3OX7U

The crystal structure of upa complex with peptide inhibitor mh027 at ph4.6
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSALAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title The binding mechanism of a peptidic cyclic serine protease inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 245
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ox7U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ox7U01
3SO3A 1YPKH 4JZEH 1GDUA 5AFZH 1S85A 2WV4A 2A4OA 1HRTH 3GY7A 3NPSA 4DVAU 2H1UA 3HATH 1F5RA 4X8VH 2OC8A 3RXDA 1O2ZA 1UVPA 3V13A 1TBQH 4FVDA 3RM2H 4J1YA 4K1TA 2Q6GA 1HAPH 1EJNA 1HAHH 2AMDA 1W12U 2Y80A 4AB9A 1V2TT 3SV9A 2BVSH 2O9QA 5PTPA 2ZDMA 4O03A 1OS8A 2OTVA 1TPSA 1MD7A 4JYVH 1VGCB 4NIYA 3SORA 6CHAC 4FUHA 1HNEE 1NFXA 3MMGA 3TITA 2R3UA 2HLCA 1GHAG 2H9TH 1GG6B 1GJCB 4BAOB 4K1EA 1O2OA 1B7XB 2SGEE 1GI1A 2ZEBA 1BBRK 2FOAA 4UEHH 2ZHDA 1W2KH 1HIAB 1AY6H 3F68H 3SU0A 3U8TH 3OY6U 4IS5A 4MNWA 2QCYA 3EQ0H 1O35A 2SNWA 4IN2A 1O3GA 3M5NA 1Z8JB 1G9IE 1F92A 2AYWA 2HWLB 1ANCA 1YCPH 1BDAA 1CHOF 3KN2A 2B8OH 3M3SA 1H9HE 3L33A 3O8RA 4JYTA 3T28A 1CT2E 2ANMH 4XSKU 2TBSA 2Y7XA 5A2MH 1MZDA 1DX5M 1ZMLA 1T4VH 1ZYOA 2PR3A 1MBMA 2BDHA 3TH2H 4DW2U 3STJA 2ZGXH 4ISLA 1TNIA 3M7TA 1O2JA 3RMLH 3A87A 3RXAA 2SGDE 1SB1H 2PUQH 1UTNA 2J92A 1Z8GA 2ODYB 1GHXH 1KY9A 1VZQH 1CE5A 1NZQH 1VCQA 2FOEA 1DITH 1TNLA 3MU1A 3NCLA 1J14A 2IN2A 4OS6A 1TA2A 4AORA 1ZJKA 2GCTC 1C2MA 1LHGH 2CJIA 1EP5A 5DP7A 4Y8XA 4A6LA 1EPTB 1MUEB 1Y5AT 1HGTH 4Y79A 1F0SA 2THFB 2STBE 1IHSH 1ZGVA 4WMEA 4ZROA 4ASHA 4KTCA 1F7ZA 4KTUA 1Y3UA 2FX4A 3V3MA 2ANWA 1C1TA 3RDZA 1E38B 2VGCC 1C5RA 1O5EH 2ZDAH 1UK4A 3A81A 1DS2E 2VB0A 5DK1A 4FUIA 3QGNB 3C27B 2PGBB 1N8OB 3EA7A 2VIPA 3SNCA 1D3DB 1AVGH 1KXFA 3PMAB 2B7DH 1O2RA 1DWCH 5B6OA 1HJAB 3A8DA 3DHKH 1T7CA 2Y5GA 1V2NT 4RKJB 3SNEA 1BHXF 1D6WA 4WVPE 1AUJA 3R3GB 2A4GA 1Y59T 2ZPSA 2P93A 4K1SA 2QGRA 2R9PA 5SGAE 1MAXA 1WOFA 3BG8A 4ZKNU 4TYDA 1C9PA 1LQEA 1MTSA 1O39A 3UQOA 3SJ9A 2NWNA 2J34A 3Q77A 5BPEA 3U98H 1FY5A 5T3HA 1DY9A 1NS3A 1EQ9A 3K6ZA 3ODDA 1IQLA 4OS5A 1GHBF 2ZCKP 1CBWB 2YNAA 1ESAA 5FX6A 1D3TB 2BY9X 2YOLA 2A5AA 4ABHA 1J15A 1P57B 1EAIA 3VPKA 1AKSB 1OSSA 1TX8A 1GJ9B 1C4Y2 3D23A 1S81A 1SGFA 4CRCA 3F9EA 1VCPA 2P95A 1AD8H 1EZQA 1L2EA 1PPCE 3BEFB 5I46H 1Z8IB 1Q31A 2C90B 1O3AA 1EZSC 2ZFFH 1W7XH 4MNYA 3HPTB 1SR5C 4OS7A 3L6PA 2ZGBH 2FPZA 2SFAA 1BZXE 2VU8E 2ZKSA 4DURA 1MCTA 1K1IA 1UHBB 1Y8TA 2C93B 3SQEE 1AE5A 4I31A 5DP4A 1CQQA 1RIWC 1O2UA 1FV9A 1CA8B 2QXJA 2ZGHA 1O5AB 2OXSA 1NESE 2ZCLP 1HYLA 2A45B 4I8GA 5GDSH 5FCKA 3MH5A 5DP5A 4ABJA 3ZZ6A 2XCNA 2ZI2H 3AVZA 1KLIH 5JDUB 4DIIH 1W13U 1MTNC 1QJ1B 3CS7A 4JZFH 1QBVH 2BD9A 2FS8A 4WH6A 4ZMAH 4KTSA 1K1PA 1BHXB 1PYTD 4Q7ZA 1P3CA 3OY5U 4CRDA 1O34A 9LPRA 1TX7A 1AUTC 3MNBA 1ANBA 1FAXA 1SGFG 4X6PA 5HMAA 4O3TA 1FAKH 1W0ZU 1O3FA 1UTLM 3QTVH 3E6PH 3SNBA 4D8NA 4BOHA 2QC2A 4NG9H 1GI2A 1EOJA 3UR9A 1OP0A 1MH0A 1HAOH 1O5GH 1GMCG 1O3OA 1K28D 1P05A 1IAUA 1P11E 1MMJN 1HXFH 3GISB 2ZDVH 1RTLA 4OS4A 1RD3B 1YP9A 2BDIA 2ZO3H 4R8TB 4AFZA 5L2YH 3GICB 3MHWU 2D8WA 3TPIZ 2W26A 2C8ZB 3EE0B 4D7FA 2C8YB 1L1JA 1V2WT 4FUJA 1QY6A 5F8XA 3RXCA 3MFJA 3OYPA 2UUKB 2PSYA 3HKIB 1XVOA 3UY9A 4BAHB 4X8TH 2AIPA 1EZXC 1W0YH 1UO6A 1XX9A 5FPTA 1AVXA 4YOJA 3ATLA 2ULLA 1UTJA 6GCHG 2XBXA 2G81E 1O2YA 1NFWA 4GUXA 4MPXA 1C2HA 4X2WA 3A7XA 2A0QB 1V6DA 4H6SB 1J16A 3KCGH 2QF3A 1FY1A 1P2MA 2ZNKH 2ZA5A 3GCNA 1EJMA 4UFEH 1HFDA 3UWIA 3Q3KA 1ANDA 1OXGA 4NZLA 4Y71A 3ZZ8A 4WJG2 4E7NA 3VGCC 5CE1A 4JMYA 1TLDA 1G37A 2BX3A 2HNTC 1FDPA 3A84A 2P3TB 3UNQA 3O8CA 3GCHC 3S0NA 1C5PA 1O2LA 4X6MA 2F9OA 4YLUA 3SOSA 2JH5D 4LZ4B 1QTFA 3VB6A 1EB2A 1L1GA 2NU3E 3DA9B 5E2OA 3NZIA 4Y10E 3UOPA 2FMJA 4AOQA 1FJSA 1C5UA 2FOGA 4Q2KA 1C1RA 1DSUA 2XBYA 4O97A 3QK1A 5CHAC 1UCYK 5A0AE 1Q2WA 4IC6A 7GCHF 1LKAA 4BNRA 3RXEA 4FU8A 5EXLA 2J94A 3P8OA 2Y81A 1H4WA 3D65E 1C1WH 3QLPH 1XUKA 4ZXYH 1LCYA 2GT8A 3BV9B 1O3IA 5EPNA 2BXTH 2GDEH 4JK5A 3SU2A 2W5EA 3LJOA 3VB3A 5EQSA 4GHTA 1DLKB 4IMQA 4HI3A 1O5BB 4F49A 1G3BA 1OWIA 3A7VA 5GCHF 1TGSZ 1LHCH 5TCCA 2J2UA 2ZZUH 4UONA 1FXYA 2CHAC 1Z6EA 3GDVA 1EKBB 1EP6A 3VB7A 3KQBA 1EAXA 1AIXH 1OWJA 2QF0A 4YT6H 2VNTA 1K1LA 1C1UH 2Z9LA 3MWIU 4NFEA 4VGCB 1AO5A 2Z9KA 5L30H 1BT7A 1TNGA 4A1TA 4SGAE 4UFFH 3M3TA 1SI5H 1WAYB 1A3BH 1SHHB 2AGIX 2BOHB 1TONA 3FANA 3ZZBA 3TH3H 2JETC 1AWHB 1QQUA 1EAWA 1GMDF 2AH4X 3ZYEA 3RU4T 5FPSA 5C3NA 4I33A 3D62A 1MTVA 1SL3A 4SGBE 1ZTKA 2HVXA 4A1XA 1C1QA 2IPHA 3UTUH 3RXBA 1C5TA 1IQGA 1O3BA 1ZZZA 5A8XA 2WYJA 5JBCS 1UVSH 2FIRH 4CRFA 5ETXA 2SGFE 4X0WU 2UUFB 1V2VT 5EGMA 2A1DB 2VIWA 4DGJA 1F2SE 2STAE 4X8SH 1Y3VA 5HM2A 3V0XA 3T2NA 7GCHG 2W3KA 1EUFA 3O8BA 1Q3XA 1ABIH 1NY22 1BUIA 1O33A 2ZFRH 4IC5A 4I7YH 3S69A 2ALPA 1SGNE 2GCHF 2ILNA 1DLEA 3BG4C 1UCYE 1ANEA 4WWYA 1ZRBA 4X8UH 1NROH 5JBAS 3PTNA 5GPIB 3LONA 4KELA 1IQNA 1G3DA 5C2ZA 4ZKOU 3CENA 3RP2A 4U2WA 1W3CA 5FX5A 2FO9A 5FHTA 1ELFA 3SJKA 3U69H 2D2DA 2WUBA 3S7KB 1V2KT 2WINI 3PV4A 2OUAA 1IQMA 1GVKB 1A2CH 1O5FH 3MU4A 5DP8A 1KXEA 3A80A 1QB6A 2H2ZA 2ZHFH 4NZQA 1ELBA 4A5TS 1GJ4H 1TMUH 3FAOA 3A86A 1QB9A 1GMHF 1H8IH 2HRVA 3V7TA 2Y82A 4KGAA 4CHAC 1O2HA 1YPMH 4B2BA 5A0BA 5HM9A 1ESBA 5C5OA 1S0RA 1UTKA 2G55A 1P0SH 4GCHF 3TK5A 1JIMA 1ZSKA 4JZDH 3RM0H 2WPJS 2ANYA 2Z9IA 1DY8A 3B23B 3A7TA 3M35A 4CREA 2DE8A 5JB9S 1VCWA 1O3KA 2QXIA 2UUYA 3SGAE 2LNCA 1M9UA 3UREA 3SBKA 1TAWA 2VWLA 1QL8A 1WTHD 1ETRH 5A0CA 3SQHE 3ZV8A 4K60A 3P8NA 1IQFA 4CR5A 1HIAA 1TABE 4ZH8A 3TJVA 1WQSA 3PO1B 1TQ7B 3KL6A 3OSYA 1ZRKA 5T6DA 1QNJA 1BTZA 1ELVA 4FUGA 2EI8A 5GWZA 4YESB 1MQ6A 1Z8RA 1GBKA 2AEIH 2BQWB 3KEEA 2F9UA 1K1NA 3BSQA 3UWJH 1HUTH 2P8OC 1DWEH 2GTBA 3PTBA 3SU4A 1PJPA 1HDTH 1ZGIA 2ZCHP 3LOXA 2HNTF 1N1LA 3SUGA 2AERH 3HGNA 1LPZB 1WTGH 1AE8H 3TLOA 2TGPZ 2ZPRA 1D4PB 3NWUA 3MO6A 3GDSA 3I78A 1RTFB 9ESTA 1YGCH 4TPIZ 1NU7B 1YC0A 3S9AA 2QV1A 2G4TA 2FTLE 1TOMH 2V3HH 1TRMA 4TWYA 1BTHH 1GHZA 1O5CB 5GJ4B 5TCAA 1WSSH 1MKXH 3QGJA 3RLYH 3RXTA 4B76A 2BYAX 1QHRB 1K21H 2A7CA 3FP7E 5JPMH 3A82A 1XMNB 2KAIB 2TRMA 1ESTA 1PPZA 4X6OA 1SOZA 3MH6A 1GBAA 2SGQE 1G3CA 5DP9A 1SMFE 1TGCA 2Z7FE 3VXFH 3T27A 1EPTA 1HAYB 1YPGH 3ZZDA 5FBIA 3MU0A 1CGHA 3F1SB 4FUDA 3H7TA 4RSPA 2M5TA 1ZTJA 2FM2A 1H9IE 2XXLA 3SHAH 3EA8A 1XM1A 4K5ZA 1V2UT 3BTQE 4UDWH 1VITF 1ZR0A 1UTQA 2W7UA 2BD4A 1UTOA 2VVUA 2XC4A 4ZXXH 1C5SA 3SNAA 1P10A 3SU5A 2G5VA 1EX3A 2ANKH 2I6QA 2RDLA 1GBJA 1PQ5A 2LPRA 1KXCA 4E06H 4XBDA 3AAUA 4OGYA 5AF9H 1IQKA 4ISOA 4MNVA 1P2KA 1C5OH 3PWBA 4M7GA 5C5NA 3LJJA 2BD5A 3VB5A 2P94A 1GJAB 1L1NA 1MKWK 4TY6A 2VH0A 1K9OE 5GXPA 2WV5A 1A0JA 4CH8B 4IMZA 1AFQC 1D3PB 1XVMA 3GCHB 1O2PA 2WPLS 2BLVA 1C2IA 4CR9A 1SLUB 1C5VA 1ELGA 1QRZA 3BTFE 1DXWA 1SGCA 1TGNA 1FONA 1GJ5H 1UTPA 1AWFH 4XDEA 2AIQA 4GAWA 3LGYA 1B5GH 1S6FA 1BRAA 3RXIA 2BLQA 1ZSLA 4WXIA 1AKSA 1SBWA 7ESTE 2Z3EA 3TVJB 1T8LA 2Z3CA 1V2JT 3BTEE 3HGPA 2ZWLH 5HYOA 1Z1JA 3SU6A 1CHOG 1HXEH 3P70B 4WXVA 3TIUA 1W14U 2Y5FA 1YYY1 2R2MB 5A8ZA 1WBGB 1GBFA 2R2WU 1LPKB 1V2RT 4MLFB 2GZ9A 3P95A 5DPAA 1C2GA 2HGTH 1CA0C 1F0UA 3SI4H 1SLXB 1UHBA 1QIXB 2PHBA 1AHTH 5F6MA 3MYWA 1O2KA 2BD2A 1ELEE 4FU9A 3UFAA 1NRQH 2UWPA 2CHAB 3GY4A 4MQAA 1AQ7A 2QXGA 1S0QA 1WCZA 1O5DH 1SGRE 3URDA 3F9GA 1Y3WA 4Y11E 1DOJA 2BM2A 2XC0A 1NU9A 1GCTC 2CGAA 4Y0YE 1C2EA 1Z71A 1OPHB 3GCOA 3RXKA 5FPYA 3RXOA 1NTPA 3ENSB 1YCPK 4IW4E 4B2AA 2F83A 1SGDE 1HLTH 3GCTF 1EATA 5HGGA 4ZKSU 1V3XA 4FUBA 1DANH 2J4IA 2JETB 5J4SA 5E8EH 5F8TA 3CP7A 4X1SU 1GVZA 1WV7H 2Z6BD 4FUEA 1NFUA 1GBCA 2BDGA 1DT2A 2VVVA 1L0ZA 1SGTA 4I8HA 1O3CA 1O2NA 1SGIB 3LT3A 5JBTA 1TOCB 1GBTA 1LVOA 1BOQA 2OBQA 4AGJA 3N7OA 3AAVA 3VB4A 3GY2A 3A85A 1KTSB 4MNXA 2J95A 1OWHA 1Y5UT 3RXHA 5GIBA 1G3EA 2F9BH 3D49H 3TGIE 1IQIA 1QFKH 1ZHPA 1E0FD 1YF4A 1ZHRA 2GMTB 1C1PA 1Z7KA 2GD4B 1C2FA 1BMLA 1P3EA 2BTCE 2O8MA 1BRBE 3PROA 2H5DA 4YOIA 1MBQA 1O3EA 1THSH 3MU5A 3BTWE 1D9IA 1ZTLA 2JKHA 4OS1A 2G51A 4DG4A 4RKOB 3UNSA 5DKMA 4H6TA 3FP8E 1D3QB 1C9TA 1BA8B 3SJOA 5JYIA 1T4UH 3E3TA 3F9FA 2PKAB 3ZVDA 1TE0A 1GJ7B 1LVBA 2FDAA 3RXFA 4DOQA 3ZVAA 4X1RU 1FPHH 3SI3H 1GHBG 1YPHE 4X1PU 5DP3A 5L6NH 4DIHH 1C4U2 3MOCA 1GG6C 1NRNH 2GV7A 1E37B 2ZQ2A 2HPQH 1T31A 2ZTZA 4ABDA 4DY7B 2V6NA 1BMNH 1G2LA 4MTBA 3RXJA 2QXHA 1TFXA 3MO3A 4BAQB 3P8GA 1QA0A 4AFSA 6ESTA 2DE9A 2RG3A 2TGDA 1TWXB 3BIUH 3DT0H 1KXDA 1G36A 2FOFA 2FI3E 3LC5A 1UK2A 3DFLA 1ZOMA 1UTMA 2F91A 2VIVA 3OU0A 4OS2A 2TGTA 2BY7X 1S5SA 3SUDA 1YCPM 1HAGE 4Y7BA 2SGPE 3ATKA 3FFGA 1O3NA 4A1VA 4THNH 3ZZAA 2VWOA 1BTWA 1P12E 4O3UA 4ABFA 1LKBA 4E05H 3LKWA 3PB1E 8KME2 2GZ7A 3QTOH 1ELTA 3GY8A 3VXEH 2A7JA 4GVUA 1X7AC 3SW2B 1ARBA 3M5OA 8LPRA 1UJ1A 2B5TB 4LZ1H 2V0BA 1ZMNA 4GPGA 1MU6B 4D9QA 1UK3A 5E0HA 1TRNA 1B0FA 1ZJDA 4X1NU 1MTWA 8GCHF 2CF8H 4ISHH 1S83A 3DD2H 5ABWA 1JRTA 4NA7A 2SGAA 4ABEA 1ARCA 1V2LT 2FX6A 1C1VH 4UD9H 2OBOA 5E0JA 3S9BA 3MTYA 3LIWA 1SG8B 6CHAB 1KLTA 2GVFA 1G32B 1EPTC 3L3TA 3RC5A 4BTTB 1NO9H 2XWAA 1C5YB 3PLKA 1B0EA 2A4RA 1G30B 4YOGA 1THPB 1OWEA 2XRCA 1H1BA 2ZQ1A 2TPIZ 1BTPA 1O3PB 3ELAH 3MO9A 4I32A 2PFEA 4OGXA 1C1NA 1F5KU 2XW9A 3A8CA 2H9EH 4INHA 3UQVA 2PSXA 1PQAA 4AG1A 2BQ6B 1GJBB 2XC5A 5FBEA 2H6MA 1D6RA 4B2CA 3I77A 2CMYA 3LU9B 3H5CB 1Z1IA 4FXGH 3G01A 3GYMA 1N6YA 2A7HA 4GHQA 3U8RH 1SGPE 1KXBA 1HJAC 1WYKA 1SQAA 1P03A 1GBIA 1MU8B 3B8JA 4H42U 1AZ8A 1C1OA 1SQOA 3K6YA 5G4BA 1INCA 2Z3DA 1Y5BT 5K0HA 1GBLA 2BD7A 4J2YB 2AMQA 1NT1A 1GBEA 1KDQB 3LH3A 4QT8C 4CH2B 3EDXB 2OQUA 4X2VA 1GJDB 1P2JA 3EAJA 1GWAA 2XTTB 3LGVA 5DJ7A 1ZPZA 2VINA 1VJAU 1O36A 1Y3YA 3QZQA 2EEKA 1YLDA 3RXUA 1P2QA 2HOBA 1HBTH 3FP6E 4LXBH 2BDYA 3SU1A 2GKVE 1JIRA 2ZFQH 2GCTB 3E16B 3HK6B 3GY6A 4ISIH 1YBWA 4YLQH 4JZIA 2ZU2A 3SV8A 2QIQA 3URCA 5LPRA 4F4OC 4MPUA 3SV2H 1TGTA 1A7SA 2BVRH 3STIA 1BMMH 1LVMA 4E7RG 1A3EH 4NGAH 4IN1A 3GDUA 3SN8A 5HXFA 2AFQB 1LO6A 3SV7A 5IDKA 4XFQA 2GX4A 3ZZ5A 3Q3YA 1GI0A 4AGKA 2AS9A 4DCDA 4FU7A 2VGCB 1W8BH 3ZZ9A 1XUHA 3TJNA 2RA3A 3ZZ3A 2VIDA 1QJ6B 1XKAC 2BDBA 3UPEA 1AMHA 3LH1A 3Q00A 5A09A 4WY3A 1O3HA 1P06A 3UR6A 5I25A 3P17H 1SGQE 1G2MA 3U1IB 4O9VA 4BXWA 1FIZA 1BTUA 2BQ7B 3RU4D 1BBRH 1FQ3A 4ZHLU 1UMAH 1O3LA 2EA3A 1MCVA 3RXSA 1C5ZB 3BTKE 3LPRA 1YPLH 2OQ5A 2GGVB 4Y6DA 1GHYH 1XUFA 3F9HA 1ETSH 1YPEH 1O2MA 5GCHG 1CA0B 3NXPA 4AFQA 5LPFA 3A8AA 5J4QA 5LH8A 2WYGA 4TPYA 1F5LA 1C2DA 1RRKA 1NPMA 2VVCA 2QY0B 2ZU3A 2F3CE 1CGIE 3GY5A 1DICA 1KXAA 1P04A 3ITIA 2OC1A 1GHAF 3GY3A 5H4IB 4X6NA 5FXLA 3T29A 1LHEH 1JMOH 3EGKH 3DFJA 3IITA 4PROA 1GI5A 1A61H 1RTKA 4X2XA 1RGQA 1U6QA 1GMDG 1NRRH 4XOJA 3MNCA 4ESTE 2Z94A 1NC6A 1J17T 1C5XB 2JH6D 4KP0A 1KSNA 5LPEA 1QGFA 2PW8H 1BJUA 1SC8U 1E35B 1CU1A 1FUJA 2ZGCA 3SGQE 2BHGA 3TH4H 1A4WH 4BANB 1DPOA 2F9VA 1RIWB 5EW2H 2PV9B 3PMJA 4RN6A 5C67A 4YZUA 2KAIA 5FCRA 3KF2A 2ZFTA 3U8OH 1MTNB 2JH0D 1V2PT 1A46H 3AW0A 2BMGB 4A7IB 1FPCH 1GHVH 1UVOA 3U1JB 4Q7XA 2C8XB 3M37A 1GCDA 3SNDA 1VITH 2EI6A 1FY4A 1MD8A 2GCHG 5EXMA 2XCFA 1GDQA 3OX7U 2ZHEH 2OP9A 3UIRA 2FODA 1WUNH 3ATMA 1MQ5A 3RXRA 2CF9H 1HJ9A 5AHGH 1LDTT 1TMBH 4NWLA 2F9NA 1AFEH 1GI8B 2ALVA 1SFIA 3RXLA 2R3YA 2K1QA 4Q80A 3UUZA 3ODFA 4ZHAA 1ABJH 2BLWA 1DE7H 1GBBA 4AFUA 1BITA 1GL0E 5A8YA 3EA9A 3Q3XA 2B0FA 2AGGX 3M7QA 4Y7AA 4GSOA 4TY7A 1GJ8B 2ESTE 2XWBI 3E0NB 2QN5T 1SFQB 3SUFA 5EXNA 2ZU5A 1GGDC 3EYDA 2B9LA 4Y8YA 3KNXA 3M36A 1GMHG 4ZKRU 2BB4A 3BTME 1XUJA 1TGBA 3QUMP 1TBRH 1RS0A 4YM9A 3A7WA 1DDJA 1C1SA 2Q6FA 3SJ8A 2G52A 4GCHG 4JK6A 4ZHMU 2XNIA 2BD8A 1J8AA 2FS9A 3ZZ7A 1PQ8A 3M3VA 1ACBE 1DUEA 1SLVB 1YM0A 4NIXA 2PUXB 3M61U 3E8LA 1SGYE 3TGKE 3MH4A 3DUXH 3VEQB 5AFYH 1GBDA 1SQTA 3A88A 3KQCA 3AW1A 2NU2E 1TQ0B 3QN7A 1O2TA 1A0HB 1GI6A 1P9UA 2R0KA 3ZV9A 4D9RA 1DXPA 5IYTA 3BN9A 1ETTH 3ZVFA 3UNRA 4B1TA 2FESH 1JWTA 2XYAA 1OWDA 6LPRA 3P8FA 4HTCH 2OINA 3K9XB 3VGCB 3IG6B 2VIOA 4VGCC 1MAYA 4FUCA 5F03A 1K1OA 3BTGE 4HZHA 1QA7A 3CS0A 5EG4A 1C1MA 3SHCH 2A4QA 7KMEH 1GI9B 1BRCE 1A5IA 4JZ1A 1SGEE 4X2YA 5C20A 3RXMA 2P3UB 2BZAA 1QQ4A 5F8ZA 2Z9JA 3RUOA 3NUMA 2OD3B 4UFDH 1WU1A 4LOYH 1CGJE 4IBLH 1LTOA 4XBBA 1CT4E 4B73A 1S82A 2HPPH 3SZNA 1TMTH 2BY8X 1H9LB 4NA9H 2WPKS 1K2I1 5CHAB 1OKXA 4B75A 1C5LH 1TPOA 1P2OA 1AZZA 2OLGA 3KQDA 3TJUA 3A7ZA 4U01A 1XXDA 4AX9H 1QRWA 1DWBH 3RXPA 2GP9B 2P59A 1HAXB 3SUEA 5AVDA 2A2XH 1T8MA 1AB9C 1YLCA 3PMBB 4UFGH 1EAUA 2GZ8A 3LGIA 1A5GH 2FI4E 1THRH 2FI5E 1FMGA 1HV7A 3HKJB 1PPEE 3HK3B 1QR3E 1IQJA 2A5KA 2FOMB 4IGDA 5DO4H 2CV3A 3BTHE 3E1XB 4WMDA 1FY8E 2FXRA 1TNHA 4AB8A 1ZHMA 4Q7YA 2FEQH 2OC0A 1BBRE 2NU0E 1IQHA 1GL1A 3ZVGA 3RMOH 3QDZB 4B71A 1PYTC 1TIOA 1VITG 1EOLA 1UVTH 4JYUH 2Y6TA 1GBMA 1MKXK 4ABIA 1O37A 1DM4B 1O3JA 1QB1A 1W7GH 1BB0B 4MPVA 4K2YA 3JZ2B 3LGUA 2ZFSA 1C2JA 1KLJH 1GI4A 1O30A 2VWNA 3LDXH 3LGWA 1EXFA 1GMCF 2ZDKA 1SLWB 4D76A 1TPAE 1PPBH 4CBNA 4I8KA 3TNTA 2WUCA 2ODPA 3WY8A 2BOKA 1SVPA 1DFPA 1C5MD 4ZUHA 4NWKA 2EI7A 4FUFA 2PKSC 1XUGA 3P92A 3R0FA 1E36B 2HNTE 2J9NA 1C2LA 1S6HA 3TJOA 3TGJE 2IJOB 1GJ6A 1HJ8A 2QYIA 1V2ST 1F0TA 2QA9E 2PKAA 1NRPH 5JB8S 3MNXA 2O8TA 2UWOA 4AYYB 1A5HA 3KGPA 5DG6A 4HFPB 5FAHA 3LC3A 4WMFA 1HPGA 1ZSJA 3SU3A 6GCHF 3RXQA 1XKBC 4YO9A 1FI8A 1NN6A 1O2QA 1KIGH 1P02A 1W11U 5DP6A 3T62A 1L4DA 1NM6A 1TRYA 1PFXC 8ESTE 2WPIS 3NK8A 5EQQA 1KYNA 1OOKB 4INLA 3PO1C 2RCEA 2ZHWH 3IWMA 5C1XA 5DGJA 1C4V2 3BG4B 4WF8A 3U9AH 5L2ZH 1UCYH 1L4ZA 2W7SA 1XXFA 3T26A 3K65B 1V2QT 3RU4E 2O8UA 5EQRA 2FYQA 1O2SA 4YT7H 5EODA 1V2OT 1VGCC 2BDCA 4Z6AH 1YPJH 4ISNA 1GVLA 3QWCH 2YNBA 1OYTH 3VFEA 3RXVA 4TWWA 1HAVA 2C8WB 1AGJA 2GV6A 2Q6DA 1BCUH 4U32A 3NKKA 3RC6A 3RC4A 3RLWH 1VR1H 2AMPA 2J38A 1BMAA 1TX6A 2PLXA 1E34B 2TIOA 3TNSA 4X1QU 1EB1H 3GCTG 2Q1JA 2F9PA 3QO6A 3OTJE 1O31A 1GI3A 3ZVBA 1PPFE 4CHAB 3MNSA 4MVNA 3AASA 4NIVA 3ATIA 2ZIQH 2GDDA 4MDSA 1FLEE 3A8BA 2FZZA 4BTIB 5JBBS 1S84A 4MG3A 2FYRA 2H5CA 3ZZCA 3S9CA 1HCGA 1AU8A 1TNKA 1FZZA 2XBWA 1HAVB 4DJZB 1LVYA 5T6GA 1LHDH 2H9HA 5BRRE 2WPHS 3ZVEA 2BLOA 2BZ6H 7LPRA 4ZAEA 2BY5X 2P3FH 4I8JA 1UVUH 1AI8H 1TB6H 1GI7B 2G4UA 4WH8A 2A32A 1C5NH 1QL7A 1K1MA 3PYHA 1MTUA 3T25A 2A5IA 2QAAA 3SJIA 2FTMA 2P8OB 4NCYA 3UOUA 1ZMJA 2D26C 4FVBA 3MI4A 5EU8A 3F6UH 2C4FH 1FN8A 5E0GA 2VIQA 4B74A 1C2KA 5EOKA 5C1UA 2FOCA 3M5MA 1QBOA 2OCVB 1Z6JH 2BVXH 1CHGA 2ZF0H 1QBNA 1T8OA 2W3IA 1EASA 1IQEA 2HALA 3BEUA 4K3JA 3ZVCA 1MZAA 1W10U 1ELDE 3QX5H 1FNIA 2BX4A 2ZG0H 3M5LA 4K69A 1P2IA 2DUCA 1KDQA 3SV6A 2PGQB 1ZPCA 3A83A 3A7YA 2NU1E 3FZDA 1RJXB 3QZRA 4U30A 3W94A 4NFFA 2VH6A 1JBUH 1HB0B 1O2XA 1ORFA 1WQVH 4XE4A 1IOEA 3KHVA 3ZYDA 2A31A 4AYVB 3E90B 4NA8A 2CXVA 1PPHE 3FVFB 1EZUC 2TGAA 3PLBA 1P9SA 2FP7B 1GGDB 1N8OC 2RA0A 4NSYA 3T5FH 4BTUB 2ZU1A 2VWMA 2V3OH 3ESTA 1JRSA 1T8NA 1BTXA 1SHYA 3PM3A 1OX1A 2BXUH 1VJ9U 2SNVA 2BD3A 4Y8ZA 3MH7A 4CRAA 1CT0E 1DVAH 3O8DA 3JZ1B 3P6ZB 1ID5H 4KKDA 1DWDH 2C3SA 1P01A 2FOBA 1HAZB 1OWKA 2D1JA 4H4FA 1A1RA 2A2QH 2FLBH 4R0IA 2G00A 1TNJA 2I6SA 3C1KA 3LGTA 2CN0H 2VJ1A 5C1YA 1SSXA 3W95A 1RXPA 1SOTA 3RMMH 4AG2A 1TALA 1C5QA 2AGEX 1PQ7A 1SPJA 2Y7ZA 3PWCA 1BTYA 4HGCA 4NSVA 4GLYA 5ESTE 3SGBE 3KQEA 1CBWC 1YPHC 1QCPA 3I29A 3B9FH 2ZTXA 2EC9H 4LK4A 8GCHG 4I8LA 1O2WA 1FY3A 1EJAA 1JOUB 2ZECA 1O3DA 1ZLRA 4ABGA 2OC7A 4CBOA 3ATWA 4CRBA 2UUJB 5EPYA 5T6FA 4BAMB 1AFQB 3GYLB 4ABBA 4YTAA 5K7RA 2ASUB 1Y3XA 2FLRH 1P09A 1BJVA 1O3MA 1O38A 3S7HB 1F0RA 2FOHA 3KIDU 1ELCA 1TYNA 1OP2A 1QRXA 2NU4E 2ZP0H 1GHWH 5LGOA 1GDNA 2ZTYA 1LHFH 1P8VC 3Q76A 3ZZ4A 2Y5HA 4Z0KA 1C5WB 1NFYA 3TK9A 4AN7A 1V2MT 1P2NA 4NIWA 1QL9A 1ELAA 1TPPA 1N6XA 1TBZH 2ZPQA 1O2VA 5E2PA 4JCNA 1K22H 1O0DH 1AB9B 3FZZA 4K8BA 4AZ2B 5CMXH 1O2IA 1H8DH 3BF6H 1KTTB 3BEIB 4INKA 2P16A 1ZPBA 2GMTC 2PWXA 2O8LA 4MPWA 3TK6A 4K8YA 2IOTA 1BQYA 1AVWA 2ZU4A 1BIOA 1QURH 3PLPA 4Y76A 4ABAA 1YKTA 1OYQA 1T32A 1DSTA 2BY6X 1NRSH 3PMHB 2O8WA 1XUIA 3RMNH 2Z9GA 2ZC9H 4UE7H 1TA6A 1CSOE 3E91A 3MU8A 1O32A 1GCTB 2ZDNA 2GT7A 3E0PB 2PTCE 3V12A 2G5NA 3M7UA 1OP8A 1FIWA 2PTNA 3BTTE 2UWLA 2ZGJA 1K1JA 4BAKB 1O2GH 1J9CH 2PKSB 1A0LA 4Y0ZE 1IHTH 1AN1E 3RXGA 4D7GA 1FN6A 3H7OA 2V35A 1DUAA 1RFNA 4CRGA 2ZHQH 4A92A 3TU7H 3K2UA 2XBVA 2ZFPH 2ZDLA 1LPGB 1LQDB 3BIVH 1MKWH 3BTDE 2G8TA 1PPGE 5TJXA 1GPZA 4XBCA 1HAIH 1LMWB 1CVWH 3A89A 5EW1H 2WPMS 1JXPA 1GBHA 2BDAA 4BXSA 3GOVB 2ODQA 1QJ7B 2FWWA 2R0LA 1CO7E 5ESBA 4DT7B 1BRUP
chains in the Genus database with same CATH superfamily
3SO3A 1YPKH 4JZEH 1GDUA 5AFZH 1S85A 2WV4A 2A4OA 1HRTH 3GY7A 3FKSD 3NPSA 4DVAU 2J5UA 2H1UA 3HATH 1F5RA 4X8VH 2LP6A 2OC8A 3ZIAD 3RXDA 1O2ZA 1UVPA 3V13A 1TBQH 4FVDA 3RM2H 4J1YA 3FOAA 4K1TA 2Q6GA 1HAPH 1YWUA 1EJNA 3SYJA 1HAHH 2AMDA 1W12U 2Y80A 4AB9A 1V2TT 3SV9A 2BVSH 2O9QA 5PTPA 2ZDMA 4O03A 1OS8A 2OTVA 1TPSA 1MD7A 4JYVH 1WDIA 1VGCB 4NIYA 3SORA 6CHAC 4FUHA 1HNEE 1NFXA 3MMGA 3TITA 2R3UA 2HLCA 1GHAG 5C0TA 2H9TH 1GG6B 1GJCB 4BAOB 4K1EA 1O2OA 1B7XB 2SGEE 1GI1A 2ZEBA 1BBRK 1W0KD 2FOAA 4UEHH 2ZHDA 1W2KH 1HIAB 1AY6H 3F68H 3SU0A 3U8TH 3OY6U 4IS5A 4MNWA 2QCYA 3EQ0H 1O35A 2SNWA 4IN2A 1O3GA 3M5NA 1Z8JB 1G9IE 1F92A 2AYWA 2HWLB 2QE7D 1ANCA 2F43B 1YCPH 1BDAA 1CHOF 3KN2A 2B8OH 3M3SA 1H9HE 3L33A 3O8RA 4JYTA 3T28A 1CT2E 1H8HD 2ANMH 4XSKU 2TBSA 2Y7XA 5A2MH 1MZDA 1DX5M 1ZMLA 1T4VH 1ZYOA 2PR3A 1MBMA 2BDHA 3TH2H 4DW2U 3STJA 2ZGXH 4ISLA 1TNIA 3M7TA 1O2JA 3RMLH 3A87A 3RXAA 2SGDE 1SB1H 2PUQH 3U28C 1UTNA 2J92A 1Z8GA 2ODYB 1GHXH 1KY9A 1VZQH 1CE5A 1NZQH 1VCQA 2FOEA 1DITH 1TNLA 3MU1A 3NCLA 1J14A 2IN2A 4OS6A 1TA2A 4AORA 5EIYA 1ZJKA 2GCTC 1C2MA 1LHGH 2CJIA 1EP5A 5DP7A 4Y8XA 4A6LA 1EPTB 1MUEB 1Y5AT 1HGTH 4Y79A 1F0SA 2THFB 2STBE 1IHSH 1ZGVA 4WMEA 4ZROA 4ASHA 4KTCA 1F7ZA 4KTUA 1Y3UA 2FX4A 3V3MA 2ANWA 1C1TA 2IJD1 3RDZA 1E38B 2VGCC 1C5RA 1O5EH 2ZDAH 1UK4A 3A81A 1DS2E 2VB0A 5DK1A 4FUIA 3QGNB 3C27B 2PGBB 1N8OB 3EA7A 2VIPA 3SNCA 1D3DB 1AVGH 1KXFA 3PMAB 2B7DH 1O2RA 1DWCH 5B6OA 1COWD 1MABB 1HJAB 3N7DA 3A8DA 3DHKH 1T7CA 2Y5GA 1V2NT 4RKJB 3SNEA 1BHXF 1D6WA 4WVPE 2LELA 1AUJA 3R3GB 2A4GA 1Y59T 2ZPSA 2P93A 4K1SA 2QGRA 2R9PA 5SGAE 1MAXA 1WOFA 3BG8A 4ZKNU 4TYDA 1C9PA 1LQEA 1MTSA 1O39A 3UQOA 5EJ1A 3SJ9A 2NWNA 2J34A 3Q77A 5BPEA 3U98H 1FY5A 5T3HA 1DY9A 1NS3A 1EQ9A 3K6ZA 3ODDA 1IQLA 4OS5A 1GHBF 2ZCKP 1CBWB 2YNAA 1ESAA 5FX6A 1D3TB 2BY9X 2YOLA 2A5AA 4ABHA 1BMFD 1J15A 1P57B 1EAIA 3VPKA 1AKSB 1QZ8A 1OSSA 1TX8A 1GJ9B 1C4Y2 3D23A 1S81A 1SGFA 4CRCA 3F9EA 1VCPA 2P95A 1AD8H 1EZQA 1L2EA 1PPCE 3BEFB 5I46H 1Z8IB 1Q31A 2C90B 1O3AA 1EZSC 2ZFFH 1W7XH 4MNYA 3HPTB 1SR5C 4OS7A 3L6PA 2ZGBH 2FPZA 2SFAA 1BZXE 2VU8E 1E1QD 2ZKSA 4DURA 1MCTA 1K1IA 1UHBB 1Y8TA 2C93B 3SQEE 1AE5A 4I31A 5DP4A 2YMSC 1CQQA 1RIWC 1O2UA 1FV9A 1CA8B 2QXJA 2ZGHA 1O5AB 2OXSA 1NESE 2ZCLP 1HYLA 2A45B 4I8GA 1SKYE 5GDSH 3MH5A 5DP5A 5FCKA 4ABJA 3ZZ6A 2XCNA 2ZI2H 2XNDD 3AVZA 1KLIH 2KCYA 3FO8D 2RDEA 5JDUB 4DIIH 1W13U 1MTNC 1QJ1B 3CS7A 4JZFH 1QBVH 2BD9A 2FS8A 2KCAA 4WH6A 4ZMAH 4KTSA 1K1PA 1BHXB 5C94A 1PYTD 4Q7ZA 1P3CA 3OY5U 4CRDA 1O34A 9LPRA 1TX7A 1AUTC 3MNBA 1ANBA 1FAXA 1SGFG 4X6PA 5HMAA 4O3TA 1FAKH 1W0ZU 5T1VA 1O3FA 1UTLM 3QTVH 3E6PH 3SNBA 4D8NA 4BOHA 2QC2A 4NG9H 1GI2A 1EOJA 3UR9A 2AHME 1OP0A 1MH0A 1HAOH 1O5GH 4B6EA 1GMCG 1O3OA 1K28D 1P05A 1IAUA 1P11E 1MMJN 1HXFH 3F3BA 3GISB 2ZDVH 1RTLA 4OS4A 1RD3B 1YP9A 2BDIA 2ZO3H 4R8TB 4AFZA 5L2YH 3GICB 3MHWU 2D8WA 3TPIZ 2W26A 2C8ZB 3EE0B 4D7FA 2C8YB 2KZ4A 1L1JA 1V2WT 4FUJA 1QY6A 5F8XA 3RXCA 3MFJA 3OYPA 2UUKB 3GS9A 2PSYA 3HKIB 1NBMD 1XVOA 3UY9A 4X8TH 2AIPA 1EZXC 4BAHB 1W0YH 1UO6A 1XX9A 5CHBA 5FPTA 3N7EA 1AVXA 4YOJA 3ATLA 2ULLA 5F53A 1UTJA 6GCHG 4HG6A 2XBXA 2JDID 2G81E 1O2YA 1NFWA 4GUXA 4MPXA 1C2HA 2KR7A 4X2WA 2WHXA 3A7XA 2A0QB 1V6DA 4H6SB 1J16A 3KCGH 2QF3A 1FY1A 1P2MA 2ZNKH 2ZA5A 3GCNA 1EJMA 4UFEH 1HFDA 3UWIA 3Q3KA 3DSGA 1ANDA 1FX0B 1OXGA 4NZLA 4Y71A 3ZZ8A 4WJG2 4E7NA 3VGCC 5CE1A 1EFRD 4JMYA 1TLDA 1G37A 2BX3A 2HNTC 1FDPA 3A84A 2P3TB 3UNQA 3O8CA 3GCHC 3S0NA 1C5PA 1O2LA 2KM0A 4X6MA 2F9OA 4YLUA 3SOSA 2JH5D 4LZ4B 1QTFA 2J97A 3VB6A 1EB2A 1L1GA 2NU3E 3DA9B 4RT1A 5E2OA 3NZIA 4Y10E 3UOPA 2FMJA 4AOQA 1FJSA 1C5UA 2FOGA 4Q2KA 1C1RA 1DSUA 2XBYA 4O97A 3QK1A 5CHAC 1UCYK 5A0AE 1Q2WA 4IC6A 3DCLA 7GCHF 1LKAA 4BNRA 3RXEA 4FU8A 5EXLA 2J94A 3P8OA 2Y81A 1H4WA 3D65E 1C1WH 3QLPH 1XUKA 1YLNA 4ZXYH 3UB0A 1LCYA 2GT8A 3BV9B 1O3IA 5EPNA 2BXTH 2GDEH 4JK5A 3SU2A 2W5EA 3LJOA 3WWFA 3VB3A 5EQSA 4GHTA 1DLKB 4IMQA 4HI3A 1O5BB 4F49A 1G3BA 1OWIA 3A7VA 5GCHF 1TGSZ 1LHCH 5TCCA 2J2UA 2ZZUH 4UONA 1FXYA 2CHAC 1Z6EA 3GDVA 1EKBB 1EP6A 3VB7A 3KQBA 1EAXA 1AIXH 1OWJA 2QF0A 4YT6H 2VNTA 1K1LA 1C1UH 2Z9LA 3OFND 3MWIU 4NFEA 4VGCB 1AO5A 2Z9KA 5L30H 1BT7A 1TNGA 4A1TA 4SGAE 4UFFH 3M3TA 1SI5H 1WAYB 1A3BH 1SHHB 2AGIX 2BOHB 1TONA 3FANA 3ZZBA 3TH3H 2JETC 1AWHB 1QQUA 1EAWA 1GMDF 2AH4X 3ZYEA 3RU4T 5FPSA 5C3NA 4I33A 3D62A 1MTVA 1SL3A 4SGBE 1ZTKA 2HVXA 4A1XA 1C1QA 2IPHA 3UTUH 3RXBA 1C5TA 1IQGA 1O3BA 1ZZZA 5A8XA 2HLDD 2WYJA 5JBCS 1UVSH 2FIRH 4TSFD 4CRFA 5ETXA 2SGFE 2VBCA 4X0WU 2UUFB 1V2VT 5EGMA 2A1DB 2K0QA 2VIWA 4DGJA 1F2SE 2STAE 4X8SH 1Y3VA 5HM2A 3V0XA 3T2NA 7GCHG 2W3KA 1EUFA 3O8BA 1Q3XA 1ABIH 1NY22 1BUIA 1O33A 2ZFRH 4IC5A 4I7YH 3S69A 2ALPA 1SGNE 2GCHF 2ILNA 1DLEA 3BG4C 1UCYE 2V7QD 1ANEA 4WWYA 1ZRBA 4X8UH 1NROH 5JBAS 3PTNA 5GPIB 3LONA 4KELA 1IQNA 1G3DA 5C2ZA 4ZKOU 3CENA 4RT0A 3RP2A 4U2WA 1W3CA 5FX5A 2FO9A 5FHTA 3F0PA 1ELFA 3SJKA 3U69H 2D2DA 2WUBA 3S7KB 1V2KT 2WINI 3PV4A 4FOUC 2F4LA 2OUAA 1IQMA 1GVKB 1A2CH 1O5FH 3MU4A 5DP8A 1KXEA 3A80A 1QB6A 2H2ZA 2ZHFH 4NZQA 3OEHD 1ELBA 4A5TS 1GJ4H 1TMUH 4Q63A 3FAOA 3A86A 1QB9A 1GMHF 1H8IH 2HRVA 3V7TA 3F0OA 2Y82A 4KGAA 4CHAC 1O2HA 1YPMH 4B2BA 5A0BA 5HM9A 1ESBA 1E1RD 5C5OA 1S0RA 1UTKA 2G55A 1P0SH 4GCHF 3TK5A 1JIMA 1ZSKA 4JZDH 3RM0H 2WPJS 2ANYA 2Z9IA 1DY8A 3B23B 3A7TA 3M35A 4CREA 2DE8A 5JB9S 1VCWA 1O3KA 2QXIA 2UUYA 3SGAE 2LNCA 1M9UA 3UREA 3SBKA 1TAWA 2VWLA 1QL8A 1WTHD 1ETRH 2YMSB 5A0CA 3SQHE 3ZV8A 4K60A 3P8NA 1IQFA 4CR5A 3WW7A 1HIAA 1TABE 4ZH8A 3TJVA 1WQSA 3PO1B 1TQ7B 3KL6A 3OSYA 1ZRKA 5T6DA 1QNJA 1YY3A 1BTZA 1ELVA 4FUGA 2EI8A 5GWZA 4YESB 1MQ6A 1Z8RA 1GBKA 2AEIH 2BQWB 3KEEA 2F9UA 1K1NA 3BSQA 3UWJH 1HUTH 2P8OC 1DWEH 2GTBA 3PTBA 3SU4A 1PJPA 1HDTH 2WZQA 1ZGIA 2ZCHP 3LOXA 2HNTF 1N1LA 3SUGA 2AERH 3HGNA 1LPZB 1WTGH 1AE8H 3TLOA 2TGPZ 2ZPRA 1D4PB 3NWUA 3MO6A 3GDSA 3I78A 1RTFB 9ESTA 1YGCH 4TPIZ 1NU7B 1YC0A 3S9AA 2QV1A 2G4TA 2FTLE 1TOMH 2V3HH 1TRMA 4TWYA 1BTHH 1GHZA 1O5CB 5GJ4B 5TCAA 1WSSH 1MKXH 3QGJA 3RLYH 3RXTA 4B76A 2BYAX 2HVYB 1QHRB 1K21H 2A7CA 3FP7E 5JPMH 3A82A 1XMNB 2KAIB 2TRMA 1ESTA 1PPZA 5B6LA 4X6OA 1SOZA 3MH6A 1GBAA 2SGQE 1G3CA 5DP9A 1SMFE 1TGCA 2Z7FE 3VXFH 3T27A 4DT4A 1EPTA 1HAYB 1YPGH 3ZZDA 5FBIA 3MU0A 1CGHA 3F1SB 4FUDA 3PRBA 3H7TA 4RSPA 2M5TA 1ZTJA 2FM2A 1H9IE 1NBME 2XXLA 3SHAH 3EA8A 1XM1A 4K5ZA 1V2UT 3BTQE 2QF5A 4UDWH 1VITF 1ZR0A 1UTQA 2W7UA 2BD4A 1UTOA 2VVUA 2XC4A 4ZXXH 1C5SA 3SNAA 1P10A 3SU5A 2G5VA 2ANKH 1EX3A 2I6QA 2RDLA 1GBJA 1PQ5A 2LPRA 1KXCA 4E06H 4XBDA 3AAUA 4OGYA 5AF9H 1IQKA 4ISOA 4MNVA 1P2KA 1C5OH 3PWBA 4M7GA 5C5NA 3LJJA 2BD5A 3VB5A 5C0UA 2P94A 1GJAB 1L1NA 1MKWK 4TY6A 2VH0A 1K9OE 5GXPA 2WV5A 1A0JA 4CH8B 4IMZA 1AFQC 1D3PB 1XVMA 2KCOA 3GCHB 2J98B 1O2PA 2WPLS 2BLVA 1C2IA 4CR9A 1SLUB 1C5VA 1ELGA 1QRZA 3BTFE 1DXWA 1SGCA 1TGNA 1FONA 1GJ5H 1UTPA 1AWFH 4XDEA 2AIQA 4GAWA 3F2GA 3LGYA 1B5GH 1S6FA 1BRAA 3RXIA 2BLQA 1ZSLA 4F48B 4WXIA 1AKSA 1SBWA 7ESTE 2Z3EA 3TVJB 1T8LA 2Z3CA 1V2JT 3BTEE 3HGPA 2ZWLH 5HYOA 1Z1JA 4XD7D 3SU6A 2IPQX 1CHOG 4OM9A 1HXEH 3P70B 4WXVA 3TIUA 1W14U 2Y5FA 1YYY1 2R2MB 5A8ZA 1WBGB 1GBFA 2R2WU 1LPKB 1V2RT 4MLFB 2GZ9A 3P95A 5DPAA 1C2GA 2HGTH 1CA0C 1F0UA 3SI4H 1SLXB 1UHBA 1QIXB 2PHBA 1AHTH 5F6MA 3MYWA 1O2KA 2BD2A 1ELEE 4FU9A 3UFAA 1NRQH 2UWPA 2CHAB 3GY4A 4MQAA 1AQ7A 2QXGA 1S0QA 1WCZA 1O5DH 1SGRE 3URDA 3F9GA 1Y3WA 4Y11E 1DOJA 2BM2A 5DSFA 2XC0A 1NU9A 1GCTC 1UW7A 2CGAA 4Y0YE 1C2EA 1Z71A 1OPHB 3GCOA 3DSPA 3RXKA 5FPYA 3RXOA 1NTPA 3ENSB 1YCPK 2EY4C 4IW4E 4B2AA 2F83A 1SGDE 1HLTH 3GCTF 1EATA 5HGGA 2KCPA 1V3XA 4FUBA 4ZKSU 1DANH 3UAIC 2J4IA 2JETB 5J4SA 3WWBA 5E8EH 2WV9A 5F8TA 3CP7A 4ASUD 4X1SU 1GVZA 1WV7H 2Z6BD 4FUEA 1NFUA 1E79D 1GBCA 2BDGA 1DT2A 2VVVA 4M9FA 1L0ZA 1SGTA 4I8HA 1O3CA 1O2NA 1SGIB 3LT3A 5JBTA 1TOCB 1GBTA 1LVOA 1BOQA 2OBQA 4AGJA 3N7OA 3AAVA 3VB4A 3GY2A 3A85A 1KTSB 4MNXA 2J95A 1OWHA 1Y5UT 3RXHA 5GIBA 1G3EA 2F9BH 3D49H 3TGIE 1IQIA 1QFKH 1ZHPA 1E0FD 1YF4A 1ZHRA 2GMTB 1C1PA 1Z7KA 2GD4B 1C2FA 1BMLA 1P3EA 2BTCE 3OAAD 2O8MA 1BRBE 3PROA 2H5DA 4YOIA 1MBQA 1O3EA 1THSH 3MU5A 3BTWE 1D9IA 1ZTLA 2JKHA 4OS1A 2G51A 4DG4A 5IK2D 4RKOB 3UNSA 5DKMA 4H6TA 3FP8E 1D3QB 1C9TA 1BA8B 3SJOA 5JYIA 1T4UH 3E3TA 3F9FA 2PKAB 3ZVDA 1TE0A 1GJ7B 1LVBA 2FDAA 3RXFA 4DOQA 3ZVAA 1S6LA 4X1RU 1FPHH 3SI3H 1GHBG 1YPHE 4X1PU 5DP3A 5L6NH 4DIHH 1C4U2 3MOCA 1GG6C 1NRNH 2GV7A 1E37B 2ZQ2A 2HPQH 1T31A 2ZTZA 4ABDA 4DY7B 3OTPA 2V6NA 1BMNH 1G2LA 2GJGA 4MTBA 3RXJA 2QXHA 1TFXA 3MO3A 4BAQB 3P8GA 1QA0A 4AFSA 4RI0A 6ESTA 2DE9A 2RG3A 2TGDA 1TWXB 3BIUH 3DT0H 1KXDA 1G36A 2W6JD 2FOFA 2FI3E 3LC5A 1UK2A 3DFLA 1ZOMA 1UTMA 2F91A 2YMSD 2VIVA 3OU0A 4OS2A 2TGTA 2BY7X 1S5SA 3SUDA 1YCPM 1HAGE 4Y7BA 2SGPE 2JJ2D 3ATKA 3FFGA 1O3NA 4A1VA 4THNH 3ZZAA 2VWOA 1BTWA 1P12E 3H09A 4O3UA 4ABFA 1LKBA 4E05H 3LKWA 3PB1E 8KME2 2GZ7A 3QTOH 1ELTA 5KGOA 3GY8A 3VXEH 2A7JA 4GVUA 1X7AC 3SW2B 1ARBA 3M5OA 8LPRA 2L74A 1UJ1A 3SZEA 2B5TB 4LZ1H 2V0BA 2K8IA 1ZMNA 4GPGA 1MU6B 4D9QA 1UK3A 5E0HA 1TRNA 1B0FA 1ZJDA 4X1NU 1MTWA 8GCHF 2CF8H 4ISHH 1S83A 3DD2H 5ABWA 1JRTA 4NA7A 2SGAA 4ABEA 1ARCA 1V2LT 2FX6A 1C1VH 4UD9H 2RFKC 2OBOA 5E0JA 3S9BA 3MTYA 2CK3D 1SG8B 3LIWA 6CHAB 1KLTA 2GVFA 1G32B 1EPTC 3L3TA 3RC5A 4BTTB 1NO9H 2XWAA 1C5YB 3PLKA 1B0EA 2A4RA 1G30B 4YOGA 1THPB 1OWEA 2XRCA 1H1BA 2ZQ1A 2TPIZ 1BTPA 1O3PB 3ELAH 3MO9A 4I32A 2PFEA 4OGXA 1C1NA 1F5KU 2XW9A 3A8CA 2H9EH 3MQKC 4INHA 3UQVA 2PSXA 1H8ED 1PQAA 4AG1A 2BQ6B 1GJBB 2XC5A 5FBEA 2H6MA 1D6RA 4B2CA 3I77A 2CMYA 3LU9B 3H5CB 1Z1IA 4FXGH 5KECA 3G01A 3GYMA 1N6YA 2A7HA 4GHQA 3U8RH 1SGPE 1KXBA 1HJAC 1WYKA 1SQAA 1P03A 1GBIA 1MU8B 3B8JA 4H42U 1AZ8A 1C1OA 1SQOA 3K6YA 5G4BA 1INCA 2Z3DA 1Y5BT 5K0HA 4FETA 1GBLA 2BD7A 4J2YB 2AMQA 1NT1A 1GBEA 1KDQB 3LH3A 4QT8C 4CH2B 3EDXB 2OQUA 4X2VA 1GJDB 1P2JA 3EAJA 3F2HA 1GWAA 2XTTB 3LGVA 5DJ7A 1ZPZA 2VINA 1VJAU 1O36A 1Y3YA 3QZQA 2EEKA 1YLDA 3RXUA 1P2QA 2HOBA 1HBTH 3FP6E 4LXBH 2BDYA 3SU1A 2GKVE 1JIRA 2ZFQH 2GCTB 3E16B 3HK6B 3GY6A 3PV5A 1YBWA 4ISIH 4JZIA 4YLQH 3NRLA 2ZU2A 3SV8A 2QIQA 3URCA 5LPRA 4F4OC 4MPUA 5CDFE 3SV2H 1TGTA 3CNRA 1A7SA 2BVRH 3STIA 1BMMH 1LVMA 4E7RG 1A3EH 4NGAH 4IN1A 3GDUA 3SN8A 5HXFA 2AFQB 1LO6A 3SV7A 5IDKA 4XFQA 2GX4A 3ZZ5A 3Q3YA 1GI0A 4AGKA 2AS9A 4DCDA 4FU7A 2VGCB 1W8BH 3ZZ9A 1XUHA 3TJNA 2RA3A 3ZZ3A 2VIDA 1QJ6B 1XKAC 2BDBA 3UPEA 1AMHA 3LH1A 3Q00A 5A09A 4WY3A 1O3HA 1P06A 3UR6A 5I25A 3P17H 1SGQE 1G2MA 3U1IB 4O9VA 4BXWA 1FIZA 1BTUA 2BQ7B 3RU4D 1BBRH 1FQ3A 4ZHLU 1UMAH 1O3LA 2EA3A 1MCVA 3RXSA 1C5ZB 3BTKE 3LPRA 1YPLH 2OQ5A 2GGVB 4Y6DA 1GHYH 1XUFA 3F9HA 1ETSH 1YPEH 1O2MA 5GCHG 1CA0B 3NXPA 4AFQA 5LPFA 3A8AA 5J4QA 5LH8A 2WYGA 4TPYA 1F5LA 1C2DA 1RRKA 1NPMA 2VVCA 2QY0B 2ZU3A 2F3CE 3PRDA 1CGIE 3GY5A 1DICA 1KXAA 4TT3D 1P04A 3ITIA 2OC1A 1GHAF 3GY3A 5H4IB 4X6NA 5FXLA 3T29A 1LHEH 1JMOH 3EGKH 3DFJA 4B6FA 3IITA 4PROA 1GI5A 1A61H 1RTKA 4X2XA 1RGQA 1U6QA 1GMDG 1NRRH 4XOJA 3MNCA 4ESTE 2Z94A 1NC6A 1J17T 1C5XB 2JH6D 4KP0A 1KSNA 5LPEA 1QGFA 2PW8H 1BJUA 1SC8U 1E35B 1CU1A 1FUJA 2ZGCA 3SGQE 2BHGA 3TH4H 4Q4LA 1A4WH 4BANB 1DPOA 2F9VA 1RIWB 5EW2H 2PV9B 3PMJA 4RN6A 5KEDA 5C67A 4YZUA 2KAIA 5FCRA 3KF2A 2ZFTA 3U8OH 1MTNB 2JH0D 1V2PT 1A46H 3AW0A 2BMGB 4A7IB 1FPCH 1GHVH 1UVOA 3U1JB 4Q7XA 2C8XB 3M37A 1GCDA 3SNDA 1VITH 2EI6A 1FY4A 1MD8A 2GCHG 2W6ID 5EXMA 2XCFA 1GDQA 3OX7U 2ZHEH 2OP9A 3UIRA 2FODA 1WUNH 3ATMA 1MQ5A 2KFWA 3RXRA 2CF9H 3KQ5A 1HJ9A 5AHGH 1LDTT 1TMBH 4NWLA 2F9NA 3OE7D 1AFEH 1GI8B 2ALVA 1SFIA 3RXLA 2R3YA 2K1QA 4Q80A 3UUZA 3ODFA 4ZHAA 1ABJH 2BLWA 1DE7H 1GBBA 4AFUA 1BITA 1GL0E 5A8YA 3EA9A 3Q3XA 2B0FA 2AGGX 3M7QA 4Y7AA 4GSOA 5DN6D 4TY7A 1GJ8B 2ESTE 2XWBI 3E0NB 2QN5T 1SFQB 3SUFA 2KX4A 4AC9A 5EXNA 2ZU5A 1GGDC 3EYDA 1W0JD 2B9LA 4Y8YA 3KNXA 3M36A 1GMHG 4ZKRU 2BB4A 3BTME 1XUJA 1TGBA 3QUMP 1TBRH 1RS0A 4YM9A 3A7WA 1DDJA 2L6OA 1C1SA 2Q6FA 3SJ8A 2G52A 4GCHG 4JK6A 2J98A 4ZHMU 2XNIA 2BD8A 1J8AA 2FS9A 3N99A 4P02A 3ZZ7A 1PQ8A 3M3VA 1ACBE 1DUEA 1SLVB 1KMHB 1YM0A 4NIXA 2PUXB 3M61U 3E8LA 1SGYE 3TGKE 3MH4A 3DUXH 3VEQB 5AFYH 1GBDA 1SQTA 3A88A 3KQCA 3AW1A 2NU2E 1TQ0B 3QN7A 1O2TA 1A0HB 1GI6A 1P9UA 2R0KA 3ZV9A 4D9RA 1DXPA 5IYTA 3BN9A 1ETTH 3ZVFA 3UNRA 4B1TA 2FESH 1JWTA 2XYAA 1OWDA 6LPRA 3P8FA 4HTCH 2OINA 3K9XB 3VGCB 3IG6B 2VIOA 4VGCC 1MAYA 4FUCA 5F03A 1K1OA 3BTGE 1SQRA 4HZHA 1QA7A 3CS0A 5EG4A 1C1MA 3SHCH 2A4QA 7KMEH 1GI9B 5FL7D 1BRCE 1A5IA 4JZ1A 1SGEE 4X2YA 5C20A 3RXMA 2P3UB 2BZAA 1QQ4A 5F8ZA 2Z9JA 2WSSD 3RUOA 3NUMA 2OD3B 4UFDH 1WU1A 4LOYH 1CGJE 4IBLH 1LTOA 4XBBA 1CT4E 4B73A 1S82A 2HPPH 3SZNA 1TMTH 2BY8X 1H9LB 4NA9H 2WPKS 5C17A 1K2I1 5CHAB 1OKXA 4B75A 4Z1MD 1C5LH 1TPOA 1P2OA 1AZZA 2OLGA 3KQDA 3TJUA 3A7ZA 4U01A 1XXDA 4AX9H 1QRWA 1DWBH 3RXPA 2GP9B 2P59A 1HAXB 3SUEA 5AVDA 2A2XH 1T8MA 1AB9C 1YLCA 3PMBB 4UFGH 1EAUA 2GZ8A 3LGIA 1A5GH 2FI4E 1THRH 2FI5E 1FMGA 1HV7A 3HKJB 1PPEE 3HK3B 1QR3E 1IQJA 2A5KA 2FOMB 4IGDA 5DO4H 2CV3A 3BTHE 3E1XB 4WMDA 1FY8E 2FXRA 1TNHA 4AB8A 1ZHMA 4Q7YA 2FEQH 2OC0A 1BBRE 2NU0E 1IQHA 1GL1A 3ZVGA 3RMOH 3QDZB 4B71A 1PYTC 1TIOA 1VITG 1EOLA 1UVTH 4JYUH 2Y6TA 1GBMA 1WXRA 1MKXK 4ABIA 1O37A 1DM4B 1O3JA 1QB1A 1W7GH 1BB0B 4MPVA 4K2YA 3JZ2B 3LGUA 2ZFSA 1C2JA 1KLJH 1GI4A 1O30A 2VWNA 3LDXH 3LGWA 1EXFA 1GMCF 2ZDKA 1SLWB 4D76A 1TPAE 1PPBH 4CBNA 4I8KA 3TNTA 2WUCA 2ODPA 3WY8A 2BOKA 1SVPA 1DFPA 1C5MD 4ZUHA 4NWKA 2EI7A 4FUFA 2PKSC 1XUGA 3P92A 3R0FA 1E36B 2HNTE 2J9NA 1C2LA 1S6HA 3TJOA 3TGJE 2IJOB 1GJ6A 1HJ8A 2QYIA 1V2ST 4ZCNA 5GNDA 1F0TA 2QA9E 2PKAA 1NRPH 5JB8S 3MNXA 2O8TA 2UWOA 4AYYB 1A5HA 3KGPA 5DG6A 4HFPB 5FAHA 3LC3A 4WMFA 1HPGA 1ZSJA 3SU3A 1VKYA 6GCHF 3RXQA 3KYFA 1XKBC 4YO9A 1FI8A 1NN6A 1O2QA 1KIGH 1P02A 1W11U 5DP6A 3T62A 1L4DA 1NM6A 1TRYA 1PFXC 8ESTE 2WPIS 3NK8A 5EQQA 1KYNA 1OOKB 4INLA 3PO1C 2RCEA 3EE7A 2ZHWH 3IWMA 5C1XA 5DGJA 1C4V2 3BG4B 2M2AA 4WF8A 3U9AH 5L2ZH 1UCYH 1L4ZA 2W7SA 1XXFA 3T26A 3K65B 1V2QT 3RU4E 2XOKD 2O8UA 3VG8A 2PP6A 5EQRA 2FYQA 1O2SA 4YT7H 5EODA 1V2OT 1VGCC 2BDCA 4Z6AH 1YPJH 4ISNA 1GVLA 3QWCH 2YNBA 1OYTH 3VFEA 3RXVA 4TWWA 1HAVA 2C8WB 1AGJA 2GV6A 2Q6DA 1BCUH 5EJZA 4U32A 3NKKA 3RC6A 3RC4A 3RLWH 2QF4A 1VR1H 2AMPA 2J38A 1BMAA 1TX6A 2PLXA 1E34B 2TIOA 3TNSA 4X1QU 1EB1H 3GCTG 2Q1JA 2F9PA 3QO6A 3OTJE 1O31A 1GI3A 3ZVBA 1PPFE 4CHAB 3MNSA 4MVNA 3AASA 4NIVA 3ATIA 2ZIQH 2GDDA 4MDSA 1FLEE 3A8BA 2FZZA 4BTIB 5JBBS 1S84A 4MG3A 2FYRA 2H5CA 3ZZCA 4P00A 3S9CA 1HCGA 1AU8A 1TNKA 1FZZA 2XBWA 1HAVB 5HKKD 4DJZB 1LVYA 5T6GA 1LHDH 2H9HA 5BRRE 2WPHS 3ZVEA 2BLOA 2BZ6H 7LPRA 4ZAEA 2BY5X 2P3FH 4I8JA 1UVUH 1AI8H 1TB6H 1GI7B 2G4UA 4WH8A 2A32A 1C5NH 1QL7A 3OEED 1K1MA 3PYHA 1MTUA 3T25A 2A5IA 2QAAA 3SJIA 2FTMA 2P8OB 4NCYA 3UOUA 1ZMJA 2D26C 4FVBA 3MI4A 5EU8A 3F6UH 2C4FH 1FN8A 5E0GA 2VIQA 4B74A 1C2KA 5EOKA 5C1UA 2FOCA 3M5MA 1QBOA 2OCVB 1Z6JH 2BVXH 4ACBA 1CHGA 4F55A 2ZF0H 1QBNA 1T8OA 2W3IA 1EASA 1IQEA 2HALA 3BEUA 4K3JA 3ZVCA 1MZAA 1W10U 1ELDE 3W1EA 3QX5H 1FNIA 2BX4A 2ZG0H 3M5LA 4K69A 1P2IA 2DUCA 1KDQA 3SV6A 2PGQB 1ZPCA 3A83A 3A7YA 2NU1E 3FZDA 1RJXB 3QZRA 4U30A 3W94A 4NFFA 2VH6A 1JBUH 1HB0B 2JIZD 1O2XA 1ORFA 1WQVH 4XE4A 1IOEA 3KHVA 3ZYDA 2A31A 4AYVB 3E90B 4NA8A 2CXVA 1PPHE 3FVFB 1EZUC 2TGAA 3PLBA 1P9SA 2FP7B 1GGDB 1N8OC 2RA0A 4NSYA 3T5FH 4BTUB 2ZU1A 2VWMA 2V3MA 2V3OH 3ESTA 1JRSA 1T8NA 1BTXA 1SHYA 3PM3A 1OX1A 2BXUH 1VJ9U 2SNVA 2BD3A 4Y8ZA 3MH7A 4CRAA 1CT0E 1DVAH 3O8DA 3JZ1B 3P6ZB 1ID5H 4KKDA 1DWDH 2C3SA 1P01A 2FOBA 1HAZB 3KYGA 1OWKA 2D1JA 3PV2A 4H4FA 1A1RA 2A2QH 2FLBH 4R0IA 2G00A 1TNJA 2I6SA 3C1KA 3LGTA 2CN0H 2VJ1A 5C1YA 1SSXA 3W95A 1RXPA 1SOTA 3RMMH 4AG2A 1TALA 1C5QA 2AGEX 1PQ7A 1SPJA 2Y7ZA 3PWCA 1BTYA 4HGCA 4NSVA 4GLYA 5ESTE 3SGBE 3KQEA 1CBWC 1YPHC 4ACAA 1QCPA 3I29A 3B9FH 2ZTXA 2EC9H 4LK4A 4XRNA 8GCHG 4I8LA 1O2WA 1FY3A 1EJAA 1JOUB 2ZECA 1O3DA 1ZLRA 4ABGA 2OC7A 4CBOA 3ATWA 4CRBA 1K0HA 2UUJB 5EPYA 5T6FA 2WPDD 1AFQB 3GYLB 4BAMB 4ABBA 4YTAA 5K7RA 2ASUB 1Y3XA 2FLRH 1P09A 1BJVA 1O3MA 1O38A 3S7HB 1F0RA 2FOHA 3KIDU 1ELCA 1TYNA 1OP2A 1QRXA 2NU4E 2ZP0H 1GHWH 5LGOA 1GDNA 2ZTYA 1LHFH 1P8VC 3Q76A 3ZZ4A 2Y5HA 4Z0KA 1C5WB 5EJLA 1NFYA 3TK9A 4AN7A 1V2MT 1P2NA 4NIWA 1QL9A 3DSOA 1ELAA 1TPPA 1N6XA 1TBZH 2JJ1D 2ZPQA 1O2VA 5E2PA 4JCNA 1K22H 1O0DH 1AB9B 3FZZA 4K8BA 4AZ2B 5CMXH 1O2IA 1H8DH 3BF6H 1KTTB 3BEIB 4INKA 2P16A 1ZPBA 2GMTC 2PWXA 2O8LA 4MPWA 3TK6A 4K8YA 2IOTA 5HIYA 1BQYA 1AVWA 2ZU4A 1BIOA 1OHHD 1QURH 3PLPA 4Y76A 4ABAA 1YKTA 1OYQA 1T32A 1DSTA 2BY6X 1NRSH 3PMHB 2O8WA 1XUIA 3RMNH 3AK5A 2Z9GA 2ZC9H 4UE7H 1TA6A 1CSOE 3E91A 3MU8A 1O32A 1GCTB 2ZDNA 2GT7A 3E0PB 2PTCE 3V12A 2G5NA 3M7UA 1OP8A 1FIWA 2PTNA 2EQNA 3BTTE 2UWLA 4YXWD 2ZGJA 1K1JA 3F2FA 4BAKB 1O2GH 1J9CH 2PKSB 1A0LA 4Y0ZE 1IHTH 1AN1E 3RXGA 5HIZA 4D7GA 1FN6A 3H7OA 2V35A 1DUAA 1RFNA 4CRGA 2ZHQH 4I86A 4A92A 3TU7H 3K2UA 2XBVA 2ZFPH 2ZDLA 1LPGB 2OK5A 1LQDB 3BIVH 1MKWH 3BTDE 2G8TA 1PPGE 5TJXA 1GPZA 4XBCA 1HAIH 1LMWB 1CVWH 3A89A 5EW1H 2WPMS 1JXPA 1GBHA 2BDAA 4BXSA 3GOVB 2ODQA 1QJ7B 2FWWA 2R0LA 1CO7E 3FN8A 5ESBA 4DT7B 1BRUP
chains in the Genus database with same CATH topology
3SO3A 1YPKH 4JZEH 1GDUA 5AFZH 1S85A 2WV4A 2A4OA 1HRTH 3GY7A 3NPSA 4DVAU 2H1UA 3HATH 1F5RA 4X8VH 2OC8A 3RXDA 1O2ZA 1UVPA 3V13A 1TBQH 4FVDA 3RM2H 4J1YA 4K1TA 2Q6GA 1HAPH 1EJNA 1HAHH 2AMDA 1W12U 2Y80A 4AB9A 1V2TT 3SV9A 2BVSH 2O9QA 5PTPA 2ZDMA 4O03A 1OS8A 2OTVA 1TPSA 1MD7A 4JYVH 1VGCB 4NIYA 3SORA 6CHAC 4FUHA 1HNEE 1NFXA 3MMGA 3TITA 2R3UA 2HLCA 1GHAG 2H9TH 1GG6B 1GJCB 4BAOB 4K1EA 1O2OA 1B7XB 2SGEE 1GI1A 2ZEBA 1BBRK 2FOAA 4UEHH 2ZHDA 1W2KH 1HIAB 1AY6H 3F68H 3SU0A 3U8TH 3OY6U 4IS5A 4MNWA 2QCYA 3EQ0H 1O35A 2SNWA 4IN2A 1O3GA 3M5NA 1Z8JB 1G9IE 1F92A 2AYWA 2HWLB 1ANCA 1YCPH 1BDAA 1CHOF 3KN2A 2B8OH 3M3SA 1H9HE 3L33A 3O8RA 4JYTA 3T28A 1CT2E 2ANMH 4XSKU 2TBSA 2Y7XA 5A2MH 1MZDA 1DX5M 1ZMLA 1T4VH 1ZYOA 2PR3A 1MBMA 2BDHA 3TH2H 4DW2U 3STJA 2ZGXH 4ISLA 1TNIA 3M7TA 1O2JA 3RMLH 3A87A 3RXAA 2SGDE 1SB1H 2PUQH 1UTNA 2J92A 1Z8GA 2ODYB 1GHXH 1KY9A 1VZQH 1CE5A 1NZQH 1VCQA 2FOEA 1DITH 1TNLA 3MU1A 3NCLA 1J14A 2IN2A 4OS6A 1TA2A 4AORA 1ZJKA 2GCTC 1C2MA 1LHGH 2CJIA 1EP5A 5DP7A 4Y8XA 4A6LA 1EPTB 1MUEB 1Y5AT 1HGTH 4Y79A 1F0SA 2THFB 2STBE 1IHSH 1ZGVA 4WMEA 4ZROA 4ASHA 4KTCA 1F7ZA 4KTUA 1Y3UA 2FX4A 3V3MA 2ANWA 1C1TA 3RDZA 1E38B 2VGCC 1C5RA 1O5EH 2ZDAH 1UK4A 3A81A 1DS2E 2VB0A 5DK1A 4FUIA 3QGNB 3C27B 2PGBB 1N8OB 3EA7A 2VIPA 3SNCA 1D3DB 1AVGH 1KXFA 3PMAB 2B7DH 1O2RA 1DWCH 5B6OA 1HJAB 3A8DA 3DHKH 1T7CA 2Y5GA 1V2NT 4RKJB 3SNEA 1BHXF 1D6WA 4WVPE 1AUJA 3R3GB 2A4GA 1Y59T 2ZPSA 2P93A 4K1SA 2QGRA 2R9PA 5SGAE 1MAXA 1WOFA 3BG8A 4ZKNU 4TYDA 1C9PA 1LQEA 1MTSA 1O39A 3UQOA 3SJ9A 2NWNA 2J34A 3Q77A 5BPEA 3U98H 1FY5A 5T3HA 1DY9A 1NS3A 1EQ9A 3K6ZA 3ODDA 1IQLA 4OS5A 1GHBF 2ZCKP 1CBWB 2YNAA 1ESAA 5FX6A 1D3TB 2BY9X 2YOLA 2A5AA 4ABHA 1J15A 1P57B 1EAIA 3VPKA 1AKSB 1OSSA 1TX8A 1GJ9B 1C4Y2 3D23A 1S81A 1SGFA 4CRCA 3F9EA 1VCPA 2P95A 1AD8H 1EZQA 1L2EA 1PPCE 3BEFB 5I46H 1Z8IB 1Q31A 2C90B 1O3AA 1EZSC 2ZFFH 1W7XH 4MNYA 3HPTB 1SR5C 4OS7A 3L6PA 2ZGBH 2FPZA 2SFAA 1BZXE 2VU8E 2ZKSA 4DURA 1MCTA 1K1IA 1UHBB 1Y8TA 2C93B 3SQEE 1AE5A 4I31A 5DP4A 1CQQA 1RIWC 1O2UA 1FV9A 1CA8B 2QXJA 2ZGHA 1O5AB 2OXSA 1NESE 2ZCLP 1HYLA 2A45B 4I8GA 5GDSH 5FCKA 3MH5A 5DP5A 4ABJA 3ZZ6A 2XCNA 2ZI2H 3AVZA 1KLIH 5JDUB 4DIIH 1W13U 1MTNC 1QJ1B 3CS7A 4JZFH 1QBVH 2BD9A 2FS8A 4WH6A 4ZMAH 4KTSA 1K1PA 1BHXB 1PYTD 4Q7ZA 1P3CA 3OY5U 4CRDA 1O34A 9LPRA 1TX7A 1AUTC 3MNBA 1ANBA 1FAXA 1SGFG 4X6PA 5HMAA 4O3TA 1FAKH 1W0ZU 1O3FA 1UTLM 3QTVH 3E6PH 3SNBA 4D8NA 4BOHA 2QC2A 4NG9H 1GI2A 1EOJA 3UR9A 1OP0A 1MH0A 1HAOH 1O5GH 1GMCG 1O3OA 1K28D 1P05A 1IAUA 1P11E 1MMJN 1HXFH 3GISB 2ZDVH 1RTLA 4OS4A 1RD3B 1YP9A 2BDIA 2ZO3H 4R8TB 4AFZA 5L2YH 3GICB 3MHWU 2D8WA 3TPIZ 2W26A 2C8ZB 3EE0B 4D7FA 2C8YB 1L1JA 1V2WT 4FUJA 1QY6A 5F8XA 3RXCA 3MFJA 3OYPA 2UUKB 2PSYA 3HKIB 1XVOA 3UY9A 4BAHB 4X8TH 2AIPA 1EZXC 1W0YH 1UO6A 1XX9A 5FPTA 1AVXA 4YOJA 3ATLA 2ULLA 1UTJA 6GCHG 2XBXA 2G81E 1O2YA 1NFWA 4GUXA 4MPXA 1C2HA 4X2WA 3A7XA 2A0QB 1V6DA 4H6SB 1J16A 3KCGH 2QF3A 1FY1A 1P2MA 2ZNKH 2ZA5A 3GCNA 1EJMA 4UFEH 1HFDA 3UWIA 3Q3KA 1ANDA 1OXGA 4NZLA 4Y71A 3ZZ8A 4WJG2 4E7NA 3VGCC 5CE1A 4JMYA 1TLDA 1G37A 2BX3A 2HNTC 1FDPA 3A84A 2P3TB 3UNQA 3O8CA 3GCHC 3S0NA 1C5PA 1O2LA 4X6MA 2F9OA 4YLUA 3SOSA 2JH5D 4LZ4B 1QTFA 3VB6A 1EB2A 1L1GA 2NU3E 3DA9B 5E2OA 3NZIA 4Y10E 3UOPA 2FMJA 4AOQA 1FJSA 1C5UA 2FOGA 4Q2KA 1C1RA 1DSUA 2XBYA 4O97A 3QK1A 5CHAC 1UCYK 5A0AE 1Q2WA 4IC6A 7GCHF 1LKAA 4BNRA 3RXEA 4FU8A 5EXLA 2J94A 3P8OA 2Y81A 1H4WA 3D65E 1C1WH 3QLPH 1XUKA 4ZXYH 1LCYA 2GT8A 3BV9B 1O3IA 5EPNA 2BXTH 2GDEH 4JK5A 3SU2A 2W5EA 3LJOA 3VB3A 5EQSA 4GHTA 1DLKB 4IMQA 4HI3A 1O5BB 4F49A 1G3BA 1OWIA 3A7VA 5GCHF 1TGSZ 1LHCH 5TCCA 2J2UA 2ZZUH 4UONA 1FXYA 2CHAC 1Z6EA 3GDVA 1EKBB 1EP6A 3VB7A 3KQBA 1EAXA 1AIXH 1OWJA 2QF0A 4YT6H 2VNTA 1K1LA 1C1UH 2Z9LA 3MWIU 4NFEA 4VGCB 1AO5A 2Z9KA 5L30H 1BT7A 1TNGA 4A1TA 4SGAE 4UFFH 3M3TA 1SI5H 1WAYB 1A3BH 1SHHB 2AGIX 2BOHB 1TONA 3FANA 3ZZBA 3TH3H 2JETC 1AWHB 1QQUA 1EAWA 1GMDF 2AH4X 3ZYEA 3RU4T 5FPSA 5C3NA 4I33A 3D62A 1MTVA 1SL3A 4SGBE 1ZTKA 2HVXA 4A1XA 1C1QA 2IPHA 3UTUH 3RXBA 1C5TA 1IQGA 1O3BA 1ZZZA 5A8XA 2WYJA 5JBCS 1UVSH 2FIRH 4CRFA 5ETXA 2SGFE 4X0WU 2UUFB 1V2VT 5EGMA 2A1DB 2VIWA 4DGJA 1F2SE 2STAE 4X8SH 1Y3VA 5HM2A 3V0XA 3T2NA 7GCHG 2W3KA 1EUFA 3O8BA 1Q3XA 1ABIH 1NY22 1BUIA 1O33A 2ZFRH 4IC5A 4I7YH 3S69A 2ALPA 1SGNE 2GCHF 2ILNA 1DLEA 3BG4C 1UCYE 1ANEA 4WWYA 1ZRBA 4X8UH 1NROH 5JBAS 3PTNA 5GPIB 3LONA 4KELA 1IQNA 1G3DA 5C2ZA 4ZKOU 3CENA 3RP2A 4U2WA 1W3CA 5FX5A 2FO9A 5FHTA 1ELFA 3SJKA 3U69H 2D2DA 2WUBA 3S7KB 1V2KT 2WINI 3PV4A 2OUAA 1IQMA 1GVKB 1A2CH 1O5FH 3MU4A 5DP8A 1KXEA 3A80A 1QB6A 2H2ZA 2ZHFH 4NZQA 1ELBA 4A5TS 1GJ4H 1TMUH 3FAOA 3A86A 1QB9A 1GMHF 1H8IH 2HRVA 3V7TA 2Y82A 4KGAA 4CHAC 1O2HA 1YPMH 4B2BA 5A0BA 5HM9A 1ESBA 5C5OA 1S0RA 1UTKA 2G55A 1P0SH 4GCHF 3TK5A 1JIMA 1ZSKA 4JZDH 3RM0H 2WPJS 2ANYA 2Z9IA 1DY8A 3B23B 3A7TA 3M35A 4CREA 2DE8A 5JB9S 1VCWA 1O3KA 2QXIA 2UUYA 3SGAE 2LNCA 1M9UA 3UREA 3SBKA 1TAWA 2VWLA 1QL8A 1WTHD 1ETRH 5A0CA 3SQHE 3ZV8A 4K60A 3P8NA 1IQFA 4CR5A 1HIAA 1TABE 4ZH8A 3TJVA 1WQSA 3PO1B 1TQ7B 3KL6A 3OSYA 1ZRKA 5T6DA 1QNJA 1BTZA 1ELVA 4FUGA 2EI8A 5GWZA 4YESB 1MQ6A 1Z8RA 1GBKA 2AEIH 2BQWB 3KEEA 2F9UA 1K1NA 3BSQA 3UWJH 1HUTH 2P8OC 1DWEH 2GTBA 3PTBA 3SU4A 1PJPA 1HDTH 1ZGIA 2ZCHP 3LOXA 2HNTF 1N1LA 3SUGA 2AERH 3HGNA 1LPZB 1WTGH 1AE8H 3TLOA 2TGPZ 2ZPRA 1D4PB 3NWUA 3MO6A 3GDSA 3I78A 1RTFB 9ESTA 1YGCH 4TPIZ 1NU7B 1YC0A 3S9AA 2QV1A 2G4TA 2FTLE 1TOMH 2V3HH 1TRMA 4TWYA 1BTHH 1GHZA 1O5CB 5GJ4B 5TCAA 1WSSH 1MKXH 3QGJA 3RLYH 3RXTA 4B76A 2BYAX 1QHRB 1K21H 2A7CA 3FP7E 5JPMH 3A82A 1XMNB 2KAIB 2TRMA 1ESTA 1PPZA 4X6OA 1SOZA 3MH6A 1GBAA 2SGQE 1G3CA 5DP9A 1SMFE 1TGCA 2Z7FE 3VXFH 3T27A 1EPTA 1HAYB 1YPGH 3ZZDA 5FBIA 3MU0A 1CGHA 3F1SB 4FUDA 3H7TA 4RSPA 2M5TA 1ZTJA 2FM2A 1H9IE 2XXLA 3SHAH 3EA8A 1XM1A 4K5ZA 1V2UT 3BTQE 4UDWH 1VITF 1ZR0A 1UTQA 2W7UA 2BD4A 1UTOA 2VVUA 2XC4A 4ZXXH 1C5SA 3SNAA 1P10A 3SU5A 2G5VA 1EX3A 2ANKH 2I6QA 2RDLA 1GBJA 1PQ5A 2LPRA 1KXCA 4E06H 4XBDA 3AAUA 4OGYA 5AF9H 1IQKA 4ISOA 4MNVA 1P2KA 1C5OH 3PWBA 4M7GA 5C5NA 3LJJA 2BD5A 3VB5A 2P94A 1GJAB 1L1NA 1MKWK 4TY6A 2VH0A 1K9OE 5GXPA 2WV5A 1A0JA 4CH8B 4IMZA 1AFQC 1D3PB 1XVMA 3GCHB 1O2PA 2WPLS 2BLVA 1C2IA 4CR9A 1SLUB 1C5VA 1ELGA 1QRZA 3BTFE 1DXWA 1SGCA 1TGNA 1FONA 1GJ5H 1UTPA 1AWFH 4XDEA 2AIQA 4GAWA 3LGYA 1B5GH 1S6FA 1BRAA 3RXIA 2BLQA 1ZSLA 4WXIA 1AKSA 1SBWA 7ESTE 2Z3EA 3TVJB 1T8LA 2Z3CA 1V2JT 3BTEE 3HGPA 2ZWLH 5HYOA 1Z1JA 3SU6A 1CHOG 1HXEH 3P70B 4WXVA 3TIUA 1W14U 2Y5FA 1YYY1 2R2MB 5A8ZA 1WBGB 1GBFA 2R2WU 1LPKB 1V2RT 4MLFB 2GZ9A 3P95A 5DPAA 1C2GA 2HGTH 1CA0C 1F0UA 3SI4H 1SLXB 1UHBA 1QIXB 2PHBA 1AHTH 5F6MA 3MYWA 1O2KA 2BD2A 1ELEE 4FU9A 3UFAA 1NRQH 2UWPA 2CHAB 3GY4A 4MQAA 1AQ7A 2QXGA 1S0QA 1WCZA 1O5DH 1SGRE 3URDA 3F9GA 1Y3WA 4Y11E 1DOJA 2BM2A 2XC0A 1NU9A 1GCTC 2CGAA 4Y0YE 1C2EA 1Z71A 1OPHB 3GCOA 3RXKA 5FPYA 3RXOA 1NTPA 3ENSB 1YCPK 4IW4E 4B2AA 2F83A 1SGDE 1HLTH 3GCTF 1EATA 5HGGA 4ZKSU 1V3XA 4FUBA 1DANH 2J4IA 2JETB 5J4SA 5E8EH 5F8TA 3CP7A 4X1SU 1GVZA 1WV7H 2Z6BD 4FUEA 1NFUA 1GBCA 2BDGA 1DT2A 2VVVA 1L0ZA 1SGTA 4I8HA 1O3CA 1O2NA 1SGIB 3LT3A 5JBTA 1TOCB 1GBTA 1LVOA 1BOQA 2OBQA 4AGJA 3N7OA 3AAVA 3VB4A 3GY2A 3A85A 1KTSB 4MNXA 2J95A 1OWHA 1Y5UT 3RXHA 5GIBA 1G3EA 2F9BH 3D49H 3TGIE 1IQIA 1QFKH 1ZHPA 1E0FD 1YF4A 1ZHRA 2GMTB 1C1PA 1Z7KA 2GD4B 1C2FA 1BMLA 1P3EA 2BTCE 2O8MA 1BRBE 3PROA 2H5DA 4YOIA 1MBQA 1O3EA 1THSH 3MU5A 3BTWE 1D9IA 1ZTLA 2JKHA 4OS1A 2G51A 4DG4A 4RKOB 3UNSA 5DKMA 4H6TA 3FP8E 1D3QB 1C9TA 1BA8B 3SJOA 5JYIA 1T4UH 3E3TA 3F9FA 2PKAB 3ZVDA 1TE0A 1GJ7B 1LVBA 2FDAA 3RXFA 4DOQA 3ZVAA 4X1RU 1FPHH 3SI3H 1GHBG 1YPHE 4X1PU 5DP3A 5L6NH 4DIHH 1C4U2 3MOCA 1GG6C 1NRNH 2GV7A 1E37B 2ZQ2A 2HPQH 1T31A 2ZTZA 4ABDA 4DY7B 2V6NA 1BMNH 1G2LA 4MTBA 3RXJA 2QXHA 1TFXA 3MO3A 4BAQB 3P8GA 1QA0A 4AFSA 6ESTA 2DE9A 2RG3A 2TGDA 1TWXB 3BIUH 3DT0H 1KXDA 1G36A 2FOFA 2FI3E 3LC5A 1UK2A 3DFLA 1ZOMA 1UTMA 2F91A 2VIVA 3OU0A 4OS2A 2TGTA 2BY7X 1S5SA 3SUDA 1YCPM 1HAGE 4Y7BA 2SGPE 3ATKA 3FFGA 1O3NA 4A1VA 4THNH