2Q6GA

Crystal structure of sars-cov main protease h41a mutant in complex with an n-terminal substrate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
305
structure length
305
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRAVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords severe acute respiratory syndrome coronavirus (SARS-CoV)
publication title Structures of two coronavirus main proteases: implications for substrate binding and antiviral drug design.
pubmed doi rcsb
source organism Sars coronavirus
total genus 82
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2q6gA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2q6gA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2q6gA02
4JZIA 3A82A 3PV4A 2BOHB 2SFAA 2AIPA 4KELA 2BDHA 2FPZA 1PJPA 3H5CB 4O03A 1O3FA 3MU0A 1ZGIA 4AG2A 1ESTA 1MKXK 4ISLA 4AORA 1CGJE 1GI8B 2A2QH 4FUGA 1HLTH 4Y11E 4ABAA 1TRMA 1H8DH 3EYDA 1EOJA 4DY7B 4TWYA 3TVJB 1GHXH 4CR5A 4KGAA 3ATMA 1F0TA 1OOKB 3A87A 1UHBA 4GAWA 1O3NA 3UFAA 1H9IE 3S7KB 2TGDA 3RU4D 5FX6A 6GCHF 2Y5FA 1LO6A 5EXNA 2OCVB 3GYMA 5FCRA 2PTNA 2AMPA 1HJAC 1A0HB 1C5MD 2ZC9H 2NU4E 4ZKSU 1PPHE 3OTJE 1FXYA 3V3MA 4CRGA 1PQ7A 3SHAH 3T29A 4K8YA 2G8TA 5TCAA 2Y5GA 3TNSA 2A4GA 2D8WA 1GMCG 1THSH 3QDZB 1WV7H 1AMHA 2AMDA 1JIMA 2FOEA 2ZTYA 1MAXA 2VVCA 1XKAC 1W3CA 1V2QT 1MH0A 1S0RA 1QB1A 1RFNA 1EAWA 2A7HA 5L6NH 1QRXA 1TX8A 2XCFA 3RC5A 3M7UA 4YLQH 1BTPA 1ORFA 5DJ7A 1N6XA 1TPPA 4D7FA 3BIVH 6LPRA 1SGNE 1AHTH 2BLQA 1C2EA 2ZU2A 4OS2A 3NK8A 2WPJS 2RCEA 2VIOA 2F91A 3Q76A 3SO3A 2Q6DA 2J92A 3LPRA 2VWNA 2BXUH 2P3FH 5DG6A 3PMHB 1P2QA 1O33A 3PTBA 1ZPBA 4AB8A 2EC9H 2G4UA 2QAAA 1Y5UT 3IITA 1EXFA 1ETTH 2FLRH 1V2OT 2THFB 3KQDA 5A8XA 1GBHA 1GJDB 1S84A 3BTTE 3RXDA 3UNQA 2VIQA 1DS2E 2BD7A 2WUBA 4Y71A 3MH6A 1O30A 3KNXA 3L3TA 5DP5A 1LPGB 4A1XA 3GOVB 3ZZ7A 1C1VH 1SFQB 3SZNA 2OXSA 1XXDA 5LPEA 5HM2A 1FNIA 2A7JA 4XFQA 1HIAB 3LC5A 3TJVA 2HOBA 2FOHA 1TMBH 3R0FA 1L4DA 1T8LA 1AD8H 4K8BA 1TQ7B 1KXAA 2AYWA 4TY6A 1K1LA 4E7NA 1DT2A 5J4SA 1TRNA 1ZGVA 3LGYA 4A1TA 3EA9A 1C5UA 1O2UA 1NRPH 2OQ5A 3HKJB 9LPRA 2SGPE 4ABBA 1G3DA 5C1XA 1QURH 4ABDA 4D9RA 4CHAB 1W11U 4HTCH 1PPEE 1ETSH 1P9SA 3AAVA 1CHOF 1MKWK 3PM3A 1C1MA 2PW8H 2ZGBH 3RXRA 3RXSA 3W94A 5C2ZA 2SGQE 1S82A 4DG4A 2ZFRH 4VGCB 1H4WA 2G5VA 2CXVA 4MNYA 1LQDB 3KCGH 3Q3KA 4KP0A 1N8OB 1GHVH 3M5OA 1IHTH 4X8UH 2IOTA 1EKBB 1O2KA 3PYHA 3CP7A 4I31A 3SGAE 1TB6H 2VB0A 1Y8TA 2BYAX 3KGPA 2ASUB 1GBIA 2BXTH 1P02A 4FUDA 5A0AE 1O5GH 1RGQA 4NZQA 1QB9A 2GCHF 3FANA 1KLIH 3E8LA 3TJNA 4ABIA 2BQWB 1FPHH 1OXGA 4I32A 2GT7A 1GBDA 2A0QB 1GCTB 2BLVA 1TX6A 2HGTH 3LKWA 3T28A 1GI9B 2VGCB 2V3OH 3P95A 4WVPE 2NU1E 1RIWC 4UE7H 3HATH 4DCDA 1V2VT 4ISHH 1O3AA 1GJCB 4UONA 1ZPZA 1C5VA 3BSQA 1S81A 1GI7B 2V35A 4HFPB 2YNBA 5EQQA 1C5OH 1GJ9B 3UREA 1B5GH 1CBWB 1LMWB 1HIAA 1V2RT 3MFJA 1YPGH 3LGVA 1BRAA 5A09A 3ZZ4A 1GWAA 2ULLA 1J14A 2Q6FA 1TMUH 2JH6D 3PWCA 1SI5H 2FLBH 1QJ6B 1L4ZA 3A83A 5F03A 2UWOA 3LOXA 3E91A 3IG6B 1PPGE 2FWWA 2BY9X 1XUJA 5L2YH 3GY2A 3RUOA 1UK4A 3UR6A 2K1QA 5A0CA 1TA6A 2HVXA 1SBWA 3SOSA 1UMAH 2XWBI 2BOKA 1YP9A 1ZMJA 1VCPA 2H9HA 3K6YA 1OYQA 2F9OA 1T4UH 1QA0A 3TH2H 2JH5D 2Z3DA 4AZ2B 1IQHA 1BBRH 1GGDC 2FXRA 3KIDU 3M36A 1ZSJA 1O2QA 4JK5A 5DP8A 1J16A 2OC1A 2H9TH 4DJZB 1JMOH 2SGDE 1GBMA 3RDZA 1WAYB 2TIOA 4NSYA 4Q7ZA 5EW1H 1T8OA 2BD8A 4ZXXH 1SLXB 1O2GH 2Z6BD 4DURA 1TGCA 3D62A 2LIZA 4WMEA 1NY22 1SGQE 1P05A 2ILNA 4IS5A 1OP8A 2O9QA 2XC5A 4IMQA 1HXFH 1HAXB 2A4QA 2OQUA 3OU0A 3RLYH 4GSOA 4CBOA 3BTHE 2ZU1A 1HJAB 2HPPH 1ELGA 3N7OA 4K69A 1TPAE 2B9LA 2ZDVH 3OY6U 4B71A 2QIQA 1TABE 1BZXE 2A5AA 5DP9A 2ZGCA 1EJAA 3MU5A 1CT4E 2A4RA 1NFYA 3I78A 1KLTA 3A89A 1H1BA 1L1JA 2STAE 3FP6E 2ZDNA 2ODYB 3QN7A 2TGTA 2ZDMA 1VITG 4K1SA 2FOAA 3LJJA 3MO6A 3BTME 1GMCF 1ESAA 3OYPA 1Z6JH 1KYNA 2SGAA 4A6LA 3ATLA 1XXFA 2ZGXH 1UTNA 1AWHB 2HNTE 4AX9H 4E06H 2IPHA 4MNWA 1A5IA 1ZLRA 3M7TA 3ZZ5A 1O36A 4AFQA 4ZUHA 4FUFA 1C5YB 1FDPA 2JH0D 4H4FA 1D6WA 4XBDA 4D76A 3HKIB 4RKJB 3OX7U 1K1NA 1FY5A 1EP6A 2H2ZA 2BM2A 3SGBE 1K22H 3ZVGA 2Z9KA 1A61H 2Z9JA 4X8TH 1MD7A 5B6OA 3SN8A 1SGEE 3SU1A 4ESTE 3SI4H 2BD4A 3BG8A 4I8KA 2FS9A 9ESTA 2GGVB 3ATIA 1AB9C 1XUFA 5C1YA 1TAWA 2SNVA 1ZHPA 3FFGA 3SUEA 3QUMP 2ZHWH 3B8JA 4OS5A 2VWLA 1O2TA 1XMNB 3SUDA 1Z8GA 1GL1A 3GICB 1TPSA 4TY7A 5HGGA 1K1IA 1TOCB 1DICA 2ZFTA 2ODQA 2C93B 1KY9A 4K1EA 1UVOA 1WQSA 1D9IA 1P57B 2F83A 2Y5HA 2QXGA 1A5HA 3M61U 1LHGH 2XXLA 1AIXH 3PROA 1BUIA 1H8IH 1NESE 1O5CB 6CHAC 2OP9A 3MMGA 1ZOMA 1KTSB 3A85A 4Y76A 3PMJA 5T6DA 3A7WA 3UTUH 1SGRE 2FI4E 1GHWH 1LVBA 4J2YB 3URCA 3E16B 2OC0A 3SI3H 2FIRH 5GXPA 3MO9A 1NC6A 2G81E 1ZMLA 2ZDKA 1GI2A 1YPHE 4UEHH 1YPLH 3SJOA 1ANCA 2AGEX 5C5OA 1BBRE 4H6TA 4Y79A 3BTFE 1O0DH 1Z8RA 4YZUA 4TPIZ 1QL9A 1HCGA 1OP0A 1OWEA 2HLCA 3WY8A 3GDUA 1O2SA 2VJ1A 4Y7BA 4Q7XA 1RIWB 2M5TA 2C3SA 2VVVA 1RS0A 1NFUA 1Q3XA 2ZCKP 1GDNA 3KEEA 3SBKA 1AI8H 2AH4X 3EGKH 2A32A 1MTSA 2ANWA 4NG9H 5IDKA 1OX1A 1W13U 4XBBA 1RJXB 1GMHF 1C2GA 4X1RU 4RKOB 5HMAA 4VGCC 1SGFA 1RTKA 3U8OH 4NA9H 1CHGA 1BDAA 1DY8A 3DA9B 1MBQA 3F6UH 2J94A 3DUXH 3SGQE 4JCNA 1GG6C 1QBOA 2GD4B 3UY9A 1GBCA 3SUFA 1UK2A 1ELEE 3AASA 3QK1A 4ABHA 1UVUH 2QXJA 2EI7A 1C5TA 1JRSA 4XBCA 1YCPK 3UWJH 2YNAA 2AFQB 1G2MA 3M3SA 1ELTA 1K1OA 1C1RA 5C1UA 1UTJA 2VINA 3RM2H 3PWBA 4OGXA 1EUFA 4X1QU 1EJNA 3QLPH 1FY1A 3HK3B 4A5TS 1GGDB 2FTMA 3RXPA 1ZTKA 4GLYA 5K0HA 1Y3WA 4MG3A 1ARCA 2QF3A 3S9CA 1VCWA 2K7XA 5H4IB 2GCTC 1Z7KA 5JBTA 1A0JA 4I8JA 3V12A 3MNCA 4IN1A 2GP9B 1CU1A 1O3BA 1ANDA 2PGQB 2FEQH 5CE1A 2Z3EA 2CF8H 3BG4C 4U2WA 1EZSC 3AAUA 4Z6AH 2ZDLA 1MTUA 1Z8IB 3TJUA 1QTFA 1C1NA 3RXOA 4BAOB 7ESTE 1SLWB 1TRYA 1YLCA 1HPGA 1GHBG 3I77A 4F49A 1HAGE 4HGCA 4JK6A 5ABWA 3LC3A 3LH1A 1GBFA 1RTFB 2C90B 1BQYA 3MI4A 1GJAB 2F9VA 4GHQA 3SQHE 4INHA 2Y81A 5TCCA 1BRUP 2PTCE 1A1RA 3LT3A 3UPEA 1IQEA 1D3PB 3PB1E 1MBMA 1O5AB 1GDUA 1C2DA 8LPRA 2IJOB 1K9OE 1ZJDA 2H6MA 1OWDA 3V0XA 4B73A 2JETC 2G55A 1TBQH 4DW2U 5DPAA 4R0IA 1S6FA 3B23B 1FPCH 1BBRK 4X2WA 3RC4A 1LKBA 1QQUA 1OWJA 3GY6A 1VITF 1QRWA 2FYQA 3BTEE 1OWKA 3MNSA 1O3EA 2PUXB 5ESBA 1EP5A 3MU4A 3RP2A 4D8NA 1O38A 1MTVA 2FX6A 3GY8A 2FS8A 1FZZA 4UFFH 4NIXA 2GDEH 1TWXB 3E1XB 3A88A 2UWPA 3D65E 3LH3A 2HPQH 3P8OA 3AVZA 3EBNA 2AGGX 3ZVBA 4X8SH 2SGFE 4ASHA 1O2HA 2BQ6B 1DLEA 4NCYA 1N6YA 2A7CA 4WWYA 4Y7AA 3EA7A 4IMZA 2ZGHA 1AB9B 1NFXA 1ZMNA 2EEKA 3VGCC 1HAVB 4MTBA 5E2OA 1TMTH 1HXEH 2PV9B 1FV9A 1TALA 1TA2A 1DDJA 1XM1A 1KTTB 4GHTA 1ELAA 3QTOH 2Q1JA 1AGJA 4ZHMU 3BV9B 1W10U 4AFSA 1MQ5A 2F9UA 1C1OA 1M9UA 4ZXYH 1E34B 4KTUA 1SGTA 4K3JA 5T6FA 4IC5A 5DGJA 3ZZ6A 4FUBA 5FBIA 2WYGA 6CHAB 3FZZA 2QC2A 1HAYB 4ISNA 1SOTA 1S0QA 3BN9A 2P3UB 5LH8A 3RU4T 3TGIE 3C1KA 3RMLH 2EA3A 3ATWA 1A3EH 1C5PA 2W5EA 2QXHA 1EAXA 1GI3A 1MZAA 1DE7H 3T62A 3SQEE 3U98H 2W7UA 1MU8B 3ENSB 3GISB 4AOQA 1C5QA 4NWLA 2UUKB 1Y5AT 3RMOH 3HGNA 1BCUH 3MH4A 4NA7A 3P70B 4THNH 1F5RA 3SV2H 2TRMA 4Y8XA 3RXIA 1VZQH 2DE9A 1NS3A 4BXSA 1B0FA 1K28D 4Y6DA 3NUMA 2CV3A 3GCTG 2XBYA 3Q3YA 1W7GH 1F5KU 3TK5A 4KTCA 1YCPH 1U6QA 3PLBA 2VU8E 1W0ZU 1FN6A 4GVUA 1RRKA 2G4TA 3ZV9A 4AGJA 3MNBA 5A8ZA 3P8GA 1O3HA 1K1JA 1HAVA 2TPIZ 4Q2KA 1V2JT 1QFKH 1HJ8A 3KQEA 1MMJN 3MH5A 5I46H 2ZCLP 4K2YA 1XUKA 1GG6B 1S83A 1GI5A 1O3CA 1YKTA 3DHKH 4BANB 1EATA 1MAYA 2UUYA 1DSUA 4X2YA 5DP7A 1XX9A 1NRNH 1BHXF 2P3TB 1IQLA 2GVFA 3M5NA 1XVOA 3PMBB 1ZHRA 4X6MA 1HRTH 2XWAA 4MPVA 1CA8B 3S9AA 1BRBE 1S5SA 1C5NH 3Q00A 5EW2H 3UWIA 1V2MT 1ABJH 1DPOA 4X6NA 5EPNA 4A92A 3M5LA 4ZAEA 1V2PT 2O8UA 3LGWA 4K5ZA 2FI3E 2A4OA 1GJ5H 3TH4H 3TLOA 5JB8S 1A0LA 4BAMB 1GHAG 3A7VA 3UNSA 1ZJKA 1AVXA 2ZI2H 5EOKA 2ZNKH 2GCTB 3LONA 1O2LA 4IC6A 8GCHG 2BZ6H 2GZ7A 1F0SA 2C8YB 2QF0A 3UQVA 4Y0ZE 6ESTA 1DWEH 2P8OC 4O9VA 3RXAA 1A5GH 1J9CH 1BTHH 3BG4B 1UVPA 4DIIH 3BIUH 5DP3A 1AVGH 5GDSH 4BXWA 1Y3XA 1L2EA 3SNCA 1QL7A 4RN6A 1G32B 2STBE 1Q31A 3K2UA 2BMGB 1FY3A 5DKMA 1WOFA 2Z3CA 3M3TA 1X7AC 1IQGA 1YPJH 2FOCA 1G3CA 1O3JA 4IN2A 1SC8U 5FPTA 3T27A 4LZ4B 2BLWA 4MQAA 1HFDA 1S6HA 1P09A 3RMMH 2FYRA 3NXPA 1TNIA 2O8LA 1IQMA 3S9BA 3A7YA 1GHBF 5C5NA 3LIWA 4D9QA 7LPRA 1SL3A 2ZFQH 1TX7A 2GMTC 3JZ2B 1V2TT 4YT7H 1SFIA 2JKHA 1ABIH 1P06A 3RXHA 1NTPA 2JETB 1BA8B 1IQKA 1FMGA 2RA0A 2A5KA 2WINI 5AFZH 2F9BH 1UTLM 1DXWA 4YOJA 3ZVEA 3RXVA 4I8GA 1CA0C 1O3PB 1DY9A 1LVOA 1O5BB 5BRRE 2VH0A 1YPKH 2CMYA 4NGAH 4MVNA 2FOFA 2SNWA 1P3CA 5L30H 3SU5A 1N1LA 1AKSB 1UK3A 2FI5E 4U32A 5HYOA 4NFEA 3P92A 4OS6A 3SU6A 4BTTB 4B2AA 2FOGA 1J15A 3GCNA 2GX4A 1O2NA 1ELDE 2FDAA 1SR5C 1FLEE 5JBAS 1K1MA 2CHAC 3BEFB 1ANBA 4CRAA 1YC0A 3STIA 2J34A 4CREA 4KTSA 1CVWH 1YBWA 2XC0A 1GI4A 1RTLA 1HAPH 2B0FA 1QJ1B 2WPMS 1T4VH 1GHZA 4X6OA 1XKBC 1O2JA 1BHXB 5FPSA 1PYTC 1DUAA 1F0UA 1IOEA 1LKAA 3VGCB 2ZU4A 3FAOA 1TNKA 4WY3A 2PHBA 2R2MB 2TGPZ 1K2I1 1O2YA 1O35A 3NZIA 3RXEA 3RXCA 1C1TA 3ZZAA 1EQ9A 3KN2A 1EB2A 1BTXA 2TGAA 3GY7A 5F8TA 2ZHEH 3BTWE 1CSOE 4NIVA 1W8BH 3EE0B 1DWDH 4NIYA 1DITH 5A2MH 1O2XA 3STJA 2OBOA 4FVDA 1SQOA 3B9FH 4WXIA 3SNBA 1GJ8B 1WTHD 3O8BA 5GPIB 3VPKA 1TFXA 4ZKNU 1AUJA 4Z0KA 3NWUA 1C4U2 1O2MA 3PLPA 1O2RA 3A8AA 3E0PB 4NWKA 4CRBA 1IAUA 5GJ4B 1QBVH 2BX4A 1DVAH 1NZQH 1S85A 2ZPSA 1GBAA 1P03A 1C4Y2 5F8ZA 5FHTA 4MNXA 2BY5X 4AB9A 4YLUA 3F9EA 1K1PA 4Y10E 5FXLA 1INCA 4IGDA 1V2UT 1ELCA 4ZH8A 5EQRA 3TH3H 3LJOA 1FN8A 3L6PA 5AF9H 2BDAA 4WJG2 1K21H 5GCHG 2GZ9A 1AKSA 3F9GA 1BOQA 3TNTA 2RDLA 1TONA 5A0BA 4MPUA 3VB7A 1GCDA 3HK6B 3RU4E 5I25A 2PSXA 2OC8A 5AFYH 3ZZCA 1KDQB 1C1WH 1UTMA 1AWFH 3NKKA 1UO6A 1UTKA 1DLKB 1TGNA 3MHWU 1A7SA 1TPOA 1TGBA 4UFEH 1HAIH 2VIVA 3T2NA 1QCPA 3M7QA 1TOMH 4INKA 2NU0E 2BVSH 4I33A 2ZU5A 1BJUA 5HXFA 1VCQA 1C2LA 2ANYA 1WYKA 4INLA 2ZZUH 2OC7A 3SJ9A 2AMQA 2J38A 1Q2WA 1EZUC 1MTNC 1AFQC 2BD5A 5DP4A 1C4V2 1TGSZ 3GCTF 4FU9A 2RA3A 5DO4H 4D7GA 5SGAE 4YO9A 4ZMAH 1ESBA 1BB0B 1IQJA 4AN7A 1GBEA 2QY0B 2ZFPH 1DSTA 1FQ3A 2VWMA 1ELVA 8ESTE 5FX5A 2HWLB 2CJIA 3ZZBA 3LGTA 1SGDE 1GI0A 4I8LA 1O3IA 1EPTC 4Y8ZA 1UJ1A 1EX3A 2R9PA 4ABEA 2ZG0H 5GWZA 1D3TB 1O3KA 1QBNA 2QYIA 2LPRA 1TBZH 2PSYA 1KXDA 1H9HE 2BB4A 2P94A 2DE8A 1AUTC 1QJ7B 2XC4A 1IQIA 3QO6A 4X1PU 1PYTD 1UVTH 1YGCH 1OSSA 3BTGE 3MTYA 3DD2H 1CE5A 5T3HA 3SNDA 1PQAA 2PKSC 1NU7B 2XW9A 3FP7E 2BZAA 3RXLA 1NO9H 3TIUA 1DFPA 3TGKE 4YOIA 1Z1IA 3U8RH 4GPGA 2BHGA 2Z9IA 2V6NA 1AFEH 1EJMA 2P8OB 2PR3A 5DK1A 1QL8A 3MYWA 1GHAF 4IBLH 1KDQA 1LHFH 1ETRH 1DX5M 4K1TA 4ABJA 1AQ7A 1A2CH 3GCHC 1HB0B 1QQ4A 4BTUB 8GCHF 3E90B 2FOMB 3ODFA 1ELBA 4AG1A 1GVKB 1SGIB 1V2KT 4LK4A 5TJXA 1LCYA 1E38B 1BMLA 1KXFA 2ZP0H 2FO9A 1LPZB 1FIWA 1P2KA 4BAKB 4X0WU 3QTVH 1BTZA 2GT8A 1DM4B 1MUEB 2C8WB 3A8CA 2ZHDA 2R0KA 4ZHLU 3SW2B 5EU8A 1C2JA 1VR1H 2LNCA 2PGBB 3ZVAA 3PO1C 1QIXB 1CT2E 1YPHC 4UFGH 1SGCA 5LGOA 1T32A 3UOUA 3FZDA 2ZTXA 1SGPE 1A46H 1F5LA 2VNTA 1FONA 1C9PA 1P12E 2GMTB 3CS7A 1L1NA 3D49H 4ZKOU 1O3MA 1ZPCA 3DT0H 3R3GB 1GDQA 2Z9GA 2ZA5A 3RXFA 2VIDA 2BDCA 1MTWA 1CA0B 1PPFE 2XYAA 4X1NU 1HGTH 1P01A 4E05H 3A8BA 1SGFG 1Z1JA 2QCYA 2GTBA 1Z6EA 2HNTF 1PQ5A 1ID5H 1GBKA 3AW0A 1T31A 2ESTE 3GDSA 5FBEA 3URDA 1G3BA 2WV5A 1EASA 2BY7X 4I7YH 3A7ZA 2ZF0H 3GY4A 2Q6GA 2CHAB 1THRH 1QGFA 1C1SA 1IHSH 3RXJA 1SQAA 1D3QB 2WPHS 1V3XA 3BEUA 3ZVCA 4F4OC 4RSPA 5IYTA 3SORA 3SUGA 1PQ8A 1DWCH 5JBCS 2BVXH 2KAIB 3ITIA 5F8XA 4FUIA 1LVYA 4O3UA 1O31A 2EI8A 1NPMA 4WH8A 2I6QA 3U1IB 1HNEE 4SGAE 3RLWH 2D1JA 1G2LA 5CHAC 2WPLS 1EZQA 3LDXH 4O97A 1JIRA 1W14U 2GZ8A 1C5XB 1OYTH 4AYVB 2UWLA 4U01A 5E0JA 4MPWA 1LVMA 2QV1A 4GCHG 4OS7A 4B76A 1GJ6A 2DUCA 3SJ8A 4DOQA 2Z7FE 1AVWA 2J9NA 3MNXA 4OS1A 1C5WB 1P2MA 1SMFE 5CMXH 4CBNA 5G4BA 4YT6H 2G5NA 1RD3B 5EG4A 5DP6A 5ESTE 1P9UA 1C2FA 2V0BA 4TWWA 3SU2A 1JBUH 1TNLA 1P2OA 1A4WH 2ZECA 4YOGA 4ZROA 1YPMH 1MD8A 5EODA 4AYYB 1SLUB 3K65B 4UFDH 1EB1H 2AS9A 3EDXB 1G3EA 2YOLA 5F6MA 1PPZA 2AEIH 2ZHFH 2Y6TA 2FESH 1WU1A 3JZ1B 4E7RG 1T8MA 2FP7B 2GV7A 1BIOA 1GMDG 1QHRB 2G52A 2O8WA 5LPFA 2BDIA 1XUGA 3P8NA 2P93A 1MU6B 2ZEBA 1HJ9A 1TQ0B 2FOBA 1Y3UA 5GCHF 3VFEA 1BTWA 3SHCH 2ANMH 1GBLA 3OY5U 1C2MA 2ZO3H 1GBTA 4BTIB 4MPXA 3BTQE 1EAUA 2Z94A 2QGRA 1AZZA 2ZHQH 3D23A 3L33A 1BTYA 2P95A 2PFEA 3FVFB 1XUIA 2KAIA 5FAHA 4B2BA 1ZR0A 4ISOA 1HYLA 2I6SA 3VB4A 1C5ZB 1DXPA 1FI8A 7GCHG 1MTNB 1AFQB 5E2PA 1XUHA 1L0ZA 1C5RA 1PFXC 5PTPA 1QY6A 1D6RA 1GBBA 1KXCA 4UDWH 2F9PA 1MQ6A 1CGHA 3LGIA 3HPTB 1NFWA 1QA7A 1P10A 3A86A 1OKXA 1UCYE 1GJ4H 3A7TA 3VXEH 8KME2 3IWMA 4JZFH 1JXPA 1O5DH 2R2WU 1EPTB 4B1TA 1FY4A 2R3YA 2QN5T 3SNAA 3TGJE 1JRTA 2H1UA 4PROA 2F3CE 1C2IA 1P8VC 1FY8E 3P8FA 1GJBB 4FXGH 3U1JB 1MCVA 2A5IA 1E36B 4O3TA 3S0NA 1ZHMA 1C2HA 2ZIQH 3VB3A 5EXLA 1P11E 1D3DB 3MU1A 3E3TA 4X1SU 3RC6A 2G51A 2NU2E 2PKSB 1CT0E 1WTGH 1H9LB 3RXTA 2FX4A 1EZXC 1T8NA 2CN0H 2BD3A 5EGMA 1GI1A 4XSKU 2CF9H 2R0LA 4SGBE 4JYTA 1ANEA 5LPRA 2O8TA 3A81A 1O2WA 2A31A 3A80A 3GCHB 1GPZA 4Y8YA 5AHGH 2A2XH 3GY3A 3ELAH 4ISIH 1QR3E 2XCNA 5C20A 2B5TB 3H7TA 1VGCC 1O2IA 5JYIA 4JZEH 3RXKA 1E37B 3M35A 2EI6A 1EAIA 2B8OH 5JPMH 1OPHB 1F2SE 1SHYA 4MLFB 5AVDA 4GUXA 1WCZA 1F92A 3SU4A 1GMHG 1TGTA 3PO1B 3V13A 3O8CA 1YCPM 2ODPA 2ZTZA 4XOJA 1GBJA 2OLGA 4LXBH 4MNVA 3ESTA 1PPBH 1AN1E 1MZDA 3E6PH 2XNIA 3MH7A 1YPEH 2PWXA 4ABGA 3ODDA 3ZZ3A 2ALVA 1SSXA 1HBTH 2R3UA 1EPTA 3VXFH 1UTPA 1VITH 5C67A 4FUEA 1TIOA 3QX5H 5K7RA 1BTUA 1TBRH 1W7XH 1CO7E 1FIZA 3PLKA 1E35B 3Q3XA 1ZTLA 2BD2A 4BOHA 3U9AH 1KLJH 2VIWA 4LOYH 1C1PA 1OP2A 1V2NT 1B0EA 1TNHA 4Q7YA 3CENA 1YYY1 2WUCA 1KSNA 1SPJA 2ZQ2A 2QXIA 3BTDE 5JDUB 3QGJA 2XBXA 2FTLE 1KIGH 1O3OA 4NA8A 5FPYA 1V2WT 3OSYA 4QT8C 1WBGB 2OUAA 1MKXH 1ZRBA 2GKVE 1D4PB 1Y59T 3MOCA 5EPYA 4YESB 3SV7A 3SV6A 2GV6A 4DIHH 1DOJA 4A7IB 2HRVA 1T7CA 2J95A 1L1GA 2P16A 2VVUA 3E0NB 4CH2B 3GYLB 1UTOA 1SLVB 4WXVA 3MO3A 1UVSH 1NRSH 2Z9LA 1UCYK 4OGYA 5CHAB 3LGUA 2SGEE 2BDBA 3UNRA 2H9EH 1AE8H 2W26A 2FODA 2XBWA 3GDVA 3NCLA 2TBSA 1J8AA 1SQTA 1O2ZA 3ZYDA 4UD9H 4AFUA 1O3GA 2OINA 3QGNB 1LDTT 3T5FH 1Y3YA 2UUFB 4HI3A 1HV7A 3T26A 2C8XB 4GCHF 1O3DA 1P0SH 4J1YA 5L2ZH 3H7OA 3ZV8A 2D2DA 1F0RA 4BNRA 1CQQA 2BDGA 3ZZDA 1QB6A 5EQSA 3F9HA 4BAQB 3SNEA 2PKAB 1FAKH 3AW1A 1O39A 2RG3A 4LZ1H 4HZHA 1NRRH 3EQ0H 2Y7XA 4X2XA 2ZFFH 4BAHB 1O34A 2BD9A 3BEIB 3RXUA 1KXEA 3P17H 3F1SB 1C5LH 4CRFA 1HAZB 3I29A 3QZRA 3SJIA 1G30B 3TK9A 4FU8A 1THPB 4TYDA 3UR9A 3V7TA 1SB1H 3C27B 2OTVA 1BMAA 3TITA 1G36A 3M37A 6GCHG 4JYUH 4ZHAA 1F7ZA 5BPEA 5E0GA 1DWBH 1TLDA 3UOPA 1Y5BT 1V6DA 2ZU3A 1GMDF 3BF6H 2A45B 1GL0E 3QZQA 2WYJA 4X2VA 1GHYH 2ZDAH 3ATKA 2ZPQA 2F9NA 1P2IA 1ZYOA 3PTNA 3SU3A 4WF8A 3SU0A 5T6GA 1Z71A 1V2LT 2VIPA 2ZFSA 1BRCE 2NWNA 2ZPRA 3F68H 4B2CA 3TK6A 1RXPA 3K9XB 1AO5A 3ZVDA 1TNGA 4FUJA 1C1QA 1W12U 3VEQB 2CGAA 3W95A 5E8EH 1P3EA 4KKDA 1A3BH 1BITA 5EXMA 1BJVA 1Z8JB 1CGIE 2WPIS 3K6ZA 3TU7H 3EAJA 3RMNH 7GCHF 2H5CA 2ZGJA 1EOLA 2OBQA 1XVMA 1SG8B 1GVLA 3ZVFA 2W7SA 1DANH 2O8MA 3DFLA 3LU9B 2AIQA 2BQ7B 1WUNH 1VJ9U 1YLDA 1LHCH 1NN6A 2BDYA 3VB5A 2AERH 4X8VH 3S7HB 3SV8A 1AU8A 1SGYE 1MKWH 3MU8A 1P04A 1UTQA 2V3HH 3ZZ8A 4R8TB 3KQCA 1BT7A 2D26C 4DVAU 2P59A 2PKAA 3RXBA 1MCTA 2BY6X 2NU3E 2AGIX 1BMNH 2VWOA 4CH8B 3G01A 3ZZ9A 1LHEH 2OD3B 4FUCA 3QWCH 2FZZA 3GCOA 4XDEA 2HALA 4TPYA 4H42U 2ZCHP 3A84A 4B75A 4FUHA 4NSVA 1O37A 3A8DA 4YM9A 2BY8X 3O8RA 3KL6A 3RXQA 4AGKA 1WQVH 2HNTC 2XRCA 5E0HA 1O2VA 4NZLA 3VB6A 1E0FD 4AFZA 4JMYA 3U69H 5C3NA 3FP8E 2PLXA 1YM0A 2Y80A 3A7XA 4ZKRU 4YTAA 1VGCB 3RXMA 1WSSH 1OWIA 4FVBA 2WV4A 3EA8A 4OS4A 1NRQH 4WMFA 1J17T 4A1VA 1TE0A 1B7XB 3KQBA 1O32A 2J4IA 1W2KH 5A8YA 2C4FH 1CHOG 4U30A 4JZ1A 1AY6H 1HAOH 1O2PA 1PPCE 1LPKB 2ZWLH 1P2JA 4WH6A 4DGJA 1C5SA 2VH6A 1ARBA 4NIWA 2J2UA 4CHAC 1C1UH 5GIBA 3UUZA 1FUJA 1P2NA 3PMAB 1HAHH 1QNJA 5J4QA 1HDTH 3U8TH 1IQFA 3F9FA 2IN2A 1NT1A 3KF2A 1FAXA 1LTOA 1V2ST 2GCHG 3S69A 1ZRKA 1N8OC 1ZSKA 1SVPA 4FU7A 2H5DA 2ZKSA 3HGPA 4K60A 4B74A 7KMEH 2G00A 1NM6A 1O3LA 1DUEA 4CRDA 1O5EH 3CS0A 4ABFA 1BMMH 1G9IE 1FJSA 1SOZA 2C8ZB 2W3IA 3DFJA 5HM9A 1NROH 1ZSLA 1UCYH 4JYVH 2BX3A 2Y82A 3BTKE 1GCTC 4NFFA 4XE4A 2VGCC 4Y0YE 2BVRH 1O5FH 1G37A 3M3VA 1AZ8A 1C9TA 1UHBB 3MWIU 2ZQ1A 4H6SB 1TNJA 4Q80A 4CRCA 1GI6A 1ZZZA 2Y7ZA 3TJOA 3SJKA 1JOUB 2ALPA 2B7DH 1GJ7B 1ACBE 3P6ZB 1Y3VA 5JB9S 1CBWC 4IW4E 3SV9A 1NU9A 3O8DA 3TPIZ 2XTTB 4JZDH 4WMDA 2GDDA 1VJAU 3GY5A 1OWHA 3T25A 1ZTJA 2ANKH 2XBVA 4X6PA 3RM0H 1AE5A 1ELFA 1HUTH 1IQNA 2QA9E 5ETXA 1OS8A 2PUQH 2FMJA 1GVZA 1LQEA 2W3KA 3M5MA 1KXBA 1TYNA 1JWTA 1W0YH 2BTCE 4M7GA 4DT7B 1YF4A 2WPKS 3Q77A 4CR9A 1C2KA 5FCKA 2A1DB 1O2OA 3KHVA 1LHDH 3UQOA 5JBBS 2UUJB 3UIRA 3ZYEA 3RXGA 2FM2A 4MDSA 2BLOA 3NPSA 4I8HA 1SHHB 1QRZA
chains in the Genus database with same CATH superfamily
4JZIA 3A82A 3PV4A 2BOHB 2SFAA 2AIPA 4KELA 2BDHA 2FPZA 1PJPA 3H5CB 4O03A 1O3FA 3MU0A 1ZGIA 4AG2A 1ESTA 1MKXK 4ISLA 4AORA 1CGJE 1GI8B 2A2QH 4FUGA 1HLTH 4Y11E 4ABAA 1TRMA 1H8DH 3EYDA 1EOJA 4DY7B 4TWYA 3TVJB 1GHXH 4CR5A 4KGAA 3ATMA 1F0TA 1OOKB 3A87A 1UHBA 4GAWA 1O3NA 3UFAA 1H9IE 3S7KB 2TGDA 3RU4D 5FX6A 6GCHF 2Y5FA 1LO6A 5EXNA 2OCVB 2W6ID 3GYMA 5FCRA 2PTNA 2AMPA 1HJAC 1A0HB 1C5MD 2ZC9H 2NU4E 4ZKSU 1PPHE 3OTJE 1FXYA 3V3MA 4CRGA 1PQ7A 3SHAH 3T29A 4K8YA 2G8TA 4Q4LA 5TCAA 2Y5GA 3TNSA 2A4GA 2D8WA 1GMCG 1THSH 3QDZB 1WV7H 1AMHA 2AMDA 1JIMA 2FOEA 2ZTYA 1MAXA 2VVCA 1XKAC 1W3CA 1V2QT 2L74A 3WWBA 1MH0A 1S0RA 1QB1A 1RFNA 1EAWA 2A7HA 5L6NH 1QRXA 1TX8A 2XCFA 3RC5A 3M7UA 4YLQH 1BTPA 1ORFA 5DJ7A 1N6XA 1TPPA 4D7FA 3BIVH 6LPRA 1SGNE 1AHTH 2BLQA 1C2EA 2ZU2A 4OS2A 3NK8A 2WPJS 2RCEA 2VIOA 2F91A 3Q76A 3SO3A 2Q6DA 2J98B 2J92A 3LPRA 2VWNA 2BXUH 2P3FH 5DG6A 3PMHB 1P2QA 1O33A 3PTBA 1ZPBA 4AB8A 2EC9H 2G4UA 2QAAA 1Y5UT 3IITA 1EXFA 1ETTH 2FLRH 1V2OT 2THFB 3KQDA 5A8XA 1GBHA 1GJDB 2QF4A 1S84A 3UAIC 3BTTE 3RXDA 3UNQA 2VIQA 1DS2E 2BD7A 2WUBA 4Y71A 3MH6A 1O30A 3KNXA 3L3TA 5DP5A 1LPGB 4A1XA 3GOVB 3ZZ7A 1C1VH 1SFQB 3SZNA 2OXSA 1XXDA 2WV9A 5LPEA 5HM2A 1FNIA 2A7JA 4XFQA 1HIAB 3LC5A 3TJVA 2HOBA 2FOHA 1TMBH 3R0FA 1L4DA 1T8LA 1AD8H 4K8BA 1TQ7B 1KXAA 2AYWA 4TY6A 1K1LA 4E7NA 1DT2A 5J4SA 1TRNA 1ZGVA 3LGYA 4A1TA 3EA9A 1C5UA 1O2UA 1NRPH 2OQ5A 3HKJB 9LPRA 2SGPE 4ABBA 1G3DA 5C1XA 1QURH 4ABDA 4D9RA 4CHAB 1W11U 4HTCH 1PPEE 1ETSH 2WPDD 1P9SA 3AAVA 1CHOF 1MKWK 3PM3A 5HIYA 1C1MA 2PW8H 2ZGBH 2KX4A 3EE7A 3RXRA 3RXSA 3W94A 5C2ZA 2SGQE 1S82A 4DG4A 2ZFRH 4VGCB 1H4WA 2G5VA 2CXVA 4MNYA 1LQDB 3KCGH 3Q3KA 4KP0A 1N8OB 1GHVH 3M5OA 1IHTH 4X8UH 2IOTA 1EKBB 1O2KA 3OFND 3CP7A 3PYHA 4I31A 3SGAE 1TB6H 2VB0A 1Y8TA 2BYAX 3KGPA 2ASUB 1GBIA 2J98A 2BXTH 1P02A 4FUDA 5A0AE 1O5GH 1RGQA 4NZQA 1QB9A 2GCHF 3FANA 1KLIH 3E8LA 3TJNA 4ABIA 2BQWB 1FPHH 1OXGA 4I32A 2GT7A 1GBDA 2A0QB 1GCTB 2BLVA 1TX6A 2HGTH 3F2FA 3LKWA 3T28A 1GI9B 2VGCB 2V3OH 3P95A 4WVPE 2NU1E 1RIWC 4UE7H 3HATH 4DCDA 1V2VT 4ISHH 1O3AA 1GJCB 4UONA 1ZPZA 1C5VA 3BSQA 1S81A 1GI7B 2V35A 4HFPB 2YNBA 5EQQA 2KFWA 1C5OH 1GJ9B 3UREA 1B5GH 1CBWB 1LMWB 1HIAA 1V2RT 3MFJA 1YPGH 3LGVA 1BRAA 5A09A 3ZZ4A 1GWAA 2ULLA 1J14A 2Q6FA 1TMUH 2JH6D 3PWCA 1SI5H 2FLBH 1W0KD 1QJ6B 1L4ZA 3A83A 5F03A 2UWOA 3LOXA 3E91A 3IG6B 1PPGE 2FWWA 2BY9X 1XUJA 5L2YH 3GY2A 2QF5A 3RUOA 1UK4A 3UR6A 2K1QA 5A0CA 1TA6A 2HVXA 3F0PA 1SBWA 3SOSA 1UMAH 2XWBI 2BOKA 1YP9A 1ZMJA 1VCPA 4HG6A 2H9HA 3K6YA 1OYQA 2F9OA 1T4UH 1QA0A 1SKYE 3TH2H 2JH5D 2Z3DA 4AZ2B 1IQHA 1BBRH 1GGDC 5C0UA 2FXRA 3KIDU 3M36A 1ZSJA 1O2QA 4JK5A 5DP8A 1J16A 2OC1A 2H9TH 4DJZB 1JMOH 2SGDE 1GBMA 3RDZA 1WAYB 2TIOA 4NSYA 4Q7ZA 5EW1H 1T8OA 2BD8A 4ZXXH 1SLXB 2WSSD 1O2GH 2Z6BD 4DURA 3FOAA 1TGCA 3D62A 2LIZA 4WMEA 1NY22 1SGQE 4XRNA 1P05A 2ILNA 4IS5A 2AHME 1OP8A 2O9QA 2XC5A 4IMQA 1HXFH 1HAXB 2A4QA 2OQUA 3OU0A 3RLYH 4GSOA 4CBOA 3BTHE 2ZU1A 1HJAB 2HPPH 1ELGA 3N7OA 4K69A 1TPAE 2B9LA 2ZDVH 3OY6U 4B71A 2QIQA 2CK3D 1TABE 3WW7A 1BZXE 2A5AA 5DP9A 2ZGCA 1EJAA 3MU5A 1CT4E 2A4RA 1NFYA 3I78A 1KLTA 3A89A 1H1BA 1L1JA 2STAE 3FP6E 2ZDNA 2ODYB 3QN7A 2TGTA 2ZDMA 1VITG 5KGOA 4K1SA 2FOAA 3LJJA 3MO6A 3BTME 1GMCF 1ESAA 3OYPA 1Z6JH 1KYNA 2SGAA 3DSOA 4A6LA 3ATLA 1XXFA 2ZGXH 1UTNA 1AWHB 3ZIAD 2HNTE 4AX9H 4E06H 2IPHA 4MNWA 1A5IA 1ZLRA 3M7TA 3ZZ5A 1O36A 2V7QD 4AFQA 4ZUHA 4FUFA 3DSGA 1C5YB 1FDPA 2JH0D 4H4FA 1D6WA 4XBDA 4D76A 3HKIB 4RKJB 3OX7U 1K1NA 1FY5A 1EP6A 2H2ZA 2BM2A 3SGBE 1K22H 3ZVGA 2Z9KA 1A61H 2Z9JA 4X8TH 1MD7A 5B6OA 3SN8A 1SGEE 5KECA 3SU1A 4ESTE 3SI4H 2BD4A 3BG8A 4I8KA 2FS9A 9ESTA 2GGVB 3ATIA 1AB9C 1XUFA 5C1YA 1TAWA 2SNVA 1ZHPA 3FFGA 3SUEA 3QUMP 2ZHWH 3B8JA 4OS5A 2VWLA 1O2TA 1XMNB 3SUDA 1Z8GA 1GL1A 3GICB 1TPSA 3PRBA 4TY7A 5HGGA 5CHBA 1K1IA 1TOCB 1DICA 5KEDA 2ZFTA 2ODQA 1E1RD 2F4LA 3UB0A 2C93B 1KY9A 3DSPA 4K1EA 1UVOA 1WQSA 1D9IA 2F83A 1P57B 2Y5HA 2QXGA 1A5HA 3M61U 1LHGH 2XXLA 1AIXH 3PROA 1BUIA 1H8IH 1NESE 1O5CB 6CHAC 2HVYB 2OP9A 3MMGA 1ZOMA 1KTSB 3A85A 4Y76A 3PMJA 5T6DA 3A7WA 3UTUH 1SGRE 2FI4E 1GHWH 1LVBA 1UW7A 4J2YB 3URCA 3E16B 2OC0A 3SI3H 2FIRH 5GXPA 3MO9A 1NC6A 2G81E 1ZMLA 2ZDKA 1GI2A 1YPHE 4UEHH 1YPLH 3SJOA 1ANCA 2AGEX 5C5OA 1BBRE 4H6TA 4Y79A 2KCOA 3BTFE 2LP6A 1O0DH 1Z8RA 4YZUA 4TPIZ 1QL9A 1HCGA 1OP0A 1OWEA 2HLCA 3WY8A 3GDUA 1O2SA 2VJ1A 4Y7BA 4Q7XA 1RIWB 2M5TA 2C3SA 2VVVA 1RS0A 1KMHB 1NFUA 1Q3XA 2ZCKP 1GDNA 3KEEA 3SBKA 1VKYA 1AI8H 2AH4X 3EGKH 2A32A 1MTSA 1YLNA 2ANWA 4NG9H 5IDKA 1OX1A 1W13U 4XBBA 1RJXB 1GMHF 4DT4A 1C2GA 5C17A 4X1RU 4RKOB 5HMAA 4VGCC 1SGFA 1RTKA 3U8OH 4NA9H 1CHGA 1BDAA 1DY8A 3DA9B 1MBQA 3F6UH 2J94A 3DUXH 3SGQE 4JCNA 1GG6C 1QBOA 2GD4B 3UY9A 1GBCA 3SUFA 1UK2A 1ELEE 3AASA 3QK1A 4ABHA 1UVUH 2QXJA 2EI7A 1C5TA 1JRSA 4XBCA 1YCPK 3UWJH 2YNAA 2AFQB 1G2MA 3M3SA 1ELTA 1K1OA 1C1RA 4OM9A 5C1UA 1WXRA 1UTJA 2VINA 3RM2H 3PWBA 4OGXA 1EUFA 4X1QU 1EJNA 3QLPH 1FY1A 3HK3B 4A5TS 1GGDB 2FTMA 3RXPA 1ZTKA 4GLYA 5K0HA 1Y3WA 4MG3A 2QE7D 1ARCA 2QF3A 3S9CA 1VCWA 2K7XA 5H4IB 2GCTC 1Z7KA 5JBTA 1A0JA 4I8JA 3V12A 3MNCA 2K0QA 4IN1A 2GP9B 1CU1A 1O3BA 1ANDA 2PGQB 2FEQH 5CE1A 2Z3EA 2CF8H 3BG4C 4U2WA 1EZSC 3AAUA 4Z6AH 2ZDLA 1MTUA 1Z8IB 3TJUA 1QTFA 1C1NA 3RXOA 4BAOB 7ESTE 1SLWB 1TRYA 1YLCA 5HIZA 1HPGA 1GHBG 3I77A 4F49A 1HAGE 4HGCA 4JK6A 5ABWA 3LC3A 3LH1A 1E79D 1GBFA 1RTFB 2C90B 1BQYA 3MI4A 1GJAB 2F9VA 4GHQA 3SQHE 4INHA 2Y81A 5TCCA 1BRUP 2PTCE 1A1RA 3LT3A 3UPEA 1IQEA 1D3PB 3PB1E 1MBMA 1O5AB 1GDUA 1C2DA 8LPRA 2IJOB 1K9OE 1ZJDA 3PV5A 1E1QD 2H6MA 1OWDA 3V0XA 4B73A 2JETC 2G55A 1TBQH 4DW2U 5DPAA 4R0IA 1S6FA 3B23B 1FPCH 1BBRK 4X2WA 3SYJA 3RC4A 1LKBA 1QQUA 1OWJA 3GY6A 1VITF 1QRWA 2FYQA 3BTEE 1OWKA 3N7EA 3MNSA 1O3EA 2PUXB 5ESBA 1EP5A 3MU4A 3RP2A 5C0TA 4D8NA 1O38A 1MTVA 2FX6A 3GY8A 3WWFA 2FS8A 1FZZA 4UFFH 4NIXA 2GDEH 1TWXB 3E1XB 3A88A 2UWPA 3D65E 3LH3A 2HPQH 3P8OA 3AVZA 3EBNA 1YY3A 2AGGX 3ZVBA 4X8SH 2SGFE 4ASHA 1O2HA 2BQ6B 1DLEA 4NCYA 1N6YA 2A7CA 4WWYA 4Y7AA 3EA7A 4IMZA 2ZGHA 1AB9B 1NFXA 1ZMNA 2EEKA 3VGCC 1HAVB 4MTBA 5E2OA 1TMTH 1HXEH 2PV9B 1FV9A 1TALA 1TA2A 1DDJA 1XM1A 1KTTB 4GHTA 1ELAA 5IK2D 3QTOH 2Q1JA 1AGJA 4ZHMU 3BV9B 3OAAD 2YMSC 1W10U 4AFSA 1MQ5A 2F9UA 1C1OA 1M9UA 4ZXYH 1E34B 4KTUA 1SGTA 4K3JA 5T6FA 4IC5A 5DGJA 3ZZ6A 4FUBA 5FBIA 2WYGA 6CHAB 3FZZA 2QC2A 1HAYB 4ISNA 1SOTA 1S0QA 3BN9A 3KYFA 2P3UB 5LH8A 3RU4T 3TGIE 3C1KA 3RMLH 2EA3A 3ATWA 1A3EH 1C5PA 2W5EA 5B6LA 2QXHA 1EAXA 1GI3A 1MZAA 1DE7H 3T62A 3SQEE 3U98H 2W7UA 1MU8B 3ENSB 3GISB 5GNDA 4AOQA 1C5QA 4NWLA 2UUKB 1Y5AT 3RMOH 3HGNA 1BCUH 3MH4A 4NA7A 1OHHD 3P70B 2KZ4A 4THNH 1F5RA 3SV2H 2TRMA 4Y8XA 3RXIA 1VZQH 2DE9A 1NS3A 4BXSA 1B0FA 1K28D 4Y6DA 3NUMA 4ACBA 2CV3A 3W1EA 3GCTG 2XBYA 3Q3YA 1W7GH 1F5KU 3TK5A 4KTCA 1YCPH 1U6QA 2J5UA 3PLBA 2VU8E 1W0ZU 1FN6A 4GVUA 1RRKA 2G4TA 3ZV9A 4AGJA 3MNBA 5A8ZA 3P8GA 1O3HA 1K1JA 1HAVA 2TPIZ 4Q2KA 1V2JT 1QFKH 1HJ8A 3KQEA 1MMJN 3MH5A 5I46H 2ZCLP 4K2YA 1XUKA 1GG6B 1S83A 1GI5A 1O3CA 1YKTA 2F43B 3DHKH 4BANB 1EATA 1MAYA 2UUYA 1DSUA 4X2YA 5DP7A 1XX9A 1NRNH 1BHXF 3KYGA 2P3TB 1IQLA 2GVFA 3M5NA 1XVOA 3PMBB 1ZHRA 4X6MA 1HRTH 2XWAA 4MPVA 1CA8B 3S9AA 1FX0B 1BRBE 1S5SA 4M9FA 1C5NH 3Q00A 5EW2H 3UWIA 1NBMD 1V2MT 1ABJH 1DPOA 4X6NA 5EPNA 4A92A 3M5LA 4ZAEA 1V2PT 2O8UA 3LGWA 4K5ZA 2FI3E 2A4OA 1GJ5H 3TH4H 3TLOA 5JB8S 1A0LA 4BAMB 1GHAG 3A7VA 3UNSA 1ZJKA 1AVXA 2ZI2H 5EOKA 2ZNKH 2GCTB 2J97A 3LONA 1S6LA 1O2LA 4IC6A 8GCHG 2BZ6H 2GZ7A 1F0SA 2C8YB 2QF0A 3UQVA 4Y0ZE 6ESTA 1DWEH 2P8OC 4O9VA 2YMSD 3RXAA 1A5GH 1J9CH 1BTHH 3BG4B 1UVPA 5CDFE 4DIIH 3BIUH 1BMFD 5DP3A 1AVGH 5GDSH 4BXWA 1Y3XA 1L2EA 3SNCA 1QL7A 4RN6A 1G32B 2STBE 1Q31A 3K2UA 2BMGB 1FY3A 5DKMA 1WOFA 2Z3CA 3M3TA 1X7AC 1IQGA 2RDEA 1YPJH 2FOCA 2IPQX 1G3CA 1O3JA 4IN2A 2L6OA 1SC8U 5FPTA 3T27A 4LZ4B 2BLWA 4MQAA 1HFDA 1S6HA 1P09A 3RMMH 3KQ5A 2FYRA 3NXPA 1TNIA 2O8LA 1IQMA 3S9BA 2W6JD 3A7YA 1GHBF 5C5NA 1W0JD 3LIWA 4D9QA 7LPRA 1SL3A 2ZFQH 1TX7A 2GMTC 3JZ2B 1V2TT 4YT7H 1SFIA 2JKHA 1ABIH 1P06A 3RXHA 1NTPA 2EQNA 2JETB 4AC9A 1BA8B 1IQKA 1FMGA 2RA0A 2A5KA 2WINI 5AFZH 2F9BH 1UTLM 2IJD1 1DXWA 4YOJA 3ZVEA 3RXVA 4I8GA 1CA0C 1O3PB 1DY9A 1LVOA 1O5BB 3FN8A 5BRRE 2VH0A 1YPKH 2CMYA 4NGAH 4MVNA 2FOFA 2SNWA 1P3CA 5L30H 3SU5A 1N1LA 1AKSB 1UK3A 2FI5E 4U32A 5HYOA 4NFEA 3P92A 4OS6A 3SU6A 4BTTB 4B2AA 2FOGA 1J15A 2EY4C 3GCNA 2GX4A 1O2NA 2KCAA 1ELDE 2FDAA 1SR5C 1FLEE 5JBAS 1K1MA 2CHAC 3BEFB 1ANBA 4CRAA 1YC0A 3STIA 2J34A 4CREA 4KTSA 1CVWH 1YBWA 2XC0A 1GI4A 1RTLA 1HAPH 3GS9A 2B0FA 1QJ1B 2WPMS 1T4VH 1GHZA 4X6OA 1XKBC 1O2JA 1BHXB 5FPSA 1PYTC 1DUAA 1F0UA 1IOEA 3FKSD 1LKAA 3VGCB 2ZU4A 3FAOA 1TNKA 4WY3A 2PHBA 2R2MB 2TGPZ 2K8IA 2RFKC 1K2I1 1O2YA 1O35A 3NZIA 3RXEA 3RXCA 1C1TA 3ZZAA 1EQ9A 3KN2A 1EB2A 2VBCA 1BTXA 2TGAA 3GY7A 5F8TA 2ZHEH 3BTWE 1CSOE 4NIVA 2YMSB 2JIZD 1W8BH 3EE0B 1DWDH 4NIYA 1DITH 5A2MH 3PRDA 1O2XA 3STJA 2OBOA 4FVDA 1SQOA 3B9FH 4WXIA 3SNBA 1GJ8B 1WTHD 3O8BA 5GPIB 3VPKA 1TFXA 4ZKNU 1AUJA 4Z0KA 3NWUA 1C4U2 1O2MA 3PLPA 1O2RA 3A8AA 3E0PB 4NWKA 4CRBA 1IAUA 5GJ4B 1QBVH 2BX4A 1DVAH 1NZQH 1S85A 2ZPSA 1GBAA 5F53A 1P03A 1C4Y2 5F8ZA 5FHTA 4MNXA 2BY5X 4AB9A 4YLUA 3F9EA 1K1PA 4Y10E 5FXLA 1INCA 4IGDA 1V2UT 1ELCA 4ZH8A 5EQRA 3TH3H 4F48B 3LJOA 1FN8A 3L6PA 5AF9H 2BDAA 4WJG2 4P02A 1K21H 5GCHG 2GZ9A 1AKSA 3F9GA 1BOQA 3TNTA 2RDLA 1TONA 5A0BA 4MPUA 3VB7A 1GCDA 3HK6B 3RU4E 5I25A 2PSXA 2OC8A 5AFYH 3ZZCA 1KDQB 1C1WH 1UTMA 1AWFH 2JDID 3NKKA 1UO6A 1UTKA 1DLKB 1TGNA 3MHWU 1A7SA 1TPOA 1TGBA 4UFEH 1HAIH 2VIVA 3T2NA 1QCPA 3M7QA 1TOMH 4INKA 2NU0E 2BVSH 4I33A 2ZU5A 1BJUA 5HXFA 1VCQA 1C2LA 2ANYA 1WYKA 4INLA 2ZZUH 2OC7A 3SJ9A 2AMQA 2J38A 5EJLA 1Q2WA 1EZUC 1MTNC 1AFQC 2BD5A 5DP4A 1C4V2 1TGSZ 3GCTF 1MABB 2RA3A 4FU9A 4D7GA 5DO4H 5SGAE 4YO9A 4ZMAH 1ESBA 1BB0B 1IQJA 4AN7A 1GBEA 2QY0B 2ZFPH 1DSTA 1FQ3A 5T1VA 5DN6D 2VWMA 2OK5A 1ELVA 8ESTE 5FX5A 2HWLB 2CJIA 3ZZBA 2M2AA 3LGTA 2WHXA 1SGDE 1GI0A 4I8LA 1O3IA 1EPTC 4Y8ZA 1UJ1A 1EX3A 2R9PA 4ABEA 2ZG0H 5GWZA 1D3TB 4F55A 1O3KA 1QBNA 2QYIA 2LPRA 1TBZH 2PSYA 3DCLA 1WDIA 1KXDA 1H9HE 2BB4A 2P94A 1YWUA 2DE8A 1AUTC 1QJ7B 2XC4A 1IQIA 3QO6A 4X1PU 1PYTD 1UVTH 1YGCH 1OSSA 3BTGE 3MTYA 3DD2H 1CE5A 1QZ8A 5T3HA 3SNDA 1PQAA 2PKSC 1NU7B 2XW9A 3FP7E 2BZAA 3RXLA 1NO9H 3TIUA 1DFPA 3TGKE 4YOIA 1Z1IA 3U8RH 2PP6A 4GPGA 2BHGA 2Z9IA 2V6NA 1AFEH 1EJMA 2P8OB 2PR3A 5DK1A 1QL8A 3MYWA 5C94A 1GHAF 4IBLH 2KR7A 1KDQA 1LHFH 1ETRH 1DX5M 4K1TA 4ABJA 1AQ7A 2KCYA 1A2CH 3GCHC 1HB0B 1QQ4A 4BTUB 8GCHF 3E90B 2FOMB 3ODFA 1ELBA 4AG1A 1GVKB 1SGIB 1V2KT 4LK4A 5TJXA 1LCYA 1E38B 1BMLA 1KXFA 2ZP0H 2FO9A 1LPZB 1FIWA 1P2KA 4BAKB 4X0WU 3QTVH 2JJ1D 1BTZA 2GT8A 1DM4B 1MUEB 4ACAA 2C8WB 3A8CA 2ZHDA 2R0KA 4ZHLU 3SW2B 5EU8A 1C2JA 1VR1H 2LNCA 2PGBB 3ZVAA 3PO1C 1QIXB 5FL7D 1CT2E 1YPHC 4UFGH 1SGCA 2WZQA 5LGOA 1T32A 3UOUA 3FZDA 2ZTXA 1SGPE 1A46H 1F5LA 2VNTA 1FONA 1C9PA 1P12E 2GMTB 3CS7A 1L1NA 3D49H 4ZKOU 3PV2A 1O3MA 1ZPCA 3DT0H 3R3GB 1GDQA 2Z9GA 2ZA5A 3RXFA 2VIDA 2BDCA 1MTWA 1CA0B 1PPFE 2XYAA 5EJ1A 4X1NU 1HGTH 1P01A 4E05H 3A8BA 1SGFG 1Z1JA 2QCYA 2GTBA 1Z6EA 2HNTF 1PQ5A 1ID5H 1GBKA 3AW0A 1T31A 2ESTE 3GDSA 5FBEA 4FETA 3URDA 1G3BA 2WV5A 1EASA 2BY7X 4I7YH 3A7ZA 2ZF0H 3GY4A 2Q6GA 2CHAB 1THRH 1QGFA 1C1SA 1IHSH 3RXJA 1SQAA 1D3QB 2WPHS 1V3XA 3BEUA 3ZVCA 4F4OC 4RSPA 5IYTA 3SORA 3SUGA 1PQ8A 1DWCH 5JBCS 2BVXH 2KAIB 3ITIA 5F8XA 4FUIA 1LVYA 4O3UA 1O31A 2EI8A 1NPMA 4WH8A 2I6QA 3U1IB 4P00A 1HNEE 4SGAE 3RLWH 2D1JA 1G2LA 5CHAC 2WPLS 1EZQA 3LDXH 4O97A 1JIRA 1W14U 2GZ8A 1C5XB 1OYTH 4AYVB 2UWLA 4U01A 5E0JA 4MPWA 1LVMA 2QV1A 4GCHG 4OS7A 4B76A 1GJ6A 2DUCA 3SJ8A 4DOQA 2Z7FE 1AVWA 2J9NA 3MNXA 4OS1A 1C5WB 1P2MA 1SMFE 5CMXH 4CBNA 5G4BA 4YT6H 2G5NA 1RD3B 5EG4A 5DP6A 5ESTE 1P9UA 1C2FA 2V0BA 4TWWA 1K0HA 3SU2A 1JBUH 1TNLA 1P2OA 1A4WH 2ZECA 4YOGA 4ZROA 1YPMH 1MD8A 5EODA 4AYYB 1SLUB 3K65B 2V3MA 4UFDH 1EB1H 2AS9A 3EDXB 1G3EA 2YOLA 5F6MA 1PPZA 2AEIH 3F3BA 4TSFD 2ZHFH 2Y6TA 2FESH 1WU1A 3JZ1B 4E7RG 1T8MA 2FP7B 2GV7A 1BIOA 1GMDG 1QHRB 2G52A 2O8WA 5LPFA 2BDIA 1XUGA 3P8NA 2P93A 1MU6B 2ZEBA 1HJ9A 1TQ0B 2FOBA 1Y3UA 5GCHF 3VFEA 1BTWA 3N99A 3SHCH 2ANMH 1GBLA 3OY5U 1C2MA 2HLDD 2ZO3H 1GBTA 4BTIB 4MPXA 3BTQE 1EAUA 2Z94A 2QGRA 1AZZA 2ZHQH 3D23A 3L33A 1BTYA 2P95A 2PFEA 3FVFB 1XUIA 2KAIA 5FAHA 4B2BA 1ZR0A 4ISOA 1HYLA 2I6SA 3VB4A 1C5ZB 4YXWD 3OEED 1DXPA 1FI8A 7GCHG 1MTNB 1AFQB 5E2PA 1XUHA 1L0ZA 1C5RA 1PFXC 5PTPA 1QY6A 1D6RA 1GBBA 1KXCA 4UDWH 2F9PA 1MQ6A 1CGHA 3LGIA 3HPTB 1NFWA 1QA7A 1P10A 3A86A 1OKXA 1UCYE 1GJ4H 3A7TA 3VXEH 8KME2 3IWMA 4JZFH 1JXPA 1O5DH 2R2WU 1EPTB 4B1TA 1FY4A 2R3YA 2QN5T 3SNAA 4RT0A 3TGJE 3MQKC 1JRTA 2H1UA 4PROA 2F3CE 1C2IA 1P8VC 1FY8E 3P8FA 1GJBB 4FXGH 3U1JB 1MCVA 2A5IA 1E36B 4O3TA 3S0NA 1ZHMA 1C2HA 2ZIQH 3VB3A 3OE7D 5EXLA 1P11E 1D3DB 3MU1A 3E3TA 4X1SU 3RC6A 2G51A 2NU2E 2PKSB 1CT0E 1WTGH 2GJGA 1H9LB 3RXTA 2FX4A 1EZXC 1T8NA 2CN0H 2BD3A 5EGMA 1GI1A 4XSKU 2CF9H 2R0LA 4SGBE 4JYTA 1ANEA 5LPRA 3CNRA 2O8TA 3A81A 1O2WA 2A31A 3A80A 3GCHB 1GPZA 4Y8YA 5AHGH 2A2XH 3GY3A 3ELAH 4ISIH 1QR3E 2XCNA 5C20A 2B5TB 3H7TA 1VGCC 1O2IA 5JYIA 4JZEH 3RXKA 1E37B 3M35A 2EI6A 1EAIA 2B8OH 5JPMH 1OPHB 1F2SE 1SHYA 4MLFB 5AVDA 4GUXA 1WCZA 1F92A 3SU4A 1GMHG 1TGTA 3PO1B 3V13A 3O8CA 1YCPM 2ODPA 2ZTZA 4XOJA 1GBJA 2OLGA 4LXBH 4MNVA 3ESTA 1PPBH 1AN1E 1MZDA 3E6PH 2XNIA 3MH7A 1YPEH 2PWXA 4ABGA 3ODDA 3ZZ3A 2ALVA 1SSXA 1HBTH 2R3UA 1EPTA 3VXFH 1UTPA 1VITH 5C67A 4FUEA 1TIOA 3QX5H 5K7RA 1BTUA 1TBRH 1W7XH 1CO7E 1FIZA 3PLKA 3U28C 1E35B 3Q3XA 1ZTLA 2BD2A 4BOHA 3U9AH 1KLJH 2VIWA 4LOYH 1C1PA 1OP2A 1V2NT 1B0EA 1TNHA 4Q7YA 3CENA 1YYY1 2WUCA 1KSNA 1SPJA 3FO8D 2ZQ2A 2QXIA 3BTDE 5JDUB 3QGJA 2XBXA 2FTLE 1KIGH 1O3OA 4NA8A 5FPYA 1V2WT 3OSYA 4QT8C 1WBGB 2OUAA 1MKXH 1ZRBA 2GKVE 1D4PB 1Y59T 3MOCA 5EPYA 4YESB 3SV7A 3SV6A 2GV6A 4DIHH 1DOJA 1EFRD 4A7IB 2HRVA 1T7CA 2J95A 1L1GA 2P16A 2VVUA 3E0NB 4CH2B 3GYLB 1UTOA 1SLVB 4WXVA 3MO3A 1UVSH 1NRSH 2Z9LA 1UCYK 4OGYA 5CHAB 3LGUA 2SGEE 2BDBA 3UNRA 2H9EH 1AE8H 2W26A 2FODA 2XBWA 2XNDD 3GDVA 3NCLA 2TBSA 4Q63A 1J8AA 1SQTA 1O2ZA 3ZYDA 4UD9H 4AFUA 1O3GA 2OINA 3QGNB 1LDTT 3T5FH 1SQRA 1Y3YA 2UUFB 4HI3A 1HV7A 3T26A 5EIYA 2C8XB 4GCHF 1O3DA 1P0SH 4J1YA 5L2ZH 3H7OA 3ZV8A 1H8ED 2KCPA 2D2DA 1F0RA 4BNRA 1CQQA 2BDGA 3ZZDA 1QB6A 3F2HA 5EQSA 3F9HA 4BAQB 3SNEA 2PKAB 1FAKH 3AW1A 3H09A 3F2GA 1O39A 2RG3A 3NRLA 4LZ1H 4HZHA 1NRRH 3EQ0H 2Y7XA 4X2XA 2ZFFH 4BAHB 1O34A 2BD9A 3BEIB 3RXUA 1KXEA 3P17H 3F1SB 1C5LH 4CRFA 1HAZB 3I29A 3QZRA 3SJIA 1G30B 3TK9A 4FU8A 1THPB 4TYDA 3UR9A 3V7TA 1SB1H 3C27B 2OTVA 3SZEA 1BMAA 3TITA 1G36A 3M37A 6GCHG 4JYUH 4TT3D 4ZHAA 1F7ZA 3VG8A 5BPEA 5E0GA 1DWBH 1TLDA 3UOPA 1Y5BT 1V6DA 2ZU3A 1GMDF 3BF6H 2A45B 1GL0E 3QZQA 2WYJA 4X2VA 1GHYH 2ZDAH 3ATKA 2ZPQA 4ZCNA 2F9NA 1P2IA 1ZYOA 3PTNA 3SU3A 4WF8A 3SU0A 5T6GA 1Z71A 1V2LT 2VIPA 2ZFSA 2KM0A 1BRCE 2NWNA 2ZPRA 3F68H 4B2CA 3TK6A 1RXPA 3K9XB 1AO5A 3ZVDA 1TNGA 4FUJA 1C1QA 1W12U 3VEQB 2CGAA 3W95A 5E8EH 1P3EA 4KKDA 1A3BH 1BITA 5EXMA 1BJVA 1Z8JB 1CGIE 2WPIS 3K6ZA 3TU7H 3EAJA 3RMNH 4FOUC 7GCHF 2H5CA 2ZGJA 1EOLA 2OBQA 1XVMA 1SG8B 1GVLA 3ZVFA 2W7SA 1DANH 2O8MA 3DFLA 3LU9B 2AIQA 2BQ7B 1WUNH 1VJ9U 1YLDA 1LHCH 1NN6A 2BDYA 3VB5A 2AERH 4X8VH 3S7HB 3SV8A 1AU8A 1SGYE 4RT1A 1MKWH 3MU8A 1P04A 1UTQA 2V3HH 3ZZ8A 4R8TB 3KQCA 1BT7A 2D26C 4DVAU 2P59A 2LELA 4B6FA 2PKAA 3RXBA 1MCTA 2BY6X 3F0OA 2NU3E 2AGIX 1BMNH 2VWOA 4CH8B 3G01A 3ZZ9A 1LHEH 2OD3B 4FUCA 3QWCH 2FZZA 3GCOA 4XDEA 2HALA 4TPYA 4ASUD 4H42U 2ZCHP 3A84A 4B75A 4FUHA 4NSVA 3OTPA 4Z1MD 1O37A 3A8DA 4YM9A 2BY8X 3O8RA 3KL6A 3RXQA 4AGKA 1WQVH 2HNTC 2XRCA 5E0HA 1O2VA 4NZLA 3VB6A 1E0FD 4AFZA 4JMYA 3U69H 5C3NA 3FP8E 5EJZA 2XOKD 2PLXA 1YM0A 2Y80A 3A7XA 4ZKRU 4YTAA 1VGCB 2JJ2D 3RXMA 1WSSH 1OWIA 4FVBA 2WV4A 3EA8A 4OS4A 1NRQH 4WMFA 1J17T 4A1VA 1TE0A 1B7XB 3KQBA 1O32A 2J4IA 1W2KH 5A8YA 2C4FH 1CHOG 4U30A 4JZ1A 1AY6H 1HAOH 1O2PA 1PPCE 1LPKB 2ZWLH 1P2JA 4WH6A 4DGJA 1C5SA 2VH6A 1ARBA 4NIWA 2J2UA 4CHAC 1C1UH 5GIBA 3UUZA 1FUJA 1P2NA 3PMAB 1HAHH 1QNJA 5J4QA 1HDTH 3U8TH 1IQFA 3F9FA 2IN2A 1NT1A 5DSFA 3KF2A 1FAXA 1LTOA 1V2ST 2GCHG 3S69A 4XD7D 1ZRKA 1N8OC 1ZSKA 1SVPA 4FU7A 4RI0A 2H5DA 2ZKSA 3HGPA 4K60A 4B74A 7KMEH 2G00A 1NM6A 1O3LA 1DUEA 4CRDA 1O5EH 3CS0A 4ABFA 1BMMH 1G9IE 1FJSA 1SOZA 2C8ZB 2W3IA 3DFJA 5HM9A 1NROH 1ZSLA 1UCYH 4JYVH 2BX3A 4I86A 2Y82A 3BTKE 3OEHD 1GCTC 4NFFA 4XE4A 2VGCC 1H8HD 4Y0YE 2BVRH 1O5FH 1G37A 3M3VA 1AZ8A 1C9TA 1UHBB 3MWIU 3AK5A 5HKKD 2ZQ1A 4H6SB 1TNJA 4Q80A 4CRCA 1GI6A 1ZZZA 2Y7ZA 3TJOA 3SJKA 1JOUB 2ALPA 4B6EA 2B7DH 1GJ7B 1ACBE 3P6ZB 1Y3VA 5JB9S 1CBWC 4IW4E 3SV9A 1NU9A 3O8DA 1COWD 3TPIZ 2XTTB 4JZDH 4WMDA 2GDDA 1VJAU 3GY5A 1OWHA 3T25A 1ZTJA 2ANKH 2XBVA 4X6PA 3RM0H 1AE5A 1ELFA 1HUTH 1IQNA 2QA9E 5ETXA 1OS8A 2PUQH 2FMJA 1GVZA 1LQEA 1NBME 2W3KA 3M5MA 1KXBA 1TYNA 1JWTA 1W0YH 2BTCE 4M7GA 4DT7B 1YF4A 2WPKS 3Q77A 4CR9A 1C2KA 5FCKA 2A1DB 1O2OA 3KHVA 1LHDH 3UQOA 5JBBS 2UUJB 3N7DA 3UIRA 3ZYEA 3RXGA 2FM2A 4MDSA 2BLOA 3NPSA 4I8HA 1SHHB 1QRZA
chains in the Genus database with same CATH topology
4JZIA 3A82A 3PV4A 2BOHB 2SFAA 2AIPA 4KELA 2BDHA 2FPZA 1PJPA 3H5CB 4O03A 1O3FA 3MU0A 1ZGIA 4AG2A 1ESTA 1MKXK 4ISLA 4AORA 1CGJE 1GI8B 2A2QH 4FUGA 1HLTH 4Y11E 4ABAA 1TRMA 1H8DH 3EYDA 1EOJA 4DY7B 4TWYA 3TVJB 1GHXH 4CR5A 4KGAA 3ATMA 1F0TA 1OOKB 3A87A 1UHBA 4GAWA 1O3NA 3UFAA 1H9IE 3S7KB 2TGDA 3RU4D 5FX6A 6GCHF 2Y5FA 1LO6A 5EXNA 2OCVB 3GYMA 5FCRA 2PTNA 2AMPA 1HJAC 1A0HB 1C5MD 2ZC9H 2NU4E 4ZKSU 1PPHE 3OTJE 1FXYA 3V3MA 4CRGA 1PQ7A 3SHAH 3T29A 4K8YA 2G8TA 5TCAA 2Y5GA 3TNSA 2A4GA 2D8WA 1GMCG 1THSH 3QDZB 1WV7H 1AMHA 2AMDA 1JIMA 2FOEA 2ZTYA 1MAXA 2VVCA 1XKAC 1W3CA 1V2QT 1MH0A 1S0RA 1QB1A 1RFNA 1EAWA 2A7HA 5L6NH 1QRXA 1TX8A 2XCFA 3RC5A 3M7UA 4YLQH 1BTPA 1ORFA 5DJ7A 1N6XA 1TPPA 4D7FA 3BIVH 6LPRA 1SGNE 1AHTH 2BLQA 1C2EA 2ZU2A 4OS2A 3NK8A 2WPJS 2RCEA 2VIOA 2F91A 3Q76A 3SO3A 2Q6DA 2J92A 3LPRA 2VWNA 2BXUH 2P3FH 5DG6A 3PMHB 1P2QA 1O33A 3PTBA 1ZPBA 4AB8A 2EC9H 2G4UA 2QAAA 1Y5UT 3IITA 1EXFA 1ETTH 2FLRH 1V2OT 2THFB 3KQDA 5A8XA 1GBHA 1GJDB 1S84A 3BTTE 3RXDA 3UNQA 2VIQA 1DS2E 2BD7A 2WUBA 4Y71A 3MH6A 1O30A 3KNXA 3L3TA 5DP5A 1LPGB 4A1XA 3GOVB 3ZZ7A 1C1VH 1SFQB 3SZNA 2OXSA 1XXDA 5LPEA 5HM2A 1FNIA 2A7JA 4XFQA 1HIAB 3LC5A 3TJVA 2HOBA 2FOHA 1TMBH 3R0FA 1L4DA 1T8LA 1AD8H 4K8BA 1TQ7B 1KXAA 2AYWA 4TY6A 1K1LA 4E7NA 1DT2A 5J4SA 1TRNA 1ZGVA 3LGYA 4A1TA 3EA9A 1C5UA 1O2UA 1NRPH 2OQ5A 3HKJB 9LPRA 2SGPE 4ABBA 1G3DA 5C1XA 1QURH 4ABDA 4D9RA 4CHAB 1W11U 4HTCH 1PPEE 1ETSH 1P9SA 3AAVA 1CHOF 1MKWK 3PM3A 1C1MA 2PW8H 2ZGBH 3RXRA 3RXSA 3W94A 5C2ZA 2SGQE 1S82A 4DG4A 2ZFRH 4VGCB 1H4WA 2G5VA 2CXVA 4MNYA 1LQDB 3KCGH 3Q3KA 4KP0A 1N8OB 1GHVH 3M5OA 1IHTH 4X8UH 2IOTA 1EKBB 1O2KA 3PYHA 3CP7A 4I31A 3SGAE 1TB6H 2VB0A 1Y8TA 2BYAX 3KGPA 2ASUB 1GBIA 2BXTH 1P02A 4FUDA 5A0AE 1O5GH 1RGQA 4NZQA 1QB9A 2GCHF 3FANA 1KLIH 3E8LA 3TJNA 4ABIA 2BQWB 1FPHH 1OXGA 4I32A 2GT7A 1GBDA 2A0QB 1GCTB 2BLVA 1TX6A 2HGTH 3LKWA 3T28A 1GI9B 2VGCB 2V3OH 3P95A 4WVPE 2NU1E 1RIWC 4UE7H 3HATH 4DCDA 1V2VT 4ISHH 1O3AA 1GJCB 4UONA 1ZPZA 1C5VA 3BSQA 1S81A 1GI7B 2V35A 4HFPB 2YNBA 5EQQA 1C5OH 1GJ9B 3UREA 1B5GH 1CBWB 1LMWB 1HIAA 1V2RT 3MFJA 1YPGH 3LGVA 1BRAA 5A09A 3ZZ4A 1GWAA 2ULLA 1J14A 2Q6FA 1TMUH 2JH6D 3PWCA 1SI5H 2FLBH 1QJ6B 1L4ZA 3A83A 5F03A 2UWOA 3LOXA 3E91A 3IG6B 1PPGE 2FWWA 2BY9X 1XUJA 5L2YH 3GY2A 3RUOA 1UK4A 3UR6A 2K1QA 5A0CA 1TA6A 2HVXA 1SBWA 3SOSA 1UMAH 2XWBI 2BOKA 1YP9A 1ZMJA 1VCPA 2H9HA 3K6YA 1OYQA 2F9OA 1T4UH 1QA0A 3TH2H 2JH5D 2Z3DA 4AZ2B 1IQHA 1BBRH 1GGDC 2FXRA 3KIDU 3M36A 1ZSJA 1O2QA 4JK5A 5DP8A 1J16A 2OC1A 2H9TH 4DJZB 1JMOH 2SGDE 1GBMA 3RDZA 1WAYB 2TIOA 4NSYA 4Q7ZA 5EW1H 1T8OA 2BD8A 4ZXXH 1SLXB 1O2GH 2Z6BD 4DURA 1TGCA 3D62A 2LIZA 4WMEA 1NY22 1SGQE 1P05A 2ILNA 4IS5A 1OP8A 2O9QA 2XC5A 4IMQA 1HXFH 1HAXB 2A4QA 2OQUA 3OU0A 3RLYH 4GSOA 4CBOA 3BTHE 2ZU1A 1HJAB 2HPPH 1ELGA 3N7OA 4K69A 1TPAE 2B9LA 2ZDVH 3OY6U 4B71A 2QIQA 1TABE 1BZXE 2A5AA 5DP9A 2ZGCA 1EJAA 3MU5A 1CT4E 2A4RA 1NFYA 3I78A 1KLTA 3A89A 1H1BA 1L1JA 2STAE 3FP6E 2ZDNA 2ODYB 3QN7A 2TGTA 2ZDMA 1VITG 4K1SA 2FOAA 3LJJA 3MO6A 3BTME 1GMCF 1ESAA 3OYPA 1Z6JH 1KYNA 2SGAA 4A6LA 3ATLA 1XXFA 2ZGXH 1UTNA 1AWHB 2HNTE 4AX9H 4E06H 2IPHA 4MNWA 1A5IA 1ZLRA 3M7TA 3ZZ5A 1O36A 4AFQA 4ZUHA 4FUFA 1C5YB 1FDPA 2JH0D 4H4FA 1D6WA 4XBDA 4D76A 3HKIB 4RKJB 3OX7U 1K1NA 1FY5A 1EP6A 2H2ZA 2BM2A 3SGBE 1K22H 3ZVGA 2Z9KA 1A61H 2Z9JA 4X8TH 1MD7A 5B6OA 3SN8A 1SGEE 3SU1A 4ESTE 3SI4H 2BD4A 3BG8A 4I8KA 2FS9A 9ESTA 2GGVB 3ATIA 1AB9C 1XUFA 5C1YA 1TAWA 2SNVA 1ZHPA 3FFGA 3SUEA 3QUMP 2ZHWH 3B8JA 4OS5A 2VWLA 1O2TA 1XMNB 3SUDA 1Z8GA 1GL1A 3GICB 1TPSA 4TY7A 5HGGA 1K1IA 1TOCB 1DICA 2ZFTA 2ODQA 2C93B 1KY9A 4K1EA 1UVOA 1WQSA 1D9IA 1P57B 2F83A 2Y5HA 2QXGA 1A5HA 3M61U 1LHGH 2XXLA 1AIXH 3PROA 1BUIA 1H8IH 1NESE 1O5CB 6CHAC 2OP9A 3MMGA 1ZOMA 1KTSB 3A85A 4Y76A 3PMJA 5T6DA 3A7WA 3UTUH 1SGRE 2FI4E 1GHWH 1LVBA 4J2YB 3URCA 3E16B 2OC0A 3SI3H 2FIRH 5GXPA 3MO9A 1NC6A 2G81E 1ZMLA 2ZDKA 1GI2A 1YPHE 4UEHH 1YPLH 3SJOA 1ANCA 2AGEX 5C5OA 1BBRE 4H6TA 4Y79A 3BTFE 1O0DH 1Z8RA 4YZUA 4TPIZ 1QL9A 1HCGA 1OP0A 1OWEA 2HLCA 3WY8A 3GDUA 1O2SA 2VJ1A 4Y7BA 4Q7XA 1RIWB 2M5TA 2C3SA 2VVVA 1RS0A 1NFUA 1Q3XA 2ZCKP 1GDNA 3KEEA 3SBKA 1AI8H 2AH4X 3EGKH 2A32A 1MTSA 2ANWA 4NG9H 5IDKA 1OX1A 1W13U 4XBBA 1RJXB 1GMHF 1C2GA 4X1RU 4RKOB 5HMAA 4VGCC 1SGFA 1RTKA 3U8OH 4NA9H 1CHGA 1BDAA 1DY8A 3DA9B 1MBQA 3F6UH 2J94A 3DUXH 3SGQE 4JCNA 1GG6C 1QBOA 2GD4B 3UY9A 1GBCA 3SUFA 1UK2A 1ELEE 3AASA 3QK1A 4ABHA 1UVUH 2QXJA 2EI7A 1C5TA 1JRSA 4XBCA 1YCPK 3UWJH 2YNAA 2AFQB 1G2MA 3M3SA 1ELTA 1K1OA 1C1RA 5C1UA 1UTJA 2VINA 3RM2H 3PWBA 4OGXA 1EUFA 4X1QU 1EJNA 3QLPH 1FY1A 3HK3B 4A5TS 1GGDB 2FTMA 3RXPA 1ZTKA 4GLYA 5K0HA 1Y3WA 4MG3A 1ARCA 2QF3A 3S9CA 1VCWA 2K7XA 5H4IB 2GCTC 1Z7KA 5JBTA 1A0JA 4I8JA 3V12A 3MNCA 4IN1A 2GP9B 1CU1A 1O3BA 1ANDA 2PGQB 2FEQH 5CE1A 2Z3EA 2CF8H 3BG4C 4U2WA 1EZSC 3AAUA 4Z6AH 2ZDLA 1MTUA 1Z8IB 3TJUA 1QTFA 1C1NA 3RXOA 4BAOB 7ESTE 1SLWB 1TRYA 1YLCA 1HPGA 1GHBG 3I77A 4F49A 1HAGE 4HGCA 4JK6A 5ABWA 3LC3A 3LH1A 1GBFA 1RTFB 2C90B 1BQYA 3MI4A 1GJAB 2F9VA 4GHQA 3SQHE 4INHA 2Y81A 5TCCA 1BRUP 2PTCE 1A1RA 3LT3A 3UPEA 1IQEA 1D3PB 3PB1E 1MBMA 1O5AB 1GDUA 1C2DA 8LPRA 2IJOB 1K9OE 1ZJDA 2H6MA 1OWDA 3V0XA 4B73A 2JETC 2G55A 1TBQH 4DW2U 5DPAA 4R0IA 1S6FA 3B23B 1FPCH 1BBRK 4X2WA 3RC4A 1LKBA 1QQUA 1OWJA 3GY6A 1VITF 1QRWA 2FYQA 3BTEE 1OWKA 3MNSA 1O3EA 2PUXB 5ESBA 1EP5A 3MU4A 3RP2A 4D8NA 1O38A 1MTVA 2FX6A 3GY8A 2FS8A 1FZZA 4UFFH 4NIXA 2GDEH 1TWXB 3E1XB 3A88A 2UWPA 3D65E 3LH3A 2HPQH 3P8OA 3AVZA 3EBNA 2AGGX 3ZVBA 4X8SH 2SGFE 4ASHA 1O2HA 2BQ6B 1DLEA 4NCYA 1N6YA 2A7CA 4WWYA 4Y7AA 3EA7A 4IMZA 2ZGHA 1AB9B 1NFXA 1ZMNA 2EEKA 3VGCC 1HAVB 4MTBA 5E2OA 1TMTH 1HXEH 2PV9B 1FV9A 1TALA 1TA2A 1DDJA 1XM1A 1KTTB 4GHTA 1ELAA 3QTOH 2Q1JA 1AGJA 4ZHMU 3BV9B 1W10U 4AFSA 1MQ5A 2F9UA 1C1OA 1M9UA 4ZXYH 1E34B 4KTUA 1SGTA 4K3JA 5T6FA 4IC5A 5DGJA 3ZZ6A 4FUBA 5FBIA 2WYGA 6CHAB 3FZZA 2QC2A 1HAYB 4ISNA 1SOTA 1S0QA 3BN9A 2P3UB 5LH8A 3RU4T 3TGIE 3C1KA 3RMLH 2EA3A 3ATWA 1A3EH 1C5PA 2W5EA 2QXHA 1EAXA 1GI3A 1MZAA 1DE7H 3T62A 3SQEE 3U98H 2W7UA 1MU8B 3ENSB 3GISB 4AOQA 1C5QA 4NWLA 2UUKB 1Y5AT 3RMOH 3HGNA 1BCUH 3MH4A 4NA7A 3P70B 4THNH 1F5RA 3SV2H 2TRMA 4Y8XA 3RXIA 1VZQH 2DE9A 1NS3A 4BXSA 1B0FA 1K28D 4Y6DA 3NUMA 2CV3A 3GCTG 2XBYA 3Q3YA 1W7GH 1F5KU 3TK5A 4KTCA 1YCPH 1U6QA 3PLBA 2VU8E 1W0ZU 1FN6A 4GVUA 1RRKA 2G4TA 3ZV9A 4AGJA 3MNBA 5A8ZA 3P8GA 1O3HA 1K1JA 1HAVA 2TPIZ 4Q2KA 1V2JT 1QFKH 1HJ8A 3KQEA 1MMJN 3MH5A 5I46H 2ZCLP 4K2YA 1XUKA 1GG6B 1S83A 1GI5A 1O3CA 1YKTA 3DHKH 4BANB 1EATA 1MAYA 2UUYA 1DSUA 4X2YA 5DP7A 1XX9A 1NRNH 1BHXF 2P3TB 1IQLA 2GVFA 3M5NA 1XVOA 3PMBB 1ZHRA 4X6MA 1HRTH 2XWAA 4MPVA 1CA8B 3S9AA 1BRBE 1S5SA 1C5NH 3Q00A 5EW2H 3UWIA 1V2MT 1ABJH 1DPOA 4X6NA 5EPNA 4A92A 3M5LA 4ZAEA 1V2PT 2O8UA 3LGWA 4K5ZA 2FI3E 2A4OA 1GJ5H 3TH4H 3TLOA 5JB8S 1A0LA 4BAMB 1GHAG 3A7VA 3UNSA 1ZJKA 1AVXA 2ZI2H 5EOKA 2ZNKH 2GCTB 3LONA 1O2LA 4IC6A 8GCHG 2BZ6H 2GZ7A 1F0SA 2C8YB 2QF0A 3UQVA 4Y0ZE 6ESTA 1DWEH 2P8OC 4O9VA 3RXAA 1A5GH 1J9CH 1BTHH 3BG4B 1UVPA 4DIIH 3BIUH 5DP3A 1AVGH 5GDSH 4BXWA 1Y3XA 1L2EA 3SNCA 1QL7A 4RN6A 1G32B 2STBE 1Q31A 3K2UA 2BMGB 1FY3A 5DKMA 1WOFA 2Z3CA 3M3TA 1X7AC 1IQGA 1YPJH 2FOCA 1G3CA 1O3JA 4IN2A 1SC8U 5FPTA 3T27A 4LZ4B 2BLWA 4MQAA 1HFDA 1S6HA 1P09A 3RMMH 2FYRA 3NXPA 1TNIA 2O8LA 1IQMA 3S9BA 3A7YA 1GHBF 5C5NA 3LIWA 4D9QA 7LPRA 1SL3A 2ZFQH 1TX7A 2GMTC 3JZ2B 1V2TT 4YT7H 1SFIA 2JKHA 1ABIH 1P06A 3RXHA 1NTPA 2JETB 1BA8B 1IQKA 1FMGA 2RA0A 2A5KA 2WINI 5AFZH 2F9BH 1UTLM 1DXWA 4YOJA 3ZVEA 3RXVA 4I8GA 1CA0C 1O3PB 1DY9A 1LVOA 1O5BB 5BRRE 2VH0A 1YPKH 2CMYA 4NGAH 4MVNA 2FOFA 2SNWA 1P3CA 5L30H 3SU5A 1N1LA 1AKSB 1UK3A 2FI5E 4U32A 5HYOA 4NFEA 3P92A 4OS6A 3SU6A 4BTTB 4B2AA 2FOGA 1J15A 3GCNA 2GX4A 1O2NA 1ELDE 2FDAA 1SR5C 1FLEE 5JBAS 1K1MA 2CHAC 3BEFB 1ANBA 4CRAA 1YC0A 3STIA 2J34A 4CREA 4KTSA 1CVWH 1YBWA 2XC0A 1GI4A 1RTLA 1HAPH 2B0FA 1QJ1B 2WPMS 1T4VH 1GHZA 4X6OA 1XKBC 1O2JA 1BHXB 5FPSA 1PYTC 1DUAA 1F0UA 1IOEA 1LKAA 3VGC