3OX7U

The crystal structure of upa complex with peptide inhibitor mh027 at ph4.6
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSALAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title The binding mechanism of a peptidic cyclic serine protease inhibitor
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 245
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ox7U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ox7U01
2FI4E 4JZDH 3SOSA 1BJUA 1O30A 1P02A 1V3XA 1P11E 2QYIA 4NA8A 1O39A 3E0PB 1K1JA 1LVBA 2BY8X 1ZHRA 5GXPA 1TLDA 1DWDH 1HBTH 2J94A 2V35A 3EGKH 4K8BA 5AVDA 3E6PH 2CXVA 3GDVA 2R0LA 1THPB 5JBCS 1GBMA 3BTKE 2Y5HA 1E38B 2F9NA 1IQKA 1UTMA 3R0FA 4K1SA 2OCVB 1O3CA 3GCOA 1AWFH 2PV9B 4UFEH 1FN6A 4GPGA 1F7ZA 4GLYA 3KQCA 4B2CA 2GV6A 1WTHD 3TH2H 3Q77A 1AKSA 1GDNA 2C3SA 5ETXA 1AE5A 1F0TA 1TQ7B 2ZDVH 3HKIB 4CRGA 1T8OA 1RRKA 1H9IE 5LGOA 2ZFQH 1C2IA 2P3TB 3ZVGA 3RXUA 1L4ZA 1UK3A 1J16A 3QWCH 3I78A 1ZLRA 1WQVH 1LCYA 1NM6A 1MU6B 4NIYA 6CHAB 5EXLA 1BRBE 1OWIA 3SUGA 4ABEA 3KNXA 1WOFA 3A83A 1DLEA 1V2KT 1W0ZU 1EZQA 1SHHB 3UREA 2RG3A 4K3JA 3VB3A 5JB8S 1O3DA 1Z7KA 3GY2A 3RXPA 1MTSA 4WVPE 1C5ZB 1GMHF 1P57B 1Z8IB 3SUFA 1N8OB 1AI8H 3ATMA 6GCHG 1NO9H 2Y7ZA 3URDA 1SR5C 4ZKOU 1OPHB 4ABIA 2PGBB 1HAIH 1EX3A 2WPIS 4FUEA 1MTNB 4DURA 2Y5GA 1YF4A 2FI3E 2GT7A 4I8LA 1A46H 1O2IA 3ATLA 1EB2A 1TAWA 4MQAA 1NRRH 1H9HE 1NN6A 3DFLA 4I33A 4OGXA 2FOGA 3RM0H 3BF6H 1A7SA 3HGPA 2F9BH 2ZPRA 1GJ9B 3E91A 1AZZA 4Y71A 1ZHPA 4J2YB 1BRUP 1O33A 3PWCA 1EASA 4ISLA 4J1YA 1L1JA 3PO1B 1SOTA 4Y10E 3ZVFA 1BB0B 1F92A 1D9IA 2BDBA 5HGGA 7GCHG 1GVLA 1F0SA 2FP7B 4JZFH 3VEQB 3UR9A 1UMAH 1HNEE 1GHBG 1ZHMA 1K21H 2C8ZB 2IPHA 3SV2H 4LZ4B 2W3KA 1K2I1 2JETB 1TNIA 2J2UA 2EA3A 2BDYA 3SU5A 3PMHB 2R3YA 2UUKB 4AB9A 4GSOA 2NU4E 1OOKB 1JXPA 3DT0H 5GCHF 1CE5A 4WH8A 2H6MA 1ZSJA 1JBUH 3RXDA 1O3JA 3BTWE 4M7GA 1MTUA 4BXSA 3M5OA 1Y3XA 2AMPA 2ZDAH 1LTOA 3EA9A 1UO6A 2FESH 3S0NA 1AVGH 4X8VH 3P70B 1BITA 3H7TA 2Z7FE 5HYOA 1TRNA 1OYTH 2PW8H 4D7FA 2BXUH 4CRAA 4MPUA 2O8UA 1MBMA 1HYLA 3ZZDA 3L3TA 3U9AH 1AN1E 2CN0H 5K0HA 2BD2A 4HTCH 1T32A 1J14A 1TFXA 1AB9C 4FXGH 3TU7H 4LZ1H 3KGPA 1RXPA 1F5RA 3SI4H 4ESTE 1MKWH 2ULLA 2ZG0H 3MU4A 4DT7B 5C2ZA 4AG1A 1ESTA 1KYNA 1AUTC 2VIVA 2BXTH 2A7HA 2WUBA 5FPYA 2BMGB 5C1UA 5C5NA 1FY1A 1MQ6A 2A32A 2BOHB 5A8ZA 1NZQH 2SGEE 3ZZ4A 4CRDA 1O3BA 4GCHG 2FTLE 1EAXA 2GCTB 4XE4A 4K1EA 1O0DH 3M36A 5AHGH 3D65E 3UWIA 2ZI2H 5JBTA 1EUFA 4WWYA 2ZF0H 3OY6U 3MNBA 4ZHLU 3TGJE 3ZVEA 1HAZB 2W3IA 4U30A 1O3PB 1CVWH 2A4QA 1ELTA 1QQ4A 2VIOA 2ZWLH 1RIWB 2P3UB 4ZROA 2LNCA 3FFGA 2ZU3A 2ZU4A 5CMXH 1G2MA 4AFQA 5HXFA 1NFUA 1XUGA 1BUIA 1P12E 2D8WA 1L2EA 2I6SA 5EOKA 1UVPA 1GJBB 1QRXA 2J92A 3NZIA 4ABDA 4YT6H 1LQDB 1QB1A 2G00A 2FZZA 4FVBA 3NCLA 1GBKA 2QF0A 1NRPH 2GVFA 2XBWA 1C5VA 1JOUB 4Q7ZA 5GPIB 1O3AA 2VWOA 5H4IB 2SFAA 1CT0E 1WYKA 5EQQA 3Q00A 1NY22 4UD9H 1Y5BT 1HV7A 4ZXYH 5C20A 2W7SA 2FXRA 1O3NA 4B74A 2Z3DA 2H9TH 1FNIA 1J15A 3FZZA 1FY3A 1TB6H 1ZTLA 2ZA5A 1CHOF 1E35B 4X1QU 3TVJB 1KLJH 3BTTE 1XXFA 4CHAC 3SU4A 2D26C 1ID5H 1S85A 4D9QA 2FODA 2HPPH 1EXFA 1F2SE 1SQOA 3KQBA 1WAYB 4CRCA 2BZ6H 3VFEA 1UK2A 1P01A 2NU3E 3SZNA 4KTSA 1RFNA 3RMLH 1EKBB 1AVWA 4FUHA 1G2LA 1O36A 2ZHWH 2JETC 1O3GA 2FS9A 1P3CA 2VIQA 3S69A 2Z94A 3O8CA 1HAVA 4YT7H 1BTHH 1CGJE 1MAYA 1S0QA 1UJ1A 1ZMJA 3PMBB 5A8XA 3F9HA 4KGAA 5E2OA 3SU6A 3UOPA 4Y79A 1PPFE 2AMDA 1EAUA 2HLCA 1DLKB 1QL7A 2VWNA 3BV9B 1HAYB 1OS8A 3RDZA 4XBDA 2VWLA 1O5BB 1ABIH 2GP9B 1ZJKA 1YPLH 3ZZBA 2A5KA 3KCGH 4IC5A 3SUDA 1BMNH 1GI9B 1A5GH 3GYLB 4GHTA 1XUKA 2BD5A 5CHAC 1T4UH 2TIOA 2ZPSA 2J34A 1F0UA 4NWKA 3MI4A 3TH4H 2PGQB 2R2MB 1QNJA 3BTQE 3QZQA 1SGIB 2OP9A 3LGIA 1OYQA 3T29A 1FQ3A 3FP7E 4AYYB 1INCA 1NFWA 5FXLA 2VVCA 1PPGE 4F49A 4YESB 1YPHE 1O37A 4IS5A 4I32A 1C5OH 3SHAH 2UWPA 6GCHF 4OS5A 1FPCH 2OC8A 4Y11E 4O3TA 3CS0A 5DK1A 3HATH 4MNXA 2IN2A 4AGJA 2GT8A 2ASUB 3RXIA 1GBBA 2BLOA 4BAOB 5F8ZA 1YBWA 4MNVA 1Y3WA 1UVTH 1GBFA 1XUFA 3RP2A 5F8XA 1EPTB 1FIZA 1P03A 4FU8A 5IDKA 3SI3H 1GJCB 1QB9A 5E0GA 1V2PT 1KXCA 3EE0B 1O2TA 7GCHF 3TPIZ 3SQEE 1TMBH 1UVUH 1ZTJA 3TJOA 4JYUH 1GHBF 2BD3A 1JWTA 4WF8A 3PLBA 4ABAA 2V3HH 4FVDA 1BTWA 1EP5A 1NROH 3A84A 3E3TA 3MU8A 5FAHA 1GG6C 4NGAH 1GI1A 3MU5A 1C4Y2 3P17H 1GJ8B 1CGHA 1GJDB 1Z8RA 1RTLA 2OLGA 1C1OA 3MNSA 1SVPA 1GJ7B 5FPTA 5C3NA 1SC8U 1FV9A 4VGCC 1IQHA 1O5AB 3U8RH 1AFQB 3E8LA 1CQQA 3GISB 3KHVA 4Y7AA 3V13A 4CBNA 3RU4E 1C2MA 3EYDA 1TNKA 1GVZA 1L1NA 1VJAU 1QL8A 3ZVCA 2B0FA 3LJJA 2P8OC 3SV8A 4AX9H 2YOLA 1DFPA 1VCPA 5EU8A 3GY7A 3RXBA 5HM2A 4FUCA 1KY9A 1ELFA 1MMJN 2D1JA 3NXPA 1PPEE 3K65B 1CA0C 1HUTH 1FY5A 2J38A 4X2XA 3R3GB 5DJ7A 2PKSB 4WJG2 3O8BA 2OC7A 1AY6H 1C5NH 4YOJA 1ZPZA 3OX7U 3KL6A 5FPSA 1PQAA 1O2LA 3OSYA 5EW2H 4CREA 4UFDH 2XBYA 1GHXH 1EJNA 5TCCA 3PTNA 2GGVB 4GAWA 1Y3VA 4GCHF 3SGAE 1DS2E 3BTGE 4SGAE 3TGIE 2A4RA 3UIRA 1D4PB 4MPXA 1W8BH 2FOHA 4NIWA 4A6LA 3B8JA 4ISHH 1TGBA 2WYJA 2ZP0H 2BY9X 3P95A 1XUJA 1MH0A 1UTJA 4JYTA 3SJKA 2ZDNA 2AEIH 1SGNE 1V2RT 3W95A 2M5TA 5J4SA 3RXCA 1P06A 8GCHG 1SGTA 5DP3A 4RSPA 1SFIA 1JRSA 2HGTH 3VPKA 8LPRA 3ZZAA 1GBLA 4Y0YE 2R2WU 1D3DB 2ZHFH 2O8WA 3QGNB 1GJ5H 2QF3A 2VINA 1BOQA 3PM3A 2RA3A 4KELA 1XKAC 4DGJA 3BEUA 1IOEA 2BVSH 3MYWA 1C1TA 4BNRA 1Q3XA 2FPZA 1C2JA 2ZQ2A 2XCFA 3TLOA 4H6TA 3SORA 1GI5A 2FLRH 3I29A 3ITIA 2JKHA 4ABFA 1M9UA 2ZTZA 1C2FA 1A0HB 3A80A 1ANBA 3U8OH 3WY8A 1GL0E 1KSNA 4HGCA 5E2PA 1GGDC 2ZECA 5EGMA 4H6SB 3LGTA 3QN7A 3A7VA 2P93A 4GHQA 1W7XH 1AFEH 3RMNH 3RXVA 1D3QB 1AWHB 2O8MA 5C1XA 4ZH8A 1O2SA 1P9UA 1V2LT 3SGQE 3RU4D 1WQSA 4TY6A 1P2KA 3RMMH 4JZ1A 2J95A 1UVOA 2QXJA 2ANKH 1RGQA 3VXEH 1A61H 1DUAA 1EZUC 1DPOA 1L1GA 3VGCB 2EI8A 1Y5AT 1F5LA 1OKXA 1SGYE 3T27A 3URCA 2XW9A 1NRQH 4NWLA 4BTUB 3GY5A 3HK6B 1FI8A 3T25A 1H1BA 2UUYA 1OP8A 3EA8A 8ESTE 4AB8A 2AIQA 1E36B 1O34A 4X2WA 1D3PB 2EC9H 4E05H 1NPMA 2RDLA 3M7QA 1GI4A 1MKWK 1MTVA 2F83A 5G4BA 1QJ7B 1NFYA 1ELCA 3BN9A 1HRTH 4I31A 4UONA 2BYAX 1IQLA 1DDJA 2TGAA 1BRAA 1EJAA 1BRCE 5SGAE 2PSXA 1BTYA 2ODQA 1C5TA 4ZHAA 1XUIA 3A7WA 2G4UA 4I8KA 1FY4A 1SGDE 2THFB 1OXGA 1BT7A 4JK6A 4UE7H 3D23A 4Y7BA 1ELAA 2HWLB 3U69H 2R3UA 3BG4B 3ATWA 5A8YA 3UR6A 1TX7A 1ANCA 2CF9H 4AN7A 1PQ5A 3A89A 1DXWA 1SLVB 4UFGH 1DSUA 1HGTH 2GCHF 1PYTD 2OTVA 4ZXXH 3P8OA 1E37B 1BCUH 4Z0KA 2XC0A 1OSSA 2Z9LA 4Y6DA 2XCNA 1TPAE 1NS3A 3JZ1B 3SGBE 4UEHH 2G5VA 2SGFE 2Y82A 2PKAB 2ZFFH 2AH4X 5T3HA 3OTJE 4CBOA 1NRSH 1ZPBA 1C5XB 3GY6A 3NPSA 1UTOA 1V2OT 2V3OH 1HJAB 2OC1A 4Q80A 4D8NA 1FXYA 1MQ5A 1VITG 3LDXH 3L6PA 1W0YH 1EZSC 4TY7A 1C5SA 1TNLA 4D76A 1BTZA 1TABE 1RTFB 1O3FA 1DY8A 4LK4A 3ZV8A 1GI2A 1SLWB 1Z6JH 1EP6A 2BLWA 4B2AA 2PLXA 1L4DA 1QIXB 2G52A 3RC5A 1AIXH 3LIWA 3QTOH 4JYVH 4ABJA 1SLUB 4X6NA 3E1XB 4BTIB 1O2UA 3QO6A 2F9PA 1VGCB 1C9TA 2P59A 3LH1A 4I8JA 2VVUA 3A82A 2GMTB 2XWAA 1L0ZA 3IWMA 1ZGVA 1BIOA 1A2CH 2BD4A 3S9AA 1DVAH 4AOQA 3SU2A 3BIVH 1GBTA 1GCDA 3KQDA 1OP2A 2H1UA 2UWOA 4OS1A 3UPEA 2W26A 1GHAG 1SGPE 5ESTE 3IG6B 1C1SA 3K6ZA 1W12U 1A1RA 1QJ6B 1HIAB 2PFEA 1QTFA 4ABHA 5DP9A 1ZRBA 3KIDU 4THNH 5EPNA 4DCDA 2BB4A 4MDSA 1HAVB 1DX5M 1MAXA 4YM9A 2BDAA 1W10U 2FX4A 3AW1A 3LGVA 4NZQA 1ZJDA 1C1PA 1Y59T 1FN8A 1SLXB 4O97A 1HAGE 3LH3A 5JB9S 1O3KA 4WXIA 1C5MD 1NT1A 3A7XA 1IQMA 3SV6A 1PFXC 2VVVA 1KDQA 1O31A 4RKOB 3MWIU 3EAJA 3CENA 1QQUA 2G55A 2R9PA 1YP9A 3C1KA 4Y0ZE 1YKTA 2Y7XA 1DWBH 1Q31A 4YOGA 3P8GA 2ODYB 4IBLH 1HAXB 3ZYEA 1K22H 2KAIB 2CHAB 1UTPA 3GCHB 7ESTE 1T8MA 4BXWA 4DJZB 4CR5A 1H8IH 4QT8C 1XXDA 1ZSKA 3AVZA 3CS7A 3VB6A 4X8SH 2HNTF 3BEFB 1O2HA 3M3VA 4RKJB 3TK5A 1TNHA 1MKXH 4XBBA 3K2UA 5JDUB 1Y8TA 4IGDA 4ISIH 3H5CB 2J9NA 1N6YA 1O3MA 5FCKA 5EG4A 4X8TH 2A4GA 1HAPH 4IN2A 3V0XA 1K28D 2Z3CA 4IMQA 1JMOH 1HJ9A 4X6PA 3Q3KA 3GY4A 1DWCH 2TPIZ 1CGIE 5ABWA 2FLBH 6CHAC 1SL3A 1HJ8A 2FDAA 2IOTA 4XFQA 4AORA 1CA8B 1Z8GA 1GI7B 4MPVA 2J4IA 1ZPCA 1AVXA 3RM2H 2FEQH 2P94A 1GBAA 2C8WB 1N8OC 1O2XA 1CBWB 2STAE 3FAOA 4UDWH 1ZZZA 1BMAA 2F91A 1XUHA 2ZDMA 1SOZA 3ZZ5A 3M37A 3ODDA 1H8DH 3O8RA 3KQEA 1VITH 1DSTA 1MTNC 1P3EA 2A45B 1O2QA 2STBE 3RLWH 4FU7A 1THSH 3M5LA 3SUEA 3K9XB 2H5CA 1RD3B 5E0HA 1EQ9A 3SHCH 1LQEA 1TA6A 1K1PA 3PO1C 2QCYA 4X1NU 1RTKA 3BSQA 1Z1JA 3ATKA 1XMNB 3U1JB 1QGFA 1T8LA 4INKA 1QBNA 1SSXA 2ZO3H 2WPKS 3A8BA 3B23B 1LHGH 4B71A 1HCGA 2AGEX 1LO6A 3V3MA 3HKJB 1IQFA 2XXLA 1V2NT 1B5GH 1C5YB 1YC0A 3BTEE 1AMHA 1IHTH 3M35A 1P2OA 5BRRE 2G8TA 4JZIA 3A85A 3LGWA 4ISNA 1SHYA 2K1QA 2ZIQH 1GDQA 1SPJA 3SNBA 1AE8H 2BD7A 2VGCB 1TNJA 3DD2H 4WXVA 2FS8A 1YGCH 1XX9A 4CH2B 1C4V2 2ZHDA 3M3TA 4OGYA 1C4U2 2ZU2A 1G9IE 1UCYH 2O9QA 2VJ1A 3P8NA 3T5FH 3Q3XA 2VIWA 3QX5H 2TBSA 5GJ4B 1RJXB 4KTCA 1UTKA 3A8AA 1KTSB 2ESTE 1BHXF 3A87A 1O2OA 2ZC9H 7KMEH 1C5LH 1KIGH 3PMJA 2ZQ1A 4RN6A 3UQVA 3U8TH 2WUCA 1KXDA 1LPKB 1Y3UA 2B9LA 2DUCA 4H4FA 1YPGH 2ZGXH 5J4QA 1SI5H 2ZDKA 2SGPE 2AYWA 1GBJA 9ESTA 1ZYOA 1EAIA 2ZTYA 5E0JA 1N1LA 2HVXA 1D6RA 2OINA 2GCTC 1Y5UT 3A7ZA 3QGJA 1NTPA 4MNYA 1VITF 1EOJA 5LPRA 4NA7A 4OS7A 3V7TA 3ESTA 2ZPQA 3E90B 2C8YB 4TYDA 3RXRA 3TITA 4K1TA 1G37A 2FOCA 2ZHEH 1HXFH 1YPJH 3GY8A 1SGCA 1RIWC 2XNIA 2FOFA 3QDZB 3AAVA 4E7NA 2VNTA 1V6DA 2PTNA 2W7UA 4ISOA 1SGQE 4MVNA 4NFEA 4O9VA 2OC0A 2NU0E 2VU8E 1G3EA 4TPYA 3LU9B 1SQTA 2CV3A 4INHA 1VCQA 3BEIB 1K9OE 4DW2U 1ELDE 1GI3A 1PQ7A 2VIPA 3UY9A 2VH0A 2C93B 2ZHQH 1T8NA 2RA0A 1CHGA 1S81A 3ZVBA 3JZ2B 4Q2KA 4BOHA 4WMEA 1GHAF 3RXKA 2JH6D 8KME2 1K1OA 1D6WA 2ILNA 1YM0A 2QIQA 1OP0A 1DICA 1WCZA 4FUGA 1H4WA 3SJ9A 4AFUA 5DO4H 1AHTH 1KXFA 1XVOA 4A7IB 1YYY1 3GYMA 1EB1H 1PPZA 3LPRA 2FMJA 3PLKA 2ZGHA 5LPFA 1TNGA 1UHBA 4DVAU 1YPHC 5A0BA 1O2NA 1FUJA 1C1NA 1GHWH 1BA8B 1F5KU 1YCPM 3ZZ9A 4I8HA 1LVYA 4MLFB 3TGKE 1MU8B 2BVXH 3TIUA 4X2VA 5F8TA 1O2ZA 3TNTA 1B7XB 2A2XH 1X7AC 2BQWB 4TWWA 4MPWA 5HM9A 2OD3B 1MD7A 1IQEA 1YLDA 5JBAS 1GCTB 1Z6EA 1GMCG 2BQ7B 3G01A 3B9FH 1WSSH 1XKBC 3N7OA 5EXNA 3TJVA 1TWXB 3UTUH 1FONA 4X1SU 2QC2A 4KP0A 1SMFE 2GZ9A 4Y76A 2VGCC 2BY7X 5EQSA 2C4FH 1DWEH 2ZZUH 5GCHG 1AKSB 1WTGH 2Z3EA 2ZGCA 1C1MA 2Z9GA 1C1WH 4IW4E 1ETTH 4JZEH 3MU1A 4OS6A 2B7DH 1Z71A 4BAMB 3GDSA 1ZRKA 1SB1H 1TQ0B 2UUJB 1UK4A 2WV5A 4UFFH 1AGJA 1ELBA 1TGTA 1O5DH 2V0BA 4ZUHA 2C90B 1OWKA 2A4OA 2GDDA 1O3EA 1ZMNA 1DXPA 1IAUA 1SG8B 3EA7A 1C5UA 2FIRH 5IYTA 2YNAA 1BZXE 1S0RA 1ABJH 3U98H 1FJSA 2BZAA 5L30H 1OWJA 1TPSA 1P2IA 2XC4A 3UUZA 3LGYA 3S7HB 2HNTE 4DIHH 5A0AE 1S84A 3QLPH 1UTNA 2VWMA 1K1IA 3RXLA 3F68H 2ZCKP 1J8AA 4O03A 3ZVAA 4ZKRU 3GOVB 4BANB 1S5SA 3F9GA 5FX5A 3UNSA 2Z6BD 3TJNA 2FYQA 2QXGA 1A5IA 1LPGB 3SW2B 4A1VA 2G81E 1FDPA 3V12A 3MMGA 1ELEE 2RCEA 4NA9H 2A7JA 1GVKB 2ZKSA 1EPTC 3Q76A 5JYIA 1C2EA 2OQ5A 1QBVH 1SFQB 3NK8A 3RXFA 1TGSZ 1HXEH 2Z9IA 1EAWA 1ELGA 1O3HA 3PMAB 1C1QA 1O5GH 1S6HA 1V2QT 4CRBA 4NFFA 1O2VA 2FYRA 2TGDA 4NIVA 1B0EA 3H7OA 6LPRA 1ZGIA 5C5OA 4U01A 3GDUA 1IQGA 2FX6A 1GBCA 5DGJA 2OUAA 2ZGBH 5LH8A 3F6UH 3ZZ3A 1ANEA 2FOBA 3QK1A 4X1RU 2HRVA 1NU7B 4R8TB 3ELAH 4INLA 5DP7A 5T6GA 4NZLA 1BHXB 1DE7H 1QRWA 2ZFSA 4TPIZ 3AW0A 2V6NA 3P92A 2WYGA 1DOJA 1A0JA 1S82A 1PYTC 4X1PU 1AFQC 1O3LA 1GDUA 3MH6A 2Y6TA 2WPJS 2ZU1A 1BTUA 1AU8A 1HDTH 2OBQA 1TX8A 1AD8H 1T4VH 1KDQB 1O2KA 4B76A 3P6ZB 1PQ8A 1V2UT 1TOMH 4NIXA 1BBRH 2ZNKH 5T6FA 1O5CB 1A3BH 1TALA 2BLQA 4AG2A 1KXBA 2NWNA 2WPHS 3MO9A 1IQJA 1FLEE 2HPQH 5DKMA 3T62A 4BAQB 1YCPH 1MKXK 2TGPZ 2PR3A 3BG8A 4WMFA 1ZSLA 3LC5A 3RXQA 1AO5A 1BQYA 2PKSC 3PTBA 1TRYA 3FZDA 4Q7YA 1GI0A 2A7CA 3VB4A 1KXAA 4CH8B 2PUQH 2XRCA 4OS4A 3M7UA 4X6MA 1AB9B 1Q2WA 1C5RA 4YOIA 1SGEE 3U1IB 1W14U 3E0NB 1C2KA 1LVMA 3F9FA 3MH4A 5C1YA 4AFZA 1GBDA 5A2MH 2ANYA 2SGQE 3UNRA 1QBOA 2XC5A 3SN8A 3O8DA 1O2JA 3NUMA 3PV4A 1IQIA 3A88A 3SU0A 3UNQA 1TPOA 5FX6A 3ODFA 1MTWA 3KN2A 2Q6GA 1C9PA 1TOCB 1TBQH 4PROA 2WPLS 5T6DA 2VH6A 5L6NH 4TWYA 2VIDA 3MTYA 4ZKNU 3CP7A 3M61U 1LHFH 2P16A 3OY5U 1OWDA 5LPEA 2FO9A 1OWEA 1T31A 1ESBA 1QY6A 1CO7E 3S9CA 3RXMA 1BTXA 4K2YA 4OS2A 5DP4A 5DP8A 1GI8B 1TGCA 2PTCE 3TK6A 1XM1A 2BD9A 1GJ4H 2WV4A 1O32A 2O8LA 3L33A 1C2DA 3VB5A 1FZZA 1GMDG 4A1TA 1ETRH 2OQUA 3RC4A 3QZRA 4GVUA 3ENSB 1CT4E 3SQHE 3SNAA 2F9VA 4ABGA 1K1MA 1EOLA 1D3TB 1BMLA 3GICB 1ACBE 4X0WU 1FAXA 1V2MT 1CU1A 2G5NA 4SGBE 3T26A 3M3SA 5C67A 1QA0A 4X8UH 5GWZA 1JIMA 4CHAB 1SGFG 1TBRH 2PSYA 2ZTXA 3STIA 1Z8JB 5AF9H 1QJ1B 1TGNA 1MZAA 2H2ZA 3C27B 1F0RA 1HAOH 1C2GA 1Z1IA 4MNWA 3SNEA 2TGTA 4BAHB 1K1LA 1GMCF 2ZDLA 3M7TA 4MTBA 3ZV9A 2ZEBA 2A5AA 3EDXB 1BTPA 4LOYH 2PUXB 4HI3A 3A8DA 3VGCC 2G4TA 1FMGA 1Y3YA 1NESE 4KKDA 1UTQA 2BVRH 2GDEH 5B6OA 1UCYK 2QAAA 1O5FH 1DT2A 3A8CA 4FUBA 1MUEB 3GCNA 5PTPA 3SJOA 1ANDA 1ETSH 1V2VT 3FANA 1P05A 1YLCA 4HFPB 1G32B 3ATIA 4Z6AH 4ASHA 1UCYE 2ZFTA 4IN1A 4H42U 2DE8A 3LC3A 1A5HA 1KTTB 1P9SA 4I8GA 2GD4B 5A09A 1VZQH 2BOKA 2GV7A 5CHAB 4KTUA 3PYHA 1W13U 5FHTA 4IMZA 1S83A 4HZHA 8GCHF 3BG4C 4D7GA 2BQ6B 5DP6A 1KXEA 3E16B 2JH5D 5FCRA 2C8XB 3F9EA 4WY3A 1SGFA 1NU9A 4WH6A 1EZXC 1QB6A 2Q6DA 1O2MA 2H5DA 4YLUA 4B75A 2BY6X 1RS0A 3T2NA 2A0QB 4DIIH 3SNDA 1MCVA 1C5WB 2ALVA 4B1TA 2O8TA 2CMYA 4FUIA 1C1RA 2SNWA 2GZ7A 1UTLM 1G3BA 1OWHA 1YPMH 5BPEA 3S7KB 2AS9A 5F6MA 1IQNA 1HJAC 1BMMH 1P2QA 1GJAB 4AYVB 2QV1A 3RUOA 4DY7B 5L2YH 3EQ0H 1TRMA 2FI5E 7LPRA 2A5IA 4JCNA 2PKAA 4FUDA 2QN5T 1GI6A 5ESBA 1GBIA 3MOCA 2B5TB 2AERH 1HAHH 1W11U 1PPCE 5F03A 2LPRA 4WMDA 3ZZCA 3SV9A 4X6OA 1TMUH 2F9OA 1VGCC 3P8FA 1C2HA 3HPTB 2EI7A 3GCTG 2GMTC 1LHCH 3TH3H 3MO6A 4Q7XA 4YZUA 4B73A 1MD8A 1N6XA 1TE0A 3RLYH 1DANH 2AFQB 1TBZH 4IC6A 4A1XA 1K1NA 1UHBB 1J17T 4ZKSU 3DA9B 3ZZ7A 3M5MA 2P3FH 1QA7A 4E06H 3ZZ8A 1QL9A 1U6QA 1GG6B 4ZAEA 1P0SH 3I77A 2NU2E 1A3EH 1XVMA 2WINI 4ZHMU 1SBWA 3A81A 2BHGA 1LDTT 4E7RG 5I46H 2FOAA 2BDHA 1AZ8A 4VGCB 2BX4A 4NSYA 2H9HA 3RXAA 1QURH 1LHDH 1TX6A 1HIAA 2AGIX 3NKKA 4Y8ZA 1LKAA 3BTME 2ANMH 5DP5A 2Z9JA 2IJOB 3T28A 1LVOA 2GKVE 3STJA 1HPGA 1G30B 2P8OB 3RMOH 5FBEA 5EQRA 2H9EH 4NG9H 2BDCA 1QCPA 2BDGA 3BTDE 2BX3A 2NU1E 1HLTH 3QUMP 3RXEA 4NSVA 1ZTKA 3MH7A 1AUJA 5TCAA 2ANWA 4K69A 1CA0B 1G3DA 1WBGB 1LHEH 3SJIA 5AFYH 1TIOA 1QHRB 2G51A 4CR9A 2CHAC 3RXGA 3GCHC 5E8EH 4K8YA 1HB0B 2EEKA 3VB7A 5AFZH 2BM2A 1GL1A 3BIUH 1JRTA 4FU9A 1DITH 1WUNH 1GHYH 2FWWA 1VCWA 1O3IA 2ODPA 2ZGJA 3DUXH 2Y5FA 3TJUA 3ZZ6A 1ARCA 3FP6E 1W7GH 1VJ9U 1O38A 1THRH 2XBXA 2KAIA 3MNXA 1V2ST 3PLPA 2SNVA 1B0FA 2HALA 3PROA 2YNBA 5EPYA 3BTFE 2QXHA 3FP8E 1C2LA 2AIPA 2B8OH 3ZVDA 2TRMA 1T7CA 1PPBH 1A4WH 4FUFA 1W2KH 1ZMLA 2ZFRH 4I7YH 2XWBI 3LOXA 4F4OC 1DM4B 3RU4T 3SBKA 1EJMA 4XDEA 4R0IA 4K60A 3M5NA 2ZCHP 1V2TT 5JPMH 5I25A 1GMDF 1CBWC 3AAUA 3NWUA 2GCHG 1CSOE 3MO3A 4JMYA 3LJOA 1GHZA 2Y81A 2ZCLP 3MNCA 1FAKH 4Y8XA 2QXIA 3RXOA 1LKBA 2WPMS 1GMHG 1QFKH 1C5QA 1O2RA 5FBIA 3LONA 2SGDE 1O2YA 2Z9KA 5CE1A 1SGRE 1FY8E 3PB1E 2UWLA 5EW1H 4JK5A 4ZMAH 1ORFA 3D62A 1ZOMA 3PWBA 1TMTH 1GGDB 1QRZA 5EODA 1QR3E 1O3OA 3Q3YA 2AGGX 3F1SB 2A1DB 1A0LA 3A7TA 2XTTB 2JH0D 3KF2A 1G3CA 1V2JT 6ESTA 4XBCA 5A0CA 2ZU5A 1C1VH 3W94A 1BBRK 2BD8A 2GTBA 1NFXA 2BDIA 1ZR0A 1P2NA 1O2PA 2P95A 1FPHH 1JIRA 5GIBA 3LKWA 2VB0A 1YCPK 4DOQA 3UWJH 3QTVH 1GPZA 1PPHE 1S6FA 3TNSA 3IITA 1E34B 1SQAA 4A5TS 1O5EH 1VR1H 1BBRE 1O2GH 1P8VC 3RC6A 4DG4A 3HGNA 1KLTA 5L2ZH 3SU3A 4D9RA 2ZFPH 1EATA 3ZYDA 2GZ8A 3MFJA 4GUXA 1ESAA 4CRFA 1P10A 4BTTB 1YPKH 4XOJA 1J9CH 3KEEA 1V2WT 3A7YA 4O3UA 1UVSH 1CT2E 4U32A 2CF8H 3GY3A 4YO9A 3FVFB 2I6QA 1IHSH 2QA9E 4YTAA 3UOUA 2PHBA 4K5ZA 1PJPA 3SNCA 1OX1A 3SJ8A 4U2WA 1ELVA 1BDAA 2EI6A 3SV7A 1WV7H 3K6YA 1GJ6A 1GBHA 2F9UA 3OYPA 2ALPA 3OU0A 2A31A 4X2YA 1KLIH 3S9BA 3UFAA 3HK3B 1W3CA 2R0KA 5DG6A 1C5PA 2F3CE 2FTMA 1NRNH 4AGKA 1C1UH 2BLVA 2AMQA 2QGRA 1TONA 5GDSH 1TPPA 3SU1A 2OXSA 4B2BA 2Q6FA 3LGUA 2GX4A 3UQOA 1FIWA 3SO3A 4XSKU 1AQ7A 2OBOA 1ARBA 1MZDA 1H9LB 3GCTF 3D49H 2FOMB 1P2JA 4MG3A 2BTCE 3RXTA 3A86A 4FUJA 4BAKB 2SGAA 1E0FD 4YLQH 5K7RA 3RXJA 1YPEH 2W5EA 1HFDA 1EPTA 1G36A 4ABBA 2XYAA 4AFSA 1P04A 4NCYA 1BJVA 1MCTA 3RXHA 3MU0A 1GBEA 1O35A 3MHWU 1WU1A 1NC6A 1P09A 2A2QH 5DPAA 1DUEA 4AZ2B 1LMWB 2CGAA 3TK9A 3LT3A 3VXFH 4A92A 2CJIA 2BY5X 1P2MA 1TYNA 5TJXA 2Y80A 1GWAA 1MBQA 3DHKH 3AASA 2HOBA 2DE9A 3DFJA 1TA2A 2XBVA 2FOEA 2HNTC 1LPZB 3MH5A 1GHVH 2FM2A 2Q1JA 4LXBH 5HMAA 1CHOG 1DY9A 3RXSA 5EXMA 5JBBS 2QY0B 2UUFB 1O2WA 2PWXA 9LPRA 3BTHE 4Y8YA 1GCTC 2D2DA
chains in the Genus database with same CATH superfamily
2FI4E 3FO8D 4JZDH 3SOSA 1BJUA 1O30A 1P02A 1V3XA 1P11E 2QYIA 4NA8A 1O39A 3E0PB 1K1JA 1LVBA 2BY8X 1ZHRA 5GXPA 1TLDA 1DWDH 1HBTH 2J94A 2V35A 3EGKH 4K8BA 5AVDA 3E6PH 2CXVA 3GDVA 2R0LA 1THPB 5JBCS 1GBMA 3BTKE 1E1QD 2Y5HA 1E38B 2F9NA 1IQKA 1COWD 1UTMA 3R0FA 4K1SA 2OCVB 2J98B 1O3CA 3SZEA 3GCOA 1AWFH 2PV9B 4UFEH 1FN6A 4GPGA 1F7ZA 4GLYA 3KQCA 4B2CA 2GV6A 1WTHD 3TH2H 3Q77A 1AKSA 1GDNA 2C3SA 5ETXA 4ACBA 1AE5A 4TSFD 1F0TA 1TQ7B 2ZDVH 3HKIB 4CRGA 1T8OA 1RRKA 1H9IE 5LGOA 2ZFQH 3KQ5A 1C2IA 2P3TB 3ZVGA 3RXUA 1L4ZA 1UK3A 1J16A 3QWCH 3I78A 1ZLRA 1WQVH 1LCYA 1NM6A 1MU6B 4NIYA 6CHAB 5EXLA 1BRBE 1OWIA 3SUGA 4ABEA 3KNXA 1WOFA 3A83A 1DLEA 1V2KT 1W0ZU 1EZQA 1SHHB 3UREA 2RG3A 4K3JA 3VB3A 5JB8S 1O3DA 1Z7KA 3GY2A 3RXPA 1MTSA 4WVPE 1C5ZB 1GMHF 1P57B 1Z8IB 3SUFA 1N8OB 1AI8H 3ATMA 6GCHG 1NO9H 2Y7ZA 3URDA 1SR5C 4ZKOU 1OPHB 4ABIA 2LP6A 1HAIH 2PGBB 1EX3A 2WPIS 4FUEA 1MTNB 4DURA 2Y5GA 1BMFD 1YF4A 2FI3E 2GT7A 4I8LA 1A46H 1O2IA 3ATLA 1EB2A 1TAWA 4MQAA 1NRRH 1H9HE 1NN6A 3DFLA 4I33A 4OGXA 2FOGA 3RM0H 3BF6H 1A7SA 3HGPA 2F9BH 2ZPRA 1GJ9B 3E91A 1AZZA 4Y71A 1ZHPA 4J2YB 1BRUP 1O33A 3PWCA 1EASA 4ISLA 4J1YA 1L1JA 3N99A 5GNDA 3PO1B 1SOTA 4Y10E 3ZVFA 1BB0B 1F92A 1D9IA 2BDBA 5HGGA 7GCHG 1GVLA 1F0SA 2FP7B 4JZFH 3VEQB 3UR9A 1UMAH 1HNEE 1GHBG 1H8ED 1ZHMA 1K21H 2C8ZB 2IPHA 3SV2H 4LZ4B 2W3KA 1K2I1 2JETB 1TNIA 2J2UA 2EA3A 2BDYA 3SU5A 3PMHB 2R3YA 2UUKB 4AB9A 4GSOA 2HLDD 2NU4E 1OOKB 1JXPA 3DT0H 5GCHF 1CE5A 4WH8A 2H6MA 1ZSJA 1JBUH 3RXDA 1O3JA 3BTWE 4M7GA 1MTUA 4BXSA 3M5OA 1Y3XA 2AMPA 2ZDAH 1LTOA 3EA9A 1UO6A 2FESH 3S0NA 1AVGH 4X8VH 3P70B 1BITA 3H7TA 2Z7FE 5HYOA 1TRNA 1OYTH 2PW8H 4D7FA 2BXUH 1KMHB 4CRAA 4MPUA 2O8UA 1MBMA 1HYLA 3ZZDA 3L3TA 3U9AH 1AN1E 2CN0H 5K0HA 4P00A 4F48B 2BD2A 4HTCH 1T32A 1J14A 1TFXA 1AB9C 4FXGH 2PP6A 3TU7H 4LZ1H 3KGPA 1RXPA 1F5RA 3SI4H 4ESTE 1MKWH 2ULLA 2ZG0H 3MU4A 4DT7B 5C2ZA 4AG1A 1ESTA 1KYNA 1AUTC 2VIVA 2BXTH 2A7HA 2WUBA 5FPYA 2BMGB 5C1UA 5C5NA 1FY1A 1MQ6A 2A32A 2BOHB 5A8ZA 1NZQH 2SGEE 3ZZ4A 3KYFA 4CRDA 1O3BA 4GCHG 2FTLE 1EAXA 2GCTB 4XE4A 4K1EA 1O0DH 3M36A 5AHGH 3D65E 3UWIA 2ZI2H 5JBTA 1EUFA 4WWYA 2ZF0H 3OY6U 3MNBA 4ZHLU 3TGJE 3ZVEA 2L6OA 1HAZB 5HKKD 2W3IA 4U30A 1O3PB 1CVWH 2A4QA 1ELTA 1QQ4A 2K8IA 2VIOA 2ZWLH 1RIWB 2P3UB 4ZROA 2LNCA 3FFGA 2ZU3A 2ZU4A 5CMXH 1G2MA 3WWBA 4AFQA 3FOAA 5HXFA 1NFUA 1XUGA 1BUIA 1P12E 2D8WA 1L2EA 2I6SA 5EOKA 1UVPA 1GJBB 1QRXA 2J92A 3NZIA 4ABDA 3F0OA 4YT6H 1LQDB 1QB1A 2G00A 2FZZA 4FVBA 3FN8A 3NCLA 1GBKA 2QF0A 1NRPH 2GVFA 2XBWA 1C5VA 1JOUB 4Q7ZA 5GPIB 1O3AA 2VWOA 5H4IB 2SFAA 1CT0E 1WYKA 5EQQA 3Q00A 1NY22 4UD9H 1Y5BT 1HV7A 4ZXYH 5C20A 2W7SA 2FXRA 1O3NA 4B74A 2Z3DA 2H9TH 3GS9A 1FNIA 1J15A 3FZZA 1FY3A 1TB6H 1ZTLA 2ZA5A 1CHOF 1E35B 4X1QU 3TVJB 1KLJH 3BTTE 1XXFA 4CHAC 3SU4A 2D26C 1ID5H 1S85A 4D9QA 2FODA 2HPPH 1EXFA 1F2SE 1SQOA 3KQBA 3F3BA 1WAYB 4CRCA 2BZ6H 3VFEA 1UK2A 1P01A 2NU3E 3SZNA 4KTSA 1RFNA 3RMLH 1EKBB 1AVWA 4FUHA 1G2LA 1O36A 2ZHWH 2JETC 1O3GA 2FS9A 1P3CA 3N7EA 2VIQA 3S69A 2Z94A 2RFKC 3O8CA 1HAVA 4YT7H 1BTHH 1CGJE 1MAYA 1S0QA 1UJ1A 1ZMJA 3PMBB 5A8XA 3F9HA 4KGAA 5E2OA 3SU6A 3UOPA 4Y79A 1PPFE 3F2GA 2AMDA 1EAUA 2HLCA 1DLKB 1QL7A 2VWNA 3BV9B 1HAYB 1OS8A 4ZCNA 3RDZA 4XBDA 2VWLA 1O5BB 1ABIH 2GP9B 1ZJKA 1YPLH 3ZZBA 2A5KA 3KCGH 4IC5A 3SUDA 1BMNH 1GI9B 1A5GH 2GJGA 3GYLB 4GHTA 1XUKA 2BD5A 3WWFA 5CHAC 1T4UH 2TIOA 2ZPSA 2J34A 1F0UA 4NWKA 3MI4A 3TH4H 2PGQB 2R2MB 1QNJA 3BTQE 3QZQA 1SGIB 2OP9A 3LGIA 1OYQA 3T29A 1FQ3A 3FP7E 2WPDD 4AYYB 1INCA 1NFWA 5HIYA 5FXLA 2VVCA 1PPGE 4F49A 4YESB 2JDID 1YPHE 2W6JD 1O37A 4IS5A 4I32A 1C5OH 3SHAH 2UWPA 6GCHF 4OS5A 1FPCH 2JIZD 2OC8A 4Y11E 4O3TA 3CS0A 5DK1A 3HATH 4MNXA 2IN2A 4AGJA 2GT8A 2ASUB 3RXIA 1GBBA 2BLOA 4BAOB 5F8ZA 1YBWA 4MNVA 1Y3WA 3DSPA 1UVTH 1GBFA 1XUFA 3RP2A 5F8XA 1EPTB 5F53A 1FIZA 1P03A 4FU8A 5IDKA 3SI3H 1GJCB 1QB9A 5E0GA 1V2PT 1KXCA 3EE0B 1O2TA 7GCHF 3TPIZ 5KGOA 3SQEE 1TMBH 1UVUH 1ZTJA 3TJOA 4JYUH 1GHBF 2J5UA 2BD3A 1JWTA 4WF8A 3PLBA 4ABAA 2V3HH 4FVDA 1BTWA 1EP5A 1NROH 3A84A 3E3TA 3MU8A 5FAHA 1GG6C 4NGAH 3ZIAD 1GI1A 3MU5A 1C4Y2 3P17H 1GJ8B 1CGHA 1GJDB 1Z8RA 1SQRA 1RTLA 2OLGA 1C1OA 3MNSA 1SVPA 1GJ7B 5FPTA 5C3NA 1SC8U 1FV9A 4VGCC 1IQHA 1O5AB 3U8RH 1AFQB 3E8LA 1CQQA 3GISB 3KHVA 4Y7AA 3V13A 4CBNA 3RU4E 1C2MA 3EYDA 1TNKA 1GVZA 1L1NA 1VJAU 3MQKC 1QL8A 3ZVCA 2B0FA 3LJJA 3F2HA 2P8OC 3SV8A 4AX9H 2YOLA 1DFPA 1VCPA 5EU8A 3GY7A 4TT3D 3RXBA 3F0PA 5HM2A 4FUCA 2QF5A 1KY9A 1ELFA 1MMJN 2D1JA 3NXPA 1PPEE 3K65B 1CA0C 1HUTH 1FY5A 2J38A 4X2XA 3R3GB 5DJ7A 2PKSB 4WJG2 3O8BA 2OC7A 1AY6H 1C5NH 4YOJA 1ZPZA 3OX7U 3KL6A 5FPSA 1PQAA 1O2LA 3OSYA 5EW2H 4CREA 4UFDH 3OEHD 2XBYA 1GHXH 3FKSD 1EJNA 5TCCA 3PTNA 2GGVB 4GAWA 1Y3VA 4GCHF 3SGAE 1DS2E 3BTGE 4SGAE 3VG8A 3TGIE 2A4RA 3UIRA 1D4PB 4MPXA 1W8BH 2FOHA 4NIWA 4A6LA 3B8JA 4ISHH 1TGBA 2WYJA 2ZP0H 2BY9X 3P95A 1XUJA 1OHHD 1MH0A 1UTJA 4JYTA 3SJKA 2ZDNA 2AEIH 1SGNE 1V2RT 3W95A 2M5TA 5J4SA 3RXCA 1P06A 8GCHG 1SGTA 5DP3A 2F43B 4RSPA 1SFIA 1JRSA 2HGTH 3VPKA 8LPRA 3ZZAA 1GBLA 4Y0YE 2R2WU 1D3DB 2ZHFH 2O8WA 2W6ID 1GJ5H 2KCPA 3QGNB 2LELA 2QF3A 2VINA 1BOQA 3PM3A 2RA3A 4KELA 1XKAC 4DGJA 3BEUA 1IOEA 2BVSH 3MYWA 1C1TA 1E1RD 4BNRA 4ASUD 1Q3XA 2FPZA 1C2JA 2ZQ2A 2XCFA 3TLOA 4H6TA 3SORA 1GI5A 2FLRH 3I29A 3ITIA 2JKHA 4ABFA 1M9UA 2ZTZA 1C2FA 1A0HB 3A80A 1ANBA 3OAAD 3U8OH 3WY8A 1GL0E 1KSNA 4HGCA 5E2PA 1GGDC 2ZECA 5EGMA 2WZQA 4H6SB 3LGTA 3QN7A 3A7VA 2P93A 4GHQA 1W7XH 1AFEH 3RMNH 3RXVA 1D3QB 1AWHB 2O8MA 5C1XA 4ZH8A 1O2SA 1P9UA 1V2LT 3SGQE 3RU4D 1WQSA 4TY6A 1P2KA 3RMMH 4JZ1A 2J95A 5DSFA 1UVOA 2KM0A 2QXJA 2ANKH 1RGQA 3VXEH 1A61H 1DUAA 3AK5A 1EZUC 1DPOA 1L1GA 3VGCB 2EI8A 2RDEA 1Y5AT 1F5LA 1OKXA 1SGYE 3T27A 3URCA 2XW9A 1NRQH 4NWLA 4BTUB 3GY5A 3HK6B 1FI8A 3T25A 1H1BA 2UUYA 1OP8A 3EA8A 8ESTE 4AB8A 2AIQA 1E36B 1O34A 4X2WA 1D3PB 2EC9H 4E05H 3KYGA 1NPMA 2RDLA 3M7QA 1GI4A 1MKWK 1MTVA 2F83A 5G4BA 1QJ7B 1NFYA 1ELCA 3BN9A 1HRTH 4I31A 4UONA 2BYAX 1IQLA 1DDJA 2TGAA 4RT1A 1BRAA 1EJAA 1BRCE 5SGAE 2PSXA 1BTYA 2ODQA 1C5TA 4ZHAA 1XUIA 3A7WA 2G4UA 4I8KA 1FY4A 1SGDE 2THFB 1OXGA 1BT7A 4JK6A 4UE7H 3D23A 4Y7BA 1ELAA 2HWLB 2KX4A 4Q63A 3U69H 2R3UA 3BG4B 3ATWA 5A8YA 3UR6A 1TX7A 1ANCA 2CF9H 3UB0A 2J97A 4AN7A 1PQ5A 3A89A 1DXWA 1SLVB 4UFGH 1DSUA 1HGTH 2GCHF 1PYTD 2OTVA 4ZXXH 3P8OA 1E37B 1BCUH 4Z0KA 2XC0A 1OSSA 2Z9LA 4Y6DA 2XCNA 1TPAE 1NS3A 3JZ1B 3SGBE 4UEHH 2G5VA 2SGFE 2Y82A 2PKAB 2M2AA 2ZFFH 2AH4X 5T3HA 3OTJE 4CBOA 1NRSH 1ZPBA 1C5XB 3GY6A 3NPSA 1UTOA 1V2OT 2V3OH 1HJAB 2OC1A 4Q80A 4D8NA 1FXYA 1MQ5A 1VITG 3LDXH 3L6PA 1W0YH 1EZSC 4TY7A 1C5SA 1TNLA 4D76A 1BTZA 1TABE 1RTFB 1O3FA 1DY8A 4LK4A 3ZV8A 1GI2A 1SLWB 1Z6JH 1EP6A 2BLWA 4B2AA 2PLXA 1L4DA 1QIXB 2G52A 3RC5A 1AIXH 3LIWA 3QTOH 4JYVH 4ABJA 1SLUB 4X6NA 3E1XB 4BTIB 1O2UA 3QO6A 2F9PA 1VGCB 1C9TA 2P59A 3LH1A 4I8JA 2VVUA 2XNDD 3A82A 2GMTB 2XWAA 1L0ZA 3IWMA 1ZGVA 2AHME 1BIOA 1A2CH 2BD4A 3S9AA 1DVAH 4AOQA 2EY4C 3SU2A 3BIVH 1GBTA 1GCDA 2WV9A 3KQDA 1OP2A 2H1UA 2UWOA 2VBCA 2KCOA 4OS1A 3UPEA 2W26A 1GHAG 1SGPE 5ESTE 3IG6B 1C1SA 3K6ZA 1W12U 1A1RA 1QJ6B 1HIAB 2PFEA 1QTFA 4ABHA 5DP9A 1ZRBA 3KIDU 4THNH 5EPNA 2YMSB 4DCDA 2BB4A 1MABB 4MDSA 1HAVB 1DX5M 1MAXA 4YM9A 2BDAA 1W10U 2FX4A 3AW1A 3LGVA 4NZQA 1ZJDA 1C1PA 1Y59T 1FN8A 1SLXB 4O97A 1HAGE 1QZ8A 3LH3A 4DT4A 3DSOA 1O3KA 4WXIA 1C5MD 5JB9S 1NT1A 3A7XA 1IQMA 3SV6A 1PFXC 2VVVA 1KDQA 2XOKD 1O31A 4RKOB 3MWIU 3EAJA 3CENA 1QQUA 2G55A 2R9PA 1YP9A 3C1KA 4Y0ZE 1YKTA 2Y7XA 1DWBH 1Q31A 3OEED 4YOGA 3P8GA 2ODYB 4IBLH 1HAXB 3ZYEA 5DN6D 1K22H 2KAIB 2CHAB 1UTPA 3GCHB 7ESTE 1T8MA 3PRBA 4BXWA 4DJZB 4CR5A 1H8IH 4QT8C 1XXDA 1ZSKA 3AVZA 3CS7A 3VB6A 4X8SH 2HNTF 3BEFB 1O2HA 3M3VA 4RKJB 3TK5A 1TNHA 1MKXH 2J98A 4XBBA 3K2UA 5JDUB 1Y8TA 4IGDA 4ISIH 3H5CB 2J9NA 1N6YA 3PRDA 1O3MA 5FCKA 5EG4A 4X8TH 2A4GA 1HAPH 4IN2A 3V0XA 1K28D 2Z3CA 4IMQA 1JMOH 1HJ9A 4X6PA 3Q3KA 3GY4A 1DWCH 2TPIZ 1CGIE 5ABWA 2FLBH 6CHAC 4RI0A 1SL3A 1HJ8A 2FDAA 2IOTA 4XFQA 4AORA 1CA8B 2OK5A 1Z8GA 1GI7B 4MPVA 2J4IA 1ZPCA 1AVXA 3RM2H 2FEQH 2P94A 1GBAA 2C8WB 1N8OC 1O2XA 1CBWB 2STAE 3FAOA 4UDWH 5EJZA 1ZZZA 1BMAA 2F91A 1XUHA 2ZDMA 1SOZA 3ZZ5A 5IK2D 3M37A 3ODDA 5CDFE 1H8DH 3O8RA 3KQEA 1VITH 1DSTA 1MTNC 1P3EA 2A45B 2CK3D 1O2QA 2STBE 4P02A 3RLWH 4FU7A 1THSH 3M5LA 3SUEA 3K9XB 2H5CA 1RD3B 5E0HA 1EQ9A 3SHCH 1LQEA 1TA6A 1SKYE 1K1PA 3PO1C 2QCYA 4X1NU 2IJD1 1RTKA 3BSQA 1Z1JA 3ATKA 1XMNB 3U1JB 1QGFA 1T8LA 5C94A 1H8HD 4INKA 1QBNA 1SSXA 2ZO3H 2WPKS 3A8BA 3B23B 1LHGH 4B71A 1HCGA 2AGEX 1LO6A 3V3MA 3HKJB 1IQFA 2XXLA 1V2NT 1B5GH 1C5YB 1YC0A 3BTEE 1AMHA 1IHTH 3M35A 1P2OA 5BRRE 2G8TA 4JZIA 3A85A 3LGWA 4ISNA 1SHYA 2K1QA 2ZIQH 1GDQA 1SPJA 3SNBA 1AE8H 2BD7A 2VGCB 1TNJA 3DD2H 4WXVA 2FS8A 4YXWD 2WHXA 1YGCH 1XX9A 4CH2B 1C4V2 2ZHDA 3M3TA 4OGYA 1C4U2 2ZU2A 5T1VA 1G9IE 1UCYH 2O9QA 2VJ1A 3P8NA 3WW7A 3T5FH 3Q3XA 2VIWA 3QX5H 2TBSA 5GJ4B 1RJXB 4KTCA 1UTKA 3A8AA 1KTSB 2ESTE 1BHXF 3A87A 1O2OA 2ZC9H 7KMEH 1C5LH 1KIGH 3PMJA 2ZQ1A 4RN6A 3UQVA 3U8TH 2WUCA 1KXDA 1LPKB 1Y3UA 2B9LA 2DUCA 4H4FA 1YPGH 2ZGXH 5J4QA 1SI5H 2ZDKA 2SGPE 2AYWA 1GBJA 9ESTA 1ZYOA 1EAIA 2ZTYA 5E0JA 1EFRD 2YMSD 1N1LA 2HVXA 1D6RA 2OINA 2GCTC 1Y5UT 3A7ZA 3QGJA 1NTPA 4MNYA 1VITF 1EOJA 5LPRA 4NA7A 4OS7A 3SYJA 3ESTA 3V7TA 2ZPQA 2HVYB 3E90B 2C8YB 4TYDA 2KCYA 3RXRA 3TITA 4K1TA 1G37A 2FOCA 2ZHEH 1HXFH 1YPJH 3GY8A 1SGCA 1RIWC 2XNIA 2FOFA 3QDZB 3AAVA 4E7NA 2VNTA 1V6DA 2PTNA 2W7UA 4ISOA 1SGQE 4MVNA 4NFEA 4O9VA 2OC0A 4AC9A 2NU0E 2VU8E 1G3EA 4TPYA 3LU9B 1SQTA 2CV3A 4INHA 1VCQA 3BEIB 1K9OE 4DW2U 1ELDE 1GI3A 1PQ7A 2VIPA 3UY9A 2VH0A 2C93B 1K0HA 2ZHQH 1T8NA 2RA0A 1CHGA 1S81A 3ZVBA 3JZ2B 4Q2KA 4BOHA 4WMEA 1GHAF 2KFWA 2JH6D 3RXKA 1K1OA 2V7QD 8KME2 1D6WA 2ILNA 1YM0A 2QIQA 1OP0A 1DICA 1WCZA 4FUGA 1H4WA 3SJ9A 4AFUA 5DO4H 1AHTH 1KXFA 1XVOA 4A7IB 1YYY1 3GYMA 1EB1H 1PPZA 3LPRA 2FMJA 3PLKA 2ZGHA 5LPFA 1TNGA 1UHBA 4DVAU 1YPHC 5A0BA 1O2NA 1FUJA 5EJ1A 1C1NA 1GHWH 1BA8B 1F5KU 1YCPM 5HIZA 3ZZ9A 4Z1MD 1NBME 4I8HA 1LVYA 4MLFB 3TGKE 1MU8B 2BVXH 3TIUA 2QE7D 4X2VA 5F8TA 1O2ZA 3TNTA 1B7XB 2A2XH 1X7AC 2BQWB 4TWWA 4MPWA 5HM9A 2OD3B 1MD7A 1IQEA 1YLDA 5JBAS 1GCTB 1Z6EA 1GMCG 2BQ7B 3G01A 3B9FH 1WSSH 1XKBC 3N7OA 5EXNA 3TJVA 5B6LA 1TWXB 3UTUH 1FONA 4FOUC 4X1SU 2QC2A 4KP0A 1SMFE 2GZ9A 4Y76A 2VGCC 1FX0B 2BY7X 1S6LA 5EQSA 2C4FH 1DWEH 2ZZUH 5GCHG 1AKSB 1WTGH 2Z3EA 2ZGCA 1C1MA 2Z9GA 1C1WH 3DCLA 4IW4E 1ETTH 4JZEH 3MU1A 4OS6A 2B7DH 3NRLA 1Z71A 4BAMB 3GDSA 1ZRKA 4OM9A 1SB1H 1TQ0B 2UUJB 1UK4A 2WV5A 3W1EA 4B6EA 4UFFH 1AGJA 1ELBA 1TGTA 1O5DH 2V0BA 4ZUHA 2C90B 1OWKA 2A4OA 2GDDA 1O3EA 3N7DA 1ZMNA 1DXPA 1IAUA 1SG8B 3EA7A 1C5UA 2FIRH 5IYTA 2YNAA 1BZXE 1S0RA 1ABJH 3U98H 1FJSA 2BZAA 5L30H 1OWJA 1TPSA 1P2IA 2XC4A 3UUZA 3LGYA 3S7HB 2HNTE 4DIHH 5A0AE 1S84A 3QLPH 1UTNA 2VWMA 1K1IA 3RXLA 3F68H 2ZCKP 1J8AA 4O03A 3ZVAA 4ZKRU 3GOVB 4BANB 1S5SA 3F9GA 5FX5A 3UNSA 2Z6BD 3TJNA 2FYQA 2QXGA 1A5IA 1LPGB 3SW2B 4A1VA 2G81E 1FDPA 3V12A 3MMGA 1ELEE 2RCEA 3PV5A 4NA9H 2A7JA 1GVKB 2ZKSA 1EPTC 3Q76A 5JYIA 1C2EA 2OQ5A 1QBVH 1SFQB 3NK8A 3RXFA 1TGSZ 1HXEH 2Z9IA 1EAWA 1ELGA 1O3HA 3PMAB 1C1QA 1O5GH 1S6HA 1V2QT 4CRBA 4NFFA 1O2VA 2FYRA 2F4LA 2TGDA 4NIVA 1B0EA 3H7OA 6LPRA 1ZGIA 5C5OA 4U01A 5EJLA 3GDUA 1IQGA 1NBMD 2FX6A 1GBCA 5DGJA 2OUAA 2ZGBH 5LH8A 3F6UH 3ZZ3A 1ANEA 2FOBA 3QK1A 4X1RU 2HRVA 1NU7B 4R8TB 3ELAH 4INLA 5DP7A 5C17A 5T6GA 4NZLA 1BHXB 1DE7H 5KEDA 1QRWA 2ZFSA 4TPIZ 3AW0A 2V6NA 3P92A 2WYGA 1DOJA 2KZ4A 1A0JA 1S82A 1PYTC 4X1PU 1AFQC 1O3LA 1GDUA 3MH6A 2Y6TA 2WPJS 2ZU1A 1BTUA 1AU8A 1E79D 1HDTH 2OBQA 1TX8A 1AD8H 1T4VH 1KDQB 1O2KA 4B76A 3P6ZB 1PQ8A 1V2UT 1TOMH 4NIXA 1BBRH 2ZNKH 5T6FA 1O5CB 1A3BH 1TALA 2BLQA 4M9FA 4AG2A 1KXBA 2NWNA 2WPHS 3MO9A 1IQJA 1FLEE 2HPQH 5DKMA 3T62A 4BAQB 1YCPH 1MKXK 2TGPZ 2PR3A 3BG8A 4WMFA 1ZSLA 3LC5A 3RXQA 1AO5A 1BQYA 2PKSC 3PTBA 1TRYA 3FZDA 4Q7YA 1GI0A 2A7CA 3VB4A 1KXAA 4CH8B 2PUQH 2XRCA 4OS4A 3M7UA 4X6MA 1AB9B 1Q2WA 1C5RA 4YOIA 1SGEE 3U1IB 1W14U 3E0NB 1C2KA 1LVMA 3F9FA 3MH4A 5C1YA 2K0QA 4AFZA 1GBDA 5A2MH 2ANYA 2SGQE 3UNRA 1QBOA 2XC5A 3SN8A 3O8DA 1O2JA 3NUMA 3PV4A 1IQIA 3A88A 3SU0A 3UNQA 1TPOA 5FX6A 3ODFA 1MTWA 3KN2A 2Q6GA 1C9PA 1TOCB 5KECA 1TBQH 4PROA 2WPLS 5T6DA 2VH6A 1W0KD 5L6NH 4TWYA 2VIDA 3MTYA 4ZKNU 3CP7A 3M61U 1LHFH 2P16A 3OY5U 1OWDA 5LPEA 2FO9A 1OWEA 1T31A 1ESBA 1QY6A 1CO7E 3S9CA 3RXMA 1BTXA 4K2YA 4OS2A 5DP4A 5DP8A 1GI8B 1TGCA 2PTCE 3TK6A 1XM1A 2BD9A 1GJ4H 2WV4A 4HG6A 1O32A 2O8LA 3L33A 1C2DA 3VB5A 1FZZA 3OTPA 1GMDG 4A1TA 1ETRH 2OQUA 3RC4A 3QZRA 4GVUA 3ENSB 1CT4E 3SQHE 3DSGA 3SNAA 2F9VA 4ABGA 1K1MA 1EOLA 4FETA 1D3TB 1BMLA 3GICB 1ACBE 4X0WU 1FAXA 1V2MT 1CU1A 2G5NA 4SGBE 3T26A 3M3SA 5C67A 1QA0A 4X8UH 1WXRA 5GWZA 1JIMA 4CHAB 1SGFG 1TBRH 2PSYA 2ZTXA 3STIA 1Z8JB 5AF9H 1QJ1B 1TGNA 1MZAA 2H2ZA 3C27B 1F0RA 1HAOH 1C2GA 1Z1IA 4MNWA 3SNEA 2TGTA 4BAHB 1K1LA 1GMCF 2ZDLA 3M7TA 4MTBA 3ZV9A 2ZEBA 2A5AA 3EDXB 1BTPA 4LOYH 2PUXB 4HI3A 3A8DA 3VGCC 2G4TA 1FMGA 1Y3YA 1NESE 4KKDA 1UTQA 2BVRH 2GDEH 5B6OA 1UCYK 2QAAA 1O5FH 1DT2A 2QF4A 3A8CA 4FUBA 1MUEB 3GCNA 3H09A 5PTPA 3SJOA 1ANDA 1ETSH 1V2VT 3FANA 1P05A 1YLCA 4HFPB 1G32B 3ATIA 4Z6AH 4ASHA 1UCYE 2ZFTA 4IN1A 4H42U 2DE8A 3LC3A 1A5HA 1KTTB 1P9SA 4I8GA 2GD4B 1VKYA 5A09A 1VZQH 2BOKA 2GV7A 5CHAB 4KTUA 3PYHA 1W13U 5FHTA 4IMZA 1S83A 4HZHA 8GCHF 3BG4C 4D7GA 2BQ6B 5DP6A 1KXEA 3E16B 2JH5D 5FCRA 2C8XB 3F9EA 4WY3A 1SGFA 1NU9A 4F55A 2KR7A 4WH6A 1EZXC 1QB6A 2Q6DA 1O2MA 2H5DA 4YLUA 4B75A 2BY6X 1RS0A 3T2NA 5FL7D 2A0QB 4DIIH 3SNDA 1MCVA 1C5WB 2ALVA 4B1TA 2O8TA 2CMYA 4FUIA 1C1RA 2SNWA 2GZ7A 1UTLM 1G3BA 1OWHA 1YPMH 5BPEA 3OE7D 3S7KB 2AS9A 5F6MA 1IQNA 3PV2A 1HJAC 1BMMH 1P2QA 1GJAB 4AYVB 2QV1A 3RUOA 4DY7B 5L2YH 3EQ0H 1TRMA 2FI5E 7LPRA 2A5IA 4JCNA 2PKAA 4FUDA 2QN5T 1GI6A 5ESBA 1GBIA 1W0JD 3MOCA 2B5TB 2AERH 3OFND 1YWUA 1HAHH 1W11U 1PPCE 5F03A 2LPRA 4WMDA 3ZZCA 3SV9A 4X6OA 1TMUH 2F9OA 1VGCC 3P8FA 1C2HA 3HPTB 2EI7A 2EQNA 3GCTG 2GMTC 1LHCH 3TH3H 2JJ2D 3MO6A 4Q7XA 4YZUA 4B73A 1MD8A 1N6XA 1TE0A 3RLYH 1DANH 2AFQB 1TBZH 4IC6A 4A1XA 1K1NA 1UHBB 1J17T 4ZKSU 3DA9B 3ZZ7A 3M5MA 2P3FH 1QA7A 4E06H 3ZZ8A 1QL9A 1U6QA 1GG6B 4ZAEA 1P0SH 3I77A 2NU2E 1A3EH 1XVMA 2WINI 4ZHMU 1SBWA 3A81A 2BHGA 1LDTT 4E7RG 5I46H 2YMSC 2FOAA 2BDHA 1AZ8A 4VGCB 2BX4A 4NSYA 2H9HA 5C0UA 3RXAA 1QURH 1LHDH 1TX6A 1HIAA 2AGIX 3NKKA 4Y8ZA 1LKAA 3BTME 2ANMH 5DP5A 2Z9JA 2IJOB 3T28A 1LVOA 2GKVE 3STJA 1HPGA 1G30B 2P8OB 3RMOH 5FBEA 5EQRA 2H9EH 5EIYA 4NG9H 2BDCA 1QCPA 2BDGA 3BTDE 2BX3A 4XD7D 2NU1E 1HLTH 3QUMP 3RXEA 4NSVA 1ZTKA 3MH7A 1AUJA 5TCAA 2ANWA 4K69A 1CA0B 1G3DA 1WBGB 1LHEH 3SJIA 5AFYH 1TIOA 1QHRB 2G51A 4CR9A 2CHAC 3RXGA 3GCHC 5E8EH 4K8YA 1HB0B 2EEKA 3VB7A 5AFZH 2BM2A 1GL1A 3BIUH 1JRTA 4FU9A 1DITH 1WUNH 1GHYH 2FWWA 1VCWA 1O3IA 2ODPA 2ZGJA 3DUXH 2Y5FA 3TJUA 3ZZ6A 1ARCA 3FP6E 1W7GH 1VJ9U 1O38A 1THRH 2XBXA 2KAIA 3MNXA 1V2ST 3PLPA 2SNVA 2JJ1D 1B0FA 2HALA 3PROA 2YNBA 5EPYA 3BTFE 2L74A 2QXHA 3FP8E 1C2LA 2AIPA 2B8OH 3ZVDA 2TRMA 4RT0A 1T7CA 1PPBH 1A4WH 4FUFA 1W2KH 1ZMLA 2ZFRH 4I7YH 2XWBI 3LOXA 4F4OC 1DM4B 3RU4T 3SBKA 1EJMA 4XDEA 4R0IA 4K60A 3M5NA 2ZCHP 1V2TT 5JPMH 4I86A 5I25A 1GMDF 1CBWC 3AAUA 3NWUA 2GCHG 1CSOE 3MO3A 4JMYA 3LJOA 1GHZA 2Y81A 2ZCLP 3MNCA 1FAKH 4Y8XA 2QXIA 3RXOA 1LKBA 2WPMS 1GMHG 1QFKH 1YY3A 1C5QA 1O2RA 5FBIA 5CHBA 3LONA 2SGDE 1O2YA 2Z9KA 5CE1A 1SGRE 1FY8E 3PB1E 2UWLA 5EW1H 4JK5A 4ZMAH 1ORFA 3D62A 1ZOMA 3PWBA 1TMTH 1GGDB 1QRZA 5EODA 1QR3E 1O3OA 3Q3YA 2AGGX 3F1SB 3CNRA 2A1DB 1A0LA 3A7TA 2XTTB 2JH0D 3KF2A 1G3CA 1V2JT 6ESTA 4XBCA 5A0CA 2ZU5A 3UAIC 4ACAA 1C1VH 3W94A 1BBRK 2BD8A 2GTBA 1NFXA 2BDIA 1ZR0A 1P2NA 1O2PA 2P95A 1FPHH 1JIRA 5GIBA 3LKWA 2VB0A 1YCPK 4DOQA 3UWJH 3QTVH 1GPZA 1PPHE 1S6FA 3TNSA 3IITA 1E34B 1SQAA 4A5TS 1O5EH 1VR1H 1BBRE 1O2GH 1P8VC 3RC6A 4DG4A 3HGNA 1KLTA 5L2ZH 1UW7A 2WSSD 3SU3A 2ZFPH 1EATA 4D9RA 3ZYDA 2GZ8A 3MFJA 4GUXA 1ESAA 4CRFA 1P10A 4BTTB 1YPKH 4XOJA 1J9CH 3KEEA 1V2WT 3A7YA 4O3UA 1UVSH 2KCAA 1CT2E 4U32A 2CF8H 3GY3A 4YO9A 3FVFB 2I6QA 1IHSH 2QA9E 4YTAA 3UOUA 2PHBA 4K5ZA 1PJPA 3SNCA 1OX1A 3SJ8A 4U2WA 1ELVA 2V3MA 4XRNA 1BDAA 4B6FA 2EI6A 3SV7A 1WDIA 1WV7H 3K6YA 1GJ6A 1GBHA 2F9UA 3OYPA 3U28C 2ALPA 3OU0A 1YLNA 2A31A 4X2YA 1KLIH 4Q4LA 3S9BA 3UFAA 3HK3B 1W3CA 2R0KA 5DG6A 1C5PA 2F3CE 2FTMA 1NRNH 4AGKA 1C1UH 2BLVA 2AMQA 2QGRA 1TONA 5GDSH 1TPPA 3SU1A 2OXSA 4B2BA 2Q6FA 3LGUA 2GX4A 3UQOA 1FIWA 3SO3A 4XSKU 1AQ7A 2OBOA 1ARBA 1MZDA 1H9LB 3GCTF 3D49H 5C0TA 2FOMB 1P2JA 4MG3A 2BTCE 3RXTA 3A86A 4FUJA 4BAKB 2SGAA 1E0FD 4YLQH 5K7RA 3RXJA 1YPEH 2W5EA 1HFDA 1EPTA 1G36A 4ABBA 2XYAA 4AFSA 1P04A 4NCYA 1BJVA 1MCTA 2IPQX 3RXHA 3MU0A 3F2FA 1GBEA 1O35A 3MHWU 1WU1A 1NC6A 1P09A 2A2QH 5DPAA 1DUEA 4AZ2B 1LMWB 2CGAA 3TK9A 3LT3A 3VXFH 4A92A 2CJIA 2BY5X 1P2MA 1TYNA 5TJXA 2Y80A 1GWAA 1MBQA 3DHKH 3AASA 2HOBA 2DE9A 3DFJA 1TA2A 2XBVA 2FOEA 2HNTC 1LPZB 3MH5A 1GHVH 2FM2A 2Q1JA 4LXBH 5HMAA 1CHOG 1DY9A 3RXSA 5EXMA 5JBBS 2QY0B 2UUFB 1O2WA 3EE7A 2PWXA 9LPRA 3BTHE 4Y8YA 1GCTC 2D2DA
chains in the Genus database with same CATH topology
2FI4E 4JZDH 3SOSA 1BJUA 1O30A 1P02A 1V3XA 1P11E 2QYIA 4NA8A 1O39A 3E0PB 1K1JA 1LVBA 2BY8X 1ZHRA 5GXPA 1TLDA 1DWDH 1HBTH 2J94A 2V35A 3EGKH 4K8BA 5AVDA 3E6PH 2CXVA 3GDVA 2R0LA 1THPB 5JBCS 1GBMA 3BTKE 2Y5HA 1E38B 2F9NA 1IQKA 1UTMA 3R0FA 4K1SA 2OCVB 1O3CA 3GCOA 1AWFH 2PV9B 4UFEH 1FN6A 4GPGA 1F7ZA 4GLYA 3KQCA 4B2CA 2GV6A 1WTHD 3TH2H 3Q77A 1AKSA 1GDNA 2C3SA 5ETXA 1AE5A 1F0TA 1TQ7B 2ZDVH 3HKIB 4CRGA 1T8OA 1RRKA 1H9IE 5LGOA 2ZFQH 1C2IA 2P3TB 3ZVGA 3RXUA 1L4ZA 1UK3A 1J16A 3QWCH 3I78A 1ZLRA 1WQVH 1LCYA 1NM6A 1MU6B 4NIYA 6CHAB 5EXLA 1BRBE 1OWIA 3SUGA 4ABEA 3KNXA 1WOFA 3A83A 1DLEA 1V2KT 1W0ZU 1EZQA 1SHHB 3UREA 2RG3A 4K3JA 3VB3A 5JB8S 1O3DA 1Z7KA 3GY2A 3RXPA 1MTSA 4WVPE 1C5ZB 1GMHF 1P57B 1Z8IB 3SUFA 1N8OB 1AI8H 3ATMA 6GCHG 1NO9H 2Y7ZA 3URDA 1SR5C 4ZKOU 1OPHB 4ABIA 2PGBB 1HAIH 1EX3A 2WPIS 4FUEA 1MTNB 4DURA 2Y5GA 1YF4A 2FI3E 2GT7A 4I8LA 1A46H 1O2IA 3ATLA 1EB2A 1TAWA 4MQAA 1NRRH 1H9HE 1NN6A 3DFLA 4I33A 4OGXA 2FOGA 3RM0H 3BF6H 1A7SA 3HGPA 2F9BH 2ZPRA 1GJ9B 3E91A 1AZZA 4Y71A 1ZHPA 4J2YB 1BRUP 1O33A 3PWCA 1EASA 4ISLA 4J1YA 1L1JA 3PO1B 1SOTA 4Y10E 3ZVFA 1BB0B 1F92A 1D9IA 2BDBA 5HGGA 7GCHG 1GVLA 1F0SA 2FP7B 4JZFH 3VEQB 3UR9A 1UMAH 1HNEE 1GHBG 1ZHMA 1K21H 2C8ZB 2IPHA 3SV2H 4LZ4B 2W3KA 1K2I1 2JETB 1TNIA 2J2UA 2EA3A 2BDYA 3SU5A 3PMHB 2R3YA 2UUKB 4AB9A 4GSOA 2NU4E 1OOKB 1JXPA 3DT0H 5GCHF 1CE5A 4WH8A 2H6MA 1ZSJA 1JBUH 3RXDA 1O3JA 3BTWE 4M7GA 1MTUA 4BXSA 3M5OA 1Y3XA 2AMPA 2ZDAH 1LTOA 3EA9A 1UO6A 2FESH 3S0NA 1AVGH 4X8VH 3P70B 1BITA 3H7TA 2Z7FE 5HYOA 1TRNA 1OYTH 2PW8H 4D7FA 2BXUH 4CRAA 4MPUA 2O8UA 1MBMA 1HYLA 3ZZDA 3L3TA 3U9AH 1AN1E 2CN0H 5K0HA 2BD2A 4HTCH 1T32A 1J14A 1TFXA 1AB9C 4FXGH 3TU7H 4LZ1H 3KGPA 1RXPA 1F5RA 3SI4H 4ESTE 1MKWH 2ULLA 2ZG0H 3MU4A 4DT7B 5C2ZA 4AG1A 1ESTA 1KYNA 1AUTC 2VIVA 2BXTH 2A7HA 2WUBA 5FPYA 2BMGB 5C1UA 5C5NA 1FY1A 1MQ6A 2A32A 2BOHB 5A8ZA 1NZQH 2SGEE 3ZZ4A 4CRDA 1O3BA 4GCHG 2FTLE 1EAXA 2GCTB 4XE4A 4K1EA 1O0DH 3M36A 5AHGH 3D65E 3UWIA 2ZI2H 5JBTA 1EUFA 4WWYA 2ZF0H 3OY6U 3MNBA 4ZHLU 3TGJE 3ZVEA 1HAZB 2W3IA 4U30A 1O3PB 1CVWH 2A4QA 1ELTA 1QQ4A 2VIOA 2ZWLH 1RIWB 2P3UB 4ZROA 2LNCA 3FFGA 2ZU3A 2ZU4A 5CMXH 1G2MA 4AFQA 5HXFA 1NFUA 1XUGA 1BUIA 1P12E 2D8WA 1L2EA 2I6SA 5EOKA 1UVPA 1GJBB 1QRXA 2J92A 3NZIA 4ABDA 4YT6H 1LQDB 1QB1A 2G00A 2FZZA 4FVBA 3NCLA 1GBKA 2QF0A 1NRPH 2GVFA 2XBWA 1C5VA 1JOUB 4Q7ZA 5GPIB 1O3AA 2VWOA 5H4IB 2SFAA 1CT0E 1WYKA 5EQQA 3Q00A 1NY22 4UD9H 1Y5BT 1HV7A 4ZXYH 5C20A 2W7SA 2FXRA 1O3NA 4B74A 2Z3DA 2H9TH 1FNIA 1J15A 3FZZA 1FY3A 1TB6H 1ZTLA 2ZA5A 1CHOF 1E35B 4X1QU 3TVJB 1KLJH 3BTTE 1XXFA 4CHAC 3SU4A 2D26C 1ID5H 1S85A 4D9QA 2FODA 2HPPH 1EXFA 1F2SE 1SQOA 3KQBA 1WAYB 4CRCA 2BZ6H 3VFEA 1UK2A 1P01A 2NU3E 3SZNA 4KTSA 1RFNA 3RMLH 1EKBB 1AVWA 4FUHA 1G2LA 1O36A 2ZHWH 2JETC 1O3GA 2FS9A 1P3CA 2VIQA 3S69A 2Z94A 3O8CA 1HAVA 4YT7H 1BTHH 1CGJE 1MAYA 1S0QA 1UJ1A 1ZMJA 3PMBB 5A8XA 3F9HA 4KGAA 5E2OA 3SU6A 3UOPA 4Y79A 1PPFE 2AMDA 1EAUA 2HLCA 1DLKB 1QL7A 2VWNA 3BV9B 1HAYB 1OS8A 3RDZA 4XBDA 2VWLA 1O5BB 1ABIH 2GP9B 1ZJKA 1YPLH 3ZZBA 2A5KA 3KCGH 4IC5A 3SUDA 1BMNH 1GI9B 1A5GH 3GYLB 4GHTA 1XUKA 2BD5A 5CHAC 1T4UH 2TIOA 2ZPSA 2J34A 1F0UA 4NWKA 3MI4A 3TH4H 2PGQB 2R2MB 1QNJA 3BTQE 3QZQA 1SGIB 2OP9A 3LGIA 1OYQA 3T29A 1FQ3A 3FP7E 4AYYB 1INCA 1NFWA 5FXLA 2VVCA 1PPGE 4F49A 4YESB 1YPHE 1O37A 4IS5A 4I32A 1C5OH 3SHAH 2UWPA 6GCHF 4OS5A 1FPCH 2OC8A 4Y11E 4O3TA 3CS0A 5DK1A 3HATH 4MNXA 2IN2A 4AGJA 2GT8A 2ASUB 3RXIA 1GBBA 2BLOA 4BAOB 5F8ZA 1YBWA 4MNVA 1Y3WA 1UVTH 1GBFA 1XUFA 3RP2A 5F8XA 1EPTB 1FIZA 1P03A 4FU8A 5IDKA 3SI3H 1GJCB 1QB9A 5E0GA 1V2PT 1KXCA 3EE0B 1O2TA 7GCHF 3TPIZ 3SQEE 1TMBH 1UVUH 1ZTJA 3TJOA 4JYUH 1GHBF 2BD3A 1JWTA 4WF8A 3PLBA 4ABAA 2V3HH 4FVDA 1BTWA 1EP5A 1NROH 3A84A 3E3TA 3MU8A 5FAHA 1GG6C 4NGAH 1GI1A 3MU5A 1C4Y2 3P17H 1GJ8B 1CGHA 1GJDB 1Z8RA 1RTLA 2OLGA 1C1OA 3MNSA 1SVPA 1GJ7B 5FPTA 5C3NA 1SC8U 1FV9A 4VGCC 1IQHA 1O5AB 3U8RH 1AFQB 3E8LA 1CQQA 3GISB 3KHVA 4Y7AA 3V13A 4CBNA 3RU4E 1C2MA 3EYDA 1TNKA 1GVZA 1L1NA 1VJAU 1QL8A 3ZVCA 2B0FA 3LJJA 2P8OC 3SV8A 4AX9H 2YOLA 1DFPA 1VCPA 5EU8A 3GY7A 3RXBA 5HM2A 4FUCA 1KY9A 1ELFA 1MMJN 2D1JA 3NXPA 1PPEE 3K65B 1CA0C 1HUTH 1FY5A 2J38A 4X2XA 3R3GB 5DJ7A 2PKSB 4WJG2 3O8BA 2OC7A 1AY6H 1C5NH 4YOJA 1ZPZA 3OX7U 3KL6A 5FPSA 1PQAA 1O2LA 3OSYA 5EW2H 4CREA 4UFDH 2XBYA 1GHXH 1EJNA 5TCCA 3PTNA 2GGVB 4GAWA 1Y3VA 4GCHF 3SGAE 1DS2E 3BTGE 4SGAE 3TGIE 2A4RA 3UIRA 1D4PB 4MPXA 1W8BH 2FOHA 4NIWA 4A6LA 3B8JA 4ISHH 1TGBA 2WYJA 2ZP0H 2BY9X 3P95A 1XUJA 1MH0A 1UTJA 4JYTA 3SJKA 2ZDNA 2AEIH 1SGNE 1V2RT 3W95A 2M5TA 5J4SA 3RXCA 1P06A 8GCHG 1SGTA 5DP3A 4RSPA 1SFIA 1JRSA 2HGTH 3VPKA 8LPRA 3ZZAA 1GBLA 4Y0YE 2R2WU 1D3DB 2ZHFH 2O8WA 3QGNB 1GJ5H 2QF3A 2VINA 1BOQA 3PM3A 2RA3A 4KELA 1XKAC 4DGJA 3BEUA 1IOEA 2BVSH 3MYWA 1C1TA 4BNRA 1Q3XA 2FPZA 1C2JA 2ZQ2A 2XCFA 3TLOA 4H6TA 3SORA 1GI5A 2FLRH 3I29A 3ITIA 2JKHA 4ABFA 1M9UA 2ZTZA 1C2FA 1A0HB 3A80A 1ANBA 3U8OH 3WY8A 1GL0E 1KSNA 4HGCA 5E2PA 1GGDC 2ZECA 5EGMA 4H6SB 3LGTA 3QN7A 3A7VA 2P93A 4GHQA 1W7XH 1AFEH 3RMNH 3RXVA 1D3QB 1AWHB 2O8MA 5C1XA 4ZH8A 1O2SA 1P9UA 1V2LT 3SGQE 3RU4D 1WQSA 4TY6A 1P2KA 3RMMH 4JZ1A 2J95A 1UVOA 2QXJA 2ANKH 1RGQA 3VXEH 1A61H 1DUAA 1EZUC 1DPOA 1L1GA 3VGCB 2EI8A 1Y5AT 1F5LA 1OKXA 1SGYE 3T27A 3URCA 2XW9A 1NRQH 4NWLA 4BTUB 3GY5A 3HK6B 1FI8A 3T25A 1H1BA 2UUYA 1OP8A 3EA8A 8ESTE 4AB8A 2AIQA 1E36B 1O34A 4X2WA 1D3PB 2EC9H 4E05H 1NPMA 2RDLA 3M7QA 1GI4A 1MKWK 1MTVA 2F83A 5G4BA 1QJ7B 1NFYA 1ELCA 3BN9A 1HRTH 4I31A 4UONA 2BYAX 1IQLA 1DDJA 2TGAA 1BRAA 1EJAA 1BRCE 5SGAE 2PSXA 1BTYA 2ODQA 1C5TA 4ZHAA 1XUIA 3A7WA 2G4UA 4I8KA 1FY4A 1SGDE 2THFB 1OXGA 1BT7A 4JK6A 4UE7H 3D23A 4Y7BA 1ELAA 2HWLB 3U69H 2R3UA 3BG4B 3ATWA 5A8YA 3UR6A 1TX7A 1ANCA 2CF9H 4AN7A 1PQ5A 3A89A 1DXWA 1SLVB 4UFGH 1DSUA 1HGTH 2GCHF 1PYTD 2OTVA 4ZXXH 3P8OA 1E37B 1BCUH 4Z0KA 2XC0A 1OSSA 2Z9LA 4Y6DA 2XCNA 1TPAE 1NS3A 3JZ1B 3SGBE 4UEHH 2G5VA 2SGFE 2Y82A 2PKAB 2ZFFH 2AH4X 5T3HA 3OTJE 4CBOA 1NRSH 1ZPBA 1C5XB 3GY6A 3NPSA 1UTOA 1V2OT 2V3OH 1HJAB 2OC1A 4Q80A 4D8NA 1FXYA 1MQ5A 1VITG 3LDXH 3L6PA 1W0YH 1EZSC 4TY7A 1C5SA 1TNLA 4D76A 1BTZA 1TABE 1RTFB 1O3FA 1DY8A 4LK4A 3ZV8A 1GI2A 1SLWB 1Z6JH 1EP6A 2BLWA 4B2AA 2PLXA 1L4DA 1QIXB 2G52A 3RC5A 1AIXH 3LIWA 3QTOH 4JYVH 4ABJA 1SLUB 4X6NA 3E1XB 4BTIB 1O2UA 3QO6A 2F9PA 1VGCB 1C9TA 2P59A 3LH1A 4I8JA 2VVUA 3A82A 2GMTB 2XWAA 1L0ZA 3IWMA 1ZGVA 1BIOA 1A2CH 2BD4A 3S9AA 1DVAH 4AOQA 3SU2A 3BIVH 1GBTA 1GCDA 3KQDA 1OP2A 2H1UA 2UWOA 4OS1A 3UPEA 2W26A 1GHAG 1SGPE 5ESTE 3IG6B 1C1SA 3K6ZA 1W12U 1A1RA 1QJ6B 1HIAB 2PFEA 1QTFA 4ABHA 5DP9A 1ZRBA 3KIDU 4THNH 5EPNA 4DCDA 2BB4A 4MDSA 1HAVB 1DX5M 1MAXA 4YM9A 2BDAA 1W10U 2FX4A 3AW1A 3LGVA 4NZQA 1ZJDA 1C1PA 1Y59T 1FN8A 1SLXB 4O97A 1HAGE 3LH3A 5JB9S 1O3KA 4WXIA 1C5MD 1NT1A 3A7XA 1IQMA 3SV6A 1PFXC 2VVVA 1KDQA 1O31A 4RKOB 3MWIU 3EAJA 3CENA 1QQUA 2G55A 2R9PA 1YP9A 3C1KA 4Y0ZE 1YKTA 2Y7XA 1DWBH 1Q31A 4YOGA 3P8GA 2ODYB 4IBLH 1HAXB 3ZYEA 1K22H 2KAIB 2CHAB 1UTPA 3GCHB 7ESTE 1T8MA 4BXWA 4DJZB 4CR5A 1H8IH 4QT8C 1XXDA 1ZSKA 3AVZA 3CS7A 3VB6A 4X8SH 2HNTF 3BEFB 1O2HA 3M3VA 4RKJB 3TK5A 1TNHA 1MKXH 4XBBA 3K2UA 5JDUB 1Y8TA 4IGDA 4ISIH 3H5CB 2J9NA 1N6YA 1O3MA 5FCKA 5EG4A 4X8TH 2A4GA 1HAPH 4IN2A 3V0XA 1K28D 2Z3CA 4IMQA 1JMOH 1HJ9A 4X6PA 3Q3KA 3GY4A 1DWCH 2TPIZ 1CGIE 5ABWA 2FLBH 6CHAC 1SL3A 1HJ8A 2FDAA 2IOTA 4XFQA 4AORA 1CA8B 1Z8GA 1GI7B 4MPVA 2J4IA 1ZPCA 1AVXA 3RM2H 2FEQH 2P94A 1GBAA 2C8WB 1N8OC 1O2XA 1CBWB 2STAE 3FAOA 4UDWH 1ZZZA 1BMAA 2F91A 1XUHA 2ZDMA 1SOZA 3ZZ5A 3M37A 3ODDA 1H8DH 3O8RA 3KQEA 1VITH 1DSTA 1MTNC 1P3EA 2A45B 1O2QA 2STBE 3RLWH 4FU7A 1THSH 3M5LA 3SUEA 3K9XB 2H5CA 1RD3B 5E0HA 1EQ9A 3SHCH 1LQEA 1TA6A 1K1PA 3PO1C 2QCYA 4X1NU 1RTKA 3BSQA 1Z1JA 3ATKA 1XMNB 3U1JB 1QGFA 1T8LA 4INKA 1QBNA 1SSXA 2ZO3H 2WPKS 3A8BA 3B23B 1LHGH 4B71A 1HCGA 2AGEX 1LO6A 3V3MA 3HKJB 1IQFA 2XXLA 1V2NT 1B5GH 1C5YB 1YC0A 3BTEE 1AMHA 1IHTH 3M35A 1P2OA 5BRRE 2G8TA 4JZIA 3A85A 3LGWA 4ISNA 1SHYA 2K1QA 2ZIQH 1GDQA 1SPJA 3SNBA 1AE8H 2BD7A 2VGCB 1TNJA 3DD2H