3OX7U

The crystal structure of upa complex with peptide inhibitor mh027 at ph4.6
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSALAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The binding mechanism of a peptidic cyclic serine protease inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 57
structure length 245
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ox7U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ox7U01
2PKSC 1CT2E 3EGKH 1BHXB 3VB7A 1BRCE 2ZU1A 5E8EH 2XBVA 3PM3A 1DFPA 1TABE 3WY8A 1CO7E 1FY1A 3LGTA 3BTEE 4XBDA 4M7GA 2TGDA 1ZOMA 1F2SE 3A7TA 1C1TA 1K21H 5A09A 1YCPM 2A45B 4CRDA 3SJKA 4UFFH 1EASA 3TIUA 1C5QA 4CRBA 2Y6TA 7GCHF 1Z8JB 1O2QA 3M3SA 1OOKB 1YKTA 5LH8A 4BAHB 3PTNA 2BD5A 1TLDA 4ZMAH 1GI8B 2G4UA 1OP2A 1TPOA 1YPHC 1MKWK 2A5KA 4X6OA 5LPFA 1EAWA 3BG4C 4FUIA 3V3MA 4OGXA 2R3UA 1QA7A 5AVDA 1O5CB 1A3BH 1Z8GA 1YCPK 1GI3A 1P01A 2FOAA 3W95A 5ETXA 2G5VA 5A8XA 4CBOA 1TB6H 1OYTH 1LKAA 2PTCE 1MAYA 2VU8E 4Y7AA 4X1RU 4ZKOU 4WY3A 1MKWH 2KAIA 1O5FH 1VJAU 1VCQA 1ZJKA 4F4OC 1O32A 3DFLA 3GCHB 3MOCA 2GP9B 5AFYH 2GDDA 3A8DA 2XC0A 4U32A 4NIWA 3NXPA 1F0UA 1C9TA 1LPGB 2VGCC 4UE7H 2GKVE 1KLIH 3ZZ4A 4TY7A 1GBTA 4OS2A 2D2DA 3T2NA 1DY8A 3S9AA 2ZC9H 1GBJA 2FTLE 1SGIB 5HM2A 3PLKA 4OS4A 4IGDA 1RTLA 1YF4A 4X6MA 2DE9A 4E05H 1LVBA 4HGCA 4I33A 2OTVA 1ZRBA 2G5NA 2QGRA 2ZFSA 1MQ5A 5LPEA 4K1TA 1SGYE 1K1IA 2BVSH 3KN2A 3RMNH 3SU4A 1GL0E 5L6NH 5DP8A 5LGOA 1EPTC 3BSQA 1SMFE 1P12E 3UOUA 2A1DB 4WXIA 3DFJA 1GJDB 4NG9H 2F9VA 3NPSA 1QQ4A 2BY6X 3E0PB 5G4BA 3ENSB 4ZAEA 1W0YH 1SOZA 3NK8A 1LHGH 4LZ4B 2OBQA 4JK6A 4SGAE 1UTLM 1J14A 1GVZA 1L1GA 2GCHF 2ODPA 1BDAA 4Y11E 1WV7H 1BRBE 4Q7ZA 4X1SU 2EI6A 1MZDA 1T8MA 2AS9A 1PQ8A 5FXLA 1DSTA 2WPLS 3ZV8A 2AFQB 4YT7H 1QTFA 1SLVB 1DLEA 2BD3A 1RXPA 1P9SA 3ZYEA 1HDTH 4JZFH 1AKSA 3LGYA 1UTPA 5DJ7A 2HNTE 1KTSB 3P17H 2W3IA 1IOEA 1VZQH 1O38A 2H5DA 1FONA 3I78A 3GCTF 3P8NA 1CHOG 2P93A 2QXGA 3RMMH 2WPHS 3E1XB 1OSSA 3MWIU 2HWLB 1ELBA 1GI6A 1O39A 1NU9A 1BHXF 2NU0E 3E0NB 4R8TB 3GDVA 3RXVA 1NM6A 4Y8XA 2FO9A 1HAVB 1KXAA 1PJPA 2OP9A 1B0FA 2ZF0H 2PFEA 3T25A 4FUBA 1DXWA 2A4OA 1BTYA 2Z9IA 4AB9A 2ZHDA 2GTBA 1K22H 1F92A 3QX5H 2Q6FA 2EA3A 1SG8B 2D1JA 1G3DA 1TRNA 1C1RA 2UWPA 3MFJA 1MAXA 1ELTA 1MCVA 1PPBH 1EAUA 1SLXB 5K0HA 2XBXA 1SB1H 3FZZA 3SNEA 2QA9E 1BMLA 2ANYA 4Y8YA 1GBFA 4AOQA 1UCYK 2VH0A 3ATKA 4UEHH 1BZXE 1MMJN 4I32A 2A4QA 3MYWA 4K5ZA 1K1NA 2HPPH 4X2WA 3ZZ6A 4BTIB 1SGEE 3TH4H 1W8BH 3OU0A 4IC5A 5FX5A 5TCAA 4A1TA 1ZSJA 2FI3E 3A7XA 1QB6A 5A2MH 3T62A 4X8SH 4ASHA 1PYTC 1C1NA 4ABJA 3RXHA 1DUEA 1UCYH 1NN6A 1GHBF 3H7TA 5AHGH 1JIMA 2TRMA 2Y7XA 5CHAB 3LGIA 3ATWA 4X1QU 2Y7ZA 1N6XA 1C1SA 3CS0A 5TJXA 1NU7B 1TBRH 4I8HA 4AYVB 3S9CA 2I6QA 3QTVH 1AE8H 2C3SA 3L6PA 2CF9H 3L3TA 3LKWA 1KXBA 3V7TA 3ZZCA 2SGPE 4WH8A 4CR5A 1NPMA 2AMDA 4KTUA 1GBIA 1HV7A 4K3JA 1O5DH 1C5PA 3A7VA 1O30A 3AASA 2FOCA 4ISOA 1C5UA 1YPLH 3SI3H 1GBLA 1ZJDA 1O5EH 2FZZA 1HAPH 3SJIA 1O3AA 1ZMNA 3M7UA 5L30H 1XMNB 1TALA 4FU8A 4GCHG 4DIHH 4YOJA 3SGQE 3UWIA 1UTMA 2FI5E 1YLDA 1ZHRA 2SNVA 3PLBA 4JZIA 1ID5H 1Y3UA 3CENA 2Q1JA 2P8OC 2GMTB 1C1QA 4MNYA 2FMJA 2CHAC 1GG6B 1K2I1 1TPPA 1W0ZU 1AB9C 1MCTA 1Y5BT 2J34A 1NC6A 1C1OA 1C5LH 3P8OA 1FY3A 2ZGHA 1QGFA 3EAJA 1V2UT 4TWWA 4CBNA 4DGJA 3GY8A 4DT7B 3F1SB 2PKAB 4NA9H 3A88A 8LPRA 4CH8B 2AIQA 1CQQA 1ANDA 3EA7A 8KME2 1TGNA 1DITH 3QWCH 1LHEH 2QXIA 2P16A 4ABFA 2GVFA 1ZSKA 3RDZA 1K1OA 2J2UA 1GBHA 5EXMA 5B6OA 4YT6H 2IN2A 2BD9A 1V2TT 3C1KA 1O3JA 2ZDAH 1KIGH 3TITA 1DOJA 4ZXYH 4FUHA 3TU7H 1SQOA 4H6SB 1DVAH 1ZLRA 4NWLA 1ARCA 2AGGX 1LPKB 2F9NA 3TNSA 2F9OA 5AF9H 4ABEA 3MI4A 4DURA 1TQ0B 2BHGA 1F0SA 1TRMA 1MUEB 2OCVB 2ZZUH 3E16B 1GMHF 1CT0E 3BTHE 4Z0KA 1HLTH 2F91A 4HTCH 2V3OH 4B1TA 3LGVA 1BUIA 1XUHA 2ZGCA 2YNBA 4YM9A 1MU8B 1DWCH 3RXBA 1IAUA 1CT4E 1TNIA 1P2JA 4BNRA 3OX7U 3PWCA 2ZP0H 1AGJA 3RXRA 3EA9A 1MTUA 1AFEH 4FUCA 2ZKSA 1P57B 3NCLA 2IOTA 1ZTKA 1HPGA 1JWTA 1GHBG 5FBIA 1QQUA 1YPHE 1T32A 1C4Y2 1P09A 1IQMA 1C1WH 1DS2E 1UJ1A 2C8WB 2BD4A 1KDQA 2AGIX 3S7KB 1C1VH 1L4DA 1FY8E 5EXNA 1OKXA 1GJBB 1IQHA 3VXFH 3S7HB 1GHAG 1GJ6A 3TGJE 1YPEH 3SZNA 2ASUB 1BTXA 1HFDA 4AORA 4H4FA 3LOXA 1NRQH 2BD7A 1S81A 1IQEA 1W2KH 1FAKH 2Z3EA 1B5GH 1ETTH 3ESTA 2PGQB 4OS1A 3OY6U 4GCHF 3DT0H 2GD4B 4INHA 1C5YB 3A85A 1S6HA 1ZMJA 1E38B 1WCZA 1V2NT 2VJ1A 3BTGE 1KXEA 1LPZB 2GCTB 3HATH 1LVYA 3KCGH 1ELCA 1Q31A 1A4WH 2UWLA 3BIUH 5FPTA 4YO9A 3RXKA 3RP2A 3RXOA 3F6UH 2FTMA 2JETC 3QUMP 4CRFA 3QO6A 2H1UA 4VGCB 2P3UB 3ZZDA 1D6RA 1AVWA 2WPKS 1BMNH 3S69A 3E91A 1N8OB 3A82A 6ESTA 1Y8TA 5EW2H 5HXFA 7LPRA 4FXGH 1O5BB 1NS3A 2Y5FA 2DUCA 3VGCB 1UVTH 3VB4A 4AFQA 3V0XA 2VWOA 1VGCB 2G8TA 3KNXA 1SGNE 4Y10E 1G2MA 1C4U2 3TGKE 3UNSA 1LDTT 3U1JB 3SORA 2B9LA 2GV6A 1G2LA 2R0KA 3HGNA 5EQRA 1DE7H 1JIRA 1SHYA 3HK6B 2BQWB 3O8BA 3P70B 4AFSA 2BY8X 3HKJB 1GMDF 2OC8A 4BAQB 4Q7YA 1JRSA 3AAVA 2A31A 3GICB 1OXGA 6GCHF 4UDWH 3RC5A 2GMTC 1EUFA 1DXPA 1AQ7A 1Y3YA 1AVGH 3UPEA 2FYQA 2AIPA 2Y81A 3ZZ3A 2RA0A 3BG8A 1TGBA 1SGCA 3M5NA 1V2KT 4A1VA 1XVOA 2UWOA 3M35A 1BCUH 2ZU5A 1O2UA 3PMBB 1CE5A 1GGDC 4E7RG 4B71A 1A2CH 5J4SA 2B7DH 4Y8ZA 1JMOH 1BA8B 2RA3A 3Q00A 4AX9H 2QV1A 1W13U 2XCNA 3SJ9A 3ZZ5A 5EU8A 1KXFA 4RN6A 1A3EH 4A1XA 3STJA 1O3CA 1XUKA 1ELGA 1TONA 2ZDMA 4GHTA 1GDQA 4TWYA 3ZVFA 1TOMH 2FLRH 2XC4A 4B2AA 1N6YA 1FI8A 1SGFA 1LVMA 4JYTA 1SHHB 1RD3B 1C4V2 1PPFE 4NCYA 3ZVCA 2P95A 5A0BA 1EZSC 3LH1A 4XE4A 2CGAA 2PKAA 2ZI2H 2OLGA 3ZYDA 1O2JA 1SPJA 1EATA 1A5IA 1UK2A 1EOJA 3OYPA 3SNAA 4DW2U 1C1UH 2J92A 1SGTA 1WQVH 1AKSB 1K1PA 4E06H 5E2OA 2I6SA 1EZXC 4IMQA 6CHAB 1N1LA 2OBOA 1AWFH 4O03A 4FUDA 5DK1A 4ABBA 4Y0YE 3OY5U 1O5GH 2BMGB 2BD8A 3ZVDA 4MPUA 1OWKA 2PHBA 2PTNA 4AG1A 4U01A 1O2WA 4X2YA 5ESTE 1QFKH 3LU9B 1XUFA 2Y5HA 1TGCA 1UK4A 2AMPA 1BTWA 1C5RA 2A7JA 2XBWA 1TMUH 1GDUA 1Y3VA 4E7NA 3PV4A 2F83A 5EPYA 1GCDA 4GHQA 3SI4H 5DP7A 2PGBB 1BBRH 3A8BA 1TIOA 3K6ZA 3QZRA 1AD8H 1Z8IB 2Z9JA 3UR9A 1EZUC 1XXFA 1A46H 4B73A 2VNTA 1D4PB 1T8LA 5EOKA 3HPTB 1HYLA 1UTKA 1F5LA 2FPZA 2LPRA 2UUKB 4X2XA 2IJOB 2THFB 3U8TH 4ABHA 1D3QB 1O2LA 3S0NA 4O97A 1GBBA 1GHAF 3NWUA 5EW1H 4MPXA 1PYTD 2B8OH 4BXWA 2ZG0H 3UIRA 2O8WA 3ATMA 1GDNA 1H4WA 5EQSA 3QLPH 2SGQE 2VVCA 1MTNB 1L2EA 2WPIS 2TGPZ 2ZQ1A 4DVAU 1J15A 5HYOA 2PSYA 2Z9LA 3ATLA 1GBKA 1O36A 2ZWLH 1GHZA 1NRPH 1HGTH 1O2RA 4YOGA 3TJUA 1VGCC 4BAOB 4A5TS 4NIYA 2F9BH 2H2ZA 4D9QA 9LPRA 1P3EA 3A81A 1FY5A 2ZFTA 2TGAA 3RM0H 1HAOH 1OPHB 3PMAB 3A8AA 1AWHB 1BTUA 1YC0A 1ZPCA 1QJ1B 4D7GA 1QURH 2TBSA 4LOYH 3UREA 4JMYA 2CF8H 1AI8H 1TA2A 2PR3A 2VGCB 4JCNA 3P6ZB 1LKBA 1G3CA 2WPMS 1RJXB 4AN7A 3K6YA 3TJNA 5DP6A 4K69A 1ELEE 2ODQA 3IG6B 1H8DH 1Z6EA 1JOUB 2FX4A 3UFAA 2BDGA 3PMHB 1FAXA 1PQ7A 4Q80A 2ZQ2A 3M36A 4OS7A 1LHFH 2FWWA 1L1JA 1GWAA 4MTBA 2QIQA 4ZH8A 4AYYB 3BF6H 4FUFA 1CU1A 2BXUH 2AEIH 1E0FD 3EDXB 3RXCA 2SFAA 1HAVA 2ANWA 3T28A 2SGAA 1W7XH 3A87A 2W3KA 5I46H 1Z7KA 4CREA 2WUBA 1HUTH 2XTTB 4ABGA 3KEEA 4I7YH 2BX3A 3UTUH 1O2XA 1D3DB 1QL9A 3JZ2B 3V13A 2OC7A 3LC3A 5HMAA 1GI4A 2BY7X 4LZ1H 1X7AC 3G01A 1GL1A 2C90B 1YBWA 1C2DA 3UUZA 2G51A 2Z7FE 1L1NA 3SV2H 3SNCA 1SSXA 3A7WA 2TPIZ 5BRRE 1HAXB 2FX6A 1ZTJA 2FM2A 1O3DA 2XYAA 1TBQH 3TK5A 1SOTA 1RTFB 3ODFA 1QB9A 3OTJE 3BTQE 1DICA 1OWJA 1EB2A 2PUXB 2ZU4A 1M9UA 1RS0A 1TMBH 1TNKA 4OS5A 1TGTA 1V6DA 1A0LA 1DPOA 4YOIA 3AW1A 1WYKA 4X1PU 1H1BA 5DP4A 1XUGA 1W7GH 2ODYB 1AHTH 5FCKA 5C1UA 1GJ4H 4JZDH 1FIZA 3T26A 4ABIA 1E36B 3TVJB 4YTAA 1OX1A 3QTOH 2HOBA 1UCYE 2OQ5A 1SBWA 1TNGA 2XC5A 1MD8A 1TX8A 5EPNA 2P8OB 3LJOA 1MTVA 4O9VA 1NESE 1T31A 3M7TA 5C1YA 2WUCA 5HM9A 8GCHF 2BY9X 1DANH 3O8CA 1GI5A 1WOFA 2CHAB 5E2PA 4JZ1A 1AMHA 2GZ8A 3PO1C 1MH0A 5L2YH 5C3NA 3Q3XA 2ZCLP 1CA0C 3KQEA 4X0WU 3RXJA 1VITG 1WU1A 2W5EA 2GT8A 1TBZH 1DM4B 1ELFA 1GHYH 1YPMH 1T4VH 1TMTH 4NSVA 1NFYA 1GI9B 2HNTF 5FCRA 1ORFA 3ZZ9A 5DGJA 1RTKA 4YLUA 1TAWA 3BTTE 1BBRE 3VFEA 2C8XB 5EQQA 2ULLA 2P59A 2BDYA 3BTWE 7ESTE 2NU1E 1NT1A 3ZZ7A 2Z6BD 2VWLA 3URDA 1DWEH 3L33A 1BJUA 2A7HA 1JBUH 1O2KA 1GMDG 1FDPA 4H42U 3SU5A 1ABIH 1TA6A 1DWDH 3RXFA 1HCGA 4ZHAA 1ZSLA 4Y71A 4K60A 2OD3B 1C2LA 1GHVH 3F9HA 4SGBE 1UMAH 1THRH 3LC5A 1BTHH 2D8WA 5GPIB 1S5SA 4ZHLU 2V3HH 2CJIA 3O8DA 8GCHG 2O8TA 1QBNA 1CBWB 3M37A 1WAYB 1V2MT 4U2WA 3T27A 1P11E 3UY9A 6LPRA 3B9FH 2ZO3H 3UQVA 4TPIZ 1MKXH 1VCPA 3A7YA 2VVUA 1DSUA 2ZPQA 1PPGE 5T3HA 4Y0ZE 1A5HA 2XW9A 3MMGA 1DWBH 1P03A 4Y7BA 1VJ9U 3UWJH 2FDAA 3SUFA 5FPSA 2J4IA 4AGKA 2JH5D 4I8KA 1NRRH 1TOCB 3VB6A 3SU6A 3A89A 1AFQC 1QY6A 3E3TA 4FU9A 1FMGA 2C8YB 1W3CA 2GCTC 2R0LA 4B76A 1O3KA 5E0HA 1G30B 1RGQA 1C5ZB 2BZAA 4LK4A 2PWXA 5GWZA 2PLXA 2JH0D 1AUTC 2VB0A 3BIVH 2B5TB 5DP9A 2KAIB 3EA8A 2BLVA 3GYLB 1WQSA 3RXUA 1GG6C 4I8GA 2P3FH 2OUAA 2GX4A 1F0RA 4OGYA 1YP9A 2FXRA 3LPRA 4Q7XA 3Q76A 3GCOA 4F49A 2BY5X 1N8OC 1GBAA 4KTCA 3U9AH 2AYWA 3VXEH 1XUIA 1Y3XA 1GJCB 2BDBA 3MTYA 2XBYA 1YGCH 4KELA 1GHWH 1QBOA 2K1QA 2BYAX 3SO3A 2M5TA 3VGCC 1AE5A 2R3YA 2BQ7B 1CGHA 3F9GA 3HK3B 2Y80A 2GV7A 2CN0H 1FPCH 3LDXH 3ATIA 1GBDA 3STIA 1NRSH 1B0EA 3MH4A 3BEUA 1BRAA 3HGPA 1F0TA 2NU3E 9ESTA 1GJ7B 1GI1A 1TRYA 3E8LA 4X8UH 2Z9GA 4GVUA 1HAYB 1HJAC 3SGAE 1DY9A 4IC6A 1JRTA 2QY0B 3UR6A 1WSSH 1HJ9A 1CSOE 3LJJA 5AFZH 4A7IB 2PUQH 2VVVA 3RXQA 1CGJE 1A61H 1RFNA 4WMDA 5FBEA 1IQFA 4WMFA 4D7FA 2W7UA 4ABDA 3RXAA 1DT2A 4NIXA 2GGVB 1GGDB 3BV9B 4NFEA 4TY6A 1ACBE 1IQLA 1H9IE 3LIWA 1J16A 2A5AA 5EG4A 1BTZA 5DP3A 4ESTE 1TNLA 1UVPA 2SGDE 2YOLA 3Q3YA 1P8VC 1ANEA 1BBRK 5GCHG 4RKOB 4DG4A 1HAGE 1KLTA 3MU0A 4UFGH 3URCA 1UVSH 3LONA 2V35A 1O3LA 4X8TH 5SGAE 3SU2A 3KQBA 1LCYA 1MTWA 3TH2H 4A6LA 2NU4E 4WVPE 1DUAA 1GMHG 1GHXH 2A4GA 1TE0A 3EYDA 2QF0A 3HKIB 5FHTA 1HAIH 1FZZA 1ETRH 3GY5A 1KXCA 2FOEA 2HVXA 4CHAB 3GY7A 2BB4A 5A0CA 3SUGA 2ILNA 1G32B 4UONA 2HLCA 2QXJA 4XBCA 4AGJA 3NZIA 1TX7A 1O33A 2BD2A 3D62A 3H7OA 1SI5H 2F9PA 2ZDNA 1O2PA 1NFWA 2EI7A 2H6MA 2ZFQH 2ZTYA 4JYUH 3SOSA 1SC8U 4TPYA 1CBWC 4MPVA 2J9NA 4VGCC 1O2ZA 4FU7A 2G4TA 3VB3A 1P2MA 5HGGA 1W10U 3M5OA 1P10A 1ZYOA 2WV5A 5A8YA 2H9EH 1BB0B 5L2ZH 2BOHB 5CE1A 3Q77A 5T6GA 1O3GA 3T29A 1A5GH 1O3EA 1UHBA 2HPQH 2WPJS 5GCHF 1UO6A 1V2VT 2STBE 1RRKA 1EAXA 5JBAS 4I8LA 3DUXH 3SN8A 3ZVAA 5JB8S 4ZHMU 5ABWA 1GMCG 5JB9S 1WUNH 1G9IE 4JK5A 1XXDA 4ZROA 2P94A 3FP8E 1QRWA 2HGTH 1HNEE 4D9RA 1EB1H 4K2YA 4BOHA 5H4IB 2GT7A 3KGPA 3KL6A 4Y6DA 4B2CA 1MBMA 2HNTC 4JZEH 1ZGVA 1C2KA 3KQDA 4DJZB 2J95A 4ABAA 2VIDA 1O2HA 2ZFFH 4ISHH 2ZNKH 2FLBH 2STAE 4IS5A 4U30A 2VH6A 4DIIH 1CHOF 1LHCH 4NA7A 1DX5M 3M5MA 2JKHA 2UUYA 4TYDA 3NKKA 2ZDVH 4D76A 4X6NA 1TPAE 5K7RA 3BEFB 1NFXA 1O2OA 1OYQA 1KXDA 3U8RH 5DPAA 4ZXXH 1W14U 4H6TA 3W94A 3GY6A 1GVKB 2YNAA 3PLPA 1J9CH 3AAUA 3AW0A 1E34B 1H9LB 1D3PB 7KMEH 5F8XA 5GXPA 1D9IA 2FEQH 4MLFB 3SV9A 2BX4A 3U8OH 1A7SA 1O3PB 1KYNA 1MTNC 2Z9KA 5FX6A 1SGDE 2QYIA 1C1MA 2PKSB 4IBLH 2FP7B 1HAHH 3SGBE 2WV4A 1GJAB 2ZPSA 1ELAA 2QC2A 3O8RA 3GDUA 3RXTA 4WXVA 5DO4H 1AN1E 1A0HB 1UTJA 1K1MA 5CMXH 1TYNA 2ZDKA 3MH5A 2DE8A 1TNHA 3GCTG 4Y76A 1Z1JA 2VIOA 1G3EA 2G81E 2BDCA 4AB8A 3P8GA 4NSYA 2ZU3A 2VWNA 3KIDU 3MHWU 5JBTA 2G55A 3ZZAA 1EQ9A 1ESAA 5FPYA 4WH6A 4AZ2B 1QBVH 3MH7A 3E6PH 1OWDA 2WYJA 3LT3A 4ZKSU 2QF3A 5DKMA 1SQAA 4I31A 3TJOA 2XWBI 1ZPBA 1FY4A 1NO9H 1L0ZA 4FUGA 1ELDE 1GBMA 2BQ6B 2NWNA 4GPGA 1BQYA 1Z8RA 4NGAH 1OS8A 2CV3A 1S82A 3IWMA 3RXDA 3Q3KA 1C5SA 1LMWB 1O2YA 3GDSA 3MNCA 3LH3A 3QK1A 3TNTA 1O3NA 1IQNA 3GCHC 1GPZA 4RSPA 4CHAC 3F68H 3R3GB 3A83A 2A7CA 1TQ7B 2CXVA 2QN5T 3MU4A 1V2QT 1TGSZ 1RIWB 2O8LA 4X6PA 5C5NA 4IMZA 3PB1E 1S0QA 1BITA 1FUJA 1QRXA 1U6QA 3RXEA 3FP6E 2F3CE 1O34A 6GCHG 1O0DH 1C2EA 3N7OA 4J1YA 1GCTC 1Y5UT 4K8BA 1HXFH 1LTOA 3DD2H 2ZTZA 4UFEH 5FAHA 3QZQA 3MNBA 4ISIH 2FI4E 3LGUA 4YZUA 1NRNH 3K9XB 3UNQA 1OP8A 1YPGH 1LQEA 1PPZA 1F5RA 1NFUA 2BDHA 2ZECA 1EPTA 3K2UA 3RU4T 1IHSH 4XFQA 5JBBS 1HXEH 4OS6A 4THNH 3TGIE 1LHDH 1J8AA 1ARBA 1MU6B 4MNVA 3GISB 3A8CA 1YM0A 1V2OT 1P2KA 2TGTA 3SHAH 3FZDA 4WF8A 1SR5C 2FIRH 1KLJH 2GDEH 1C5WB 1HIAB 3SQHE 2ZTXA 3FVFB 3ZZBA 3RXMA 2A2XH 3LGWA 1P2IA 4ISNA 2AERH 3PO1B 3BEIB 1EKBB 3P92A 1V2PT 4XDEA 5F6MA 1QIXB 1O31A 2NU2E 4XSKU 1QHRB 2FOHA 1V2JT 3U98H 3SJ8A 1T4UH 5TCCA 3SV8A 1BMMH 1O2TA 1G36A 1ZHMA 1K28D 2AGEX 1TPSA 3S9BA 2J94A 3M7QA 1C2IA 3M3VA 2XCFA 2Y82A 4PROA 3BG4B 1IQGA 1CA0B 2G00A 5A8ZA 1S6FA 2ZPRA 1Z6JH 3D49H 4MG3A 2VIWA 3MO6A 2GZ7A 4CRAA 2A0QB 3RLWH 1A1RA 4IN2A 1FLEE 2FS8A 1FQ3A 4CRCA 1ZR0A 5F8ZA 3RU4D 4J2YB 4K1SA 4ISLA 3BN9A 2FOGA 4DY7B 1O2SA 4HI3A 4AFZA 4B74A 1JXPA 3DHKH 4BAMB 3SBKA 5JBCS 1EP5A 1HB0B 1MD7A 2FS9A 1QNJA 4NWKA 1CVWH 1C5XB 1ESTA 1T7CA 3IITA 3TK9A 1HRTH 1ESBA 1EZQA 1XVMA 2Q6GA 3SHCH 3TLOA 1SL3A 1ELVA 5F8TA 3U1IB 1Q3XA 2ZCHP 3SU0A 1WBGB 2RDLA 1BJVA 1THSH 1V2LT 1OWIA 1IQKA 2JH6D 1FN8A 1SFQB 1TX6A 2P3TB 4K8YA 2VIPA 3MU8A 1P9UA 3PTBA 4Q2KA 4BTUB 1S84A 2RCEA 1UTQA 1FNIA 1CA8B 1WTGH 1Y59T 3MU1A 3QN7A 1O2VA 3A86A 1AFQB 3BTDE 4IN1A 2BXTH 4MNXA 5C2ZA 1Z1IA 1T8OA 2ESTE 4WWYA 5T6DA 2PV9B 1SGQE 3VPKA 1BTPA 3ELAH 1XM1A 2BOKA 1KDQB 1GJ9B 2ZA5A 1GVLA 2O9QA 1P3CA 1CGIE 4YESB 2OC1A 3SJOA 3TH3H 4KGAA 4XOJA 1EP6A 4GAWA 1V2WT 2FESH 2VIQA 3SNBA 3NUMA 1ZZZA 4WJG2 1H9HE 1YPJH 3KHVA 4FVBA 1YYY1 1UTNA 1FJSA 5E0JA 1O3FA 2ZHFH 1ANCA 3GY3A 1V3XA 3VEQB 5C5OA 1GI2A 1AZZA 1VCWA 1YLCA 1AY6H 2EEKA 1P02A 3P8FA 1GI0A 1C2HA 3RM2H 1VR1H 2ZFRH 2XRCA 2IPHA 5LPRA 2D26C 4FVDA 2ALVA 1F5KU 3PROA 2V0BA 1Y3WA 1QA0A 3SV6A 2BZ6H 1K1LA 2ZDLA 4NFFA 1EOLA 5IYTA 2H9HA 1S0RA 1S85A 3ODDA 1UTOA 1QCPA 1HJ8A 3GOVB 3K65B 4INLA 2EI8A 3UOPA 3UQOA 2XNIA 2ZHEH 1YPKH 4GUXA 2G52A 4YLQH 1LVOA 2BDAA 1ETSH 2VINA 2ZGXH 2C8ZB 4AFUA 2Q6DA 1FN6A 3F9EA 3M5LA 4MDSA 1HJAB 1C5VA 1O2IA 4NA8A 4Y79A 1FXYA 2FOFA 5GDSH 2R2WU 1GJ8B 3ZVGA 3SW2B 3FANA 1O5AB 1EAIA 1WTHD 3RUOA 1DLKB 3RXLA 1VITH 2Z94A 5BPEA 2ZHQH 3KF2A 3TJVA 3SV7A 4CH2B 2W26A 5EXLA 2SGEE 3I29A 4A92A 1PQ5A 2QAAA 2A2QH 3RMOH 1XUJA 1O2MA 1IQJA 4AG2A 3B8JA 1S83A 1W11U 2XXLA 1GI7B 2ZHWH 4ZKNU 3M3TA 5ESBA 1TFXA 3RXGA 2BLOA 1OWHA 4B2BA 2ANKH 1NY22 4CR9A 2C4FH 4D8NA 2QXHA 2FOMB 3ITIA 2CMYA 2VWMA 3M61U 2Z3CA 4X2VA 2B0FA 3T5FH 1CHGA 1QB1A 5DP5A 1Q2WA 1QJ6B 1AZ8A 1EJMA 1C9PA 2AMQA 1D6WA 1GBEA 1ZGIA 5DG6A 3SNDA 1PFXC 2FOBA 1C5OH 4NZLA 2BLQA 5CHAC 2PW8H 3QGNB 1ANBA 1C2FA 1FV9A 1EX3A 2BVRH 3SU1A 5JPMH 3GY2A 5JYIA 3RXIA 1PPHE 3DA9B 4XBBA 1W12U 1YCPH 4FUJA 3PMJA 4NZQA 1SGPE 2ALPA 1P04A 1K9OE 1O37A 2A5IA 1K1JA 3MNXA 1PPEE 3BTFE 1UK3A 1TNJA 5F03A 4O3TA 1KSNA 1HAZB 2ZGBH 1AVXA 4KKDA 2A4RA 1SLUB 1KTTB 1ZPZA 2OINA 5PTPA 4BTTB 2TIOA 1KY9A 4ZUHA 4KTSA 1O35A 2R9PA 1UHBB 3CP7A 4ZKRU 2RG3A 1BRUP 2UUJB 1OWEA 1O3OA 4CRGA 1D3TB 2A32A 2H9TH 2OC0A 2ZIQH 3EQ0H 4MNWA 5A0AE 3CS7A 3UNRA 4GSOA 3KQCA 2F9UA 1E35B 2ZCKP 1Z71A 3PYHA 1UVUH 3C27B 1QL8A 2BTCE 3RC4A 3SUEA 1L4ZA 5GJ4B 3A84A 5GIBA 1EJAA 3MO9A 2GCHG 3JZ1B 4O3UA 1P05A 4INKA 3RMLH 1SQTA 1AB9B 1ZMLA 2QCYA 2OQUA 3P95A 4B75A 4DOQA 1V2RT 1O2GH 1O3IA 3SQEE 5C67A 2R2MB 5JDUB 5EODA 1GBCA 4X1NU 1QJ7B 1INCA 1MKXK 4I8JA 2FODA 2ZU2A 1E37B 1SLWB 1ZRKA 4MQAA 5IDKA 1THPB 2EC9H 8ESTE 1BOQA 1O2NA 5J4QA 1G37A 2W7SA 1XX9A 2FYRA 1C2GA 1P2QA 3FP7E 1DDJA 5EGMA 1C2MA 1UVOA 1MQ6A 3OSYA 2PSXA 1OP0A 2BM2A 1MZAA 1EJNA 1C1PA 1O3MA 7GCHG 3I77A 1H8IH 4MPWA 1XKBC 1P0SH 2BDIA 4BANB 2ZEBA 1EXFA 1G3BA 4K1EA 1F7ZA 2OXSA 3QDZB 2O8MA 3ZZ8A 1HIAA 3VB5A 3PWBA 3TPIZ 4KP0A 2ZFPH 1VITF 2HALA 1BT7A 1GMCF 2V6NA 2BLWA 2H5CA 4Z6AH 1GJ5H 3ZVEA 3GY4A 2AH4X 2WINI 4JYVH 3MNSA 3B23B 4NIVA 1IHTH 3TK6A 1AO5A 3ZVBA 1C5MD 4UFDH 1A0JA 1EPTB 2XWAA 3RLYH 2O8UA 1AU8A 1TWXB 3RXPA 1P06A 1MBQA 4HZHA 3ZV9A 2LNCA 4BXSA 5E0GA 1PQAA 4R0IA 2BVXH 1ABJH 3D23A 4HFPB 1AUJA 1C2JA 3RC6A 2HRVA 3R0FA 1SGRE 1QR3E 3U69H 1QRZA 3GCNA 3V12A 4IW4E 4DCDA 2VIVA 3FAOA 3SUDA 3MH6A 3SU3A 1FPHH 1SVPA 4UD9H 1FIWA 1RIWC 1SFIA 2UUFB 4RKJB 1O3HA 1HBTH 1AIXH 3MO3A 4LXBH 3BTME 2ZGJA 1V2ST 3AVZA 3A80A 4BAKB 3FFGA 1LQDB 1O3BA 3RU4E 1NTPA 1NZQH 2JETB 3EE0B 3F9FA 1XKAC 1MTSA 1P2NA 1BMAA 4MVNA 5T6FA 1B7XB 1Y5AT 1J17T 4X8VH 2Y5GA 1ZHPA 5C1XA 6CHAC 2WYGA 2GZ9A 3MU5A 3A7ZA 1BIOA 1C5TA 1LO6A 5C20A 1GCTB 1IQIA 5I25A 4FUEA 3BTKE 3D65E 2J38A 1ZTLA 2C93B 4GLYA 1PPCE 1QL7A 1T8NA 3E90B 2Z3DA 2SNWA 2ANMH 1P2OA 4WMEA 3QGJA 2SGFE 3RXSA 4QT8C 1NROH 3GYMA 3H5CB 1C5NH 1SGFG
chains in the Genus database with same CATH superfamily
2PKSC 1CT2E 3EGKH 1BHXB 3VB7A 1BRCE 2ZU1A 5E8EH 2XBVA 3PM3A 1DFPA 1TABE 3WY8A 4M9FA 1CO7E 1FY1A 3LGTA 3BTEE 2IPQX 4XBDA 4M7GA 2TGDA 1ZOMA 1F2SE 3A7TA 1C1TA 1K21H 5A09A 1YCPM 2A45B 4CRDA 3SJKA 4UFFH 1EASA 3TIUA 1C5QA 2LP6A 4CRBA 2Y6TA 7GCHF 1Z8JB 1O2QA 3M3SA 1OOKB 1YKTA 5LH8A 4BAHB 3PTNA 2BD5A 1TLDA 4ZMAH 1GI8B 1UW7A 2G4UA 1OP2A 1TPOA 2XOKD 1YPHC 1MKWK 2A5KA 4X6OA 5LPFA 1EAWA 3BG4C 4FUIA 3V3MA 4OGXA 2R3UA 1QA7A 5AVDA 1O5CB 1A3BH 1Z8GA 1YCPK 1GI3A 1P01A 2FOAA 3W95A 5ETXA 2G5VA 5A8XA 4CBOA 1TB6H 1OYTH 1LKAA 2PTCE 1MAYA 2VU8E 4Y7AA 4X1RU 4ZKOU 4WY3A 1MKWH 2KAIA 1O5FH 1VJAU 1VCQA 1ZJKA 4F4OC 1O32A 2RFKC 3DFLA 3GCHB 3MOCA 3ZIAD 1K0HA 5GNDA 2GP9B 5AFYH 2GDDA 3A8DA 2XC0A 4U32A 4NIWA 3NXPA 1F0UA 1C9TA 1LPGB 2VGCC 4UE7H 2GKVE 1KLIH 3ZZ4A 4TY7A 1GBTA 4OS2A 2D2DA 3T2NA 1DY8A 3S9AA 2ZC9H 1GBJA 2FTLE 1SGIB 5HM2A 3PLKA 4OS4A 4IGDA 1RTLA 1YF4A 4X6MA 2DE9A 4E05H 1LVBA 2QE7D 4HGCA 1W0KD 4I33A 2OTVA 1ZRBA 2G5NA 2QGRA 2ZFSA 1MQ5A 5LPEA 4K1TA 1SGYE 1K1IA 2BVSH 3KN2A 3RMNH 3SU4A 1GL0E 3OFND 4HG6A 5L6NH 5DP8A 5LGOA 1EPTC 3BSQA 1SMFE 1P12E 3UOUA 2A1DB 4WXIA 3DFJA 1GJDB 4NG9H 2F9VA 3NPSA 1QQ4A 2BY6X 3E0PB 5G4BA 3ENSB 4ZAEA 1W0YH 1SOZA 3NK8A 1LHGH 4LZ4B 2OBQA 1MABB 4JK6A 4SGAE 1UTLM 4Q4LA 1J14A 1GVZA 1E1RD 1L1GA 2GCHF 2ODPA 1BDAA 4Y11E 1WV7H 1BRBE 4Q7ZA 4X1SU 2EI6A 1MZDA 1T8MA 2AS9A 1PQ8A 5FXLA 1DSTA 2WPLS 3ZV8A 2AFQB 4YT7H 1QTFA 1SLVB 1DLEA 2BD3A 1RXPA 1P9SA 3ZYEA 1HDTH 4JZFH 1AKSA 3LGYA 1UTPA 5DJ7A 2HNTE 1KTSB 3P17H 2W3IA 1IOEA 1VZQH 1O38A 2H5DA 1FONA 3I78A 3GCTF 3P8NA 1CHOG 2P93A 2J98A 2QXGA 2KCPA 3RMMH 2WPHS 3E1XB 1OSSA 3MWIU 2HWLB 1ELBA 5T1VA 2IJD1 1GI6A 1O39A 2JJ1D 1NU9A 5C0UA 1BHXF 2NU0E 3E0NB 4R8TB 3GDVA 3RXVA 1NM6A 4Y8XA 2FO9A 1HAVB 1KXAA 1PJPA 2OP9A 2V3MA 1B0FA 2ZF0H 2PFEA 3T25A 4FUBA 1DXWA 2A4OA 1E1QD 1BTYA 2Z9IA 4AB9A 2ZHDA 2GTBA 1K22H 1F92A 3QX5H 2Q6FA 2EA3A 1YWUA 1SG8B 2D1JA 1G3DA 1TRNA 1C1RA 2UWPA 3MFJA 1MAXA 1ELTA 1MCVA 1PPBH 1EAUA 1SLXB 5K0HA 2XBXA 1SB1H 3FZZA 1H8HD 3SNEA 2QA9E 1BMLA 2ANYA 4Y8YA 1GBFA 2OK5A 3WWFA 4AOQA 2WHXA 1UCYK 2VH0A 3ATKA 4UEHH 1BZXE 1MMJN 4I32A 2A4QA 3MYWA 4F48B 3OAAD 4K5ZA 1K1NA 2HPPH 4X2WA 3ZZ6A 4BTIB 1SGEE 3TH4H 1W8BH 3OU0A 4IC5A 5FX5A 5HIZA 5TCAA 4A1TA 1ZSJA 2FI3E 2K0QA 3A7XA 1QB6A 5A2MH 3T62A 4X8SH 4ASHA 1PYTC 1C1NA 4ABJA 2F4LA 2M2AA 2W6JD 3RXHA 1DUEA 1UCYH 1NN6A 1GHBF 3H7TA 5AHGH 1JIMA 2TRMA 2Y7XA 5CHAB 3LGIA 3ATWA 4X1QU 2Y7ZA 1N6XA 1C1SA 3CS0A 5TJXA 1NU7B 1TBRH 4I8HA 4AYVB 3S9CA 2I6QA 3QTVH 1AE8H 2C3SA 3L6PA 2CF9H 3L3TA 3LKWA 1KXBA 3V7TA 3ZZCA 2SGPE 4WH8A 4CR5A 1NPMA 2AMDA 4KTUA 1GBIA 1HV7A 4K3JA 1O5DH 1C5PA 3N99A 3A7VA 1O30A 3AASA 2FOCA 4ISOA 1C5UA 1YPLH 3SI3H 1GBLA 1ZJDA 1O5EH 2FZZA 1HAPH 3SJIA 1O3AA 1ZMNA 4XRNA 3M7UA 5L30H 1XMNB 1TALA 4FU8A 4GCHG 4ACBA 4DIHH 4YOJA 4RT1A 3F2HA 3SGQE 3UWIA 1UTMA 2FI5E 1YLDA 1ZHRA 2SNVA 3PLBA 4JZIA 1ID5H 5CDFE 1Y3UA 3CENA 2Q1JA 2P8OC 2GMTB 1C1QA 4MNYA 2FMJA 2CHAC 1GG6B 1K2I1 1TPPA 1W0ZU 1AB9C 1MCTA 1Y5BT 2J34A 1NC6A 1C1OA 1C5LH 3P8OA 1FY3A 2ZGHA 1QGFA 3EAJA 1V2UT 4TWWA 4CBNA 4DGJA 3GY8A 4DT7B 3F1SB 2PKAB 2J97A 4NA9H 3A88A 8LPRA 4CH8B 2AIQA 1CQQA 3U28C 1ANDA 3EA7A 8KME2 1TGNA 1DITH 3QWCH 1LHEH 2QXIA 2P16A 4ABFA 2GVFA 1ZSKA 3RDZA 1K1OA 2J2UA 1GBHA 5EXMA 5B6OA 4YT6H 2IN2A 4FETA 3KYFA 2BD9A 1V2TT 3C1KA 1O3JA 2ZDAH 1KIGH 3TITA 1DOJA 4ZXYH 4FUHA 3TU7H 1SQOA 4H6SB 1DVAH 1ZLRA 3GS9A 4NWLA 3NRLA 1ARCA 2AGGX 1LPKB 2F9NA 3TNSA 2F9OA 5AF9H 4ABEA 3PRBA 3MI4A 4DURA 1TQ0B 2BHGA 1F0SA 1TRMA 1MUEB 2OCVB 2ZZUH 3E16B 1GMHF 1CT0E 3BTHE 4Z0KA 1HLTH 2F91A 4HTCH 2V3OH 4B1TA 4Z1MD 3LGVA 1BUIA 1XUHA 2KCOA 2ZGCA 2YNBA 4YM9A 1MU8B 1DWCH 3RXBA 1IAUA 1CT4E 1TNIA 1P2JA 4BNRA 3OX7U 3PWCA 2ZP0H 1AGJA 3RXRA 3EA9A 1MTUA 1AFEH 4FUCA 2ZKSA 1P57B 3NCLA 2IOTA 1ZTKA 1HPGA 1JWTA 1GHBG 5FBIA 1QQUA 1YPHE 1T32A 1C4Y2 1P09A 1IQMA 1C1WH 1DS2E 1UJ1A 2C8WB 2BD4A 1KDQA 2AGIX 3S7KB 1C1VH 1L4DA 1FY8E 5EXNA 1OKXA 1GJBB 1IQHA 3VXFH 3S7HB 1GHAG 1GJ6A 3TGJE 1YPEH 3SZNA 2ASUB 1BTXA 1HFDA 4AORA 4H4FA 3LOXA 1NRQH 2BD7A 1S81A 1IQEA 1W2KH 1FAKH 2Z3EA 1B5GH 1ETTH 3ESTA 2PGQB 4OS1A 3OY6U 4GCHF 3DT0H 2GD4B 4INHA 1C5YB 3A85A 1S6HA 1ZMJA 1E38B 1WCZA 1V2NT 2VJ1A 3BTGE 3KYGA 3MQKC 1KXEA 1LPZB 2GCTB 3HATH 1LVYA 3KCGH 1ELCA 1Q31A 1A4WH 2UWLA 3BIUH 5FPTA 4YO9A 3RXKA 4Q63A 3RP2A 3RXOA 3F6UH 2FTMA 2F43B 2JETC 3QUMP 4CRFA 3QO6A 2H1UA 4VGCB 2P3UB 3ZZDA 1D6RA 1AVWA 2WPKS 1BMNH 5F53A 3S69A 3E91A 1N8OB 3A82A 6ESTA 1Y8TA 5EW2H 5HXFA 7LPRA 4FXGH 1O5BB 1NS3A 2Y5FA 2DUCA 3VGCB 1UVTH 3VB4A 4AFQA 3V0XA 2PP6A 2VWOA 1VGCB 2G8TA 3KNXA 1SGNE 4Y10E 1G2MA 1C4U2 3TGKE 3UNSA 1LDTT 3U1JB 3SORA 2B9LA 2GV6A 1G2LA 2R0KA 3HGNA 5EQRA 1DE7H 1JIRA 1SHYA 3HK6B 2BQWB 3O8BA 3P70B 4AFSA 2BY8X 3HKJB 1GMDF 2OC8A 4BAQB 4Q7YA 1JRSA 3AAVA 2A31A 3GICB 1OXGA 6GCHF 4UDWH 3RC5A 2GMTC 1EUFA 1DXPA 1AQ7A 1Y3YA 1AVGH 3UPEA 2FYQA 4TT3D 2AIPA 2Y81A 3ZZ3A 2RA0A 3BG8A 1TGBA 1SGCA 3M5NA 1V2KT 4A1VA 1XVOA 2UWOA 3M35A 1BCUH 2ZU5A 1O2UA 3PMBB 1CE5A 1GGDC 4E7RG 4B71A 1A2CH 5J4SA 2B7DH 4Y8ZA 1JMOH 1BA8B 2RA3A 3Q00A 2YMSD 4AX9H 2QV1A 1W13U 2XCNA 3SJ9A 4XD7D 3ZZ5A 2JDID 5EU8A 1KXFA 4RN6A 1A3EH 4A1XA 3STJA 1O3CA 1XUKA 1ELGA 1TONA 2ZDMA 4GHTA 1GDQA 4TWYA 3ZVFA 1TOMH 2FLRH 2XC4A 4B2AA 1N6YA 1FI8A 1SGFA 1LVMA 4JYTA 1SHHB 1RD3B 1C4V2 1PPFE 4NCYA 3ZVCA 2P95A 5A0BA 1EZSC 3LH1A 4XE4A 2CGAA 2PKAA 2ZI2H 2OLGA 3ZYDA 1O2JA 1SPJA 1EATA 1A5IA 1UK2A 1EOJA 3OYPA 3SNAA 3OEED 1C1UH 2J92A 3DSPA 4DW2U 1SGTA 1WQVH 1AKSB 1K1PA 4E06H 5E2OA 2I6SA 1EZXC 4IMQA 6CHAB 1N1LA 2OBOA 1AWFH 4O03A 3OE7D 4FUDA 5DK1A 4ABBA 4Y0YE 3OY5U 5KEDA 1O5GH 2BMGB 2BD8A 3ZVDA 4MPUA 1OWKA 2PHBA 2PTNA 4AG1A 4U01A 1O2WA 4X2YA 5ESTE 1QFKH 3LU9B 3FN8A 1SQRA 1XUFA 2Y5HA 4OM9A 1TGCA 1UK4A 2AMPA 1BTWA 1C5RA 2A7JA 2XBWA 1TMUH 1GDUA 1Y3VA 3WW7A 4E7NA 3PV4A 2F83A 5EPYA 1GCDA 4GHQA 3SI4H 5DP7A 2J5UA 2PGBB 1BBRH 3A8BA 1TIOA 3CNRA 3K6ZA 3QZRA 1AD8H 1Z8IB 2Z9JA 3UR9A 1EZUC 1XXFA 1A46H 4B73A 2VNTA 1D4PB 1T8LA 5EOKA 3HPTB 1HYLA 1UTKA 1F5LA 2FPZA 2LPRA 2UUKB 4X2XA 2IJOB 2THFB 3U8TH 4ABHA 1D3QB 1O2LA 3S0NA 4O97A 1GBBA 1GHAF 2QF4A 3NWUA 5EW1H 4MPXA 1PYTD 2JJ2D 2B8OH 4BXWA 2ZG0H 3UB0A 3UIRA 2O8WA 3ATMA 1GDNA 1H4WA 5EQSA 3QLPH 2SGQE 2VVCA 1MTNB 1L2EA 2KM0A 2WPIS 2TGPZ 2ZQ1A 4DVAU 1J15A 5HYOA 2PSYA 2Z9LA 3ATLA 1GBKA 1O36A 2ZWLH 1GHZA 1NRPH 1HGTH 1O2RA 4YOGA 3TJUA 1VGCC 1VKYA 4BAOB 4A5TS 4NIYA 2F9BH 2H2ZA 4D9QA 9LPRA 1P3EA 3A81A 1FY5A 2ZFTA 2TGAA 3RM0H 1HAOH 1OPHB 3PMAB 3A8AA 1AWHB 1BTUA 1YC0A 1ZPCA 1QJ1B 4D7GA 1QURH 2TBSA 4LOYH 3UREA 4JMYA 2CF8H 1AI8H 2PR3A 1TA2A 2VGCB 4JCNA 3P6ZB 1LKBA 1G3CA 2WPMS 1RJXB 4AN7A 3K6YA 3TJNA 5DP6A 4K69A 1ELEE 2ODQA 3IG6B 1H8DH 1Z6EA 1JOUB 2FX4A 3UFAA 2BDGA 3PMHB 1FAXA 1PQ7A 1SKYE 4Q80A 2ZQ2A 3M36A 4OS7A 1LHFH 2FWWA 1L1JA 1GWAA 4MTBA 2QIQA 4ZH8A 4AYYB 3BF6H 4FUFA 1CU1A 2BXUH 2AEIH 1E0FD 3EDXB 3RXCA 2SFAA 1HAVA 2ANWA 3T28A 2SGAA 1W7XH 3A87A 2W3KA 5I46H 1Z7KA 4CREA 2WUBA 3PV2A 1HUTH 2XTTB 4ABGA 3KEEA 4I7YH 2BX3A 3UTUH 1O2XA 1D3DB 2KCAA 1QL9A 3JZ2B 3V13A 2OC7A 3LC3A 5HMAA 1OHHD 1GI4A 2BY7X 4LZ1H 1X7AC 3G01A 2KCYA 1GL1A 2C90B 1YBWA 1NBME 1EFRD 1C2DA 3UUZA 2G51A 2Z7FE 1L1NA 3SV2H 3SNCA 1SSXA 3A7WA 2TPIZ 5BRRE 1HAXB 2FX6A 1ZTJA 2FM2A 1O3DA 4DT4A 2XYAA 1TBQH 3TK5A 1SOTA 1RTFB 5HKKD 3ODFA 1COWD 1QB9A 3OTJE 4ASUD 3BTQE 1DICA 3W1EA 1OWJA 1EB2A 2PUXB 2ZU4A 1M9UA 1RS0A 1TMBH 1TNKA 4OS5A 1TGTA 1V6DA 1A0LA 1DPOA 4YOIA 3AW1A 1WYKA 4X1PU 1H1BA 5DP4A 1XUGA 1W7GH 2ODYB 1AHTH 5FCKA 5C1UA 1GJ4H 4JZDH 1FIZA 3T26A 4ABIA 1E36B 3TVJB 4YTAA 1OX1A 3UAIC 3QTOH 2HOBA 1UCYE 2OQ5A 1SBWA 1TNGA 2XC5A 1MD8A 1TX8A 5EPNA 2P8OB 3LJOA 1MTVA 4O9VA 1NESE 1T31A 3M7TA 5C1YA 2WUCA 5HM9A 8GCHF 2BY9X 1DANH 3O8CA 1GI5A 4ZCNA 1WOFA 2CHAB 5DSFA 4JZ1A 1AMHA 5E2PA 2GZ8A 3PO1C 1MH0A 5L2YH 5C3NA 3Q3XA 2ZCLP 1CA0C 3KQEA 4X0WU 3RXJA 1VITG 1WU1A 2W5EA 2GT8A 1TBZH 1DM4B 1ELFA 1GHYH 1YPMH 1T4VH 1TMTH 4NSVA 1NFYA 1GI9B 2HNTF 5FCRA 1ORFA 3ZZ9A 5DGJA 1RTKA 4YLUA 1TAWA 3BTTE 1BBRE 3VFEA 2C8XB 5EQQA 2ULLA 2P59A 2BDYA 3BTWE 7ESTE 2NU1E 1NT1A 3FOAA 3ZZ7A 2Z6BD 2VWLA 3URDA 1DWEH 3L33A 1BJUA 2A7HA 1JBUH 1O2KA 1GMDG 1FDPA 4H42U 3SU5A 1ABIH 1TA6A 1DWDH 3RXFA 1HCGA 4ZHAA 1ZSLA 4Y71A 4K60A 2OD3B 2W6ID 1C2LA 5C94A 1GHVH 3F9HA 4SGBE 1UMAH 1THRH 3LC5A 1BTHH 2D8WA 5GPIB 1S5SA 4ZHLU 2V3HH 2CJIA 3O8DA 8GCHG 2O8TA 1QBNA 1CBWB 3M37A 1WAYB 1V2MT 4U2WA 3T27A 1P11E 3UY9A 6LPRA 3B9FH 2ZO3H 3UQVA 4TPIZ 1MKXH 1VCPA 3A7YA 2VVUA 1DSUA 2ZPQA 1PPGE 5T3HA 4Y0ZE 1A5HA 2XW9A 3MMGA 1DWBH 1P03A 4Y7BA 1VJ9U 3FKSD 3UWJH 1W0JD 2FDAA 3SUFA 5FPSA 2J4IA 4AGKA 2JH5D 4I8KA 1NRRH 1TOCB 3VB6A 3SU6A 3A89A 1AFQC 1QY6A 3E3TA 4FU9A 1FMGA 2C8YB 1W3CA 2GCTC 2R0LA 4B76A 1O3KA 5E0HA 1G30B 1RGQA 1C5ZB 2BZAA 4LK4A 2PWXA 5GWZA 2PLXA 2JH0D 1AUTC 2VB0A 3BIVH 2B5TB 5DP9A 2KAIB 3EA8A 2BLVA 3GYLB 1WQSA 3RXUA 1GG6C 4I8GA 2P3FH 2OUAA 2GX4A 1F0RA 4OGYA 1YP9A 2FXRA 3LPRA 4Q7XA 3Q76A 3GCOA 4F49A 2BY5X 1N8OC 1GBAA 4KTCA 3U9AH 2AYWA 3VXEH 1XUIA 1Y3XA 1GJCB 2BDBA 3MTYA 2XBYA 1YGCH 4KELA 2YMSC 1GHWH 1QBOA 2VBCA 2K1QA 2BYAX 3SO3A 2M5TA 3VGCC 1AE5A 2R3YA 2BQ7B 1CGHA 3F9GA 3HK3B 2Y80A 2GV7A 2CN0H 1FPCH 3LDXH 3ATIA 1GBDA 3STIA 1NRSH 1B0EA 3MH4A 3BEUA 1BRAA 3HGPA 2L74A 1F0TA 2NU3E 9ESTA 1GJ7B 1GI1A 1TRYA 3E8LA 4X8UH 2Z9GA 4GVUA 1HAYB 1HJAC 3SGAE 1DY9A 4IC6A 2QY0B 1JRTA 3UR6A 1WSSH 1HJ9A 1CSOE 3LJJA 5AFZH 4A7IB 2PUQH 2VVVA 3RXQA 1CGJE 1A61H 1RFNA 4WMDA 5FBEA 1IQFA 4WMFA 4D7FA 2W7UA 4ABDA 3RXAA 5KECA 1DT2A 3AK5A 4NIXA 2GGVB 1GGDB 3BV9B 4NFEA 4TY6A 1ACBE 1IQLA 1H9IE 3LIWA 1J16A 2A5AA 5EG4A 1BTZA 5DP3A 4ESTE 4TSFD 1TNLA 1UVPA 2SGDE 2CK3D 2YOLA 3Q3YA 1P8VC 1ANEA 1BBRK 5GCHG 4RKOB 4DG4A 3PV5A 1HAGE 1KLTA 3MU0A 4UFGH 3URCA 1UVSH 3LONA 2V35A 1O3LA 4X8TH 5SGAE 3SU2A 3KQBA 1LCYA 1MTWA 3TH2H 4A6LA 2NU4E 4WVPE 1DUAA 1GMHG 1GHXH 2EY4C 2A4GA 1TE0A 3EYDA 2QF0A 3HKIB 4FOUC 5FHTA 1HAIH 1FZZA 1ETRH 3GY5A 1KXCA 5CHBA 2FOEA 2HVXA 4CHAB 3GY7A 2BB4A 5A0CA 3SUGA 2ILNA 1G32B 4UONA 2HLCA 2QXJA 4XBCA 4AGJA 2L6OA 1TX7A 1O33A 2BD2A 3NZIA 3D62A 3H7OA 1SI5H 2F9PA 2ZDNA 1O2PA 1NFWA 2EI7A 2H6MA 2ZFQH 2ZTYA 4JYUH 3SOSA 1SC8U 4TPYA 1CBWC 4MPVA 2J9NA 4VGCC 1O2ZA 4FU7A 2G4TA 3VB3A 1P2MA 5HGGA 1W10U 3M5OA 1P10A 1ZYOA 2WV5A 5A8YA 4F55A 2H9EH 1BB0B 5L2ZH 2BOHB 5CE1A 2HLDD 3Q77A 5T6GA 1O3GA 3T29A 1A5GH 1O3EA 1UHBA 2HPQH 2WPJS 5GCHF 1UO6A 1V2VT 2STBE 1RRKA 1EAXA 5JBAS 4I8LA 3DUXH 1YLNA 3SN8A 3ZVAA 5JB8S 4ZHMU 5ABWA 1GMCG 5JB9S 1WUNH 1G9IE 4JK5A 1XXDA 4ZROA 2P94A 3FP8E 1QRWA 2HGTH 1HNEE 4D9RA 1EB1H 4K2YA 4BOHA 5H4IB 2GT7A 3KGPA 3KL6A 4Y6DA 4B2CA 1MBMA 3DCLA 2HNTC 4JZEH 1ZGVA 1C2KA 3KQDA 4DJZB 2J95A 4ABAA 2VIDA 1S6LA 1O2HA 2ZFFH 4ISHH 2ZNKH 2FLBH 2STAE 4IS5A 5C0TA 4U30A 2VH6A 4DIIH 1CHOF 1LHCH 4NA7A 1DX5M 3M5MA 2JKHA 2UUYA 4TYDA 3NKKA 2ZDVH 4D76A 4X6NA 1TPAE 2YMSB 5K7RA 3BEFB 1NFXA 1O2OA 1OYQA 1KXDA 3U8RH 5DPAA 4ZXXH 1W14U 4H6TA 3W94A 3GY6A 1GVKB 2YNAA 3PLPA 1J9CH 3AAUA 3AW0A 1E34B 1H9LB 1D3PB 7KMEH 5F8XA 5GXPA 1D9IA 2FEQH 4MLFB 3SV9A 2BX4A 3U8OH 1A7SA 1O3PB 1KYNA 1MTNC 2Z9KA 5FX6A 1SGDE 2QYIA 1C1MA 2PKSB 4IBLH 2FP7B 1HAHH 3SGBE 2WV4A 1GJAB 2ZPSA 3OTPA 1ELAA 2QC2A 3O8RA 3GDUA 3RXTA 4WXVA 3WWBA 3FO8D 1AN1E 5DO4H 1A0HB 1UTJA 1K1MA 5CMXH 1TYNA 2ZDKA 3MH5A 2DE8A 1TNHA 3GCTG 4Y76A 1Z1JA 2VIOA 1G3EA 2G81E 2BDCA 4AB8A 3P8GA 4NSYA 2ZU3A 2VWNA 3KIDU 3MHWU 4ACAA 5JBTA 2G55A 2GJGA 3ZZAA 1EQ9A 1ESAA 5FPYA 4WH6A 4AZ2B 1QBVH 3MH7A 3E6PH 1OWDA 2WYJA 3LT3A 4ZKSU 2QF3A 5DKMA 5HIYA 4RI0A 1SQAA 4I31A 3TJOA 2XWBI 1ZPBA 1FY4A 1NO9H 1L0ZA 4FUGA 1ELDE 1GBMA 2BQ6B 2NWNA 4GPGA 1BQYA 1Z8RA 4NGAH 1OS8A 2CV3A 1S82A 4RT0A 3IWMA 3RXDA 5EIYA 3Q3KA 1C5SA 1LMWB 1O2YA 3GDSA 3MNCA 3LH3A 3QK1A 3TNTA 1O3NA 1IQNA 3GCHC 1GPZA 4RSPA 1BMFD 4CHAC 3F68H 3R3GB 3A83A 2A7CA 1TQ7B 2CXVA 2QN5T 3MU4A 1V2QT 1TGSZ 1RIWB 2O8LA 4X6PA 5C5NA 4IMZA 3PB1E 1S0QA 1BITA 1FUJA 1QRXA 1U6QA 3RXEA 3FP6E 2F3CE 1O34A 6GCHG 1O0DH 1C2EA 3N7OA 4J1YA 1GCTC 1Y5UT 4K8BA 1HXFH 1LTOA 3DD2H 2ZTZA 4UFEH 5FAHA 3QZQA 3MNBA 4ISIH 2FI4E 3LGUA 4YZUA 1NRNH 3K9XB 3UNQA 1OP8A 1YPGH 1LQEA 1PPZA 1F5RA 1NFUA 2BDHA 2ZECA 1EPTA 3K2UA 3RU4T 1IHSH 4XFQA 5JBBS 1HXEH 4OS6A 4THNH 3TGIE 1LHDH 1J8AA 1ARBA 1MU6B 4MNVA 3GISB 3A8CA 1YM0A 1V2OT 2WPDD 1P2KA 2TGTA 3SHAH 3FZDA 4WF8A 1SR5C 2FIRH 3F0OA 1KLJH 2GDEH 1C5WB 1HIAB 3SQHE 2ZTXA 3FVFB 3ZZBA 3RXMA 2A2XH 2J98B 3LGWA 1P2IA 4ISNA 2AERH 3PO1B 3BEIB 1EKBB 3P92A 1FX0B 1V2PT 4XDEA 5F6MA 1QIXB 1O31A 2NU2E 4XSKU 1QHRB 2FOHA 1V2JT 3U98H 3SJ8A 1T4UH 5TCCA 4YXWD 3SV8A 1BMMH 4B6FA 1O2TA 1G36A 1ZHMA 1K28D 2AGEX 1TPSA 3S9BA 2J94A 1YY3A 3M7QA 1C2IA 3M3VA 2XCFA 3PRDA 2Y82A 4PROA 3BG4B 1IQGA 1CA0B 2G00A 5A8ZA 1WDIA 1S6FA 2ZPRA 1Z6JH 3D49H 4MG3A 2VIWA 3MO6A 2V7QD 2GZ7A 4CRAA 2A0QB 3RLWH 1A1RA 4IN2A 1FLEE 2FS8A 1FQ3A 4CRCA 1ZR0A 4I86A 5F8ZA 3RU4D 4J2YB 3SZEA 4K1SA 4ISLA 3BN9A 2FOGA 4DY7B 1O2SA 5B6LA 4HI3A 4AFZA 4B74A 1JXPA 3DHKH 5KGOA 4BAMB 3SBKA 5JBCS 1EP5A 1HB0B 1MD7A 2FS9A 1QNJA 4NWKA 1CVWH 1C5XB 1ESTA 1T7CA 3IITA 3TK9A 1HRTH 1ESBA 1EZQA 1XVMA 2Q6GA 3SHCH 3TLOA 2WSSD 1SL3A 1ELVA 3F0PA 5F8TA 3U1IB 1Q3XA 2ZCHP 3SU0A 1WBGB 2RDLA 1BJVA 1THSH 1V2LT 1OWIA 1IQKA 2JH6D 1FN8A 1SFQB 4P00A 1TX6A 2P3TB 4K8YA 2VIPA 3MU8A 1P9UA 3PTBA 4Q2KA 4BTUB 1S84A 2RCEA 1UTQA 1FNIA 4P02A 1CA8B 1WTGH 1Y59T 3MU1A 3QN7A 1O2VA 3A86A 1AFQB 3BTDE 4IN1A 2BXTH 4MNXA 5C2ZA 1Z1IA 2KR7A 1T8OA 2ESTE 4WWYA 5T6DA 2PV9B 1SGQE 3VPKA 1BTPA 3ELAH 1XM1A 2BOKA 1KDQB 1GJ9B 3VG8A 2ZA5A 1GVLA 2O9QA 1P3CA 1CGIE 4YESB 2OC1A 3SJOA 3TH3H 4KGAA 4XOJA 1EP6A 4GAWA 1V2WT 2FESH 2VIQA 3SNBA 3NUMA 1ZZZA 3EE7A 4WJG2 1H9HE 1YPJH 3KHVA 4FVBA 1YYY1 1UTNA 1FJSA 5E0JA 3SYJA 1O3FA 3KQ5A 2ZHFH 1ANCA 3GY3A 1V3XA 3VEQB 5C5OA 1GI2A 1AZZA 1VCWA 1YLCA 5FL7D 1AY6H 2QF5A 2EEKA 1P02A 3P8FA 1GI0A 1C2HA 3RM2H 1VR1H 2ZFRH 2XRCA 2IPHA 5LPRA 2D26C 4FVDA 2ALVA 1F5KU 3PROA 2V0BA 1Y3WA 1QA0A 3SV6A 2KZ4A 2BZ6H 1K1LA 2ZDLA 4NFFA 1EOLA 3OEHD 3N7DA 5IYTA 2H9HA 1S0RA 1S85A 3ODDA 2K8IA 1UTOA 1QCPA 1HJ8A 3GOVB 3K65B 4INLA 2EI8A 3UOPA 3UQOA 2XNIA 2ZHEH 1YPKH 4GUXA 2G52A 4YLQH 1LVOA 2BDAA 1ETSH 2VINA 2ZGXH 2C8ZB 4AFUA 2Q6DA 1FN6A 3F9EA 3M5LA 4MDSA 1HJAB 1C5VA 1O2IA 3N7EA 4NA8A 4Y79A 1FXYA 2FOFA 5GDSH 2R2WU 1GJ8B 3ZVGA 3SW2B 3FANA 1O5AB 1EAIA 1WTHD 4B6EA 3RUOA 1DLKB 3RXLA 1VITH 2Z94A 5EJLA 5BPEA 2ZHQH 3KF2A 3TJVA 3SV7A 4CH2B 2W26A 5EXLA 2SGEE 3I29A 4A92A 1PQ5A 2QAAA 2A2QH 3RMOH 1XUJA 1O2MA 1IQJA 4AG2A 3B8JA 1S83A 3H09A 1W11U 2XXLA 1GI7B 5IK2D 2ZHWH 3F2GA 3M3TA 5ESBA 4ZKNU 1TFXA 3RXGA 2BLOA 1OWHA 4B2BA 2ANKH 1NY22 5DN6D 4CR9A 2C4FH 4D8NA 2QXHA 2FOMB 3ITIA 2CMYA 2VWMA 3M61U 2Z3CA 4X2VA 2B0FA 3T5FH 1CHGA 1QB1A 5DP5A 1Q2WA 1QJ6B 1AZ8A 1EJMA 1C9PA 2AMQA 1D6WA 1GBEA 1ZGIA 5DG6A 3SNDA 1PFXC 2FOBA 1C5OH 4NZLA 2KX4A 2BLQA 5CHAC 2PW8H 3QGNB 1ANBA 1C2FA 1FV9A 1EX3A 2KFWA 2BVRH 3SU1A 5JPMH 3GY2A 5JYIA 2LELA 3RXIA 1PPHE 3DA9B 4XBBA 1W12U 1YCPH 4FUJA 3PMJA 4NZQA 1SGPE 2ALPA 1P04A 2WV9A 1K9OE 1O37A 1H8ED 2A5IA 1K1JA 3MNXA 1PPEE 3BTFE 3F2FA 1UK3A 1TNJA 5F03A 4O3TA 1KSNA 1HAZB 2ZGBH 1AVXA 4KKDA 2A4RA 1SLUB 1KTTB 1ZPZA 2OINA 5PTPA 4BTTB 2TIOA 1KY9A 4ZUHA 4KTSA 1O35A 2R9PA 1UHBB 3CP7A 4ZKRU 2RG3A 1BRUP 2UUJB 1OWEA 1O3OA 4CRGA 1D3TB 2A32A 2H9TH 5EJZA 2OC0A 2ZIQH 3EQ0H 4MNWA 5A0AE 3CS7A 3UNRA 4GSOA 3KQCA 2F9UA 1E35B 2ZCKP 1Z71A 3PYHA 1UVUH 3C27B 1QL8A 2BTCE 3RC4A 3SUEA 1L4ZA 5GJ4B 3A84A 5GIBA 1EJAA 3MO9A 2GCHG 3JZ1B 4O3UA 1P05A 4INKA 3RMLH 1SQTA 1AB9B 1ZMLA 2QCYA 2OQUA 3P95A 2WZQA 4B75A 4DOQA 1V2RT 1O2GH 1O3IA 2EQNA 3SQEE 5C67A 2R2MB 5JDUB 5EODA 1GBCA 4X1NU 2AHME 1QJ7B 1INCA 1MKXK 4I8JA 2FODA 2ZU2A 1E37B 1SLWB 1ZRKA 4MQAA 5IDKA 1THPB 2EC9H 8ESTE 1BOQA 1O2NA 5J4QA 1G37A 2W7SA 1XX9A 1QZ8A 2FYRA 1C2GA 1P2QA 3FP7E 1DDJA 5EGMA 1C2MA 1UVOA 1MQ6A 3OSYA 3DSGA 2PSXA 5C17A 1OP0A 2BM2A 1MZAA 1EJNA 1C1PA 1O3MA 1WXRA 7GCHG 3I77A 1H8IH 4MPWA 1XKBC 1P0SH 2BDIA 4BANB 2ZEBA 1EXFA 1G3BA 4K1EA 1F7ZA 2OXSA 1E79D 3QDZB 2O8MA 3ZZ8A 1HIAA 3VB5A 3PWBA 3TPIZ 4KP0A 2ZFPH 1VITF 2HALA 1BT7A 1GMCF 2V6NA 2BLWA 2H5CA 4Z6AH 1GJ5H 3ZVEA 3GY4A 2AH4X 2WINI 4JYVH 3MNSA 3B23B 4NIVA 1IHTH 3TK6A 1AO5A 3ZVBA 1C5MD 4UFDH 1A0JA 5EJ1A 1EPTB 2XWAA 3RLYH 2O8UA 1AU8A 1TWXB 3RXPA 1P06A 1MBQA 4HZHA 3ZV9A 2LNCA 4BXSA 5E0GA 1PQAA 4R0IA 2BVXH 1ABJH 3D23A 3F3BA 4HFPB 4AC9A 1AUJA 1C2JA 3RC6A 2HRVA 3R0FA 1SGRE 1QR3E 3U69H 1QRZA 3GCNA 3V12A 4IW4E 4DCDA 2VIVA 3FAOA 3SUDA 3MH6A 3SU3A 1FPHH 1SVPA 4UD9H 1FIWA 1RIWC 1SFIA 2UUFB 2RDEA 1O3HA 1HBTH 4RKJB 1AIXH 3MO3A 4LXBH 3BTME 2ZGJA 1V2ST 3AVZA 3A80A 4BAKB 3FFGA 1LQDB 1O3BA 1NBMD 3RU4E 1NTPA 1NZQH 2JETB 3EE0B 3F9FA 1XKAC 1MTSA 1P2NA 1BMAA 4MVNA 5T6FA 1B7XB 1Y5AT 2JIZD 1J17T 4X8VH 2Y5GA 1ZHPA 5C1XA 6CHAC 2WYGA 2GZ9A 3DSOA 3MU5A 3A7ZA 1BIOA 2HVYB 1C5TA 1LO6A 5C20A 1GCTB 1IQIA 5I25A 4FUEA 3BTKE 3D65E 2J38A 1ZTLA 2C93B 4GLYA 1PPCE 1QL7A 1KMHB 1T8NA 3E90B 2Z3DA 2SNWA 2ANMH 1P2OA 2XNDD 4WMEA 3QGJA 2SGFE 3RXSA 4QT8C 1NROH 3GYMA 3H5CB 1C5NH 1SGFG
chains in the Genus database with same CATH topology
2PKSC 1CT2E 3EGKH 1BHXB 3VB7A 1BRCE 2ZU1A 5E8EH 2XBVA 3PM3A 1DFPA 1TABE 3WY8A 1CO7E 1FY1A 3LGTA 3BTEE 4XBDA 4M7GA 2TGDA 1ZOMA 1F2SE 3A7TA 1C1TA 1K21H 5A09A 1YCPM 2A45B 4CRDA 3SJKA 4UFFH 1EASA 3TIUA 1C5QA 4CRBA 2Y6TA 7GCHF 1Z8JB 1O2QA 3M3SA 1OOKB 1YKTA 5LH8A 4BAHB 3PTNA 2BD5A 1TLDA 4ZMAH 1GI8B 2G4UA 1OP2A 1TPOA 1YPHC 1MKWK 2A5KA 4X6OA 5LPFA 1EAWA 3BG4C 4FUIA 3V3MA 4OGXA 2R3UA 1QA7A 5AVDA 1O5CB 1A3BH 1Z8GA 1YCPK 1GI3A 1P01A 2FOAA 3W95A 5ETXA 2G5VA 5A8XA 4CBOA 1TB6H 1OYTH 1LKAA 2PTCE 1MAYA 2VU8E 4Y7AA 4X1RU 4ZKOU 4WY3A 1MKWH 2KAIA 1O5FH 1VJAU 1VCQA 1ZJKA 4F4OC 1O32A 3DFLA 3GCHB 3MOCA 2GP9B 5AFYH 2GDDA 3A8DA 2XC0A 4U32A 4NIWA 3NXPA 1F0UA 1C9TA 1LPGB 2VGCC 4UE7H 2GKVE 1KLIH 3ZZ4A 4TY7A 1GBTA 4OS2A 2D2DA 3T2NA 1DY8A 3S9AA 2ZC9H 1GBJA 2FTLE 1SGIB 5HM2A 3PLKA 4OS4A 4IGDA 1RTLA 1YF4A 4X6MA 2DE9A 4E05H 1LVBA 4HGCA 4I33A 2OTVA 1ZRBA 2G5NA 2QGRA 2ZFSA 1MQ5A 5LPEA 4K1TA 1SGYE 1K1IA 2BVSH 3KN2A 3RMNH 3SU4A 1GL0E 5L6NH 5DP8A 5LGOA 1EPTC 3BSQA 1SMFE 1P12E 3UOUA 2A1DB 4WXIA 3DFJA 1GJDB 4NG9H 2F9VA 3NPSA 1QQ4A 2BY6X 3E0PB 5G4BA 3ENSB 4ZAEA 1W0YH 1SOZA 3NK8A 1LHGH 4LZ4B 2OBQA 4JK6A 4SGAE 1UTLM 1J14A 1GVZA 1L1GA 2GCHF 2ODPA 1BDAA 4Y11E 1WV7H 1BRBE 4Q7ZA 4X1SU 2EI6A 1MZDA 1T8MA 2AS9A 1PQ8A 5FXLA 1DSTA 2WPLS 3ZV8A 2AFQB 4YT7H 1QTFA 1SLVB 1DLEA 2BD3A 1RXPA 1P9SA 3ZYEA 1HDTH 4JZFH 1AKSA 3LGYA 1UTPA 5DJ7A 2HNTE 1KTSB 3P17H 2W3IA 1IOEA 1VZQH 1O38A 2H5DA 1FONA 3I78A 3GCTF 3P8NA 1CHOG 2P93A 2QXGA 3RMMH 2WPHS 3E1XB 1OSSA 3MWIU 2HWLB 1ELBA 1GI6A 1O39A 1NU9A 1BHXF 2NU0E 3E0NB 4R8TB 3GDVA 3RXVA 1NM6A 4Y8XA 2FO9A 1HAVB 1KXAA 1PJPA 2OP9A 1B0FA 2ZF0H 2PFEA 3T25A 4FUBA 1DXWA 2A4OA 1BTYA 2Z9IA 4AB9A 2ZHDA 2GTBA 1K22H 1F92A 3QX5H 2Q6FA 2EA3A 1SG8B 2D1JA 1G3DA 1TRNA 1C1RA 2UWPA 3MFJA 1MAXA 1ELTA 1MCVA 1PPBH 1EAUA 1SLXB 5K0HA 2XBXA 1SB1H 3FZZA 3SNEA 2QA9E 1BMLA 2ANYA 4Y8YA 1GBFA 4AOQA 1UCYK 2VH0A 3ATKA 4UEHH 1BZXE 1MMJN 4I32A 2A4QA 3MYWA 4K5ZA 1K1NA 2HPPH 4X2WA 3ZZ6A 4BTIB 1SGEE 3TH4H 1W8BH 3OU0A 4IC5A 5FX5A 5TCAA 4A1TA 1ZSJA 2FI3E 3A7XA 1QB6A 5A2MH 3T62A 4X8SH 4ASHA 1PYTC 1C1NA 4ABJA 3RXHA 1DUEA 1UCYH 1NN6A 1GHBF 3H7TA 5AHGH 1JIMA 2TRMA 2Y7XA 5CHAB 3LGIA 3ATWA 4X1QU 2Y7ZA 1N6XA 1C1SA 3CS0A 5TJXA 1NU7B 1TBRH 4I8HA 4AYVB 3S9CA 2I6QA 3QTVH 1AE8H 2C3SA 3L6PA 2CF9H 3L3TA 3LKWA 1KXBA 3V7TA 3ZZCA 2SGPE 4WH8A 4CR5A 1NPMA 2AMDA 4KTUA 1GBIA 1HV7A 4K3JA 1O5DH 1C5PA 3A7VA 1O30A 3AASA 2FOCA 4ISOA 1C5UA 1YPLH 3SI3H 1GBLA 1ZJDA 1O5EH 2FZZA 1HAPH 3SJIA 1O3AA 1ZMNA 3M7UA 5L30H 1XMNB 1TALA 4FU8A 4GCHG 4DIHH 4YOJA 3SGQE 3UWIA 1UTMA 2FI5E 1YLDA 1ZHRA 2SNVA 3PLBA 4JZIA 1ID5H 1Y3UA 3CENA 2Q1JA 2P8OC 2GMTB 1C1QA 4MNYA 2FMJA 2CHAC 1GG6B 1K2I1 1TPPA 1W0ZU 1AB9C 1MCTA 1Y5BT 2J34A 1NC6A 1C1OA 1C5LH 3P8OA 1FY3A 2ZGHA 1QGFA 3EAJA 1V2UT 4TWWA 4CBNA 4DGJA 3GY8A 4DT7B 3F1SB 2PKAB 4NA9H 3A88A 8LPRA 4CH8B 2AIQA 1CQQA 1ANDA 3EA7A 8KME2 1TGNA 1DITH 3QWCH 1LHEH 2QXIA 2P16A 4ABFA 2GVFA 1ZSKA 3RDZA 1K1OA 2J2UA 1GBHA 5EXMA 5B6OA 4YT6H 2IN2A 2BD9A 1V2TT 3C1KA 1O3JA 2ZDAH 1KIGH 3TITA 1DOJA 4ZXYH 4FUHA 3TU7H 1SQOA 4H6SB 1DVAH 1ZLRA 4NWLA 1ARCA 2AGGX 1LPKB 2F9NA 3TNSA 2F9OA 5AF9H 4ABEA 3MI4A 4DURA 1TQ0B 2BHGA 1F0SA 1TRMA 1MUEB 2OCVB 2ZZUH 3E16B 1GMHF 1CT0E 3BTHE 4Z0KA 1HLTH 2F91A 4HTCH 2V3OH 4B1TA 3LGVA 1BUIA 1XUHA 2ZGCA 2YNBA 4YM9A 1MU8B 1DWCH 3RXBA 1IAUA 1CT4E 1TNIA 1P2JA 4BNRA 3OX7U 3PWCA 2ZP0H 1AGJA 3RXRA 3EA9A 1MTUA 1AFEH 4FUCA 2ZKSA 1P57B 3NCLA 2IOTA 1ZTKA 1HPGA 1JWTA 1GHBG 5FBIA 1QQUA 1YPHE 1T32A 1C4Y2 1P09A 1IQMA 1C1WH 1DS2E 1UJ1A 2C8WB 2BD4A 1KDQA 2AGIX 3S7KB 1C1VH 1L4DA 1FY8E 5EXNA 1OKXA 1GJBB 1IQHA 3VXFH 3S7HB 1GHAG 1GJ6A 3TGJE 1YPEH 3SZNA 2ASUB 1BTXA 1HFDA 4AORA 4H4FA 3LOXA 1NRQH 2BD7A 1S81A 1IQEA 1W2KH 1FAKH 2Z3EA 1B5GH 1ETTH 3ESTA 2PGQB 4OS1A 3OY6U 4GCHF 3DT0H 2GD4B 4INHA 1C5YB 3A85A 1S6HA 1ZMJA 1E38B 1WCZA 1V2NT 2VJ1A 3BTGE 1KXEA 1LPZB 2GCTB 3HATH 1LVYA 3KCGH 1ELCA 1Q31A 1A4WH 2UWLA 3BIUH 5FPTA 4YO9A 3RXKA 3RP2A 3RXOA 3F6UH 2FTMA 2JETC 3QUMP 4CRFA 3QO6A 2H1UA 4VGCB 2P3UB 3ZZDA 1D6RA 1AVWA 2WPKS 1BMNH 3S69A 3E91A 1N8OB 3A82A 6ESTA 1Y8TA 5EW2H 5HXFA 7LPRA 4FXGH 1O5BB 1NS3A 2Y5FA 2DUCA 3VGCB 1UVTH 3VB4A 4AFQA 3V0XA 2VWOA 1VGCB 2G8TA 3KNXA 1SGNE 4Y10E 1G2MA 1C4U2 3TGKE 3UNSA 1LDTT 3U1JB 3SORA 2B9LA 2GV6A 1G2LA 2R0KA 3HGNA 5EQRA 1DE7H 1JIRA 1SHYA 3HK6B 2BQWB 3O8BA 3P70B 4AFSA 2BY8X 3HKJB 1GMDF 2OC8A 4BAQB 4Q7YA 1JRSA 3AAVA 2A31A 3GICB 1OXGA 6GCHF 4UDWH 3RC5A 2GMTC 1EUFA 1DXPA 1AQ7A 1Y3YA 1AVGH 3UPEA 2FYQA 2AIPA 2Y81A 3ZZ3A 2RA0A 3BG8A 1TGBA 1SGCA 3M5NA 1V2KT 4A1VA 1XVOA 2UWOA 3M35A 1BCUH 2ZU5A 1O2UA 3PMBB 1CE5A 1GGDC 4E7RG 4B71A 1A2CH 5J4SA 2B7DH 4Y8ZA 1JMOH 1BA8B 2RA3A 3Q00A 4AX9H 2QV1A 1W13U 2XCNA 3SJ9A 3ZZ5A 5EU8A 1KXFA 4RN6A 1A3EH 4A1XA 3STJA 1O3CA 1XUKA 1ELGA 1TONA 2ZDMA 4GHTA 1GDQA 4TWYA 3ZVFA 1TOMH 2FLRH 2XC4A 4B2AA 1N6YA 1FI8A 1SGFA 1LVMA 4JYTA 1SHHB 1RD3B 1C4V2 1PPFE 4NCYA 3ZVCA 2P95A 5A0BA 1EZSC 3LH1A 4XE4A 2CGAA 2PKAA 2ZI2H 2OLGA 3ZYDA 1O2JA 1SPJA 1EATA 1A5IA 1UK2A 1EOJA 3OYPA 3SNAA 4DW2U 1C1UH 2J92A 1SGTA 1WQVH 1AKSB 1K1PA 4E06H 5E2OA 2I6SA 1EZXC 4IMQA 6CHAB 1N1LA 2OBOA 1AWFH 4O03A 4FUDA 5DK1A 4ABBA 4Y0YE 3OY5U 1O5GH 2BMGB 2BD8A 3ZVDA 4MPUA 1OWKA 2PHBA 2PTNA 4AG1A 4U01A 1O2WA 4X2YA 5ESTE 1QFKH 3LU9B 1XUFA 2Y5HA 1TGCA 1UK4A 2AMPA 1BTWA 1C5RA 2A7JA 2XBWA 1TMUH 1GDUA 1Y3VA 4E7NA 3PV4A 2F83A 5EPYA 1GCDA 4GHQA 3SI4H 5DP7A 2PGBB 1BBRH 3A8BA 1TIOA 3K6ZA 3QZRA 1AD8H 1Z8IB 2Z9JA 3UR9A 1EZUC 1XXFA 1A46H 4B73A 2VNTA 1D4PB 1T8LA 5EOKA 3HPTB 1HYLA 1UTKA 1F5LA 2FPZA 2LPRA 2UUKB 4X2XA 2IJOB 2THFB 3U8TH 4ABHA 1D3QB 1O2LA 3S0NA 4O97A 1GBBA 1GHAF 3NWUA 5EW1H 4MPXA 1PYTD 2B8OH 4BXWA 2ZG0H 3UIRA 2O8WA 3ATMA 1GDNA 1H4WA 5EQSA 3QLPH 2SGQE 2VVCA 1MTNB 1L2EA 2WPIS 2TGPZ 2ZQ1A 4DVAU 1J15A 5HYOA 2PSYA 2Z9LA 3ATLA 1GBKA 1O36A 2ZWLH 1GHZA 1NRPH 1HGTH 1O2RA 4YOGA 3TJUA 1VGCC 4BAOB 4A5TS 4NIYA 2F9BH 2H2ZA 4D9QA 9LPRA 1P3EA 3A81A 1FY5A 2ZFTA 2TGAA 3RM0H 1HAOH 1OPHB 3PMAB 3A8AA 1AWHB 1BTUA 1YC0A 1ZPCA 1QJ1B 4D7GA 1QURH 2TBSA 4LOYH 3UREA 4JMYA 2CF8H 1AI8H 1TA2A 2PR3A 2VGCB 4JCNA 3P6ZB 1LKBA 1G3CA 2WPMS 1RJXB 4AN7A 3K6YA 3TJNA 5DP6A 4K69A 1ELEE 2ODQA 3IG6B 1H8DH 1Z6EA 1JOUB 2FX4A 3UFAA 2BDGA 3PMHB 1FAXA 1PQ7A 4Q80A 2ZQ2A 3M36A 4OS7A 1LHFH 2FWWA 1L1JA 1GWAA 4MTBA 2QIQA 4ZH8A 4AYYB 3BF6H 4FUFA 1CU1A 2BXUH 2AEIH 1E0FD 3EDXB 3RXCA 2SFAA 1HAVA 2ANWA 3T28A 2SGAA 1W7XH 3A87A 2W3KA 5I46H 1Z7KA 4CREA 2WUBA 1HUTH 2XTTB 4ABGA 3KEEA 4I7YH 2BX3A 3UTUH 1O2XA 1D3DB 1QL9A 3JZ2B 3V13A 2OC7A 3LC3A 5HMAA 1GI4A 2BY7X 4LZ1H 1X7AC 3G01A 1GL1A 2C90B 1YBWA 1C2DA 3UUZA 2G51A 2Z7FE 1L1NA 3SV2H 3SNCA 1SSXA 3A7WA 2TPIZ 5BRRE 1HAXB 2FX6A 1ZTJA 2FM2A 1O3DA 2XYAA 1TBQH 3TK5A 1SOTA 1RTFB 3ODFA 1QB9A 3OTJE 3BTQE 1DICA 1OWJA 1EB2A 2PUXB 2ZU4A 1M9UA 1RS0A 1TMBH 1TNKA 4OS5A 1TGTA 1V6DA 1A0LA 1DPOA 4YOIA 3AW1A 1WYKA 4X1PU 1H1BA 5DP4A 1XUGA 1W7GH 2ODYB 1AHTH 5FCKA 5C1UA 1GJ4H 4JZDH 1FIZA 3T26A 4ABIA 1E36B 3TVJB 4YTAA 1OX1A 3QTOH 2HOBA 1UCYE 2OQ5A 1SBWA 1TNGA 2XC5A 1MD8A 1TX8A 5EPNA 2P8OB 3LJOA 1MTVA 4O9VA 1NESE 1T31A 3M7TA 5C1YA 2WUCA 5HM9A 8GCHF 2BY9X 1DANH 3O8CA 1GI5A 1WOFA 2CHAB 5E2PA 4JZ1A 1AMHA 2GZ8A 3PO1C 1MH0A 5L2YH 5C3NA 3Q3XA 2ZCLP 1CA0C 3KQEA 4X0WU 3RXJA 1VITG 1WU1A 2W5EA 2GT8A 1TBZH 1DM4B 1ELFA 1GHYH 1YPMH 1T4VH 1TMTH 4NSVA 1NFYA 1GI9B 2HNTF 5FCRA 1ORFA 3ZZ9A 5DGJA 1RTKA 4YLUA 1TAWA 3BTTE 1BBRE 3VFEA 2C8XB 5EQQA 2ULLA 2P59A 2BDYA 3BTWE 7ESTE 2NU1E 1NT1A 3ZZ7A 2Z6BD 2VWLA 3URDA 1DWEH 3L33A 1BJUA 2A7HA 1JBUH 1O2KA 1GMDG 1FDPA 4H42U 3SU5A 1ABIH 1TA6A 1DWDH 3RXFA 1HCGA 4ZHAA 1ZSLA 4Y71A 4K60A 2OD3B 1C2LA 1GHVH 3F9HA 4SGBE 1UMAH 1THRH 3LC5A 1BTHH 2D8WA 5GPIB 1S5SA 4ZHLU 2V3HH 2CJIA 3O8DA 8GCHG 2O8TA 1QBNA 1CBWB 3M37A 1WAYB 1V2MT 4U2WA 3T27A 1P11E 3UY9A 6LPRA 3B9FH 2ZO3H 3UQVA 4TPIZ 1MKXH 1VCPA 3A7YA 2VVUA 1DSUA 2ZPQA 1PPGE 5T3HA 4Y0ZE 1A5HA 2XW9A 3MMGA 1DWBH 1P03A 4Y7BA 1VJ9U 3UWJH 2FDAA 3SUFA 5FPSA 2J4IA 4AGKA 2JH5D 4I8KA 1NRRH 1TOCB 3VB6A 3SU6A 3A89A 1AFQC 1QY6A 3E3TA