1L4DA

Crystal structure of microplasminogen-streptokinase alpha domain complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
249
structure length
249
Chain Sequence
APSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDAGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PLASMINOGEN
publication title Effects of deletion of streptokinase residues 48-59 on plasminogen activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase activator
total genus 56
structure length 249
sequence length 249
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2002-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l4dA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l4dA01
3AAVA 4IMZA 4ZROA 1AFQC 3T2NA 3SU3A 1VCPA 1ELTA 5J4QA 3A8DA 2QA9E 4TY7A 1C1UH 2GKVE 3SGBE 2STBE 2ODQA 5DP9A 1TB6H 1MKXH 2NU0E 5JPMH 1O2RA 1UCYE 2ZDLA 4Y8ZA 3M7UA 5E0HA 2ZCHP 1C5XB 4D8NA 3NWUA 4ISNA 3DFJA 1EQ9A 2ZZUH 3GY4A 5G4BA 1Z6JH 2ZFFH 4JMYA 3SU6A 1YCPK 3RXQA 1GMDF 3M36A 3TNTA 3RXVA 4XBBA 1QJ6B 2PGQB 3EGKH 4A1XA 1GI1A 4NFFA 3A8CA 2J9NA 1N6XA 1GHWH 2FX6A 2H5CA 1O38A 2YNBA 4TPIZ 1O5DH 4F4OC 3VGCB 3SV2H 1Z8IB 1TRMA 4H6TA 2XC4A 1C1OA 2PW8H 2HNTE 1GWAA 5FAHA 2A7CA 3MTYA 4X6OA 3LT3A 4ABHA 2A1DB 5F03A 1D6WA 1TX8A 3SQEE 1D3TB 2ZGBH 1JIMA 1Y3XA 4KKDA 2ZDVH 3VB5A 2BZAA 8ESTE 1A4WH 2BD9A 1SGNE 1HAGE 5ESBA 1GBKA 1SR5C 2R2MB 3K9XB 1O2VA 1XXFA 1S6FA 1C2FA 5EODA 1ELDE 1LVYA 1D6RA 1AWHB 3RXTA 4MVNA 2ZO3H 1GDUA 2FODA 1SI5H 3SBKA 1YPLH 2OC0A 3HATH 5TJXA 1BDAA 3SNCA 3TK6A 4GHTA 4BOHA 4CHAB 4XE4A 4K8BA 5DP4A 3CS0A 3O8DA 2G55A 2JH6D 2XBVA 1N1LA 3SNAA 1HFDA 1G3CA 3FVFB 1P02A 1V2NT 1S6HA 2GT7A 2ANKH 5AVDA 1BT7A 3A7XA 4NGAH 1P09A 1AE8H 5EPYA 4LZ4B 1J9CH 2TGPZ 1SOTA 1ABIH 3NUMA 4YLUA 3GY8A 4CRGA 2XBYA 3SU0A 4MTBA 4UFFH 2O8TA 2ALPA 3QDZB 1K1IA 2W26A 4WF8A 1SMFE 2GDDA 2FTMA 1O31A 2ZFSA 2BVSH 4ZXYH 3UNQA 1EOJA 1OWEA 3GYLB 4IN1A 1E36B 4JZDH 1TALA 2ZKSA 2RCEA 3AAUA 3RU4D 1YLDA 3LIWA 5C5OA 3SV9A 1GI7B 4DURA 5T6DA 3T62A 1NU7B 1W12U 1JRTA 3A80A 3LONA 1PPGE 3SGAE 4NA9H 1Y3WA 2GTBA 4ZHMU 1BZXE 1GI6A 2OBOA 2Y80A 1ZSLA 3Q77A 1GBDA 1P06A 3U69H 1LHGH 2HGTH 1QBNA 3ZVDA 1F5RA 3M5OA 4KP0A 3W95A 3ZZ5A 3O8BA 3ITIA 1AHTH 1QA0A 4JZEH 1Z6EA 4X6PA 3RMOH 1ANEA 1W14U 3C1KA 3BEFB 4ZXXH 2O8UA 3CENA 1BHXB 3L6PA 1GJ8B 3M5NA 4FU7A 1DXWA 1CO7E 3M61U 5A8ZA 1QURH 5C2ZA 3KQDA 1ZRKA 1FONA 1TOMH 2GD4B 1GHAF 1V2JT 1VITH 2Z3CA 1MZDA 3HKJB 2NU3E 5EXNA 1MUEB 2XCNA 1ANBA 2G00A 5J4SA 3BSQA 3LJOA 1CT4E 1O3KA 2ESTE 2D1JA 5F8TA 1TRNA 4X1NU 1FPHH 1TMUH 3BTDE 1PQ5A 3FZDA 1KLTA 3KN2A 1KXDA 1V2LT 1TIOA 5EW2H 1ZPBA 3SHAH 4CRDA 3HPTB 1C5QA 1TNKA 1YF4A 1C5YB 4IC5A 1O2PA 3RC4A 4AOQA 1INCA 3P95A 1GJ7B 1V2WT 1A7SA 1EUFA 3SI3H 2ZA5A 2F3CE 2SNVA 2F83A 3OYPA 3OX7U 5TCCA 3U8RH 1P0SH 3M7QA 2ILNA 4H42U 4MNWA 3ZVAA 3ATMA 2OTVA 1NO9H 5SGAE 2VVCA 1SFIA 3KIDU 1O3FA 1FQ3A 4ZHLU 1NRQH 2AEIH 3S7HB 4DIIH 5E2OA 2AIQA 1RXPA 3B9FH 2XNIA 2FI3E 2ZU1A 1B0FA 3GCOA 4KTUA 4IBLH 1ZLRA 1EASA 4I8KA 1W7XH 3UPEA 2A7JA 3BTQE 1TX7A 1UTJA 1W8BH 1L1NA 7GCHG 3A82A 1BTHH 1G2MA 1IHTH 4NG9H 1Y5BT 1ETTH 3GOVB 1GBBA 4WY3A 1SFQB 2ZPRA 2EI7A 1NS3A 1S83A 3KCGH 1XVOA 4Y79A 1FNIA 3RXSA 3TJOA 1CA0C 2XBWA 1A0JA 3MYWA 3IG6B 1FIZA 1FV9A 2ULLA 5LGOA 1O3LA 1CHGA 2FTLE 3P17H 1C1PA 1H8IH 2CHAC 2GZ8A 1CBWC 2XC5A 1CA8B 2Y82A 3V7TA 1OXGA 4DIHH 1GMDG 2GT8A 1MKWH 2P3UB 3A7YA 3ZZBA 1QQUA 4O03A 2FLRH 2FI4E 2ANYA 2OCVB 3GCHB 1EJNA 1E0FD 4ABFA 1SGQE 1VGCB 3KL6A 1UTPA 1P2JA 1ARBA 1A5GH 1WBGB 2AMQA 2V3HH 3H7OA 3M35A 4MNVA 1UHBB 1AMHA 2WV5A 1MZAA 3NXPA 1SGTA 1NN6A 2H6MA 2J95A 1FMGA 2R3UA 2ZTZA 2F9VA 3AW0A 5BPEA 1V2ST 2BQ7B 1CGHA 4NIWA 4Z0KA 3ODFA 4B76A 3SNDA 4WH8A 1C5SA 3EDXB 1FY8E 3GISB 3N7OA 1IQEA 1ESAA 2P93A 4X1QU 4YZUA 3EYDA 1DLKB 1RIWB 4ABDA 1GI8B 2G5NA 4O9VA 1TPOA 1DUAA 1W3CA 3IITA 2AMDA 4D7FA 1OP0A 2OQUA 1GG6C 4OS5A 2V0BA 3CP7A 1Y3YA 1EXFA 2B5TB 3BIUH 1BRBE 2XWAA 1YCPM 1IQHA 3BTHE 1O3MA 3UR6A 3GY2A 4U2WA 4Y7BA 3SI4H 1EAWA 1S0RA 2PSYA 3MMGA 1H9HE 1ZTKA 2BD5A 1C1MA 2HALA 1G32B 2VNTA 2WPMS 4R0IA 5DP3A 4ABAA 2FS9A 4VGCC 3RXDA 1RTLA 2W5EA 4JYVH 1DM4B 6ESTA 3PLBA 2Z7FE 1NY22 3E1XB 3M5MA 1YP9A 1KIGH 2VINA 1GDNA 1FI8A 1P9SA 4Y0YE 4I8HA 2AFQB 5DG6A 1PPBH 4FU9A 3E6PH 1A3EH 1T4UH 1AO5A 1GHYH 2O9QA 3TJVA 4BAOB 4WWYA 2ZCKP 1TBZH 5EXLA 4CRFA 3CS7A 1ESBA 3SGQE 1P11E 5A09A 4CBOA 3PO1C 5C1UA 4YESB 1TOCB 4GSOA 4DOQA 1W0YH 5JB8S 2CF8H 4YT7H 1F0TA 2G51A 1HIAB 1SGFG 3TJUA 4AFUA 1Z8JB 1A1RA 2BY7X 3RU4T 1RD3B 1KLJH 2ZHWH 4WXIA 1UK4A 4MPUA 1C2KA 2FOCA 3DT0H 4NZLA 2IOTA 1C2GA 1O5FH 1S0QA 3D62A 3Q3XA 1ZGIA 3GY5A 1THSH 1MTNC 3ZVGA 5JYIA 4TWWA 4J2YB 2V35A 3TPIZ 3C27B 1AB9B 2BQ6B 1GI5A 1EZSC 1OS8A 3A83A 2ZECA 1TNHA 2B0FA 1MBQA 8GCHF 2BZ6H 1OWIA 1QNJA 2VJ1A 1ELBA 1HJAC 2OBQA 5DK1A 3S9CA 1Z1IA 1G2LA 1SL3A 3OU0A 1ZMJA 4FUCA 4AGJA 3ATIA 1KDQB 1TFXA 1F0UA 2BHGA 1FAKH 1O2SA 4JCNA 3F9HA 1EKBB 4FUJA 2J92A 1MQ5A 1RFNA 4ZHAA 1O39A 2QV1A 3SW2B 1C5PA 1XUKA 1DWEH 1TMBH 3GY3A 9ESTA 3SJIA 4D7GA 1C5OH 2ZFPH 1KXCA 1L1GA 1BTWA 2NU2E 3PM3A 1P3EA 5HM2A 1T8MA 4LOYH 3SV6A 5DP5A 1ETRH 2QYIA 3LGTA 5K7RA 1WV7H 1WTGH 7LPRA 1N6YA 2BYAX 4Q7XA 3SOSA 2TBSA 2HNTC 2TGDA 1TONA 4FVBA 4I8LA 2TRMA 1ZMNA 1ABJH 2AGIX 5C67A 1GBAA 4TWYA 1DFPA 1FY3A 1TNIA 5DP7A 4KGAA 2GCTB 1C5UA 1QCPA 5TCAA 5HM9A 1GI0A 5I46H 1EB1H 1ELEE 2BDIA 4UFDH 5FCKA 1EB2A 1MH0A 1F0SA 1XMNB 1HAHH 2VGCC 1OP2A 1K21H 1HAYB 3MU4A 4NA7A 2YOLA 2PTCE 1MQ6A 1LHDH 1YGCH 2SGQE 1FN6A 1P12E 4BXWA 2VWMA 4H4FA 1NRRH 1O33A 4UDWH 4AYYB 2RA0A 3I29A 1AVWA 1O2HA 3RMMH 4Z6AH 4X8VH 1K9OE 2BD3A 1TAWA 2A5KA 1YPEH 1V2VT 1EPTA 2C8YB 4UE7H 3RMLH 1C1TA 3AW1A 2NU4E 3VGCC 5CMXH 3BTKE 3BN9A 2ZIQH 1Y3VA 1QB9A 1YPHE 4B74A 1FY5A 1HAVB 2Z9IA 1BB0B 1AUTC 3RXLA 3LOXA 1AZZA 1UTLM 3TH4H 5T6FA 2GV7A 3A7VA 4FUDA 5LPFA 2F9NA 1O2XA 1BOQA 1PQ8A 2C4FH 3BTEE 2W7UA 4B1TA 5A0AE 5DO4H 5E2PA 3PTBA 6LPRA 3A7TA 3FZZA 3LC3A 1SQTA 2BTCE 4Y10E 2B9LA 3SJ9A 5EQSA 4UONA 3A84A 1CU1A 4GHQA 5F8ZA 3A81A 4IMQA 2P8OB 3LU9B 1NESE 4TYDA 5CHAB 1RTFB 4IGDA 3VB3A 2XBXA 3RU4E 2A4GA 3KQEA 2XRCA 1UCYH 1GGDB 3PV4A 1UK3A 1VCQA 2ZEBA 1O2LA 2Y7XA 5AFYH 2CGAA 1B7XB 4X0WU 1T8LA 4K1EA 5F6MA 4AG1A 1H4WA 1RTKA 2ZTXA 3RMNH 2EC9H 4CHAC 5FCRA 1P2QA 1QRXA 3MO3A 4I8GA 2BLVA 2BDGA 2FXRA 3ELAH 6CHAC 1PFXC 3GICB 3TNSA 5DGJA 1EAUA 1A5IA 1UK2A 3SUFA 4MLFB 3RM0H 5PTPA 3ZZ8A 3RLWH 1QB6A 3LGUA 3T29A 1CT2E 2OC7A 2GP9B 2GGVB 3U1IB 5B6OA 3TH3H 1C4U2 4WJG2 1SVPA 4MPXA 1PPHE 1G30B 1O3JA 3SJOA 2RDLA 4FU8A 1NFUA 5LH8A 1KSNA 1GVZA 4X8UH 4CBNA 1C4Y2 2XCFA 5HMAA 3QGJA 1QGFA 2ZFRH 1W13U 3OY5U 3MHWU 4KTCA 2Q6GA 1SGPE 2HLCA 2W3IA 2AYWA 1H9LB 1H8DH 2UUFB 2FOFA 1C1WH 1HNEE 1PPZA 4H6SB 2ZFTA 2UWOA 1QL9A 2ZDAH 1UTKA 2IN2A 4GAWA 3L3TA 1ELFA 4AFSA 2NWNA 1D3QB 3PLKA 3VFEA 1GJ5H 2BDCA 1K22H 1UMAH 2H9TH 1O2KA 1IHSH 2GZ7A 3UFAA 3GDVA 1TLDA 5FHTA 2PUQH 4FUBA 2VVVA 2FOGA 3VEQB 5JBTA 3A89A 1HJ9A 1P9UA 1VJ9U 2SGAA 2ASUB 4YM9A 1YPMH 2BLWA 3K65B 4IW4E 2JH5D 1ZSJA 1YPKH 2HPPH 1C5MD 1BMLA 1NU9A 1OPHB 2PKSC 2FDAA 1MMJN 1IQMA 3KQCA 5JDUB 1GBLA 1EAIA 2PUXB 4ABEA 2OC8A 3SZNA 1EAXA 5EGMA 1O3AA 2R0KA 1FUJA 1C1RA 1L4DA 4AB9A 2OXSA 3SUGA 4B75A 1DSUA 1QBVH 4CRAA 1WOFA 4A5TS 1QRWA 2GMTC 1HJ8A 1NC6A 4OS1A 2AGGX 1HCGA 1O2MA 1EZUC 1BBRK 1TMTH 2AGEX 1LVOA 2BDBA 1C9PA 3EA7A 1MTWA 5EXMA 5DPAA 1XXDA 2UWPA 2BX3A 1GJ9B 5EW1H 4HGCA 1QJ1B 4INHA 1G3EA 4NZQA 3QLPH 1XVMA 2QY0B 1NM6A 4UD9H 1BTXA 3QGNB 5ETXA 2P3FH 3ZYEA 1J14A 3UTUH 1XKBC 1GJCB 1O2OA 5C1YA 4JYTA 5GJ4B 4JYUH 8GCHG 2HNTF 2EEKA 3MU8A 1GHBG 1EATA 1TYNA 1OX1A 1MKXK 2PSXA 3UY9A 1LHCH 4FXGH 2BDYA 3PWBA 2JH0D 3A85A 4LZ1H 2ODPA 4A6LA 2A31A 1T8NA 2C8WB 1MTVA 5JBCS 2BY6X 2SGEE 3BF6H 2XC0A 4BAMB 3EQ0H 2LPRA 1EX3A 1XUIA 1KTSB 3ZVCA 1D9IA 5E0JA 1Q3XA 1TA2A 3RXUA 4KELA 2OLGA 1HXFH 2VWNA 4M7GA 2ZQ2A 1TQ7B 1GHXH 4Y71A 5GIBA 5C3NA 1AN1E 1UVTH 5GCHF 4DW2U 3H5CB 3MNCA 4RN6A 2ODYB 2ZCLP 3SHCH 5EU8A 3ZZ6A 3GDUA 3LGYA 4NSVA 1SB1H 1AIXH 1DWBH 2VIWA 2A32A 4O3UA 4WMEA 1O5CB 1J16A 3QZRA 4GPGA 2BD7A 1E38B 2HVXA 1HUTH 3RXEA 3VB4A 1O3EA 1C2EA 3W94A 4Q7YA 1HYLA 2PGBB 4DJZB 3S9BA 1IQJA 1LO6A 2VIOA 5L2ZH 1NFWA 2ZDNA 3TITA 2WPJS 1BTPA 4O97A 1TGNA 3BTFE 2FYRA 1LQEA 5E8EH 4ISOA 5A2MH 2PLXA 2ZU5A 4MNXA 3ZZDA 2WV4A 3URDA 1IQIA 2G4TA 1LPZB 4BAHB 3TLOA 1O2GH 3M3SA 2FOBA 3BV9B 3SU2A 2ZG0H 5JBAS 4ABJA 3F68H 2QXIA 4Y11E 1ID5H 1WTHD 4K69A 3FAOA 1G3DA 1KXEA 2ZI2H 3RDZA 2Q6FA 1W11U 1BRCE 1ACBE 1THPB 4Q7ZA 1TGSZ 2WUCA 3SO3A 1GMCF 5FPTA 1BTZA 1O37A 1XUFA 1BCUH 4GCHF 3T27A 1EZQA 4X2XA 2Z3DA 4K2YA 3T25A 4U32A 4DVAU 4ESTE 2I6QA 1C1SA 1G37A 4ABIA 4NCYA 4BXSA 1O5AB 1VR1H 3LGIA 3VXEH 1EJAA 1K2I1 1LHEH 1MU8B 3BEUA 1AQ7A 4B2AA 4ABGA 4FUEA 2GZ9A 3ZV8A 3E0PB 1VITF 1FPCH 1LKAA 1O2WA 2QAAA 4YTAA 1Z1JA 4B73A 1DUEA 3SN8A 1ZGVA 1GI3A 1PYTC 2BDAA 2KAIB 1Z71A 2FS8A 1O2TA 3K6ZA 1SGRE 1P3CA 4NIVA 1T8OA 4JZFH 4AB8A 3RXHA 2J2UA 3ZZ4A 1Y5UT 4KTSA 3U98H 4RSPA 3UNSA 2ZNKH 3RXPA 1MTSA 3QZQA 3PMBB 4K3JA 1V2RT 3LJJA 4X1RU 2FOAA 9LPRA 2AIPA 1GBMA 3GYMA 2R0LA 5EQRA 1HAZB 1ZHRA 2Y6TA 2R3YA 1T7CA 4HTCH 1DS2E 1ZHPA 2F9BH 3EA8A 1KY9A 2FZZA 2XW9A 3RXRA 1C1VH 1JIRA 1YLCA 3TK5A 3A7WA 4CH2B 2CV3A 3M3VA 2A4OA 4NFEA 2JETC 4SGAE 2TPIZ 1K1OA 1SG8B 1O5EH 1O3HA 2VVUA 1ELCA 5FX5A 1GBHA 2TIOA 1AVXA 4Y0ZE 3ZVFA 1HPGA 2H1UA 4MPWA 2BLQA 5GDSH 1A0LA 1Y8TA 4ISIH 1KXFA 2A4QA 4GUXA 1ANDA 5E0GA 1QTFA 1UTQA 3QO6A 1CA0B 2KAIA 2LNCA 3V13A 1P2MA 1SQAA 5HGGA 1H9IE 2FP7B 2BY8X 3MI4A 1LPGB 7ESTE 3O8RA 2CHAB 1UHBA 1HBTH 1MBMA 3BG4C 1CBWB 3PMAB 4JK5A 2OUAA 1V2TT 2SNWA 1G36A 1GCTC 1O5GH 1Y3UA 5DP6A 1SPJA 2BQWB 1QJ7B 1O2YA 1ARCA 3E8LA 1KXBA 2D8WA 1GJBB 3HGPA 4ISLA 1V2MT 4MG3A 1GMHF 1ZMLA 2G5VA 3RP2A 1EPTC 1NROH 1A2CH 1P2NA 5GPIB 3OY6U 1IQLA 4YT6H 3UNRA 1N8OB 1BMAA 1BQYA 1CVWH 3RXKA 4CREA 1O5BB 2WPKS 4BANB 1SHHB 4XBDA 3LGVA 3VPKA 1BTUA 1O3NA 3TIUA 2Q1JA 3AVZA 4X1SU 3ZVEA 2W3KA 3EA9A 3HK3B 5DJ7A 1C4V2 1OOKB 2Z94A 3UOUA 2VB0A 1BRAA 1YCPH 1GI9B 2I6SA 2BOKA 1X7AC 2HWLB 3RXBA 1DPOA 3OTJE 4J1YA 2STAE 1S81A 4NWLA 2ZU3A 2WUBA 1GG6B 3SV7A 3BTGE 1C5VA 4K1TA 2GVFA 1XUGA 5FX6A 3E3TA 5T3HA 2D2DA 2ZHDA 2OC1A 5I25A 1ESTA 2QC2A 3FP8E 3SUDA 1GHAG 3GY6A 2WYGA 1FXYA 1K1PA 2P94A 1GCDA 1IQGA 1C2HA 2XYAA 1Y5AT 1V2KT 4ZAEA 2O8LA 2THFB 4DT7B 2ANMH 1GJ6A 1MKWK 1LKBA 1S84A 2P16A 1NFYA 4VGCB 1UTOA 1P10A 2QIQA 4E7NA 4I33A 2IPHA 3DFLA 2OQ5A 2CF9H 1HIAA 1OSSA 2A5IA 5GCHG 1O2UA 1DLEA 1BUIA 1VJAU 1S82A 1Q2WA 4OS2A 4INLA 3LDXH 1NPMA 4FUHA 3TJNA 3DA9B 3GCTF 1V2QT 1HLTH 3A8BA 2H9HA 2AH4X 3Q76A 2Z9KA 3LH3A 1K1JA 3PO1B 3MH7A 1DWDH 2O8MA 2ANWA 2UUJB 2A0QB 2ZP0H 4B2CA 1OWJA 1GHZA 3QUMP 1UVOA 2O8WA 1E34B 3KNXA 3FP7E 5JB9S 3ESTA 4NIYA 1GBTA 3NK8A 1GL1A 2JKHA 5A0BA 3BG8A 1F5KU 1P8VC 1KDQA 2PR3A 1TA6A 3FP6E 1V6DA 4E05H 1EZXC 2EA3A 1SHYA 4XFQA 1MTNB 2GV6A 1O0DH 1YPJH 1GBEA 3MH5A 1AFEH 4I32A 1FIWA 3PB1E 1LDTT 3R0FA 6GCHF 2SGPE 2VH0A 1DT2A 1M9UA 4RKOB 8KME2 1HB0B 4I8JA 4E7RG 1MAXA 1ELVA 1XM1A 3GDSA 4GVUA 2BVRH 1FJSA 1HJAB 4K8YA 3S9AA 1IQFA 1BBRE 4QT8C 3JZ1B 2FO9A 2Y81A 2UUYA 2P3TB 4I31A 1FLEE 4GCHG 3KGPA 1OWKA 1DDJA 3L33A 4AGKA 2QF3A 3A8AA 4YOJA 1UJ1A 2DE8A 5BRRE 2WPIS 2W7SA 4E06H 1AWFH 1AI8H 4B2BA 1IAUA 1VITG 1Z7KA 2AERH 4ZH8A 2SFAA 2AS9A 2ZGJA 2ZDMA 1DY8A 4DG4A 2PTNA 1C5LH 1GBIA 1H1BA 1EP5A 1ZSKA 4WVPE 2HPQH 1A5HA 2QN5T 4MNYA 1J8AA 3ZZAA 1DXPA 3EAJA 3SQHE 1BJUA 1P2KA 5ESTE 3UQVA 3STIA 1HAXB 1RS0A 4YLQH 1DOJA 2FEQH 1AUJA 1C1QA 1QHRB 1HAVA 3M7TA 2A2QH 1CE5A 1SLXB 2VGCB 2Y7ZA 2FOEA 3NZIA 1GI2A 3T5FH 2G4UA 3BEIB 1TRYA 1TGBA 2A45B 3I77A 3S69A 5C5NA 4Q2KA 4X2VA 3F1SB 2H2ZA 1SLVB 3RUOA 3SNBA 1KTTB 1O30A 2BXTH 2F9UA 2PV9B 3BTTE 3TK9A 2SGFE 3S7KB 1O2JA 3SU4A 2TGAA 1AY6H 3RC5A 1SGIB 4SGBE 1TWXB 2Q6DA 4BAQB 3E90B 5FPYA 3NCLA 4Y8XA 1SGFA 3UREA 3R3GB 2YNAA 1G9IE 2A2XH 2NU1E 1AU8A 1HGTH 2XTTB 2ZPSA 3SORA 5FPSA 4ZKRU 1F5LA 3GCNA 1BTYA 2FLBH 1T4VH 4LXBH 1AFQB 3P6ZB 4XDEA 5GWZA 3P8GA 1PQ7A 1UVUH 3MO9A 1NZQH 1V2OT 1MD8A 2IJOB 3ZZCA 3MWIU 2F9OA 3ODDA 1BRUP 3MOCA 4BNRA 3E16B 4DY7B 1B0EA 1QQ4A 4OGXA 2F9PA 3PYHA 2FESH 2Y5HA 1GPZA 1NTPA 2ZPQA 3MU5A 2ZHEH 5FBEA 3F9FA 3ZZ9A 2FOHA 2PKAB 2P59A 5IYTA 2AMPA 1YBWA 1GMHG 4IS5A 1AD8H 1K1LA 4NIXA 4NA8A 1UTNA 4TPYA 3KF2A 6CHAB 3IWMA 3KHVA 3M37A 4X8SH 3P70B 3U1JB 1ZJKA 2UUKB 3D65E 1QB1A 4U01A 5A8YA 3MNBA 1C2JA 5EG4A 5EPNA 1OP8A 2F91A 1W2KH 1L2EA 5L2YH 2QGRA 1B5GH 1ETSH 4CR5A 1O32A 4K60A 5DP8A 3OSYA 3RXMA 1O2IA 1SSXA 4YOGA 1C5RA 4X2WA 2BDHA 2FM2A 2DE9A 5LPRA 1L4ZA 3I78A 4AX9H 3A88A 4AZ2B 2BX4A 1MAYA 2BB4A 3F9GA 1PQAA 1A3BH 2Y5GA 3PROA 2G8TA 4Y8YA 1C5TA 1WUNH 3D23A 1O2NA 4FVDA 4K1SA 1D4PB 3G01A 3P92A 2Z9GA 3NKKA 1RRKA 1TABE 5H4IB 1TBQH 3Q00A 5C1XA 2CXVA 1HXEH 1O3PB 1TPSA 5HYOA 1LHFH 2PKAA 1HRTH 3QWCH 3TU7H 1DE7H 4THNH 2J34A 2V6NA 4NWKA 1O3GA 4FUIA 2PWXA 2XWBI 3MH4A 1UCYK 2ZU4A 2J4IA 1C2IA 1CHOF 1SGDE 1G3BA 1GBCA 1Z8RA 2ZHQH 3T28A 2OP9A 3DUXH 2FI5E 3UIRA 4X6MA 1QA7A 1EP6A 1W7GH 4NSYA 5A8XA 1C5WB 3UUZA 2ZU2A 3T26A 1ELGA 3LH1A 2PKSB 4Y76A 1C9TA 3U9AH 2C8ZB 4FUGA 1SLUB 4D9RA 4WMFA 3GCTG 1Y59T 3HGNA 1ZTLA 2GCHF 2J38A 2BD4A 2PFEA 1MU6B 2CJIA 4O3TA 5IDKA 1OKXA 1F7ZA 5LPEA 1XX9A 1EOLA 2FIRH 1DITH 3MU0A 4R8TB 3STJA 3LC5A 3HKIB 3U8OH 2GMTB 1E37B 4GLYA 1LMWB 4WH6A 3RXFA 1DX5M 1ZHMA 3DHKH 4Y7AA 3UQOA 1D3DB 3TH2H 1ZRBA 2WPLS 4ABBA 1ORFA 1OYQA 3VXFH 1MCTA 3A7ZA 3ZVBA 2D26C 4D76A 1WU1A 1K1MA 4A7IB 1FZZA 4UEHH 4XBCA 3E91A 3VB7A 4B71A 4X2YA 2UWLA 1VZQH 3GCHC 6GCHG 1HAPH 1AZ8A 3U8TH 1JRSA 1VCWA 1VGCC 1WSSH 4OGYA 5T6GA 1O34A 4IC6A 3V0XA 4HI3A 1C2MA 1C5NH 1PJPA 1LTOA 3PMHB 3MH6A 2P95A 1LVBA 4WXVA 4AORA 2FMJA 2B8OH 1TNGA 2H9EH 4INKA 1S85A 1P04A 1SGCA 1P05A 1A0HB 2FWWA 1F2SE 1ZR0A 2FX4A 2G52A 4OS4A 2HRVA 1O35A 1O3IA 1DY9A 1IQNA 1GVLA 1P57B 1XKAC 4HZHA 3BTWE 3MO6A 3MU1A 1RIWC 1V2PT 5DKMA 3URCA 1QFKH 1WQVH 1YKTA 1ZPZA 2VU8E 2C3SA 2OD3B 1ZPCA 2ZC9H 1K28D 1Z8GA 1XUJA 3QN7A 1BMMH 3LPRA 4D9QA 3P8NA 1SBWA 2H5DA 1LPKB 1SOZA 1BJVA 3UR9A 4AFQA 4WMDA 1P2IA 4AFZA 1TX6A 4X1PU 2A7HA 2BM2A 3O8CA 1WQSA 1E35B 2BXUH 4UFGH 5AFZH 2VIDA 2VWLA 3TGJE 5EOKA 4BAKB 4TY6A 2C93B 3K6YA 5AF9H 1DWCH 1WCZA 1HAOH 1RGQA 3SNEA 2FPZA 1NFXA 1GJAB 1JOUB 2BY5X 5FBIA 1PPFE 1HV7A 4CR9A 1O3BA 2QCYA 2CN0H 3JZ2B 1BHXF 1RJXB 2FOMB 3E0NB 1QIXB 2Z6BD 1SGYE 1AKSB 1DVAH 4X6NA 2BOHB 4YOIA 1BMNH 2CMYA 1NRNH 2J94A 4ZMAH 1N8OC 3RXCA 4A1TA 1A46H 3MNSA 3QTOH 3SU1A 1BA8B 5L6NH 3M5LA 1YC0A 4PROA 4CH8B 2Z3EA 3SJ8A 4BTTB 3Q3YA 1GDQA 2SGDE 3RXOA 1NT1A 3RC6A 5JBBS 1AGJA 4ZKNU 3PMJA 1ZOMA 2WPHS 2XXLA 1UVPA 2G81E 1CGJE 3PLPA 1OWHA 3AASA 4HFPB 4JZ1A 3QK1A 1O3OA 1P2OA 1UVSH 3WY8A 1JMOH 3RXIA 1NRPH 1OYTH 1ZYOA 2ZFQH 5C20A 1V3XA 1TNLA 3VB6A 1THRH 1AB9C 3H7TA 2ZHFH 3SU5A 1SLWB 1JXPA 2RA3A 1L0ZA 3SJKA 2BLOA 4MQAA 4DCDA 3RLYH 3KEEA 1P03A 3RM2H 1W10U 1AVGH 4AYVB 3S0NA 3UOPA 3P8OA 1AKSA 1D3PB 3BTME 4JZIA 2QXHA 4XSKU 2ZF0H 3PTNA 1TQ0B 2R2WU 3BIVH 1FAXA 2R9PA 1QRZA 1DICA 3MFJA 4ISHH 3A86A 1O2ZA 1ANCA 1PPCE 2VIVA 1GI4A 1KYNA 1YPHC 4CRCA 1C1NA 3RXAA 3NPSA 4A92A 5A0CA 1TBRH 1FDPA 1DSTA 4JK6A 3V12A 1WYKA 2JETB 3F6UH 3FANA 2GCTC 4MPVA 4ZKOU 3RXGA 1T31A 5FXLA 2DUCA 2VWOA 3FFGA 2VH6A 3K2UA 4U30A 1J17T 2QF0A 1EJMA 1JBUH 1LQDB 2B7DH 1YM0A 1PPEE 2K1QA 1O3DA 3QTVH 1CHOG 1CT0E 1QL8A 2A4RA 4XOJA 4RKJB 2VIPA 1TGCA 2VIQA 2ZQ1A 4Y6DA 1WAYB 1UTMA 3LKWA 5K0HA 5L30H 3TVJB 2A5AA 3B23B 4DGJA 3BG4B 2ZGHA 2Z9LA 4BTUB 3V3MA 1MTUA 1GVKB 1GCTB 1U6QA 1CQQA 3A87A 4UFEH 1Q31A 1GHBF 2EI8A 2ZGCA 3RXJA 2BY9X 2GCHG 3ATWA 1ZTJA 2C90B 1KXAA 3M3TA 2RG3A 1T32A 1K1NA 1TPPA 5EQQA 2ZWLH 2P8OC 4F49A 1GJDB 1O3CA 1EPTB 1QBOA 5CHAC 3SUEA 7KMEH 3ATKA 1L1JA 2FYQA 1CSOE 1LCYA 1SGEE 2QXJA 3QX5H 4AN7A 1UO6A 3MNXA 2OINA 1W0ZU 2ZGXH 4A1VA 4ASHA 1GGDC 1GJ4H 1NRSH 4FUFA 1GL0E 4IN2A 3ZZ3A 3TGIE 1HAIH 2Y5FA 1C2LA 1C5ZB 1O2QA 3GY7A 2HOBA 4OS7A 1SQOA 4Q80A 3D49H 4MDSA 1FY1A 3P8FA 1AE5A 1YYY1 2EI6A 5F8XA 1ELAA 8LPRA 2GX4A 1F0RA 4ZUHA 1IOEA 2GDEH 5GXPA 1QL7A 4BTIB 1ZJDA 1HDTH 1QY6A 1F92A 3F9EA 1YPGH 3UWIA 3EE0B 1O36A 1S5SA 2V3OH 1SC8U 3ENSB 1FY4A 4AG2A 1TE0A 4OS6A 1BIOA 4K5ZA 3DD2H 1CGIE 1V2UT 1MCVA 1GHVH 4LK4A 3ZV9A 1BITA 1P01A 2C8XB 3SV8A 3ZYDA 1MD7A 3KQBA 4I7YH 1TGTA 2BVXH 2M5TA 2WINI 3TGKE 2BD8A 2BD2A 1C2DA 1LVMA 2Z9JA 2TGTA 1GMCG 3B8JA 1J15A 5ABWA 2ALVA 1BBRH 1TNJA 5HXFA 1GBJA 1DANH 1XUHA 2WYJA 1QR3E 1KLIH 1FN8A 2PHBA 2QXGA 3Q3KA 1A61H 1GBFA 3ATLA 3HK6B 5CE1A 4YO9A 1OWDA 3PWCA 3ZZ7A 4ZKSU 2BMGB 4CRBA 2ZDKA 1TPAE 3LGWA 3UWJH 1JWTA 7GCHF 5AHGH 1ZZZA 2ZTYA 4X8TH 1PYTD 1IQKA
chains in the Genus database with same CATH superfamily
3AAVA 4IMZA 4ZROA 1AFQC 3T2NA 3SU3A 1VCPA 1ELTA 5J4QA 3A8DA 2QA9E 4TY7A 1C1UH 2GKVE 3SGBE 2STBE 2ODQA 5DP9A 1TB6H 1MKXH 2NU0E 5JPMH 1O2RA 1UCYE 2ZDLA 4Y8ZA 3M7UA 3F2FA 5E0HA 2ZCHP 1C5XB 4D8NA 3NWUA 4ISNA 3DFJA 1EQ9A 2ZZUH 3GY4A 5G4BA 1Z6JH 2ZFFH 4JMYA 3SU6A 1YCPK 3RXQA 1GMDF 3M36A 3TNTA 3RXVA 4XBBA 1QJ6B 4M9FA 2PGQB 3EGKH 4A1XA 1GI1A 3GS9A 4NFFA 3A8CA 2J9NA 1N6XA 1GHWH 2FX6A 2H5CA 1O38A 2YNBA 4TPIZ 1O5DH 4F4OC 4TSFD 3SV2H 3VGCB 1Z8IB 1TRMA 4H6TA 2XC4A 1C1OA 2PW8H 5B6LA 2HNTE 2RFKC 1GWAA 5FAHA 2A7CA 3MTYA 4X6OA 3LT3A 4ABHA 1MABB 2A1DB 5F03A 1D6WA 1TX8A 3SQEE 1D3TB 2ZGBH 1JIMA 1Y3XA 4KKDA 2ZDVH 3VB5A 2BZAA 8ESTE 1A4WH 2BD9A 1SGNE 1HAGE 5ESBA 1GBKA 1SR5C 2R2MB 3K9XB 1O2VA 1XXFA 1S6FA 1C2FA 5EODA 1ELDE 1LVYA 1D6RA 1AWHB 3RXTA 4MVNA 2ZO3H 3N99A 1GDUA 2FODA 1SI5H 3SBKA 1YPLH 2OC0A 3HATH 5TJXA 1BDAA 3SNCA 3TK6A 4GHTA 4BOHA 4CHAB 4XE4A 4K8BA 5DP4A 3CS0A 2KCYA 3O8DA 2G55A 2JH6D 2XBVA 1N1LA 3SNAA 1HFDA 1G3CA 3FVFB 1P02A 1V2NT 1S6HA 2GT7A 2ANKH 5AVDA 1BT7A 3A7XA 4NGAH 1P09A 1AE8H 2QF4A 5EPYA 4LZ4B 1J9CH 2TGPZ 1SOTA 1ABIH 5F53A 3NUMA 4YLUA 3GY8A 4CRGA 2XBYA 3SU0A 4MTBA 4ACBA 4UFFH 2O8TA 2ALPA 3QDZB 1K1IA 2W26A 4WF8A 1SMFE 5CHBA 2GDDA 2FTMA 2PP6A 4YXWD 1O31A 2ZFSA 2BVSH 4ZXYH 3UNQA 1EOJA 1OWEA 3GYLB 4IN1A 1E36B 4JZDH 1TALA 2ZKSA 2RCEA 3AAUA 3RU4D 1YLDA 3LIWA 5C5OA 3SV9A 1GI7B 4DURA 5T6DA 3T62A 4ASUD 1NU7B 1W12U 1JRTA 3A80A 3LONA 1PPGE 3SGAE 4NA9H 1Y3WA 2GTBA 4ZHMU 1BZXE 1GI6A 2OBOA 2Y80A 1ZSLA 3Q77A 1GBDA 1P06A 3U69H 1LHGH 2HGTH 1QBNA 3ZVDA 1F5RA 3M5OA 4KP0A 3W95A 3ZZ5A 3O8BA 3ITIA 1AHTH 1QA0A 4JZEH 1Z6EA 4X6PA 3RMOH 1ANEA 1W14U 3C1KA 3BEFB 4ZXXH 2O8UA 3CENA 1BHXB 3L6PA 1GJ8B 3M5NA 4FU7A 1DXWA 2VBCA 1CO7E 3M61U 5A8ZA 1QURH 5C2ZA 3KQDA 1ZRKA 1FONA 1TOMH 2GD4B 1GHAF 1V2JT 1VITH 2Z3CA 3PRBA 1MZDA 3HKJB 2KR7A 2NU3E 3WWFA 5EXNA 1MUEB 5CDFE 2XCNA 1ANBA 2G00A 5J4SA 3BSQA 3LJOA 1CT4E 1O3KA 2ESTE 2D1JA 5F8TA 1TRNA 4X1NU 1FPHH 1TMUH 1E1QD 3BTDE 1PQ5A 3FZDA 1KLTA 3KN2A 1KXDA 1V2LT 1TIOA 5EW2H 1ZPBA 3SHAH 4CRDA 3HPTB 1C5QA 1TNKA 1YF4A 1C5YB 4IC5A 1O2PA 3RC4A 4AOQA 1INCA 3P95A 1GJ7B 1V2WT 1A7SA 1EUFA 3SI3H 2ZA5A 2F3CE 2SNVA 2F83A 3OYPA 3OX7U 5TCCA 3U8RH 1P0SH 3M7QA 2ILNA 4H42U 4MNWA 3ZVAA 3ATMA 2OTVA 1NO9H 5SGAE 2VVCA 1SFIA 3KIDU 1O3FA 1FQ3A 4ZHLU 1NRQH 2AEIH 3S7HB 4DIIH 2WHXA 5HIZA 5E2OA 2AIQA 1RXPA 3B9FH 2W6JD 2XNIA 2YMSB 2FI3E 2ZU1A 1B0FA 3GCOA 4KTUA 4IBLH 1ZLRA 1EASA 4I8KA 1W7XH 3UPEA 2A7JA 3BTQE 1TX7A 1UTJA 1W8BH 1L1NA 7GCHG 3A82A 1BTHH 1G2MA 1IHTH 2AHME 3OTPA 4NG9H 4FETA 1Y5BT 1ETTH 3GOVB 1GBBA 4WY3A 1SFQB 2ZPRA 2EI7A 1NS3A 1S83A 3KCGH 1XVOA 4Y79A 1FNIA 3RXSA 3TJOA 1CA0C 2XBWA 1A0JA 3MYWA 3IG6B 1FIZA 1FV9A 2ULLA 5LGOA 1O3LA 1CHGA 2FTLE 3P17H 1C1PA 1H8IH 2CHAC 2GZ8A 1CBWC 2KZ4A 2XC5A 1CA8B 2Y82A 2OK5A 3V7TA 1OXGA 4DIHH 1GMDG 2GT8A 1MKWH 2P3UB 3A7YA 3ZZBA 1QQUA 4O03A 2FLRH 2FI4E 2ANYA 2OCVB 3GCHB 1EJNA 1E0FD 4ABFA 1SGQE 1VGCB 3KL6A 1UTPA 1P2JA 1ARBA 1A5GH 1WBGB 2AMQA 2V3HH 3H7OA 3M35A 4MNVA 1UHBB 1AMHA 2WV5A 1MZAA 3NXPA 1SGTA 1NN6A 2H6MA 2J95A 1FMGA 3N7DA 2R3UA 2ZTZA 2F9VA 5T1VA 3AW0A 5BPEA 1V2ST 2BQ7B 1CGHA 4NIWA 4Z0KA 3ODFA 4B76A 3SNDA 4WH8A 1C5SA 3EDXB 1FY8E 1W0JD 3GISB 3N7OA 1IQEA 1ESAA 2P93A 4X1QU 4YZUA 3EYDA 1DLKB 1RIWB 4ABDA 1GI8B 2G5NA 4O9VA 1TPOA 1DUAA 2WPDD 3OAAD 1W3CA 3IITA 2AMDA 4D7FA 1OP0A 2OQUA 1GG6C 4OS5A 2V0BA 3CP7A 1Y3YA 1EXFA 2B5TB 3BIUH 1BRBE 2XWAA 1YCPM 1IQHA 3BTHE 1O3MA 3UR6A 3GY2A 4U2WA 4Y7BA 3SI4H 1EAWA 1S0RA 2PSYA 3MMGA 1H9HE 1ZTKA 2BD5A 4F48B 1C1MA 2HALA 1G32B 2JIZD 2VNTA 2WPMS 4R0IA 5DP3A 4ABAA 2FS9A 4VGCC 3RXDA 1RTLA 2W5EA 4JYVH 1DM4B 6ESTA 1OHHD 2M2AA 3PLBA 2Z7FE 1NY22 3E1XB 3M5MA 1YP9A 1KIGH 2VINA 1GDNA 1EFRD 1FI8A 1P9SA 4Y0YE 4I8HA 2AFQB 5DG6A 1PPBH 4FU9A 3E6PH 1A3EH 1T4UH 1AO5A 1GHYH 2O9QA 3TJVA 4BAOB 4WWYA 2ZCKP 1TBZH 5EXLA 4CRFA 3CS7A 1ESBA 3SGQE 1P11E 5A09A 1SQRA 4CBOA 3PO1C 5C1UA 4YESB 1TOCB 4GSOA 4DOQA 1W0YH 5JB8S 2CF8H 4YT7H 1F0TA 2G51A 3DSGA 1HIAB 1SGFG 3TJUA 4AFUA 1Z8JB 1A1RA 2BY7X 3RU4T 1RD3B 1KLJH 2ZHWH 4WXIA 1UK4A 4MPUA 1C2KA 3FN8A 2FOCA 3DT0H 4NZLA 2IOTA 1C2GA 1O5FH 1S0QA 3D62A 3OFND 5EJLA 3Q3XA 1ZGIA 3GY5A 1THSH 1MTNC 3ZVGA 5JYIA 4TWWA 4J2YB 2V35A 3TPIZ 3C27B 1AB9B 2BQ6B 1GI5A 1EZSC 1OS8A 3A83A 2ZECA 1TNHA 2B0FA 1MBQA 8GCHF 2BZ6H 1OWIA 1QNJA 2VJ1A 1ELBA 1HJAC 2OBQA 5DK1A 3S9CA 1Z1IA 1G2LA 1SL3A 3OU0A 1ZMJA 4FUCA 4AGJA 3ATIA 1KDQB 1TFXA 1F0UA 2BHGA 1FAKH 1O2SA 4JCNA 3F9HA 1EKBB 4RT0A 4FUJA 2J92A 1MQ5A 1RFNA 4ZHAA 1O39A 2QV1A 3SW2B 1C5PA 1XUKA 1DWEH 1TMBH 3GY3A 9ESTA 3SJIA 4D7GA 1C5OH 2ZFPH 1KXCA 1L1GA 1BTWA 2NU2E 3PM3A 1P3EA 5HM2A 1T8MA 4LOYH 3SV6A 5DP5A 1ETRH 2QYIA 3LGTA 5K7RA 1WV7H 1WTGH 7LPRA 1N6YA 2BYAX 4Q7XA 3SOSA 2TBSA 2HNTC 2TGDA 1TONA 4FVBA 4I8LA 2TRMA 1ZMNA 1ABJH 2AGIX 5C67A 5EJ1A 1GBAA 4TWYA 1DFPA 1FY3A 1TNIA 5DP7A 4KGAA 2GCTB 1C5UA 1QCPA 5TCAA 5HM9A 3DSPA 1GI0A 5I46H 1EB1H 1ELEE 2BDIA 4UFDH 5FCKA 1EB2A 1MH0A 1F0SA 1XMNB 1HAHH 2JJ1D 2VGCC 1OP2A 1K21H 1HAYB 3MU4A 4NA7A 2YOLA 2PTCE 1MQ6A 1LHDH 1YGCH 2SGQE 1FN6A 1P12E 4BXWA 2VWMA 4H4FA 1NRRH 1O33A 4UDWH 4AYYB 2RA0A 3I29A 1AVWA 1O2HA 3RMMH 4Z6AH 4X8VH 1K9OE 2BD3A 1TAWA 2A5KA 1YPEH 1V2VT 1EPTA 2C8YB 4UE7H 3RMLH 1C1TA 3AW1A 2NU4E 3VGCC 5CMXH 3BTKE 3BN9A 2ZIQH 1Y3VA 1QB9A 1YPHE 4B74A 1FY5A 1HAVB 2Z9IA 1BB0B 1AUTC 3RXLA 3LOXA 3F2GA 3FO8D 1AZZA 1UTLM 3TH4H 5T6FA 2GV7A 3A7VA 4FUDA 5LPFA 2F9NA 1O2XA 1BOQA 1PQ8A 2C4FH 3BTEE 2W7UA 4B1TA 5A0AE 5DO4H 5E2PA 2KCAA 3PTBA 6LPRA 3A7TA 3FZZA 3LC3A 1SQTA 2BTCE 4Y10E 2B9LA 3SJ9A 5EQSA 4UONA 3A84A 1CU1A 4GHQA 5F8ZA 2W6ID 3A81A 4IMQA 2P8OB 3LU9B 5KECA 1NESE 4TYDA 5CHAB 3DSOA 1RTFB 4IGDA 3VB3A 2XBXA 3RU4E 2A4GA 3KQEA 2XRCA 1UCYH 1GGDB 3PV4A 1UK3A 1VCQA 2ZEBA 1O2LA 2Y7XA 5AFYH 5DSFA 2CGAA 1B7XB 4X0WU 1T8LA 4K1EA 5F6MA 4AG1A 1H4WA 1RTKA 2ZTXA 3RMNH 2EC9H 4CHAC 5FCRA 1P2QA 1QRXA 3MO3A 4I8GA 2BLVA 4TT3D 2BDGA 2FXRA 3ELAH 6CHAC 1PFXC 3GICB 3TNSA 5DGJA 1EAUA 1A5IA 1UK2A 3SUFA 4MLFB 3RM0H 5PTPA 3ZZ8A 3RLWH 1QB6A 3LGUA 3T29A 3SZEA 1CT2E 2OC7A 2GP9B 5C17A 2GGVB 3U1IB 5B6OA 3TH3H 1C4U2 4WJG2 1SVPA 4MPXA 1PPHE 1G30B 1O3JA 2LELA 3SJOA 2RDLA 4FU8A 1NFUA 5LH8A 1KSNA 1GVZA 4X8UH 3VG8A 4CBNA 1C4Y2 2XCFA 5HMAA 3QGJA 5EIYA 1QGFA 2ZFRH 5IK2D 1W13U 3OY5U 3MHWU 4KTCA 2Q6GA 3WWBA 1SGPE 2HLCA 2KM0A 2AYWA 2W3IA 1H9LB 1H8DH 2UUFB 2FOFA 1C1WH 1HNEE 1PPZA 4H6SB 2ZFTA 2UWOA 1QL9A 2ZDAH 1UTKA 2IN2A 3F3BA 4GAWA 3L3TA 1ELFA 4AFSA 2NWNA 1D3QB 3PLKA 3VFEA 1GJ5H 2BDCA 1K22H 1UMAH 2H9TH 1O2KA 1IHSH 2GZ7A 3UFAA 3GDVA 1TLDA 5FHTA 2PUQH 4FUBA 2VVVA 2FOGA 3VEQB 5JBTA 3A89A 2F4LA 2QE7D 2F43B 1HJ9A 1P9UA 1VJ9U 2SGAA 2ASUB 4YM9A 1YPMH 2BLWA 3K65B 3EE7A 4IW4E 2JH5D 1ZSJA 1YPKH 2HPPH 1C5MD 1BMLA 1NU9A 1OPHB 2PKSC 2FDAA 1MMJN 1IQMA 3KQCA 5JDUB 1GBLA 3UB0A 3F0PA 1EAIA 2PUXB 4ABEA 2OC8A 3SZNA 1EAXA 5EGMA 1O3AA 2R0KA 1FUJA 4Q4LA 1C1RA 1L4DA 4AB9A 2OXSA 3SUGA 4B75A 1DSUA 1QBVH 4CRAA 1WOFA 4A5TS 1QRWA 2GMTC 1HJ8A 1NC6A 4OS1A 2AGGX 1HCGA 1O2MA 1EZUC 2KX4A 1BBRK 1TMTH 2AGEX 1LVOA 2BDBA 3NRLA 1C9PA 3EA7A 1MTWA 5EXMA 5DPAA 1XXDA 2UWPA 2BX3A 1GJ9B 5EW1H 4HGCA 1QJ1B 4INHA 1G3EA 4NZQA 3QLPH 1XVMA 2QY0B 1NM6A 4UD9H 1BTXA 3QGNB 5ETXA 2P3FH 3ZYEA 1J14A 3UTUH 1XKBC 1GJCB 1O2OA 5C1YA 4JYTA 5GJ4B 3KYFA 4JYUH 8GCHG 2HNTF 2EEKA 3MU8A 1E79D 1GHBG 1EATA 1TYNA 1OX1A 1MKXK 2PSXA 3UY9A 1LHCH 2XNDD 4FXGH 2BDYA 3PWBA 2JH0D 3A85A 4LZ1H 2ODPA 4A6LA 2A31A 1T8NA 1H8HD 2C8WB 2YMSC 1MTVA 5JBCS 2BY6X 2SGEE 3BF6H 2XC0A 4BAMB 3EQ0H 2LPRA 1EX3A 1XUIA 1KTSB 3ZVCA 1D9IA 5E0JA 1Q3XA 1TA2A 3RXUA 4KELA 1NBME 2OLGA 1HXFH 2VWNA 4M7GA 2ZQ2A 1TQ7B 1GHXH 4Y71A 5GIBA 5C3NA 1AN1E 1UVTH 5GCHF 2JDID 4DW2U 3H5CB 3MNCA 3N7EA 4F55A 4RN6A 2ODYB 2ZCLP 3SHCH 5EU8A 3KQ5A 3ZZ6A 1FX0B 3DCLA 3GDUA 3LGYA 4NSVA 1SB1H 1AIXH 1DWBH 2VIWA 2A32A 4O3UA 4WMEA 1O5CB 1J16A 3QZRA 4GPGA 2BD7A 1E38B 2HVXA 1HUTH 3RXEA 3VB4A 2HVYB 1O3EA 1C2EA 3W94A 4Q7YA 1HYLA 2PGBB 4XD7D 4DJZB 3S9BA 2HLDD 4RT1A 1IQJA 1LO6A 2VIOA 5L2ZH 1NFWA 2ZDNA 3TITA 2WPJS 1BTPA 4O97A 1TGNA 3BTFE 2FYRA 1LQEA 1WDIA 5E8EH 4ISOA 5A2MH 2PLXA 2ZU5A 4MNXA 3ZZDA 2WV4A 3URDA 1IQIA 2G4TA 1LPZB 4BAHB 3TLOA 1O2GH 3M3SA 2FOBA 3BV9B 3SU2A 2ZG0H 5JBAS 4ABJA 3F68H 2QXIA 4Y11E 1ID5H 1WTHD 4K69A 3FAOA 1G3DA 1KXEA 2ZI2H 3RDZA 2Q6FA 1W11U 1BRCE 1ACBE 1THPB 4Z1MD 4Q7ZA 1TGSZ 2WUCA 3SO3A 4FOUC 1GMCF 5FPTA 1BTZA 1O37A 1XUFA 1BCUH 4GCHF 3T27A 1EZQA 4X2XA 2Z3DA 4K2YA 3T25A 4U32A 4DVAU 4ESTE 2I6QA 1C1SA 1G37A 4ABIA 4NCYA 4BXSA 1O5AB 1VR1H 3LGIA 3VXEH 1EJAA 1K2I1 4XRNA 1LHEH 1MU8B 3BEUA 1AQ7A 4B2AA 4ABGA 4FUEA 2GZ9A 3ZV8A 3E0PB 1VITF 1FPCH 1LKAA 1O2WA 2QAAA 4YTAA 1Z1JA 4B73A 1DUEA 3SN8A 1ZGVA 1GI3A 1PYTC 2BDAA 2KAIB 1Z71A 2FS8A 1O2TA 3K6ZA 1SGRE 1P3CA 4NIVA 1T8OA 4JZFH 4AB8A 3RXHA 2J2UA 3ZZ4A 1Y5UT 4KTSA 3U98H 4RSPA 3UNSA 4ZCNA 2ZNKH 3RXPA 1MTSA 3QZQA 3PMBB 4K3JA 1V2RT 3LJJA 4X1RU 2FOAA 9LPRA 2AIPA 1GBMA 3GYMA 2R0LA 2LP6A 1HAZB 5EQRA 1ZHRA 2Y6TA 2R3YA 1T7CA 4HTCH 1DS2E 1NBMD 1ZHPA 2F9BH 3EA8A 2K8IA 2EY4C 5HIYA 2KCPA 1KY9A 2FZZA 2XW9A 2QF5A 3RXRA 1C1VH 1JIRA 1YLCA 3TK5A 3A7WA 4CH2B 2CV3A 3M3VA 2A4OA 4NFEA 2JETC 4SGAE 2TPIZ 1K1OA 1SG8B 1O5EH 1O3HA 2VVUA 1ELCA 5FX5A 1GBHA 2TIOA 1AVXA 4Y0ZE 3ZVFA 3KYGA 1HPGA 2H1UA 4MPWA 2BLQA 5GDSH 1A0LA 1Y8TA 4ISIH 1KXFA 5DN6D 2A4QA 4GUXA 1ANDA 5E0GA 1QTFA 1UTQA 3QO6A 1CA0B 2KAIA 2LNCA 3V13A 1P2MA 1SQAA 5HGGA 4P00A 1H9IE 2FP7B 2BY8X 3MI4A 1LPGB 7ESTE 3O8RA 2CHAB 1UHBA 1HBTH 1MBMA 3BG4C 1CBWB 3PMAB 4JK5A 2OUAA 1V2TT 2SNWA 1G36A 1GCTC 1O5GH 1Y3UA 5DP6A 1SPJA 2BQWB 1QJ7B 1O2YA 1ARCA 3E8LA 1KXBA 2D8WA 1GJBB 3HGPA 4ISLA 1V2MT 4MG3A 1UW7A 1GMHF 1ZMLA 2G5VA 2RDEA 3RP2A 1EPTC 1NROH 1A2CH 1P2NA 1H8ED 5GPIB 3OY6U 1IQLA 4YT6H 3UNRA 1N8OB 1BMAA 1BQYA 1CVWH 3RXKA 4CREA 1O5BB 2WPKS 4BANB 1SHHB 4XBDA 3LGVA 3VPKA 1BTUA 1O3NA 3TIUA 4B6EA 2Q1JA 3AVZA 4X1SU 3ZVEA 2W3KA 3EA9A 2WV9A 3HK3B 5DJ7A 3OEED 1C4V2 1OOKB 2Z94A 3UOUA 2VB0A 1BRAA 1YCPH 1GI9B 2I6SA 2BOKA 1X7AC 2HWLB 3RXBA 1DPOA 3OTJE 4J1YA 2STAE 1S81A 4NWLA 1S6LA 2WUBA 2ZU3A 1GG6B 3SV7A 3BTGE 1C5VA 4K1TA 2GVFA 1XUGA 5FX6A 3E3TA 3OE7D 5T3HA 2D2DA 2ZHDA 2OC1A 5I25A 1ESTA 2QC2A 3FP8E 3SUDA 1GHAG 3GY6A 2WYGA 5KEDA 1FXYA 1K1PA 2P94A 1GCDA 1IQGA 1C2HA 2XYAA 1Y5AT 1V2KT 4ZAEA 2O8LA 2THFB 4DT7B 2ANMH 1GJ6A 1MKWK 1LKBA 1S84A 2P16A 1NFYA 4VGCB 1UTOA 1P10A 2QIQA 4E7NA 4I33A 2IPHA 3DFLA 2OQ5A 2CF9H 1HIAA 1OSSA 2A5IA 5GCHG 1O2UA 1DLEA 1BUIA 1VJAU 1S82A 1Q2WA 4OS2A 4INLA 3LDXH 1NPMA 4FUHA 3TJNA 3DA9B 3GCTF 1K0HA 1V2QT 2KFWA 1HLTH 3A8BA 2H9HA 2AH4X 3Q76A 2Z9KA 3LH3A 1K1JA 3PO1B 3MH7A 1DWDH 2O8MA 2ANWA 2UUJB 2A0QB 2ZP0H 4B2CA 1OWJA 1GHZA 3QUMP 3U28C 5FL7D 1UVOA 2O8WA 1E34B 3KNXA 3FP7E 5JB9S 3ESTA 4NIYA 1GBTA 3NK8A 1GL1A 2JKHA 2WZQA 3BG8A 5A0BA 3W1EA 2IPQX 1F5KU 1P8VC 1KDQA 2PR3A 1TA6A 3FP6E 5C94A 1V6DA 4E05H 1EZXC 2EA3A 1SHYA 4XFQA 1MTNB 2GV6A 1O0DH 1YPJH 1GBEA 3MH5A 1AFEH 4I32A 1FIWA 3PB1E 1LDTT 3R0FA 6GCHF 2SGPE 2VH0A 1DT2A 1M9UA 3H09A 4RKOB 8KME2 1HB0B 4I8JA 4E7RG 1MAXA 1ELVA 1XM1A 3GDSA 4GVUA 2BVRH 1FJSA 1HJAB 4K8YA 3S9AA 1IQFA 1KMHB 1BBRE 1VKYA 4QT8C 3JZ1B 2V7QD 2FO9A 2Y81A 2UUYA 2P3TB 4I31A 1FLEE 4GCHG 3KGPA 1OWKA 1DDJA 3FKSD 3L33A 2QF3A 2GJGA 4AGKA 3A8AA 4YOJA 1UJ1A 2DE8A 5BRRE 2WPIS 2W7SA 4E06H 1AWFH 1AI8H 4B2BA 1IAUA 1VITG 1Z7KA 2AERH 4ZH8A 2SFAA 2AS9A 2ZGJA 2ZDMA 1DY8A 4DG4A 1QZ8A 4HG6A 2PTNA 1C5LH 1GBIA 1H1BA 1EP5A 1ZSKA 4WVPE 2HPQH 1A5HA 2QN5T 4MNYA 1J8AA 3ZZAA 1DXPA 3EAJA 3SQHE 1BJUA 1P2KA 5ESTE 3PV2A 3UQVA 3STIA 1HAXB 1RS0A 4YLQH 1DOJA 2FEQH 1AUJA 1C1QA 1QHRB 1HAVA 3M7TA 2A2QH 1CE5A 1SLXB 2VGCB 2Y7ZA 2FOEA 3NZIA 1GI2A 3T5FH 2G4UA 3BEIB 1TRYA 1TGBA 2A45B 3I77A 3S69A 2IJD1 5C5NA 4Q2KA 4X2VA 3F1SB 2H2ZA 1SLVB 3RUOA 3SNBA 1KTTB 1O30A 2BXTH 2F9UA 2PV9B 3BTTE 3TK9A 2SGFE 3S7KB 1O2JA 3F2HA 3SU4A 2TGAA 5KGOA 1AY6H 3RC5A 1SGIB 4SGBE 1TWXB 2Q6DA 4BAQB 3E90B 5FPYA 3NCLA 4Y8XA 1SGFA 3UREA 1BMFD 3R3GB 2YNAA 1G9IE 3MQKC 2A2XH 2NU1E 1AU8A 1HGTH 2K0QA 2XTTB 2ZPSA 3SORA 5FPSA 4ZKRU 1F5LA 3GCNA 1BTYA 3PV5A 2FLBH 1T4VH 4LXBH 1AFQB 3P6ZB 4XDEA 5GWZA 3P8GA 3CNRA 1PQ7A 1UVUH 3MO9A 1NZQH 1V2OT 1MD8A 2IJOB 3ZZCA 3MWIU 2F9OA 3ODDA 1BRUP 3MOCA 4BNRA 3E16B 3F0OA 4DY7B 1B0EA 1QQ4A 4OGXA 2F9PA 3PYHA 2FESH 2Y5HA 1GPZA 1NTPA 2ZPQA 3MU5A 2ZHEH 5FBEA 3F9FA 3ZZ9A 2FOHA 2PKAB 4I86A 2P59A 2L74A 5IYTA 2AMPA 2V3MA 1YBWA 1GMHG 4IS5A 1AD8H 1K1LA 4NIXA 4NA8A 1UTNA 4TPYA 3KF2A 1E1RD 6CHAB 3IWMA 3KHVA 3M37A 4X8SH 3P70B 3U1JB 1ZJKA 2UUKB 3D65E 1QB1A 4U01A 5A8YA 3MNBA 1C2JA 5EG4A 5EPNA 1OP8A 2F91A 1W2KH 1L2EA 5L2YH 2QGRA 1B5GH 1ETSH 4CR5A 1O32A 4K60A 5DP8A 3OSYA 3RXMA 1O2IA 1SSXA 4YOGA 1C5RA 4X2WA 2BDHA 2FM2A 2DE9A 5LPRA 1L4ZA 3I78A 4AX9H 3A88A 4AZ2B 2BX4A 1MAYA 2BB4A 3F9GA 1PQAA 1A3BH 2Y5GA 3PROA 3FOAA 2G8TA 4Y8YA 1C5TA 1WUNH 3D23A 1O2NA 4FVDA 4K1SA 1D4PB 3G01A 3P92A 2Z9GA 3NKKA 1RRKA 1TABE 5H4IB 1TBQH 3Q00A 5C1XA 2CXVA 1HXEH 1O3PB 1TPSA 5HYOA 1LHFH 2PKAA 1HRTH 3QWCH 3TU7H 1DE7H 4THNH 2J34A 2V6NA 4NWKA 1O3GA 4FUIA 2PWXA 2XWBI 3MH4A 1UCYK 2ZU4A 2J4IA 1C2IA 1CHOF 1SGDE 1G3BA 1GBCA 1Z8RA 2ZHQH 3T28A 2OP9A 3DUXH 2FI5E 3UIRA 4X6MA 1W0KD 1QA7A 1EP6A 1W7GH 4NSYA 5A8XA 1C5WB 3UUZA 2ZU2A 3T26A 1ELGA 3LH1A 2PKSB 3ZIAD 4Y76A 1C9TA 3U9AH 2C8ZB 4FUGA 1SLUB 4D9RA 4WMFA 3GCTG 1Y59T 3HGNA 1ZTLA 2GCHF 3UAIC 2J38A 2BD4A 2PFEA 1MU6B 2CJIA 4O3TA 5IDKA 1OKXA 1F7ZA 5LPEA 1XX9A 1EOLA 2FIRH 1DITH 3MU0A 4R8TB 3STJA 3LC5A 3HKIB 4OM9A 3U8OH 2GMTB 1E37B 3WW7A 4GLYA 1LMWB 4WH6A 3RXFA 1DX5M 1ZHMA 2XOKD 3DHKH 4Y7AA 1WXRA 3UQOA 3PRDA 1D3DB 3TH2H 1ZRBA 2WPLS 4ABBA 1ORFA 1OYQA 3VXFH 4RI0A 1MCTA 3A7ZA 3ZVBA 2D26C 4D76A 1WU1A 1K1MA 4A7IB 1FZZA 4UEHH 4XBCA 3E91A 3VB7A 4B71A 4X2YA 1YLNA 2UWLA 1VZQH 3GCHC 6GCHG 1HAPH 1AZ8A 3U8TH 1JRSA 1VCWA 1VGCC 1WSSH 4OGYA 5T6GA 1O34A 4IC6A 3V0XA 3OEHD 4HI3A 1C2MA 1C5NH 1PJPA 1LTOA 3PMHB 3MH6A 2P95A 1LVBA 4WXVA 4AORA 2FMJA 2B8OH 1TNGA 2H9EH 4INKA 1S85A 1P04A 1SGCA 1P05A 1A0HB 2FWWA 1F2SE 1ZR0A 2FX4A 2G52A 4OS4A 2HRVA 1O35A 1O3IA 1DY9A 1IQNA 1GVLA 1P57B 1XKAC 4HZHA 3BTWE 3MO6A 3MU1A 1RIWC 1V2PT 5DKMA 3URCA 1QFKH 1WQVH 1YKTA 1ZPZA 2VU8E 2C3SA 2OD3B 1ZPCA 2ZC9H 1K28D 1Z8GA 1XUJA 3QN7A 1BMMH 3LPRA 4D9QA 3P8NA 1SBWA 2H5DA 1LPKB 1SOZA 1BJVA 3UR9A 4AFQA 4WMDA 1P2IA 4AFZA 1TX6A 2KCOA 2A7HA 2BM2A 4X1PU 3O8CA 1WQSA 1E35B 2BXUH 4UFGH 5AFZH 2J98B 2VIDA 2VWLA 3TGJE 5EOKA 4DT4A 4BAKB 4TY6A 2C93B 3K6YA 5AF9H 1DWCH 1WCZA 5HKKD 1RGQA 1HAOH 3SNEA 4Q63A 2FPZA 5EJZA 1NFXA 1GJAB 1JOUB 2BY5X 5FBIA 1PPFE 1HV7A 4CR9A 1O3BA 2QCYA 2CN0H 3JZ2B 1BHXF 5GNDA 1RJXB 2FOMB 3E0NB 1QIXB 2Z6BD 1SGYE 1AKSB 1DVAH 4X6NA 2BOHB 2J97A 4YOIA 1BMNH 2CMYA 1NRNH 2J94A 4ZMAH 1N8OC 3RXCA 4A1TA 1A46H 3MNSA 3QTOH 3SU1A 1BA8B 5L6NH 3M5LA 1YC0A 4PROA 4CH8B 2Z3EA 3SJ8A 4BTTB 3Q3YA 1GDQA 2SGDE 3RXOA 1NT1A 3RC6A 5JBBS 1AGJA 4ZKNU 3PMJA 1ZOMA 2WPHS 2XXLA 1UVPA 2G81E 1CGJE 3PLPA 1OWHA 3AASA 4HFPB 4JZ1A 3QK1A 1O3OA 1P2OA 1UVSH 3WY8A 1JMOH 3RXIA 1NRPH 1OYTH 1ZYOA 2ZFQH 5C20A 1V3XA 2J98A 1TNLA 3VB6A 1THRH 1AB9C 3H7TA 2ZHFH 3SU5A 1SLWB 1JXPA 2RA3A 1L0ZA 3SJKA 2BLOA 4MQAA 4DCDA 3RLYH 3KEEA 1P03A 3RM2H 1W10U 1AVGH 4AYVB 3S0NA 3UOPA 3P8OA 1AKSA 1D3PB 3BTME 4JZIA 2QXHA 4XSKU 2ZF0H 3PTNA 1TQ0B 2R2WU 1COWD 3BIVH 1FAXA 2R9PA 1YWUA 1QRZA 2WSSD 1DICA 3MFJA 4ISHH 3A86A 1O2ZA 3AK5A 1ANCA 1PPCE 2VIVA 1GI4A 1KYNA 1YPHC 4CRCA 5C0UA 1C1NA 4AC9A 3RXAA 3NPSA 4A92A 5A0CA 1TBRH 1FDPA 1DSTA 2L6OA 4JK6A 3V12A 1WYKA 2JETB 3F6UH 3FANA 2GCTC 4MPVA 4ZKOU 3RXGA 1T31A 5FXLA 2DUCA 2VWOA 3FFGA 2VH6A 3K2UA 2YMSD 4U30A 1J17T 2QF0A 1EJMA 1JBUH 1LQDB 2B7DH 1YM0A 1PPEE 2K1QA 1O3DA 3QTVH 1CHOG 1CT0E 1QL8A 2A4RA 4XOJA 4RKJB 2VIPA 1TGCA 2VIQA 2ZQ1A 4Y6DA 1WAYB 1YY3A 1UTMA 3LKWA 5K0HA 5L30H 2JJ2D 3TVJB 2A5AA 3B23B 4DGJA 3BG4B 2ZGHA 2Z9LA 4BTUB 3V3MA 1MTUA 1GVKB 1GCTB 1U6QA 1CQQA 3A87A 4UFEH 1Q31A 1GHBF 2EI8A 2ZGCA 3RXJA 2CK3D 2BY9X 2GCHG 3ATWA 1ZTJA 2C90B 1KXAA 3M3TA 2RG3A 1T32A 1K1NA 1TPPA 5EQQA 2ZWLH 2P8OC 4F49A 1GJDB 1O3CA 1EPTB 1QBOA 5CHAC 3SUEA 7KMEH 3ATKA 1L1JA 2FYQA 1CSOE 1LCYA 1SGEE 2QXJA 3QX5H 4AN7A 1UO6A 3MNXA 2OINA 1W0ZU 2ZGXH 4A1VA 4ASHA 1GGDC 1GJ4H 1NRSH 4FUFA 1GL0E 4IN2A 3ZZ3A 3TGIE 1HAIH 2Y5FA 1C2LA 1C5ZB 1O2QA 3GY7A 2HOBA 4OS7A 1SQOA 4Q80A 3D49H 4MDSA 1FY1A 3P8FA 1AE5A 1YYY1 2EI6A 5F8XA 1ELAA 8LPRA 2GX4A 1F0RA 4ZUHA 1IOEA 5C0TA 2GDEH 5GXPA 1QL7A 4BTIB 1ZJDA 4ACAA 1HDTH 1QY6A 1F92A 3F9EA 1YPGH 3UWIA 3EE0B 1O36A 1S5SA 2V3OH 1SC8U 3ENSB 1FY4A 4AG2A 1TE0A 4OS6A 1BIOA 4K5ZA 3DD2H 1CGIE 1V2UT 1MCVA 1GHVH 4LK4A 3ZV9A 4B6FA 1BITA 1P01A 2C8XB 4P02A 2J5UA 3SV8A 3ZYDA 1MD7A 3KQBA 3SYJA 4I7YH 1TGTA 2BVXH 2M5TA 2WINI 3TGKE 2BD8A 2BD2A 1C2DA 1LVMA 2Z9JA 2TGTA 1GMCG 3B8JA 1SKYE 1J15A 5ABWA 2ALVA 1BBRH 1TNJA 5HXFA 1GBJA 1DANH 1XUHA 2WYJA 1QR3E 1KLIH 1FN8A 2PHBA 2QXGA 3Q3KA 1A61H 1GBFA 3ATLA 3HK6B 5CE1A 4YO9A 1OWDA 2EQNA 3PWCA 3ZZ7A 4ZKSU 2BMGB 4CRBA 2ZDKA 1TPAE 3LGWA 3UWJH 1JWTA 7GCHF 5AHGH 1ZZZA 2ZTYA 4X8TH 1PYTD 1IQKA
chains in the Genus database with same CATH topology
3AAVA 4IMZA 4ZROA 1AFQC 3T2NA 3SU3A 1VCPA 1ELTA 5J4QA 3A8DA 2QA9E 4TY7A 1C1UH 2GKVE 3SGBE 2STBE 2ODQA 5DP9A 1TB6H 1MKXH 2NU0E 5JPMH 1O2RA 1UCYE 2ZDLA 4Y8ZA 3M7UA 5E0HA 2ZCHP 1C5XB 4D8NA 3NWUA 4ISNA 3DFJA 1EQ9A 2ZZUH 3GY4A 5G4BA 1Z6JH 2ZFFH 4JMYA 3SU6A 1YCPK 3RXQA 1GMDF 3M36A 3TNTA 3RXVA 4XBBA 1QJ6B 2PGQB 3EGKH 4A1XA 1GI1A 4NFFA 3A8CA 2J9NA 1N6XA 1GHWH 2FX6A 2H5CA 1O38A 2YNBA 4TPIZ 1O5DH 4F4OC 3VGCB 3SV2H 1Z8IB 1TRMA 4H6TA 2XC4A 1C1OA 2PW8H 2HNTE 1GWAA 5FAHA 2A7CA 3MTYA 4X6OA 3LT3A 4ABHA 2A1DB 5F03A 1D6WA 1TX8A 3SQEE 1D3TB 2ZGBH 1JIMA 1Y3XA 4KKDA 2ZDVH 3VB5A 2BZAA 8ESTE 1A4WH 2BD9A 1SGNE 1HAGE 5ESBA 1GBKA 1SR5C 2R2MB 3K9XB 1O2VA 1XXFA 1S6FA 1C2FA 5EODA 1ELDE 1LVYA 1D6RA 1AWHB 3RXTA 4MVNA 2ZO3H 1GDUA 2FODA 1SI5H 3SBKA 1YPLH 2OC0A 3HATH 5TJXA 1BDAA 3SNCA 3TK6A 4GHTA 4BOHA 4CHAB 4XE4A 4K8BA 5DP4A 3CS0A 3O8DA 2G55A 2JH6D 2XBVA 1N1LA 3SNAA 1HFDA 1G3CA 3FVFB 1P02A 1V2NT 1S6HA 2GT7A 2ANKH 5AVDA 1BT7A 3A7XA 4NGAH 1P09A 1AE8H 5EPYA 4LZ4B 1J9CH 2TGPZ 1SOTA 1ABIH 3NUMA 4YLUA 3GY8A 4CRGA 2XBYA 3SU0A 4MTBA 4UFFH 2O8TA 2ALPA 3QDZB 1K1IA 2W26A 4WF8A 1SMFE 2GDDA 2FTMA 1O31A 2ZFSA 2BVSH 4ZXYH 3UNQA 1EOJA 1OWEA 3GYLB 4IN1A 1E36B 4JZDH 1TALA 2ZKSA 2RCEA 3AAUA 3RU4D 1YLDA 3LIWA 5C5OA 3SV9A 1GI7B 4DURA 5T6DA 3T62A 1NU7B 1W12U 1JRTA 3A80A 3LONA 1PPGE 3SGAE 4NA9H 1Y3WA 2GTBA 4ZHMU 1BZXE 1GI6A 2OBOA 2Y80A 1ZSLA 3Q77A 1GBDA 1P06A 3U69H 1LHGH 2HGTH 1QBNA 3ZVDA 1F5RA 3M5OA 4KP0A 3W95A 3ZZ5A 3O8BA 3ITIA 1AHTH 1QA0A 4JZEH 1Z6EA 4X6PA 3RMOH 1ANEA 1W14U 3C1KA 3BEFB 4ZXXH 2O8UA 3CENA 1BHXB 3L6PA 1GJ8B 3M5NA 4FU7A 1DXWA 1CO7E 3M61U 5A8ZA 1QURH 5C2ZA 3KQDA 1ZRKA 1FONA 1TOMH 2GD4B 1GHAF 1V2JT 1VITH 2Z3CA 1MZDA 3HKJB 2NU3E 5EXNA 1MUEB 2XCNA 1ANBA 2G00A 5J4SA 3BSQA 3LJOA 1CT4E 1O3KA 2ESTE 2D1JA 5F8TA 1TRNA 4X1NU 1FPHH 1TMUH 3BTDE 1PQ5A 3FZDA 1KLTA 3KN2A 1KXDA 1V2LT 1TIOA 5EW2H 1ZPBA 3SHAH 4CRDA 3HPTB 1C5QA 1TNKA 1YF4A 1C5YB 4IC5A 1O2PA 3RC4A 4AOQA 1INCA 3P95A 1GJ7B 1V2WT 1A7SA 1EUFA 3SI3H 2ZA5A 2F3CE 2SNVA 2F83A 3OYPA 3OX7U 5TCCA 3U8RH 1P0SH 3M7QA 2ILNA 4H42U 4MNWA 3ZVAA 3ATMA 2OTVA 1NO9H 5SGAE 2VVCA 1SFIA 3KIDU 1O3FA 1FQ3A 4ZHLU 1NRQH 2AEIH 3S7HB 4DIIH 5E2OA 2AIQA 1RXPA 3B9FH 2XNIA 2FI3E 2ZU1A 1B0FA 3GCOA 4KTUA 4IBLH 1ZLRA 1EASA 4I8KA 1W7XH 3UPEA 2A7JA 3BTQE 1TX7A 1UTJA 1W8BH 1L1NA 7GCHG 3A82A 1BTHH 1G2MA 1IHTH 4NG9H 1Y5BT 1ETTH 3GOVB 1GBBA 4WY3A 1SFQB 2ZPRA 2EI7A 1NS3A 1S83A 3KCGH 1XVOA 4Y79A 1FNIA 3RXSA 3TJOA 1CA0C 2XBWA 1A0JA 3MYWA 3IG6B 1FIZA 1FV9A 2ULLA 5LGOA 1O3LA 1CHGA 2FTLE 3P17H 1C1PA 1H8IH 2CHAC 2GZ8A 1CBWC 2XC5A 1CA8B 2Y82A 3V7TA 1OXGA 4DIHH 1GMDG 2GT8A 1MKWH 2P3UB 3A7YA 3ZZBA 1QQUA 4O03A 2FLRH 2FI4E 2ANYA 2OCVB 3GCHB 1EJNA 1E0FD 4ABFA 1SGQE 1VGCB 3KL6A 1UTPA 1P2JA 1ARBA 1A5GH 1WBGB 2AMQA 2V3HH 3H7OA 3M35A 4MNVA 1UHBB 1AMHA 2WV5A 1MZAA 3NXPA 1SGTA 1NN6A 2H6MA 2J95A 1FMGA 2R3UA 2ZTZA 2F9VA 3AW0A 5BPEA 1V2ST 2BQ7B 1CGHA 4NIWA 4Z0KA 3ODFA 4B76A 3SNDA 4WH8A 1C5SA 3EDXB 1FY8E 3GISB 3N7OA 1IQEA 1ESAA 2P93A 4X1QU 4YZUA 3EYDA 1DLKB 1RIWB 4ABDA 1GI8B 2G5NA 4O9VA 1TPOA 1DUAA 1W3CA 3IITA 2AMDA 4D7FA 1OP0A 2OQUA 1GG6C 4OS5A 2V0BA 3CP7A 1Y3YA 1EXFA 2B5TB 3BIUH 1BRBE 2XWAA 1YCPM 1IQHA 3BTHE 1O3MA 3UR6A 3GY2A 4U2WA 4Y7BA 3SI4H 1EAWA 1S0RA 2PSYA 3MMGA 1H9HE 1ZTKA 2BD5A 1C1MA 2HALA 1G32B 2VNTA 2WPMS 4R0IA 5DP3A 4ABAA 2FS9A 4VGCC 3RXDA 1RTLA 2W5EA 4JYVH 1DM4B 6ESTA 3PLBA 2Z7FE 1NY22 3E1XB 3M5MA 1YP9A 1KIGH 2VINA 1GDNA 1FI8A 1P9SA 4Y0YE 4I8HA 2AFQB 5DG6A 1PPBH 4FU9A 3E6PH 1A3EH 1T4UH 1AO5A 1GHYH 2O9QA 3TJVA 4BAOB 4WWYA 2ZCKP 1TBZH 5EXLA 4CRFA 3CS7A 1ESBA 3SGQE 1P11E 5A09A 4CBOA 3PO1C 5C1UA 4YESB 1TOCB 4GSOA 4DOQA 1W0YH 5JB8S 2CF8H 4YT7H 1F0TA 2G51A 1HIAB 1SGFG 3TJUA 4AFUA 1Z8JB 1A1RA 2BY7X 3RU4T 1RD3B 1KLJH 2ZHWH 4WXIA 1UK4A 4MPUA 1C2KA 2FOCA 3DT0H 4NZLA 2IOTA 1C2GA 1O5FH 1S0QA 3D62A 3Q3XA 1ZGIA 3GY5A 1THSH 1MTNC 3ZVGA 5JYIA 4TWWA 4J2YB 2V35A 3TPIZ 3C27B 1AB9B 2BQ6B 1GI5A 1EZSC 1OS8A 3A83A 2ZECA 1TNHA 2B0FA 1MBQA 8GCHF 2BZ6H 1OWIA 1QNJA 2VJ1A 1ELBA 1HJAC 2OBQA 5DK1A 3S9CA 1Z1IA 1G2LA 1SL3A 3OU0A 1ZMJA 4FUCA 4AGJA 3ATIA 1KDQB 1TFXA 1F0UA 2BHGA 1FAKH 1O2SA 4JCNA 3F9HA 1EKBB 4FUJA 2J92A 1MQ5A 1RFNA 4ZHAA 1O39A 2QV1A 3SW2B 1C5PA 1XUKA 1DWEH 1TMBH 3GY3A 9ESTA 3SJIA 4D7GA 1C5OH 2ZFPH 1KXCA 1L1GA 1BTWA 2NU2E 3PM3A 1P3EA 5HM2A 1T8MA 4LOYH 3SV6A 5DP5A 1ETRH 2QYIA 3LGTA 5K7RA 1WV7H 1WTGH 7LPRA 1N6YA 2BYAX 4Q7XA 3SOSA 2TBSA 2HNTC 2TGDA 1TONA 4FVBA 4I8LA 2TRMA 1ZMNA 1ABJH 2AGIX 5C67A 1GBAA 4TWYA 1DFPA 1FY3A 1TNIA 5DP7A 4KGAA 2GCTB 1C5UA 1QCPA 5TCAA 5HM9A 1GI0A 5I46H 1EB1H 1ELEE 2BDIA 4UFDH 5FCKA 1EB2A 1MH0A 1F0SA 1XMNB 1HAHH 2VGCC 1OP2A 1K21H 1HAYB 3MU4A 4NA7A 2YOLA 2PTCE 1MQ6A 1LHDH 1YGCH 2SGQE 1FN6A 1P12E 4BXWA 2VWMA 4H4FA 1NRRH 1O33A 4UDWH 4AYYB 2RA0A 3I29A 1AVWA 1O2HA 3RMMH 4Z6AH 4X8VH 1K9OE 2BD3A 1TAWA 2A5KA 1YPEH 1V2VT 1EPTA 2C8YB 4UE7H 3RMLH 1C1TA 3AW1A 2NU4E 3VGCC 5CMXH 3BTKE 3BN9A 2ZIQH 1Y3VA 1QB9A 1YPHE 4B74A 1FY5A 1HAVB 2Z9IA 1BB0B 1AUTC 3RXLA 3LOXA 1AZZA 1UTLM 3TH4H 5T6FA 2GV7A 3A7VA 4FUDA 5LPFA 2F9NA 1O2XA 1BOQA 1PQ8A 2C4FH 3BTEE 2W7UA 4B1TA 5A0AE 5DO4H 5E2PA 3PTBA 6LPRA 3A7TA 3FZZA 3LC3A 1SQTA 2BTCE 4Y10E 2B9LA 3SJ9A 5EQSA 4UONA 3A84A 1CU1A 4GHQA 5F8ZA 3A81A 4IMQA 2P8OB 3LU9B 1NESE 4TYDA 5CHAB 1RTFB 4IGDA 3VB3A 2XBXA 3RU4E 2A4GA 3KQEA 2XRCA 1UCYH 1GGDB 3PV4A 1UK3A 1VCQA 2ZEBA 1O2LA 2Y7XA 5AFYH 2CGAA 1B7XB 4X0WU 1T8LA 4K1EA 5F6MA 4AG1A 1H4WA 1RTKA 2ZTXA 3RMNH 2EC9H 4CHAC 5FCRA 1P2QA 1QRXA 3MO3A 4I8GA 2BLVA 2BDGA 2FXRA 3ELAH 6CHAC 1PFXC 3GICB 3TNSA 5DGJA 1EAUA 1A5IA 1UK2A 3SUFA 4MLFB 3RM0H 5PTPA 3ZZ8A 3RLWH 1QB6A 3LGUA 3T29A 1CT2E 2OC7A 2GP9B 2GGVB 3U1IB 5B6OA 3TH3H 1C4U2 4WJG2 1SVPA 4MPXA 1PPHE 1G30B 1O3JA 3SJOA 2RDLA 4FU8A 1NFUA 5LH8A 1KSNA 1GVZA 4X8UH 4CBNA 1C4Y2 2XCFA 5HMAA 3QGJA 1QGFA 2ZFRH 1W13U 3OY5U 3MHWU 4KTCA 2Q6GA 1SGPE 2HLCA 2W3IA 2AYWA 1H9LB 1H8DH 2UUFB 2FOFA 1C1WH 1HNEE 1PPZA 4H6SB 2ZFTA 2UWOA 1QL9A 2ZDAH 1UTKA 2IN2A 4GAWA 3L3TA 1ELFA 4AFSA 2NWNA 1D3QB 3PLKA 3VFEA 1GJ5H 2BDCA 1K22H 1UMAH 2H9TH 1O2KA 1IHSH 2GZ7A 3UFAA 3GDVA 1TLDA 5FHTA 2PUQH 4FUBA 2VVVA 2FOGA 3VEQB 5JBTA 3A89A 1HJ9A 1P9UA 1VJ9U 2SGAA 2ASUB 4YM9A 1YPMH 2BLWA 3K65B 4IW4E 2JH5D 1ZSJA 1YPKH 2HPPH 1C5MD 1BMLA 1NU9A 1OPHB 2PKSC 2FDAA 1MMJN 1IQMA 3KQCA 5JDUB 1GBLA 1EAIA 2PUXB 4ABEA 2OC8A 3SZNA 1EAXA 5EGMA 1O3AA 2R0KA 1FUJA 1C1RA 1L4DA 4AB9A 2OXSA 3SUGA 4B75A 1DSUA 1QBVH 4CRAA 1WOFA 4A5TS 1QRWA 2GMTC 1HJ8A 1NC6A 4OS1A 2AGGX 1HCGA 1O2MA 1EZUC 1BBRK 1TMTH 2AGEX 1LVOA 2BDBA 1C9PA 3EA7A 1MTWA 5EXMA 5DPAA 1XXDA 2UWPA 2BX3A 1GJ9B 5EW1H 4HGCA 1QJ1B 4INHA 1G3EA 4NZQA 3QLPH 1XVMA 2QY0B 1NM6A 4UD9H 1BTXA 3QGNB 5ETXA 2P3FH 3ZYEA 1J14A 3UTUH 1XKBC 1GJCB 1O2OA 5C1YA 4JYTA 5GJ4B 4JYUH 8GCHG 2HNTF 2EEKA 3MU8A 1GHBG 1EATA 1TYNA 1OX1A 1MKXK 2PSXA 3UY9A 1LHCH 4FXGH 2BDYA 3PWBA 2JH0D 3A85A 4LZ1H 2ODPA 4A6LA 2A31A 1T8NA 2C8WB 1MTVA 5JBCS 2BY6X 2SGEE 3BF6H 2XC0A 4BAMB 3EQ0H 2LPRA 1EX3A 1XUIA 1KTSB 3ZVCA 1D9IA 5E0JA 1Q3XA 1TA2A 3RXUA 4KELA 2OLGA 1HXFH 2VWNA 4M7GA 2ZQ2A 1TQ7B 1GHXH 4Y71A 5GIBA 5C3NA 1AN1E 1UVTH 5GCHF 4DW2U 3H5CB 3MNCA 4RN6A 2ODYB 2ZCLP 3SHCH 5EU8A 3ZZ6A 3GDUA 3LGYA 4NSVA 1SB1H 1AIXH 1DWBH 2VIWA 2A32A 4O3UA 4WMEA 1O5CB 1J16A 3QZRA 4GPGA 2BD7A 1E38B 2HVXA 1HUTH 3RXEA 3VB4A 1O3EA 1C2EA 3W94A 4Q7YA 1HYLA 2PGBB 4DJZB 3S9BA 1IQJA 1LO6A 2VIOA 5L2ZH 1NFWA 2ZDNA 3TITA 2WPJS 1BTPA 4O97A 1TGNA 3BTFE 2FYRA 1LQEA 5E8EH 4ISOA 5A2MH 2PLXA 2ZU5A 4MNXA 3ZZDA 2WV4A 3URDA 1IQIA 2G4TA 1LPZB 4BAHB 3TLOA 1O2GH 3M3SA 2FOBA 3BV9B 3SU2A 2ZG0H 5JBAS 4ABJA 3F68H 2QXIA 4Y11E 1ID5H 1WTHD 4K69A 3FAOA 1G3DA 1KXEA 2ZI2H 3RDZA 2Q6FA 1W11U 1BRCE 1ACBE 1THPB 4Q7ZA 1TGSZ 2WUCA 3SO3A 1GMCF 5FPTA 1BTZA 1O37A 1XUFA 1BCUH 4GCHF 3T27A 1EZQA 4X2XA 2Z3DA 4K2YA 3T25A 4U32A 4DVAU 4ESTE 2I6QA 1C1SA 1G37A 4ABIA 4NCYA 4BXSA 1O5AB 1VR1H 3LGIA 3VXEH 1EJAA 1K2I1 1LHEH 1MU8B 3BEUA 1AQ7A 4B2AA 4ABGA 4FUEA 2GZ9A 3ZV8A 3E0PB 1VITF 1FPCH 1LKAA 1O2WA 2QAAA 4YTAA 1Z1JA 4B73A 1DUEA 3SN8A 1ZGVA 1GI3A 1PYTC 2BDAA 2KAIB 1Z71A 2FS8A 1O2TA 3K6ZA 1SGRE 1P3CA 4NIVA 1T8OA