3OX7U

The crystal structure of upa complex with peptide inhibitor mh027 at ph4.6
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSALAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title The binding mechanism of a peptidic cyclic serine protease inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 245
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ox7U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ox7U01
3RLYH 1O3FA 1TA2A 1BBRH 1YYY1 2VVVA 3MO9A 3KGPA 3VGCC 1GBCA 3H7TA 1EKBB 3AW1A 1W2KH 1UVPA 2BXTH 2QCYA 2ZDNA 4GHTA 3T25A 4ISLA 1AB9B 4X6NA 3K6YA 3U8TH 1GI4A 5GXPA 1DSUA 1UTPA 2Y7XA 4ABAA 2H1UA 1FNIA 1O5AB 2H5DA 3IWMA 2OQUA 1E34B 1KLIH 3B9FH 1QL8A 3T62A 1KDQA 3MNXA 4DURA 1K1OA 1O3OA 5K0HA 1CO7E 1VGCB 1P57B 2W3KA 2FTMA 1HJAB 1TPOA 3ENSB 2G5VA 3A7VA 1EP5A 1OS8A 4WMEA 1DLKB 1EOJA 1V2MT 4DIIH 1GJDB 1QTFA 1LQEA 1MCTA 2LPRA 3OSYA 2R9PA 1C5YB 4D9RA 1V2QT 5JBBS 1K1JA 1GHVH 2AEIH 4DT7B 2OCVB 2EC9H 2JH5D 2H9EH 2CJIA 3RXGA 1BA8B 3RXCA 5E2OA 1P05A 4I8KA 1CGIE 1RIWC 1VITF 1F0RA 1JXPA 2GKVE 1O3DA 1ZHPA 1FJSA 1TA6A 2R2WU 2VIWA 4NG9H 1MAXA 4OGXA 7GCHF 1QQ4A 1O3JA 4WXVA 5T6FA 7LPRA 1S6HA 1TYNA 2VH0A 1H9IE 2QF0A 1A0HB 2P95A 2HPPH 5C20A 1GMHF 3BEFB 3I78A 4K3JA 4K1SA 2XBWA 1TE0A 1P03A 2ZFRH 5JB9S 1IQLA 1QB1A 1W11U 1SB1H 4YLUA 2Z9LA 3KQBA 2ZDKA 1C2IA 2Z3CA 1ACBE 3A7YA 1CT2E 2W3IA 5DP7A 3GY6A 2J9NA 5F8XA 1JWTA 3NK8A 2QA9E 3W95A 1P2QA 3TU7H 5L2ZH 1ELDE 4FUBA 2ZCLP 2BTCE 2ZO3H 3UR6A 4YESB 1SFIA 1WV7H 4YT6H 5FPSA 1FIZA 1OWKA 4IC6A 3ATIA 4XOJA 4B71A 3U1JB 3QN7A 2OINA 1P9SA 4INLA 1YPHC 4F4OC 1CA0B 1GBKA 4AB8A 2ZP0H 1JRSA 1UVTH 3QGJA 2P3UB 1UK4A 4K2YA 2DUCA 3ZV9A 3ZZAA 1JIMA 1NC6A 1SI5H 1P2KA 4MNYA 8GCHG 3VB5A 3BG4C 1A7SA 3O8DA 3TH3H 4R8TB 1DWCH 2PW8H 3V13A 4BTIB 2ALVA 4ASHA 1ELFA 4FUHA 3SU1A 1KLTA 1SGNE 1ZSLA 2BDIA 3TIUA 4WMDA 5T6GA 1Y5UT 3EAJA 3DFLA 1C5ZB 2F9OA 1FONA 3PTBA 2A2XH 2XBYA 1BTUA 2CF9H 1O3PB 3QUMP 1ETSH 2FOBA 1D6RA 3Q3YA 3HKJB 3RUOA 1ZGVA 2WPIS 4K69A 1D3PB 5C2ZA 4BAKB 1C1VH 3FAOA 1MD7A 3BTKE 1TX7A 1XMNB 1IQFA 3G01A 4CHAB 2TRMA 3SUDA 1FY3A 1SLXB 5AVDA 2ANMH 2GCTC 1Z8IB 4GCHG 1T31A 2HPQH 2ZNKH 5LH8A 1OWHA 2ZKSA 2XNIA 4YOGA 1T8MA 4X2VA 2J2UA 2Z9IA 4DG4A 4X1NU 1GHYH 2NU3E 1G2LA 1CHGA 1HDTH 2A4GA 1JOUB 4K1TA 2ZU2A 4ISNA 1UTQA 1OP2A 2OC1A 2BD5A 1QNJA 1C1UH 1TRNA 3MU5A 1IQEA 2PGBB 2PWXA 1QJ6B 1BTZA 3L33A 4I31A 1MCVA 3NUMA 1TRMA 2BY9X 4XBDA 1UTMA 3I29A 3MTYA 2BZ6H 3LONA 8GCHF 2BY8X 3FFGA 1GBBA 1ZHRA 3VPKA 4CREA 2V3OH 1DY8A 3LDXH 1ARBA 4JZFH 4BAOB 4KTUA 4JYTA 1AU8A 1NU9A 1C5TA 1XXDA 1F0TA 2OC8A 5C5OA 1QRZA 4AFZA 1MQ5A 3PB1E 2SFAA 3BIUH 1SOZA 1EXFA 2VB0A 3GCHC 1TB6H 3HATH 3VXFH 2Z94A 1BTXA 4FUEA 1C9PA 1Z1JA 1L4ZA 1O2UA 3M37A 1H8DH 1BMLA 3K6ZA 4KTSA 6LPRA 1AO5A 1NTPA 5EQRA 1H9LB 1VR1H 5C1XA 2BVXH 2G55A 3CS0A 4BOHA 3DT0H 1ABIH 2GDEH 1YPEH 1LDTT 1PPBH 2C4FH 4Z0KA 4E7NA 2O8TA 1S0RA 2GGVB 5FCRA 2A5IA 3MHWU 2VIVA 3KQEA 4FUCA 1OXGA 5DP3A 2ZZUH 1GJ9B 1LQDB 2VIQA 1GL1A 2A5KA 1SGEE 1O32A 3Q3XA 3U8RH 2PR3A 4GCHF 2Y5FA 3S9BA 1WQSA 2J4IA 4Y8XA 3NKKA 4RN6A 5L6NH 1UVSH 3SU0A 1QRXA 3P8FA 5GJ4B 1PYTC 1WSSH 4RKOB 2KAIB 4OGYA 1QR3E 2AMDA 1P3CA 1TGBA 1HPGA 1B7XB 5DK1A 1PPFE 2FM2A 1KXEA 2XCFA 1ZPZA 1BUIA 1XUGA 1K1LA 2WPKS 3LT3A 2ZPQA 1BTYA 1GGDB 1G3CA 2EEKA 3VFEA 1TNGA 1UCYK 1GDNA 2GVFA 1V2TT 2P8OB 3GOVB 1MZDA 3D65E 4CBNA 1NT1A 3MMGA 2AGIX 1XUKA 3NPSA 1GDQA 1BRBE 1BCUH 1F5LA 3FZDA 1HAOH 2ANWA 3A84A 1G3EA 2RA3A 1O3AA 1GHBG 1G3BA 1L1JA 4MPUA 3V0XA 3SNEA 3PMJA 1CSOE 1UTJA 4ABFA 1VJ9U 2C3SA 1E35B 4Y79A 4H6SB 3RXLA 3EGKH 4I8LA 1AFEH 3CENA 4I33A 2HNTF 1LHGH 1FY4A 3PM3A 2FWWA 4FXGH 2Y82A 1G2MA 1N6XA 1CA0C 3C1KA 2XC0A 3QDZB 2WUBA 2P93A 3RXQA 1HAXB 1NZQH 1N1LA 1SMFE 1AI8H 3S0NA 1C1OA 2IPHA 4UDWH 2BHGA 1NRPH 6CHAB 4H42U 1BMMH 3JZ1B 2GCHG 1YM0A 2CHAB 1CVWH 1ETRH 1ZHMA 3GCNA 3GY5A 1GBEA 1THPB 2ZG0H 4K5ZA 4ZKSU 1V2WT 1N8OB 1LHFH 2ZU1A 2O9QA 1OSSA 1ZZZA 2FYRA 2B5TB 1Q3XA 3TPIZ 3A8BA 3PO1C 1EAUA 5EQQA 1PJPA 3GY2A 2A31A 2R3YA 4A7IB 2QXHA 4B73A 4UE7H 1GI7B 4IN2A 1IQKA 1C4V2 5JYIA 1EP6A 3MU4A 5DJ7A 3NZIA 3GCOA 1C2LA 1GBTA 1OWJA 1DDJA 3SORA 1Z7KA 1HYLA 1RFNA 3M36A 4BNRA 4Q80A 4X8TH 4IC5A 4LK4A 5EGMA 1EPTC 1IOEA 3ZZ3A 1K1IA 3QTVH 4X2XA 2ZGBH 1AD8H 1ARCA 1SGTA 1O34A 3BG8A 3RP2A 4CHAC 2ZTYA 4I7YH 3DA9B 2Z9GA 6GCHG 7KMEH 1HJ9A 5FX5A 1UVUH 1ZSKA 4MG3A 2YNAA 3E1XB 2OP9A 5J4SA 1GHBF 3OY5U 1AZ8A 1HIAB 3LKWA 4ZKOU 5L30H 2ZQ2A 3AW0A 3OTJE 3SNDA 4GLYA 2AGGX 4KTCA 3U98H 2BD9A 4ISIH 4IN1A 2ZQ1A 4BANB 1Z8RA 1FV9A 4WJG2 1HGTH 2NU0E 4AG2A 2VIDA 1ZOMA 4RKJB 1GJ7B 2PSXA 1P9UA 2PFEA 4ZH8A 3SU6A 1C2JA 3SGAE 4VGCB 1O5DH 2ZU3A 3MH5A 2EI8A 3D23A 5FPYA 5A0AE 3RMNH 1K9OE 1A3BH 1S81A 4FUGA 1ETTH 3BEUA 2GCHF 1FXYA 4ABDA 5JBAS 1UTNA 3SN8A 4DW2U 1L2EA 1RGQA 1W0YH 3RXTA 1IQMA 1P2IA 3KQDA 1FPCH 2ODYB 5HGGA 5H4IB 1W13U 1DT2A 3MNBA 3KIDU 4X8SH 1HAVB 1W8BH 1YPLH 3P8GA 4AOQA 1HCGA 3NCLA 1EASA 1ANEA 5C67A 2BDBA 4H4FA 3WY8A 2ZHWH 1ELCA 2XCNA 1UTOA 3SNBA 1GI5A 4IW4E 3TGIE 1Z8JB 1PQAA 2V3HH 2AMPA 3TJNA 1O0DH 1QQUA 2BZAA 1ZTKA 3SU4A 2BQWB 2GZ9A 3QZRA 2ZDVH 1WBGB 3IITA 1V2ST 3SU5A 1FN6A 3RMLH 1TNIA 3H7OA 2WV4A 2GV7A 5DG6A 1YCPK 2V6NA 1ESBA 1P2OA 6GCHF 1C5SA 1O2WA 1SHYA 1TX8A 3PMHB 4B2AA 2XC4A 1A3EH 2ALPA 2ZGCA 4SGAE 3ZVCA 2G8TA 2XYAA 1WAYB 2O8WA 5HYOA 4B1TA 1BTWA 2FI3E 1KTSB 1OYTH 1A0JA 3RXIA 3PLKA 1G32B 3SHCH 1MKWK 5FHTA 3A89A 5JB8S 1LHDH 3PROA 3ZZ5A 2FLRH 3A87A 1BJVA 2VVUA 4D76A 3FZZA 2G52A 5DP5A 1RTFB 3E8LA 4OS6A 1HBTH 2UWPA 1GGDC 1EATA 4TYDA 3B8JA 3GY7A 2AFQB 5A09A 1AZZA 3I77A 1HAZB 3ZYEA 4XDEA 1LPGB 1SGQE 3RXPA 2BDHA 3TK9A 3O8CA 1IQJA 3SU2A 2F9VA 1MAYA 2W7SA 2EI7A 3LC5A 1FAKH 1ORFA 1O2QA 4ZUHA 1GI0A 2CF8H 1A2CH 1MTNB 3KQCA 3P8OA 3R0FA 1UCYE 3MYWA 2PKSB 3ITIA 4FUDA 3T2NA 3TK6A 4Y6DA 4AGKA 1OPHB 1O5CB 1O5EH 1F7ZA 1T4UH 1ELGA 1FQ3A 3SNAA 1C5UA 2JETC 3HPTB 2A2QH 3GY4A 1KXDA 4CRFA 3RXAA 1TMBH 1EUFA 3RU4E 1OP8A 4MDSA 1UCYH 1FPHH 2WPJS 2FEQH 1V2KT 1MUEB 2XXLA 4X2WA 4B76A 3A82A 1C1WH 2VGCB 5AFZH 1GMCG 2P16A 2A1DB 1SGFA 1WQVH 3TLOA 3MU8A 4FU7A 1WTHD 4Y0YE 2AH4X 1H1BA 1EZQA 3RLWH 3KF2A 6CHAC 1FY8E 1GI2A 1KXBA 3P17H 1YGCH 2W7UA 1KDQB 2OC0A 5HM2A 1BQYA 2V35A 3RDZA 4B75A 1MH0A 1B0EA 2A32A 2FS8A 2CGAA 3QZQA 2Z3DA 1GBJA 1KTTB 1TQ7B 3BTEE 1YPMH 2PUQH 3M7QA 2BD8A 3F1SB 3GYLB 3T26A 1XVMA 1QA7A 1RJXB 1C1MA 1D6WA 2AIQA 4ISHH 3STIA 5LGOA 1T4VH 2VH6A 2FOAA 2Y5HA 1EQ9A 1GCTB 2ZDMA 9LPRA 2YNBA 3LC3A 2FMJA 4UFFH 2BD4A 1P2JA 3TJVA 1MTSA 1NRQH 3Q77A 1C1QA 1Y59T 2BY6X 1CE5A 3ATLA 4D8NA 3SOSA 5E0HA 2GZ8A 1K22H 1V6DA 1ELTA 1OP0A 1VCPA 4YM9A 2SGQE 3UWIA 2XRCA 3F9FA 1NFXA 1O3IA 3A7WA 1AKSA 3RC5A 2BQ7B 1LKBA 1O33A 4MNXA 2OUAA 3UOUA 1O3KA 3MH7A 1IAUA 2UWOA 3ATMA 1TRYA 1GI6A 2Q1JA 4IGDA 4U2WA 3BF6H 3MO6A 1EPTA 1ZMLA 3SW2B 1GBDA 2CV3A 2FTLE 1A1RA 1GHWH 1U6QA 1GDUA 5J4QA 4E7RG 1EJAA 8KME2 1BHXF 2OBOA 1O2NA 4QT8C 3A7XA 1V2OT 2F9UA 2F9NA 3BTWE 1E0FD 1Z1IA 1GHAG 2B8OH 1P09A 1S82A 2BVRH 1O31A 4VGCC 1GMCF 4MPVA 3U69H 1UJ1A 1S6FA 3S7HB 1RTLA 2AERH 2FP7B 2FIRH 4Q7ZA 2D26C 5JBTA 2C90B 3M5MA 1TPAE 1KLJH 1L0ZA 2Y5GA 1CGJE 4OS2A 4Y0ZE 1ZRKA 1TGNA 3ZZ8A 1PPHE 3PLPA 1NO9H 3A83A 1L4DA 2QXGA 3LOXA 1GBHA 4WVPE 1S0QA 1Q2WA 1TONA 4CBOA 1BDAA 1E38B 3M35A 1KXFA 1GI1A 1TMTH 1OWDA 4IBLH 4M7GA 2HOBA 2ZHQH 4YLQH 2H2ZA 5FCKA 2YOLA 3LGUA 3L6PA 3SI3H 5I46H 4MLFB 3SUEA 4DVAU 1HUTH 2AIPA 4Y10E 3SJIA 4FUJA 1AY6H 1NRSH 2EI6A 4ZKNU 3RMOH 1W7GH 3RC4A 5F6MA 1D9IA 1RTKA 1MD8A 4J2YB 1ID5H 1K28D 3LH1A 3V3MA 2G51A 2BLOA 1T8OA 1BOQA 1P2NA 2WYGA 5FBIA 2WUCA 4U01A 1BRUP 9ESTA 1HAIH 1ELBA 1W0ZU 1GJAB 2OXSA 3UNRA 4BXWA 3PWBA 2STAE 1BMNH 1DWBH 3QO6A 4SGBE 1ELEE 4CRBA 5DP9A 1W7XH 2SNWA 4A1TA 1UHBA 3SV8A 1C5QA 1S83A 1ZTLA 1SGPE 1AE5A 1TWXB 3TJOA 3TNSA 2Q6FA 2G81E 5FX6A 2SGDE 1O2YA 2BLQA 2QF3A 3VB6A 1AFQB 2VIOA 4B74A 2PLXA 3PYHA 1EZUC 1ZYOA 4JYVH 2ZFTA 3QLPH 1GHAF 1AHTH 1K21H 1GBFA 2ZPSA 2GMTB 3M3TA 2ZECA 4D9QA 1TFXA 5DO4H 3VB7A 1VZQH 5B6OA 4WF8A 1FMGA 2XW9A 2FOFA 1FIWA 1W14U 1XVOA 2HWLB 3UFAA 1SC8U 3SUGA 1W10U 5TCCA 1AB9C 4OS5A 3RXFA 1MTUA 4H6TA 3CP7A 4DY7B 1KIGH 2VIPA 2BD2A 1IHSH 5GWZA 2WYJA 4B2CA 1YC0A 3ODDA 2BOKA 3ZVGA 1T8NA 3VB4A 2PV9B 5A8ZA 5C1UA 2OC7A 1VGCC 1XX9A 3LH3A 1BHXB 4JK6A 4RSPA 1HJAC 4B2BA 5HM9A 1P10A 3SGQE 4ZXYH 1TX6A 1J14A 2RCEA 1C5LH 3HK3B 3BN9A 3A7TA 2OTVA 1O2VA 1P0SH 1WUNH 2J94A 2VINA 1AVWA 4MNWA 3TK5A 5GDSH 5DP8A 1UK3A 1KY9A 2C93B 4BXSA 2H5CA 2TPIZ 1CBWB 3SQHE 1AIXH 4K60A 4NSYA 4X1RU 2FLBH 1O2OA 1ZJKA 5CMXH 4UEHH 2JH6D 5EW2H 1A5GH 3MH4A 3ZVAA 1C4Y2 2J92A 5FBEA 3BV9B 1A5HA 1H9HE 4DGJA 5T6DA 4JZIA 1ZTJA 4GHQA 1FY1A 2Z3EA 4Q7XA 2HLCA 3A7ZA 2HGTH 2CXVA 2Q6GA 4E06H 3OX7U 3VGCB 2ESTE 2I6QA 1Z6JH 1OKXA 1QB6A 3FP8E 3B23B 4JCNA 3UNQA 3MU0A 5AFYH 2UUJB 4Y11E 2SGPE 2D1JA 2D8WA 2Y81A 3S7KB 4Y8ZA 4ABIA 1GCTC 1DXPA 3ATKA 1OWEA 3GDVA 1HV7A 3LGIA 3GISB 1TBZH 1GJ8B 1GCDA 4YOJA 4BTTB 1GMDG 2A7CA 2FZZA 4BAMB 1C5MD 1SL3A 2IOTA 1LHCH 5IYTA 5A8XA 1DWDH 1UTKA 2A4QA 6ESTA 1UVOA 1UK2A 5EXLA 1Y3XA 2IJOB 2WV5A 1QFKH 1SBWA 1XKAC 3BTME 5I25A 4AYYB 1HXEH 2FXRA 1TIOA 3IG6B 1GI3A 3UY9A 4ZHMU 4CR5A 5DP6A 1SPJA 3MWIU 2ZI2H 4ZROA 1MBMA 5C1YA 3RM0H 3Q76A 1GVZA 5C3NA 2ZFFH 3TGJE 3P6ZB 1MKXK 3KEEA 5EXNA 3N7OA 1T8LA 2Y80A 1O5BB 3MU1A 2GD4B 3UR9A 3V12A 4GAWA 1HAGE 5EG4A 4Y8YA 2PKAB 2QV1A 5AHGH 1YPHE 1Y5AT 1GWAA 1EB2A 3A8DA 1HIAA 3TJUA 1F92A 1NM6A 1P01A 4HFPB 2FOGA 2ZCKP 2WINI 1D4PB 3M3SA 2WPHS 2BX4A 1HB0B 4OS7A 4NFEA 4FU8A 1A61H 2J95A 4O03A 1SGFG 3TH4H 2WPLS 2FOHA 2HALA 3AAVA 3UUZA 1C5VA 2ZCHP 3EE0B 2GTBA 1AUTC 3ZV8A 4Y7BA 1ZRBA 4JMYA 1SGYE 3LJJA 1ZR0A 3SUFA 1HAHH 3FP7E 1ESTA 1O39A 2ZFSA 2EA3A 1HAYB 1CGHA 1GBIA 3A85A 5FXLA 2DE8A 1V2NT 1V2RT 2FX6A 1TBRH 3RXUA 3ZZ4A 4Z6AH 4DCDA 2ZU4A 3BG4B 1GMDF 3A86A 2ZGHA 1O3CA 3A8CA 4U30A 3SI4H 1K1MA 1V2JT 3MO3A 1PQ8A 1SGDE 5GIBA 3D62A 3GDSA 1H4WA 1V2PT 2BB4A 3E3TA 1YP9A 1Y3WA 1EOLA 1O30A 2F9PA 1CA8B 1M9UA 5T3HA 5K7RA 1ZMNA 1GJ5H 1QA0A 2B7DH 4THNH 3E0PB 5EODA 2RA0A 4WH6A 5JDUB 1H8IH 3S9AA 3GCTG 1NFWA 2CMYA 2ZGXH 2TGAA 3ZZDA 3DFJA 1EAXA 5A2MH 3GDUA 3MFJA 2BD7A 1GVKB 1QY6A 4X6OA 3ZZ6A 2D2DA 3T27A 1YLCA 4X1PU 1EB1H 1BRAA 1TNLA 2BDCA 3UPEA 1C5NH 1E37B 3KHVA 4Q7YA 1DFPA 1P2MA 1SLWB 4UONA 1PPGE 2FO9A 3M5OA 4XBCA 3RXEA 3A80A 2QYIA 1TGTA 1Q31A 1ZGIA 3S69A 5CE1A 1S5SA 2ZDLA 5CHAB 5A0BA 1TOCB 3UOPA 1O2TA 2R0LA 2FI4E 4IS5A 1P12E 4CR9A 3EYDA 4XSKU 3RXKA 3RXJA 3RXBA 1SSXA 4Y76A 1C2GA 1ZSJA 3UNSA 1C9TA 3RXOA 1A46H 3URCA 1BZXE 3M3VA 2ZHEH 2J34A 1K2I1 1THRH 2R3UA 2XWBI 4YTAA 4AZ2B 2R0KA 4UD9H 4ESTE 1UTLM 2C8XB 1X7AC 2STBE 1JIRA 1C2DA 2RDLA 4ZXXH 1HAPH 2M5TA 1LPKB 1NU7B 4INHA 3F68H 3PV4A 1AQ7A 1C1NA 1S85A 3TITA 4AORA 2GT8A 5JBCS 2P8OC 4ABBA 2ZWLH 1SQOA 4UFDH 5BPEA 3ATWA 1AVGH 1YKTA 3AVZA 2VWMA 4X2YA 3GCHB 1LPZB 2LNCA 4DIHH 1YBWA 1P11E 1T7CA 3RU4D 5LPFA 5E0GA 3ZVFA 3GCTF 1TNJA 1ANBA 2QAAA 1O5GH 4YOIA 5LPRA 3KL6A 2Y7ZA 2NU1E 4ABEA 2TGTA 1DLEA 1GJBB 4MVNA 1P06A 3RU4T 4ZHLU 4GPGA 1LTOA 4KELA 1Z6EA 3QK1A 4TY7A 1PQ7A 1C2KA 1DY9A 5EXMA 1NY22 1NS3A 3E90B 4HGCA 3UREA 1XUHA 2BDAA 1J9CH 1D3DB 1O2GH 1BMAA 3L3TA 1THSH 1BT7A 3AASA 4D7FA 1V2UT 2ZDAH 1LVBA 1XM1A 3RXDA 1DWEH 1K1NA 1SG8B 1J8AA 1HFDA 1KXCA 2QXJA 1GBAA 4AN7A 2CHAC 3M7TA 1EAWA 4CRDA 1TGSZ 4NWLA 3SV7A 2O8UA 4BAQB 2BDYA 1N8OC 1SOTA 2W26A 4ABJA 1DS2E 1PQ5A 3A88A 1AVXA 1AN1E 2QGRA 2NU4E 1Z71A 5LPEA 1XUIA 4JZEH 3STJA 4NFFA 4NZLA 4NWKA 1TOMH 1AUJA 1ELVA 1O2RA 1QB9A 4CH8B 4K1EA 2WPMS 1QGFA 3D49H 3FP6E 2Q6DA 3MH6A 7ESTE 1IQGA 1C2MA 1A0LA 2F3CE 3FVFB 5AF9H 1ELAA 4LZ1H 4NA9H 4FVDA 1F0SA 4O9VA 4ABHA 2BMGB 2SGAA 3K65B 3TH2H 4A5TS 2V0BA 5ABWA 3PWCA 1O2HA 1Y8TA 1MMJN 1CU1A 3SBKA 3BTTE 2Z9KA 4AX9H 1ESAA 1TQ0B 1A5IA 1MKXH 1GPZA 4FU9A 1G36A 3UTUH 8ESTE 5EU8A 3UIRA 4OS4A 2AYWA 1DVAH 4MTBA 4X0WU 1QBVH 2FYQA 1C2EA 3RXRA 5TCAA 4UFGH 2A4RA 4MPWA 1OYQA 1BTPA 1DITH 2OD3B 1AE8H 2THFB 4NGAH 3LGTA 1EAIA 4I32A 4A1VA 4ZMAH 2B9LA 3W94A 3VEQB 1RRKA 3O8RA 1IQHA 4JK5A 3M61U 1Y3YA 2DE9A 4KP0A 1IQIA 2XTTB 4XE4A 4KGAA 4HTCH 5TJXA 1O2LA 2GV6A 1C1TA 2A45B 2ZGJA 1GG6B 1KXAA 1HRTH 2Z7FE 2ODPA 4O97A 4AB9A 3NXPA 1FY5A 5EQSA 3PO1B 2W5EA 4O3TA 3SGBE 4U32A 2CN0H 1RD3B 3BIVH 2C8WB 2BM2A 2ZC9H 3A8AA 3EA7A 4YT7H 2QXIA 1AKSB 2ANKH 4D7GA 1LVYA 2ZTZA 4J1YA 1TNHA 3M5LA 5E0JA 3SZNA 3ESTA 5GPIB 1YCPM 3ODFA 3RC6A 1EPTB 4WWYA 2HNTC 4NZQA 1NFUA 1MU6B 1GJCB 1KYNA 3SV9A 5E8EH 4MNVA 1VITH 4JYUH 4A6LA 3GY8A 2VWLA 1G30B 2P94A 2ZTXA 1FN8A 2FDAA 3UWJH 1B5GH 2BX3A 5HMAA 1DOJA 2NU2E 3LJOA 1VJAU 2VVCA 1GI8B 4HZHA 2ANYA 3TNTA 1D3TB 3PLBA 1BJUA 4CRCA 3OU0A 4WMFA 2A0QB 5A8YA 3OYPA 1O37A 1BRCE 1HXFH 1QCPA 1XKBC 3EQ0H 1ZPBA 2BD3A 2ILNA 2UUFB 4WY3A 5CHAC 2G00A 1DICA 1MZAA 1QIXB 1FLEE 5EPNA 3U9AH 2XWAA 5C5NA 4R0IA 3EA8A 2C8YB 3A81A 3BTGE 3MNSA 1KSNA 1C1SA 1J17T 1EJMA 4AFUA 4HI3A 1WU1A 2GP9B 4NIVA 3BTHE 3MI4A 1TPSA 2ZEBA 1SVPA 2TBSA 3RMMH 3ZVEA 3K9XB 4PROA 2FOMB 3HKIB 3K2UA 1BB0B 4Y7AA 1O2XA 1SLUB 3BSQA 1ANCA 3OY6U 4NSVA 1GJ6A 3LIWA 4NA8A 2Y6TA 3LPRA 5A0CA 1QBNA 3QGNB 1MQ6A 1YCPH 1TNKA 4Q2KA 2AMQA 2PTCE 3O8BA 5EOKA 1FI8A 3Q00A 2VWOA 4K8BA 1YPGH 4Y71A 1DXWA 4MPXA 4K8YA 2KAIA 2BOHB 1NROH 3P92A 1XUFA 2ULLA 3M7UA 3KCGH 4NA7A 1O3LA 2F9BH 2GX4A 2H6MA 1MTNC 4FUIA 2PKSC 1CT4E 1AWHB 3U1IB 5JPMH 2TIOA 3Q3KA 4E05H 1L1NA 1MKWH 1HJ8A 1INCA 1GBMA 1UHBB 4X6MA 3SHAH 1SLVB 2OBQA 3LU9B 1SQAA 2ZFPH 2R2MB 1MTWA 3ZYDA 2Z9JA 3ZVBA 3SV6A 1YPKH 1ZMJA 2K1QA 4X8VH 1BBRK 3DUXH 2ZA5A 1QL7A 3RM2H 3E16B 1SHHB 1FAXA 1ZLRA 3QX5H 3TVJB 4CRGA 5ETXA 1P3EA 2J38A 1HNEE 1NRNH 1NPMA 1E36B 3ZZ9A 2VGCC 5G4BA 2BY5X 5F8TA 1O5FH 1XUJA 3SJKA 2H9HA 1O3GA 1FDPA 1QRWA 2F83A 2TGDA 3RXHA 3VXEH 3KN2A 1ZJDA 3P8NA 2PSYA 1CQQA 2PUXB 1CHOG 4GSOA 2AGEX 4INKA 1SFQB 1GVLA 1TBQH 2H9TH 3SO3A 1AWFH 1O3EA 1S84A 1OOKB 3BTFE 1W3CA 2BXUH 2HRVA 1LVMA 1C5OH 4DJZB 1C4U2 4LZ4B 2VU8E 1O2KA 3FANA 2FPZA 3T29A 2BDGA 2B0FA 2PTNA 5FPTA 4AFSA 3F9GA 1Z8GA 4XBBA 1PPCE 1IHTH 3AAUA 3F6UH 4YO9A 2OQ5A 3ZZ7A 1SQTA 2BQ6B 2JH0D 3SNCA 3DD2H 1ZPCA 5FAHA 3SJ8A 1MU8B 1DM4B 1O3NA 3LGWA 1UO6A 1VCWA 3P95A 5PTPA 4O3UA 4GVUA 8LPRA 1O2IA 1GJ4H 1QL9A 4GUXA 4FUFA 3ZZCA 1O3BA 1TALA 3SQEE 2JETB 4XFQA 1WTGH 1VCQA 3HGNA 2PKAA 1N6YA 1J15A 2SGFE 2BY7X 2VNTA 1DPOA 1O2JA 1ANDA 1YLDA 4CRAA 3ZZBA 3E6PH 1T32A 2BVSH 2C8ZB 3LGYA 1UMAH 4JZ1A 4YZUA 1O2PA 2UUKB 1CT0E 2ASUB 1DSTA 1O35A 2O8LA 1RIWB 2ZFQH 4ZHAA 3H5CB 2NWNA 4IMZA 1NN6A 3E0NB 2AS9A 2FESH 1C5PA 2FODA 2UUYA 3MOCA 1DX5M 4TY6A 2A5AA 2FOCA 1RXPA 4TWWA 1RS0A 3PMAB 3SJ9A 1FZZA 4A1XA 3TGKE 1DUEA 4NCYA 2ZF0H 5ESBA 1C2FA 1LCYA 1TABE 1ABJH 2TGPZ 2P3FH 4WXIA 3LGVA 1MBQA 2A7HA 4ISOA 2FX4A 2G5NA 1GG6C 1V2LT 1FUJA 2ZIQH 1L1GA 1NFYA 4AFQA 1F0UA 1CHOF 4OS1A 3S9CA 5F03A 2XBVA 3BTDE 4F49A 3RXMA 1SGRE 3R3GB 3PMBB 4KKDA 1BIOA 1DE7H 2P59A 1PPEE 1O36A 2P3TB 2GZ7A 1JBUH 2OLGA 2PHBA 2QIQA 2UWLA 2XC5A 4WH8A 3SU3A 4ABGA 1O3HA 2IN2A 1WYKA 4DOQA 4I8JA 3T28A 1EZSC 2BLWA 1TLDA 1XXFA 5DPAA 5GCHG 3C27B 5DGJA 2VWNA 3EA9A 2FOEA 3M5NA 1QJ7B 1OX1A 3EDXB 2SGEE 4X6PA 1LHEH 4AG1A 1O2ZA 4BAHB 1TAWA 3SV2H 5DP4A 1P04A 1EX3A 1OWIA 1JRTA 1C1RA 1QBOA 2XBXA 2ZHDA 3QTOH 4NIWA 3HK6B 1G37A 1EJNA 5ESTE 1TMUH 1SGIB 1V2VT 1AGJA 1F5RA 1SR5C 3F9HA 1GL0E 5SGAE 3T5FH 1G3DA 2ODQA 1HAVA 2GDDA 4UFEH 3UQOA 1F2SE 1GI9B 4X8UH 1O2SA 1K1PA 4NIXA 5F8ZA 3BTQE 1LMWB 3GYMA 3NWUA 2JKHA 2HNTE 1JMOH 1WCZA 3P70B 1O2MA 4I8HA 1NRRH 1QHRB 3JZ2B 2HVXA 1NESE 2G4UA 2O8MA 3BEIB 2FS9A 1C5XB 2BLVA 1PPZA 2ZU5A 2A7JA 3HGPA 5EPYA 2F91A 3QWCH 1AFQC 4TWYA 3F9EA 1O3MA 2QN5T 4A92A 1YPJH 2GMTC 1TPPA 1QURH 2QC2A 4LOYH 1AMHA 3KNXA 3VB3A 1O38A 1P02A 3E91A 3RXSA 2GCTB 2BYAX 1BITA 3U8OH 1J16A 2ZHFH 3ELAH 3GICB 1EZXC 4IMQA 1MTVA 5IDKA 2PGQB 1LVOA 3MNCA 1F5KU 1V3XA 3RXVA 1IQNA 1SGCA 2GT7A 3URDA 1YF4A 3UQVA 1HLTH 2I6SA 1B0FA 2RG3A 4JZDH 1GBLA 4ZKRU 1C1PA 1VITG 1D3QB 3CS7A 4AGJA 5GCHF 2Z6BD 4X1QU 1GHZA 1QJ1B 4FVBA 1W12U 1A4WH 5HXFA 1Y5BT 7GCHG 4CH2B 4TPIZ 4ZAEA 1C2HA 4MQAA 2ZPRA 2VJ1A 2A4OA 1G9IE 1LKAA 3SJOA 3PTNA 5DKMA 1Y3UA 3V7TA 1GMHG 5BRRE 1Y3VA 1CBWC 1DANH 1GHXH 3GY3A 4I8GA 1BBRE 1TGCA 1WOFA 1BTHH 2G4TA 4AYVB 1PYTD 4BTUB 3ZVDA 2SNVA 1C5WB 4X1SU 5E2PA 2QY0B 4TPYA 3DHKH 5L2YH 4LXBH 5EW1H 2FI5E 1PFXC 1LO6A 1P8VC 1DUAA 4NIYA 1C5RA
chains in the Genus database with same CATH superfamily
3RLYH 1O3FA 1TA2A 1BBRH 1YYY1 2VVVA 3MO9A 3KGPA 3VGCC 1GBCA 3H7TA 1EKBB 1UW7A 3AW1A 1W2KH 1UVPA 2BXTH 2QCYA 2ZDNA 4GHTA 4RT0A 3T25A 4ISLA 1AB9B 4X6NA 3K6YA 3U8TH 1WXRA 1GI4A 5GXPA 1DSUA 1UTPA 2Y7XA 4ABAA 2H1UA 1FNIA 1O5AB 2H5DA 3IWMA 2OQUA 1E34B 1KLIH 3B9FH 1QL8A 3T62A 1KDQA 3MNXA 4DURA 1K1OA 1O3OA 5K0HA 4P00A 1CO7E 1VGCB 1P57B 2W3KA 2FTMA 1HJAB 1TPOA 3ENSB 2G5VA 3A7VA 1EP5A 1OS8A 4WMEA 1DLKB 1EOJA 1V2MT 4DIIH 1GJDB 1QTFA 1LQEA 1MCTA 2LPRA 3OSYA 2R9PA 1C5YB 4D9RA 1V2QT 5JBBS 1K1JA 1GHVH 2AEIH 4DT7B 2OCVB 2EC9H 2JH5D 2H9EH 2CJIA 3RXGA 1BA8B 3RXCA 5E2OA 3CNRA 1P05A 4I8KA 1CGIE 1RIWC 1VITF 1F0RA 1JXPA 2GKVE 1O3DA 1ZHPA 1FJSA 1TA6A 2R2WU 3F2HA 2VIWA 4NG9H 1MAXA 4OGXA 5DN6D 3OTPA 7GCHF 1QQ4A 1O3JA 4WXVA 5T6FA 7LPRA 1S6HA 1TYNA 2VH0A 1H9IE 2QF0A 1A0HB 2P95A 2HPPH 5C20A 1GMHF 3BEFB 3I78A 4K3JA 4K1SA 2XBWA 1TE0A 1P03A 2ZFRH 5JB9S 1WDIA 1IQLA 2L74A 1QB1A 1W11U 1SB1H 4YLUA 2Z9LA 3KQBA 2ZDKA 1C2IA 2Z3CA 1ACBE 3A7YA 1CT2E 2W3IA 5DP7A 3GY6A 2J9NA 5F8XA 1JWTA 3NK8A 2QA9E 3W95A 1P2QA 3TU7H 1YWUA 5L2ZH 1ELDE 4FUBA 2ZCLP 2BTCE 2ZO3H 3UR6A 4YESB 1SFIA 1WV7H 4YT6H 5FPSA 1FIZA 1OWKA 4IC6A 3ATIA 4XOJA 4B71A 3U1JB 3QN7A 2OINA 1P9SA 4INLA 1YPHC 4F4OC 1CA0B 1GBKA 4AB8A 2ZP0H 1JRSA 1UVTH 3QGJA 2P3UB 1UK4A 4K2YA 2DUCA 3ZV9A 3ZZAA 1JIMA 1NC6A 1SI5H 1P2KA 4MNYA 8GCHG 3VB5A 3BG4C 1A7SA 3O8DA 3TH3H 4R8TB 1DWCH 2PW8H 3V13A 2XNDD 4BTIB 2ALVA 4ASHA 1ELFA 4FUHA 3SU1A 1KLTA 1SGNE 1ZSLA 2BDIA 3TIUA 4WMDA 5T6GA 1Y5UT 3EAJA 3DFLA 1C5ZB 2F9OA 1FONA 3PTBA 2A2XH 2XBYA 1BTUA 2CF9H 1O3PB 3QUMP 1ETSH 2FOBA 1KMHB 1D6RA 3Q3YA 3HKJB 3RUOA 1ZGVA 2WPIS 4K69A 1D3PB 5C2ZA 2KCYA 3PRBA 4BAKB 1C1VH 3FAOA 1MD7A 3BTKE 1TX7A 1XMNB 1IQFA 3G01A 4CHAB 2TRMA 3SUDA 5CHBA 1FY3A 1SLXB 5AVDA 2ANMH 2GCTC 1NBMD 1Z8IB 4GCHG 1T31A 2HPQH 2ZNKH 5LH8A 1OWHA 2ZKSA 2XNIA 4YOGA 1T8MA 4X2VA 2J2UA 2Z9IA 4DG4A 4X1NU 1GHYH 2NU3E 1G2LA 1CHGA 1HDTH 2A4GA 1JOUB 4K1TA 5GNDA 2ZU2A 1W0KD 5IK2D 4ISNA 1UTQA 1OP2A 2OC1A 2BD5A 1QNJA 1C1UH 1TRNA 3MU5A 1IQEA 2PGBB 2PWXA 1QJ6B 1BTZA 3L33A 4I31A 1MCVA 3NUMA 1TRMA 2BY9X 4XBDA 1UTMA 3I29A 3DSGA 3MTYA 2BZ6H 3LONA 8GCHF 2BY8X 3FFGA 1GBBA 1ZHRA 3VPKA 4CREA 2QE7D 2V3OH 1DY8A 3LDXH 1ARBA 4JZFH 4BAOB 4KTUA 4JYTA 1AU8A 1NU9A 1C5TA 1XXDA 1F0TA 2OC8A 5C5OA 1QRZA 4AFZA 1MQ5A 3PB1E 2SFAA 3BIUH 1SOZA 3MQKC 2JJ2D 1EXFA 4ZCNA 3SZEA 2VB0A 3GCHC 1TB6H 3HATH 3VXFH 2Z94A 1BTXA 4FUEA 1C9PA 1Z1JA 1L4ZA 4I86A 1O2UA 3M37A 1H8DH 1BMLA 3K6ZA 4KTSA 6LPRA 1AO5A 2J5UA 1NTPA 5EQRA 1COWD 1H9LB 1VR1H 5C1XA 2BVXH 2G55A 3CS0A 4BOHA 3DT0H 1ABIH 2GDEH 1YPEH 3OAAD 1LDTT 1PPBH 2C4FH 4Z0KA 4E7NA 2O8TA 1S0RA 2GGVB 5FCRA 2A5IA 3MHWU 2VIVA 3KQEA 4FUCA 1OXGA 5DP3A 2ZZUH 1GJ9B 1LQDB 2VIQA 1GL1A 2A5KA 1SGEE 1O32A 3Q3XA 3U8RH 2PR3A 4GCHF 2Y5FA 3S9BA 1WQSA 2J4IA 4Y8XA 3NKKA 4RN6A 5L6NH 1UVSH 3SU0A 1QRXA 3P8FA 5GJ4B 1PYTC 1WSSH 4RKOB 2KAIB 4OGYA 5KEDA 1QR3E 2AMDA 1P3CA 1TGBA 1HPGA 1B7XB 5DK1A 1PPFE 2FM2A 1KXEA 2XCFA 1ZPZA 1BUIA 1XUGA 1K1LA 2WPKS 3LT3A 2ZPQA 1BTYA 1GGDB 1G3CA 2EEKA 3VFEA 1TNGA 1UCYK 1GDNA 2GVFA 1V2TT 2P8OB 3GOVB 1MZDA 3D65E 4CBNA 1NT1A 3MMGA 1K0HA 2AGIX 1XUKA 2GJGA 2KM0A 5C0TA 3NPSA 1GDQA 2AHME 1BRBE 2K8IA 1BCUH 1F5LA 3FZDA 1HAOH 2ANWA 3A84A 1G3EA 2RA3A 1O3AA 1GHBG 1G3BA 1L1JA 4MPUA 3V0XA 3SNEA 3PMJA 1CSOE 1UTJA 5HKKD 4ABFA 1VJ9U 2C3SA 1E35B 4Y79A 4H6SB 3UAIC 3RXLA 3EGKH 1E1QD 4I8LA 1AFEH 3CENA 4I33A 2HNTF 1LHGH 1FY4A 3PM3A 2FWWA 4FXGH 2Y82A 1G2MA 1N6XA 1CA0C 3C1KA 2XC0A 3QDZB 2WUBA 2P93A 3RXQA 1HAXB 1NZQH 1N1LA 1SMFE 1AI8H 3S0NA 1C1OA 2IPHA 4UDWH 2BHGA 1NRPH 6CHAB 4H42U 1BMMH 3JZ1B 2GCHG 1YM0A 2CHAB 1CVWH 1ETRH 1ZHMA 3GCNA 3GY5A 1GBEA 1THPB 2ZG0H 4K5ZA 4ZKSU 1V2WT 1N8OB 1LHFH 2ZU1A 4ACBA 1ZZZA 1OSSA 2O9QA 2FYRA 2QF5A 2B5TB 1Q3XA 3TPIZ 3A8BA 3PO1C 1EAUA 5EQQA 1PJPA 3GY2A 2A31A 2R3YA 3KYGA 2QXHA 4A7IB 4UE7H 4B73A 1GI7B 4IN2A 1IQKA 1C4V2 5JYIA 1EP6A 3MU4A 5DJ7A 3NZIA 3GCOA 1C2LA 1GBTA 1OWJA 1DDJA 3SORA 1Z7KA 1HYLA 1RFNA 3M36A 4BNRA 4Q80A 4X8TH 4IC5A 4LK4A 5EGMA 1EPTC 1IOEA 3ZZ3A 1K1IA 3QTVH 4X2XA 2ZGBH 1AD8H 1ARCA 1SGTA 3WWFA 1O34A 3BG8A 3RP2A 4Z1MD 4CHAC 2ZTYA 3EE7A 4I7YH 3DA9B 2Z9GA 6GCHG 7KMEH 1HJ9A 5FX5A 1UVUH 1ZSKA 4MG3A 2YNAA 3E1XB 2OP9A 5J4SA 1GHBF 3OY5U 1AZ8A 1HIAB 3LKWA 4ZKOU 5L30H 2KX4A 2ZQ2A 3AW0A 3OTJE 3SNDA 4GLYA 2AGGX 4KTCA 3U98H 2BD9A 4ISIH 4IN1A 2ZQ1A 4BANB 1Z8RA 1FV9A 3KQ5A 4WJG2 1HGTH 2LELA 3WW7A 2NU0E 4AG2A 2VIDA 1ZOMA 4RKJB 1GJ7B 2PSXA 1P9UA 2PFEA 4FETA 4ZH8A 3SU6A 1C2JA 3SGAE 2WV9A 4VGCB 1O5DH 2ZU3A 3MH5A 2EI8A 3D23A 5FPYA 5A0AE 3RMNH 1K9OE 5C94A 1A3BH 1S81A 4FUGA 1ETTH 3BEUA 2GCHF 1SQRA 2J98A 1FXYA 4ABDA 5JBAS 1UTNA 3SN8A 4DW2U 1L2EA 1RGQA 2HLDD 1W0YH 3RXTA 1IQMA 1P2IA 3KQDA 1FPCH 2ODYB 5HGGA 4TT3D 5H4IB 1W13U 1DT2A 2K0QA 1H8HD 3MNBA 3KIDU 4X8SH 1HAVB 1W8BH 1YPLH 3P8GA 4AOQA 1HCGA 3NCLA 1EASA 1ANEA 5C67A 2BDBA 4H4FA 2KCAA 3WY8A 2ZHWH 1ELCA 2XCNA 1UTOA 3SNBA 1GI5A 4IW4E 3TGIE 1Z8JB 1PQAA 2V3HH 2AMPA 3TJNA 1O0DH 1QQUA 2BZAA 1ZTKA 3SU4A 2BQWB 2GZ9A 3QZRA 2ZDVH 1WBGB 3IITA 1V2ST 3SU5A 1FN6A 3RMLH 1TNIA 3H7OA 2WV4A 2GV7A 5DG6A 1YCPK 2V6NA 1ESBA 1P2OA 5T1VA 6GCHF 1C5SA 1O2WA 1SHYA 1TX8A 3PMHB 3KYFA 4B2AA 2XC4A 1A3EH 2ALPA 2ZGCA 4SGAE 3ZVCA 2G8TA 2XYAA 1WAYB 2O8WA 5HYOA 4B1TA 1BTWA 2FI3E 1KTSB 1OYTH 1A0JA 3RXIA 3PLKA 1G32B 3SHCH 3N7EA 1MKWK 5FHTA 3A89A 5JB8S 1LHDH 3PROA 3ZZ5A 2FLRH 3A87A 1BJVA 3H09A 2VVUA 4D76A 3FZZA 2G52A 2JJ1D 5C17A 5DP5A 1RTFB 3E8LA 4OS6A 1HBTH 2UWPA 1GGDC 1EATA 4TYDA 3B8JA 3GY7A 2AFQB 5A09A 1AZZA 3I77A 1HAZB 3ZYEA 4XDEA 1LPGB 1SGQE 3RXPA 2BDHA 3TK9A 3O8CA 1IQJA 3SU2A 2F9VA 1MAYA 2W7SA 2EI7A 3LC5A 1FAKH 1ORFA 1O2QA 4ZUHA 1GI0A 2CF8H 1A2CH 1MTNB 3KQCA 3P8OA 3R0FA 1UCYE 3MYWA 2PKSB 3ITIA 4FUDA 3T2NA 3TK6A 4Y6DA 4AGKA 1OPHB 1O5CB 1O5EH 2PP6A 1F7ZA 1T4UH 1ELGA 1FQ3A 3SNAA 1C5UA 2JETC 3HPTB 2A2QH 3GY4A 1KXDA 4CRFA 3RXAA 1TMBH 1EUFA 3RU4E 1OP8A 4MDSA 1UCYH 1FPHH 2WPJS 2FEQH 1V2KT 1MUEB 2XXLA 4X2WA 4B76A 3A82A 1C1WH 2OK5A 2VGCB 5AFZH 1OHHD 1GMCG 2P16A 2A1DB 1SGFA 1WQVH 3TLOA 3MU8A 4FU7A 1WTHD 4Y0YE 2AH4X 1H1BA 1EZQA 3RLWH 3KF2A 6CHAC 1FY8E 1GI2A 3F2FA 1KXBA 3P17H 1YGCH 2W7UA 1KDQB 2OC0A 5HM2A 1BQYA 2V35A 3RDZA 4B75A 1MH0A 1B0EA 2A32A 2FS8A 2CGAA 3QZQA 2WPDD 2Z3DA 1GBJA 1KTTB 1SKYE 1TQ7B 3BTEE 1YPMH 2PUQH 3M7QA 2BD8A 3F1SB 3GYLB 3T26A 1XVMA 1QA7A 1RJXB 2WHXA 1C1MA 1D6WA 2AIQA 4ISHH 3STIA 3WWBA 5LGOA 1T4VH 2VH6A 2FOAA 2Y5HA 1EQ9A 1GCTB 2ZDMA 9LPRA 2YNBA 3LC3A 2FMJA 4UFFH 2BD4A 1P2JA 3TJVA 1MTSA 1NRQH 3Q77A 1C1QA 1Y59T 2BY6X 3F0PA 1CE5A 3ATLA 4D8NA 3SOSA 5E0HA 2GZ8A 1K22H 1V6DA 1ELTA 1OP0A 1VCPA 4YM9A 4ASUD 2SGQE 3UWIA 2XRCA 3F9FA 1NFXA 1O3IA 3A7WA 1AKSA 3RC5A 2BQ7B 1LKBA 1O33A 4MNXA 2OUAA 3UOUA 1O3KA 3MH7A 1IAUA 2UWOA 3ATMA 1TRYA 1GI6A 2Q1JA 4IGDA 4U2WA 3BF6H 3MO6A 1EPTA 1ZMLA 5EJ1A 3SW2B 1GBDA 2CV3A 2FTLE 1A1RA 1GHWH 1U6QA 1GDUA 5J4QA 4E7RG 1EJAA 8KME2 1BHXF 2OBOA 1O2NA 4QT8C 3A7XA 1V2OT 2F9UA 2F9NA 3BTWE 1E0FD 2YMSB 3PRDA 1Z1IA 1GHAG 2B8OH 1P09A 1S82A 2BVRH 1O31A 4VGCC 1GMCF 4MPVA 3U69H 1UJ1A 1S6FA 3S7HB 1RTLA 2AERH 2FP7B 2FIRH 4Q7ZA 2D26C 5JBTA 2C90B 3M5MA 1TPAE 1KLJH 1L0ZA 2Y5GA 1CGJE 4OS2A 4Y0ZE 1ZRKA 1TGNA 3ZZ8A 1PPHE 3N99A 3PLPA 1NO9H 3A83A 1L4DA 2LP6A 2QXGA 3LOXA 1GBHA 4WVPE 1S0QA 1Q2WA 1TONA 4CBOA 1BDAA 1E38B 3M35A 4M9FA 1KXFA 1GI1A 1TMTH 1OWDA 4IBLH 4M7GA 2HOBA 2ZHQH 2EY4C 4YLQH 3OFND 2H2ZA 5FCKA 2YOLA 3LGUA 3L6PA 3SI3H 5I46H 4MLFB 3SUEA 4DVAU 1HUTH 2AIPA 4Y10E 3SJIA 4FUJA 1AY6H 1NRSH 1VKYA 2EI6A 4ZKNU 3RMOH 1W7GH 3RC4A 5F6MA 1D9IA 1RTKA 1MD8A 4J2YB 1ID5H 1K28D 3LH1A 1W0JD 3V3MA 2G51A 2BLOA 1T8OA 1BOQA 1P2NA 2WYGA 5FBIA 2WUCA 4U01A 1BRUP 9ESTA 1HAIH 1ELBA 1W0ZU 1GJAB 2OXSA 3UNRA 4BXWA 3PWBA 2STAE 1BMNH 1DWBH 1NBME 3QO6A 4SGBE 1ELEE 4CRBA 5DP9A 1W7XH 2SNWA 4A1TA 1UHBA 3SV8A 1C5QA 1S83A 1ZTLA 1SGPE 1AE5A 1TWXB 3TJOA 3TNSA 2Q6FA 2G81E 5FX6A 2SGDE 1O2YA 2BLQA 2QF3A 3VB6A 1AFQB 2VIOA 4B74A 2PLXA 3PYHA 1EZUC 1ZYOA 4JYVH 2ZFTA 3QLPH 1GHAF 1AHTH 1K21H 1GBFA 2ZPSA 2GMTB 3M3TA 2ZECA 4D9QA 1TFXA 5DO4H 2F43B 3VB7A 1VZQH 5B6OA 4WF8A 1FMGA 2XW9A 2FOFA 1FIWA 1W14U 1XVOA 2HWLB 3UFAA 1SC8U 3SUGA 1W10U 5TCCA 1AB9C 4OS5A 3RXFA 4ACAA 1MTUA 4H6TA 3CP7A 4DY7B 1KIGH 2VIPA 2BD2A 1IHSH 5GWZA 2WYJA 4B2CA 1YC0A 3ODDA 2JIZD 2BOKA 3ZVGA 1T8NA 3VB4A 2PV9B 5A8ZA 5C1UA 2OC7A 1VGCC 1XX9A 3LH3A 1BHXB 4JK6A 4RI0A 4RSPA 1HJAC 4B2BA 5HM9A 1P10A 3SGQE 4ZXYH 1TX6A 1J14A 2RCEA 1C5LH 3HK3B 3BN9A 3A7TA 2OTVA 1O2VA 1P0SH 1WUNH 4XRNA 2J94A 2VINA 1AVWA 4MNWA 3TK5A 5GDSH 5DP8A 1UK3A 1KY9A 2C93B 4BXSA 2WSSD 2H5CA 2TPIZ 1CBWB 3SQHE 1AIXH 4K60A 4NSYA 4X1RU 2FLBH 1O2OA 1ZJKA 5CMXH 4UEHH 2JH6D 5EW2H 1A5GH 3MH4A 4P02A 3ZVAA 1C4Y2 2J92A 5FBEA 3BV9B 1A5HA 1H9HE 4DGJA 5T6DA 4JZIA 1ZTJA 4GHQA 1FY1A 2Z3EA 4Q7XA 2HLCA 3A7ZA 2HGTH 2CXVA 2Q6GA 4E06H 2KR7A 3OX7U 3VGCB 2ESTE 2I6QA 1Z6JH 1OKXA 1QB6A 4AC9A 3FP8E 3B23B 4JCNA 3UNQA 3MU0A 5AFYH 2UUJB 4Y11E 2SGPE 2D1JA 2D8WA 2Y81A 3S7KB 4Y8ZA 3AK5A 4ABIA 1GCTC 5B6LA 1DXPA 3ATKA 1OWEA 3GDVA 1HV7A 2KFWA 3LGIA 3GISB 1TBZH 1GJ8B 1GCDA 4YOJA 4BTTB 1GMDG 2A7CA 2FZZA 4BAMB 1C5MD 1SL3A 2IOTA 1LHCH 5IYTA 5A8XA 1DWDH 1UTKA 2A4QA 6ESTA 1UVOA 1UK2A 5EXLA 1Y3XA 2IJOB 2WV5A 1QFKH 1SBWA 1XKAC 3BTME 5I25A 4AYYB 4F48B 1HXEH 2FXRA 1TIOA 3IG6B 1GI3A 3UY9A 4ZHMU 4CR5A 5DP6A 1SPJA 3MWIU 4HG6A 2ZI2H 4ZROA 1MBMA 5C1YA 3RM0H 3Q76A 1GVZA 5C3NA 2ZFFH 3TGJE 3P6ZB 1MKXK 3KEEA 5EXNA 3N7OA 1T8LA 2KZ4A 2Y80A 3GS9A 1O5BB 1E1RD 2W6JD 3MU1A 2GD4B 3UR9A 3V12A 4GAWA 2J97A 1HAGE 5EG4A 4Y8YA 2PKAB 2QV1A 5AHGH 1YPHE 1Y5AT 1GWAA 1EB2A 4Q63A 3A8DA 1HIAA 3DSOA 3F2GA 3TJUA 1F92A 1NM6A 1P01A 4HFPB 2FOGA 2ZCKP 2WINI 1D4PB 3M3SA 2WPHS 1YLNA 2BX4A 3W1EA 1HB0B 4OS7A 4NFEA 4FU8A 1A61H 2J95A 4O03A 1SGFG 3TH4H 2WPLS 2FOHA 2HALA 3AAVA 3UUZA 1C5VA 2ZCHP 3EE0B 2GTBA 1AUTC 3ZV8A 4Y7BA 1ZRBA 4JMYA 1SGYE 3LJJA 1ZR0A 3SUFA 1HAHH 3FP7E 1ESTA 1O39A 2ZFSA 5F53A 2EA3A 1HAYB 1CGHA 1GBIA 3A85A 5FXLA 2DE8A 1V2NT 1V2RT 3N7DA 2FX6A 1TBRH 3RXUA 3ZZ4A 4Z6AH 4DCDA 2ZU4A 5FL7D 3BG4B 1GMDF 3A86A 2ZGHA 1O3CA 3A8CA 4U30A 3SI4H 1K1MA 1V2JT 3MO3A 1PQ8A 1SGDE 5GIBA 3D62A 5KECA 3GDSA 1H4WA 1V2PT 2BB4A 3E3TA 4Q4LA 2WZQA 1YP9A 1Y3WA 1EOLA 1O30A 2F9PA 1CA8B 1M9UA 4B6FA 5T3HA 5K7RA 1ZMNA 1GJ5H 1QA0A 2B7DH 4THNH 3E0PB 5EODA 2RA0A 4WH6A 2V3MA 1H8IH 3S9AA 5JDUB 3GCTG 1NFWA 2CMYA 2ZGXH 2TGAA 3ZZDA 3DFJA 1EAXA 5A2MH 3GDUA 3MFJA 2BD7A 1GVKB 1QY6A 4X6OA 3ZZ6A 2D2DA 3T27A 1YLCA 4X1PU 1EB1H 1BRAA 1TNLA 2BDCA 3UPEA 1C5NH 1E37B 3KHVA 4Q7YA 1DFPA 1P2MA 1SLWB 4UONA 1PPGE 2FO9A 3M5OA 4XBCA 3RXEA 3A80A 2QYIA 1H8ED 1TGTA 1Q31A 1ZGIA 3S69A 5CE1A 1S5SA 2ZDLA 5CHAB 5A0BA 1TOCB 3UOPA 1O2TA 2R0LA 2FI4E 4IS5A 1P12E 4CR9A 3EYDA 4XSKU 2J98B 3RXKA 3RXJA 3RXBA 1SSXA 4Y76A 1C2GA 1ZSJA 3UNSA 1C9TA 3RXOA 1A46H 3URCA 1BZXE 3M3VA 2ZHEH 2J34A 1K2I1 1THRH 2R3UA 2XWBI 4YTAA 4AZ2B 2R0KA 3F0OA 4UD9H 4ESTE 4XD7D 1UTLM 1MABB 2C8XB 1X7AC 2STBE 1JIRA 1C2DA 2RDLA 4ZXXH 1HAPH 2M5TA 1LPKB 1NU7B 4INHA 3F68H 3PV4A 1AQ7A 1C1NA 1S85A 3TITA 1BMFD 4AORA 2GT8A 5JBCS 2P8OC 4ABBA 2ZWLH 1SQOA 4UFDH 5BPEA 2HVYB 3ATWA 1AVGH 1YKTA 3AVZA 2VWMA 4X2YA 3GCHB 1LPZB 2LNCA 4DIHH 1YBWA 1P11E 1T7CA 3RU4D 5LPFA 5E0GA 3ZVFA 3GCTF 1TNJA 1ANBA 2QAAA 1O5GH 4YOIA 5LPRA 3KL6A 2Y7ZA 2NU1E 4ABEA 2TGTA 1DLEA 1GJBB 4MVNA 1P06A 3RU4T 2IPQX 4ZHLU 4GPGA 1LTOA 4KELA 1Z6EA 3QK1A 4TY7A 1PQ7A 1C2KA 1DY9A 5EXMA 1NY22 1NS3A 3E90B 4HGCA 2QF4A 4OM9A 3UREA 1XUHA 2BDAA 1J9CH 1D3DB 1O2GH 1BMAA 3L3TA 1THSH 1BT7A 3AASA 4D7FA 1V2UT 2ZDAH 2F4LA 1LVBA 1XM1A 3RXDA 1DWEH 1K1NA 1SG8B 1J8AA 1HFDA 1KXCA 2QXJA 1GBAA 4AN7A 3ZIAD 2CHAC 3M7TA 1EAWA 4CRDA 1TGSZ 4NWLA 3SV7A 2O8UA 4BAQB 2BDYA 1N8OC 1SOTA 2W26A 4ABJA 1DS2E 1PQ5A 3A88A 1AVXA 1AN1E 2QGRA 2NU4E 1Z71A 5LPEA 1XUIA 2KCPA 4JZEH 3STJA 4NFFA 4NZLA 4NWKA 1TOMH 1AUJA 1ELVA 1O2RA 1QB9A 2YMSD 4K1EA 2WPMS 1QGFA 3D49H 3FP6E 4CH8B 2Q6DA 3MH6A 7ESTE 3PV5A 1IQGA 1C2MA 1A0LA 2F3CE 3FVFB 5AF9H 1ELAA 4LZ1H 4NA9H 4FVDA 1F0SA 4O9VA 4ABHA 2BMGB 3VG8A 2SGAA 3K65B 3TH2H 4A5TS 2V0BA 5ABWA 3PWCA 1O2HA 1Y8TA 1MMJN 2L6OA 1E79D 1CU1A 3SBKA 3BTTE 2Z9KA 4AX9H 1ESAA 1TQ0B 1A5IA 1MKXH 1GPZA 4FU9A 1G36A 3UTUH 8ESTE 5EU8A 3OEED 3UIRA 4OS4A 2AYWA 1DVAH 4MTBA 4X0WU 1QBVH 2FYQA 1C2EA 3RXRA 5TCAA 4UFGH 2A4RA 4MPWA 2RDEA 1OYQA 1BTPA 1DITH 2OD3B 1AE8H 2THFB 4NGAH 3LGTA 1EAIA 4I32A 4A1VA 4ZMAH 2B9LA 3W94A 3VEQB 1RRKA 3O8RA 1IQHA 4JK5A 3M61U 1Y3YA 2DE9A 1YY3A 4KP0A 1IQIA 2XTTB 4DT4A 4XE4A 4KGAA 4HTCH 5TJXA 1O2LA 2GV6A 1C1TA 2A45B 2ZGJA 1GG6B 1KXAA 2W6ID 1HRTH 2Z7FE 2ODPA 4O97A 4AB9A 3NXPA 1FY5A 5EQSA 3PO1B 2W5EA 4O3TA 3SGBE 4U32A 2CN0H 1RD3B 3BIVH 2C8WB 2BM2A 2ZC9H 3A8AA 3EA7A 4YT7H 2QXIA 1AKSB 2ANKH 4D7GA 1LVYA 2ZTZA 4J1YA 1TNHA 3M5LA 5E0JA 3SZNA 3ESTA 5GPIB 1YCPM 3ODFA 3RC6A 1EPTB 4WWYA 2HNTC 4NZQA 3OEHD 1NFUA 1MU6B 2IJD1 1GJCB 1KYNA 3SV9A 5E8EH 4MNVA 1VITH 4JYUH 4A6LA 3GY8A 2VWLA 1G30B 2P94A 2ZTXA 1FN8A 2FDAA 3UWJH 1B5GH 2BX3A 5EJLA 5HMAA 1DOJA 2NU2E 3LJOA 1VJAU 2VVCA 1GI8B 4HZHA 2ANYA 3TNTA 1D3TB 3PLBA 1BJUA 4CRCA 3OU0A 4WMFA 2A0QB 5A8YA 3OYPA 1O37A 1BRCE 1HXFH 1QCPA 1XKBC 3EQ0H 1ZPBA 2BD3A 2ILNA 2UUFB 4WY3A 5CHAC 2G00A 1DICA 1MZAA 1QIXB 1FLEE 5EPNA 3U9AH 2XWAA 5C5NA 4R0IA 3EA8A 2C8YB 3A81A 3DSPA 3BTGE 3MNSA 1KSNA 1C1SA 1J17T 1EJMA 4AFUA 4HI3A 1WU1A 2GP9B 4NIVA 3BTHE 3MI4A 1TPSA 2ZEBA 1SVPA 2TBSA 3RMMH 3ZVEA 5C0UA 4YXWD 3K9XB 4PROA 2FOMB 3FO8D 3HKIB 3K2UA 5DSFA 1BB0B 4Y7AA 1O2XA 1SLUB 3BSQA 1ANCA 3OY6U 4NSVA 1GJ6A 3LIWA 4NA8A 2Y6TA 3LPRA 5A0CA 1QBNA 3SYJA 3QGNB 1MQ6A 1YCPH 1TNKA 4Q2KA 2AMQA 2PTCE 3O8BA 5EOKA 1FI8A 3Q00A 2VWOA 4K8BA 1YPGH 4Y71A 4TSFD 1DXWA 4MPXA 4K8YA 2KAIA 2BOHB 1NROH 3P92A 1XUFA 2ULLA 3M7UA 3KCGH 4NA7A 1O3LA 2F9BH 2GX4A 2H6MA 1MTNC 4FUIA 2PKSC 1CT4E 1AWHB 3U1IB 5JPMH 2TIOA 3Q3KA 4E05H 1L1NA 1MKWH 1HJ8A 1INCA 1GBMA 5CDFE 1UHBB 4X6MA 3SHAH 2M2AA 1SLVB 2OBQA 3LU9B 1SQAA 2ZFPH 2R2MB 1MTWA 3ZYDA 2Z9JA 3ZVBA 3SV6A 1YPKH 1ZMJA 2K1QA 4X8VH 1BBRK 3DUXH 2ZA5A 1QL7A 3RM2H 3E16B 1SHHB 2RFKC 1FAXA 1ZLRA 3QX5H 3TVJB 4CRGA 5ETXA 1P3EA 2J38A 1HNEE 1NRNH 5HIYA 1NPMA 1E36B 3ZZ9A 2CK3D 2VGCC 5G4BA 2BY5X 5F8TA 1O5FH 1XUJA 3SJKA 2H9HA 1O3GA 1FDPA 1QRWA 2F83A 2TGDA 3RXHA 3VXEH 3KN2A 1ZJDA 3P8NA 2PSYA 1CQQA 2PUXB 1CHOG 4GSOA 2AGEX 4INKA 1SFQB 1GVLA 1TBQH 2H9TH 3SO3A 1AWFH 1O3EA 1EFRD 1OOKB 1S84A 3BTFE 2KCOA 1W3CA 2BXUH 2HRVA 1LVMA 1C5OH 4DJZB 1C4U2 4LZ4B 2VU8E 1O2KA 3FANA 2FPZA 3T29A 2BDGA 2B0FA 2PTNA 5FPTA 4AFSA 3F9GA 1Z8GA 4XBBA 1PPCE 1IHTH 3AAUA 3F6UH 4YO9A 2OQ5A 3ZZ7A 1SQTA 2BQ6B 1QZ8A 2JH0D 3SNCA 3DD2H 1ZPCA 5FAHA 3SJ8A 1MU8B 1DM4B 1O3NA 3LGWA 1UO6A 1VCWA 3P95A 5PTPA 4O3UA 4GVUA 8LPRA 1O2IA 1GJ4H 1QL9A 4GUXA 4FUFA 3ZZCA 1O3BA 1TALA 3SQEE 2JETB 4XFQA 1WTGH 1VCQA 3HGNA 2PKAA 1N6YA 1J15A 2SGFE 2BY7X 2VNTA 1DPOA 1O2JA 1ANDA 1YLDA 4CRAA 3ZZBA 3E6PH 1T32A 2BVSH 2C8ZB 3LGYA 1UMAH 4JZ1A 4YZUA 1O2PA 2UUKB 1CT0E 2ASUB 1DSTA 1O35A 2O8LA 1RIWB 2ZFQH 4ZHAA 3H5CB 2NWNA 4IMZA 1NN6A 3E0NB 2AS9A 2FESH 1C5PA 2FODA 4B6EA 2UUYA 3MOCA 1DX5M 4TY6A 2A5AA 2FOCA 1RXPA 4TWWA 1RS0A 3PMAB 3SJ9A 1FZZA 4A1XA 3TGKE 1DUEA 4NCYA 3OE7D 2JDID 2ZF0H 5ESBA 1C2FA 1LCYA 2YMSC 1TABE 1ABJH 2TGPZ 2P3FH 2EQNA 4WXIA 3LGVA 1MBQA 2A7HA 4ISOA 2FX4A 1FX0B 1GG6C 2G5NA 1V2LT 1FUJA 2ZIQH 1L1GA 1NFYA 4AFQA 1F0UA 1CHOF 4OS1A 3S9CA 5F03A 2XBVA 3BTDE 4F49A 3RXMA 1SGRE 3R3GB 3PMBB 4KKDA 1BIOA 1DE7H 2P59A 1PPEE 1O36A 2P3TB 2GZ7A 1JBUH 2OLGA 2PHBA 2QIQA 2UWLA 2XC5A 4WH8A 3SU3A 4ABGA 1O3HA 2IN2A 1WYKA 4DOQA 4I8JA 3T28A 1EZSC 2BLWA 1TLDA 1XXFA 5DPAA 5GCHG 3C27B 5DGJA 2VWNA 2V7QD 3EA9A 2FOEA 3M5NA 1QJ7B 1OX1A 3EDXB 2SGEE 4X6PA 1LHEH 3FN8A 4AG1A 1O2ZA 4BAHB 1TAWA 3UB0A 3SV2H 5DP4A 1P04A 3U28C 1EX3A 1OWIA 1JRTA 1C1RA 1QBOA 2XBXA 2ZHDA 3QTOH 4NIWA 3HK6B 1G37A 1EJNA 5ESTE 1TMUH 1SGIB 1V2VT 1AGJA 1F5RA 1SR5C 3F9HA 1GL0E 5SGAE 3T5FH 1G3DA 2ODQA 1HAVA 2GDDA 4UFEH 3UQOA 1F2SE 1GI9B 4X8UH 1O2SA 1K1PA 4FOUC 4NIXA 5F8ZA 3BTQE 1LMWB 3GYMA 3NWUA 2JKHA 2HNTE 1JMOH 1WCZA 3P70B 1O2MA 4I8HA 1NRRH 1QHRB 3JZ2B 2HVXA 1NESE 2G4UA 2O8MA 3BEIB 2FS9A 1C5XB 2BLVA 3F3BA 1PPZA 2ZU5A 2A7JA 3HGPA 5EPYA 2F91A 3QWCH 1AFQC 5EIYA 3FKSD 4TWYA 3F9EA 1O3MA 2QN5T 4A92A 1YPJH 2GMTC 1TPPA 1QURH 2QC2A 4LOYH 1AMHA 3KNXA 3VB3A 1O38A 1P02A 3E91A 3RXSA 2GCTB 2BYAX 1BITA 3U8OH 1J16A 5KGOA 2VBCA 2ZHFH 3ELAH 3GICB 1EZXC 4IMQA 1MTVA 5IDKA 2PGQB 1LVOA 3MNCA 1F5KU 1V3XA 3RXVA 3NRLA 1IQNA 1SGCA 3FOAA 2GT7A 3URDA 1YF4A 3UQVA 1HLTH 2I6SA 1B0FA 2RG3A 4JZDH 3DCLA 1GBLA 4ZKRU 4RT1A 1C1PA 1VITG 1D3QB 3CS7A 4AGJA 2XOKD 5GCHF 2Z6BD 4X1QU 1GHZA 1QJ1B 5EJZA 4FVBA 1W12U 4F55A 1A4WH 5HXFA 1Y5BT 7GCHG 4CH2B 4TPIZ 4ZAEA 1C2HA 4MQAA 2ZPRA 3PV2A 2VJ1A 2A4OA 1G9IE 1LKAA 3SJOA 3PTNA 5DKMA 1Y3UA 3V7TA 1GMHG 1S6LA 5BRRE 1Y3VA 1CBWC 1DANH 1GHXH 3GY3A 4I8GA 1BBRE 1TGCA 1WOFA 1BTHH 2G4TA 4AYVB 1PYTD 4BTUB 3ZVDA 2SNVA 1C5WB 4X1SU 5E2PA 2QY0B 4TPYA 5HIZA 3DHKH 5L2YH 4LXBH 5EW1H 2FI5E 1PFXC 1LO6A 1P8VC 1DUAA 4NIYA 1C5RA
chains in the Genus database with same CATH topology
3RLYH 1O3FA 1TA2A 1BBRH 1YYY1 2VVVA 3MO9A 3KGPA 3VGCC 1GBCA 3H7TA 1EKBB 3AW1A 1W2KH 1UVPA 2BXTH 2QCYA 2ZDNA 4GHTA 3T25A 4ISLA 1AB9B 4X6NA 3K6YA 3U8TH 1GI4A 5GXPA 1DSUA 1UTPA 2Y7XA 4ABAA 2H1UA 1FNIA 1O5AB 2H5DA 3IWMA 2OQUA 1E34B 1KLIH 3B9FH 1QL8A 3T62A 1KDQA 3MNXA 4DURA 1K1OA 1O3OA 5K0HA 1CO7E 1VGCB 1P57B 2W3KA 2FTMA 1HJAB 1TPOA 3ENSB 2G5VA 3A7VA 1EP5A 1OS8A 4WMEA 1DLKB 1EOJA 1V2MT 4DIIH 1GJDB 1QTFA 1LQEA 1MCTA 2LPRA 3OSYA 2R9PA 1C5YB 4D9RA 1V2QT 5JBBS 1K1JA 1GHVH 2AEIH 4DT7B 2OCVB 2EC9H 2JH5D 2H9EH 2CJIA 3RXGA 1BA8B 3RXCA 5E2OA 1P05A 4I8KA 1CGIE 1RIWC 1VITF 1F0RA 1JXPA 2GKVE 1O3DA 1ZHPA 1FJSA 1TA6A 2R2WU 2VIWA 4NG9H 1MAXA 4OGXA 7GCHF 1QQ4A 1O3JA 4WXVA 5T6FA 7LPRA 1S6HA 1TYNA 2VH0A 1H9IE 2QF0A 1A0HB 2P95A 2HPPH 5C20A 1GMHF 3BEFB 3I78A 4K3JA 4K1SA 2XBWA 1TE0A 1P03A 2ZFRH 5JB9S 1IQLA 1QB1A 1W11U 1SB1H 4YLUA 2Z9LA 3KQBA 2ZDKA 1C2IA 2Z3CA 1ACBE 3A7YA 1CT2E 2W3IA 5DP7A 3GY6A 2J9NA 5F8XA 1JWTA 3NK8A 2QA9E 3W95A 1P2QA 3TU7H 5L2ZH 1ELDE 4FUBA 2ZCLP 2BTCE 2ZO3H 3UR6A 4YESB 1SFIA 1WV7H 4YT6H 5FPSA 1FIZA 1OWKA 4IC6A 3ATIA 4XOJA 4B71A 3U1JB 3QN7A 2OINA 1P9SA 4INLA 1YPHC 4F4OC 1CA0B 1GBKA 4AB8A 2ZP0H 1JRSA 1UVTH 3QGJA 2P3UB 1UK4A 4K2YA 2DUCA 3ZV9A 3ZZAA 1JIMA 1NC6A 1SI5H 1P2KA 4MNYA 8GCHG 3VB5A 3BG4C 1A7SA 3O8DA 3TH3H 4R8TB 1DWCH 2PW8H 3V13A 4BTIB 2ALVA 4ASHA 1ELFA 4FUHA 3SU1A 1KLTA 1SGNE 1ZSLA 2BDIA 3TIUA 4WMDA 5T6GA 1Y5UT 3EAJA 3DFLA 1C5ZB 2F9OA 1FONA 3PTBA 2A2XH 2XBYA 1BTUA 2CF9H 1O3PB 3QUMP 1ETSH 2FOBA 1D6RA 3Q3YA 3HKJB 3RUOA 1ZGVA 2WPIS 4K69A 1D3PB 5C2ZA 4BAKB 1C1VH 3FAOA 1MD7A 3BTKE 1TX7A 1XMNB 1IQFA 3G01A 4CHAB 2TRMA 3SUDA 1FY3A 1SLXB 5AVDA 2ANMH 2GCTC 1Z8IB 4GCHG 1T31A 2HPQH 2ZNKH 5LH8A 1OWHA 2ZKSA 2XNIA 4YOGA 1T8MA 4X2VA 2J2UA 2Z9IA 4DG4A 4X1NU 1GHYH 2NU3E 1G2LA 1CHGA 1HDTH 2A4GA 1JOUB 4K1TA 2ZU2A 4ISNA 1UTQA 1OP2A 2OC1A 2BD5A 1QNJA 1C1UH 1TRNA 3MU5A 1IQEA 2PGBB 2PWXA 1QJ6B 1BTZA 3L33A 4I31A 1MCVA 3NUMA 1TRMA 2BY9X 4XBDA 1UTMA 3I29A 3MTYA 2BZ6H 3LONA 8GCHF 2BY8X 3FFGA 1GBBA 1ZHRA 3VPKA 4CREA 2V3OH 1DY8A 3LDXH 1ARBA 4JZFH 4BAOB 4KTUA 4JYTA 1AU8A 1NU9A 1C5TA 1XXDA 1F0TA 2OC8A 5C5OA 1QRZA 4AFZA 1MQ5A 3PB1E 2SFAA 3BIUH 1SOZA 1EXFA 2VB0A 3GCHC 1TB6H 3HATH 3VXFH 2Z94A 1BTXA 4FUEA 1C9PA 1Z1JA 1L4ZA 1O2UA 3M37A 1H8DH 1BMLA 3K6ZA 4KTSA 6LPRA 1AO5A 1NTPA 5EQRA 1H9LB 1VR1H 5C1XA 2BVXH 2G55A 3CS0A 4BOHA 3DT0H 1ABIH 2GDEH 1YPEH 1LDTT 1PPBH 2C4FH 4Z0KA 4E7NA 2O8TA 1S0RA 2GGVB 5FCRA 2A5IA 3MHWU 2VIVA 3KQEA 4FUCA 1OXGA 5DP3A 2ZZUH 1GJ9B 1LQDB 2VIQA 1GL1A 2A5KA 1SGEE 1O32A 3Q3XA 3U8RH 2PR3A 4GCHF 2Y5FA 3S9BA 1WQSA 2J4IA 4Y8XA 3NKKA 4RN6A 5L6NH 1UVSH 3SU0A 1QRXA 3P8FA 5GJ4B 1PYTC 1WSSH 4RKOB 2KAIB 4OGYA 1QR3E 2AMDA 1P3CA 1TGBA 1HPGA 1B7XB 5DK1A 1PPFE 2FM2A 1KXEA 2XCFA 1ZPZA 1BUIA 1XUGA 1K1LA 2WPKS 3LT3A 2ZPQA 1BTYA 1GGDB 1G3CA 2EEKA 3VFEA 1TNGA 1UCYK 1GDNA 2GVFA 1V2TT 2P8OB 3GOVB 1MZDA 3D65E 4CBNA 1NT1A 3MMGA 2AGIX 1XUKA 3NPSA 1GDQA 1BRBE 1BCUH 1F5LA 3FZDA 1HAOH 2ANWA 3A84A 1G3EA 2RA3A 1O3AA 1GHBG 1G3BA 1L1JA 4MPUA 3V0XA 3SNEA 3PMJA 1CSOE 1UTJA 4ABFA 1VJ9U 2C3SA 1E35B 4Y79A 4H6SB 3RXLA 3EGKH 4I8LA 1AFEH 3CENA 4I33A 2HNTF 1LHGH 1FY4A 3PM3A 2FWWA 4FXGH 2Y82A 1G2MA 1N6XA 1CA0C 3C1KA 2XC0A 3QDZB 2WUBA 2P93A 3RXQA 1HAXB 1NZQH 1N1LA 1SMFE 1AI8H 3S0NA 1C1OA 2IPHA 4UDWH 2BHGA 1NRPH 6CHAB 4H42U 1BMMH 3JZ1B 2GCHG 1YM0A 2CHAB 1CVWH 1ETRH 1ZHMA 3GCNA 3GY5A 1GBEA 1THPB 2ZG0H 4K5ZA 4ZKSU 1V2WT 1N8OB 1LHFH 2ZU1A 2O9QA 1OSSA 1ZZZA 2FYRA 2B5TB 1Q3XA 3TPIZ 3A8BA 3PO1C 1EAUA 5EQQA 1PJPA 3GY2A 2A31A 2R3YA 4A7IB 2QXHA 4B73A 4UE7H 1GI7B 4IN2A 1IQKA 1C4V2 5JYIA 1EP6A 3MU4A 5DJ7A 3NZIA 3GCOA 1C2LA 1GBTA 1OWJA 1DDJA 3SORA 1Z7KA 1HYLA 1RFNA 3M36A 4BNRA 4Q80A 4X8TH 4IC5A 4LK4A 5EGMA 1EPTC 1IOEA 3ZZ3A 1K1IA 3QTVH 4X2XA 2ZGBH 1AD8H 1ARCA 1SGTA 1O34A 3BG8A 3RP2A 4CHAC 2ZTYA 4I7YH 3DA9B 2Z9GA 6GCHG 7KMEH 1HJ9A 5FX5A 1UVUH 1ZSKA 4MG3A 2YNAA 3E1XB 2OP9A 5J4SA 1GHBF 3OY5U 1AZ8A 1HIAB 3LKWA 4ZKOU 5L30H 2ZQ2A 3AW0A 3OTJE 3SNDA 4GLYA 2AGGX 4KTCA 3U98H 2BD9A 4ISIH 4IN1A 2ZQ1A 4BANB 1Z8RA 1FV9A 4WJG2 1HGTH 2NU0E 4AG2A 2VIDA 1ZOMA 4RKJB 1GJ7B 2PSXA 1P9UA 2PFEA 4ZH8A 3SU6A 1C2JA 3SGAE 4VGCB 1O5DH 2ZU3A 3MH5A 2EI8A 3D23A 5FPYA 5A0AE 3RMNH 1K9OE 1A3BH 1S81A 4FUGA 1ETTH 3BEUA 2GCHF 1FXYA 4ABDA 5JBAS 1UTNA 3SN8A 4DW2U 1L2EA 1RGQA 1W0YH 3RXTA 1IQMA 1P2IA 3KQDA 1FPCH 2ODYB 5HGGA 5H4IB 1W13U 1DT2A 3MNBA 3KIDU 4X8SH 1HAVB 1W8BH 1YPLH 3P8GA 4AOQA 1HCGA 3NCLA 1EASA 1ANEA 5C67A 2BDBA 4H4FA 3WY8A 2ZHWH 1ELCA 2XCNA 1UTOA 3SNBA 1GI5A 4IW4E 3TGIE 1Z8JB 1PQAA 2V3HH 2AMPA 3TJNA 1O0DH 1QQUA 2BZAA 1ZTKA 3SU4A 2BQWB 2GZ9A 3QZRA 2ZDVH 1WBGB 3IITA 1V2ST 3SU5A 1FN6A 3RMLH 1TNIA 3H7OA 2WV4A 2GV7A 5DG6A 1YCPK 2V6NA 1ESBA 1P2OA 6GCHF 1C5SA 1O2WA 1SHYA 1TX8A 3PMHB 4B2AA 2XC4A 1A3EH 2ALPA 2ZGCA 4SGAE 3ZVCA 2G8TA 2XYAA 1WAYB 2O8WA 5HYOA 4B1TA 1BTWA 2FI3E 1KTSB 1OYTH 1A0JA 3RXIA 3PLKA 1G32B 3SHCH 1MKWK 5FHTA 3A89A 5JB8S 1LHDH 3PROA 3ZZ5A 2FLRH 3A87A 1BJVA 2VVUA 4D76A 3FZZA 2G52A 5DP5A 1RTFB 3E8LA 4OS6A 1HBTH 2UWPA 1GGDC 1EATA 4TYDA 3B8JA 3GY7A 2AFQB 5A09A 1AZZA 3I77A 1HAZB 3ZYEA 4XDEA 1LPGB 1SGQE 3RXPA 2BDHA 3TK9A 3O8CA 1IQJA 3SU2A 2F9VA 1MAYA 2W7SA 2EI7A 3LC5A 1FAKH 1ORFA 1O2QA 4ZUHA 1GI0A 2CF8H 1A2CH 1MTNB 3KQCA 3P8OA 3R0FA 1UCYE 3MYWA 2PKSB 3ITIA 4FUDA 3T2NA 3TK6A 4Y6DA 4AGKA 1OPHB 1O5CB 1O5EH 1F7ZA 1T4UH 1ELGA 1FQ3A 3SNAA 1C5UA 2JETC 3HPTB 2A2QH 3GY4A 1KXDA 4CRFA 3RXAA 1TMBH 1EUFA 3RU4E 1OP8A 4MDSA 1UCYH 1FPHH 2WPJS 2FEQH 1V2KT 1MUEB 2XXLA 4X2WA 4B76A 3A82A 1C1WH 2VGCB 5AFZH 1GMCG 2P16A 2A1DB 1SGFA 1WQVH 3TLOA 3MU8A 4FU7A 1WTHD 4Y0YE 2AH4X 1H1BA 1EZQA 3RLWH 3KF2A 6CHAC 1FY8E 1GI2A 1KXBA 3P17H 1YGCH 2W7UA 1KDQB 2OC0A 5HM2A 1BQYA 2V35A 3RDZA 4B75A 1MH0A 1B0EA 2A32A 2FS8A 2CGAA 3QZQA 2Z3DA 1GBJA 1KTTB 1TQ7B 3BTEE 1YPMH 2PUQH 3M7QA 2BD8A 3F1SB 3GYLB 3T26A 1XVMA 1QA7A 1RJXB 1C1MA 1D6WA 2AIQA 4ISHH 3STIA 5LGOA 1T4VH 2VH6A 2FOAA 2Y5HA 1EQ9A 1GCTB 2ZDMA 9LPRA 2YNBA 3LC3A 2FMJA 4UFFH 2BD4A 1P2JA 3TJVA 1MTSA 1NRQH 3Q77A 1C1QA 1Y59T 2BY6X 1CE5A 3ATLA 4D8NA 3SOSA 5E0HA 2GZ8A 1K22H 1V6DA 1ELTA 1OP0A 1VCPA 4YM9A 2SGQE 3UWIA 2XRCA 3F9FA 1NFXA 1O3IA 3A7WA 1AKSA 3RC5A 2BQ7B 1LKBA 1O33A 4MNXA 2OUAA 3UOUA 1O3KA 3MH7A 1IAUA 2UWOA 3ATMA 1TRYA 1GI6A 2Q1JA 4IGDA 4U2WA 3BF6H 3MO6A 1EPTA 1ZMLA 3SW2B 1GBDA 2CV3A 2FTLE 1A1RA 1GHWH 1U6QA 1GDUA 5J4QA 4E7RG 1EJAA 8KME2 1BHXF 2OBOA 1O2NA 4QT8C 3A7XA 1V2OT 2F9UA 2F9NA 3BTWE 1E0FD 1Z1IA 1GHAG 2B8OH 1P09A 1S82A 2BVRH 1O31A 4VGCC 1GMCF 4MPVA 3U69H 1UJ1A 1S6FA 3S7HB 1RTLA 2AERH 2FP7B 2FIRH 4Q7ZA 2D26C 5JBTA 2C90B 3M5MA 1TPAE 1KLJH 1L0ZA 2Y5GA 1CGJE 4OS2A 4Y0ZE 1ZRKA 1TGNA 3ZZ8A 1PPHE 3PLPA 1NO9H 3A83A 1L4DA 2QXGA 3LOXA 1GBHA 4WVPE 1S0QA 1Q2WA 1TONA 4CBOA 1BDAA 1E38B 3M35A 1KXFA 1GI1A 1TMTH 1OWDA 4IBLH 4M7GA 2HOBA 2ZHQH 4YLQH 2H2ZA 5FCKA 2YOLA 3LGUA 3L6PA 3SI3H 5I46H 4MLFB 3SUEA 4DVAU 1HUTH 2AIPA 4Y10E 3SJIA 4FUJA 1AY6H 1NRSH 2EI6A 4ZKNU 3RMOH 1W7GH 3RC4A 5F6MA 1D9IA 1RTKA 1MD8A 4J2YB 1ID5H 1K28D 3LH1A 3V3MA 2G51A 2BLOA 1T8OA 1BOQA 1P2NA 2WYGA 5FBIA 2WUCA 4U01A 1BRUP 9ESTA 1HAIH 1ELBA 1W0ZU 1GJAB 2OXSA 3UNRA 4BXWA 3PWBA 2STAE 1BMNH 1DWBH 3QO6A 4SGBE 1ELEE 4CRBA 5DP9A 1W7XH 2SNWA 4A1TA 1UHBA 3SV8A 1C5QA 1S83A 1ZTLA 1SGPE 1AE5A 1TWXB 3TJOA 3TNSA 2Q6FA 2G81E 5FX6A 2SGDE 1O2YA 2BLQA 2QF3A 3VB6A 1AFQB 2VIOA 4B74A 2PLXA 3PYHA 1EZUC 1ZYOA 4JYVH 2ZFTA 3QLPH 1GHAF 1AHTH 1K21H 1GBFA 2ZPSA 2GMTB 3M3TA 2ZECA 4D9QA 1TFXA 5DO4H 3VB7A 1VZQH 5B6OA 4WF8A 1FMGA 2XW9A 2FOFA 1FIWA 1W14U 1XVOA 2HWLB 3UFAA 1SC8U 3SUGA 1W10U 5TCCA 1AB9C 4OS5A 3RXFA 1MTUA 4H6TA 3CP7A 4DY7B 1KIGH 2VIPA 2BD2A 1IHSH 5GWZA 2WYJA 4B2CA 1YC0A 3ODDA 2BOKA 3ZVGA 1T8NA 3VB4A 2PV9B 5A8ZA 5C1UA 2OC7A 1VGCC 1XX9A 3LH3A 1BHXB 4JK6A 4RSPA 1HJAC 4B2BA 5HM9A 1P10A 3SGQE 4ZXYH 1TX6A 1J14A 2RCEA 1C5LH 3HK3B 3BN9A 3A7TA 2OTVA 1O2VA 1P0SH 1WUNH 2J94A 2VINA 1AVWA 4MNWA 3TK5A 5GDSH 5DP8A 1UK3A 1KY9A 2C93B 4BXSA 2H5CA 2TPIZ 1CBWB 3SQHE 1AIXH 4K60A 4NSYA 4X1RU 2FLBH 1O2OA 1ZJKA 5CMXH