1BJVA

Beta-trypsin complexed with appu
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Oxyanion-mediated inhibition of serine proteases.
pubmed doi rcsb
molecule tags Serine protease
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bjvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bjvA02
1AY6H 1H9LB 2ANYA 1GI4A 2C8YB 3LH3A 2Q1JA 1SLWB 5A8ZA 3T2NA 1C1VH 2XBYA 1V2ST 2WPHS 6CHAB 5C5OA 2FODA 1EZUC 1SVPA 2WPLS 1TGTA 1ZTLA 1CA0B 4X1NU 8KME2 1ZHRA 2FIRH 4A7IB 2OUAA 2FS8A 2BQWB 3LC3A 4AYVB 1P05A 2VNTA 1G3EA 3RXGA 2I6QA 1K28D 1OKXA 1OWEA 1BQYA 1TX7A 2GKVE 1ZHPA 2UUJB 4GAWA 5TCAA 1HAVB 1NROH 3MHWU 5JBBS 4XDEA 3SNEA 1Q3XA 1IHSH 1VCWA 1CHOF 1S82A 1N6YA 3A88A 2FOGA 3TU7H 5DJ7A 3MMGA 1C5UA 2FYRA 1EPTA 3HKIB 3EE0B 2Y80A 1EOLA 1O2LA 1QY6A 1V2TT 2FLRH 1QB6A 4BXWA 2IPHA 3AW1A 2VB0A 2BZAA 4INKA 1SGEE 5GIBA 5A2MH 1EB2A 1SGTA 1W8BH 2HGTH 3Q3KA 1LQDB 2LNCA 1O2PA 2PKSB 1VITG 1GCTB 4JZIA 1JMOH 5GDSH 3TNSA 3KQBA 3JZ1B 4R0IA 1LTOA 3WY8A 3ZZ5A 2J2UA 1P12E 3SORA 1FNIA 3QX5H 3TH3H 1YPGH 1P2NA 3PMAB 2Y81A 1DVAH 7GCHG 1S5SA 2YNAA 6CHAC 1GHBF 2QXIA 2GDDA 3RLWH 4ZHMU 3I29A 3UNQA 1DUEA 1NS3A 2AMQA 1Z1IA 3GCHB 4A1TA 4X8VH 2XW9A 2W7UA 1EJAA 4CRAA 2V6NA 1EAUA 1SGNE 1TOCB 1IQNA 2ZGHA 1G37A 2BD4A 2G8TA 2SGDE 2FX4A 2SNVA 1AWHB 1NZQH 5BRRE 1NRNH 1YPJH 2WUBA 1HPGA 3M7QA 1HNEE 3ZZCA 4X6NA 4ABEA 1BHXB 4RKJB 1HAPH 2ANMH 4HTCH 1WQVH 1EPTB 1HGTH 4X8TH 3ZV9A 1S84A 3PLKA 3MNBA 3V7TA 4X2VA 4ABHA 4X6MA 1C5ZB 1KYNA 2PKAA 1GCTC 2BOHB 3SI3H 1C1NA 1OP2A 3GDUA 1B0FA 3LOXA 1F5LA 1TNIA 2SNWA 3SQEE 3ZZBA 3UR6A 4DVAU 2PWXA 2ZGCA 4Y0YE 2C8ZB 4J2YB 4AFQA 3A8CA 3A7VA 4FU8A 4O3TA 1FIZA 1NFUA 3GCHC 1HAGE 3SNDA 1CQQA 5FAHA 3SHAH 1PPGE 1DS2E 1TNGA 2H9EH 1QQ4A 2FOEA 1NFYA 3K9XB 1C5WB 4ZKSU 2ZFRH 3M3VA 3QLPH 5E0GA 1K1NA 3EYDA 3RUOA 2FI4E 2FO9A 1BTXA 3QN7A 1GL1A 2W7SA 2XXLA 1G2LA 3A7YA 1OX1A 3GCOA 4A6LA 2GTBA 3KIDU 3RXSA 5GWZA 3SGAE 2F9UA 2G00A 1DANH 3AVZA 1TNLA 4Q80A 2WPIS 1EPTC 3RU4D 1W0ZU 1GHAG 3ZVGA 1AKSB 1H9IE 3ZVBA 1XXFA 1ZMJA 2XBVA 4UEHH 4MNWA 4O97A 3T25A 5T6GA 1DXPA 1FZZA 1UVTH 4CHAC 1GHZA 1D6RA 1AO5A 1L0ZA 1Y3YA 3MO9A 1X7AC 1B0EA 2BDHA 2ZI2H 1O3NA 1OOKB 1Y5BT 2Y7XA 3BTQE 1TYNA 3FVFB 2PKAB 3MU4A 1LPZB 1TPSA 1SPJA 4NGAH 4QT8C 1DY8A 1SGDE 3U69H 1HAHH 3UNRA 2GGVB 1G36A 1O5GH 1FY4A 1QCPA 4AGJA 1D3PB 2IN2A 2A2XH 2PV9B 1PQ7A 1N8OB 4TPIZ 2WYGA 1UO6A 1ELAA 2BY6X 1AE8H 1E34B 3GDSA 2VINA 1C1PA 2Q6FA 2PW8H 2VWOA 3ESTA 1JRSA 4TYDA 1VITH 2F9OA 4TY6A 3D49H 4NFFA 2XBXA 1S0RA 1QQUA 3RXRA 4NWLA 2QF0A 1O3IA 1ANDA 6ESTA 5EQQA 4YZUA 2R2WU 3RC5A 4U30A 1P03A 1O3AA 1TONA 2XWBI 3N7OA 1MKXK 3RU4T 3UR9A 4IMZA 1SGIB 1C2LA 2A4QA 1O35A 1O36A 1TGBA 4WMFA 2OC0A 1P57B 1TRMA 1RGQA 2F3CE 2NU2E 4GSOA 1EP6A 1L2EA 1RTLA 3EAJA 1KLIH 1EZSC 1XVOA 2BLWA 3T5FH 4U32A 2BHGA 1C5RA 3M7TA 1O2HA 1LVYA 1FY5A 1BIOA 1HJ9A 1O2ZA 3BTTE 2OP9A 1YPKH 1C9TA 5F03A 1LHGH 1W7GH 2PSXA 1MQ6A 3BN9A 1CHOG 1FY3A 1SHHB 3KF2A 3RMMH 5DP9A 1GI3A 1OWDA 4O03A 1MBQA 4FUIA 1OSSA 3DT0H 1S85A 1C1WH 3F9FA 1PFXC 1P11E 3B9FH 2J38A 2FOBA 1JIRA 1C1SA 1OWJA 4AORA 4SGAE 3EDXB 1VGCC 1D6WA 1FPCH 2QXJA 1NRRH 5C1UA 1ESTA 2YOLA 3LPRA 3TH4H 1ESAA 1IHTH 4DJZB 3S9BA 3GISB 1KXDA 3DFLA 4IS5A 1O38A 5EW1H 1WQSA 1W12U 2WPKS 2ZHFH 3JZ2B 3SUGA 1AUJA 2PUXB 1C4Y2 5JB9S 1L1NA 1UJ1A 1DSUA 2Z94A 1ANCA 1KXFA 3ODDA 5JPMH 1GHBG 3ATLA 3U98H 4DY7B 2A2QH 1NT1A 5DP4A 1WOFA 2FYQA 4I8KA 1HAYB 4AFSA 4AGKA 3RM2H 2G4TA 2B9LA 4WXVA 1E36B 1UCYK 2R0LA 5FPYA 3RMLH 3SJ9A 1MTVA 2OD3B 1G2MA 4SGBE 3SU1A 2JH5D 3L6PA 4KKDA 1UCYE 2BLVA 1NRPH 2QXGA 1C1OA 3A8BA 1UTNA 1XUGA 1K1MA 1GBIA 3ZVDA 2YNBA 1BCUH 5FX5A 1BTUA 1PQ5A 1GG6B 5DP3A 1ZGVA 3UOUA 2O8WA 1FN6A 1EQ9A 1W2KH 3SZNA 2XRCA 2J92A 2ZQ2A 2GZ7A 1MMJN 4X8UH 4Y0ZE 4BTTB 1O2SA 3VPKA 3ATWA 4HGCA 1YM0A 5BPEA 3O8BA 3B8JA 3Q3YA 1TE0A 4NIVA 4KP0A 1A5HA 5EGMA 1Y3VA 2ASUB 2AIQA 5AFYH 1BTWA 3Q00A 2FXRA 1C5SA 2H9HA 3RP2A 3SN8A 5AVDA 1GHXH 5L6NH 4YO9A 1SR5C 4FVBA 1GCDA 3MO6A 1P2MA 1XKBC 1KXBA 2TIOA 1C5NH 2ZU4A 1Z1JA 3QZRA 1O32A 4JCNA 2P94A 4BAOB 4KELA 1AD8H 7KMEH 4AFZA 3BTKE 3PYHA 3ZYEA 4K3JA 1THRH 1O2WA 4JZ1A 3PTBA 1O3DA 1ETTH 2B5TB 3VB7A 1AIXH 1HJAB 2SGPE 5B6OA 1GPZA 4K8YA 2GCHF 1QA7A 2QY0B 2ZECA 3E8LA 1NRSH 3HGPA 2O8UA 3OSYA 1UTLM 1JIMA 3RXVA 1MKXH 3SO3A 2DUCA 4ISHH 4ISOA 1Z8RA 2ZPSA 3D23A 4B2BA 4OS1A 2F9NA 1GG6C 1UVSH 3W95A 1VR1H 5AHGH 1ABIH 4NA7A 3IG6B 1AFEH 2ZKSA 1GJ7B 3LJJA 1ZHMA 3L3TA 3QDZB 2ZU1A 3BEFB 2AIPA 2HVXA 4D9QA 3BTME 4Y8XA 1UVUH 2HOBA 1QJ6B 3U8RH 5F8TA 5EU8A 4INHA 3KNXA 3V13A 1QJ1B 3SUEA 4E7RG 3P8NA 1K9OE 1BTYA 4ABIA 5FBIA 1E37B 1TPPA 3LGTA 1HRTH 1ARCA 1QL9A 1GHVH 1OP8A 2ANWA 2J95A 5E0JA 5FHTA 3QGNB 1PYTD 1HAVA 1Z7KA 2JH6D 1FAKH 1FY8E 1KLTA 3F9HA 1HAXB 4AOQA 1TOMH 3URCA 4FUGA 1GI2A 1ETSH 2FOCA 1PQAA 3A84A 2A7JA 4Q7ZA 5EOKA 3EQ0H 1HJAC 1DWDH 1ZOMA 4O9VA 4J1YA 3LGYA 2J9NA 1XUIA 2BD3A 4VGCB 1C2MA 1UMAH 3BIUH 3TJOA 2ZDLA 2BD7A 3V3MA 1IQMA 2OC8A 4K1EA 2G5NA 1DSTA 1YCPM 2FX6A 4X2YA 3RXLA 4BTIB 1CU1A 3P95A 1A5IA 1F5KU 2WV5A 1GJ4H 3PO1B 4FUCA 1UCYH 2GP9B 1GL0E 1EZXC 1BRCE 4THNH 1IQHA 2JKHA 3MH7A 4BAHB 1D3TB 2ZG0H 4ZHLU 5DP5A 3QO6A 3ELAH 4JK5A 4CBOA 3VB5A 2B7DH 3GDVA 3SU3A 1OPHB 1DWCH 2PGQB 5LPFA 1GVLA 2VVUA 1V2JT 3BTWE 1T31A 3MOCA 1CGJE 3T29A 5E2PA 3ENSB 2W3KA 3P6ZB 1GI0A 2BDGA 1THPB 1BOQA 1BRUP 2RCEA 1KXAA 1SOTA 2BB4A 1N1LA 1HIAA 5JBAS 1U6QA 2ZU3A 3RLYH 1EZQA 5LGOA 5K7RA 1GJ8B 1ZLRA 1XUHA 3SU4A 1H1BA 3AW0A 4Y79A 2ZU5A 3KEEA 1QBNA 1RTKA 1EASA 1HDTH 3BTDE 1BBRE 1G3BA 4B73A 1O34A 5FXLA 1CGHA 2BLQA 2BY7X 2QIQA 3IITA 1FY1A 2XCNA 2Y82A 1TALA 2W5EA 1JRTA 3VFEA 4ISNA 1DT2A 3A80A 5A8YA 3PB1E 4OGXA 1MTWA 2WINI 4IW4E 4NA9H 2UUFB 3UWIA 1TBRH 2P3TB 4OS2A 1TMUH 3C1KA 2ULLA 1O3FA 4ZKOU 3MFJA 1SGFG 2BLOA 2ZFSA 3FP8E 3RXHA 1LHCH 4U2WA 1GBDA 1AVWA 3PO1C 4I8JA 2Z9JA 4BAQB 1C4V2 3GICB 3P8OA 3SGQE 1P9UA 5G4BA 2BM2A 1LHEH 4X6PA 1MZAA 1NTPA 2BQ6B 2SGFE 1L4DA 4JYVH 1DM4B 1KY9A 2OC1A 1MAXA 1P02A 3HKJB 1C1UH 2BD8A 1JBUH 3UREA 1BMMH 1C2HA 1O5FH 3BV9B 3W94A 2FMJA 1MZDA 1A1RA 3MI4A 2BDYA 3SV8A 1AZZA 4ISLA 2ZC9H 1QR3E 1GBTA 1TFXA 1TIOA 1P2QA 2F91A 1CA0C 2ILNA 4UFGH 1GJ6A 3LIWA 4AZ2B 1K1JA 3PLPA 4KTUA 2VH0A 3SJIA 1QBVH 1V2LT 3PWCA 5CMXH 4DOQA 1Q31A 4HFPB 1K22H 1Z8GA 1HIAB 2P8OB 2Y7ZA 3HATH 2Z9GA 1O2QA 4K1TA 1FQ3A 1TQ7B 2XCFA 3PTNA 4CRFA 2HLCA 1A2CH 2BYAX 3LC5A 2AS9A 1T4UH 2ZEBA 4K1SA 2ZTZA 2RA0A 2ZDKA 3VB6A 2VJ1A 1NO9H 1LQEA 1RIWB 1C5PA 2D2DA 1YLCA 1AKSA 3M5OA 1Y5AT 5E2OA 3T26A 1W14U 1GVZA 1DY9A 5GPIB 2R0KA 2B8OH 3KHVA 4BAMB 1SFQB 1NM6A 3E1XB 2TPIZ 2AERH 2PKSC 4WH6A 4Y7BA 4X2XA 1V6DA 2GVFA 2QYIA 4LK4A 4IGDA 1K1LA 1P2OA 1S0QA 2AYWA 1HAIH 1ZGIA 1DUAA 2A4RA 1Y3XA 2FOMB 1Y3WA 5HM9A 1WSSH 4MPVA 1YPHC 1AN1E 1UHBA 2A5IA 2VU8E 1V2MT 3ZZ4A 1P3CA 4GCHF 1ZMLA 2GCHG 4WMEA 1V2VT 4M7GA 1MH0A 1J15A 1SQTA 4Y6DA 1C2GA 2PGBB 3MU5A 2FESH 3EA7A 1YC0A 3MTYA 1TPAE 2BD2A 2GZ9A 3LKWA 1ELBA 5TCCA 3UIRA 4IN1A 2ZGXH 1O3KA 3D65E 3LJOA 2O8LA 1EOJA 4NA8A 5ETXA 1J16A 4WJG2 1L4ZA 4FUDA 1KIGH 3M37A 2TGAA 3Q77A 1PPCE 2ZGJA 1HUTH 1GBKA 2QCYA 3T62A 1G32B 1AUTC 3MU1A 3RDZA 2TGPZ 1TMBH 1XMNB 4D7FA 3ZVEA 1TBQH 1O31A 3ITIA 4AG2A 1D3QB 1C5YB 3SU0A 1RIWC 5DGJA 1V2OT 4F4OC 4MG3A 3BG4B 3ODFA 3T27A 2ZHEH 4R8TB 2EEKA 1A61H 1C1TA 1GI7B 3NK8A 2BOKA 2XC5A 2BVSH 3E91A 4IMQA 2EC9H 1WYKA 5A0BA 4GPGA 4YT6H 1PYTC 2LPRA 3UQVA 1F0TA 2BY8X 2ALPA 1Z8IB 2HRVA 3S9AA 1MTNB 1MKWK 1NY22 1KXEA 4Y8YA 2GMTB 4A5TS 2CXVA 4K60A 1XX9A 1RXPA 4ZAEA 2CMYA 1SLVB 3OX7U 2VIQA 3M61U 1OYQA 5PTPA 3TK9A 5AF9H 1EAIA 5JYIA 3VEQB 1Q2WA 2AGEX 2AGIX 1UHBB 8GCHG 3TLOA 4X6OA 1SHYA 1CHGA 2PLXA 4XBBA 2V0BA 3ATIA 1K21H 1TGNA 2BQ7B 3L33A 1O2YA 3AASA 1UVOA 2ODYB 3SU5A 1AU8A 1UTQA 2V35A 3ZZ9A 1V2WT 2A4OA 1CE5A 3TJVA 5T6DA 2BMGB 5E8EH 1GBMA 3MU0A 4ESTE 1CSOE 5A0AE 3BEUA 5HMAA 4MNXA 1H4WA 1O2IA 2CF8H 3QTOH 4BANB 1CA8B 2OBOA 4CR5A 4DCDA 5JDUB 2DE8A 4FUJA 4NZQA 1XVMA 3LGUA 1O3BA 2GX4A 1TLDA 5DG6A 2ZHWH 3KQDA 5I46H 3GY2A 1V2UT 4E06H 3UY9A 4I8LA 4XOJA 4LZ4B 2A7CA 3K6YA 3BG4C 1XUFA 5EXMA 2ZDMA 1ZSLA 3PROA 1O5BB 7ESTE 2ZFTA 4ABFA 2Z3CA 3HPTB 1OWHA 3RC4A 4H4FA 2FTLE 5DK1A 1D9IA 1RJXB 4E7NA 3RC6A 2EI8A 3TJNA 1Z8JB 2J4IA 1O2XA 2GMTC 1WTGH 3HK3B 4LZ1H 1C5LH 3LGIA 2PTNA 4JZEH 2AGGX 1FJSA 1N8OC 1A0HB 3B23B 4LXBH 3ZZ8A 1RTFB 4JYUH 3CS0A 2OC7A 3GY6A 1TX6A 1RS0A 1C1RA 2HNTC 3M5LA 4IC5A 2EI7A 2GT8A 4MPUA 1HXFH 3I77A 1LVOA 1H8DH 1Z6EA 1DX5M 1SGRE 1YF4A 4WF8A 1MQ5A 2I6SA 4XBDA 1MAYA 2O8TA 4ZXYH 1ID5H 4ASHA 4MPWA 1AWFH 1ELEE 1O2KA 4OS4A 3SJKA 1QB1A 1QNJA 2F9BH 1QFKH 1O3LA 1J9CH 2P3UB 3ZZ7A 3DUXH 1ZRKA 3SNBA 1O2GH 3F9EA 2ZPQA 5A09A 1QL7A 4BXSA 3HGNA 1MU8B 4RSPA 1P2KA 2BDCA 2VVVA 3K6ZA 2ANKH 4O3UA 1XUKA 5ABWA 1IQGA 1F0UA 3ZZDA 2AH4X 3E90B 3ATMA 4D8NA 3NXPA 5C3NA 2ZA5A 3SV6A 1QTFA 3MH6A 1AI8H 4AG1A 2XYAA 3SUDA 2XNIA 1O3EA 1D4PB 5F8XA 4FUEA 5L2ZH 2OBQA 3VGCB 4DIHH 2ZFQH 1WBGB 1JXPA 3U1JB 1FONA 4NIYA 5LPRA 3NKKA 3MO3A 1C2DA 2ZTXA 1GBAA 3FP7E 5ESBA 1O5EH 4ZROA 3CENA 1EAWA 1YCPK 2ZCHP 4ABJA 4B71A 2XC4A 1GBLA 1TNJA 1IOEA 1IQLA 1RD3B 2VGCB 3VB4A 1H8IH 2Y5GA 5FPTA 1B7XB 4OS6A 2ZDVH 1L1GA 1HYLA 1EJNA 1QGFA 5JBCS 2ESTE 4GUXA 1DPOA 4JZDH 3RXBA 2ZZUH 1O2TA 3ATKA 1IQFA 1BHXF 2PR3A 4UD9H 2PHBA 1UTOA 3EA9A 1TGSZ 4B2AA 2GD4B 4GCHG 2AMPA 3TGIE 6GCHF 2VIWA 1T32A 3E3TA 1GVKB 5A8XA 4K2YA 2UWLA 1UTPA 2GV7A 4DT7B 1QJ7B 5HGGA 1FPHH 4YOJA 4UONA 1YP9A 1SC8U 4ZXXH 1NC6A 1MTSA 5DP6A 1KTSB 1SQAA 1UTKA 4IN2A 3NCLA 3RU4E 1INCA 1ETRH 1O2UA 2AFQB 2VH6A 2H2ZA 3H7TA 3PV4A 1RRKA 4YLUA 1QURH 4JK6A 9LPRA 4LOYH 5TJXA 1PPHE 2FI5E 1AFQB 3VGCC 3TIUA 1EP5A 1SQOA 3LDXH 1ZRBA 2VIDA 3GOVB 2BVRH 2QN5T 2A4GA 2TRMA 4Y10E 1MD7A 1J8AA 1ELDE 1C2IA 2W3IA 2ZGBH 1UTMA 1C5QA 1P9SA 1O5DH 2H5CA 6LPRA 1OP0A 2VIOA 2VGCC 2ZFFH 2EI6A 3FAOA 1W13U 2CV3A 4WMDA 4I32A 1GJDB 2FLBH 3P70B 2Z9IA 3TVJB 3LGWA 1C1QA 3BTHE 5GCHF 3PMHB 1TAWA 3SV2H 2Q6DA 1F92A 1O37A 3SU2A 5L2YH 2CGAA 2UWPA 3QGJA 3ZVFA 2G55A 2A5AA 2PUQH 3BF6H 3F1SB 3S0NA 4I31A 1T8LA 2WYJA 1H9HE 3T28A 3M35A 3PLBA 1IQEA 2THFB 4WXIA 1BTHH 1CT0E 2EA3A 3RXFA 1C5XB 1EATA 1ZPCA 4E05H 3GCNA 4ABGA 8GCHF 1O2VA 1JOUB 3VB3A 1BTZA 3FZDA 3ZZAA 1P2IA 3KGPA 1G3CA 1SGFA 3VXEH 3O8CA 1Y3UA 5C67A 1ZZZA 1HFDA 1TQ0B 1O2JA 1PPFE 3M7UA 3A87A 2D1JA 2OLGA 4CH2B 5T3HA 3GYLB 2C8XB 2Y6TA 4YTAA 4CRDA 5L30H 5EPNA 1AFQC 2O9QA 1M9UA 4UDWH 2C3SA 4I8GA 2NWNA 1EUFA 1N6XA 2V3HH 3QWCH 3ZV8A 1IQIA 1G30B 1ELVA 2Z9KA 1O3OA 4NSVA 2C8WB 1GMDF 2SGQE 2A31A 2SGAA 2HPQH 4MLFB 4HZHA 2TGTA 1Z6JH 5HM2A 3C27B 2OINA 2P59A 3TK6A 1HAOH 1DOJA 1NU7B 8ESTE 1D3DB 1W10U 1CT2E 3K65B 1C2EA 3STIA 4MPXA 1NRQH 4B1TA 4CH8B 4GHTA 4Q7YA 3RXTA 3M3TA 1OWIA 1O3GA 5DPAA 3H7OA 2UWOA 4Y7AA 4X1RU 3GY4A 2JH0D 4FU9A 4A1XA 1YCPH 4AX9H 3MWIU 5LPEA 1HAZB 1SSXA 1KSNA 4D9RA 1BBRK 1FUJA 4Z6AH 4CBNA 1YLDA 1DITH 1EAXA 2FEQH 1YYY1 2CJIA 1A0JA 3STJA 1P8VC 1P01A 5HXFA 3UPEA 4NSYA 1IQJA 5GJ4B 1GBJA 4VGCC 3D62A 5JBTA 3TK5A 2WV4A 4RKOB 4UFFH 2R2MB 4Y8ZA 3SNAA 2BVXH 1GHYH 4CREA 1UTJA 1MD8A 4I7YH 4UFDH 1XXDA 2ZDAH 1DE7H 1F0RA 1AE5A 4GLYA 2D26C 1L1JA 2H1UA 1V2RT 2ODPA 4FVDA 5C20A 4IBLH 2F83A 1SGCA 1A46H 3A7XA 3PMBB 3SI4H 2VIPA 5C2ZA 1F0SA 3ZVCA 4GVUA 1O2MA 3RXMA 2H5DA 3MYWA 1VCQA 3MH4A 4MNVA 4X2WA 1T4VH 3U1IB 1GDNA 1HB0B 5DP8A 1DICA 1NFWA 1SLXB 1BZXE 3SV7A 3E0PB 1LHDH 3UOPA 4MNYA 2QV1A 2ZO3H 1E38B 2UUYA 3RXPA 4Q7XA 1YBWA 1GDQA 4H6TA 1EKBB 1ACBE 1NN6A 1FDPA 1O0DH 4AB8A 1GI5A 2GT7A 2ZCLP 4GHQA 3A8DA 4AN7A 3DD2H 1P2JA 1A7SA 2P3FH 3BTFE 3ZZ3A 2G5VA 4YOIA 1A3EH 1GJBB 5EQSA 4XBCA 4B76A 3S7HB 3F68H 3LONA 3RXKA 4KTCA 1FLEE 2BX4A 1TRYA 1C5VA 3RXAA 1O3JA 1YKTA 2F9PA 2VWNA 3EGKH 4D76A 2PSYA 2FDAA 1NPMA 3GY5A 2W26A 3TPIZ 4JYTA 4B74A 1HXEH 1QB9A 1SL3A 2Q6GA 4KGAA 2ZNKH 2ZHDA 1GMHF 1SG8B 1PJPA 1YPHE 4K69A 1NFXA 4D7GA 2ZPRA 2ZFPH 2ZCKP 2ZQ1A 2V3OH 2AEIH 4FUHA 2BY9X 1WV7H 3RXIA 3KQEA 1GHWH 2A5KA 3DFJA 1MBMA 3GYMA 3LGVA 1FV9A 2P95A 4Q2KA 4U01A 1GJ5H 1Y8TA 2RDLA 2Z3DA 4TY7A 4Y76A 4RN6A 1Z71A 2BX3A 6GCHG 1IQKA 5F6MA 1GMCG 1CT4E 3QK1A 4TPYA 3MNSA 1O5AB 3A85A 2Z7FE 2FM2A 1EX3A 1AGJA 2Z3EA 2OQUA 1ZSJA 1SGQE 2UUKB 5K0HA 4CHAB 1V2NT 1FMGA 1DFPA 3SHCH 4IC6A 1ABJH 1C2FA 1UK3A 1UK2A 4PROA 2H6MA 4ABDA 1V3XA 1LKBA 3HK6B 1UVPA 4BOHA 4DGJA 3LH1A 4B2CA 1V2KT 3KQCA 3EA8A 3A81A 1QRWA 4BTUB 4ZKRU 3U8TH 5A0CA 2P8OC 3FP6E 1LPGB 5I25A 4ABBA 1SI5H 1AB9B 2ZP0H 1MU6B 4JMYA 4B75A 4DURA 1K1PA 1ZJDA 5IYTA 3TGKE 1W7XH 1NESE 5FPSA 1SMFE 5T6FA 1TB6H 4I8HA 1YPEH 1WU1A 1BB0B 3UUZA 5SGAE 3GCTF 2STBE 1ZTJA 3P8GA 2RG3A 3SU6A 1BBRH 2A1DB 2QF3A 3PWBA 4OS5A 1F5RA 5GCHG 2FOAA 2OQ5A 1CVWH 4TWWA 1XUJA 3UNSA 1ESBA 1T8NA 1QRZA 2Z9LA 3DA9B 4CRGA 1FIWA 3M3SA 1FN8A 4MVNA 1TRNA 1O2NA 5HYOA 3QTVH 3CP7A 3BG8A 1GGDB 2BDAA 1DDJA 2WPMS 3M5NA 1BRAA 4H42U 3UFAA 2GCTB 2BDBA 2FOHA 3A8AA 2BZ6H 3OY5U 4X1PU 1C5OH 1CBWB 2XTTB 1LPKB 3ZYDA 3RXOA 3RMOH 2HPPH 3G01A 3KCGH 3SOSA 5H4IB 1THSH 4INLA 1DLEA 2NU4E 2ZIQH 1G3DA 1ANBA 3RXEA 3V0XA 1SGPE 4X8SH 1A5GH 4FXGH 4NCYA 2G81E 3DHKH 1O3MA 1J14A 5EXLA 1HV7A 1GBBA 1GI6A 2GZ8A 2XWAA 1MCVA 3MH5A 2R3YA 3NPSA 3OY6U 2P93A 3MU8A 1ZR0A 2BY5X 1PPZA 1KXCA 1AB9C 1C1MA 3MNXA 1LMWB 3BEIB 3UWJH 1GJCB 8LPRA 1GMDG 1ELCA 4Y71A 2BTCE 1YPLH 1PPBH 3FZZA 1C5MD 1ARBA 2A0QB 1VGCB 1T8OA 1GJAB 1BITA 1MTUA 1K1OA 2CN0H 3A83A 2BXTH 2F9VA 2VVCA 1QRXA 1A3BH 4KTSA 4X1QU 3TITA 3F9GA 1ELGA 2TGDA 1PQ8A 2ZF0H 1ZYOA 4X1SU 1AZ8A 3E16B 2C90B 2A7HA 1W11U 2OXSA 4CRBA 2BD5A 3ZVAA 4OS7A 1ZTKA 2FWWA 3PMJA 4UFEH 2BD9A 1MTNC 2A45B 1ZPBA 1LVMA 4YOGA 1GGDC 1BMLA 1C2KA 3BTGE 4NIWA 1SOZA 4AB9A 4ABAA 2PTCE 3M36A 2AMDA 4TWYA 3TGJE 2HNTE 2GCTC 2FS9A 3S69A 1CBWC 1O3CA 4DW2U 1P10A 1BJUA 2KAIA 5C1XA 3BTEE 4WVPE 2CHAB 2ZU2A 2QA9E 4F49A 5ESTE 2XC0A 5J4QA 2R3UA 4I33A 3KN2A 1WTHD 2ODQA 3TJUA 4ZHAA 3Q76A 2HWLB 3RXCA 3SW2B 3U9AH 1GBFA 5AFZH 1FAXA 5C5NA 1LKAA 5DP7A 3KL6A 3S7KB 5EG4A 1SLUB 3NWUA 3UTUH 2FOFA 2G4UA 3TNTA 2NU0E 2ZHQH 3GY8A 2BDIA 2OCVB 1DWBH 1W3CA 2WPJS 1B5GH 2VIVA 1QA0A 4X0WU 1TMTH 1TNKA 4A92A 4NZLA 2QAAA 4JZFH 1C9PA 2QGRA 5JB8S 2O8MA 1YPMH 5FBEA 3SJ8A 1G9IE 1SBWA 2OTVA 1QL8A 2SGEE 3SNCA 3OTJE 4AYYB 3R0FA 1P0SH 1FXYA 1O3PB 1T7CA 3QZQA 5FCRA 1VITF 1EJMA 1F2SE 4Y11E 1HBTH 1BMNH 1AVGH 5DO4H 2C4FH 3F6UH 1DWEH 4DG4A 4XSKU 1SB1H 4NWKA 4AFUA 4XE4A 2ZTYA 3SV9A 1S83A 1Y59T 7GCHF 2PFEA 2Z6BD 1TABE 3QUMP 1P06A 1AHTH 2G51A 1C2JA 2WUCA 1GMHG 2CHAC 2CF9H 1VJ9U 3P17H 1CO7E 4MQAA 2KAIB 1BMAA 1VZQH 2FI3E 2A32A 2J34A 3SUFA 1MKWH 5DKMA 1XKAC 1O2RA 3P92A 1PPEE 1C4U2 3RMNH 3R3GB 3SBKA 1QHRB 2H9TH 3E0NB 2J94A 3FANA 4YM9A 1ORFA 2C93B 1A0LA 3O8RA 1EXFA 3Q3XA 4XFQA 5EQRA 1BA8B 1GWAA 5FCKA 1O39A 1YGCH 3IWMA 4H6SB 1MUEB 7LPRA 3RM0H 1GI8B 1KTTB 1LO6A 3A89A 3ZZ6A 1WCZA 1GBCA 2IOTA 2M5TA 3A7TA 2HALA 3SQHE 1OWKA 1IAUA 3H5CB 1ZMNA 1BJVA 4CR9A 3VXFH 1DLKB 1GMCF 2FP7B 4NG9H 2QXHA 3A86A 1GBHA 4DIIH 3OU0A 2G52A 4WH8A 1C5TA 4FUFA 4NIXA 1FI8A 1V2PT 3A82A 3A7ZA 2B0FA 2Y5FA 2XBWA 2JETB 1XM1A 5EPYA 1KDQA 4ISIH 1F7ZA 1NU9A 1SFIA 3AAUA 1LCYA 1TGCA 3U8OH 3A7WA 4A1VA 1BUIA 1AQ7A 3BIVH 9ESTA 1BTPA 2NU3E 1S6HA 1QBOA 1BT7A 1TA6A 5LH8A 1LVBA 3GY7A 3NZIA 4WY3A 1OXGA 2DE9A 2FPZA 2QC2A 1P04A 4YLQH 2D8WA 1O30A 1VCPA 3NUMA 3SJOA 3GCTG 2P16A 5CHAB 4K8BA 1LDTT 4ZH8A 3V12A 1MCTA 5EW2H 4ZMAH 2BXUH 5J4SA 1HCGA 1BRBE 3AAVA 2RA3A 1P09A 1TA2A 2IJOB 1A4WH 5C1YA 1CGIE 2GDEH 2Y5HA 2K1QA 3MNCA 4FU7A 3TH2H 5CE1A 2FZZA 1KLJH 1O3HA 3OYPA 1SGYE 5IDKA 1QIXB 2SFAA 1J17T 5FX6A 4Z0KA 1ELFA 1P3EA 3PM3A 1WAYB 2NU1E 2ZWLH 1HJ8A 3FFGA 1GJ9B 4YT7H 4K5ZA 1GHAF 4UE7H 5EODA 2TBSA 2ZDNA 1JWTA 1AMHA 1W0YH 1BDAA 1HLTH 1K2I1 4MDSA 1ELTA 1TWXB 3RXJA 1GI1A 2FTMA 3GY3A 5EXNA 4BNRA 3O8DA 1ANEA 2JETC 1O2OA 4OGYA 1S81A 1K1IA 1EB1H 1LHFH 5F8ZA 2GV6A 1TNHA 1GDUA 2VWMA 1Y5UT 4CRCA 1KDQB 2ALVA 5E0HA 1GBEA 3P8FA 2R9PA 3RXUA 3URDA 3RXQA 1ZSKA 1V2QT 1ZJKA 3LT3A 1O33A 1UK4A 1VJAU 1TPOA 2VWLA 1O5CB 3K2UA 5CHAC 4HI3A 3BSQA 3I78A 4ZKNU 1OYTH 3SGBE 3UQOA 4MTBA 3E6PH 1GI9B 2HNTF 3M5MA 1S6FA 3RXDA 3LU9B 3CS7A 1ZPZA 2STAE 1T8MA 4ZUHA 4BAKB 4FUBA 1RFNA 3S9CA 5GXPA 1AVXA 4WWYA 4NFEA 1E35B 1DXWA 1TBZH 1E0FD 4YESB 1WUNH 1OS8A 1TX8A
chains in the Genus database with same CATH superfamily
1AY6H 1H9LB 2ANYA 1GI4A 2C8YB 3F2FA 3LH3A 2Q1JA 1SLWB 5A8ZA 3T2NA 1C1VH 2XBYA 1V2ST 2WPHS 6CHAB 5C5OA 2FODA 1EZUC 1SVPA 2WPLS 1TGTA 1ZTLA 1CA0B 4X1NU 8KME2 1ZHRA 2FIRH 4A7IB 2OUAA 2FS8A 2BQWB 3LC3A 4AYVB 1P05A 2VNTA 1G3EA 3RXGA 2I6QA 1K28D 1OKXA 1OWEA 1BQYA 2V3MA 1TX7A 2GKVE 1ZHPA 2UUJB 4GAWA 5TCAA 3DSPA 1HAVB 1NROH 3MHWU 5EIYA 5JBBS 4XDEA 3SNEA 1Q3XA 1IHSH 1VCWA 1CHOF 1S82A 1N6YA 3A88A 2FOGA 3TU7H 5DJ7A 3MMGA 2JDID 1C5UA 2FYRA 1EPTA 3HKIB 3EE0B 2Y80A 1EOLA 1O2LA 1QY6A 1V2TT 2FLRH 1QB6A 4BXWA 2IPHA 2QF5A 3AW1A 2VB0A 2BZAA 4INKA 1SGEE 5GIBA 5A2MH 1EB2A 1SGTA 1W8BH 2HGTH 3Q3KA 1LQDB 2LNCA 1O2PA 2PKSB 1VITG 1GCTB 4JZIA 1JMOH 5GDSH 3TNSA 3KQBA 3JZ1B 4R0IA 1LTOA 3WY8A 3ZZ5A 2J2UA 1P12E 3SORA 1FNIA 3QX5H 3TH3H 1YPGH 1P2NA 2JJ1D 3PMAB 2Y81A 1DVAH 4DT4A 7GCHG 1S5SA 2YNAA 6CHAC 1GHBF 2QXIA 2GDDA 2AHME 3RLWH 4ZHMU 3I29A 3UNQA 1DUEA 1NS3A 2AMQA 1Z1IA 5C0TA 3GCHB 3FKSD 4A1TA 4X8VH 2XW9A 2W7UA 1EJAA 4CRAA 2V6NA 1EAUA 1SGNE 1TOCB 1IQNA 2ZGHA 1G37A 2BD4A 2G8TA 2SGDE 2FX4A 2SNVA 1AWHB 1NZQH 1FX0B 5BRRE 1NRNH 1YPJH 2WUBA 1HPGA 3M7QA 1HNEE 3ZZCA 4X6NA 4ABEA 1BHXB 2K0QA 4RKJB 1HAPH 2ANMH 4HTCH 1OHHD 1WQVH 1EPTB 1HGTH 4X8TH 3ZV9A 2QE7D 1S84A 4RT0A 3PLKA 3MNBA 3V7TA 4X2VA 4ABHA 4X6MA 1C5ZB 1KYNA 2PKAA 1GCTC 2BOHB 3FOAA 3SI3H 5KECA 1C1NA 1OP2A 3GDUA 1B0FA 2RFKC 2J98A 3LOXA 1F5LA 1TNIA 2SNWA 3SQEE 3ZZBA 3UR6A 4DVAU 2PWXA 2ZGCA 4Y0YE 2C8ZB 4J2YB 4AFQA 1SKYE 3A8CA 3A7VA 4FU8A 4O3TA 2M2AA 1FIZA 1NFUA 3GCHC 1HAGE 3SNDA 1CQQA 5FAHA 3SHAH 1PPGE 1DS2E 1TNGA 2H9EH 1QQ4A 2FOEA 1NFYA 3K9XB 1C5WB 4ZKSU 2ZFRH 3M3VA 3QLPH 5E0GA 1K1NA 3EYDA 3RUOA 2FI4E 2FO9A 1BTXA 1E1RD 3QN7A 1GL1A 2W7SA 2XXLA 1G2LA 3A7YA 1OX1A 3GCOA 4A6LA 2GTBA 2KM0A 3KIDU 3RXSA 5GWZA 3SGAE 2F9UA 2G00A 1DANH 3AVZA 1TNLA 4Q80A 2WPIS 1EPTC 3RU4D 1W0ZU 1GHAG 3KYGA 3ZVGA 1AKSB 1H9IE 3ZVBA 1XXFA 1ZMJA 2XBVA 4UEHH 4MNWA 4O97A 3T25A 2KCYA 5T6GA 1DXPA 1FZZA 1UVTH 4CHAC 1GHZA 1D6RA 1AO5A 3H09A 1L0ZA 1Y3YA 3MO9A 1X7AC 3WWBA 1B0EA 2BDHA 2ZI2H 1O3NA 1OOKB 1Y5BT 2Y7XA 3BTQE 1TYNA 3FVFB 2PKAB 3MU4A 1LPZB 1TPSA 1SPJA 4NGAH 2KCOA 4QT8C 1DY8A 1SGDE 3U69H 1HAHH 3UNRA 2GGVB 1G36A 1O5GH 1FY4A 1QCPA 4XRNA 4AGJA 1D3PB 2IN2A 2A2XH 3KYFA 2PV9B 1PQ7A 1N8OB 4TPIZ 2WYGA 1UO6A 1ELAA 2QF4A 2BY6X 1AE8H 1E34B 3GDSA 2OK5A 2VINA 4B6FA 1C1PA 2Q6FA 2PW8H 2VWOA 3ESTA 1JRSA 4TYDA 1VITH 2F9OA 4TY6A 3D49H 4NFFA 2XBXA 1S0RA 1QQUA 3RXRA 4NWLA 4F55A 5CHBA 3DSGA 2QF0A 1O3IA 1ANDA 6ESTA 5EQQA 4YZUA 2R2WU 3RC5A 4U30A 1P03A 5FL7D 4FOUC 1O3AA 1TONA 2XWBI 3N7OA 1MKXK 3RU4T 3UR9A 4IMZA 1SGIB 1C2LA 2A4QA 1O35A 1O36A 1TGBA 4WMFA 2OC0A 1P57B 1TRMA 1RGQA 2F3CE 2WV9A 2NU2E 4GSOA 1EP6A 1L2EA 1RTLA 3EAJA 1KLIH 1EZSC 1XVOA 2BLWA 3T5FH 4U32A 2BHGA 1C5RA 3M7TA 1O2HA 1LVYA 1FY5A 1BIOA 1HJ9A 1O2ZA 3BTTE 2OP9A 1YPKH 3PRBA 1C9TA 5F03A 1LHGH 1W7GH 2PSXA 1MQ6A 3BN9A 1CHOG 1FY3A 1SHHB 3KF2A 3RMMH 5DP9A 1GI3A 1OWDA 4O03A 1MBQA 4FUIA 1OSSA 3DT0H 1S85A 1C1WH 3F9FA 1PFXC 1P11E 3B9FH 2J38A 2FOBA 1JIRA 1C1SA 1OWJA 4AORA 4SGAE 3EDXB 1VGCC 1D6WA 1FPCH 2QXJA 1NRRH 5C1UA 1ESTA 2YOLA 3LPRA 3TH4H 1ESAA 1IHTH 4DJZB 3S9BA 3GISB 1KXDA 3DFLA 2RDEA 4IS5A 1WXRA 1O38A 1H8HD 5EW1H 1WQSA 1W12U 2WPKS 2ZHFH 3JZ2B 3SUGA 3UB0A 1AUJA 2PUXB 1C4Y2 5JB9S 1L1NA 2LP6A 1UJ1A 1DSUA 2Z94A 1ANCA 5CDFE 1KXFA 3ODDA 2F43B 5JPMH 1GHBG 3ATLA 3U98H 4DY7B 2A2QH 1NT1A 5DP4A 1WOFA 2FYQA 4I8KA 1HAYB 4AFSA 4AGKA 3RM2H 2G4TA 2B9LA 4WXVA 1E36B 1UCYK 2R0LA 5FPYA 3RMLH 3SJ9A 1MTVA 2OD3B 1G2MA 2J5UA 4SGBE 3SU1A 2JH5D 3L6PA 4KKDA 1UCYE 2BLVA 1NRPH 2QXGA 1C1OA 3A8BA 1UTNA 1XUGA 1K1MA 1GBIA 3ZVDA 2YNBA 1BCUH 5FX5A 1BTUA 1PQ5A 1GG6B 5DP3A 1ZGVA 3UOUA 5IK2D 2O8WA 1FN6A 1EQ9A 1W2KH 3SZNA 4ACBA 2XRCA 2J92A 2ZQ2A 2GZ7A 1MMJN 4X8UH 4Y0ZE 4BTTB 1O2SA 3VPKA 3ATWA 4HGCA 1YM0A 5BPEA 3O8BA 3B8JA 3Q3YA 1TE0A 4NIVA 4KP0A 1A5HA 5EGMA 1Y3VA 2ASUB 2J97A 2AIQA 5AFYH 1BTWA 3Q00A 2FXRA 5EJZA 1C5SA 2H9HA 3RP2A 3SN8A 5AVDA 1GHXH 5L6NH 4YO9A 1SR5C 4FVBA 1GCDA 3MO6A 1P2MA 1XKBC 1KXBA 2TIOA 1C5NH 2ZU4A 1Z1JA 3QZRA 1O32A 4JCNA 2P94A 3DSOA 4BAOB 4KELA 1AD8H 7KMEH 4AFZA 3BTKE 3PYHA 3ZYEA 4K3JA 1THRH 1O2WA 4JZ1A 3PTBA 1O3DA 1ETTH 2B5TB 3VB7A 1AIXH 1HJAB 2SGPE 5B6OA 1GPZA 4K8YA 2GCHF 1QA7A 2L6OA 2QY0B 2ZECA 3E8LA 1NRSH 3HGPA 2O8UA 3OSYA 1UTLM 1JIMA 3RXVA 1MKXH 3SO3A 2HVYB 2DUCA 4ISHH 4ISOA 1Z8RA 2ZPSA 3D23A 4B2BA 4OS1A 2F9NA 1GG6C 1UVSH 3W95A 1VR1H 5AHGH 1ABIH 4NA7A 3IG6B 1AFEH 2ZKSA 1GJ7B 3LJJA 1ZHMA 3L3TA 3QDZB 2ZU1A 3BEFB 2AIPA 2HVXA 4D9QA 3BTME 3OTPA 4Y8XA 1UVUH 2HOBA 1QJ6B 1W0KD 3U8RH 5F8TA 5EU8A 4INHA 3KNXA 3V13A 1QJ1B 3SUEA 4E7RG 4ASUD 1SQRA 4XD7D 3P8NA 1K9OE 1BTYA 4ABIA 5FBIA 1E37B 1TPPA 3LGTA 1HRTH 1ARCA 1QL9A 1VKYA 1GHVH 1OP8A 2ANWA 2J95A 5E0JA 5FHTA 3QGNB 1PYTD 1HAVA 1Z7KA 2JH6D 1FAKH 1FY8E 1KLTA 3F9HA 1HAXB 4AOQA 1TOMH 3URCA 4FUGA 1GI2A 1ETSH 2FOCA 1PQAA 3A84A 2A7JA 4Q7ZA 5EOKA 3EQ0H 1HJAC 1DWDH 1ZOMA 4O9VA 4J1YA 3LGYA 2J9NA 1XUIA 2BD3A 4VGCB 1C2MA 1UMAH 3U28C 3BIUH 3TJOA 2ZDLA 2BD7A 3V3MA 1IQMA 2OC8A 4K1EA 2G5NA 1DSTA 1YCPM 2FX6A 4X2YA 3RXLA 4BTIB 1CU1A 2YMSD 3P95A 1A5IA 1F5KU 2WV5A 1GJ4H 3PO1B 4FUCA 1UCYH 2GP9B 1GL0E 1EZXC 1BRCE 4THNH 1IQHA 2JKHA 3MH7A 4BAHB 1D3TB 2ZG0H 4ZHLU 5DP5A 3QO6A 3ELAH 4JK5A 4CBOA 1BMFD 3VB5A 2B7DH 3GDVA 3SU3A 1OPHB 1DWCH 2PGQB 5LPFA 1GVLA 2VVUA 1V2JT 3BTWE 3N7EA 1T31A 3MOCA 1CGJE 3T29A 5E2PA 3ENSB 2W3KA 3P6ZB 1GI0A 4I86A 2BDGA 1THPB 1BOQA 1BRUP 2RCEA 1KXAA 1SOTA 2BB4A 1N1LA 1HIAA 5JBAS 1U6QA 2ZU3A 3RLYH 1EZQA 5LGOA 5K7RA 1GJ8B 1ZLRA 1XUHA 3SU4A 1H1BA 3AW0A 4Y79A 2ZU5A 3KEEA 4P02A 1QBNA 1RTKA 1EASA 1HDTH 3BTDE 1BBRE 1G3BA 4B73A 1O34A 5FXLA 1CGHA 2BLQA 2BY7X 2QIQA 3IITA 1FY1A 2XCNA 5GNDA 2Y82A 1TALA 2W5EA 1JRTA 3VFEA 4ISNA 1DT2A 2W6ID 3A80A 5A8YA 3PB1E 4OGXA 1S6LA 1MTWA 2WINI 4IW4E 4NA9H 2UUFB 3UWIA 1TBRH 2P3TB 4OS2A 1TMUH 3C1KA 2ULLA 1O3FA 4ZKOU 3MFJA 1SGFG 2BLOA 2ZFSA 3FP8E 3RXHA 1LHCH 4U2WA 1GBDA 1AVWA 3PO1C 4I8JA 2Z9JA 4BAQB 1C4V2 3GICB 3N99A 3P8OA 3SGQE 1P9UA 5G4BA 2BM2A 1LHEH 4X6PA 1MZAA 1NTPA 2BQ6B 2SGFE 1L4DA 4JYVH 5C0UA 1DM4B 1KY9A 2OC1A 3WW7A 1MAXA 1P02A 3HKJB 1C1UH 2BD8A 1JBUH 3UREA 3W1EA 1BMMH 1C2HA 1O5FH 2WHXA 3BV9B 3W94A 2FMJA 1MZDA 1A1RA 3MI4A 5F53A 2BDYA 3SV8A 1AZZA 4ISLA 2ZC9H 1QR3E 1GBTA 2PP6A 1TFXA 1TIOA 1P2QA 2F91A 1CA0C 2ILNA 4UFGH 1GJ6A 3LIWA 4AZ2B 1K1JA 3PLPA 4KTUA 2VH0A 3SJIA 2WSSD 1QBVH 1V2LT 3PWCA 5CMXH 4DOQA 1Q31A 4HFPB 1K22H 1Z8GA 1HIAB 2P8OB 2Y7ZA 3HATH 1YLNA 2Z9GA 1O2QA 4K1TA 1FQ3A 2WZQA 1TQ7B 2XCFA 3PTNA 4CRFA 2HLCA 1A2CH 2BYAX 3LC5A 2AS9A 1T4UH 2ZEBA 4K1SA 2ZTZA 2RA0A 2ZDKA 3VB6A 3PV5A 2VJ1A 1NO9H 1LQEA 1RIWB 1C5PA 2D2DA 1YLCA 1AKSA 3M5OA 1Y5AT 5E2OA 3T26A 1W14U 1GVZA 1DY9A 5GPIB 2R0KA 4Q63A 2B8OH 3KHVA 4BAMB 1SFQB 1NM6A 3E1XB 2TPIZ 2AERH 2PKSC 4WH6A 1EFRD 4X2XA 4Y7BA 1V6DA 2GVFA 2QYIA 4LK4A 4IGDA 1K1LA 1P2OA 1S0QA 2AYWA 1HAIH 1ZGIA 1DUAA 2A4RA 1Y3XA 2FOMB 1Y3WA 5HM9A 1WSSH 4MPVA 1YPHC 1AN1E 1UHBA 4M9FA 2A5IA 2VU8E 1V2MT 3ZZ4A 1P3CA 4GCHF 4ACAA 4B6EA 1ZMLA 2GCHG 4WMEA 1V2VT 4M7GA 1MH0A 1J15A 1SQTA 4Y6DA 1C2GA 2PGBB 3MU5A 2FESH 3EA7A 1YC0A 3MTYA 1TPAE 2BD2A 2GZ9A 3LKWA 1ELBA 5TCCA 3UIRA 4IN1A 2ZGXH 1O3KA 3D65E 3LJOA 1EOJA 2O8LA 4NA8A 5ETXA 1J16A 4WJG2 1L4ZA 2YMSB 4FUDA 1KIGH 3M37A 2TGAA 3Q77A 4F48B 1PPCE 2ZGJA 1HUTH 1GBKA 2QCYA 3T62A 1G32B 1AUTC 3MU1A 3RDZA 2TGPZ 1TMBH 1XMNB 4D7FA 4RI0A 4Z1MD 3ZVEA 1TBQH 1O31A 3ITIA 4AG2A 1NBMD 1D3QB 1C5YB 3SU0A 1RIWC 5DGJA 1V2OT 4F4OC 4MG3A 3BG4B 3ODFA 3T27A 2ZHEH 4R8TB 2EEKA 1A61H 1C1TA 1GI7B 3NK8A 2BOKA 2XC5A 2BVSH 3E91A 4IMQA 2EC9H 1WYKA 5A0BA 4GPGA 4HG6A 4YT6H 5EJLA 1PYTC 2KFWA 2LPRA 3UQVA 1F0TA 2BY8X 2ALPA 1Z8IB 2HRVA 3S9AA 1MTNB 1MKWK 5KEDA 1NY22 1KXEA 4Y8YA 2GMTB 4A5TS 2CXVA 4K60A 1XX9A 1RXPA 4ZAEA 2CMYA 1SLVB 3OX7U 2VIQA 3M61U 1OYQA 5PTPA 3TK9A 5AF9H 1EAIA 5JYIA 3VEQB 1Q2WA 2AGEX 2AGIX 1UHBB 8GCHG 3TLOA 4X6OA 1SHYA 1CHGA 2PLXA 4XBBA 2V0BA 3ATIA 1K21H 1TGNA 2BQ7B 3L33A 1O2YA 3AASA 1UVOA 2ODYB 3SU5A 1AU8A 3F2GA 3OE7D 1UTQA 2V35A 3ZZ9A 5B6LA 1V2WT 2A4OA 1CE5A 2YMSC 3TJVA 5T6DA 2BMGB 5E8EH 1GBMA 3MU0A 4ESTE 1CSOE 5A0AE 3BEUA 3NRLA 5HMAA 4MNXA 1H4WA 1O2IA 2CF8H 3QTOH 4BANB 1CA8B 2OBOA 4CR5A 4DCDA 5JDUB 2DE8A 4FUJA 4NZQA 1XVMA 3LGUA 1O3BA 2GX4A 1TLDA 5DG6A 2ZHWH 3KQDA 5I46H 3GY2A 1V2UT 4E06H 3UY9A 1E79D 1H8ED 4I8LA 4XOJA 4LZ4B 2A7CA 3K6YA 3BG4C 1XUFA 5EXMA 2ZDMA 1ZSLA 3PROA 1O5BB 7ESTE 2ZFTA 4ABFA 2Z3CA 3HPTB 1OWHA 3RC4A 4H4FA 2FTLE 5DK1A 1D9IA 1RJXB 4E7NA 3RC6A 2EI8A 3TJNA 1Z8JB 2J4IA 1O2XA 2GMTC 1WTGH 5DSFA 3HK3B 4LZ1H 1C5LH 3N7DA 3LGIA 2PTNA 4JZEH 2AGGX 1FJSA 1N8OC 1A0HB 3B23B 4LXBH 3ZZ8A 1RTFB 4JYUH 3CS0A 2OC7A 3GY6A 1TX6A 1RS0A 1C1RA 2HNTC 3M5LA 4IC5A 2EI7A 2GT8A 4MPUA 1HXFH 3I77A 1LVOA 1H8DH 1Z6EA 1DX5M 1SGRE 1YF4A 4WF8A 1MQ5A 3WWFA 2I6SA 4XBDA 1MAYA 2O8TA 4ZXYH 1ID5H 4ASHA 4MPWA 1AWFH 1ELEE 1O2KA 4OS4A 4AC9A 3SJKA 1QB1A 1QNJA 2F9BH 1QFKH 1O3LA 1J9CH 2P3UB 3ZZ7A 3DUXH 1ZRKA 3SNBA 3OAAD 1O2GH 3F9EA 2ZPQA 5A09A 1QL7A 4BXSA 3HGNA 1MU8B 4RSPA 1P2KA 2BDCA 2VVVA 3K6ZA 2ANKH 4O3UA 1XUKA 5ABWA 1IQGA 1F0UA 3ZZDA 2AH4X 3E90B 3ATMA 4D8NA 3NXPA 5C3NA 2ZA5A 3SV6A 1QTFA 3MH6A 1YY3A 1AI8H 4AG1A 2XYAA 3SUDA 2XNIA 1O3EA 1D4PB 5F8XA 4FUEA 5L2ZH 2OBQA 3VGCB 4DIHH 2ZFQH 1WBGB 1JXPA 2XNDD 3U1JB 1FONA 4NIYA 5LPRA 3NKKA 3MO3A 1C2DA 2ZTXA 1GBAA 3FP7E 5ESBA 1O5EH 4ZROA 2IJD1 3CENA 1EAWA 1YCPK 2ZCHP 4ABJA 4B71A 2XC4A 1GBLA 1TNJA 1IOEA 1IQLA 1RD3B 2VGCB 3VB4A 1H8IH 2Y5GA 5FPTA 1B7XB 4OS6A 2ZDVH 1L1GA 1HYLA 1EJNA 1QGFA 5JBCS 2ESTE 4GUXA 1DPOA 4JZDH 3RXBA 2ZZUH 1O2TA 3ATKA 1IQFA 1BHXF 2PR3A 4UD9H 4FETA 2PHBA 1UTOA 3EA9A 1TGSZ 4B2AA 2GD4B 4GCHG 2AMPA 3TGIE 6GCHF 2VIWA 1T32A 3E3TA 1GVKB 5A8XA 4K2YA 2EQNA 2UWLA 1UTPA 2GV7A 4DT7B 1QJ7B 2L74A 5HGGA 1FPHH 4YOJA 4UONA 1YP9A 1SC8U 4ZXXH 1NC6A 1MTSA 5DP6A 3AK5A 1KTSB 1SQAA 1UTKA 4IN2A 3NCLA 3RU4E 1INCA 1ETRH 1O2UA 2AFQB 2VH6A 2H2ZA 3H7TA 3PV4A 1RRKA 4YLUA 1QURH 4JK6A 9LPRA 4LOYH 5TJXA 1PPHE 2FI5E 1AFQB 3VGCC 3TIUA 1EP5A 1SQOA 3LDXH 1ZRBA 2VIDA 1YWUA 3GOVB 2BVRH 2QN5T 2A4GA 2TRMA 4Y10E 1MD7A 1J8AA 1ELDE 1C2IA 2W3IA 2ZGBH 1UTMA 1C5QA 1P9SA 1O5DH 2H5CA 6LPRA 1OP0A 2VIOA 2VGCC 2ZFFH 2EI6A 3FAOA 1W13U 2CV3A 4WMDA 4I32A 1GJDB 2FLBH 3P70B 2Z9IA 3TVJB 3LGWA 1C1QA 3BTHE 5GCHF 3PMHB 1TAWA 3SV2H 2Q6DA 1F92A 1O37A 3SU2A 5L2YH 2CGAA 2UWPA 3QGJA 2JJ2D 3ZVFA 2G55A 2A5AA 2PUQH 3BF6H 3F1SB 3S0NA 4I31A 1T8LA 2WYJA 1H9HE 3T28A 3M35A 3PLBA 1IQEA 2THFB 4WXIA 1BTHH 1CT0E 2EA3A 3RXFA 1C5XB 1EATA 1ZPCA 4E05H 3GCNA 4ABGA 8GCHF 1O2VA 1JOUB 3VB3A 1BTZA 3FZDA 3ZZAA 1P2IA 3KGPA 4OM9A 1G3CA 1SGFA 3UAIC 3VXEH 3O8CA 1Y3UA 5C67A 1ZZZA 1HFDA 1TQ0B 1O2JA 1PPFE 3M7UA 3A87A 2D1JA 2OLGA 4CH2B 5T3HA 3GYLB 3F0PA 2C8XB 2Y6TA 4YTAA 1W0JD 4CRDA 5L30H 5EPNA 1AFQC 2O9QA 1M9UA 4UDWH 2C3SA 4I8GA 2NWNA 1EUFA 1N6XA 2V3HH 3QWCH 3ZV8A 1IQIA 1G30B 1ELVA 2Z9KA 1O3OA 3VG8A 4NSVA 2C8WB 1GMDF 2SGQE 2A31A 2SGAA 2HPQH 3OFND 4HZHA 4MLFB 2TGTA 1Z6JH 5HM2A 3C27B 2OINA 4Q4LA 2P59A 3TK6A 1HAOH 1DOJA 1NU7B 8ESTE 1D3DB 1W10U 1CT2E 3K65B 2VBCA 1C2EA 3STIA 4MPXA 1NRQH 4B1TA 4CH8B 4GHTA 4Q7YA 3RXTA 3M3TA 1OWIA 1O3GA 5DPAA 3H7OA 2UWOA 4Y7AA 4X1RU 3GY4A 2JH0D 4FU9A 4A1XA 1YCPH 4AX9H 3MWIU 5LPEA 1HAZB 1SSXA 1KSNA 4D9RA 1BBRK 1FUJA 4Z6AH 4CBNA 1YLDA 1DITH 1EAXA 2FEQH 1YYY1 2CJIA 1A0JA 3STJA 1P8VC 1P01A 5HXFA 3UPEA 4NSYA 1IQJA 5GJ4B 1GBJA 4VGCC 3D62A 5JBTA 3TK5A 2WV4A 4RKOB 4UFFH 2R2MB 4Y8ZA 4RT1A 3SNAA 2BVXH 1GHYH 4CREA 1UTJA 1MD8A 4I7YH 4UFDH 1XXDA 2LELA 2ZDAH 1DE7H 1F0RA 1AE5A 4GLYA 2D26C 1L1JA 2H1UA 1V2RT 2ODPA 4FVDA 5C20A 5HKKD 4IBLH 2F83A 1SGCA 1A46H 3A7XA 2KR7A 3PMBB 3OEED 3SI4H 2VIPA 5C2ZA 1F0SA 3SZEA 3ZVCA 4GVUA 1O2MA 3RXMA 2H5DA 3MYWA 1VCQA 3MH4A 4MNVA 4P00A 4X2WA 1T4VH 3U1IB 1GDNA 1HB0B 5DP8A 1DICA 1NFWA 1SLXB 1BZXE 3SV7A 3E0PB 1LHDH 3UOPA 4MNYA 2QV1A 2ZO3H 1E38B 2UUYA 3RXPA 3CNRA 4Q7XA 1YBWA 1GDQA 4H6TA 1EKBB 1ACBE 1NN6A 1FDPA 1O0DH 4AB8A 1GI5A 2GT7A 2ZCLP 4GHQA 3A8DA 4AN7A 3DD2H 1P2JA 1A7SA 2P3FH 3BTFE 3ZZ3A 2G5VA 4YOIA 1A3EH 1GJBB 3F0OA 5EQSA 4XBCA 4B76A 3S7HB 3F68H 3LONA 3RXKA 4KTCA 1FLEE 2BX4A 1TRYA 1C5VA 3RXAA 1O3JA 1YKTA 2F9PA 2VWNA 3EGKH 4D76A 3MQKC 2PSYA 2FDAA 1NPMA 3GY5A 2W26A 3TPIZ 4JYTA 4B74A 1HXEH 1QB9A 1SL3A 2Q6GA 4KGAA 2ZNKH 2ZHDA 1GMHF 1SG8B 1PJPA 1YPHE 4K69A 1NFXA 4D7GA 2ZPRA 2ZFPH 3ZIAD 2ZCKP 2ZQ1A 2V3OH 2AEIH 4FUHA 2BY9X 1WV7H 3RXIA 3KQEA 1GHWH 2A5KA 3DFJA 1MBMA 3GYMA 3LGVA 1FV9A 2P95A 4Q2KA 4U01A 1GJ5H 1Y8TA 2RDLA 2Z3DA 4TY7A 4Y76A 4RN6A 1Z71A 2BX3A 6GCHG 1IQKA 5F6MA 1GMCG 1QZ8A 3OEHD 1CT4E 3QK1A 4TPYA 3MNSA 1O5AB 3A85A 2Z7FE 2FM2A 1EX3A 1AGJA 2Z3EA 2OQUA 1ZSJA 1SGQE 2UUKB 5K0HA 4CHAB 1V2NT 1FMGA 1DFPA 3SHCH 1MABB 2WPDD 4IC6A 1ABJH 1C2FA 1UK3A 1UK2A 4PROA 2H6MA 4ABDA 1V3XA 1LKBA 3HK6B 1UVPA 3SYJA 4BOHA 4DGJA 3LH1A 4B2CA 1V2KT 3KQCA 3EA8A 3A81A 1QRWA 4BTUB 4ZKRU 3U8TH 5A0CA 2P8OC 3FP6E 1LPGB 5I25A 4ABBA 1SI5H 1AB9B 2ZP0H 1MU6B 4JMYA 4B75A 4DURA 1K1PA 1ZJDA 5IYTA 3TGKE 1W7XH 1NESE 5FPSA 1SMFE 5T6FA 1TB6H 4I8HA 1YPEH 1WU1A 1BB0B 2V7QD 3UUZA 5SGAE 3GCTF 2STBE 1ZTJA 3P8GA 2RG3A 2JIZD 3SU6A 1BBRH 2A1DB 2QF3A 3PWBA 4OS5A 1F5RA 5GCHG 2FOAA 2OQ5A 1CVWH 4TWWA 1XUJA 3UNSA 1ESBA 1T8NA 1QRZA 2Z9LA 3DA9B 4CRGA 1FIWA 3M3SA 1FN8A 4MVNA 1TRNA 1O2NA 5HYOA 3QTVH 2XOKD 3CP7A 3BG8A 1GGDB 2BDAA 1DDJA 2WPMS 3M5NA 1BRAA 4H42U 3UFAA 2HLDD 2GCTB 2BDBA 2FOHA 3A8AA 2BZ6H 3OY5U 4X1PU 1C5OH 1CBWB 2XTTB 1LPKB 3ZYDA 3RXOA 3RMOH 2HPPH 3G01A 3KCGH 3SOSA 5H4IB 1THSH 3PV2A 4INLA 5EJ1A 1DLEA 2NU4E 2ZIQH 1G3DA 1ANBA 3RXEA 3V0XA 1SGPE 4X8SH 1A5GH 4FXGH 4NCYA 2G81E 2W6JD 1O3MA 3DHKH 1J14A 5EXLA 1HV7A 1GBBA 1GI6A 2GZ8A 2XWAA 1MCVA 3MH5A 2R3YA 3NPSA 3OY6U 2J98B 2P93A 3MU8A 1ZR0A 2BY5X 1PPZA 1KXCA 1AB9C 1C1MA 3MNXA 1LMWB 3BEIB 3UWJH 1GJCB 8LPRA 1GMDG 1ELCA 4Y71A 2BTCE 1YPLH 1PPBH 3FZZA 1C5MD 1ARBA 2A0QB 1VGCB 1T8OA 1GJAB 1BITA 2KCPA 1MTUA 1K1OA 2CN0H 3A83A 2BXTH 2F9VA 2VVCA 1QRXA 1A3BH 4KTSA 4X1QU 3TITA 3F9GA 1ELGA 2TGDA 1PQ8A 2ZF0H 1ZYOA 4X1SU 1AZ8A 3E16B 2C90B 2A7HA 1W11U 2OXSA 4CRBA 5KGOA 2BD5A 3ZVAA 4OS7A 1ZTKA 2FWWA 3PMJA 4UFEH 2BD9A 1MTNC 2A45B 1ZPBA 1LVMA 4YOGA 1GGDC 1BMLA 1C2KA 3BTGE 4NIWA 1SOZA 4AB9A 4ABAA 2PTCE 3M36A 2AMDA 4TWYA 3TGJE 2HNTE 2GCTC 2FS9A 2K8IA 3S69A 1CBWC 1O3CA 4DW2U 1P10A 1BJUA 2KAIA 5C1XA 3BTEE 4WVPE 2CHAB 2ZU2A 2QA9E 4F49A 5ESTE 2XC0A 5J4QA 2R3UA 4I33A 3KN2A 1WTHD 2ODQA 3TJUA 4ZHAA 3Q76A 2HWLB 3RXCA 1UW7A 3SW2B 3U9AH 1GBFA 5AFZH 1FAXA 5C5NA 1LKAA 5DP7A 3KL6A 3S7KB 1KMHB 1SLUB 3NWUA 5EG4A 3UTUH 2FOFA 2G4UA 3TNTA 2NU0E 2ZHQH 3GY8A 2BDIA 2OCVB 1DWBH 3F3BA 2KCAA 1W3CA 2WPJS 1B5GH 2VIVA 1QA0A 4X0WU 1TMTH 3F2HA 1TNKA 4A92A 4NZLA 2QAAA 4JZFH 1C9PA 3EE7A 2QGRA 5JB8S 2O8MA 1YPMH 5FBEA 3SJ8A 1G9IE 1SBWA 2OTVA 1QL8A 2SGEE 3SNCA 3OTJE 4AYYB 3R0FA 1P0SH 1FXYA 1O3PB 1T7CA 3QZQA 5FCRA 1VITF 1EJMA 1F2SE 4Y11E 1HBTH 3KQ5A 1BMNH 1AVGH 5DO4H 2C4FH 3F6UH 1DWEH 4DG4A 4XSKU 1SB1H 4NWKA 4AFUA 4XE4A 2ZTYA 3SV9A 1S83A 1Y59T 7GCHF 2PFEA 2Z6BD 1TABE 3QUMP 1P06A 1AHTH 2G51A 1C2JA 2F4LA 2WUCA 1GMHG 2CHAC 2CK3D 2CF9H 1VJ9U 3P17H 1CO7E 4MQAA 2KAIB 1BMAA 1VZQH 2FI3E 2A32A 2J34A 3SUFA 1WDIA 1MKWH 5DKMA 1XKAC 1O2RA 3P92A 1PPEE 1C4U2 3RMNH 3R3GB 3SBKA 1QHRB 5C17A 2H9TH 3E0NB 2J94A 3FANA 4YM9A 1ORFA 2C93B 1A0LA 3O8RA 1EXFA 3Q3XA 4XFQA 5EQRA 1BA8B 1GWAA 5FCKA 1O39A 1YGCH 3IWMA 4H6SB 1MUEB 7LPRA 3RM0H 1GI8B 1KTTB 1LO6A 3A89A 3ZZ6A 1WCZA 1GBCA 3DCLA 2IOTA 2M5TA 3A7TA 4YXWD 2HALA 3SQHE 1OWKA 1IAUA 3H5CB 1ZMNA 1BJVA 4CR9A 3VXFH 1DLKB 1GMCF 2FP7B 3FO8D 4NG9H 2QXHA 3A86A 1GBHA 4DIIH 3OU0A 1NBME 2G52A 4WH8A 1C5TA 4FUFA 4NIXA 1FI8A 1V2PT 3A82A 3A7ZA 2B0FA 2Y5FA 1K0HA 2XBWA 2JETB 1XM1A 5EPYA 1KDQA 4ISIH 1F7ZA 1NU9A 1SFIA 3AAUA 1LCYA 1TGCA 3U8OH 3A7WA 4A1VA 1BUIA 1AQ7A 3BIVH 9ESTA 1BTPA 2NU3E 1S6HA 1QBOA 1BT7A 1TA6A 4ZCNA 5LH8A 1LVBA 3GY7A 3NZIA 4WY3A 1OXGA 2DE9A 2FPZA 2QC2A 1P04A 4YLQH 2D8WA 1O30A 1VCPA 3NUMA 3SJOA 3GCTG 2P16A 5CHAB 4K8BA 1LDTT 4ZH8A 3V12A 1MCTA 5EW2H 4ZMAH 2BXUH 5J4SA 1HCGA 1BRBE 2IPQX 3AAVA 2RA3A 1P09A 1TA2A 2IJOB 1A4WH 5C1YA 1CGIE 2GDEH 2Y5HA 2K1QA 3MNCA 4FU7A 3TH2H 5CE1A 2FZZA 1COWD 1KLJH 1O3HA 3OYPA 1SGYE 5IDKA 1QIXB 2SFAA 1J17T 5FX6A 4Z0KA 1ELFA 1P3EA 3PM3A 1WAYB 2NU1E 2ZWLH 1HJ8A 3FFGA 2GJGA 3PRDA 1GJ9B 4YT7H 4K5ZA 1GHAF 4UE7H 5EODA 2KZ4A 3GS9A 2TBSA 2ZDNA 1JWTA 1AMHA 1W0YH 1BDAA 1HLTH 1K2I1 4MDSA 5C94A 1ELTA 1TWXB 3RXJA 1GI1A 2FTMA 3GY3A 5EXNA 2EY4C 4BNRA 3O8DA 1ANEA 2JETC 1O2OA 4OGYA 1S81A 1K1IA 1EB1H 1LHFH 5F8ZA 2GV6A 1TNHA 1GDUA 2VWMA 1Y5UT 4CRCA 1KDQB 2ALVA 5E0HA 1E1QD 1GBEA 3P8FA 2R9PA 3RXUA 4TSFD 3URDA 3FN8A 3RXQA 1ZSKA 1V2QT 1ZJKA 3LT3A 1O33A 1UK4A 1VJAU 1TPOA 2VWLA 1O5CB 3K2UA 2KX4A 5CHAC 4HI3A 3BSQA 3I78A 4ZKNU 1OYTH 4TT3D 5HIZA 3SGBE 5DN6D 3UQOA 4MTBA 3E6PH 1GI9B 2HNTF 3M5MA 1S6FA 3RXDA 3LU9B 3CS7A 1ZPZA 2STAE 1T8MA 4ZUHA 5HIYA 5T1VA 4BAKB 4FUBA 1RFNA 3S9CA 5GXPA 1AVXA 4WWYA 4NFEA 1E35B 1DXWA 1TBZH 1E0FD 4YESB 1WUNH 1OS8A 1TX8A
chains in the Genus database with same CATH topology
1AY6H 1H9LB 2ANYA 1GI4A 2C8YB 3LH3A 2Q1JA 1SLWB 5A8ZA 3T2NA 1C1VH 2XBYA 1V2ST 2WPHS 6CHAB 5C5OA 2FODA 1EZUC 1SVPA 2WPLS 1TGTA 1ZTLA 1CA0B 4X1NU 8KME2 1ZHRA 2FIRH 4A7IB 2OUAA 2FS8A 2BQWB 3LC3A 4AYVB 1P05A 2VNTA 1G3EA 3RXGA 2I6QA 1K28D 1OKXA 1OWEA 1BQYA 1TX7A 2GKVE 1ZHPA 2UUJB 4GAWA 5TCAA 1HAVB 1NROH 3MHWU 5JBBS 4XDEA 3SNEA 1Q3XA 1IHSH 1VCWA 1CHOF 1S82A 1N6YA 3A88A 2FOGA 3TU7H 5DJ7A 3MMGA 1C5UA 2FYRA 1EPTA 3HKIB 3EE0B 2Y80A 1EOLA 1O2LA 1QY6A 1V2TT 2FLRH 1QB6A 4BXWA 2IPHA 3AW1A 2VB0A 2BZAA 4INKA 1SGEE 5GIBA 5A2MH 1EB2A 1SGTA 1W8BH 2HGTH 3Q3KA 1LQDB 2LNCA 1O2PA 2PKSB 1VITG 1GCTB 4JZIA 1JMOH 5GDSH 3TNSA 3KQBA 3JZ1B 4R0IA 1LTOA 3WY8A 3ZZ5A 2J2UA 1P12E 3SORA 1FNIA 3QX5H 3TH3H 1YPGH 1P2NA 3PMAB 2Y81A 1DVAH 7GCHG 1S5SA 2YNAA 6CHAC 1GHBF 2QXIA 2GDDA 3RLWH 4ZHMU 3I29A 3UNQA 1DUEA 1NS3A 2AMQA 1Z1IA 3GCHB 4A1TA 4X8VH 2XW9A 2W7UA 1EJAA 4CRAA 2V6NA 1EAUA 1SGNE 1TOCB 1IQNA 2ZGHA 1G37A 2BD4A 2G8TA 2SGDE 2FX4A 2SNVA 1AWHB 1NZQH 5BRRE 1NRNH 1YPJH 2WUBA 1HPGA 3M7QA 1HNEE 3ZZCA 4X6NA 4ABEA 1BHXB 4RKJB 1HAPH 2ANMH 4HTCH 1WQVH 1EPTB 1HGTH 4X8TH 3ZV9A 1S84A 3PLKA 3MNBA 3V7TA 4X2VA 4ABHA 4X6MA 1C5ZB 1KYNA 2PKAA 1GCTC 2BOHB 3SI3H 1C1NA 1OP2A 3GDUA 1B0FA 3LOXA 1F5LA 1TNIA 2SNWA 3SQEE 3ZZBA 3UR6A 4DVAU 2PWXA 2ZGCA 4Y0YE 2C8ZB 4J2YB 4AFQA 3A8CA 3A7VA 4FU8A 4O3TA 1FIZA 1NFUA 3GCHC 1HAGE 3SNDA 1CQQA 5FAHA 3SHAH 1PPGE 1DS2E 1TNGA 2H9EH 1QQ4A 2FOEA 1NFYA 3K9XB 1C5WB 4ZKSU 2ZFRH 3M3VA 3QLPH 5E0GA 1K1NA 3EYDA 3RUOA 2FI4E 2FO9A 1BTXA 3QN7A 1GL1A 2W7SA 2XXLA 1G2LA 3A7YA 1OX1A 3GCOA 4A6LA 2GTBA 3KIDU 3RXSA 5GWZA 3SGAE 2F9UA 2G00A 1DANH 3AVZA 1TNLA 4Q80A 2WPIS 1EPTC 3RU4D 1W0ZU 1GHAG 3ZVGA 1AKSB 1H9IE 3ZVBA 1XXFA 1ZMJA 2XBVA 4UEHH 4MNWA 4O97A 3T25A 5T6GA 1DXPA 1FZZA 1UVTH 4CHAC 1GHZA 1D6RA 1AO5A 1L0ZA 1Y3YA 3MO9A 1X7AC 1B0EA 2BDHA 2ZI2H 1O3NA 1OOKB 1Y5BT 2Y7XA 3BTQE 1TYNA 3FVFB 2PKAB 3MU4A 1LPZB 1TPSA 1SPJA 4NGAH 4QT8C 1DY8A 1SGDE 3U69H 1HAHH 3UNRA 2GGVB 1G36A 1O5GH 1FY4A 1QCPA 4AGJA 1D3PB 2IN2A 2A2XH 2PV9B 1PQ7A 1N8OB 4TPIZ 2WYGA 1UO6A 1ELAA 2BY6X 1AE8H 1E34B 3GDSA 2VINA 1C1PA 2Q6FA 2PW8H 2VWOA 3ESTA 1JRSA 4TYDA 1VITH 2F9OA 4TY6A 3D49H 4NFFA 2XBXA 1S0RA 1QQUA 3RXRA 4NWLA 2QF0A 1O3IA 1ANDA 6ESTA 5EQQA 4YZUA 2R2WU 3RC5A 4U30A 1P03A 1O3AA 1TONA 2XWBI 3N7OA 1MKXK 3RU4T 3UR9A 4IMZA 1SGIB 1C2LA 2A4QA 1O35A 1O36A 1TGBA 4WMFA 2OC0A 1P57B 1TRMA 1RGQA 2F3CE 2NU2E 4GSOA 1EP6A 1L2EA 1RTLA 3EAJA 1KLIH 1EZSC 1XVOA 2BLWA 3T5FH 4U32A 2BHGA 1C5RA 3M7TA 1O2HA 1LVYA 1FY5A 1BIOA 1HJ9A 1O2ZA 3BTTE 2OP9A 1YPKH 1C9TA 5F03A 1LHGH 1W7GH 2PSXA 1MQ6A 3BN9A 1CHOG 1FY3A 1SHHB 3KF2A 3RMMH 5DP9A 1GI3A 1OWDA 4O03A 1MBQA 4FUIA 1OSSA 3DT0H 1S85A 1C1WH 3F9FA 1PFXC 1P11E 3B9FH 2J38A 2FOBA 1JIRA 1C1SA 1OWJA 4AORA 4SGAE 3EDXB 1VGCC 1D6WA 1FPCH 2QXJA 1NRRH 5C1UA 1ESTA 2YOLA 3LPRA 3TH4H 1ESAA 1IHTH 4DJZB 3S9BA 3GISB 1KXDA 3DFLA 4IS5A 1O38A 5EW1H 1WQSA 1W12U 2WPKS 2ZHFH 3JZ2B 3SUGA 1AUJA 2PUXB 1C4Y2 5JB9S 1L1NA 1UJ1A 1DSUA 2Z94A 1ANCA 1KXFA 3ODDA 5JPMH 1GHBG 3ATLA 3U98H 4DY7B 2A2QH 1NT1A 5DP4A 1WOFA 2FYQA 4I8KA 1HAYB 4AFSA 4AGKA 3RM2H 2G4TA 2B9LA 4WXVA 1E36B 1UCYK 2R0LA 5FPYA 3RMLH 3SJ9A 1MTVA 2OD3B 1G2MA 4SGBE 3SU1A 2JH5D 3L6PA 4KKDA 1UCYE 2BLVA 1NRPH 2QXGA 1C1OA 3A8BA 1UTNA 1XUGA 1K1MA 1GBIA 3ZVDA 2YNBA 1BCUH 5FX5A 1BTUA 1PQ5A 1GG6B 5DP3A 1ZGVA 3UOUA 2O8WA 1FN6A 1EQ9A 1W2KH 3SZNA 2XRCA 2J92A 2ZQ2A 2GZ7A 1MMJN 4X8UH 4Y0ZE 4BTTB 1O2SA 3VPKA 3ATWA 4HGCA 1YM0A 5BPEA 3O8BA 3B8JA 3Q3YA 1TE0A 4NIVA 4KP0A 1A5HA 5EGMA 1Y3VA 2ASUB 2AIQA 5AFYH 1BTWA 3Q00A 2FXRA 1C5SA 2H9HA 3RP2A 3SN8A 5AVDA 1GHXH 5L6NH 4YO9A 1SR5C 4FVBA 1GCDA 3MO6A 1P2MA 1XKBC 1KXBA 2TIOA 1C5NH 2ZU4A 1Z1JA 3QZRA 1O32A 4JCNA 2P94A 4BAOB 4KELA 1AD8H 7KMEH 4AFZA 3BTKE 3PYHA 3ZYEA 4K3JA 1THRH 1O2WA 4JZ1A 3PTBA 1O3DA 1ETTH 2B5TB 3VB7A 1AIXH 1HJAB 2SGPE 5B6OA 1GPZA 4K8YA 2GCHF 1QA7A 2QY0B 2ZECA 3E8LA 1NRSH 3HGPA 2O8UA 3OSYA 1UTLM 1JIMA 3RXVA 1MKXH 3SO3A 2DUCA 4ISHH 4ISOA 1Z8RA 2ZPSA 3D23A 4B2BA 4OS1A 2F9NA 1GG6C 1UVSH 3W95A 1VR1H 5AHGH 1ABIH 4NA7A 3IG6B 1AFEH 2ZKSA 1GJ7B 3LJJA 1ZHMA 3L3TA 3QDZB 2ZU1A 3BEFB 2AIPA 2HVXA 4D9QA 3BTME 4Y8XA 1UVUH 2HOBA 1QJ6B 3U8RH 5F8TA 5EU8A 4INHA 3KNXA 3V13A 1QJ1B 3SUEA 4E7RG 3P8NA 1K9OE 1BTYA 4ABIA 5FBIA 1E37B 1TPPA 3LGTA 1HRTH 1ARCA 1QL9A 1GHVH 1OP8A 2ANWA 2J95A 5E0JA 5FHTA 3QGNB 1PYTD 1HAVA 1Z7KA 2JH6D 1FAKH 1FY8E 1KLTA 3F9HA 1HAXB 4AOQA 1TOMH 3URCA 4FUGA 1GI2A 1ETSH 2FOCA 1PQAA 3A84A 2A7JA 4Q7ZA 5EOKA 3EQ0H 1HJAC 1DWDH 1ZOMA 4O9VA 4J1YA 3LGYA 2J9NA 1XUIA 2BD3A 4VGCB 1C2MA 1UMAH 3BIUH 3TJOA 2ZDLA 2BD7A 3V3MA 1IQMA 2OC8A 4K1EA 2G5NA 1DSTA 1YCPM 2FX6A 4X2YA 3RXLA 4BTIB 1CU1A 3P95A 1A5IA 1F5KU 2WV5A 1GJ4H 3PO1B 4FUCA 1UCYH 2GP9B 1GL0E 1EZXC 1BRCE 4THNH 1IQHA 2JKHA 3MH7A 4BAHB 1D3TB 2ZG0H 4ZHLU 5DP5A 3QO6A 3ELAH 4JK5A 4CBOA 3VB5A 2B7DH 3GDVA 3SU3A 1OPHB 1DWCH 2PGQB 5LPFA 1GVLA 2VVUA 1V2JT 3BTWE 1T31A 3MOCA 1CGJE 3T29A 5E2PA 3ENSB 2W3KA 3P6ZB 1GI0A 2BDGA 1THPB 1BOQA 1BRUP 2RCEA 1KXAA 1SOTA 2BB4A 1N1LA 1HIAA 5JBAS 1U6QA 2ZU3A 3RLYH 1EZQA 5LGOA 5K7RA 1GJ8B 1ZLRA 1XUHA 3SU4A 1H1BA 3AW0A 4Y79A 2ZU5A 3KEEA 1QBNA 1RTKA 1EASA 1HDTH 3BTDE 1BBRE 1G3BA 4B73A 1O34A 5FXLA 1CGHA 2BLQA 2BY7X 2QIQA 3IITA 1FY1A 2XCNA 2Y82A 1TALA 2W5EA 1JRTA 3VFEA 4ISNA 1DT2A 3A80A 5A8YA 3PB1E 4OGXA 1MTWA 2WINI 4IW4E 4NA9H 2UUFB 3UWIA 1TBRH 2P3TB 4OS2A 1TMUH 3C1KA 2ULLA 1O3FA 4ZKOU 3MFJA 1SGFG 2BLOA 2ZFSA 3FP8E 3RXHA 1LHCH 4U2WA 1GBDA 1AVWA 3PO1C 4I8JA 2Z9JA 4BAQB 1C4V2 3GICB 3P8OA 3SGQE 1P9UA 5G4BA 2BM2A 1LHEH 4X6PA 1MZAA 1NTPA 2BQ6B 2SGFE 1L4DA 4JYVH 1DM4B 1KY9A 2OC1A 1MAXA 1P02A 3HKJB 1C1UH 2BD8A 1JBUH 3UREA 1BMMH 1C2HA 1O5FH 3BV9B 3W94A 2FMJA 1MZDA 1A1RA 3MI4A 2BDYA 3SV8A 1AZZA 4ISLA 2ZC9H 1QR3E 1GBTA 1TFXA 1TIOA 1P2QA 2F91A 1CA0C 2ILNA 4UFGH 1GJ6A 3LIWA 4AZ2B 1K1JA 3PLPA 4KTUA 2VH0A 3SJIA 1QBVH 1V2LT 3PWCA 5CMXH 4DOQA 1Q31A 4HFPB 1K22H 1Z8GA 1HIAB 2P8OB 2Y7ZA 3HATH 2Z9GA 1O2QA 4K1TA 1FQ3A 1TQ7B 2XCFA 3PTNA 4CRFA 2HLCA 1A2CH 2BYAX 3LC5A 2AS9A 1T4UH 2ZEBA 4K1SA 2ZTZA 2RA0A 2ZDKA 3VB6A 2VJ1A 1NO9H 1LQEA 1RIWB 1C5PA 2D2DA 1YLCA 1AKSA 3M5OA 1Y5AT 5E2OA 3T26A 1W14U 1GVZA 1DY9A 5GPIB 2R0KA 2B8OH 3KHVA 4BAMB 1SFQB 1NM6A 3E1XB 2TPIZ 2AERH 2PKSC 4WH6A 4Y7BA 4X2XA 1V6DA 2GVFA 2QYIA 4LK4A 4IGDA 1K1LA 1P2OA 1S0QA 2AYWA 1HAIH 1ZGIA 1DUAA 2A4RA 1Y3XA 2FOMB 1Y3WA 5HM9A 1WSSH 4MPVA 1YPHC 1AN1E 1UHBA 2A5IA 2VU8E 1V2MT 3ZZ4A 1P3CA 4GCHF 1ZMLA 2GCHG 4WMEA 1V2VT 4M7GA 1MH0A 1J15A 1SQTA 4Y6DA 1C2GA 2PGBB 3MU5A 2FESH 3EA7A 1YC0A 3MTYA 1TPAE 2BD2A 2GZ9A 3LKWA 1ELBA 5TCCA 3UIRA 4IN1A 2ZGXH 1O3KA 3D65E 3LJOA 2O8LA 1EOJA 4NA8A 5ETXA 1J16A 4WJG2 1L4ZA 4FUDA 1KIGH 3M37A 2TGAA 3Q77A 1PPCE 2ZGJA 1HUTH 1GBKA 2QCYA 3T62A 1G32B 1AUTC 3MU1A 3RDZA 2TGPZ 1TMBH 1XMNB 4D7FA 3ZVEA 1TBQH 1O31A 3ITIA 4AG2A 1D3QB 1C5YB 3SU0A 1RIWC 5DGJA 1V2OT 4F4OC 4MG3A 3BG4B 3ODFA 3T27A 2ZHEH 4R8TB 2EEKA 1A61H 1C1TA 1GI7B 3NK8A 2BOKA 2XC5A 2BVSH 3E91A 4IMQA 2EC9H 1WYKA 5A0BA 4GPGA 4YT6H 1PYTC 2LPRA 3UQVA 1F0TA 2BY8X 2ALPA 1Z8IB 2HRVA 3S9AA 1MTNB 1MKWK 1NY22 1KXEA 4Y8YA 2GMTB 4A5TS 2CXVA 4K60A 1XX9A 1RXPA 4ZAEA 2CMYA 1SLVB 3OX7U 2VIQA 3M61U 1OYQA 5PTPA 3TK9A 5AF9H 1EAIA 5JYIA 3VEQB 1Q2WA 2AGEX 2AGIX 1UHBB 8GCHG 3TLOA 4X6OA 1SHYA 1CHGA 2PLXA 4XBBA 2V0BA 3ATIA 1K21H 1TGNA 2BQ7B 3L33A 1O2YA 3AASA 1UVOA 2ODYB 3SU5A 1AU8A 1UTQA 2V35A 3ZZ9A 1V2WT 2A4OA 1CE5A 3TJVA 5T6DA 2BMGB 5E8EH 1GBMA 3MU0A 4ESTE 1CSOE 5A0AE 3BEUA 5HMAA 4MNXA 1H4WA 1O2IA 2CF8H 3QTOH 4BANB 1CA8B 2OBOA 4CR5A 4DCDA 5JDUB 2DE8A 4FUJA 4NZQA 1XVMA 3LGUA 1O3BA 2GX4A 1TLDA 5DG6A 2ZHWH 3KQDA 5I46H 3GY2A 1V2UT 4E06H 3UY9A 4I8LA 4XOJA 4LZ4B 2A7CA 3K6YA 3BG4C 1XUFA 5EXMA 2ZDMA 1ZSLA 3PROA 1O5BB 7ESTE 2ZFTA 4ABFA 2Z3CA 3HPTB 1OWHA 3RC4A 4H4FA 2FTLE 5DK1A 1D9IA 1RJXB 4E7NA 3RC6A 2EI8A 3TJNA 1Z8JB 2J4IA 1O2XA 2GMTC 1WTGH 3HK3B 4LZ1H 1C5LH 3LGIA 2PTNA 4JZEH 2AGGX 1FJSA 1N8OC 1A0HB 3B23B 4LXBH 3ZZ8A 1RTFB 4JYUH 3CS0A 2OC7A 3GY6A 1TX6A 1RS0A 1C1RA 2HNTC 3M5LA 4IC5A 2EI7A 2GT8A 4MPUA 1HXFH 3I77A 1LVOA 1H8DH