 1O2UA 1MTNB
chains in the Genus database with same CATH topology
2GDEH 3NCLA 2UWLA 5EQSA 1ABIH 1C5UA 2ANKH 2A45B 3EA8A 1C5MD 1BITA 1HAHH 3T25A 3GY6A 3GCOA 5CE1A 3ATIA 3C27B 2B8OH 1Y3YA 4VGCB 2HNTC 3UR9A 3RXPA 1SC8U 2ZTYA 4CBNA 3FP8E 4H42U 4Q7YA 1XUHA 2YOLA 1F5KU 3P92A 2IOTA 1P10A 1Y3UA 2ANWA 1A3BH 1IOEA 2ZDVH 1GI8B 1OS8A 4JK5A 1D4PB 2STAE 4TPIZ 2FS9A 5JDUB 5B6OA 2J9NA 1N1LA 4WH6A 4X8VH 1OXGA 2EI7A 1CT4E 3FP6E 3GDUA 1Z8JB 3MH5A 3P8FA 1L1GA 2PUQH 1NT1A 1GDNA 3EE0B 3RLYH 2AIQA 3GYMA 2ZGJA 1ELAA 2ZFRH 1FIZA 2AFQB 4I31A 1YYY1 3M36A 3WY8A 3IITA 1JOUB 4MG3A 2UUKB 1SB1H 2A1DB 3SU6A 2VIVA 2BDAA 1U6QA 1DT2A 4CRGA 1W7XH 2BLVA 3TGIE 1YP9A 1C2KA 1DFPA 1TNLA 2HPQH 2JH0D 1O2IA 5TJXA 1NFXA 4NCYA 1ZTLA 2B9LA 3F9GA 2ZEBA 1YM0A 1JRTA 4RN6A 1C2FA 1HGTH 3U9AH 2GP9B 2HNTF 3UTUH 1UTLM 3MO9A 1ACBE 3BSQA 4Y76A 3FZZA 1RTFB 3STIA 3SJ9A 1MBQA 3RXGA 4X2WA 3MI4A 1VJ9U 4X2XA 1SGNE 2H5CA 4RSPA 3NK8A 3GCTF 4GHTA 2R2MB 2QXIA 3RXRA 4ISHH 1UHBB 3Q3YA 4U2WA 2C93B 1S84A 2Z94A 1J9CH 1SGFA 1HPGA 3P95A 1KTTB 1MAYA 4NZLA 1AWFH 2BDCA 2W7UA 1FMGA 1C1VH 1GBAA 1DS2E 1RGQA 2HRVA 2FLRH 1BQYA 1HUTH 1IQHA 1F0SA 1WAYB 1QL8A 1ZPZA 2OUAA 4JZIA 2QC2A 2VIQA 1GGDB 1W0ZU 1FY3A 3H7TA 1P57B 3ZZ4A 1O2ZA 3T62A 1GMHG 2EI6A 3RC4A 3EAJA 4Y0ZE 1C2LA 3RXEA 1P0SH 1SGYE 4ZXYH 1RS0A 2G81E 4Y8YA 1B7XB 1FI8A 2C8YB 2FOMB 5IDKA 1AE8H 2G8TA 2QXJA 4CR5A 3KQBA 1QL9A 3RXKA 1P2JA 5A09A 1CSOE 1WUNH 4FUCA 1CA0C 3QTVH 2F3CE 2R9PA 4DG4A 3URDA 1NC6A 1V2LT 1ZR0A 3RXTA 3RXJA 3ZYEA 3BTWE 1AUJA 1ZYOA 3RXDA 5C2ZA 3NWUA 1IHSH 2D8WA 3KQCA 1ZRKA 1T4UH 1HRTH 1LVMA 2UUJB 4K8YA 5GXPA 3Q3XA 2BDYA 1FIWA 1VGCB 3DFJA 1EXFA 1C5WB 1V2QT 1RFNA 1P2OA 3SNAA 1O33A 2OCVB 1XM1A 4IN2A 2BLWA 1QRXA 1A7SA 1O3EA 1AKSA 3OY6U 1DWBH 2BY8X 1NFWA 1THSH 1C2DA 4O03A 1GBMA 1ZTJA 2HWLB 2JH6D 4ASHA 4OS7A 2CN0H 1SI5H 2ZKSA 1GBKA 4UFGH 3LONA 3KCGH 1SLXB 3K6ZA 1NFYA 3DHKH 2BHGA 4NSVA 3SV7A 3UREA 2QF3A 1O34A 4UFDH 4BTTB 3K65B 4LK4A 5EW1H 1C2GA 2CHAB 3HGNA 1LHEH 2XC4A 1AO5A 1F0UA 1BUIA 2OXSA 2Y5GA 3A7WA 1Q3XA 1EAIA 2C8WB 3HATH 4XE4A 3HK3B 1KDQB 3SNBA 4AFSA 1KSNA 1P8VC 3KL6A 3MU8A 3JZ1B 2VB0A 4XBBA 2AGIX 1HIAB 4IMQA 2GX4A 1MKXH 3RXFA 5EXMA 1V6DA 3MH7A 1FUJA 3RMOH 1O5AB 3A7YA 4MPVA 1YPHE 1F5LA 2WYGA 2FO9A 1MKWK 3T5FH 1C5RA 1AFEH 1W0YH 1AVXA 4TWWA 4Q80A 1F0RA 1PPBH 1ZPBA 1BTXA 4FUJA 1EZUC 3BN9A 1QRWA 5FCRA 2J92A 2WV5A 4FUHA 5DP8A 2Y7ZA 1KXDA 1DVAH 5F03A 3P8NA 4ZMAH 3AW0A 1GBEA 1C2JA 3BTME 2FEQH 2ZNKH 3AVZA 1P2QA 2A7HA 3TJNA 1B5GH 3FFGA 1TX8A 2BD3A 2AIPA 1LVOA 1GJBB 1LQDB 2VIPA 4FU8A 4CH2B 1BTZA 1QB9A 5LGOA 2FOBA 3IG6B 1D6RA 1Y5BT 1K1PA 2G4TA 3U98H 2WYJA 1GDQA 4O3TA 1BRCE 1GMDG 1O37A 5T3HA 1W11U 1PPHE 1ZMJA 3TH3H 1ELTA 3QK1A 2Z3CA 3LIWA 3RC5A 1C2HA 4OS4A 3IWMA 1EX3A 2I6SA 4JZDH 1QQ4A 5J4QA 3SGBE 1XKBC 3M61U 1TNKA 3GISB 4K3JA 2OTVA 1TPPA 3URCA 2AYWA 1O3CA 4CBOA 1HAGE 2VWMA 1Y3VA 1J16A 1A3EH 3UFAA 1V3XA 3MH6A 5K7RA 1O2MA 9LPRA 3PWCA 2P59A 3S69A 5L30H 1EZQA 2EA3A 2ODQA 3M5NA 2TGAA 1C1QA 1ZMLA 3W94A 2OQUA 4YLUA 1ZZZA 2FS8A 5DP7A 1QJ6B 4ZKOU 1HAIH 3E16B 1EB1H 2ZU2A 1UTMA 2UUYA 3UWJH 1SOTA 3CS7A 4JYVH 1YPEH 3E8LA 4INLA 1SGFG 3I77A 3A8CA 3MNCA 1BOQA 4I8KA 2BX4A 4WMFA 4GCHG 1QGFA 3GY4A 4MNYA 1FAXA 3HKJB 1TE0A 2FODA 2PFEA 4AB8A 1CE5A 8ESTE 1DXWA 2GZ9A 1L4DA 1Z8IB 2Z3EA 3F1SB 4NIXA 1UJ1A 1SQAA 1T4VH 2BLQA 2H5DA 2ZQ1A 5PTPA 1FN8A 5HMAA 2A4QA 2AGGX 2WUBA 3E3TA 4D8NA 1VITH 3TJVA 1C4U2 1XKAC 3LKWA 4AORA 4PROA 2I6QA 2V35A 4ISLA 5DP5A 5JBAS 4ABAA 1IQEA 1FV9A 4U32A 1QBOA 4THNH 1BMLA 1BHXF 2BM2A 3BF6H 3TNTA 3GICB 4JK6A 3SUFA 1T32A 1EASA 3Q3KA 5IYTA 2SNVA 1WBGB 2VWLA 2GGVB 4HTCH 1GBIA 2PSYA 3UOUA 2GVFA 3TVJB 1S0QA 1IAUA 2ZCLP 3QDZB 1JIMA 4R8TB 5EXNA 1AUTC 2WPJS 2WPHS 1UK3A 4ZXXH 1AVWA 3I78A 1C5PA 3U69H 1YPJH 4X1QU 2KAIB 2GCTC 3RC6A 1H4WA 3LC5A 1H9IE 1GGDC 3KGPA 5TCCA 3T29A 3M5MA 1G3DA 1IQJA 3SW2B 4BOHA 4HFPB 3ESTA 4WY3A 1C5ZB 1TWXB 3CP7A 2VNTA 2XCNA 2BD9A 1CA0B 2VIWA 4AX9H 3LJOA 1L4ZA 2GKVE 4UEHH 4X8SH 3C1KA 1ZOMA 3ATLA 1C1RA 1GVLA 2JETC 4AFZA 1OKXA 5A0AE 1E36B 2O8MA 4BTIB 1XUKA 1SGIB 1ARBA 4D9QA 5FX6A 5F8ZA 1YF4A 4Q7ZA 4YESB 1BTHH 1TA2A 3VB7A 4X6PA 3LGIA 3E91A 1C9TA 2J95A 4K2YA 4WMDA 1P01A 1ID5H 1AHTH 3V12A 3RDZA 1TRMA 2SGEE 1ETRH 4B75A 1O31A 1O2PA 4K5ZA 1YC0A 1TNIA 1CU1A 4AN7A 2BDIA 2XRCA 2IN2A 2AMDA 1HNEE 5JB8S 2P94A 1SQTA 5JBCS 3MU4A 4CREA 4Z6AH 4XBDA 2VVCA 4OS5A 3QGJA 5A8ZA 3LGUA 1MKXK 3Q76A 3GCHC 3A8AA 1IQIA 3D23A 1SL3A 3QTOH 1QJ1B 1HAXB 5DO4H 1LMWB 3RMLH 1ZPCA 1A5IA 4IN1A 4OS1A 2HOBA 1FAKH 5JPMH 2OBQA 1G9IE 3GY7A 1ESBA 1O5EH 2WPMS 3UWIA 1DY9A 1TGTA 1O2KA 2ZO3H 2FI5E 4CHAC 1EJAA 2QYIA 3K6YA 2ZA5A 1CGIE 1UTKA 3CENA 2ALVA 3VB3A 1AIXH 2F9PA 1P9UA 2ZHQH 1BTWA 3O8BA 3BTKE 4F4OC 3LGTA 1MU6B 2ZFPH 4TWYA 2PKSC 1DWCH 2QIQA 1DSTA 1DXPA 1WOFA 2A31A 5GCHG 1GMHF 1F2SE 2A2QH 1H9HE 1PYTC 4WJG2 1GHAG 2SNWA 1CT2E 3PMJA 3VXEH 4WMEA 1L0ZA 1QNJA 5A8YA 1ARCA 4NIYA 5FPSA 1RJXB 1E0FD 4ZHMU 1SBWA 2VWOA 4O9VA 1QRZA 3LDXH 1QBNA 1SVPA 3EA7A 5E2PA 1ELBA 1BMNH 3RU4D 2PHBA 2ZECA 5AVDA 1O5BB 1OWIA 3M7UA 8LPRA 1A61H 3FZDA 4K1SA 1KXCA 2P3UB 3A87A 1OWDA 1TB6H 5F6MA 1LKBA 1THRH 1Z71A 1EP6A 4B76A 1NU7B 5FHTA 1MKWH 2HGTH 5DJ7A 1HAOH 1ZSKA 4CRBA 1BTPA 1OPHB 1V2TT 1FY5A 1ANCA 3ZZAA 4HZHA 2FOHA 1HXFH 3SJKA 2BQ7B 2XCFA 5G4BA 1AY6H 4YZUA 1TNHA 1EUFA 3OX7U 1B0EA 3SU2A 1BHXB 2H9HA 4ZHLU 1OYQA 1L1JA 1UK2A 1EAXA 4I8LA 1CGHA 1DPOA 2GZ7A 3HKIB 5ABWA 1FPHH 4MPUA 3SNCA 3A7ZA 4UFFH 4UONA 4XBCA 1UCYK 4X1PU 4YOIA 4WXVA 5EG4A 1LPKB 2W3KA 4RKOB 4KTSA 1DSUA 3SV2H 3ZZDA 3SO3A 3O8CA 1KTSB 5BRRE 3PLBA 1UK4A 1RTKA 1W2KH 1GCTC 1Q31A 3UPEA 4IGDA 1GG6C 2P8OC 1KLIH 2AEIH 4Q2KA 1V2PT 1CGJE 1FN6A 1TQ7B 4UD9H 1YCPH 2ZFQH 1FY1A 1TX7A 1C9PA 4ISNA 3W95A 1OYTH 4Y7AA 2R0LA 1HFDA 3SI4H 1GJAB 2UWPA 2BVXH 2V3HH 3RP2A 3EDXB 2R2WU 4AG1A 1MUEB 1ELGA 4BAMB 4ZKNU 4D9RA 1C5NH 2BQWB 1GI3A 1C1UH 3PLPA 5I25A 4ABFA 3GOVB 1C5LH 1BBRK 1S83A 1AU8A 1IQFA 3BTTE 3UUZA 1MU8B 4MPWA 2Q6DA 5A0CA 1PQ8A 1UMAH 3BTGE 4UDWH 1AN1E 1MZAA 1YCPM 4FUGA 3T28A 1C1WH 1TIOA 1O2NA 3MHWU 3ZZ8A 3SI3H 3T27A 3SN8A 2ZIQH 3MO6A 1HJAC 3A8DA 2ODPA 3GY3A 1YLCA 4MNVA 3GYLB 1C2EA 1NTPA 2GCTB 4NIVA 1Y5UT 1GMDF 1P09A 2FM2A 3KEEA 4TYDA 2LNCA 1ESTA 2F9NA 3LJJA 1QY6A 2SGFE 1A0JA 1O3IA 2BMGB 1UTQA 1AMHA 1HJ9A 4BAHB 1ELVA 2ZF0H 1TONA 1P12E 4K1TA 3VB4A 2FMJA 2XYAA 2CGAA 5K0HA 5LPEA 4LZ4B 2Z9GA 1PFXC 1CBWC 1EQ9A 3RXLA 1UTJA 2ZU5A 2JETB 2PWXA 2ULLA 4ZHAA 2PLXA 5T6FA 4X8TH 1XVOA 5C5NA 1J15A 5AHGH 2Q1JA 4MDSA 1YPMH 1EZSC 4WH8A 2BB4A 4E7RG 4OGYA 4CRFA 2H1UA 3VFEA 1G3BA 2TRMA 3ENSB 3M3SA 1A0HB 1O2VA 5FX5A 1OWHA 1QB6A 3QLPH 1MCTA 2O8WA 4I7YH 1NESE 3U1JB 3RM0H 4XDEA 7LPRA 4I8JA 1C4Y2 2ZDMA 4AGJA 1TALA 4IC6A 4GCHF 5ESBA 3MTYA 1FDPA 2A4RA 2R0KA 4DT7B 3T2NA 1O2SA 4KGAA 3RU4E 1DLKB 5FAHA 2J38A 1QURH 1C2MA 1ZSJA 5JYIA 2VJ1A 3SJIA 2A2XH 1YKTA 1O3BA 4Y10E 2BX3A 5TCAA 2J34A 4Y8XA 1RRKA 1IQGA 4AZ2B 3GCHB 2XWAA 1EPTA 2EEKA 1P2IA 3FVFB 2THFB 1YPKH 1SR5C 1DUAA 2FOGA 2QCYA 2GTBA 2OP9A 4YOGA 1LKAA 5EW2H 2D26C 1MH0A 1NS3A 1D9IA 1SGPE 2VGCB 1W3CA 1SGRE 5GIBA 3A7TA 4X8UH 1G3CA 1ZMNA 4CHAB 2ZDLA 2SGQE 2QGRA 2RA0A 3QGNB 4DIIH 4X1NU 2ZHWH 1ELEE 1C5OH 2W26A 2FX4A 1SMFE 3NXPA 1HDTH 1MQ6A 1P3CA 2VH6A 3ZZ3A 4ABDA 2GMTC 1HB0B 3MU5A 2QF0A 4TPYA 1Z1JA 4O97A 2PKSB 1OWKA 1TPAE 1LCYA 3FAOA 3M5OA 4OS2A 4FVBA 1T7CA 1TA6A 4YT6H 4X6NA 1QJ7B 2CXVA 2RCEA 1O5CB 2BDBA 1O5DH 2PKAA 1SLWB 1Z7KA 2R3YA 3A83A 1IHTH 4FUIA 2WPIS 1Y3WA 4KTCA 1AE5A 2BXTH 3O8RA 1O38A 1P04A 4FXGH 3U8RH 1KY9A 3E0NB 1EOLA 2STBE 3M7TA 1P2MA 3LGYA 1EOJA 5DGJA 4TY7A 4JYTA 1E37B 3E6PH 1HAPH 4WF8A 1JIRA 4M7GA 3BG8A 4H6TA 1XX9A 1BMMH 5A8XA 2TGTA 2Q6FA 3OSYA 4BAQB 2G00A 3TK5A 2PGQB 2AH4X 1Y3XA 1G2LA 6LPRA 2FI3E 3PMHB 3KHVA 3RXSA 1P05A 1V2UT 1FLEE 1GJ7B 4Q7XA 2OC7A 1Z8GA 4Z0KA 3A84A 1GI2A 5FXLA 5BPEA 3AW1A 2CV3A 3P8OA 3D49H 2NU4E 2XW9A 1DDJA 3A82A 3HGPA 1CVWH 1HAVA 1V2NT 1FJSA 4ESTE 1MTSA 3MMGA 1FZZA 2PV9B 4ABEA 1ETSH 2BYAX 2GV7A 1WQVH 2XXLA 1YCPK 2PTNA 1GJCB 1H8IH 4FU7A 3P8GA 1O3JA 1P9SA 1G36A 3RXMA 2BD2A 1WCZA