1L4DA

Crystal structure of microplasminogen-streptokinase alpha domain complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
249
structure length
249
Chain Sequence
APSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDAGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase activator
molecule keywords PLASMINOGEN
publication title Effects of deletion of streptokinase residues 48-59 on plasminogen activation
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 249
sequence length 249
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2002-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l4dA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l4dA01
4CHAB 1O39A 2ZTXA 1GI7B 4NA8A 1E37B 3MH5A 1EOLA 1CU1A 4XBDA 1P03A 5F8ZA 1C5NH 3QDZB 2QXJA 1XUJA 1TB6H 2HVXA 1S6HA 1YLDA 1E38B 2ZU3A 1SQTA 2FZZA 1FY3A 3FAOA 1ZRBA 1AY6H 1VGCB 4NIVA 5DGJA 1TOMH 1UO6A 2BDYA 1C5PA 1V2QT 3R3GB 1BJUA 1MKXK 2ZHFH 1OWHA 2Z9KA 2BX3A 3ODFA 5EQSA 1HIAB 1O5CB 1GHZA 1YF4A 1AU8A 2ZDAH 3A8DA 5F6MA 3MOCA 1TPAE 2ZU5A 4TWWA 2G4TA 1LQDB 1NRSH 1SGRE 2O8TA 1TX7A 3ATLA 1WOFA 1CVWH 1P3EA 1ESTA 1LVBA 1ZZZA 5E0HA 2QV1A 4OS5A 5GXPA 1JXPA 1C9TA 1PPFE 1AZZA 2ZCHP 1C2IA 1P06A 4K1SA 1KTTB 1O3DA 2FLRH 3ZV8A 3OX7U 4B2CA 1S82A 2Z9LA 2GDDA 1AMHA 2G5VA 1NTPA 1UTNA 3MHWU 4AB8A 1QR3E 3D65E 3F6UH 2B8OH 3M7QA 1O5DH 4A92A 4AGKA 4CH2B 1C5ZB 2ZFQH 3E16B 2A5KA 5C5OA 2Q6FA 5GCHG 1GHXH 2ZCKP 1K22H 2DE8A 3TJVA 1TOCB 4XOJA 3U8RH 4GLYA 3S69A 1O3NA 2GGVB 3ENSB 1NRRH 1T32A 2HOBA 3PMAB 4WMDA 2AERH 1SQOA 1O2RA 1CBWC 1C1VH 1EPTA 4CBOA 1V2NT 1F5RA 1GBMA 1F2SE 3QLPH 1TNKA 3BEIB 5A0BA 4E7RG 1NO9H 3NCLA 2W7SA 1J14A 4TY7A 2ZDVH 3RXTA 2J34A 3SU3A 4B1TA 2B9LA 5A0AE 3GYMA 4D9QA 3P92A 2ZI2H 2ZGBH 2PKSC 3MU4A 3OY5U 1HPGA 1TBQH 2BLOA 2CGAA 2CJIA 1LTOA 4AX9H 1GJ6A 1GBEA 7ESTE 1RXPA 1P11E 4X1QU 1HV7A 5A09A 4MNYA 1A7SA 1RTLA 1INCA 2RA0A 4K8YA 3UQVA 4X8SH 2XC0A 2ZDKA 1G2MA 2QAAA 1QRZA 3ZVCA 5DPAA 3FP8E 3RU4T 1Y3WA 5LH8A 2ZC9H 1PPBH 3ODDA 2F91A 4UFGH 3ZVBA 4AFSA 2BXUH 1V2PT 3H7OA 3SUDA 1Y5UT 2GMTC 4Y79A 1ARBA 1ELAA 3D23A 3LGUA 3SU1A 4AORA 1JWTA 1LMWB 2NWNA 3B8JA 1DFPA 3HPTB 1Z1JA 1TWXB 4GVUA 3MTYA 1TPPA 5E2OA 3SOSA 4KGAA 1FNIA 4AYYB 2OC1A 3BTWE 2QXHA 3ITIA 1SL3A 2V3HH 1IQNA 1QL8A 1C4U2 3P17H 1A3EH 1YYY1 1OWIA 4JYTA 1K2I1 1P57B 3AW1A 4TYDA 4Y8XA 3T27A 4D7GA 1Z6JH 1EZXC 3ZVDA 1EJAA 1V2ST 2VJ1A 2PGBB 1AFQC 2ZHEH 4BAHB 2ZFSA 1O33A 4FUDA 4DT7B 1KXBA 1CHOG 1PYTD 3E3TA 1BHXF 2A7HA 1OP8A 4ZAEA 1ELTA 2R2MB 1H9LB 5FBIA 2BDAA 1OWDA 4DURA 1ZPCA 3NZIA 1GMDG 1V2UT 1YPMH 2O8MA 2A2QH 2F9OA 3OSYA 1AE8H 1P0SH 1MAYA 3SV2H 3SBKA 4FVBA 4YOIA 3Q3KA 3KQCA 1F0TA 4XDEA 1ZSLA 1GI4A 2K1QA 1HAYB 3GY5A 2TGDA 3QWCH 4NZLA 1SHHB 1AKSB 4U2WA 1Z7KA 1Z8IB 1FIWA 5EQQA 4FUBA 3SZNA 4J1YA 2Y5HA 2H5DA 4ZH8A 1HAVA 5EW2H 3U9AH 2C8YB 1Y59T 2ZTZA 1G3CA 2A4QA 3MU5A 1Z1IA 3SU2A 1A2CH 3DHKH 1LQEA 3I78A 4BTTB 4X6OA 5DP8A 5DP6A 1XUFA 3MWIU 4XBBA 3QUMP 2BMGB 3NWUA 4MQAA 3SNAA 1A5GH 2ANYA 2FI4E 2FODA 1VITG 4NWKA 2Y81A 2FO9A 1DSTA 1DXPA 4ISNA 3ZZDA 2J92A 2BQ6B 3RXUA 2EI8A 1DT2A 1UTJA 2ANKH 2GVFA 3HKIB 5AHGH 2Q6GA 1HLTH 2VWNA 2C8ZB 8LPRA 1GI3A 1HJAB 5JPMH 3TGJE 3A8BA 3QZRA 1P2NA 3A82A 1IAUA 2J4IA 2A31A 2FS8A 1FY8E 4VGCC 1SLXB 1IQJA 2Y7ZA 4SGAE 2BDCA 3GDVA 1E0FD 1XUKA 1TNLA 3AVZA 4Q80A 1OP0A 2P95A 3V3MA 3S9BA 1ZTLA 2ZDNA 2J9NA 3F9GA 3L33A 1D3QB 3IITA 1K28D 2ZHQH 1CHGA 3A80A 5HMAA 3STIA 1FXYA 1ESAA 2QIQA 3RMMH 1DWBH 1KXDA 1S81A 3ZZ3A 4X8UH 2XCFA 3DUXH 1C5YB 1ANBA 4GHTA 2JH5D 9ESTA 2BM2A 5ESTE 3S7KB 5FX5A 1THPB 5E8EH 3SHAH 4X8TH 3RXRA 5E2PA 4AG1A 1C5MD 3A8AA 1ELFA 2GCHF 1AVGH 2ZIQH 3O8DA 1QFKH 2B0FA 1O38A 3SU0A 4ABJA 1YPEH 3U69H 4D8NA 2Z6BD 1BMNH 2BY6X 3TGIE 2J2UA 1C5OH 2FIRH 2AGIX 1YPKH 2AFQB 3O8RA 1YM0A 1DS2E 1XMNB 4Y8ZA 1Q31A 1UTMA 1WV7H 4YM9A 1O2PA 1RTFB 1C5QA 2Y6TA 2Z7FE 4J2YB 3TPIZ 4MNXA 1S5SA 4UEHH 1AI8H 3T28A 3IG6B 4HGCA 2PV9B 3OY6U 1SC8U 1QBVH 4I7YH 2CHAC 1QB9A 1GG6B 2PW8H 3RXGA 3A86A 1SSXA 5LPEA 2TRMA 3P8OA 4OGYA 5FAHA 3BTHE 5T6FA 5EQRA 3P8FA 4NGAH 1HJ9A 5EOKA 1HAGE 2YNBA 1NZQH 2BLWA 4X2WA 1SR5C 3A8CA 2BLVA 1BZXE 3M3VA 3M7TA 2PLXA 4ABGA 1RIWC 1GBDA 4JYVH 3WY8A 1DLKB 2ZHWH 1EX3A 1PJPA 2LPRA 3LGWA 5PTPA 3HGPA 2GD4B 4ZROA 4WMFA 2SGEE 3LU9B 3GCTG 2J95A 5FX6A 1TBZH 3BIUH 3MNCA 5IYTA 1J8AA 1O3BA 1JIRA 3DD2H 4MG3A 3M7UA 4IMZA 3DA9B 3SNDA 1O2VA 3M3TA 8GCHF 4D76A 2VB0A 3HK3B 3RM2H 1D6RA 1JRSA 2GZ8A 3LT3A 1T8OA 3EYDA 4Y71A 3VPKA 2ODPA 3LC3A 4Y0YE 4BXWA 1EJNA 1G9IE 4PROA 4DY7B 3T26A 2IPHA 2VVCA 4ABFA 1ZOMA 1G30B 1UVTH 8ESTE 1SGFG 1RTKA 3O8CA 2R2WU 3SGBE 1B0FA 3P8NA 5CHAC 5JB9S 5DP3A 1YPJH 4KTUA 1TA2A 3SORA 1C1WH 3B9FH 4YO9A 1K1MA 2C8XB 1O2OA 2BDGA 3PTNA 1TA6A 1GCTC 4ISIH 3RC4A 2UUJB 3PMJA 3QZQA 1P01A 3SNCA 2A45B 4JZ1A 4X6NA 2ASUB 2FP7B 2FOGA 1SPJA 2ZECA 4FUIA 1O3IA 5JBCS 5E0GA 1TQ7B 6CHAC 1QA7A 1DITH 1V2WT 3KN2A 1PQAA 3FFGA 1O2SA 3FVFB 1EJMA 3KCGH 3BTFE 3K6ZA 4GAWA 2VGCC 2BY5X 5T3HA 1P9UA 4BANB 1DANH 4DJZB 3CENA 1C5XB 1Q3XA 1O2TA 3E91A 1D4PB 4WWYA 3PO1C 2BDHA 1WQVH 1YP9A 1GMCG 4RKJB 1TFXA 1C2GA 4FVDA 5C1XA 1FN6A 3EGKH 4ISLA 2V3OH 1IQFA 1Y3VA 3MNSA 2QF0A 3UR6A 1UTPA 4DOQA 1C4Y2 2C93B 1NPMA 2UWOA 2HRVA 2QXGA 5GIBA 1P2IA 5DP4A 3V0XA 3SQHE 1AD8H 1YBWA 3VB3A 1YCPH 4NG9H 2VIOA 4WF8A 4Y6DA 1IQGA 2P8OC 1HAPH 1XX9A 4AZ2B 5DP5A 1GHAG 2W3KA 4NA9H 6LPRA 1HAIH 4ZHAA 1GJCB 4LZ1H 2A4GA 3RXEA 2R0LA 2F83A 5EPYA 4ZXXH 1IOEA 5H4IB 4HZHA 3RXMA 1QRXA 2PUXB 2HPQH 5FCKA 1NN6A 1HXEH 1YPLH 4X2YA 1QCPA 3RXJA 1F7ZA 4NCYA 4AN7A 1W12U 3I77A 1BT7A 2QC2A 6ESTA 3SV8A 4FUHA 2R9PA 1RGQA 1LHCH 3PLBA 2FI5E 3RXCA 3LIWA 1GMHG 1O2GH 5ETXA 1C1UH 1TGBA 3U1IB 1QHRB 1SLWB 2OQ5A 3MNBA 3GDSA 2GZ7A 1H8DH 4UFDH 3SJ8A 1GGDB 1KDQB 2PTNA 2WUBA 3MH6A 2ZFTA 1AWFH 3A7YA 5AFZH 3U8TH 4BAQB 3FZDA 1V2JT 1E36B 1GBHA 2FM2A 1AB9B 1EASA 1SGPE 1IQMA 5AF9H 1AGJA 3VB4A 3A81A 1HUTH 4UD9H 2VWLA 2A5IA 1TE0A 1PPHE 3HK6B 4R0IA 4B75A 1C1RA 1BTYA 3KHVA 1FI8A 1WCZA 1C9PA 1PPEE 1C5TA 1QURH 3QO6A 4GSOA 2TGPZ 1GJDB 2P3TB 4KP0A 3GY4A 3M37A 3U98H 1T8NA 1WQSA 1V2VT 4CRAA 1FDPA 2JH0D 1C2MA 4GUXA 1YGCH 1KIGH 2ZGHA 1UTKA 2VINA 1LHFH 3A87A 1EPTB 2BB4A 2UUYA 1LPGB 3HGNA 2VVVA 3SW2B 1QB1A 2ANWA 1TGTA 1VCWA 2EI7A 4WJG2 5GCHF 4Y0ZE 1QBNA 2Y5FA 1IQHA 2ZA5A 1BTWA 2UWLA 1D3PB 3LC5A 1NY22 1NC6A 2XWBI 2VH0A 4B73A 3VGCC 2BDIA 3A84A 2AIPA 1MTSA 2QY0B 2ZPQA 1FJSA 1MZAA 1D3DB 1W0YH 1LHDH 2OD3B 1C5LH 2PFEA 1ARCA 3G01A 3NK8A 4ZHMU 1NS3A 1ETSH 5F03A 2XXLA 2SGDE 1BRAA 3BTTE 1OKXA 1KLJH 4F4OC 3RXIA 3QX5H 5GDSH 1F0RA 3UFAA 1BRBE 1NFWA 1DOJA 4O97A 3Q77A 1ETRH 1ZPZA 5C67A 1KDQA 3TK6A 2VIQA 3SHCH 3M35A 2PHBA 4LZ4B 1K9OE 1P2OA 2TPIZ 4TWYA 1ZTKA 3TH3H 3TK9A 4YT6H 4B2BA 5A8YA 3A83A 3UPEA 3A89A 1SI5H 4DCDA 2DUCA 3ZYDA 1Y8TA 4I8GA 3JZ1B 4I33A 2HGTH 1O3OA 1QJ1B 1TNJA 1MH0A 2VIWA 5EGMA 1YKTA 2LNCA 2QXIA 1YPHC 3BTKE 4NSYA 4I32A 4A1TA 2A2XH 1GJ5H 1AQ7A 2ZU2A 4MNWA 2Z9JA 2SGFE 3K9XB 5SGAE 5FXLA 2OTVA 1A46H 4CRCA 5HYOA 5L30H 1BB0B 3Q3XA 5AFYH 1BCUH 2FOFA 4HFPB 1RRKA 3S9AA 1A0JA 4YOGA 1FN8A 1AN1E 2QGRA 2Y82A 3ZZ5A 3PLPA 3PMHB 1O3JA 4CRGA 4OS1A 1YCPM 4CR9A 1GI2A 1BBRH 4X2XA 1Y3YA 2PSYA 2BZAA 2FXRA 3UWJH 1QA0A 5HXFA 1S85A 2VWOA 2SGPE 1K1JA 2BD9A 3A7WA 4BAOB 1O3MA 1W3CA 1ZSJA 4YTAA 1P02A 2ZO3H 1O2UA 2FOCA 1XXFA 1AO5A 1XVMA 3B23B 2VWMA 1A0HB 1B5GH 4CBNA 1XM1A 1EP5A 2IOTA 1CO7E 4YOJA 1NESE 1H4WA 1GMDF 4H6TA 1LKBA 4ZKSU 1HAVB 4R8TB 2EC9H 5DJ7A 2BTCE 1GBLA 5L6NH 1GDNA 1QGFA 1THSH 2OP9A 1DUAA 2ZU4A 2OCVB 1O5FH 1MTUA 4WXIA 1TBRH 2AS9A 5JBBS 3GICB 1O2IA 4X6MA 1GBCA 2WV5A 4NSVA 1Z6EA 1QRWA 1VR1H 2BQWB 3M36A 1DWCH 2A32A 2GDEH 4I8KA 4OS6A 1MMJN 3ZZCA 2AIQA 2FOHA 1TNGA 3RU4E 6GCHG 1CA0C 2C90B 1V2RT 1BUIA 1DUEA 2PSXA 4THNH 4TY6A 1NRNH 1O2KA 4MTBA 1GVKB 3QK1A 1YPHE 2A7CA 1OP2A 1C1SA 3KQBA 4YESB 1VITF 4JCNA 1TLDA 3S0NA 2Z3CA 1UMAH 4UDWH 2PR3A 1BTZA 3LGIA 4Y10E 4E06H 2AGEX 1DY8A 1GBJA 1KXAA 1SVPA 2V6NA 1VCQA 2VIVA 1O2JA 4QT8C 2BVRH 1O31A 2DE9A 3E90B 2FDAA 1J9CH 3CS7A 1O2XA 1UHBA 4ABBA 2G8TA 2R3UA 1P2MA 3SU4A 4Y11E 1WUNH 1DLEA 1HYLA 3Q76A 4UFFH 3RC5A 4HTCH 1ACBE 1CBWB 5C1UA 2CN0H 4KELA 2G4UA 1KSNA 1GI0A 2AMDA 4MVNA 1C5RA 3RMOH 2C3SA 1W8BH 2KAIA 3SJIA 2GCTC 4BAKB 1ZR0A 4MPXA 2W26A 1F0UA 1UVOA 1N8OB 5CE1A 1UVSH 4AFQA 1TGSZ 2ZPRA 2PKSB 3V7TA 9LPRA 2Z94A 4NA7A 4AFUA 2STAE 5JBAS 1NROH 5FBEA 3BTME 3BG4C 2XRCA 1QJ6B 1AUTC 3TK5A 4ESTE 1MTNC 3W94A 3CS0A 4X1SU 1UVUH 1O5GH 1GI8B 2GV6A 1GVLA 1XXDA 3GCHC 4BOHA 2AMQA 4RN6A 4A5TS 1V2OT 4FU7A 4ZKRU 1C1TA 2YOLA 1V3XA 1ZJDA 4B2AA 4JK5A 2P93A 3SQEE 2SGQE 1TYNA 2O8WA 2FWWA 1O5BB 1C2HA 1XUGA 2ALVA 2GMTB 5L2ZH 1TMBH 1H8IH 3RUOA 4U32A 2BD3A 1TNHA 8KME2 3RDZA 1C1MA 4ZUHA 3HKJB 3MFJA 1LDTT 2G52A 1SMFE 4Y8YA 3ZVAA 7LPRA 1LHGH 1C1QA 1GPZA 1TGNA 1YC0A 3LJOA 1IHSH 1LKAA 1L2EA 3MO3A 3A7TA 3GYLB 1EKBB 3RXHA 3AASA 3UY9A 1Y3XA 2ZQ1A 1Y3UA 5C2ZA 3K65B 3F68H 2SNWA 4JK6A 4WMEA 4I8HA 1BJVA 1VZQH 1ANEA 1HGTH 1NRQH 4WVPE 1MQ6A 4IMQA 2HWLB 3GY8A 1JOUB 2FX4A 1CT2E 4IN2A 3GCTF 3H5CB 1AFQB 1C2JA 1GI6A 1L4ZA 1ETTH 4K5ZA 4AFZA 2Y80A 2EEKA 1BTUA 2I6QA 4MNVA 5JDUB 3HATH 1GDUA 1GBFA 3VXFH 1YLCA 1QL9A 4ABIA 1AE5A 4IW4E 1SOZA 3TIUA 3UTUH 2RDLA 1IQIA 2XYAA 1O32A 2BZ6H 5CMXH 2BHGA 1QBOA 4K60A 3RMLH 1TQ0B 5DP7A 3CP7A 4CRDA 1ELVA 1BRCE 1KXFA 1MCTA 1O2NA 1QB6A 3UNRA 2HALA 3A88A 2R3YA 2HNTF 2TBSA 2BD7A 2OUAA 3I29A 4WXVA 1UK4A 1ZGIA 3E6PH 1A3BH 1EUFA 2V0BA 4Y7BA 1ANDA 2H5CA 1C2FA 2NU4E 3M5LA 3P70B 1O2QA 1O0DH 3MNXA 3F9HA 1GWAA 4B74A 4DIHH 1WSSH 2P3UB 2NU3E 4D7FA 1DM4B 1Z8GA 2NU0E 3QN7A 4XE4A 1JRTA 2AYWA 5LGOA 4DVAU 1P2KA 2FYRA 3SV6A 2PWXA 1GHBG 5TCCA 1EZQA 1NM6A 1O3FA 3ZV9A 3BN9A 2A4RA 4YZUA 3KF2A 5LPRA 2BQ7B 1A4WH 3SU6A 3SI3H 4VGCB 3TJUA 1GI9B 4F49A 1TONA 3TVJB 3LH3A 1MKWH 5K0HA 2GT8A 4KTCA 2G55A 2WPJS 3VB7A 5K7RA 1UCYH 3PV4A 1QQ4A 4BAMB 2ZWLH 3OYPA 3SN8A 4CRFA 3MMGA 2F3CE 3A7ZA 2J94A 1KLIH 1MU8B 4WH8A 3T29A 3SJOA 1MQ5A 2XBYA 1O3PB 2NU1E 2QN5T 2WPLS 2ZGJA 5BPEA 1C1PA 7GCHF 1W7GH 2ODQA 5FPSA 5LPFA 3EQ0H 5DP9A 2RG3A 1G37A 4BXSA 3U8OH 5F8TA 3GCOA 2FPZA 4JZDH 1P10A 4FUEA 1ZJKA 2BOHB 2I6SA 3C1KA 4SGBE 1EAWA 1O34A 4U01A 1EAUA 1H1BA 1G32B 3VXEH 1ESBA 2GTBA 4OGXA 3TH4H 4BTIB 1UK3A 4H42U 1GMHF 3RLYH 3L6PA 2ULLA 3GCNA 1DE7H 3A7VA 4FU9A 3DFLA 1ZSKA 1HAOH 1PQ7A 5EXMA 4JZFH 2F9PA 4Q7ZA 5T6DA 2CHAB 1EOJA 1K1PA 1FY5A 4LXBH 1P8VC 4Z6AH 1HAHH 1GBIA 2TGTA 3PB1E 1SGQE 3RMNH 1GJ4H 2OXSA 3ZZ9A 2D8WA 3P8GA 1LPKB 1MTWA 3D49H 3QTOH 3ZVFA 3MH4A 3ATWA 5EODA 1ANCA 3GISB 1C5WB 1RIWB 3UNQA 2JETC 1TPOA 1ZHPA 4I8LA 1H9HE 4CHAC 2SFAA 5TCAA 5J4SA 1HAXB 1AWHB 1SGNE 3LONA 1OSSA 2P16A 4NIWA 1UCYK 1O30A 3EA8A 1A5HA 4XBCA 1GJ7B 3ZYEA 1EZSC 4E7NA 1OX1A 3MU1A 1VGCC 4NFEA 2F9UA 4DG4A 1QQUA 4INKA 3S9CA 3MI4A 4K1EA 1AHTH 1TALA 4UONA 1GBKA 1FY4A 4X2VA 2FOEA 3LGVA 1L1JA 4H6SB 4Y7AA 3RXFA 5CHAB 2XTTB 1KTSB 1P04A 1C5VA 3M5NA 1DX5M 2VIPA 1ELDE 3VEQB 4YLQH 1MD8A 2WPHS 4IBLH 4O3TA 1IHTH 2UUKB 5GPIB 1SOTA 5DG6A 2EA3A 1SFQB 2ZDMA 4DW2U 1GCTB 1G3EA 3ZVGA 1EATA 1LO6A 1LVOA 1RD3B 2PKAA 1MKXH 5DKMA 4CREA 1PQ8A 2BD2A 1OYQA 1GBAA 1O3LA 2XW9A 4JYUH 1TAWA 3OU0A 6CHAB 4YT7H 3GY7A 3P6ZB 2BOKA 2OINA 1OOKB 3LGTA 1BTPA 4CR5A 4IC6A 2VGCB 4X1PU 1GBTA 3UR9A 1BA8B 2B5TB 1NFXA 1CGHA 1YCPK 3BEUA 3PO1B 3GY3A 1DDJA 1P05A 1ZMJA 3TJOA 4TPIZ 1ELCA 2H9TH 3C27B 3S7HB 4H4FA 1L1GA 2AGGX 1SGEE 3DT0H 1MUEB 1SLUB 3LGYA 1T4UH 1PPCE 3E0PB 3PROA 3RM0H 3RXKA 4ZKOU 3UREA 1AZ8A 2PGQB 2WUCA 5BRRE 4WH6A 5JBTA 2P8OB 1ZHMA 4GCHG 3ZZBA 1FPHH 1RJXB 3SJ9A 3EA9A 1KXCA 1O3KA 3QGNB 1J17T 2ZGCA 2OBOA 1VITH 1RFNA 1V2LT 2XCNA 2FLBH 3M61U 5FHTA 2ZFRH 5FPYA 1O3GA 3LDXH 5ESBA 1Z71A 2F9NA 2XC5A 2D1JA 4ZKNU 1B0EA 5EG4A 3V12A 1Z8RA 4DGJA 2EI6A 1A5IA 4O9VA 1C2DA 4NZQA 3MYWA 3UOPA 3UQOA 2GT7A 1PYTC 2BD5A 4Q7XA 1UVPA 1Q2WA 1O2LA 4X0WU 3RXSA 2H6MA 5J4QA 3BEFB 1VJAU 1S84A 1FQ3A 4Z0KA 1ZMNA 1EB1H 3RXVA 1ELEE 1GHVH 2BX4A 1ORFA 2GZ9A 3RXPA 5L2YH 3UIRA 1F5LA 3IWMA 4ISHH 1P2JA 2STBE 2J38A 2WINI 3EDXB 4LK4A 2O9QA 4FUCA 1S0QA 1TNIA 4BNRA 3RXLA 4AOQA 3NKKA 4Y76A 1UTQA 3K2UA 1PQ5A 4E05H 4TPYA 1OPHB 1PPGE 2W3IA 4OS7A 1UCYE 6GCHF 3EE0B 1SFIA 1MAXA 2UWPA 5A8ZA 3RXOA 1ABJH 1P12E 1O2ZA 1C5SA 1UHBB 1BMMH 3SNBA 1Y5AT 3ZVEA 3PMBB 2Z9GA 2JH6D 1AVXA 2C4FH 2GKVE 5TJXA 1QL7A 1JBUH 1K1NA 2G5NA 2ZFFH 3URDA 5HM2A 1N6YA 4XSKU 2GV7A 2ZG0H 1OWJA 2KAIB 4O3UA 1GJ8B 2ZEBA 4A1XA 1CHOF 5GWZA 4ZMAH 3VGCB 1O3CA 1GCDA 3GDUA 1IQLA 5FCRA 3SU5A 2FS9A 3NXPA 1HBTH 4FUGA 3K6YA 1N8OC 1G3DA 1WTHD 3BTQE 1TMTH 3KEEA 1XUIA 2SNVA 2FTMA 1TPSA 3SUFA 1G3BA 1ABIH 1EZUC 1QIXB 2XNIA 1GI5A 4NWLA 3TU7H 1HIAA 5HGGA 4JZEH 1KY9A 3F1SB 1MD7A 2FOBA 2YNAA 4FU8A 1KYNA 1S83A 1Y5BT 1ZGVA 1ELBA 3EAJA 3L3TA 5FPTA 2F9BH 3LKWA 2BY8X 1M9UA 1EB2A 3E8LA 3KIDU 1ID5H 3U1JB 1G36A 1L4DA 2ANMH 1TX6A 1ZLRA 1OYTH 2NU2E 5HM9A 3TGKE 1TRNA 2AEIH 1L0ZA 2Q1JA 2RA3A 1O3EA 1E34B 1GI1A 4NIYA 1O36A 1PPZA 2O8LA 1J15A 3KL6A 3FZZA 3UOUA 1HJAC 4NIXA 1BBRK 4ISOA 2CV3A 3TJNA 1OS8A 3ZZ7A 1GJAB 1P3CA 1O37A 3SNEA 1GJ9B 3RLWH 1FAXA 4A7IB 2UUFB 2ODYB 3PTBA 1UJ1A 1JMOH 1SLVB 1FMGA 3GY2A 3FANA 2BY7X 1FAKH 1BQYA 3BTGE 2H2ZA 2A5AA 3FP7E 4K1TA 1LVYA 3M5MA 4CRBA 1S6FA 5A8XA 1N6XA 3OTJE 1O2HA 5EW1H 1SGTA 1K21H 4A6LA 1TMUH 1T31A 2OC0A 1DSUA 4LOYH 4D9RA 1O2WA 1ZMLA 1W10U 1P09A 2ILNA 1DWEH 3RU4D 3P95A 1D3TB 1DPOA 3PWCA 4U30A 1B7XB 1TGCA 2FMJA 3T25A 2XWAA 1V2TT 2G51A 5G4BA 1T4VH 1GDQA 1GL1A 1SB1H 3GY6A 3SV9A 1XUHA 2R0KA 2Z3DA 4K3JA 2ZHDA 4X6PA 4AG2A 3BF6H 3BIVH 1GHYH 2H1UA 1TRMA 2HLCA 1HCGA 1BRUP 1LHEH 3LJJA 3MO6A 1GG6C 1SBWA 1NU9A 2ZCLP 2CF9H 1BTXA 1QTFA 3ZZ4A 1V2KT 1FIZA 4RSPA 4IGDA 2VIDA 2ZP0H 3MU8A 2O8UA 2ZGXH 4MPWA 1CA0B 1NT1A 2IN2A 3TNSA 1BIOA 2WYJA 5JYIA 1MTVA 4CH8B 3T2NA 2XC4A 1BTHH 1W2KH 2BD8A 1C5UA 1X7AC 1UTOA 1W14U 3BTDE 5IDKA 1HFDA 1GHBF 1EXFA 1QY6A 1WAYB 2XBXA 1WU1A 2WV4A 1EQ9A 1C1NA 1RS0A 3SUEA 1GJBB 4ABEA 3ZZ8A 2OQUA 5C5NA 1W0ZU 1MCVA 1LCYA 2BVSH 1L1NA 3UNSA 1KLTA 4AGJA 2FTLE 1FONA 4OS2A 4Q2KA 3ESTA 1CQQA 5EXNA 5T6GA 1BHXB 1J16A 2A0QB 4INHA 4NFFA 3TLOA 2D2DA 1OWEA 2BDBA 2V35A 2FEQH 1XVOA 1CT0E 1C1OA 4OS4A 5EPNA 2GCTB 1DY9A 3FP6E 5C3NA 1A1RA 3E0NB 4ZHLU 1O5EH 1SGYE 2ZPSA 3RC6A 4ABDA 1T7CA 1T8MA 4K2YA 1O5AB 4JZIA 1EAIA 1T8LA 1VCPA 1JIMA 2ZF0H 4FXGH 2ZFPH 2OC7A 4UFEH 1F5KU 3QTVH 3KQEA 3D62A 2ZQ2A 1F92A 2HNTC 1HJ8A 2HPPH 5GJ4B 1AKSA 3BG4B 1HNEE 2IJOB 1AIXH 4ASHA 1KXEA 1MTNB 4I31A 3JZ2B 5A2MH 2A4OA 2PUQH 3M5OA 1ELGA 3GCHB 2OBQA 1E35B 3LH1A 1VJ9U 1BBRE 1FZZA 1FY1A 2BLQA 1CSOE 5ABWA 2WPKS 1LPZB 1GVZA 1H9IE 1CE5A 1THRH 4FUJA 1C2KA 3RXDA 3NUMA 5C20A 1GMCF 1BOQA 3O8BA 5I46H 2ESTE 1NFYA 7KMEH 1XKAC 2GX4A 3R0FA 2FX6A 4YLUA 2WPIS 4AYVB 5I25A 1CGJE 1O3AA 1UK2A 1XKBC 4IC5A 2BY9X 5A0CA 1F0SA 2Q6DA 3VB5A 1DICA 4BTUB 1GHWH 2H9EH 1TABE 4O03A 2P94A 1Z8JB 1NFUA 3LOXA 2SGAA 1OXGA 3E1XB 4X1RU 1SG8B 3TITA 2BXTH 3ATMA 4MPUA 2ZTYA 1TIOA 3T62A 2GP9B 1HRTH 2Y5GA 3RXAA 4RKOB 1GHAF 1ZRKA 4X1NU 1FLEE 1SGIB 1IQKA 3VFEA 2G00A 4A1VA 2P3FH 3MO9A 4AB9A 1ZPBA 3BV9B 3GOVB 3KNXA 4MDSA 2GCHG 1ZHRA 2VNTA 4I8JA 2RCEA 2WPMS 2VVUA 1C2EA 1EP6A 4MLFB 4ABHA 3BTEE 3SGAE 1SGDE 2FYQA 3ELAH 2FOMB 1ZTJA 3Q00A 3TNTA 4B71A 2PKAB 5B6OA 2VH6A 2FOAA 3UUZA 1GGDC 1K1IA 3Q3YA 4M7GA 1CGIE 1S0RA 1WTGH 2HNTE 2WYGA 1AUJA 2ZNKH 1IQEA 1BMLA 1AB9C 3PWBA 4X8VH 1PFXC 5EXLA 2M5TA 1DVAH 3AW0A 2OC8A 4DIIH 5AVDA 2H9HA 4KKDA 5E0JA 3AAVA 3PLKA 4GPGA 1K1LA 2QYIA 2CF8H 1O2YA 4Q7YA 5EU8A 1FV9A 2A7JA 1CT4E 1V2MT 3F9EA 2PTCE 2Y7XA 1W13U 4K69A 3KGPA 2CMYA 2G81E 1QJ7B 1QNJA 1G2LA 2ALPA 2W5EA 1FPCH 1P2QA 4K8BA 4JMYA 1MU6B 1O2MA 1ZYOA 1EPTC 1AVWA 2F9VA 1GL0E 1MKWK 3RXBA 1DXWA 4FUFA 8GCHG 2A1DB 2XBWA 1A0LA 4MPVA 1N1LA 3NPSA 1SQAA 1AFEH 3SJKA 2BVXH 4XFQA 3SI4H 2P59A 4UE7H 4ABAA 1DWDH 2ZU1A 1MBMA 3H7TA 5F8XA 2AMPA 3BG8A 3PYHA 5C1YA 1K1OA 3KQDA 1NU7B 1TRYA 1GBBA 2XBVA 1LVMA 1BITA 2JKHA 4GCHF 2CXVA 4WY3A 3ZZ6A 3T5FH 3DFJA 3V13A 3W95A 7GCHG 2OLGA 2BD4A 1BDAA 1O35A 1HB0B 3F9FA 1P9SA 1OWKA 5DK1A 3ATKA 2Z3EA 2VU8E 1A61H 1C2LA 1WBGB 2BYAX 1WYKA 3M3SA 3UWIA 2TIOA 4ZXYH 2ZKSA 1HAZB 3BSQA 1EAXA 3URCA 1SGCA 4IN1A 1TX8A 1SGFA 2ZZUH 1W7XH 3EA7A 3SV7A 2FI3E 1W11U 3MU0A 3ATIA 3PM3A 1HXFH 4HI3A 3SO3A 2D26C 2QCYA 2TGAA 3A7XA 2Z9IA 4KTSA 2AH4X 2FESH 1UTLM 5JB8S 1MZDA 3AAUA 3SGQE 2W7UA 3QGJA 4IS5A 1BMAA 2THFB 3STJA 3N7OA 5DO4H 2B7DH 3ZZAA 1YPGH 3SUGA 1NRPH 1FUJA 3MH7A 1D9IA 1SHYA 1D6WA 3TH2H 1C4V2 1MBQA 1CA8B 4INLA 1V6DA 2QF3A 4GHQA 1HDTH 3A85A 2ZDLA 3LPRA 3RXQA 1U6QA 2C8WB 2QA9E 4B76A 3RP2A 3VB6A 2JETB 1O3HA
chains in the Genus database with same CATH superfamily
4CHAB 1O39A 2ZTXA 1GI7B 4NA8A 1E37B 3MH5A 1EOLA 1CU1A 4XBDA 1P03A 5F8ZA 1C5NH 3QDZB 2QXJA 1E1QD 1XUJA 1TB6H 2HVXA 1S6HA 1YLDA 1E38B 2ZU3A 1SQTA 2FZZA 1FY3A 3FAOA 1E1RD 1ZRBA 1AY6H 1VGCB 4NIVA 5DGJA 2L74A 1TOMH 1UO6A 2BDYA 1C5PA 1V2QT 3R3GB 1BJUA 1MKXK 2ZHFH 1OWHA 2Z9KA 2BX3A 3ODFA 5EQSA 1HIAB 1O5CB 1GHZA 1YF4A 1AU8A 2ZDAH 3A8DA 5F6MA 3MOCA 1TPAE 2ZU5A 4TWWA 2G4TA 2YMSB 1LQDB 1NRSH 1SGRE 2IJD1 2O8TA 1TX7A 2JJ2D 3ATLA 1WOFA 1SKYE 1CVWH 1P3EA 1ESTA 1LVBA 1ZZZA 1OHHD 5E0HA 2QV1A 4OS5A 5GXPA 1JXPA 1C9TA 1PPFE 1AZZA 2ZCHP 1C2IA 1P06A 4K1SA 1KTTB 1O3DA 2FLRH 3ZV8A 3OX7U 4B2CA 1S82A 2Z9LA 2GDDA 1AMHA 2G5VA 5CHBA 1NTPA 1UTNA 3MHWU 4AB8A 1QR3E 3D65E 3F6UH 2B8OH 3M7QA 1O5DH 4A92A 4AGKA 4XD7D 4CH2B 1C5ZB 3OFND 2ZFQH 2K8IA 3E16B 2A5KA 5C5OA 2Q6FA 5GCHG 1GHXH 2JIZD 2ZCKP 1K22H 2DE8A 3TJVA 1TOCB 4XOJA 3U8RH 4GLYA 3S69A 1O3NA 2GGVB 3ENSB 1NRRH 1T32A 2HOBA 3PMAB 4WMDA 2AERH 1SQOA 1O2RA 1CBWC 1C1VH 1EPTA 4CBOA 1V2NT 1F5RA 1GBMA 1F2SE 3QLPH 1TNKA 3BEIB 5A0BA 4E7RG 1NO9H 3NCLA 2W7SA 2YMSD 1J14A 4TY7A 2ZDVH 3RXTA 2J34A 3SU3A 4B1TA 2B9LA 5A0AE 3GYMA 4D9QA 3P92A 2ZI2H 2ZGBH 2PKSC 3MU4A 3AK5A 3OY5U 1HPGA 1TBQH 2BLOA 2CGAA 2CJIA 1LTOA 4AX9H 1GJ6A 1GBEA 7ESTE 1RXPA 1P11E 5GNDA 4X1QU 1HV7A 5A09A 4MNYA 1A7SA 1RTLA 1INCA 2RA0A 4K8YA 3UQVA 4X8SH 2XC0A 2ZDKA 1G2MA 2QAAA 1QRZA 3ZVCA 3KQ5A 3FP8E 5DPAA 3RU4T 4M9FA 1Y3WA 5LH8A 2ZC9H 1PPBH 3ODDA 2F91A 3N7DA 4UFGH 3ZVBA 2BXUH 4AFSA 1V2PT 2J5UA 3H7OA 1Y5UT 3SUDA 2GMTC 3WWFA 4Y79A 1ARBA 1ELAA 3D23A 3LGUA 3SU1A 4AORA 1JWTA 1LMWB 2NWNA 3B8JA 1DFPA 3HPTB 1Z1JA 1TWXB 4GVUA 3MTYA 1TPPA 5E2OA 3SOSA 4KGAA 1FNIA 4AYYB 2OC1A 3BTWE 2QXHA 3ITIA 1SL3A 2V3HH 1IQNA 1QL8A 1C4U2 3P17H 1A3EH 1YYY1 1OWIA 4JYTA 1K2I1 1P57B 3AW1A 4TYDA 4Y8XA 3T27A 4D7GA 2KCYA 1Z6JH 1EZXC 3ZVDA 1EJAA 1V2ST 2VJ1A 2PGBB 1AFQC 2ZHEH 4BAHB 2ZFSA 1O33A 4FUDA 4DT7B 1KXBA 5C17A 1CHOG 1PYTD 3E3TA 1BHXF 2A7HA 1OP8A 4ZAEA 1ELTA 2R2MB 1H9LB 4DT4A 5FBIA 2BDAA 1OWDA 4DURA 1ZPCA 3NZIA 1GMDG 1V2UT 1YPMH 2O8MA 2A2QH 2F9OA 3OSYA 1AE8H 1P0SH 1MAYA 3SV2H 3SBKA 4FVBA 4YOIA 3Q3KA 3KQCA 1F0TA 4XDEA 1ZSLA 1GI4A 2K1QA 1HAYB 3GY5A 2TGDA 3QWCH 4NZLA 1SHHB 1AKSB 4U2WA 1Z7KA 1Z8IB 1FIWA 5EQQA 4FUBA 3SZNA 4J1YA 2Y5HA 2H5DA 4ZH8A 1HAVA 5EW2H 3U9AH 2C8YB 1Y59T 2ZTZA 1G3CA 2A4QA 3MU5A 1Z1IA 3SU2A 1A2CH 3DHKH 1LQEA 2V3MA 3I78A 4BTTB 4X6OA 5DP8A 5DP6A 1XUFA 3MWIU 4XBBA 3QUMP 2BMGB 3NWUA 4MQAA 3SNAA 1A5GH 2ANYA 2FI4E 2FODA 1VITG 4NWKA 2Y81A 2FO9A 1DSTA 1DXPA 4ISNA 3ZZDA 2J92A 2BQ6B 3RXUA 2EI8A 1DT2A 1UTJA 2ANKH 2GVFA 3HKIB 5AHGH 2Q6GA 1HLTH 2VWNA 2C8ZB 8LPRA 1GI3A 1HJAB 5JPMH 3TGJE 3A8BA 3QZRA 1P2NA 3A82A 1IAUA 2J4IA 2A31A 2FS8A 1FY8E 2WV9A 2OK5A 4VGCC 1SLXB 1IQJA 2Y7ZA 4SGAE 2BDCA 3GDVA 1E0FD 1XUKA 1TNLA 3AVZA 4Q80A 1OP0A 2P95A 3V3MA 3S9BA 1ZTLA 2ZDNA 2J9NA 3F9GA 3L33A 4I86A 1D3QB 3IITA 1K28D 2ZHQH 3F2GA 1CHGA 3A80A 5HMAA 3STIA 1FXYA 1ESAA 2QIQA 3RMMH 1DWBH 1KXDA 1S81A 3ZZ3A 4X8UH 2XCFA 3DUXH 1C5YB 1ANBA 4GHTA 2JH5D 9ESTA 2BM2A 5ESTE 3S7KB 5FX5A 1SQRA 1THPB 5E8EH 3SHAH 4X8TH 3RXRA 5E2PA 4AG1A 1C5MD 3A8AA 1ELFA 2GCHF 1AVGH 2ZIQH 3O8DA 1QFKH 2B0FA 1O38A 3WWBA 3SU0A 4ABJA 1YPEH 3U69H 4D8NA 2Z6BD 1BMNH 2BY6X 3TGIE 4ACBA 2J2UA 1C5OH 2FIRH 2AGIX 1YPKH 2AFQB 3O8RA 1YM0A 1DS2E 1YWUA 1XMNB 4Y8ZA 1Q31A 1UTMA 1WV7H 4YM9A 1O2PA 1RTFB 1C5QA 2Y6TA 2Z7FE 4J2YB 3TPIZ 4MNXA 1S5SA 4UEHH 1AI8H 3T28A 3IG6B 4HGCA 2PV9B 3OY6U 1SC8U 1QBVH 4I7YH 2CHAC 1QB9A 1GG6B 2PW8H 3RXGA 3A86A 1SSXA 5LPEA 2TRMA 3P8OA 4OGYA 5FAHA 3BTHE 5T6FA 5EQRA 3P8FA 4NGAH 1HJ9A 5EOKA 1HAGE 5KGOA 2YNBA 1NZQH 2BLWA 4X2WA 1SR5C 3A8CA 2BLVA 1BZXE 3M3VA 3M7TA 2PLXA 4ABGA 1RIWC 1GBDA 4JYVH 3WY8A 1DLKB 2ZHWH 5FL7D 1EX3A 1VKYA 5HIZA 1PJPA 2LPRA 3LGWA 5PTPA 3HGPA 1BMFD 2GD4B 4ZROA 4WMFA 2SGEE 3LU9B 3GCTG 2J95A 5FX6A 1TBZH 3BIUH 3MNCA 5IYTA 1J8AA 1O3BA 1JIRA 3DD2H 4MG3A 3M7UA 4IMZA 3DA9B 3SNDA 1O2VA 3M3TA 8GCHF 4D76A 1COWD 2VB0A 3HK3B 3RM2H 1D6RA 1JRSA 2GZ8A 3LT3A 1T8OA 3EYDA 4Y71A 3VPKA 2ODPA 3LC3A 4Y0YE 4BXWA 1EJNA 1G9IE 4PROA 4DY7B 3T26A 2IPHA 2VVCA 4ABFA 1ZOMA 1G30B 1UVTH 8ESTE 1H8HD 1SGFG 5DN6D 1RTKA 3O8CA 2R2WU 3SGBE 1B0FA 3P8NA 5CHAC 5JB9S 5DP3A 1YPJH 4KTUA 1TA2A 3SORA 1C1WH 3B9FH 4YO9A 1K1MA 2C8XB 1O2OA 2BDGA 3PTNA 1TA6A 1S6LA 1GCTC 4ISIH 2KCAA 3RC4A 2UUJB 3PMJA 3QZQA 1P01A 3SNCA 2A45B 4JZ1A 4X6NA 2ASUB 2FP7B 2FOGA 1SPJA 2ZECA 4FUIA 1O3IA 5JBCS 5E0GA 1TQ7B 6CHAC 1QA7A 1DITH 1V2WT 3KN2A 1PQAA 3FFGA 1O2SA 3FVFB 1EJMA 3KCGH 3BTFE 3K6ZA 4GAWA 2VGCC 2BY5X 5T3HA 1P9UA 2JJ1D 4BANB 1DANH 4DJZB 3CENA 1C5XB 1Q3XA 1O2TA 3E91A 1D4PB 4WWYA 3PO1C 2BDHA 1WQVH 1YP9A 1GMCG 4RKJB 1TFXA 1C2GA 4FVDA 5C1XA 1FN6A 3EGKH 4ISLA 2V3OH 1IQFA 1Y3VA 3MNSA 2QF0A 3UR6A 1UTPA 4DOQA 1C4Y2 2C93B 1NPMA 2UWOA 2KZ4A 2HRVA 2QXGA 5GIBA 1P2IA 5DP4A 3V0XA 3SQHE 1AD8H 1YBWA 3VB3A 1YCPH 4NG9H 1NBMD 5EIYA 2VIOA 4WF8A 4Y6DA 1IQGA 2P8OC 1HAPH 1XX9A 4AZ2B 5DP5A 1GHAG 2W3KA 4NA9H 6LPRA 2WZQA 4HG6A 1HAIH 4ZHAA 1GJCB 4LZ1H 2A4GA 3RXEA 2R0LA 2F83A 5EPYA 4ZXXH 1IOEA 5H4IB 5B6LA 4HZHA 3RXMA 1QRXA 2PUXB 2HPQH 5FCKA 1NN6A 1HXEH 1YPLH 4X2YA 1QCPA 3RXJA 1F7ZA 4NCYA 2RFKC 4AN7A 1W12U 3I77A 1BT7A 2QC2A 6ESTA 3SV8A 4FUHA 2R9PA 1RGQA 1LHCH 3PLBA 2FI5E 3RXCA 3LIWA 1GMHG 1O2GH 5ETXA 1C1UH 1TGBA 3U1IB 1QHRB 1SLWB 2OQ5A 3MNBA 3GDSA 2GZ7A 3F0PA 1H8DH 4UFDH 3SJ8A 1GGDB 1KDQB 2PTNA 2WPDD 2WUBA 3MH6A 2CK3D 1MABB 2ZFTA 1AWFH 3A7YA 5AFZH 3U8TH 4BAQB 3FZDA 1V2JT 1E36B 1GBHA 2FM2A 1AB9B 1EASA 1SGPE 1IQMA 5AF9H 1AGJA 3VB4A 3A81A 1HUTH 4UD9H 2VWLA 2A5IA 1TE0A 1PPHE 3HK6B 4R0IA 4B75A 1C1RA 1BTYA 3KHVA 1FI8A 1WCZA 1C9PA 1PPEE 1C5TA 1QURH 3QO6A 4GSOA 2TGPZ 1GJDB 2P3TB 4KP0A 3GY4A 3M37A 3U98H 1T8NA 1WQSA 1V2VT 4CRAA 1FDPA 2JH0D 2VBCA 1C2MA 4GUXA 1YGCH 1KIGH 3OE7D 2ZGHA 1UTKA 2VINA 1LHFH 3A87A 1EPTB 2BB4A 2UUYA 1LPGB 3FKSD 3HGNA 2VVVA 3SW2B 1QB1A 2ANWA 1TGTA 1VCWA 2EI7A 4WJG2 5GCHF 4Y0ZE 5KEDA 1QBNA 2Y5FA 1IQHA 2ZA5A 1BTWA 2UWLA 1D3PB 3LC5A 1NY22 1NC6A 2XWBI 2VH0A 4B73A 2W6ID 3VGCC 2BDIA 2QF5A 3A84A 2AIPA 1MTSA 3EE7A 2QY0B 2ZPQA 1FJSA 1MZAA 1D3DB 1W0YH 1LHDH 2OD3B 1C5LH 2PFEA 1H8ED 1ARCA 3G01A 3NK8A 4ZHMU 1NS3A 1ETSH 5F03A 2XXLA 2SGDE 1BRAA 3BTTE 1OKXA 1KLJH 1W0KD 4F4OC 3RXIA 3QX5H 5GDSH 1F0RA 3UFAA 1BRBE 1NFWA 1DOJA 4O97A 3PRBA 3Q77A 1ETRH 4RT0A 1ZPZA 5C67A 1KDQA 3TK6A 2VIQA 3SHCH 3M35A 2PHBA 2QF4A 1K9OE 4LZ4B 1P2OA 2TPIZ 4TWYA 1ZTKA 3TH3H 3TK9A 4YT6H 4B2BA 5A8YA 3A83A 3UPEA 3A89A 1SI5H 4DCDA 2DUCA 3ZYDA 1Y8TA 4I8GA 3JZ1B 4I33A 2HGTH 1O3OA 1QJ1B 1TNJA 1MH0A 2VIWA 5EGMA 1YKTA 3MQKC 2LNCA 2QXIA 1YPHC 3BTKE 4NSYA 4I32A 4A1TA 2A2XH 1GJ5H 1AQ7A 2ZU2A 5DSFA 4MNWA 2Z9JA 2SGFE 3K9XB 5SGAE 5FXLA 2OTVA 1A46H 4CRCA 5HYOA 5L30H 1BB0B 3Q3XA 5AFYH 1BCUH 2FOFA 4HFPB 1RRKA 3S9AA 1A0JA 2L6OA 1FN8A 1AN1E 2QGRA 2Y82A 4YOGA 3ZZ5A 3PLPA 3PMHB 1O3JA 4CRGA 4OS1A 1YCPM 4CR9A 1GI2A 1K0HA 4RI0A 1BBRH 4X2XA 1Y3YA 2PSYA 2BZAA 2FXRA 3UWJH 1QA0A 5HXFA 1S85A 2VWOA 2SGPE 1K1JA 2BD9A 3A7WA 4BAOB 1O3MA 1W3CA 1ZSJA 4YTAA 1P02A 2ZO3H 2V7QD 1O2UA 2FOCA 1XXFA 1AO5A 1XVMA 3B23B 2VWMA 1A0HB 1B5GH 4CBNA 1XM1A 1EP5A 2IOTA 1CO7E 4YOJA 1NESE 1H4WA 1GMDF 4H6TA 1LKBA 4ZKSU 1HAVB 4R8TB 2EC9H 5DJ7A 2BTCE 4FETA 2HLDD 4RT1A 3U28C 1GBLA 5L6NH 1GDNA 1QGFA 1THSH 2OP9A 1DUAA 2ZU4A 2OCVB 1QZ8A 1O5FH 1MTUA 4WXIA 1TBRH 2AS9A 5JBBS 3GICB 1O2IA 4X6MA 1GBCA 3UAIC 5KECA 2WV5A 4NSVA 1Z6EA 1QRWA 1VR1H 2BQWB 3M36A 1DWCH 2A32A 2GDEH 4I8KA 4OS6A 1MMJN 5C0UA 3ZZCA 2AIQA 2FOHA 1TNGA 3RU4E 6GCHG 1CA0C 2C90B 1V2RT 1BUIA 1DUEA 2PSXA 4THNH 4TY6A 1NRNH 1O2KA 4MTBA 1GVKB 3QK1A 1YPHE 2A7CA 1OP2A 1C1SA 3KQBA 4YESB 1VITF 2XNDD 4JCNA 1TLDA 3S0NA 2J98A 1UW7A 2Z3CA 1UMAH 4UDWH 2PR3A 1BTZA 3LGIA 4Y10E 4E06H 2AGEX 1DY8A 1GBJA 1KXAA 1SVPA 2V6NA 1VCQA 2VIVA 1O2JA 4QT8C 2BVRH 1O31A 2DE9A 2LP6A 3E90B 2FDAA 1J9CH 3CS7A 1O2XA 1UHBA 4ABBA 2G8TA 2R3UA 1P2MA 3SU4A 2RDEA 4Y11E 1W0JD 1WUNH 1DLEA 1HYLA 3Q76A 4UFFH 3RC5A 4HTCH 1ACBE 1CBWB 5C1UA 2CN0H 4KELA 2G4UA 1KSNA 1GI0A 2AMDA 4MVNA 1C5RA 3RMOH 2C3SA 3WW7A 1W8BH 2KAIA 3SJIA 2GCTC 4BAKB 1ZR0A 4MPXA 2W26A 1F0UA 1UVOA 1N8OB 5CE1A 1UVSH 4AFQA 1TGSZ 2ZPRA 2PKSB 3V7TA 9LPRA 3ZIAD 2Z94A 4NA7A 4TT3D 4AFUA 2STAE 5JBAS 1NROH 5FBEA 3BTME 4Q4LA 3BG4C 2XRCA 1QJ6B 2AHME 1AUTC 3TK5A 4ESTE 1MTNC 3W94A 3CS0A 4X1SU 1UVUH 1O5GH 1GI8B 2GV6A 1GVLA 1XXDA 3GCHC 4BOHA 3OTPA 2AMQA 4RN6A 4A5TS 1V2OT 4FU7A 4ZKRU 1C1TA 2YOLA 1V3XA 1ZJDA 4B2AA 4JK5A 2P93A 3SQEE 3NRLA 2SGQE 1TYNA 2O8WA 2FWWA 1O5BB 1C2HA 1XUGA 2ALVA 2GMTB 4ZCNA 5L2ZH 1TMBH 1H8IH 3RUOA 4U32A 2BD3A 1TNHA 8KME2 3RDZA 1C1MA 4ZUHA 3HKJB 3MFJA 1LDTT 2G52A 1SMFE 4Y8YA 3ZVAA 7LPRA 1LHGH 1C1QA 1GPZA 1TGNA 1YC0A 3LJOA 4F48B 1IHSH 1LKAA 1L2EA 3MO3A 3A7TA 3GYLB 1EKBB 3RXHA 3AASA 3UY9A 1Y3XA 2ZQ1A 1Y3UA 5C2ZA 3K65B 3F68H 2SNWA 4JK6A 4WMEA 4I8HA 1BJVA 1VZQH 1ANEA 1HGTH 1NRQH 4WVPE 1MQ6A 4IMQA 2HWLB 3GY8A 1JOUB 2FX4A 1CT2E 4IN2A 3GCTF 3H5CB 1AFQB 1C2JA 1GI6A 1L4ZA 1ETTH 4K5ZA 4AFZA 2Y80A 2EEKA 1BTUA 2I6QA 4MNVA 5JDUB 3HATH 1GDUA 1GBFA 3VXFH 1YLCA 1QL9A 4ABIA 1AE5A 3KYFA 4IW4E 1SOZA 3TIUA 3UTUH 2RDLA 1IQIA 3SZEA 2XYAA 1O32A 2BZ6H 5CMXH 2BHGA 1QBOA 4K60A 3RMLH 1TQ0B 5DP7A 3CP7A 4CRDA 1ELVA 1BRCE 1KXFA 1MCTA 1O2NA 1QB6A 3UNRA 2HALA 3A88A 2R3YA 2HNTF 2F4LA 2TBSA 2BD7A 2OUAA 3I29A 4WXVA 1UK4A 1ZGIA 3E6PH 1A3BH 1EUFA 2V0BA 4Y7BA 1ANDA 2H5CA 3F2HA 1C2FA 2NU4E 3M5LA 3P70B 1O2QA 1O0DH 3FOAA 3MNXA 3F9HA 1GWAA 4B74A 4DIHH 1WSSH 2P3UB 2NU3E 3UB0A 4D7FA 1DM4B 1Z8GA 2NU0E 3QN7A 4XE4A 4Q63A 1JRTA 2AYWA 5LGOA 4DVAU 1P2KA 2FYRA 3SV6A 2PWXA 1GHBG 5TCCA 1EZQA 1NM6A 1O3FA 3ZV9A 3BN9A 2A4RA 4YZUA 3KF2A 5LPRA 2BQ7B 1A4WH 3SU6A 3SI3H 4VGCB 3TJUA 1GI9B 4F49A 1TONA 3TVJB 3LH3A 1MKWH 5K0HA 2GT8A 4KTCA 2G55A 2WPJS 3VB7A 2JDID 5K7RA 1UCYH 3PV4A 1QQ4A 4BAMB 2ZWLH 3OYPA 3SN8A 4CRFA 3MMGA 2F3CE 3A7ZA 2J94A 1KLIH 1MU8B 4WH8A 3T29A 3SJOA 1MQ5A 1FX0B 3F2FA 2XBYA 1O3PB 2NU1E 2QN5T 2WPLS 2WSSD 2ZGJA 5BPEA 1C1PA 7GCHF 1W7GH 2ODQA 5FPSA 5LPFA 3EQ0H 5DP9A 2RG3A 1G37A 4BXSA 3U8OH 5F8TA 3GCOA 2FPZA 4JZDH 1P10A 4FUEA 1ZJKA 2BOHB 2I6SA 3C1KA 4SGBE 1EAWA 1O34A 4U01A 1EAUA 1H1BA 1G32B 3VXEH 1ESBA 2GTBA 4OGXA 3TH4H 4BTIB 1UK3A 4H42U 1GMHF 3RLYH 3L6PA 2ULLA 3GCNA 1DE7H 3A7VA 4FU9A 3DFLA 1ZSKA 1HAOH 1PQ7A 5EXMA 4JZFH 2F9PA 4Q7ZA 5EJLA 5T6DA 2CHAB 1EOJA 1K1PA 1FY5A 4LXBH 3DSOA 1P8VC 4Z6AH 1HAHH 1GBIA 2TGTA 3PB1E 1SGQE 3RMNH 1GJ4H 2OXSA 3ZZ9A 2D8WA 3P8GA 1LPKB 1MTWA 2LELA 3N99A 3D49H 3QTOH 3ZVFA 3MH4A 3ATWA 5EODA 1ANCA 3GISB 1C5WB 1RIWB 3UNQA 2JETC 1TPOA 1ZHPA 4I8LA 1H9HE 4CHAC 2SFAA 5TCAA 5J4SA 1HAXB 1AWHB 1SGNE 3LONA 1OSSA 2P16A 4NIWA 1UCYK 1O30A 3EA8A 1A5HA 4XBCA 5HKKD 1GJ7B 3GS9A 3ZYEA 1EZSC 4E7NA 1OX1A 3MU1A 2HVYB 1VGCC 4NFEA 2F9UA 4DG4A 1QQUA 4INKA 3S9CA 3MI4A 4K1EA 1AHTH 1TALA 4UONA 1GBKA 1FY4A 4X2VA 2FOEA 3LGVA 1L1JA 4H6SB 4Y7AA 3RXFA 5CHAB 2XTTB 2K0QA 1KTSB 1P04A 1C5VA 3M5NA 1DX5M 2VIPA 1ELDE 3VEQB 4YLQH 1MD8A 2WPHS 4IBLH 4O3TA 1IHTH 2UUKB 5GPIB 1SOTA 5DG6A 2EA3A 1SFQB 2ZDMA 2YMSC 4DW2U 1GCTB 1WXRA 1G3EA 3ZVGA 1EATA 1LO6A 1LVOA 1RD3B 2PKAA 3FN8A 1MKXH 4ACAA 5DKMA 4CREA 1PQ8A 2BD2A 1OYQA 1GBAA 1O3LA 2XW9A 4JYUH 1TAWA 3OU0A 6CHAB 4YT7H 3GY7A 3P6ZB 2BOKA 2OINA 1OOKB 3LGTA 2J97A 1BTPA 4CR5A 4IC6A 2VGCB 4X1PU 1GBTA 3UR9A 1BA8B 2B5TB 1NFXA 1CGHA 1YCPK 3BEUA 3H09A 3PO1B 3GY3A 1DDJA 1P05A 1ZMJA 3TJOA 4TPIZ 1ELCA 5F53A 2H9TH 3C27B 3S7HB 4H4FA 1L1GA 2AGGX 1SGEE 3DT0H 1MUEB 1SLUB 3LGYA 1T4UH 1PPCE 3E0PB 3PROA 4AC9A 3RM0H 3RXKA 4ZKOU 3UREA 1AZ8A 2PGQB 2WUCA 5BRRE 4WH6A 5JBTA 2P8OB 1ZHMA 4GCHG 3ZZBA 1FPHH 1RJXB 3SJ9A 4XRNA 3EA9A 1KXCA 1O3KA 3QGNB 1J17T 2ZGCA 2OBOA 1VITH 1RFNA 1V2LT 2XCNA 2FLBH 3M61U 5HIYA 5FHTA 2ZFRH 5FPYA 1O3GA 3LDXH 5ESBA 1Z71A 2F9NA 2XC5A 2D1JA 4ZKNU 1B0EA 5EG4A 3V12A 1Z8RA 4DGJA 2EI6A 1A5IA 4O9VA 1C2DA 4NZQA 3MYWA 3UOPA 3UQOA 2GT7A 1PYTC 2BD5A 4Q7XA 1UVPA 1Q2WA 4P00A 1O2LA 4X0WU 3RXSA 2H6MA 5J4QA 3BEFB 1VJAU 1S84A 1FQ3A 4Z0KA 1ZMNA 1EB1H 3OEHD 3RXVA 1ELEE 1GHVH 2KM0A 2BX4A 1ORFA 2GZ9A 3RXPA 5L2YH 3UIRA 1F5LA 3IWMA 4ISHH 1P2JA 2STBE 2J38A 3CNRA 2WINI 3EDXB 4LK4A 2O9QA 4FUCA 1S0QA 1TNIA 4BNRA 3RXLA 4AOQA 3NKKA 4Y76A 1UTQA 3K2UA 1PQ5A 4E05H 2J98B 4TPYA 1OPHB 1PPGE 2W3IA 4OS7A 1UCYE 6GCHF 3EE0B 1SFIA 1MAXA 2UWPA 5A8ZA 3RXOA 3VG8A 1ABJH 1P12E 1O2ZA 1C5SA 1UHBB 3N7EA 1BMMH 3SNBA 1Y5AT 3ZVEA 4P02A 3PMBB 2Z9GA 2JH6D 1AVXA 2C4FH 2GKVE 2IPQX 5TJXA 1QL7A 1JBUH 1K1NA 2G5NA 2ZFFH 3URDA 5HM2A 1N6YA 4XSKU 2GV7A 2ZG0H 1OWJA 2KAIB 4O3UA 1GJ8B 2ZEBA 4A1XA 1CHOF 5GWZA 4ZMAH 3PV5A 3VGCB 1O3CA 1GCDA 3GDUA 1IQLA 2KFWA 5FCRA 3SYJA 3SU5A 2FS9A 3NXPA 1HBTH 4FUGA 3W1EA 3K6YA 1N8OC 1G3DA 1WTHD 3BTQE 1TMTH 3KEEA 1XUIA 2SNVA 2FTMA 4FOUC 1TPSA 3F3BA 3SUFA 1G3BA 1ABIH 3DSPA 1EZUC 1QIXB 2XNIA 1GI5A 4NWLA 5T1VA 3TU7H 1HIAA 5HGGA 4JZEH 1KY9A 3F1SB 1MD7A 2FOBA 2YNAA 4FU8A 1KYNA 1S83A 1Y5BT 1ZGVA 1ELBA 3EAJA 3L3TA 5FPTA 2F9BH 3LKWA 2BY8X 1M9UA 1EB2A 3E8LA 3KIDU 1ID5H 3U1JB 1G36A 1L4DA 2ANMH 1TX6A 5CDFE 1ZLRA 1OYTH 2NU2E 5HM9A 3TGKE 1TRNA 2QE7D 2AEIH 1L0ZA 2Q1JA 2RA3A 1O3EA 1E34B 1GI1A 4NIYA 1O36A 1PPZA 2O8LA 1J15A 3KL6A 3FZZA 3UOUA 1HJAC 4NIXA 1BBRK 4ISOA 2CV3A 3TJNA 4YXWD 1OS8A 3ZZ7A 1GJAB 1KMHB 1O37A 1P3CA 3SNEA 1GJ9B 2M2AA 3RLWH 1FAXA 4A7IB 2UUFB 2ODYB 3PTBA 1UJ1A 1JMOH 1SLVB 1FMGA 3GY2A 3FANA 3OAAD 2BY7X 1FAKH 1BQYA 3BTGE 2H2ZA 2A5AA 3FP7E 4K1TA 1LVYA 3M5MA 4CRBA 1S6FA 5A8XA 1N6XA 3OTJE 4Z1MD 1O2HA 5EW1H 1SGTA 1K21H 4A6LA 1TMUH 1T31A 2OC0A 1DSUA 4LOYH 4D9RA 1O2WA 1ZMLA 1W10U 5EJ1A 1P09A 2ILNA 1DWEH 3RU4D 3P95A 4OM9A 1D3TB 1DPOA 3PWCA 4U30A 1B7XB 1TGCA 2FMJA 3T25A 2XWAA 1WDIA 1V2TT 2G51A 5G4BA 1T4VH 1GDQA 1GL1A 1SB1H 3GY6A 3SV9A 1XUHA 2R0KA 2Z3DA 4K3JA 2ZHDA 4X6PA 4AG2A 3BF6H 3BIVH 1GHYH 1YY3A 2H1UA 1TRMA 2HLCA 1HCGA 1BRUP 1LHEH 3LJJA 3MO6A 1GG6C 1SBWA 1NU9A 2ZCLP 2CF9H 1BTXA 1QTFA 3ZZ4A 1V2KT 1FIZA 4RSPA 4IGDA 2VIDA 2XOKD 2ZP0H 3MU8A 2O8UA 2ZGXH 4MPWA 1CA0B 1NT1A 2IN2A 3TNSA 1BIOA 2WYJA 5JYIA 1MTVA 4CH8B 3T2NA 2XC4A 1BTHH 1W2KH 2BD8A 2GJGA 1C5UA 1X7AC 1UTOA 1W14U 3BTDE 5IDKA 1HFDA 1GHBF 1EXFA 1QY6A 1WAYB 2XBXA 1WU1A 2WV4A 1EQ9A 1C1NA 1RS0A 3SUEA 1GJBB 4ABEA 3ZZ8A 2OQUA 5C5NA 1W0ZU 1MCVA 1LCYA 2BVSH 4B6EA 1L1NA 3UNSA 1KLTA 4AGJA 2FTLE 1FONA 4OS2A 4Q2KA 3ESTA 1CQQA 5EXNA 5T6GA 1BHXB 1J16A 2A0QB 4INHA 4NFFA 3TLOA 2D2DA 1OWEA 2BDBA 2V35A 2FEQH 1E79D 5EJZA 1XVOA 1CT0E 1C1OA 4OS4A 5EPNA 2GCTB 1DY9A 3FP6E 5C3NA 1A1RA 3E0NB 4ZHLU 1O5EH 1SGYE 2ZPSA 2WHXA 3RC6A 4ABDA 1T7CA 1T8MA 4K2YA 1O5AB 2EY4C 4JZIA 1YLNA 1EAIA 1T8LA 1VCPA 1JIMA 2ZF0H 4FXGH 2ZFPH 2OC7A 4TSFD 1F5KU 3QTVH 4UFEH 3KQEA 3D62A 2ZQ2A 1F92A 2EQNA 2HNTC 1HJ8A 2HPPH 5GJ4B 1AKSA 3BG4B 1HNEE 2KR7A 2IJOB 2KCPA 1AIXH 4ASHA 1KXEA 1MTNB 4I31A 3JZ2B 5A2MH 2A4OA 2PUQH 3M5OA 1ELGA 3GCHB 2OBQA 2KX4A 1E35B 3LH1A 1VJ9U 1BBRE 1FZZA 1FY1A 2BLQA 1CSOE 5ABWA 2WPKS 1LPZB 1GVZA 1H9IE 1CE5A 1THRH 4FUJA 1C2KA 3RXDA 3NUMA 5C20A 1GMCF 1BOQA 3O8BA 5I46H 2ESTE 1NFYA 7KMEH 1XKAC 2GX4A 3R0FA 2FX6A 4YLUA 2WPIS 4AYVB 5I25A 1CGJE 1O3AA 1UK2A 1XKBC 4IC5A 2BY9X 5A0CA 1F0SA 2Q6DA 3VB5A 1DICA 4BTUB 1GHWH 2H9EH 1TABE 4O03A 2P94A 5IK2D 1Z8JB 1NFUA 2F43B 3LOXA 2SGAA 1OXGA 3E1XB 4X1RU 1SG8B 3TITA 2BXTH 3ATMA 4MPUA 2ZTYA 1TIOA 3T62A 2GP9B 1HRTH 2Y5GA 3RXAA 4RKOB 4ASUD 1GHAF 1ZRKA 4X1NU 1FLEE 1SGIB 1IQKA 3VFEA 2G00A 4A1VA 2P3FH 3MO9A 4AB9A 1ZPBA 3BV9B 3GOVB 3KNXA 4B6FA 4MDSA 2GCHG 1ZHRA 2VNTA 4I8JA 2RCEA 2WPMS 2VVUA 1C2EA 1EP6A 4MLFB 4ABHA 3BTEE 3DCLA 3SGAE 1SGDE 2FYQA 3ELAH 1NBME 2FOMB 1ZTJA 3Q00A 3TNTA 4B71A 2PKAB 5B6OA 2VH6A 2FOAA 3UUZA 1GGDC 1K1IA 3Q3YA 4M7GA 1CGIE 1S0RA 1WTGH 2HNTE 2WYGA 1AUJA 2ZNKH 3PV2A 1IQEA 1BMLA 1AB9C 3PWBA 4X8VH 1PFXC 5EXLA 2M5TA 1DVAH 3AW0A 2OC8A 4DIIH 5AVDA 2H9HA 4KKDA 5E0JA 3AAVA 3PLKA 4GPGA 1K1LA 2QYIA 2CF8H 1O2YA 4Q7YA 1EFRD 5EU8A 1FV9A 2A7JA 1CT4E 1V2MT 3F9EA 2PTCE 2Y7XA 1W13U 4K69A 3KGPA 2CMYA 2G81E 1QJ7B 1QNJA 1G2LA 2ALPA 2W5EA 1FPCH 1P2QA 3OEED 4K8BA 5C94A 4JMYA 1MU6B 1O2MA 1ZYOA 1EPTC 1AVWA 2F9VA 1GL0E 1MKWK 3RXBA 1DXWA 4FUFA 8GCHG 2A1DB 3F0OA 2XBWA 1A0LA 3DSGA 4MPVA 1N1LA 3NPSA 1SQAA 1AFEH 3SJKA 2BVXH 4XFQA 3SI4H 2P59A 4UE7H 4ABAA 3FO8D 1DWDH 2W6JD 2ZU1A 1MBMA 3H7TA 5F8XA 2AMPA 3BG8A 3PYHA 5C1YA 1K1OA 2PP6A 3KQDA 1NU7B 1TRYA 1GBBA 2XBVA 1LVMA 1BITA 2JKHA 4GCHF 2CXVA 4WY3A 3ZZ6A 3T5FH 3DFJA 3V13A 3W95A 7GCHG 2OLGA 2BD4A 1BDAA 1O35A 1HB0B 3F9FA 1P9SA 1OWKA 5DK1A 3ATKA 2Z3EA 2VU8E 1A61H 1C2LA 1WBGB 2BYAX 1WYKA 3M3SA 3UWIA 2TIOA 4ZXYH 3KYGA 2ZKSA 1HAZB 3BSQA 1EAXA 3URCA 1SGCA 4IN1A 1TX8A 1SGFA 2ZZUH 1W7XH 3EA7A 3SV7A 2FI3E 1W11U 3MU0A 3ATIA 3PM3A 1HXFH 4HI3A 3SO3A 2D26C 2QCYA 2TGAA 3A7XA 2Z9IA 4KTSA 2AH4X 2FESH 1UTLM 5JB8S 1MZDA 3AAUA 3SGQE 2W7UA 3QGJA 4IS5A 1BMAA 2THFB 3STJA 3N7OA 5DO4H 2B7DH 3ZZAA 1YPGH 3SUGA 1NRPH 1FUJA 3MH7A 1D9IA 1SHYA 1D6WA 3TH2H 1C4V2 1MBQA 4F55A 1CA8B 4INLA 5C0TA 1V6DA 2QF3A 4GHQA 1HDTH 3A85A 2ZDLA 3LPRA 3RXQA 1U6QA 2C8WB 3PRDA 2QA9E 4B76A 3RP2A 3VB6A 2JETB 2KCOA 1O3HA
chains in the Genus database with same CATH topology
4CHAB 1O39A 2ZTXA 1GI7B 4NA8A 1E37B 3MH5A 1EOLA 1CU1A 4XBDA 1P03A 5F8ZA 1C5NH 3QDZB 2QXJA 1XUJA 1TB6H 2HVXA 1S6HA 1YLDA 1E38B 2ZU3A 1SQTA 2FZZA 1FY3A 3FAOA 1ZRBA 1AY6H 1VGCB 4NIVA 5DGJA 1TOMH 1UO6A 2BDYA 1C5PA 1V2QT 3R3GB 1BJUA 1MKXK 2ZHFH 1OWHA 2Z9KA 2BX3A 3ODFA 5EQSA 1HIAB 1O5CB 1GHZA 1YF4A 1AU8A 2ZDAH 3A8DA 5F6MA 3MOCA 1TPAE 2ZU5A 4TWWA 2G4TA 1LQDB 1NRSH 1SGRE 2O8TA 1TX7A 3ATLA 1WOFA 1CVWH 1P3EA 1ESTA 1LVBA 1ZZZA 5E0HA 2QV1A 4OS5A 5GXPA 1JXPA 1C9TA 1PPFE 1AZZA 2ZCHP 1C2IA 1P06A 4K1SA 1KTTB 1O3DA 2FLRH 3ZV8A 3OX7U 4B2CA 1S82A 2Z9LA 2GDDA 1AMHA 2G5VA 1NTPA 1UTNA 3MHWU 4AB8A 1QR3E 3D65E 3F6UH 2B8OH 3M7QA 1O5DH 4A92A 4AGKA 4CH2B 1C5ZB 2ZFQH 3E16B 2A5KA 5C5OA 2Q6FA 5GCHG 1GHXH 2ZCKP 1K22H 2DE8A 3TJVA 1TOCB 4XOJA 3U8RH 4GLYA 3S69A 1O3NA 2GGVB 3ENSB 1NRRH 1T32A 2HOBA 3PMAB 4WMDA 2AERH 1SQOA 1O2RA 1CBWC 1C1VH 1EPTA 4CBOA 1V2NT 1F5RA 1GBMA 1F2SE 3QLPH 1TNKA 3BEIB 5A0BA 4E7RG 1NO9H 3NCLA 2W7SA 1J14A 4TY7A 2ZDVH 3RXTA 2J34A 3SU3A 4B1TA 2B9LA 5A0AE 3GYMA 4D9QA 3P92A 2ZI2H 2ZGBH 2PKSC 3MU4A 3OY5U 1HPGA 1TBQH 2BLOA 2CGAA 2CJIA 1LTOA 4AX9H 1GJ6A 1GBEA 7ESTE 1RXPA 1P11E 4X1QU 1HV7A 5A09A 4MNYA 1A7SA 1RTLA 1INCA 2RA0A 4K8YA 3UQVA 4X8SH 2XC0A 2ZDKA 1G2MA 2QAAA 1QRZA 3ZVCA 5DPAA 3FP8E 3RU4T 1Y3WA 5LH8A 2ZC9H 1PPBH 3ODDA 2F91A 4UFGH 3ZVBA 4AFSA 2BXUH 1V2PT 3H7OA 3SUDA 1Y5UT 2GMTC 4Y79A 1ARBA 1ELAA 3D23A 3LGUA 3SU1A 4AORA 1JWTA 1LMWB 2NWNA 3B8JA 1DFPA 3HPTB 1Z1JA 1TWXB 4GVUA 3MTYA 1TPPA 5E2OA 3SOSA 4KGAA 1FNIA 4AYYB 2OC1A 3BTWE 2QXHA 3ITIA 1SL3A 2V3HH 1IQNA 1QL8A 1C4U2 3P17H 1A3EH 1YYY1 1OWIA 4JYTA 1K2I1 1P57B 3AW1A 4TYDA 4Y8XA 3T27A 4D7GA 1Z6JH 1EZXC 3ZVDA 1EJAA 1V2ST 2VJ1A 2PGBB 1AFQC 2ZHEH 4BAHB 2ZFSA 1O33A 4FUDA 4DT7B 1KXBA 1CHOG 1PYTD 3E3TA 1BHXF 2A7HA 1OP8A 4ZAEA 1ELTA 2R2MB 1H9LB 5FBIA 2BDAA 1OWDA 4DURA 1ZPCA 3NZIA 1GMDG 1V2UT 1YPMH 2O8MA 2A2QH 2F9OA 3OSYA 1AE8H 1P0SH 1MAYA 3SV2H 3SBKA 4FVBA 4YOIA 3Q3KA 3KQCA 1F0TA 4XDEA 1ZSLA 1GI4A 2K1QA 1HAYB 3GY5A 2TGDA 3QWCH 4NZLA 1SHHB 1AKSB 4U2WA 1Z7KA 1Z8IB 1FIWA 5EQQA 4FUBA 3SZNA 4J1YA 2Y5HA 2H5DA 4ZH8A 1HAVA 5EW2H 3U9AH 2C8YB 1Y59T 2ZTZA 1G3CA 2A4QA 3MU5A 1Z1IA 3SU2A 1A2CH 3DHKH 1LQEA 3I78A 4BTTB 4X6OA 5DP8A 5DP6A 1XUFA 3MWIU 4XBBA 3QUMP 2BMGB 3NWUA 4MQAA 3SNAA 1A5GH 2ANYA 2FI4E 2FODA 1VITG 4NWKA 2Y81A 2FO9A 1DSTA 1DXPA 4ISNA 3ZZDA 2J92A 2BQ6B 3RXUA 2EI8A 1DT2A 1UTJA 2ANKH 2GVFA 3HKIB 5AHGH 2Q6GA 1HLTH 2VWNA 2C8ZB 8LPRA 1GI3A 1HJAB 5JPMH 3TGJE 3A8BA 3QZRA 1P2NA 3A82A 1IAUA 2J4IA 2A31A 2FS8A 1FY8E 4VGCC 1SLXB 1IQJA 2Y7ZA 4SGAE 2BDCA 3GDVA 1E0FD 1XUKA 1TNLA 3AVZA 4Q80A 1OP0A 2P95A 3V3MA 3S9BA 1ZTLA 2ZDNA 2J9NA 3F9GA 3L33A 1D3QB 3IITA 1K28D 2ZHQH 1CHGA 3A80A 5HMAA 3STIA 1FXYA 1ESAA 2QIQA 3RMMH 1DWBH 1KXDA 1S81A 3ZZ3A 4X8UH 2XCFA 3DUXH 1C5YB 1ANBA 4GHTA 2JH5D 9ESTA 2BM2A 5ESTE 3S7KB 5FX5A 1THPB 5E8EH 3SHAH 4X8TH 3RXRA 5E2PA 4AG1A 1C5MD 3A8AA 1ELFA 2GCHF 1AVGH 2ZIQH 3O8DA 1QFKH 2B0FA 1O38A 3SU0A 4ABJA 1YPEH 3U69H 4D8NA 2Z6BD 1BMNH 2BY6X 3TGIE 2J2UA 1C5OH 2FIRH 2AGIX 1YPKH 2AFQB 3O8RA 1YM0A 1DS2E 1XMNB 4Y8ZA 1Q31A 1UTMA 1WV7H 4YM9A 1O2PA 1RTFB 1C5QA 2Y6TA 2Z7FE 4J2YB 3TPIZ 4MNXA 1S5SA 4UEHH 1AI8H 3T28A 3IG6B 4HGCA 2PV9B 3OY6U 1SC8U 1QBVH 4I7YH 2CHAC 1QB9A 1GG6B 2PW8H 3RXGA 3A86A 1SSXA 5LPEA 2TRMA 3P8OA 4OGYA 5FAHA 3BTHE 5T6FA 5EQRA 3P8FA 4NGAH 1HJ9A 5EOKA 1HAGE 2YNBA 1NZQH 2BLWA 4X2WA 1SR5C 3A8CA 2BLVA 1BZXE 3M3VA 3M7TA 2PLXA 4ABGA 1RIWC 1GBDA 4JYVH 3WY8A 1DLKB 2ZHWH 1EX3A 1PJPA 2LPRA 3LGWA 5PTPA 3HGPA 2GD4B 4ZROA 4WMFA 2SGEE 3LU9B 3GCTG 2J95A 5FX6A 1TBZH 3BIUH 3MNCA 5IYTA 1J8AA 1O3BA 1JIRA 3DD2H 4MG3A 3M7UA 4IMZA 3DA9B 3SNDA 1O2VA 3M3TA 8GCHF 4D76A 2VB0A 3HK3B 3RM2H 1D6RA 1JRSA 2GZ8A 3LT3A 1T8OA 3EYDA 4Y71A 3VPKA 2ODPA 3LC3A 4Y0YE 4BXWA 1EJNA 1G9IE 4PROA 4DY7B 3T26A 2IPHA 2VVCA 4ABFA 1ZOMA 1G30B 1UVTH 8ESTE 1SGFG 1RTKA 3O8CA 2R2WU 3SGBE 1B0FA 3P8NA 5CHAC 5JB9S 5DP3A 1YPJH 4KTUA 1TA2A 3SORA 1C1WH 3B9FH 4YO9A 1K1MA 2C8XB 1O2OA 2BDGA 3PTNA 1TA6A 1GCTC 4ISIH 3RC4A 2UUJB 3PMJA 3QZQA 1P01A 3SNCA 2A45B 4JZ1A 4X6NA 2ASUB 2FP7B 2FOGA 1SPJA 2ZECA 4FUIA 1O3IA 5JBCS 5E0GA 1TQ7B 6CHAC 1QA7A 1DITH 1V2WT 3KN2A 1PQAA 3FFGA 1O2SA 3FVFB 1EJMA 3KCGH 3BTFE 3K6ZA 4GAWA 2VGCC 2BY5X 5T3HA 1P9UA 4BANB 1DANH 4DJZB 3CENA 1C5XB 1Q3XA 1O2TA 3E91A 1D4PB 4WWYA 3PO1C 2BDHA 1WQVH 1YP9A 1GMCG 4RKJB 1TFXA 1C2GA 4FVDA 5C1XA 1FN6A 3EGKH 4ISLA 2V3OH 1IQFA 1Y3VA 3MNSA 2QF0A 3UR6A 1UTPA 4DOQA 1C4Y2 2C93B 1NPMA 2UWOA 2HRVA 2QXGA 5GIBA 1P2IA 5DP4A 3V0XA 3SQHE 1AD8H 1YBWA 3VB3A 1YCPH 4NG9H 2VIOA 4WF8A 4Y6DA 1IQGA 2P8OC 1HAPH 1XX9A 4AZ2B 5DP5A 1GHAG 2W3KA 4NA9H 6LPRA 1HAIH 4ZHAA 1GJCB 4LZ1H 2A4GA 3RXEA 2R0LA 2F83A 5EPYA 4ZXXH 1IOEA 5H4IB 4HZHA 3RXMA 1QRXA 2PUXB 2HPQH 5FCKA 1NN6A 1HXEH 1YPLH 4X2YA 1QCPA 3RXJA 1F7ZA 4NCYA 4AN7A 1W12U 3I77A 1BT7A 2QC2A 6ESTA 3SV8A 4FUHA 2R9PA 1RGQA 1LHCH 3PLBA 2FI5E 3RXCA 3LIWA 1GMHG 1O2GH 5ETXA 1C1UH 1TGBA 3U1IB 1QHRB 1SLWB 2OQ5A 3MNBA 3GDSA 2GZ7A 1H8DH 4UFDH 3SJ8A 1GGDB 1KDQB 2PTNA 2WUBA 3MH6A 2ZFTA 1AWFH 3A7YA 5AFZH 3U8TH 4BAQB 3FZDA 1V2JT 1E36B 1GBHA 2FM2A 1AB9B 1EASA 1SGPE 1IQMA 5AF9H 1AGJA 3VB4A 3A81A 1HUTH 4UD9H 2VWLA 2A5IA 1TE0A 1PPHE 3HK6B 4R0IA 4B75A 1C1RA 1BTYA 3KHVA 1FI8A 1WCZA 1C9PA 1PPEE 1C5TA 1QURH 3QO6A 4GSOA 2TGPZ 1GJDB 2P3TB 4KP0A 3GY4A 3M37A 3U98H 1T8NA 1WQSA 1V2VT 4CRAA 1FDPA 2JH0D 1C2MA 4GUXA 1YGCH 1KIGH 2ZGHA 1UTKA 2VINA 1LHFH 3A87A 1EPTB 2BB4A 2UUYA 1LPGB 3HGNA 2VVVA 3SW2B 1QB1A 2ANWA 1TGTA 1VCWA 2EI7A 4WJG2 5GCHF 4Y0ZE 1QBNA 2Y5FA 1IQHA 2ZA5A 1BTWA 2UWLA 1D3PB 3LC5A 1NY22 1NC6A 2XWBI 2VH0A 4B73A 3VGCC 2BDIA 3A84A 2AIPA 1MTSA 2QY0B 2ZPQA 1FJSA 1MZAA 1D3DB 1W0YH 1LHDH 2OD3B 1C5LH 2PFEA 1ARCA 3G01A 3NK8A 4ZHMU 1NS3A 1ETSH 5F03A 2XXLA 2SGDE 1BRAA 3BTTE 1OKXA 1KLJH 4F4OC 3RXIA 3QX5H 5GDSH 1F0RA 3UFAA 1BRBE 1NFWA 1DOJA 4O97A 3Q77A 1ETRH 1ZPZA 5C67A 1KDQA 3TK6A 2VIQA 3SHCH 3M35A 2PHBA 4LZ4B 1K9OE 1P2OA 2TPIZ 4TWYA 1ZTKA 3TH3H 3TK9A 4YT6H 4B2BA 5A8YA 3A83A 3UPEA 3A89A 1SI5H 4DCDA 2DUCA 3ZYDA 1Y8TA 4I8GA 3JZ1B 4I33A 2HGTH 1O3OA 1QJ1B 1TNJA 1MH0A 2VIWA 5EGMA 1YKTA 2LNCA 2QXIA 1YPHC 3BTKE 4NSYA 4I32A 4A1TA 2A2XH 1GJ5H 1AQ7A 2ZU2A 4MNWA 2Z9JA 2SGFE 3K9XB 5SGAE 5FXLA 2OTVA 1A46H 4CRCA 5HYOA 5L30H 1BB0B 3Q3XA 5AFYH 1BCUH 2FOFA 4HFPB 1RRKA 3S9AA 1A0JA 4YOGA 1FN8A 1AN1E 2QGRA 2Y82A 3ZZ5A 3PLPA 3PMHB 1O3JA 4CRGA 4OS1A 1YCPM 4CR9A 1GI2A 1BBRH 4X2XA 1Y3YA 2PSYA 2BZAA 2FXRA 3UWJH 1QA0A 5HXFA 1S85A 2VWOA 2SGPE 1K1JA 2BD9A 3A7WA 4BAOB 1O3MA 1W3CA 1ZSJA 4YTAA 1P02A 2ZO3H 1O2UA 2FOCA 1XXFA 1AO5A 1XVMA 3B23B 2VWMA 1A0HB 1B5GH 4CBNA 1XM1A 1EP5A 2IOTA 1CO7E 4YOJA 1NESE 1H4WA 1GMDF 4H6TA 1LKBA 4ZKSU 1HAVB 4R8TB 2EC9H 5DJ7A 2BTCE 1GBLA 5L6NH 1GDNA 1QGFA 1THSH 2OP9A 1DUAA 2ZU4A 2OCVB 1O5FH 1MTUA 4WXIA 1TBRH 2AS9A 5JBBS 3GICB 1O2IA 4X6MA 1GBCA 2WV5A 4NSVA 1Z6EA 1QRWA 1VR1H 2BQWB 3M36A 1DWCH 2A32A 2GDEH 4I8KA 4OS6A 1MMJN 3ZZCA 2AIQA 2FOHA 1TNGA 3RU4E 6GCHG 1CA0C 2C90B 1V2RT 1BUIA 1DUEA 2PSXA 4THNH 4TY6A 1NRNH 1O2KA 4MTBA 1GVKB 3QK1A 1YPHE 2A7CA 1OP2A 1C1SA 3KQBA 4YESB 1VITF 4JCNA 1TLDA 3S0NA 2Z3CA 1UMAH 4UDWH 2PR3A 1BTZA 3LGIA 4Y10E 4E06H 2AGEX 1DY8A 1GBJA 1KXAA 1SVPA 2V6NA 1VCQA 2VIVA 1O2JA 4QT8C 2BVRH 1O31A 2DE9A 3E90B 2FDAA 1J9CH 3CS7A 1O2XA 1UHBA 4ABBA 2G8TA 2R3UA 1P2MA 3SU4A 4Y11E 1WUNH 1DLEA 1HYLA 3Q76A 4UFFH 3RC5A 4HTCH 1ACBE 1CBWB 5C1UA 2CN0H 4KELA 2G4UA 1KSNA 1GI0A 2AMDA 4MVNA 1C5RA 3RMOH 2C3SA 1W8BH 2KAIA 3SJIA 2GCTC 4BAKB 1ZR0A 4MPXA 2W26A 1F0UA 1UVOA 1N8OB 5CE1A 1UVSH 4AFQA 1TGSZ 2ZPRA 2PKSB 3V7TA 9LPRA 2Z94A 4NA7A 4AFUA 2STAE 5JBAS 1NROH 5FBEA 3BTME 3BG4C 2XRCA 1QJ6B 1AUTC 3TK5A 4ESTE 1MTNC 3W94A 3CS0A 4X1SU 1UVUH 1O5GH 1GI8B 2GV6A 1GVLA 1XXDA 3GCHC 4BOHA 2AMQA 4RN6A 4A5TS 1V2OT 4FU7A 4ZKRU 1C1TA 2YOLA 1V3XA 1ZJDA 4B2AA 4JK5A 2P93A 3SQEE 2SGQE 1TYNA 2O8WA 2FWWA 1O5BB 1C2HA 1XUGA 2ALVA 2GMTB 5L2ZH 1TMBH 1H8IH 3RUOA 4U32A 2BD3A 1TNHA 8KME2 3RDZA 1C1MA 4ZUHA 3HKJB 3MFJA 1LDTT 2G52A 1SMFE 4Y8YA 3ZVAA 7LPRA 1LHGH 1C1QA 1GPZA 1TGNA 1YC0A 3LJOA 1IHSH 1LKAA 1L2EA 3MO3A 3A7TA 3GYLB 1EKBB 3RXHA 3AASA 3UY9A 1Y3XA 2ZQ1A