2Q6GA

Crystal structure of sars-cov main protease h41a mutant in complex with an n-terminal substrate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
305
structure length
305
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRAVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords severe acute respiratory syndrome coronavirus (SARS-CoV)
publication title Structures of two coronavirus main proteases: implications for substrate binding and antiviral drug design.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 82
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2q6gA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2q6gA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2q6gA02
1K28D 3RUOA 2FOGA 1LHFH 1NZQH 3QO6A 4B2CA 1ELVA 1A0LA 4GSOA 1UK3A 2BD7A 3RXOA 2RA3A 1NU9A 1IQIA 1H9IE 1SGQE 5EPNA 1DPOA 4UFDH 2V0BA 1K1MA 1OOKB 1G3BA 5E2PA 3A81A 3EBNA 1TMUH 1W11U 2J9NA 9ESTA 1IQNA 1C1TA 1TX6A 5C1XA 3UIRA 4IC5A 4DT7B 2Y5HA 2BTCE 3PWCA 1GI1A 1J17T 3ATMA 4IMQA 6LPRA 4XBBA 3M5NA 3D49H 1Q31A 3M5LA 2OCVB 1QTFA 1L1NA 1TQ7B 1NM6A 1MZAA 2QYIA 1BBRE 3EE0B 2A4QA 1GI6A 2ZCHP 3AW0A 2HNTF 3NKKA 1MTNC 3KIDU 1BMAA 2R2WU 2LIZA 3Q77A 4X2WA 2QV1A 2GD4B 3OSYA 1YLCA 1C1QA 3QGJA 1Y3VA 5T3HA 2H5DA 1P8VC 2WPLS 2P59A 1D6RA 4D9QA 1UTJA 1S6HA 5EXNA 2BMGB 3FFGA 1LVOA 1TBZH 1Z6EA 4UDWH 1O2OA 1K1NA 3H5CB 2Z9LA 1MQ5A 3SV6A 3GY7A 4FUGA 2AMQA 4YO9A 2O8WA 3A8BA 3SU6A 3AAVA 4UEHH 1RTFB 2XC0A 1ACBE 1HAVA 1B0EA 4GCHG 3A7XA 2PGQB 1INCA 1O3DA 3SZNA 2Z3CA 4WMFA 1N6XA 1GL1A 1O31A 4CRFA 1AVXA 4Y8XA 1C5SA 2P3TB 1O2IA 1O5DH 3SJ8A 1TA2A 5DO4H 1D3PB 1CA0C 2TGTA 4BAMB 1O5BB 2BXTH 3GYLB 4GUXA 3RXIA 3B23B 5BRRE 3O8RA 1BB0B 2G52A 4YESB 1SGRE 4MPVA 1GJ6A 1AO5A 2ZF0H 4H6TA 3RXCA 1OWKA 1FY5A 2GCHF 3U1IB 1S6FA 3W94A 4BNRA 3FP8E 4XFQA 2F91A 4TWWA 1C5UA 4NA9H 1SGIB 2Q1JA 3LC5A 1E0FD 3TITA 2UUKB 1BTYA 1LPGB 3RXEA 2YNAA 1EB1H 1F2SE 1XKAC 3E16B 2AYWA 3ZVEA 1H9HE 2XBXA 2CGAA 3M3TA 1K2I1 1W10U 3GY6A 1SQOA 1VZQH 5F8ZA 4DW2U 3QWCH 1TOCB 4XOJA 1CE5A 3GCTG 3SNBA 3PMHB 2BDCA 2F9BH 4ABDA 2GZ7A 2VGCC 3M7TA 3G01A 4Q80A 1PYTD 4WXIA 1GCTB 1OX1A 3LPRA 3V3MA 3SU4A 2A7JA 4BOHA 1O2NA 2QF3A 1GBJA 1ZHPA 1XXDA 1K1OA 1ZZZA 1SR5C 5HM9A 1C2JA 1V3XA 3ITIA 1MCVA 1C2HA 4TY7A 1OP8A 4ZMAH 1EPTC 4NSYA 1FQ3A 5A0AE 5GJ4B 1MTVA 1C5LH 1NN6A 1SMFE 1N1LA 1YPLH 3TH4H 1HJ9A 1GBEA 1C5VA 2H9EH 3BTWE 1IHSH 1W7GH 1C5MD 1IQKA 2V3HH 1HDTH 1PPHE 2FS9A 2WYJA 3T5FH 1WYKA 1EOLA 3I29A 4K1SA 2ZPRA 2GCTC 3SO3A 2W7SA 2RG3A 2WYGA 2OC0A 4MNYA 1GGDB 1UVTH 2FM2A 1O2WA 1RTLA 2OINA 2QGRA 2W7UA 1LKBA 2TGPZ 2DUCA 1FXYA 3QK1A 1HJ8A 1TRYA 1YPKH 2A5AA 2P8OC 4WMEA 1A61H 4B73A 5AF9H 1GJCB 2ZGBH 4OS6A 1CHOG 3A83A 1S81A 2VVVA 4PROA 1NT1A 4FUFA 4RKJB 1DXPA 2VIPA 2HGTH 2Q6DA 1SL3A 2Z7FE 2TRMA 1P2KA 1YPHE 1S83A 4B75A 5C67A 2FODA 5EPYA 4Q7YA 1THRH 1XUIA 4Y6DA 3BTGE 4Y76A 1K1JA 1J14A 3RC5A 1CU1A 1CA8B 2D1JA 2BM2A 3TK5A 4YLUA 4HTCH 4CRGA 1TLDA 2EEKA 1GHAG 1O2PA 4LXBH 1E35B 1F5LA 5K0HA 4NIWA 1GDNA 1QBNA 1FY1A 1MU6B 1DICA 1J8AA 5F03A 2UUFB 4KP0A 4FUDA 1TNIA 5IDKA 3AASA 2Y5GA 3R0FA 4IGDA 4O3UA 2D26C 2ODPA 1LPZB 2XW9A 2HNTE 2HWLB 6GCHF 2ALPA 2BY7X 3A7VA 1BT7A 3NCLA 5TJXA 1O3EA 1ELGA 2V6NA 1HAGE 3ATIA 1PYTC 1C2MA 1QJ7B 5ESBA 2F9VA 3LONA 2ZHDA 3A82A 8GCHG 1Y5AT 3GY3A 4BANB 3VB5A 4Z6AH 2LNCA 2D8WA 2Q6FA 5I46H 1PPZA 1A5IA 2ZEBA 3LU9B 2FOHA 1Z6JH 3PROA 4HFPB 3BEFB 1TIOA 1TGSZ 1A5HA 2GV7A 3V0XA 1FNIA 2JH6D 1HCGA 2AGEX 3F9FA 1C4V2 2H2ZA 1DFPA 1ETTH 1P11E 5GIBA 1AVGH 1EAXA 1SPJA 3U8RH 4MLFB 1HGTH 1UCYE 3MNBA 3TK6A 1Y8TA 4E06H 5FAHA 3MO3A 2AIQA 5L30H 2PWXA 1UHBB 2BXUH 1GGDC 2VNTA 1F5RA 4X1PU 1P2MA 1IQHA 2PTCE 1GBLA 1BJUA 3FZZA 5E0HA 5EQRA 3LIWA 3LT3A 1TNGA 1SLVB 1CHGA 2G5NA 3LDXH 2VWOA 2J4IA 1AVWA 1P2NA 3ZV8A 1GWAA 4O9VA 4X6OA 3P8NA 2LPRA 1MMJN 2VIVA 2FTLE 2G8TA 7GCHG 3CS7A 3OY5U 4J1YA 4LZ1H 4JK6A 1RIWB 1VGCB 1AWFH 2OC1A 2GGVB 1DY9A 3A89A 4X8UH 3PTNA 1GI4A 1AD8H 3IG6B 1AWHB 4I7YH 3RDZA 4GLYA 3L3TA 4AB9A 1UO6A 1TRMA 1YM0A 2BDIA 2ZCKP 3KEEA 2GMTB 4ISOA 1C5OH 4ZKOU 3BV9B 2BY6X 3UQOA 1FDPA 1W0ZU 1ESAA 3L6PA 2NU3E 3VB6A 3EQ0H 3GYMA 4ABAA 1GJ4H 3RXTA 1DVAH 2XRCA 3M37A 1O2UA 1XXFA 3K6YA 1SI5H 3RXPA 4JMYA 3KQBA 2BD8A 2FOMB 3LGTA 3BTFE 3ZZ6A 2R0KA 1S85A 2ZP0H 2ZA5A 1ZTJA 1GBCA 3TGKE 3SJOA 5EU8A 4FUHA 4JZFH 1C9TA 5K7RA 4IS5A 1GJDB 1OYQA 4IC6A 2K7XA 1VJAU 3A87A 1SSXA 4YLQH 1LPKB 4B1TA 1TALA 1T31A 6CHAB 1HAOH 1QRWA 5DK1A 1E37B 3M3VA 3SV8A 1UMAH 3UWJH 3SJ9A 1UTQA 2NU0E 5DP5A 3MOCA 2QIQA 3AVZA 3KQDA 5LPRA 1UHBA 4E7NA 1O3LA 1SQAA 9LPRA 1ZMJA 4INKA 3OTJE 2TPIZ 3TGIE 1XUFA 2PKAB 4FVDA 3FZDA 4AG1A 1CVWH 3HK3B 3QX5H 1AQ7A 1SOTA 1L1GA 4O3TA 1EZQA 2XBVA 1NY22 1C4U2 4TWYA 3ODDA 1EKBB 2AS9A 3GCOA 1BDAA 1QGFA 1S84A 3SNCA 2AMDA 4MVNA 2UWPA 2P16A 1KY9A 1DLKB 1JRSA 1ORFA 4CRBA 2H5CA 3BEIB 3SU0A 1TQ0B 2ZFPH 1T7CA 2AMPA 1PQ7A 2C3SA 4NGAH 3GCTF 4Y8YA 1UVOA 3P92A 4ISHH 2ANKH 1HNEE 2O8MA 1SGDE 1GHVH 4U2WA 3RMMH 1JIMA 4YM9A 3PTBA 1BJVA 5EW1H 5EQQA 3E0NB 2OP9A 1V2RT 1Z8GA 1C1RA 3QZQA 2HALA 3ATWA 1P2JA 2A7CA 2ZHEH 3JZ1B 4NA7A 1SOZA 1VR1H 3VEQB 1OP0A 1VGCC 1AKSB 1V2VT 4NWKA 1HV7A 1YC0A 1V2JT 2J94A 1OWEA 1BOQA 1O5EH 5A0CA 1SFIA 1MKWK 2GV6A 1SVPA 4Q7ZA 4Z0KA 3TJVA 4WF8A 1L2EA 2XNIA 2FPZA 2FOAA 2DE8A 3KL6A 2GVFA 4X2VA 2FO9A 2GMTC 3UY9A 1GJ9B 1AB9C 3TNTA 2HOBA 3C27B 1HFDA 2GZ8A 2ZPSA 1FI8A 3RXQA 4D76A 1XVMA 4YOJA 1TX8A 2VIQA 1O3NA 1OWDA 3ELAH 4DJZB 1O2HA 4BAQB 1BTPA 3P70B 2UUYA 3CP7A 2PLXA 3ZZCA 3M5OA 2CV3A 1MU8B 4UONA 3A85A 3NXPA 2ZTXA 5FCKA 1SFQB 1HJAC 1O39A 1CHOF 4I8KA 1BCUH 4I32A 2NU4E 2FLBH 1D3TB 4AGKA 5HM2A 3F6UH 3HGNA 3MNXA 3S7KB 2PKAA 2QXIA 5C2ZA 1ZJKA 2F9UA 1MCTA 2CJIA 3S69A 3ENSB 5T6DA 1A2CH 2ILNA 1O2TA 5FBEA 2A1DB 1QB9A 1UTOA 1CT2E 1BIOA 1GDUA 1GI2A 1C2DA 1GVLA 5EQSA 3K9XB 3RU4T 4XDEA 2O8UA 3Q3XA 1NFYA 1GHXH 1KLTA 2BB4A 2SNWA 1NRQH 1C5NH 2W26A 3MH6A 1GHAF 1YGCH 1O3KA 2PKSB 4A1TA 1O2LA 3ZVAA 1UVUH 4ZHMU 1J9CH 1O38A 1O3HA 1YCPK 3LKWA 2BYAX 2UUJB 5GXPA 3LH3A 3RXDA 1LVYA 2ZFRH 4B2AA 4A1XA 2ZGCA 1G9IE 1ELEE 3SI4H 3T62A 1O35A 1AGJA 4ZHLU 1LHCH 1ZYOA 2FWWA 1ZGIA 4INHA 2BQ6B 1AKSA 1P05A 3OYPA 2BD4A 1FPCH 3RU4E 4WVPE 4Q7XA 3STJA 5E2OA 5JPMH 1FY4A 2ZZUH 3UNRA 4D9RA 3F1SB 1C5YB 1ARCA 4X1RU 1GMCF 4KELA 1DXWA 3HKJB 1W2KH 2ANYA 4J2YB 1C1VH 4MTBA 1AFQB 4ZKSU 4BTUB 1GBMA 3MWIU 1CGIE 2BLOA 1EAUA 2PFEA 4X1QU 1GI0A 4A5TS 1O2SA 3LH1A 3T29A 4I8GA 3M36A 2B9LA 3V12A 4CRAA 2ZDKA 1LDTT 1PPEE 1TPAE 2H6MA 5TCCA 2FMJA 2EC9H 1TFXA 1GMDG 3KN2A 4CBOA 2Z94A 4CRCA 1DUAA 4K8YA 3SUEA 1G32B 3KGPA 1HB0B 1TMBH 2A4GA 2XC5A 4WJG2 1GPZA 5LPFA 1C1UH 1VCWA 1LTOA 3PLPA 2ZFTA 1SGCA 1ZSKA 1PPBH 4HGCA 1HBTH 4AORA 1BHXF 1VITH 4YZUA 1TNHA 1Z7KA 3LJJA 3EGKH 1AU8A 3SI3H 3EA7A 5A8XA 3KF2A 2J34A 3SV7A 1XMNB 3E6PH 1OWIA 1Y5UT 3QGNB 4KKDA 3TVJB 1RFNA 2SGPE 4SGAE 4JCNA 4NZLA 4OS7A 1SGYE 2V35A 2FI4E 3EA9A 1HAPH 1W12U 1IQFA 1CT0E 2PHBA 1ETRH 3Q76A 4Y10E 1W13U 4Y7BA 4FUEA 1C5WB 3NK8A 1UK4A 2F9OA 3P8GA 1BTUA 2PKSC 1O33A 2GKVE 4X6PA 3UQVA 3E0PB 1NRPH 3SN8A 1GG6B 1DT2A 2Y80A 1OYTH 2FOBA 1YPHC 1A7SA 4D7FA 4CHAB 1QL8A 4U30A 1EZSC 4NG9H 4ESTE 1ZPBA 3FANA 2ZDVH 4B76A 1KXBA 1KXEA 3MO9A 3PLKA 3ZZ9A 3RM2H 1P3EA 3V7TA 4UFEH 1ELCA 1GI9B 3VGCB 5HGGA 3ZVBA 4TPIZ 1SGPE 2AEIH 3GDUA 2QXJA 4AG2A 1L0ZA 3L33A 3SV9A 1O2GH 1F7ZA 5GPIB 1C2FA 1GBIA 1KTSB 1O2ZA 2RA0A 1D3DB 4Y7AA 3PLBA 3BTEE 1NFWA 1YLDA 5DPAA 1LQEA 4OGXA 4XBDA 3T27A 1AFQC 3MFJA 4RKOB 1GHBG 3PV4A 3ZVGA 3U1JB 1ETSH 4FU7A 2ZDLA 1LVBA 1FY3A 3A84A 3PMJA 1S0RA 3SU3A 1N8OB 1GI7B 2BZAA 3FVFB 3K65B 5C20A 1PPGE 1T8NA 1M9UA 1UTMA 3SNEA 2CXVA 1P04A 1VITG 5FCRA 3BTTE 1O37A 2HLCA 1BRAA 2EI7A 2ZI2H 1IQMA 1XUKA 1GI8B 2QF0A 4CRDA 3MNCA 1A3BH 1V2ST 5JBAS 3MI4A 5DKMA 2GDDA 1F92A 1FAKH 2G55A 1DSUA 2G51A 2TGAA 1IHTH 1AUJA 1V2WT 1G36A 1JBUH 4BAKB 2Q6GA 2WPIS 1S0QA 1ZSJA 1WU1A 1YBWA 2Y7XA 1GI3A 1EAIA 3P17H 4IBLH 4JZIA 2VVUA 4NA8A 3F9HA 3LGVA 3RXVA 1LCYA 1Z1JA 3SHAH 1THSH 1NFUA 4KTUA 1XM1A 2AGGX 2Y81A 1HAXB 1PPFE 1TYNA 4IN1A 3MMGA 5FPYA 1X7AC 1Z1IA 1MAYA 4Y0ZE 1VCQA 1ZRBA 1HUTH 1VCPA 3SQHE 1G2MA 1QB6A 1TGBA 1TPOA 2XXLA 3ZZBA 2BOKA 2Y5FA 5G4BA 1MUEB 1MBMA 1ANDA 5HMAA 2SGEE 3K2UA 3ZVCA 2B0FA 5EXLA 1EQ9A 2BDBA 4AZ2B 1P2QA 1AE5A 4K8BA 4A1VA 1WSSH 4TPYA 1G3CA 2ZU2A 4K5ZA 2BDYA 5JDUB 2A45B 1DLEA 1T4UH 3E3TA 2AGIX 1P9SA 3OY6U 3RXKA 2XBWA 1GCTC 3B9FH 1CQQA 4FXGH 4Q2KA 1N6YA 2SNVA 5CHAB 3BTKE 1C1NA 3ZYEA 1K22H 3UNSA 3MU8A 1NO9H 1C1MA 5DP7A 1V2MT 1O3BA 1DX5M 1O5CB 1LHGH 1O30A 3Q00A 1NESE 1QFKH 2KAIB 3GOVB 4THNH 2ZNKH 3M7UA 1Z8IB 3U9AH 4NIVA 3SGAE 1GMHG 2C90B 3BEUA 1FY8E 3SV2H 5J4SA 1MTSA 4ABGA 1O2YA 1C5PA 1CGJE 2PV9B 5E8EH 2YNBA 1GBTA 4AN7A 4AYVB 1C2LA 1TE0A 1PQ8A 3B8JA 1QL7A 1GI5A 1EAWA 2F9NA 2O8LA 5EG4A 4A6LA 2A2QH 2ULLA 2P93A 1UTKA 1QBVH 1P0SH 3U8OH 2ZHWH 1O3JA 3T2NA 1GL0E 1FZZA 1DY8A 2FOFA 3E91A 3TLOA 2BDGA 2BVRH 3ZZ3A 2BLQA 1SC8U 2HPPH 2BY9X 2WV4A 3PO1B 4SGBE 1IQEA 3TNSA 1BITA 2ODYB 3AW1A 3FP6E 1O3OA 1SBWA 3KHVA 2VWNA 5FX5A 3BN9A 1CT4E 3W95A 2ZTZA 1SGNE 2C8ZB 4ZHAA 2Z9KA 3ZZ4A 4ABFA 3GCHB 2P3FH 1XUHA 2FIRH 1YPGH 2ZDMA 1W14U 1EP6A 1P2IA 2OQ5A 1S82A 4DCDA 3KCGH 1RTKA 4ZAEA 2FS8A 4Y8ZA 1TOMH 3P6ZB 1O3CA 1NC6A 3MH4A 4AOQA 1ID5H 1F0TA 4DOQA 7ESTE 1O34A 2IJOB 1P2OA 2JETB 4FVBA 2XWAA 3DA9B 2ZHQH 3EDXB 1Y3XA 1QQUA 2G4TA 4BTTB 1JOUB 1MD8A 2YOLA 1C5TA 1GMDF 3HKIB 1C1OA 4F4OC 5A0BA 1O2XA 4BAHB 4U32A 5IYTA 2O9QA 3LGUA 3PB1E 2GP9B 1QRZA 2P94A 2VH6A 2ZPQA 1NROH 1QR3E 4GCHF 1Y3WA 2SGFE 1O3GA 1G3EA 2VWLA 2I6QA 8ESTE 2A7HA 2KAIA 1BUIA 2P3UB 4X8VH 4RN6A 1OXGA 1YYY1 5EGMA 1WOFA 1DWBH 1P09A 4DGJA 3UOUA 1QB1A 1BRBE 1C1SA 1FPHH 1KLJH 1AIXH 1MBQA 3DFJA 3RXBA 2VINA 1B0FA 2G00A 3TU7H 3M35A 1H9LB 1C2KA 1ANBA 1C9PA 1W0YH 2QN5T 3A7TA 3ATLA 2XTTB 2G81E 2PGBB 2FOEA 3TJNA 5HYOA 3VFEA 1BRCE 1MKWH 2CF9H 3GY2A 1OWHA 1QHRB 2VIOA 1MTUA 4DIHH 4GHTA 1J15A 1QJ6B 1V6DA 5H4IB 1SGFA 2GT8A 3UWIA 4XBCA 2HPQH 5AVDA 1HRTH 1KTTB 1KXFA 3ZV9A 1XUJA 1ZTLA 3MU1A 2XYAA 1O3PB 2WPHS 3RLYH 1HIAB 4MPUA 3BG8A 2R3YA 3TGJE 2ZQ2A 3MHWU 5F6MA 3STIA 2WINI 2SGQE 2OBQA 2OQUA 3MO6A 3RXAA 4NIXA 3O8BA 1PPCE 4Y79A 2SFAA 2DE9A 3UTUH 4R8TB 1GBBA 1TBRH 3GCHC 2C8WB 1J16A 5GDSH 3CS0A 1ELTA 1RIWC 3IWMA 3AAUA 3HPTB 1CO7E 4NFEA 1AZ8A 1UJ1A 1H4WA 4YOGA 4F49A 3EYDA 5FPSA 3V13A 5A8ZA 5BPEA 5AFYH 1GVKB 1KXAA 2XCNA 5EOKA 1QJ1B 1LHEH 4D8NA 1YCPH 3UPEA 4AFZA 1QA7A 3P8OA 2Z6BD 1TPSA 2QA9E 1Z71A 4GVUA 3MYWA 1IQJA 3E90B 1A5GH 1MTNB 3BSQA 1O3AA 2FZZA 5DP4A 4K69A 1VITF 4TYDA 3SHCH 1NRNH 4GPGA 1YPJH 4I33A 3RXSA 3UR9A 4A7IB 4ISNA 4X6MA 4DURA 3ODFA 1QBOA 1DDJA 4HZHA 4XSKU 4RSPA 4CH2B 7KMEH 2SGDE 1P01A 2QCYA 3P95A 2W3KA 4MPWA 1Q2WA 1CSOE 1OS8A 3RXUA 4GHQA 1TX7A 1ELBA 4B71A 4B2BA 1O3MA 1BMNH 1TA6A 3VB3A 1WBGB 1Y59T 2CMYA 2V3OH 4AFQA 2FOCA 4H4FA 1K21H 1UVSH 1V2PT 2IPHA 4FUJA 3DHKH 3PM3A 1KXCA 3A8DA 4H6SB 3VB4A 6CHAC 1BBRH 2F9PA 2HRVA 4Y0YE 3SOSA 1V2KT 1P12E 3LJOA 2JH5D 1EJNA 1G30B 1WTGH 3MU4A 4ABJA 4ABBA 1DE7H 1CA0B 6ESTA 1CBWB 1HIAA 1QIXB 1GJBB 1BA8B 1Z8JB 1SB1H 5DG6A 2VIWA 1NTPA 3VB7A 4FUCA 3RC4A 4NSVA 2BVXH 4DIIH 5LGOA 1C5XB 1L4DA 3SNAA 2ODQA 1H8IH 2EA3A 2H1UA 1FJSA 4JZ1A 4YT6H 2IOTA 1TMTH 2BLVA 3ZZ8A 2FEQH 1QURH 3LGIA 4INLA 4BAOB 3PWBA 1LMWB 2XCFA 1UTPA 2WPJS 2BDHA 1C5ZB 1G2LA 1K9OE 2B7DH 2VVCA 5C5NA 5DGJA 8GCHF 1UK2A 5I25A 1OP2A 3ZVDA 5DP9A 1BZXE 1LVMA 4MPXA 1SGFG 1RJXB 4WXVA 1GBAA 3RXHA 5A8YA 2A5IA 1AUTC 1ANEA 3P8FA 2FYQA 1TNLA 2BQ7B 2VGCB 3E1XB 2BD5A 1BBRK 3H7TA 2FDAA 2G5VA 1EX3A 3SW2B 1ELDE 1QY6A 2Y82A 2Y7ZA 5A2MH 1NFXA 1O2KA 5L6NH 2G4UA 2D2DA 5JBTA 5EW2H 1GMHF 2QC2A 5DP6A 2W5EA 3O8DA 3SJKA 1NPMA 1YP9A 3URDA 3ZZAA 2FTMA 3BTDE 4CH8B 1C1PA 1OSSA 1EPTB 5FX6A 1FN6A 1BTZA 1MAXA 4X8TH 4BXSA 1T8LA 4XE4A 2UWLA 1TABE 1K1PA 3EAJA 1DANH 1O5FH 2XC4A 4YT7H 3T25A 1DM4B 5DP8A 3BF6H 2ZGHA 2NWNA 3UOPA 1GHYH 2GX4A 1BHXB 3QUMP 3SUDA 4GAWA 1O2JA 2GCTB 1GBHA 4ABEA 1K1IA 1BMLA 1ZHRA 1HPGA 2OTVA 1NRRH 1S5SA 3A8AA 1RD3B 3A8CA 4ABHA 5L2YH 2C4FH 2Z3EA 4ISLA 5AHGH 7GCHF 2OXSA 1CGHA 2XBYA 1V2NT 4QT8C 3M5MA 4D7GA 3S7HB 4WY3A 1YCPM 2HVXA 2P8OB 1GBFA 1XVOA 1TBQH 2AFQB 1NS3A 3E8LA 2ZTYA 1BRUP 1BTHH 1O5AB 4I31A 1GDQA 5CE1A 1EP5A 1P57B 3I77A 1SLUB 1O2RA 1MTWA 1SLXB 1Q3XA 1P10A 2ZGJA 1CBWC 1C4Y2 3TH2H 3Q3YA 2BX3A 2A5KA 1WQVH 3RMLH 1ELFA 3UR6A 4O03A 3GICB 3DT0H 4WWYA 1JWTA 1HYLA 1UTLM 1QL9A 3BIUH 3VXFH 2FX4A 2Z3DA 4DG4A 8KME2 4X6NA 2ZO3H 3RXGA 3LC3A 5ETXA 1Y3UA 2B5TB 4ZXYH 4ZKRU 1DWDH 2PR3A 1F5KU 1H8DH 3MTYA 1GVZA 4I8HA 4OS5A 2C8YB 3RXRA 1DOJA 1C5RA 2QAAA 2QXHA 2BHGA 3MU0A 1P3CA 1FV9A 1AMHA 2QXGA 4OS1A 1GJAB 1RGQA 2ZC9H 1FN8A 1HAZB 2JKHA 1PQAA 3ZZ7A 5T6FA 4ABIA 3SUGA 2ZDNA 4Y71A 4NZQA 4CR5A 1E36B 1KDQB 2BD2A 2HNTC 3SUFA 4UFFH 1MD7A 2FESH 2PW8H 1EPTA 1O0DH 2R2MB 3DFLA 3RP2A 1U6QA 1TAWA 1KSNA 5L2ZH 4KTSA 1C2GA 5F8XA 3UREA 4WH8A 3UNQA 5JBCS 4HI3A 1T32A 2Y6TA 3BTQE 4NCYA 5JYIA 5SGAE 2GT7A 2PUQH 1XKBC 1V2OT 4YOIA 5FPTA 3QTOH 2ZFSA 1ZPZA 3IITA 1KLIH 2J95A 3RLWH 2BD3A 1TNKA 1L4ZA 2PSYA 1QRXA 2FYRA 4IMZA 4LZ4B 1UVPA 2OC8A 3MNSA 3VPKA 1HLTH 2XWBI 4OS2A 4Y11E 1JRTA 1Y3YA 5AFZH 3LGYA 1D9IA 3QN7A 2PSXA 3BG4B 1VJ9U 3NZIA 1HAHH 5FHTA 4AX9H 5FXLA 1EB2A 1WUNH 4BXWA 1DSTA 3S9CA 3RXMA 1RRKA 4TY6A 4AGJA 4ZXXH 5GCHG 2ZFFH 2TIOA 4MQAA 1EXFA 2ZU3A 1O3FA 1ZMLA 1ELAA 2F3CE 2BY5X 1EJMA 1ZMNA 3LGWA 4NIYA 5PTPA 2ZECA 3M3SA 2C93B 1ESBA 2FXRA 1BQYA 1EATA 1KYNA 3PMAB 4DY7B 1E34B 4K1EA 3N7OA 2TBSA 2BVSH 3Q3KA 3I78A 4X1SU 1A4WH 3KQCA 3A86A 1C1WH 1PQ5A 2CN0H 4WH6A 1BMMH 5EODA 1NRSH 1TGCA 5A09A 5C1YA 3LOXA 1EOJA 3TH3H 2OLGA 1IOEA 3HGPA 1GG6C 3SU5A 2ZU4A 2BX4A 2ZHFH 1UCYH 1V2UT 4CHAC 2WV5A 3GY8A 3OU0A 1SHYA 2ANWA 1AY6H 1O5GH 5JB8S 2Z9GA 2NU1E 3ZZDA 1DWEH 3O8CA 3F9GA 3GDSA 4MNXA 1KDQA 4FUBA 3VGCC 1OWJA 2FX6A 1UTNA 2H9TH 4FUIA 5ESTE 3SBKA 2THFB 1A0HB 4FU8A 1HAYB 1ZPCA 2A2XH 1SG8B 1XUGA 1F0SA 2ZG0H 4AB8A 1HXEH 3SNDA 3SU2A 1P9UA 3BTME 4IW4E 1E38B 1ZR0A 3H7OA 2ZU5A 3K6ZA 3ESTA 3U98H 1B7XB 4O97A 1DUEA 1GCDA 1GHZA 1ZTKA 4CBNA 4NFFA 1WV7H 1ZRKA 1GJ8B 1GMCG 3SQEE 3TJOA 5C3NA 1N8OC 2ZDAH 2QY0B 2ZGXH 4MNVA 3GCNA 1P02A 1QQ4A 4MG3A 1EJAA 3D65E 1W3CA 1YKTA 1NU7B 2J92A 4U01A 1SHHB 2PUXB 3SGQE 1UCYK 2ZQ1A 3RM0H 4AYYB 1YPEH 2BY8X 2CHAB 4JYTA 3U8TH 5HXFA 4E7RG 1DWCH 1EASA 3TIUA 3A88A 1D4PB 2VWMA 3KNXA 5FBIA 2RDLA 2VB0A 1AN1E 2A31A 2WPMS 3BG4C 5E0GA 3RC6A 4R0IA 3QDZB 1PFXC 4JK5A 4B74A 1JMOH 1Y5BT 2WUCA 1LHDH 1T8OA 1JXPA 2ASUB 4X1NU 2Z9IA 3OX7U 2RCEA 1SGTA 1DS2E 1FAXA 2FI5E 2TGDA 4X2YA 3S9AA 2VU8E 4JZDH 4K1TA 3NPSA 3TK9A 1OKXA 1EZXC 3MU5A 1O2VA 4KGAA 1F0RA 5JB9S 3D23A 2A32A 2J38A 4OS4A 3A7ZA 3TPIZ 4IN2A 1WQSA 4A92A 2BDAA 2WPKS 4UD9H 3UFAA 1HAIH 1YF4A 2GCHG 3SGBE 4ZKNU 1WAYB 2BLWA 1TWXB 5TCAA 3RU4D 4WMDA 4H42U 2ZFQH 1TONA 4ZH8A 1MQ6A 2BZ6H 1MH0A 1RXPA 4K3JA 2OUAA 3A7WA 4I8LA 1ESTA 1AI8H 1TNJA 3GY4A 4BTIB 2SGAA 2FLRH 2CF8H 1D3QB 3MH7A 3RXFA 3RXLA 3GISB 7LPRA 4AFUA 4LOYH 1AFEH 1LO6A 4ZROA 1O2MA 1W8BH 1C2EA 3KQEA 1GBKA 1O36A 1L1JA 1GHWH 1WCZA 1AB9B 1LKAA 3GDVA 2W3IA 2OBOA 3BIVH 4YTAA 1K1LA 1O2QA 1AHTH 3SJIA 1MKXH 2EI8A 1FUJA 1PJPA 2K1QA 5CHAC 5CMXH 1V2LT 3BTHE 1F0UA 1TGTA 1QA0A 3RMNH 4X8SH 1ZHMA 2F83A 1FMGA 4ZUHA 2BD9A 3GY5A 1HJAB 4ASHA 1TB6H 2B8OH 2VIDA 2C8XB 1G3DA 1XX9A 3C1KA 1FLEE 3PMBB 1B5GH 1FONA 4VGCB 2O8TA 3QTVH 5B6OA 2ZWLH 5DP3A 1HXFH 3URCA 1IQGA 1O32A 2Z9JA 4MDSA 1BTWA 1P06A 1OPHB 1DITH 3R3GB 1T8MA 2CHAC 2WUBA 1IAUA 4FU9A 5ABWA 2STBE 2P95A 4LK4A 1V2QT 2J2UA 3S9BA 4DVAU 1ZLRA 3ZVFA 2OD3B 1ANCA 2BOHB 3PO1C 3RXJA 2PTNA 1W7XH 2R3UA 2AH4X 1FIZA 1H1BA 3U69H 1MKXK 1WTHD 2ZIQH 3VXEH 5J4QA 3M7QA 1A0JA 2FI3E 1A3EH 1SLWB 3DUXH 4KTCA 2ZU1A 1G37A 4OGYA 4AFSA 4CR9A 2A0QB 1BTXA 3CENA 1QNJA 3T28A 4JZEH 4ISIH 2AIPA 5EXMA 1ZGVA 4K2YA 3A7YA 3RMOH 1GHBF 2R9PA 2STAE 1A46H 4X2XA 3FP7E 1EZUC 2JETC 1FIWA 2OC7A 1QCPA 1P03A 1YPMH 1IQLA 1C5QA 3ZZ5A 4E05H 1AZZA 2AERH 2ZCLP 3SORA 2GTBA 8LPRA 5GWZA 2A4OA 3NWUA 5E0JA 3QLPH 2ANMH 2FP7B 2VJ1A 3PYHA 2ZKSA 1AE8H 2JH0D 1ABIH 1D6WA 1KIGH 3HATH 1Z8RA 1JIRA 1LQDB 1GJ5H 2BQWB 4I8JA 4K60A 3JZ2B 5C5OA 2EI6A 3EA8A 1ARBA 1GBDA 1GJ7B 2VH0A 3UUZA 1KXDA 3T26A 1ZSLA 1A1RA 3S0NA 5DJ7A 3DD2H 3A80A 6GCHG 1TGNA 5GCHF 3ATKA 4MNWA 5C1UA 1ZJDA 1SGEE 2I6SA 2R0LA 3MH5A 1RS0A 5F8TA 2GZ9A 3SU1A 4NWLA 4JYVH 1V2TT 3M61U 4M7GA 4UE7H 4CREA 2NU2E 3D62A 1THPB 2H9HA 1ABJH 1TRNA 1HAVB 2A4RA 2M5TA 3FAOA 4VGCC 3ZYDA 1MZDA 2UWOA 4X0WU 3HK6B 1T4VH 1SQTA 1TPPA 5LPEA 1ZOMA 1C2IA 2ESTE 3F68H 1EUFA 4JYUH 3QZRA 5JBBS 2GDEH 3F9EA 2ALVA 2IN2A 1O3IA 5T6GA 3WY8A 5LH8A 3TJUA 4UFGH 3NUMA
chains in the Genus database with same CATH superfamily
1K28D 3RUOA 2FOGA 1LHFH 1NZQH 3QO6A 3PV2A 4B2CA 1ELVA 1A0LA 4GSOA 1UK3A 2BD7A 3RXOA 2RA3A 1NU9A 1IQIA 1H9IE 1SGQE 5EPNA 1DPOA 4UFDH 2V0BA 1K1MA 1OOKB 1G3BA 5E2PA 3A81A 1SQRA 3EBNA 1TMUH 1W11U 2J9NA 9ESTA 1IQNA 1C1TA 1TX6A 5C1XA 3UIRA 4IC5A 4DT7B 2Y5HA 2BTCE 3PWCA 1GI1A 1J17T 3ATMA 4IMQA 6LPRA 4XBBA 3M5NA 3D49H 1Q31A 3M5LA 2OCVB 1QTFA 1L1NA 1TQ7B 1NM6A 1MZAA 2QYIA 1BBRE 3EE0B 3KQ5A 2A4QA 1GI6A 2ZCHP 1QZ8A 1BMFD 1E1QD 3AW0A 2HNTF 3NKKA 1MTNC 3KIDU 1BMAA 2R2WU 2LIZA 3Q77A 4X2WA 2QV1A 2GD4B 3OSYA 1YLCA 1C1QA 3QGJA 1Y3VA 5T3HA 2H5DA 1P8VC 2WPLS 2P59A 1D6RA 4D9QA 1UTJA 1S6HA 5EXNA 2BMGB 3FFGA 1LVOA 1TBZH 1Z6EA 4UDWH 1O2OA 1K1NA 3H5CB 2Z9LA 1MQ5A 3SV6A 3GY7A 2GJGA 4FUGA 2AMQA 4YO9A 2O8WA 3A8BA 3SU6A 3AAVA 4UEHH 1RTFB 2XC0A 1ACBE 1HAVA 3OEHD 1B0EA 3OTPA 4GCHG 3A7XA 2PGQB 1INCA 2J98A 1O3DA 3SZNA 2Z3CA 4WMFA 1N6XA 1GL1A 1O31A 4CRFA 1AVXA 4Y8XA 1C5SA 3F0PA 2P3TB 1O2IA 1O5DH 3SJ8A 1TA2A 5DO4H 1D3PB 1CA0C 2TGTA 4BAMB 1O5BB 2BXTH 3GYLB 4GUXA 3RXIA 3B23B 5BRRE 3O8RA 1BB0B 2G52A 4YESB 1SGRE 4MPVA 1GJ6A 1AO5A 2ZF0H 4H6TA 3RXCA 1OWKA 1FY5A 2GCHF 3U1IB 1S6FA 3W94A 4BNRA 3FP8E 4XFQA 2WHXA 2F91A 4TWWA 1C5UA 4NA9H 1SGIB 2Q1JA 3LC5A 1E0FD 3TITA 2UUKB 1BTYA 3CNRA 1LPGB 3RXEA 2YNAA 1EB1H 1F2SE 1XKAC 3E16B 2AYWA 3ZVEA 1H9HE 2XBXA 2CGAA 3M3TA 1K2I1 1W10U 4RT0A 3GY6A 5IK2D 1SQOA 1VZQH 5F8ZA 4DW2U 3DCLA 3QWCH 3W1EA 1TOCB 4XOJA 1CE5A 3GCTG 3SNBA 3PMHB 2BDCA 2F9BH 4P02A 4ABDA 2F4LA 2GZ7A 2VGCC 3M7TA 3G01A 4Q80A 1PYTD 4WXIA 1GCTB 1OX1A 3LPRA 3V3MA 3SU4A 2A7JA 4ZCNA 4BOHA 1O2NA 2QF3A 1GBJA 1ZHPA 2V3MA 1XXDA 1K1OA 1ZZZA 3U28C 1SR5C 5HM9A 1C2JA 1V3XA 3ITIA 1MCVA 1C2HA 4TY7A 1OP8A 4ZMAH 1EPTC 4NSYA 1FQ3A 5A0AE 5GJ4B 1MTVA 2VBCA 1C5LH 1NN6A 1SMFE 1N1LA 1YPLH 3TH4H 1HJ9A 1GBEA 1C5VA 2H9EH 3BTWE 1IHSH 1W7GH 1C5MD 1IQKA 2V3HH 1HDTH 1PPHE 2FS9A 2WYJA 3T5FH 1WYKA 1EOLA 3I29A 4K1SA 2ZPRA 2GCTC 2AHME 3SO3A 2W7SA 4TT3D 2RG3A 2WYGA 2OC0A 4MNYA 1GGDB 1UVTH 2FM2A 1H8ED 1O2WA 1RTLA 2OINA 2QGRA 2W7UA 4RT1A 1LKBA 2TGPZ 2DUCA 1FXYA 3QK1A 1HJ8A 1TRYA 1YPKH 2A5AA 2P8OC 4WMEA 1A61H 4B73A 5AF9H 1GJCB 2ZGBH 4OS6A 1CHOG 3A83A 1S81A 2VVVA 4PROA 1NT1A 4FUFA 4RKJB 3OAAD 1DXPA 2VIPA 2HGTH 2Q6DA 1SL3A 2Z7FE 2TRMA 1P2KA 1YPHE 1S83A 4B75A 2V7QD 5C67A 2FODA 5EPYA 4Q7YA 1THRH 1XUIA 4Y6DA 3BTGE 4Y76A 1K1JA 1J14A 3RC5A 1CU1A 4B6EA 1CA8B 2D1JA 2BM2A 3TK5A 4YLUA 4HTCH 4CRGA 1TLDA 2EEKA 4F48B 1GHAG 1O2PA 4LXBH 1E35B 3FOAA 1F5LA 5K0HA 4NIWA 1GDNA 1QBNA 1FY1A 1MU6B 1DICA 1J8AA 5F03A 2UUFB 4KP0A 4FUDA 1TNIA 5IDKA 3AASA 2Y5GA 4DT4A 3R0FA 4IGDA 4O3UA 2D26C 2ODPA 1LPZB 2XW9A 2HNTE 2HWLB 6GCHF 2ALPA 2BY7X 3A7VA 1BT7A 3NCLA 5TJXA 1O3EA 1ELGA 2V6NA 1HAGE 3ATIA 1PYTC 1C2MA 1QJ7B 5ESBA 2F9VA 3LONA 2ZHDA 3A82A 8GCHG 1Y5AT 3GY3A 4BANB 3VB5A 4Z6AH 2LNCA 2D8WA 2Q6FA 5I46H 1PPZA 1A5IA 2ZEBA 3LU9B 2FOHA 2WPDD 1Z6JH 3PROA 4HFPB 3VG8A 3BEFB 4XD7D 1TIOA 1TGSZ 1A5HA 2GV7A 3V0XA 1FNIA 3WWFA 2JH6D 1HCGA 2AGEX 3F9FA 1C4V2 2H2ZA 1DFPA 1ETTH 1P11E 5GIBA 1AVGH 1EAXA 1SPJA 3U8RH 4MLFB 1HGTH 1UCYE 3MNBA 3TK6A 1Y8TA 4E06H 5FAHA 3MO3A 2AIQA 5L30H 2PWXA 1UHBB 2BXUH 1GGDC 2VNTA 1F5RA 4X1PU 1P2MA 1IQHA 2PTCE 1GBLA 1BJUA 3FZZA 5E0HA 5EQRA 3LIWA 3LT3A 1TNGA 1SLVB 1CHGA 2G5NA 3LDXH 2VWOA 2J4IA 1AVWA 1P2NA 3ZV8A 1GWAA 3SZEA 4O9VA 4X6OA 3P8NA 2LPRA 1MMJN 2VIVA 2FTLE 2G8TA 7GCHG 3OFND 3CS7A 3OY5U 4J1YA 4LZ1H 4JK6A 1RIWB 1VGCB 1AWFH 2OC1A 2GGVB 1DY9A 3A89A 4X8UH 3PTNA 1GI4A 1AD8H 3IG6B 1AWHB 4I7YH 3RDZA 4GLYA 3L3TA 3UB0A 4AB9A 1UO6A 1TRMA 1YM0A 2BDIA 2ZCKP 3KEEA 2GMTB 4ISOA 1C5OH 4ZKOU 3BV9B 2CK3D 2BY6X 3UQOA 1FDPA 1W0ZU 1ESAA 3L6PA 2NU3E 3VB6A 3EQ0H 3GYMA 4ABAA 1GJ4H 3RXTA 1DVAH 2XRCA 3M37A 1O2UA 1XXFA 3K6YA 1SI5H 3RXPA 4JMYA 5EJZA 3KYGA 3KQBA 2BD8A 2FOMB 3LGTA 3BTFE 3ZZ6A 2R0KA 1S85A 2ZP0H 1E1RD 2ZA5A 1ZTJA 1GBCA 3TGKE 3SJOA 5EU8A 4FUHA 4JZFH 1C9TA 5K7RA 4IS5A 2JJ2D 1GJDB 1OYQA 4IC6A 2K7XA 1VJAU 3A87A 1SSXA 4YLQH 1LPKB 4B1TA 1TALA 1T31A 6CHAB 1HAOH 1QRWA 5DK1A 1E37B 3M3VA 1H8HD 3SV8A 1UMAH 3UWJH 3SJ9A 1UTQA 2NU0E 5DP5A 3MOCA 2QIQA 3AVZA 3KQDA 5LPRA 1UHBA 4E7NA 1O3LA 1SQAA 9LPRA 1ZMJA 4INKA 3OTJE 2TPIZ 3TGIE 1XUFA 2PKAB 4FVDA 3FZDA 4AG1A 1CVWH 3HK3B 3QX5H 1AQ7A 1SOTA 1L1GA 4O3TA 1EZQA 2XBVA 1NY22 1C4U2 4TWYA 3ODDA 1EKBB 2AS9A 3GCOA 1BDAA 1QGFA 1S84A 3SNCA 2AMDA 4MVNA 2UWPA 2P16A 1KY9A 1DLKB 1JRSA 2RDEA 1ORFA 5EIYA 4CRBA 2H5CA 3BEIB 3SU0A 1TQ0B 2ZFPH 1T7CA 2AMPA 1PQ7A 2C3SA 4NGAH 3GCTF 4Y8YA 1UVOA 3P92A 4ISHH 2ANKH 1HNEE 2O8MA 1SGDE 1GHVH 4U2WA 3RMMH 1JIMA 4YM9A 3PTBA 1BJVA 5EW1H 5EQQA 3E0NB 2OP9A 1V2RT 1Z8GA 1C1RA 3QZQA 2HALA 3ATWA 1P2JA 2A7CA 2ZHEH 3JZ1B 4NA7A 1SOZA 1VR1H 1YY3A 3VEQB 3MQKC 1OP0A 1VGCC 1AKSB 1V2VT 4NWKA 1HV7A 1YC0A 1V2JT 2J94A 1OWEA 1BOQA 1O5EH 5A0CA 1SFIA 1MKWK 2GV6A 1SVPA 4Q7ZA 4Z0KA 3TJVA 4WF8A 1L2EA 2XNIA 2FPZA 2FOAA 2DE8A 3KL6A 2GVFA 1NBMD 4X2VA 2FO9A 2GMTC 3UY9A 1GJ9B 1AB9C 3TNTA 2HOBA 3N7DA 3C27B 1HFDA 2GZ8A 2ZPSA 1FI8A 3RXQA 4D76A 1XVMA 4YOJA 1TX8A 2VIQA 1O3NA 1OWDA 3ELAH 4DJZB 1O2HA 4BAQB 1BTPA 3P70B 2UUYA 3CP7A 2PLXA 3ZZCA 3M5OA 2CV3A 1MU8B 4UONA 3A85A 3NXPA 2ZTXA 5FCKA 1SFQB 1HJAC 1O39A 1CHOF 4I8KA 1BCUH 4I32A 2NU4E 2FLBH 1D3TB 4AGKA 5HM2A 3F6UH 3HGNA 3MNXA 3S7KB 2PKAA 2QXIA 3WWBA 5C2ZA 1ZJKA 2F9UA 1MCTA 2CJIA 3S69A 3ENSB 5T6DA 1A2CH 2ILNA 1O2TA 5FBEA 2A1DB 1QB9A 1UTOA 1CT2E 1BIOA 1GDUA 1GI2A 1C2DA 1GVLA 5EQSA 3K9XB 3RU4T 4XDEA 3OE7D 2O8UA 3Q3XA 1NFYA 1GHXH 1KLTA 2BB4A 2SNWA 1NRQH 1C5NH 2W26A 3MH6A 1GHAF 1YGCH 1O3KA 2PKSB 4A1TA 1O2LA 3ZVAA 1UVUH 4ZHMU 1J9CH 1O38A 1O3HA 1YCPK 3LKWA 2BYAX 2UUJB 5GXPA 3LH3A 3RXDA 1LVYA 2ZFRH 4B2AA 4A1XA 2ZGCA 1G9IE 1ELEE 3SI4H 3T62A 1O35A 1AGJA 4ZHLU 1LHCH 1ZYOA 2FWWA 1ZGIA 4INHA 2BQ6B 1AKSA 1P05A 3OYPA 2BD4A 1FPCH 3RU4E 4WVPE 4Q7XA 3STJA 5E2OA 5JPMH 1FY4A 2ZZUH 3UNRA 4D9RA 3F1SB 1C5YB 1SKYE 1ARCA 4X1RU 1GMCF 4KELA 1DXWA 2M2AA 3HKJB 1W2KH 2ANYA 4J2YB 1C1VH 4MTBA 5T1VA 1AFQB 4ZKSU 4BTUB 1GBMA 3GS9A 3MWIU 1CGIE 2BLOA 1EAUA 2PFEA 4X1QU 1GI0A 4A5TS 1O2SA 3LH1A 3T29A 4I8GA 3M36A 2B9LA 3V12A 4CRAA 2ZDKA 1LDTT 1PPEE 1TPAE 2H6MA 5KGOA 5TCCA 2FMJA 1E79D 2EC9H 1TFXA 1GMDG 5HKKD 3KN2A 4CBOA 2Z94A 2KX4A 4CRCA 1DUAA 4K8YA 3SUEA 1G32B 3KGPA 1HB0B 1TMBH 2A4GA 2XC5A 4WJG2 1GPZA 5LPFA 1C1UH 1VCWA 1LTOA 3PLPA 2ZFTA 1SGCA 1ZSKA 1PPBH 4HGCA 1HBTH 4AORA 1BHXF 1VITH 4YZUA 1TNHA 1Z7KA 3LJJA 3EGKH 1AU8A 3SI3H 3EA7A 5A8XA 3KF2A 2J34A 3SV7A 1XMNB 3E6PH 1OWIA 1Y5UT 2JJ1D 3QGNB 4KKDA 3TVJB 1RFNA 2SGPE 4SGAE 4JCNA 4NZLA 4OS7A 1KMHB 1SGYE 2V35A 2FI4E 3EA9A 1HAPH 1W12U 1IQFA 1CT0E 5GNDA 2PHBA 1ETRH 3Q76A 4Y10E 1W13U 4Y7BA 4FUEA 1C5WB 3NK8A 1UK4A 2F9OA 3P8GA 1BTUA 2PKSC 1O33A 2GKVE 4X6PA 3UQVA 3E0PB 1NRPH 3SN8A 1GG6B 1DT2A 2Y80A 1OYTH 2FOBA 1YPHC 3DSPA 1A7SA 4D7FA 4CHAB 1QL8A 4U30A 1EZSC 4NG9H 2WV9A 4ESTE 1ZPBA 3FANA 2ZDVH 4B76A 1WXRA 1KXBA 1KXEA 3MO9A 3PLKA 2WZQA 3ZZ9A 3RM2H 1P3EA 3V7TA 4UFEH 1ELCA 1GI9B 3VGCB 5HGGA 3ZVBA 4TPIZ 2KCYA 3F3BA 1SGPE 2AEIH 3GDUA 2QXJA 4AG2A 1L0ZA 3L33A 2KM0A 3SV9A 1O2GH 2LELA 1F7ZA 5GPIB 1C2FA 1GBIA 1KTSB 1O2ZA 2RA0A 1D3DB 4Y7AA 3PLBA 4YXWD 5EJLA 3BTEE 5DN6D 1NFWA 1YLDA 5DPAA 1LQEA 4OGXA 4XBDA 3T27A 1AFQC 3MFJA 4RKOB 1GHBG 3PV4A 3ZVGA 3U1JB 1ETSH 4FU7A 5HIZA 2ZDLA 1LVBA 1FY3A 3A84A 3ZIAD 3PMJA 1S0RA 3F0OA 3SU3A 1N8OB 1GI7B 2BZAA 3FVFB 3K65B 5C20A 1PPGE 1T8NA 1M9UA 1UTMA 3SNEA 2CXVA 1P04A 1VITG 5FCRA 3BTTE 1O37A 2HLCA 1BRAA 2EI7A 2ZI2H 1IQMA 1XUKA 1GI8B 2QF0A 4CRDA 3MNCA 1A3BH 1V2ST 5JBAS 3MI4A 5DKMA 1COWD 2GDDA 1F92A 1FAKH 2G55A 1DSUA 2G51A 2TGAA 1IHTH 1AUJA 1V2WT 1G36A 1JBUH 4BAKB 2Q6GA 2WPIS 1S0QA 1ZSJA 1WU1A 1YBWA 2Y7XA 1GI3A 1EAIA 3P17H 4IBLH 4JZIA 2VVUA 4NA8A 3F9HA 3LGVA 3RXVA 1LCYA 1Z1JA 2QF5A 3SHAH 1THSH 1NFUA 4KTUA 1XM1A 2AGGX 2Y81A 1HAXB 1PPFE 1TYNA 4IN1A 3MMGA 5FPYA 1X7AC 1Z1IA 1MAYA 4Y0ZE 1VCQA 1ZRBA 1HUTH 1VCPA 3SQHE 1G2MA 1QB6A 1TGBA 1TPOA 2XXLA 3ZZBA 2BOKA 2Y5FA 5G4BA 1MUEB 1MBMA 1ANDA 1YLNA 5HMAA 2SGEE 3K2UA 3ZVCA 2B0FA 5EXLA 1EQ9A 2BDBA 4AZ2B 1P2QA 1AE5A 4K8BA 2W6JD 4A1VA 1WSSH 4TPYA 1G3CA 2ZU2A 4K5ZA 2BDYA 3UAIC 5JDUB 2A45B 1DLEA 1T4UH 3E3TA 2AGIX 1P9SA 3OY6U 3RXKA 2XBWA 1GCTC 3B9FH 1CQQA 4FXGH 4Q2KA 1N6YA 2SNVA 5CHAB 3BTKE 1C1NA 3ZYEA 1K22H 3UNSA 3MU8A 1NO9H 1C1MA 5DP7A 1V2MT 1O3BA 2XOKD 1DX5M 1O5CB 1LHGH 1O30A 3Q00A 1NESE 1QFKH 2KAIB 3GOVB 4THNH 2ZNKH 3M7UA 1Z8IB 3U9AH 4NIVA 2OK5A 3SGAE 1GMHG 2C90B 3BEUA 1FY8E 3SV2H 5J4SA 1MTSA 4ABGA 1O2YA 1C5PA 1CGJE 2PV9B 5E8EH 2YNBA 1GBTA 4AN7A 4AYVB 1C2LA 1TE0A 1PQ8A 3B8JA 1QL7A 1GI5A 1EAWA 2F9NA 2O8LA 5EG4A 4A6LA 2A2QH 2ULLA 2P93A 1UTKA 1QBVH 1P0SH 3U8OH 2ZHWH 3KYFA 1O3JA 3T2NA 1GL0E 1FZZA 1DY8A 2FOFA 3E91A 3TLOA 2BDGA 2BVRH 3ZZ3A 2BLQA 1SC8U 2HPPH 2BY9X 2WV4A 3PO1B 4SGBE 1IQEA 3TNSA 1BITA 2ODYB 3AW1A 3FP6E 1O3OA 1SBWA 3KHVA 2VWNA 3PRBA 5FX5A 3BN9A 1CT4E 3W95A 2ZTZA 1SGNE 2C8ZB 4ZHAA 2Z9KA 3ZZ4A 4ABFA 3GCHB 2P3FH 1XUHA 2FIRH 1YPGH 2ZDMA 4RI0A 1W14U 1EP6A 1P2IA 2OQ5A 1S82A 4DCDA 3KCGH 1RTKA 4ZAEA 2FS8A 4Y8ZA 1TOMH 3P6ZB 1O3CA 1NC6A 3MH4A 4AOQA 1ID5H 1F0TA 4DOQA 7ESTE 1O34A 2IJOB 1P2OA 2JETB 4FVBA 2J97A 2XWAA 3DA9B 2ZHQH 3EDXB 1Y3XA 1QQUA 2G4TA 4BTTB 1JOUB 1MD8A 2YOLA 3F2GA 1C5TA 1GMDF 3HKIB 1C1OA 4F4OC 5A0BA 1O2XA 4BAHB 4U32A 5IYTA 2O9QA 3LGUA 3PB1E 2GP9B 3N7EA 1QRZA 2P94A 2VH6A 2ZPQA 1NROH 1QR3E 4GCHF 1Y3WA 2SGFE 1O3GA 1S6LA 1G3EA 2VWLA 2JIZD 2I6QA 8ESTE 2A7HA 2KAIA 3FO8D 1BUIA 2P3UB 4X8VH 4RN6A 1OXGA 1YYY1 5EGMA 1WOFA 1DWBH 1P09A 5HIYA 4DGJA 3UOUA 1QB1A 1BRBE 1C1SA 1FPHH 1KLJH 1AIXH 1MBQA 3DFJA 3RXBA 2VINA 1B0FA 2G00A 3TU7H 5C17A 4ACBA 3M35A 1H9LB 1C2KA 1ANBA 1C9PA 1W0YH 2QN5T 3A7TA 3ATLA 2XTTB 2G81E 2PGBB 2FOEA 3TJNA 5HYOA 3VFEA 1BRCE 1MKWH 2CF9H 3GY2A 1OWHA 1QHRB 2VIOA 2XNDD 1MTUA 4DIHH 2HVYB 4GHTA 5EJ1A 1J15A 4Q63A 1QJ6B 1V6DA 5H4IB 1SGFA 2GT8A 3UWIA 4XBCA 2HPQH 5AVDA 1HRTH 1KTTB 3OEED 1KXFA 5CDFE 5F53A 3ZV9A 1XUJA 1ZTLA 3MU1A 2XYAA 1O3PB 2WPHS 3RLYH 1HIAB 4MPUA 3BG8A 2R3YA 3TGJE 2ZQ2A 3MHWU 5F6MA 3STIA 2WINI 2SGQE 2OBQA 2OQUA 3MO6A 3RXAA 4NIXA 3O8BA 1PPCE 1YWUA 2KCPA 4Y79A 2SFAA 2DE9A 3UTUH 4R8TB 1GBBA 1TBRH 3GCHC 2C8WB 1J16A 5GDSH 3CS0A 1ELTA 1RIWC 3IWMA 3AAUA 3HPTB 3H09A 1CO7E 4NFEA 4I86A 1AZ8A 1UJ1A 1H4WA 4YOGA 4F49A 3EYDA 5FPSA 3V13A 5A8ZA 5BPEA 5AFYH 1GVKB 1KXAA 2XCNA 5EOKA 1QJ1B 1LHEH 4D8NA 1YCPH 3UPEA 4AFZA 1QA7A 3P8OA 2Z6BD 1TPSA 2QA9E 1Z71A 4GVUA 3MYWA 5DSFA 1IQJA 3E90B 1A5GH 1MTNB 2IJD1 3BSQA 1O3AA 2FZZA 5DP4A 4K69A 1VITF 4TYDA 3SHCH 1NRNH 4GPGA 1YPJH 4I33A 3RXSA 3UR9A 4A7IB 4ISNA 4X6MA 4DURA 3ODFA 1QBOA 1DDJA 4HZHA 4XSKU 2PP6A 4RSPA 4CH2B 7KMEH 2SGDE 1P01A 2QCYA 3P95A 2W3KA 4MPWA 1Q2WA 4XRNA 1CSOE 1OS8A 3RXUA 4GHQA 1TX7A 1ELBA 4B71A 4B2BA 1O3MA 1BMNH 1TA6A 3VB3A 1WBGB 1Y59T 2CMYA 2J5UA 2V3OH 4AFQA 2FOCA 5C0UA 2W6ID 4H4FA 1K21H 2KFWA 1UVSH 1V2PT 2IPHA 4FUJA 3DHKH 3PM3A 1KXCA 3A8DA 4H6SB 3VB4A 1UW7A 6CHAC 1BBRH 2F9PA 2HRVA 4Y0YE 3SOSA 1V2KT 1P12E 3LJOA 2JH5D 1EJNA 1G30B 1WTGH 3MU4A 4ABJA 4ABBA 1DE7H 2L6OA 3NRLA 1CA0B 3DSGA 6ESTA 1CBWB 1HIAA 2L74A 5KEDA 1QIXB 1GJBB 3DSOA 4B6FA 1BA8B 1Z8JB 1SB1H 5DG6A 2VIWA 1NTPA 3VB7A 4FUCA 3RC4A 4NSVA 2BVXH 4DIIH 4OM9A 5LGOA 1C5XB 1L4DA 3SNAA 2ODQA 1H8IH 2EA3A 2H1UA 1FJSA 4JZ1A 4YT6H 2IOTA 2RFKC 1TMTH 2BLVA 3ZZ8A 2FEQH 1QURH 3LGIA 4INLA 4BAOB 3PWBA 1LMWB 2XCFA 1W0JD 1UTPA 2WPJS 2BDHA 1C5ZB 1G2LA 1K9OE 2B7DH 2VVCA 5C5NA 5DGJA 8GCHF 1UK2A 5I25A 1OP2A 3ZVDA 5DP9A 1BZXE 1LVMA 4MPXA 1SGFG 1RJXB 4WXVA 1GBAA 3RXHA 5A8YA 2A5IA 1AUTC 1ANEA 3P8FA 2FYQA 1TNLA 2BQ7B 2VGCB 3E1XB 2BD5A 2YMSB 1BBRK 2HLDD 2FDAA 3H7TA 2G5VA 2YMSD 1EX3A 3SW2B 4FETA 1ELDE 1QY6A 3F2HA 4Z1MD 2Y82A 2Y7ZA 5A2MH 1NFXA 1O2KA 5L6NH 2G4UA 2D2DA 5JBTA 5EW2H 1GMHF 2QC2A 5DP6A 2W5EA 3O8DA 3SJKA 1NPMA 1YP9A 3URDA 3ZZAA 2FTMA 3BTDE 4CH8B 1C1PA 3AK5A 1OSSA 1EFRD 1EPTB 5FX6A 2KZ4A 1FN6A 1BTZA 1MAXA 4X8TH 2F43B 4BXSA 1T8LA 4XE4A 2UWLA 1TABE 1K1PA 3EAJA 4TSFD 1DANH 1O5FH 2XC4A 4YT7H 3T25A 2KR7A 1DM4B 5DP8A 3BF6H 2ZGHA 4M9FA 2NWNA 3UOPA 1GHYH 2GX4A 1BHXB 3QUMP 3SUDA 4GAWA 1O2JA 2GCTB 1GBHA 4ABEA 1K1IA 1BMLA 1ZHRA 1HPGA 2OTVA 1NRRH 1S5SA 3A8AA 1RD3B 3A8CA 4ABHA 5L2YH 2C4FH 2Z3EA 4ISLA 5AHGH 1OHHD 7GCHF 2OXSA 1CGHA 2XBYA 1V2NT 4QT8C 3M5MA 4D7GA 3S7HB 4WY3A 1YCPM 2HVXA 2P8OB 1GBFA 1XVOA 1TBQH 2AFQB 1NS3A 3E8LA 2ZTYA 1BRUP 1BTHH 1O5AB 4I31A 1GDQA 5CE1A 1EP5A 1P57B 3I77A 1SLUB 1O2RA 1MTWA 1SLXB 1Q3XA 1P10A 2ZGJA 1CBWC 1C4Y2 3TH2H 3Q3YA 2BX3A 2A5KA 1WQVH 3RMLH 1ELFA 3UR6A 4O03A 3GICB 3DT0H 4WWYA 5C94A 1JWTA 1HYLA 1UTLM 1QL9A 3BIUH 3EE7A 3VXFH 2FX4A 2Z3DA 4DG4A 8KME2 4X6NA 2ZO3H 3RXGA 3LC3A 5ETXA 1Y3UA 2B5TB 4ZXYH 4ZKRU 1DWDH 2PR3A 1F5KU 1H8DH 1W0KD 3MTYA 1GVZA 4I8HA 4OS5A 2C8YB 3RXRA 1DOJA 1C5RA 2QAAA 2QXHA 2BHGA 3MU0A 1P3CA 1FV9A 1AMHA 2QXGA 4OS1A 1GJAB 1RGQA 2ZC9H 1FN8A 1HAZB 2JKHA 1PQAA 3ZZ7A 5T6FA 5CHBA 4ABIA 3SUGA 2ZDNA 4Y71A 4NZQA 4CR5A 1E36B 1KDQB 2BD2A 2HNTC 3SUFA 4UFFH 1MD7A 2FESH 2QE7D 4Q4LA 2PW8H 2YMSC 1EPTA 1O0DH 2R2MB 3DFLA 2LP6A 1NBME 3RP2A 1U6QA 1TAWA 1KSNA 5L2ZH 4KTSA 1C2GA 5F8XA 3UREA 4WH8A 3UNQA 5JBCS 4HI3A 1T32A 2Y6TA 3BTQE 4NCYA 5JYIA 5SGAE 2GT7A 2PUQH 1MABB 1XKBC 1V2OT 4YOIA 5FPTA 3QTOH 2ZFSA 1ZPZA 3IITA 1KLIH 2J95A 3RLWH 2K8IA 2BD3A 1TNKA 1L4ZA 2PSYA 1QRXA 2FYRA 4IMZA 4LZ4B 1UVPA 2OC8A 3MNSA 3VPKA 1HLTH 2XWBI 4OS2A 4Y11E 1JRTA 1Y3YA 5AFZH 3LGYA 1D9IA 3QN7A 2PSXA 3BG4B 1VJ9U 3NZIA 1HAHH 5FHTA 4AX9H 5FXLA 1EB2A 1WUNH 4BXWA 1DSTA 3S9CA 3RXMA 1RRKA 4TY6A 4AGJA 4ZXXH 5GCHG 2ZFFH 2TIOA 4MQAA 1EXFA 2ZU3A 1O3FA 1ZMLA 1ELAA 2F3CE 2BY5X 1EJMA 1ZMNA 3LGWA 4NIYA 5PTPA 2ZECA 3M3SA 2C93B 1ESBA 2FXRA 1BQYA 1EATA 1KYNA 3PMAB 4DY7B 1E34B 4K1EA 3N7OA 2TBSA 2BVSH 3Q3KA 3I78A 4X1SU 1A4WH 3KQCA 3A86A 1C1WH 1PQ5A 2CN0H 4WH6A 1BMMH 5EODA 1NRSH 1TGCA 5A09A 5C1YA 3PV5A 3LOXA 1EOJA 3TH3H 5KECA 2OLGA 1IOEA 3HGPA 1GG6C 3SU5A 2ZU4A 2BX4A 2ZHFH 2IPQX 1UCYH 1V2UT 4CHAC 2WV5A 3GY8A 3OU0A 1SHYA 3FKSD 2ANWA 1AY6H 1O5GH 5JB8S 2Z9GA 2NU1E 3ZZDA 1DWEH 3O8CA 3F9GA 3GDSA 4MNXA 1KDQA 4FUBA 3VGCC 1OWJA 2FX6A 1UTNA 2H9TH 4FUIA 5ESTE 3SBKA 2THFB 1A0HB 4FU8A 1HAYB 1ZPCA 2A2XH 1SG8B 1XUGA 1F0SA 2ZG0H 4AB8A 1HXEH 1K0HA 3SNDA 3SU2A 1P9UA 3BTME 4IW4E 2JDID 1E38B 4FOUC 1ZR0A 3H7OA 2ZU5A 3K6ZA 3ESTA 3U98H 1B7XB 4O97A 1DUEA 1GCDA 1GHZA 1ZTKA 4CBNA 4NFFA 1WV7H 3PRDA 2WSSD 1ZRKA 1GJ8B 1GMCG 3SQEE 3TJOA 4AC9A 5C3NA 1N8OC 2ZDAH 2QY0B 2ZGXH 4MNVA 3GCNA 1P02A 1QQ4A 4MG3A 4ACAA 1EJAA 3D65E 1W3CA 1YKTA 1NU7B 2J92A 4U01A 1SHHB 2PUXB 3SGQE 1UCYK 2ZQ1A 3RM0H 4AYYB 1YPEH 2BY8X 2CHAB 4JYTA 3U8TH 5HXFA 4E7RG 1DWCH 1EASA 3TIUA 3A88A 1D4PB 2VWMA 3KNXA 5FBIA 2RDLA 2VB0A 1AN1E 2A31A 2WPMS 3BG4C 5E0GA 3RC6A 4R0IA 3QDZB 1PFXC 4JK5A 4B74A 1JMOH 1Y5BT 2WUCA 1LHDH 1T8OA 1JXPA 2ASUB 2KCOA 4X1NU 2Z9IA 3OX7U 2RCEA 1SGTA 1DS2E 1FAXA 2FI5E 2TGDA 4X2YA 3S9AA 2VU8E 4JZDH 4K1TA 3NPSA 3TK9A 1OKXA 1EZXC 3MU5A 1O2VA 4KGAA 1F0RA 5JB9S 3D23A 2A32A 2J38A 4OS4A 4HG6A 3A7ZA 3TPIZ 4IN2A 1WQSA 4A92A 2BDAA 2WPKS 4UD9H 3UFAA 1HAIH 1YF4A 2GCHG 3SGBE 4ZKNU 1WAYB 2BLWA 1TWXB 5TCAA 3RU4D 4WMDA 4H42U 2ZFQH 3F2FA 1TONA 4ZH8A 1MQ6A 2BZ6H 5B6LA 1MH0A 1RXPA 4K3JA 2OUAA 3A7WA 4I8LA 1ESTA 1AI8H 1TNJA 3GY4A 4BTIB 2SGAA 2FLRH 2CF8H 1D3QB 3MH7A 3RXFA 3RXLA 3GISB 7LPRA 1FX0B 4AFUA 4LOYH 1AFEH 1LO6A 4ZROA 1O2MA 1W8BH 1C2EA 3KQEA 1GBKA 1O36A 1L1JA 1GHWH 1WCZA 1AB9B 3SYJA 1LKAA 3GDVA 2W3IA 2OBOA 3BIVH 4YTAA 1K1LA 1O2QA 1AHTH 3SJIA 1MKXH 2EI8A 1FUJA 1PJPA 2K1QA 5CHAC 5CMXH 1V2LT 3BTHE 1F0UA 2KCAA 1TGTA 1QA0A 3RMNH 4X8SH 1WDIA 1ZHMA 2F83A 1FMGA 4ZUHA 2BD9A 3GY5A 1HJAB 4ASHA 1TB6H 2B8OH 2VIDA 2C8XB 1G3DA 1XX9A 3C1KA 1FLEE 3PMBB 1B5GH 1FONA 1VKYA 2O8TA 3QTVH 4VGCB 5B6OA 2ZWLH 5DP3A 1HXFH 3URCA 1IQGA 2QF4A 1O32A 2Z9JA 4MDSA 1BTWA 1P06A 1OPHB 1DITH 3R3GB 1T8MA 2CHAC 2WUBA 1IAUA 4FU9A 5ABWA 2STBE 2P95A 4LK4A 1V2QT 2J2UA 3S9BA 4DVAU 1ZLRA 3ZVFA 2OD3B 1ANCA 2BOHB 3PO1C 3RXJA 2PTNA 4ASUD 1W7XH 2R3UA 2AH4X 1FIZA 3N99A 1H1BA 3U69H 1MKXK 1WTHD 2ZIQH 3VXEH 5J4QA 3M7QA 1A0JA 2FI3E 1A3EH 3FN8A 1SLWB 3DUXH 4KTCA 2ZU1A 1G37A 4OGYA 4AFSA 4CR9A 2A0QB 1BTXA 3CENA 1QNJA 3T28A 4JZEH 4ISIH 2AIPA 5EXMA 1ZGVA 4K2YA 3A7YA 3RMOH 1GHBF 2R9PA 2STAE 1A46H 4X2XA 3FP7E 1EZUC 5C0TA 2JETC 1FIWA 2OC7A 1QCPA 1P03A 2EY4C 1YPMH 1IQLA 1C5QA 3ZZ5A 4E05H 1AZZA 2AERH 2ZCLP 3SORA 2GTBA 8LPRA 5GWZA 2A4OA 3NWUA 5E0JA 4P00A 5FL7D 3QLPH 2ANMH 2FP7B 2VJ1A 3PYHA 2ZKSA 1AE8H 2JH0D 1ABIH 1D6WA 1KIGH 3HATH 2K0QA 1Z8RA 1JIRA 1LQDB 1GJ5H 2BQWB 4I8JA 4K60A 3JZ2B 3WW7A 5C5OA 2EI6A 3EA8A 1ARBA 1GBDA 1GJ7B 2VH0A 3UUZA 1KXDA 3T26A 1ZSLA 1A1RA 3S0NA 5DJ7A 3DD2H 3A80A 6GCHG 1TGNA 5GCHF 3ATKA 4MNWA 5C1UA 1ZJDA 1SGEE 2I6SA 2R0LA 3MH5A 1RS0A 5F8TA 2GZ9A 3SU1A 4NWLA 4JYVH 1V2TT 3M61U 4M7GA 4UE7H 4CREA 2NU2E 3D62A 1THPB 2H9HA 1ABJH 1TRNA 1HAVB 2A4RA 2M5TA 3FAOA 2EQNA 4VGCC 3ZYDA 1MZDA 2J98B 2UWOA 4X0WU 3HK6B 1T4VH 1SQTA 1TPPA 5LPEA 1ZOMA 1C2IA 2ESTE 3F68H 1EUFA 4JYUH 3QZRA 5JBBS 2GDEH 4F55A 3F9EA 2ALVA 2IN2A 1O3IA 5T6GA 3WY8A 5LH8A 3TJUA 4UFGH 3NUMA
chains in the Genus database with same CATH topology
1K28D 3RUOA 2FOGA 1LHFH 1NZQH 3QO6A 4B2CA 1ELVA 1A0LA 4GSOA 1UK3A 2BD7A 3RXOA 2RA3A 1NU9A 1IQIA 1H9IE 1SGQE 5EPNA 1DPOA 4UFDH 2V0BA 1K1MA 1OOKB 1G3BA 5E2PA 3A81A 3EBNA 1TMUH 1W11U 2J9NA 9ESTA 1IQNA 1C1TA 1TX6A 5C1XA 3UIRA 4IC5A 4DT7B 2Y5HA 2BTCE 3PWCA 1GI1A 1J17T 3ATMA 4IMQA 6LPRA 4XBBA 3M5NA 3D49H 1Q31A 3M5LA 2OCVB 1QTFA 1L1NA 1TQ7B 1NM6A 1MZAA 2QYIA 1BBRE 3EE0B 2A4QA 1GI6A 2ZCHP 3AW0A 2HNTF 3NKKA 1MTNC 3KIDU 1BMAA 2R2WU 2LIZA 3Q77A 4X2WA 2QV1A 2GD4B 3OSYA 1YLCA 1C1QA 3QGJA 1Y3VA 5T3HA 2H5DA 1P8VC 2WPLS 2P59A 1D6RA 4D9QA 1UTJA 1S6HA 5EXNA 2BMGB 3FFGA 1LVOA 1TBZH 1Z6EA 4UDWH 1O2OA 1K1NA 3H5CB 2Z9LA 1MQ5A 3SV6A 3GY7A 4FUGA 2AMQA 4YO9A 2O8WA 3A8BA 3SU6A 3AAVA 4UEHH 1RTFB 2XC0A 1ACBE 1HAVA 1B0EA 4GCHG 3A7XA 2PGQB 1INCA 1O3DA 3SZNA 2Z3CA 4WMFA 1N6XA 1GL1A 1O31A 4CRFA 1AVXA 4Y8XA 1C5SA 2P3TB 1O2IA 1O5DH 3SJ8A 1TA2A 5DO4H 1D3PB 1CA0C 2TGTA 4BAMB 1O5BB 2BXTH 3GYLB 4GUXA 3RXIA 3B23B 5BRRE 3O8RA 1BB0B 2G52A 4YESB 1SGRE 4MPVA 1GJ6A 1AO5A 2ZF0H 4H6TA 3RXCA 1OWKA 1FY5A 2GCHF 3U1IB 1S6FA 3W94A 4BNRA 3FP8E 4XFQA 2F91A 4TWWA 1C5UA 4NA9H 1SGIB 2Q1JA 3LC5A 1E0FD 3TITA 2UUKB 1BTYA 1LPGB 3RXEA 2YNAA 1EB1H 1F2SE 1XKAC 3E16B 2AYWA 3ZVEA 1H9HE 2XBXA 2CGAA 3M3TA 1K2I1 1W10U 3GY6A 1SQOA 1VZQH 5F8ZA 4DW2U 3QWCH 1TOCB 4XOJA 1CE5A 3GCTG 3SNBA 3PMHB 2BDCA 2F9BH 4ABDA 2GZ7A 2VGCC 3M7TA 3G01A 4Q80A 1PYTD 4WXIA 1GCTB 1OX1A 3LPRA 3V3MA 3SU4A 2A7JA 4BOHA 1O2NA 2QF3A 1GBJA 1ZHPA 1XXDA 1K1OA 1ZZZA 1SR5C 5HM9A 1C2JA 1V3XA 3ITIA 1MCVA 1C2HA 4TY7A 1OP8A 4ZMAH 1EPTC 4NSYA 1FQ3A 5A0AE 5GJ4B 1MTVA 1C5LH 1NN6A 1SMFE 1N1LA 1YPLH 3TH4H 1HJ9A 1GBEA 1C5VA 2H9EH 3BTWE 1IHSH 1W7GH 1C5MD 1IQKA 2V3HH 1HDTH 1PPHE 2FS9A 2WYJA 3T5FH 1WYKA 1EOLA 3I29A 4K1SA 2ZPRA 2GCTC 3SO3A 2W7SA 2RG3A 2WYGA 2OC0A 4MNYA 1GGDB 1UVTH 2FM2A 1O2WA 1RTLA 2OINA 2QGRA 2W7UA 1LKBA 2TGPZ 2DUCA 1FXYA 3QK1A 1HJ8A 1TRYA 1YPKH 2A5AA 2P8OC 4WMEA 1A61H 4B73A 5AF9H 1GJCB 2ZGBH 4OS6A 1CHOG 3A83A 1S81A 2VVVA 4PROA 1NT1A 4FUFA 4RKJB 1DXPA 2VIPA 2HGTH 2Q6DA 1SL3A 2Z7FE 2TRMA 1P2KA 1YPHE 1S83A 4B75A 5C67A 2FODA 5EPYA 4Q7YA 1THRH 1XUIA 4Y6DA 3BTGE 4Y76A 1K1JA 1J14A 3RC5A 1CU1A 1CA8B 2D1JA 2BM2A 3TK5A 4YLUA 4HTCH 4CRGA 1TLDA 2EEKA 1GHAG 1O2PA 4LXBH 1E35B 1F5LA 5K0HA 4NIWA 1GDNA 1QBNA 1FY1A 1MU6B 1DICA 1J8AA 5F03A 2UUFB 4KP0A 4FUDA 1TNIA 5IDKA 3AASA 2Y5GA 3R0FA 4IGDA 4O3UA 2D26C 2ODPA 1LPZB 2XW9A 2HNTE 2HWLB 6GCHF 2ALPA 2BY7X 3A7VA 1BT7A 3NCLA 5TJXA 1O3EA 1ELGA 2V6NA 1HAGE 3ATIA 1PYTC 1C2MA 1QJ7B 5ESBA 2F9VA 3LONA 2ZHDA 3A82A 8GCHG 1Y5AT 3GY3A 4BANB 3VB5A 4Z6AH 2LNCA 2D8WA 2Q6FA 5I46H 1PPZA 1A5IA 2ZEBA 3LU9B 2FOHA 1Z6JH 3PROA 4HFPB 3BEFB 1TIOA 1TGSZ 1A5HA 2GV7A 3V0XA 1FNIA 2JH6D 1HCGA 2AGEX 3F9FA 1C4V2 2H2ZA 1DFPA 1ETTH 1P11E 5GIBA 1AVGH 1EAXA 1SPJA 3U8RH 4MLFB 1HGTH 1UCYE 3MNBA 3TK6A 1Y8TA 4E06H 5FAHA 3MO3A 2AIQA 5L30H 2PWXA 1UHBB 2BXUH 1GGDC 2VNTA 1F5RA 4X1PU 1P2MA 1IQHA 2PTCE 1GBLA 1BJUA 3FZZA 5E0HA 5EQRA 3LIWA 3LT3A 1TNGA 1SLVB 1CHGA 2G5NA 3LDXH 2VWOA 2J4IA 1AVWA 1P2NA 3ZV8A 1GWAA 4O9VA 4X6OA 3P8NA 2LPRA 1MMJN 2VIVA 2FTLE 2G8TA 7GCHG 3CS7A 3OY5U 4J1YA 4LZ1H 4JK6A 1RIWB 1VGCB 1AWFH 2OC1A 2GGVB 1DY9A 3A89A 4X8UH 3PTNA 1GI4A 1AD8H 3IG6B 1AWHB 4I7YH 3RDZA 4GLYA 3L3TA 4AB9A 1UO6A 1TRMA 1YM0A 2BDIA 2ZCKP 3KEEA 2GMTB 4ISOA 1C5OH 4ZKOU 3BV9B 2BY6X 3UQOA 1FDPA 1W0ZU 1ESAA 3L6PA 2NU3E 3VB6A 3EQ0H 3GYMA 4ABAA 1GJ4H 3RXTA 1DVAH 2XRCA 3M37A 1O2UA 1XXFA 3K6YA 1SI5H 3RXPA 4JMYA 3KQBA 2BD8A 2FOMB 3LGTA 3BTFE 3ZZ6A 2R0KA 1S85A 2ZP0H 2ZA5A 1ZTJA 1GBCA 3TGKE 3SJOA 5EU8A 4FUHA 4JZFH 1C9TA 5K7RA 4IS5A 1GJDB 1OYQA 4IC6A 2K7XA 1VJAU 3A87A 1SSXA 4YLQH 1LPKB 4B1TA 1TALA 1T31A 6CHAB 1HAOH 1QRWA 5DK1A 1E37B 3M3VA 3SV8A 1UMAH 3UWJH 3SJ9A 1UTQA 2NU0E 5DP5A 3MOCA 2QIQA 3AVZA 3KQDA 5LPRA 1UHBA 4E7NA 1O3LA 1SQAA 9LPRA 1ZMJA 4INKA 3OTJE 2TPIZ 3TGIE 1XUFA 2PKAB 4FVDA 3FZDA 4AG1A 1CVWH 3HK3B 3QX5H 1AQ7A 1SOTA 1L1GA 4O3TA 1EZQA 2XBVA 1NY22 1C4U2 4TWYA 3ODDA 1EKBB 2AS9A 3GCOA 1BDAA 1QGFA 1S84A 3SNCA 2AMDA 4MVNA 2UWPA 2P16A 1KY9A 1DLKB 1JRSA 1ORFA 4CRBA 2H5CA 3BEIB 3SU0A 1TQ0B 2ZFPH 1T7CA 2AMPA 1PQ7A 2C3SA 4NGAH 3GCTF 4Y8YA 1UVOA 3P92A 4ISHH 2ANKH 1HNEE 2O8MA 1SGDE 1GHVH 4U2WA 3RMMH 1JIMA 4YM9A 3PTBA 1BJVA 5EW1H 5EQQA 3E0NB 2OP9A 1V2RT 1Z8GA 1C1RA 3QZQA 2HALA 3ATWA 1P2JA 2A7CA 2ZHEH 3JZ1B 4NA7A 1SOZA 1VR1H 3VEQB 1OP0A 1VGCC 1AKSB 1V2VT 4NWKA 1HV7A 1YC0A 1V2JT 2J94A 1OWEA 1BOQA 1O5EH 5A0CA 1SFIA 1MKWK 2GV6A 1SVPA 4Q7ZA 4Z0KA 3TJVA 4WF8A 1L2EA 2XNIA 2FPZA 2FOAA 2DE8A 3KL6A 2GVFA 4X2VA 2FO9A 2GMTC 3UY9A 1GJ9B 1AB9C 3TNTA 2HOBA 3C27B 1HFDA 2GZ8A 2ZPSA 1FI8A 3RXQA 4D76A 1XVMA 4YOJA 1TX8A 2VIQA 1O3NA 1OWDA 3ELAH 4DJZB 1O2HA 4BAQB 1BTPA 3P70B 2UUYA 3CP7A 2PLXA 3ZZCA 3M5OA 2CV3A 1MU8B 4UONA 3A85A 3NXPA 2ZTXA 5FCKA 1SFQB 1HJAC 1O39A 1CHOF 4I8KA 1BCUH 4I32A 2NU4E 2FLBH 1D3TB 4AGKA 5HM2A 3F6UH 3HGNA 3MNXA 3S7KB 2PKAA 2QXIA 5C2ZA 1ZJKA 2F9UA 1MCTA 2CJIA 3S69A 3ENSB 5T6DA 1A2CH 2ILNA 1O2TA 5FBEA 2A1DB 1QB9A 1UTOA 1CT2E 1BIOA 1GDUA 1GI2A 1C2DA 1GVLA 5EQSA 3K9XB 3RU4T 4XDEA 2O8UA 3Q3XA 1NFYA 1GHXH 1KLTA 2BB4A 2SNWA 1NRQH 1C5NH 2W26A 3MH6A 1GHAF 1YGCH 1O3KA 2PKSB 4A1TA 1O2LA 3ZVAA 1UVUH 4ZHMU 1J9CH 1O38A 1O3HA 1YCPK 3LKWA 2BYAX 2UUJB 5GXPA 3LH3A 3RXDA 1LVYA 2ZFRH 4B2AA 4A1XA 2ZGCA 1G9IE 1ELEE 3SI4H 3T62A 1O35A 1AGJA 4ZHLU 1LHCH 1ZYOA 2FWWA 1ZGIA 4INHA 2BQ6B 1AKSA 1P05A 3OYPA 2BD4A 1FPCH 3RU4E 4WVPE 4Q7XA 3STJA 5E2OA 5JPMH 1FY4A 2ZZUH 3UNRA 4D9RA 3F1SB 1C5YB 1ARCA 4X1RU 1GMCF 4KELA 1DXWA 3HKJB 1W2KH 2ANYA 4J2YB 1C1VH 4MTBA 1AFQB 4ZKSU 4BTUB 1GBMA 3MWIU 1CGIE 2BLOA 1EAUA 2PFEA 4X1QU 1GI0A 4A5TS 1O2SA 3LH1A 3T29A 4I8GA 3M36A 2B9LA 3V12A 4CRAA 2ZDKA 1LDTT 1PPEE 1TPAE 2H6MA 5TCCA 2FMJA 2EC9H 1TFXA 1GMDG 3KN2A 4CBOA 2Z94A 4CRCA 1DUAA 4K8YA 3SUEA 1G32B 3KGPA 1HB0B 1TMBH 2A4GA 2XC5A 4WJG2 1GPZA 5LPFA 1C1UH 1VCWA 1LTOA 3PLPA 2ZFTA 1SGCA 1ZSKA 1PPBH 4HGCA 1HBTH 4AORA 1BHXF 1VITH 4YZUA 1TNHA 1Z7KA 3LJJA 3EGKH 1AU8A 3SI3H 3EA7A 5A8XA 3KF2A 2J34A 3SV7A 1XMNB 3E6PH 1OWIA 1Y5UT 3QGNB 4KKDA 3TVJB 1RFNA 2SGPE 4SGAE 4JCNA 4NZLA 4OS7A 1SGYE 2V35A 2FI4E 3EA9A 1HAPH 1W12U 1IQFA 1CT0E 2PHBA 1ETRH 3Q76A 4Y10E 1W13U 4Y7BA 4FUEA 1C5WB 3NK8A 1UK4A 2F9OA 3P8GA 1BTUA 2PKSC 1O33A 2GKVE 4X6PA 3UQVA 3E0PB 1NRPH 3SN8A 1GG6B 1DT2A 2Y80A 1OYTH 2FOBA 1YPHC 1A7SA 4D7FA 4CHAB 1QL8A 4U30A 1EZSC 4NG9H 4ESTE 1ZPBA 3FANA 2ZDVH 4B76A 1KXBA 1KXEA 3MO9A 3PLKA 3ZZ9A 3RM2H 1P3EA 3V7TA 4UFEH 1ELCA 1GI9B 3VGCB 5HGGA 3ZVBA 4TPIZ 1SGPE 2AEIH 3GDUA 2QXJA 4AG2A 1L0ZA 3L33A 3SV9A 1O2GH 1F7ZA 5GPIB 1C2FA 1GBIA 1KTSB 1O2ZA 2RA0A 1D3DB 4Y7AA 3PLBA 3BTEE 1NFWA 1YLDA 5DPAA 1LQEA 4OGXA 4XBDA 3T27A 1AFQC 3MFJA 4RKOB 1GHBG 3PV4A 3ZVGA 3U1JB 1ETSH 4FU7A 2ZDLA 1LVBA 1FY3A 3A84A 3PMJA 1S0RA 3SU3A 1N8OB 1GI7B 2BZAA 3FVFB 3K65B 5C20A 1PPGE 1T8NA 1M9UA 1UTMA 3SNEA 2CXVA 1P04A 1VITG 5FCRA 3BTTE 1O37A 2HLCA 1BRAA 2EI7A 2ZI2H 1IQMA 1XUKA 1GI8B 2QF0A 4CRDA 3MNCA 1A3BH 1V2ST 5JBAS 3MI4A 5DKMA 2GDDA 1F92A 1FAKH 2G55A 1DSUA 2G51A 2TGAA 1IHTH 1AUJA 1V2WT 1G36A 1JBUH 4BAKB 2Q6GA 2WPIS 1S0QA 1ZSJA 1WU1A 1YBWA 2Y7XA 1GI3A 1EAIA 3P17H 4IBLH 4JZIA 2VVUA 4NA8A 3F9HA 3LGVA 3RXVA 1LCYA 1Z1JA 3SHAH 1THSH 1NFUA 4KTUA 1XM1A 2AGGX 2Y81A 1HAXB 1PPFE 1TYNA 4IN1A 3MMGA 5FPYA 1X7AC 1Z1IA 1MAYA 4Y0ZE 1VCQA 1ZRBA 1HUTH 1VCPA 3SQHE 1G2MA 1QB6A 1TGBA 1TPOA 2XXLA 3ZZBA 2BOKA 2Y5FA 5G4BA 1MUEB 1MBMA 1ANDA 5HMAA 2SGEE 3K2UA 3ZVCA 2B0FA 5EXLA 1EQ9A 2BDBA 4AZ2B 1P2QA 1AE5A 4K8BA 4A1VA 1WSSH 4TPYA 1G3CA 2ZU2A 4K5ZA 2BDYA 5JDUB 2A45B 1DLEA 1T4UH 3E3TA 2AGIX 1P9SA 3OY6U 3RXKA 2XBWA 1GCTC 3B9FH 1CQQA 4FXGH 4Q2KA 1N6YA 2SNVA 5CHAB 3BTKE 1C1NA 3ZYEA 1K22H 3UNSA 3MU8A 1NO9H 1C1MA 5DP7A 1V2MT 1O3BA 1DX5M 1O5CB 1LHGH 1O30A 3Q00A 1NESE 1QFKH 2KAIB 3GOVB 4THNH 2ZNKH 3M7UA 1Z8IB 3U9AH 4NIVA 3SGAE 1GMHG 2C90B 3BEUA 1FY8E 3SV2H 5J4SA 1MTSA 4ABGA 1O2YA 1C5PA 1CGJE 2PV9B 5E8EH 2YNBA 1GBTA 4AN7A 4AYVB 1C2LA 1TE0A 1PQ8A 3B8JA 1QL7A 1GI5A 1EAWA 2F9NA 2O8LA<