1BJVA

Beta-trypsin complexed with appu
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Oxyanion-mediated inhibition of serine proteases.
pubmed doi rcsb
molecule tags Serine protease
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bjvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bjvA02
3K6YA 2CV3A 2Z9KA 2ZDMA 1YCPH 1UTQA 4GPGA 1G2MA 4XBDA 3A86A 2PWXA 2XXLA 1UVOA 6ESTA 3SU4A 3E1XB 1T8MA 4KTCA 1ANCA 1WTHD 4UFEH 4UFDH 1BITA 1TE0A 2BDHA 1O5BB 1Y3XA 2P8OB 1V2OT 1YP9A 3KIDU 3RMOH 4CHAB 1GHZA 1VITG 2BB4A 2Y81A 1ZSJA 1GHAG 1HV7A 1IQLA 2Q1JA 1XUGA 1SLWB 1MTUA 2R0KA 2QV1A 3HKJB 4AFQA 2GZ8A 1GG6C 1F5KU 1QFKH 4E05H 3MH4A 2ZG0H 3DFLA 1AE5A 1SQOA 2V3HH 3UTUH 3STJA 2PUXB 1HBTH 1NRQH 3M37A 5DP4A 1PPHE 1NRSH 2A5AA 1WYKA 2G4UA 2ZGHA 1L4DA 3MU0A 1ZR0A 1BRAA 1BTWA 3MMGA 2UWLA 3ESTA 1C5SA 2BOKA 1O2KA 2RCEA 4IBLH 1NM6A 2QAAA 1GBFA 5ESBA 2WINI 1TABE 1FLEE 2G4TA 5FXLA 1C1WH 1O2MA 3TITA 2ZGXH 1N1LA 2M5TA 3QGJA 3SU2A 4D7FA 3AVZA 4WXVA 3RC5A 1NFUA 1EXFA 1O3FA 4Q80A 4IC6A 1LKAA 1G37A 1AZ8A 2R2WU 3GOVB 1GJ9B 4Y6DA 4B2AA 1AB9C 1SLUB 1CVWH 1L2EA 3FANA 4OS6A 1MKWK 1SB1H 4A7IB 4FUHA 2QXJA 5JYIA 1SOZA 2BLQA 1QTFA 3ATMA 2PUQH 1BTXA 1UK2A 3HKIB 4BTTB 1ZHRA 5JPMH 2FOGA 2C8ZB 1O3KA 1V2LT 3LGIA 1SGYE 1NS3A 2F9VA 1DWBH 4TPYA 2PLXA 3WY8A 2AGIX 4UEHH 4TY7A 1HB0B 1DLEA 1V3XA 2NU3E 4ZKRU 1QB1A 3MNXA 5AF9H 1MUEB 1TQ7B 3B9FH 3OU0A 3AAUA 1GI2A 3SV8A 3A82A 1IAUA 4IS5A 4WJG2 1ANBA 3AASA 3Q3YA 1C1TA 1D6RA 1B7XB 1DANH 1HNEE 1Q2WA 1YYY1 2CXVA 3DA9B 4CRCA 5JBAS 3OSYA 3SJIA 1QY6A 2V35A 4A92A 1YPEH 3GCTG 1F7ZA 1X7AC 2ZFRH 3O8RA 1PPFE 1V2ST 4YLUA 5C20A 3VGCC 8LPRA 1NROH 4XFQA 3DT0H 3LIWA 2P16A 1SGTA 1SL3A 1V2KT 1ZLRA 2ZQ2A 1K21H 1YKTA 1SQAA 1TBQH 2G5VA 3GCTF 1SGPE 4GUXA 1O3DA 2VJ1A 2ODPA 1QQUA 2VWNA 1LQEA 2ZHEH 3T28A 1BHXF 4Y7BA 3RXPA 2PGBB 2Z9GA 4FVBA 1O3AA 2ZC9H 3A7WA 4A1XA 2PTNA 1G30B 4D76A 5DP5A 4VGCB 3U8RH 4ISHH 2F3CE 1O36A 1PQ8A 5DGJA 1HXFH 1MTSA 5F8XA 2ZI2H 4GCHF 1RJXB 3KQDA 4B2CA 2PFEA 1W0YH 5EGMA 1P9UA 3QN7A 2HWLB 1OWDA 5DP3A 5L2ZH 1GMHG 3P92A 4CREA 1AE8H 3LPRA 3Q3XA 5DP8A 1A0HB 1O3BA 3ZVEA 1H8IH 1SLXB 2O8MA 3M5OA 3ZVDA 4Y0ZE 2Z3DA 4D8NA 1WQSA 2VVCA 1XUIA 4DOQA 5F8TA 2FLBH 8GCHF 4YO9A 5LPFA 1O30A 2C8WB 1FN8A 4JCNA 2A31A 2UWOA 2G52A 1KIGH 1GHBF 1RTKA 1TFXA 5DP9A 4DURA 1GG6B 1ORFA 2OC7A 2JKHA 2P3UB 3RXEA 3PB1E 5A2MH 3RU4T 3TU7H 3E91A 2A0QB 1XVOA 1HJ9A 3E6PH 5C1UA 2BD8A 1GMCF 4K60A 1DWCH 2V3OH 3UUZA 4K1TA 4AYVB 1GDQA 1GVKB 1LPZB 4JZFH 1GI4A 2HOBA 5J4SA 1DLKB 3ZZ4A 1GDUA 3C27B 1JRSA 4D9QA 1FONA 1JIRA 1C4U2 3UNRA 3JZ1B 1A7SA 2O8TA 3MFJA 1IQJA 2BVSH 2GCHG 5EQQA 3ZV9A 1BMMH 2BDIA 3OY5U 1THPB 2STBE 5C3NA 2BY8X 1Z8JB 3TJNA 1HJ8A 5EG4A 4ASHA 1DSUA 4JK6A 5EW1H 2XWBI 1YGCH 3S7KB 3A7XA 4X6NA 1AB9B 3F9HA 4FU9A 3ZV8A 1C5UA 1Z6JH 3LDXH 4FUFA 2RA3A 1ELDE 4WH6A 3MHWU 1GI8B 4ZXXH 4K1SA 1ZOMA 2Z3CA 1A0LA 5EQSA 2BLVA 1YLCA 2HNTC 1IQKA 3MOCA 5JBCS 1OPHB 1LKBA 1XXDA 2TBSA 2STAE 2QYIA 2PKAA 2YNAA 3QZQA 4Q2KA 1S6HA 1L0ZA 4D7GA 1C2DA 2J9NA 1BDAA 4U30A 3ZVCA 1TPSA 1NTPA 1QRZA 4NZLA 2HVXA 1W3CA 1H9HE 4IN2A 1VCPA 5J4QA 1TNHA 3ZZDA 5JB8S 3UQVA 4Y76A 1C5XB 2BY9X 1CQQA 1VGCC 2BD5A 1RTLA 2VGCC 2FXRA 5E0JA 4LXBH 2ZCHP 4AORA 1C1VH 1UTPA 4FUEA 1BBRK 1MAXA 5DO4H 1C2JA 1NRRH 3SV7A 4H6TA 1EQ9A 3SJOA 3VGCB 4XSKU 1EAIA 3LONA 5EU8A 1DDJA 2ZECA 1TBZH 2ZIQH 5GWZA 3SNBA 1QBNA 1GI9B 4X8UH 1GBAA 1TMUH 1ID5H 1UVTH 1TX6A 3ATLA 4JZ1A 2FLRH 5GDSH 3SO3A 2PSXA 1GBCA 2BXUH 4NA9H 2TGAA 1O5EH 1W10U 5DK1A 2FS9A 1JRTA 1C5RA 3QDZB 4DCDA 3A83A 1EZXC 4TY6A 1J15A 1ZSLA 1ELVA 4JK5A 2OXSA 3ZZ6A 1KDQB 1SGFG 3MO6A 2VINA 4RN6A 1CGIE 4LK4A 1O3CA 4SGBE 3IITA 1A5IA 1GGDC 3LOXA 3A7TA 1HAZB 2GGVB 3HPTB 4OS4A 2QGRA 2Y7XA 2TGTA 1HAYB 4JYVH 2BDCA 9LPRA 5A0AE 5DPAA 1C9TA 2A4QA 4UFFH 2GT7A 1G2LA 1TNLA 1GJAB 2B7DH 2AIQA 3M5NA 1W0ZU 2GT8A 1EPTA 1VJ9U 4Y79A 2HGTH 4MNXA 3W94A 1C1NA 5E0HA 2Q6FA 1Z8GA 1M9UA 1VZQH 3ZZ5A 2VIOA 2FZZA 1T31A 1JXPA 3UR9A 1Z71A 4NWKA 1WSSH 1Z8IB 1ZPCA 2JH6D 1XKAC 3MNBA 2BD4A 5ABWA 1A4WH 2LNCA 3F68H 3V0XA 5GIBA 3TH2H 1PPGE 1FY4A 5PTPA 1DVAH 3BTGE 3KHVA 2FMJA 2QN5T 1BRCE 4ABJA 3HATH 4MPUA 1LPGB 2D8WA 1UJ1A 1MTNC 1E38B 1GPZA 1O35A 1AI8H 2ZGCA 2NWNA 5EODA 4QT8C 3SV6A 1ZJDA 4LZ4B 4KTUA 1A1RA 2R3UA 1SR5C 2Y82A 1EB2A 4Y8XA 2G5NA 6CHAC 3KQEA 4GAWA 1N6YA 1K22H 1AUJA 1BMAA 3GYMA 1O2ZA 4MLFB 4DGJA 3H7OA 1K1NA 2VIDA 4PROA 4INHA 2ZFFH 1KLTA 2Y6TA 4Y8ZA 3DHKH 2FTLE 3QGNB 1B0FA 1C1OA 2H6MA 5EPNA 1C9PA 4Y0YE 1GI6A 3PWCA 4MPXA 3RDZA 1LO6A 2CJIA 4MPVA 1JBUH 1P0SH 4FUBA 1HPGA 2FWWA 4B76A 3A8CA 3VB5A 1ZTLA 4YOJA 1DOJA 3NWUA 1OKXA 3TJOA 2ZTYA 1QA0A 3E8LA 1SQTA 2SFAA 2F9UA 4GHTA 2UUKB 1O2XA 1T8OA 1VGCB 2VGCB 3BG4C 1L1GA 1NC6A 5TJXA 1AVXA 1O32A 3ENSB 1C5OH 3Q00A 2ZF0H 4XOJA 3SUDA 2A5IA 3PO1C 4B1TA 2HALA 3LH3A 1EKBB 1QL9A 1TX7A 4R8TB 1LVOA 2GD4B 1LDTT 2ZU2A 1O2GH 1P01A 2ZU3A 2TPIZ 1NU9A 3F1SB 4TPIZ 1V2WT 5HM9A 1TA2A 4I8LA 5TCCA 2GMTC 1MQ6A 3SN8A 1TOCB 4BAOB 1XM1A 2ZFQH 2ZPRA 4BNRA 5HXFA 1OYTH 4BXSA 4TWWA 1W14U 3PLBA 6GCHF 1SGDE 3ZVFA 5EOKA 3T27A 3VFEA 1PQAA 3D62A 1BTZA 1NFYA 2BY7X 3RXFA 1LVBA 2A5KA 3M7TA 4X6PA 2FM2A 5JBBS 3TJUA 1CHOF 3MH5A 1XVMA 2CF9H 2XTTB 4ZKOU 3AAVA 1GGDB 2DUCA 2Q6GA 3F9EA 1ELEE 1VITH 5A8ZA 2QA9E 1YPHC 1YF4A 1FUJA 1IQMA 4I31A 2H2ZA 3BF6H 3A7ZA 3M5MA 3T5FH 3RXHA 4UE7H 1SGRE 2PHBA 1H4WA 2GDDA 1EASA 2VB0A 3V7TA 1EAXA 2J94A 3RXCA 3HGNA 5FCRA 1QRXA 2FOAA 2OC1A 4UFGH 4ABAA 3QX5H 5FHTA 1O3MA 4FU7A 5GCHF 3MH6A 1SG8B 2VIWA 1GJ8B 5HM2A 1E34B 3U1IB 3Q3KA 2V0BA 1FXYA 4Y11E 3PV4A 1MTVA 5DG6A 1P06A 1HIAA 2QF3A 3MNSA 3A87A 1FV9A 1O2WA 1MKXH 1SGFA 3NXPA 1TPAE 2EA3A 3SUGA 2NU1E 2XBWA 1XKBC 4I8GA 1GBIA 3M36A 2EI8A 1MZDA 2VVVA 3ELAH 2CN0H 4A5TS 2THFB 4FU8A 8KME2 3GDUA 2OBQA 2AYWA 3TIUA 1UO6A 2WUCA 4HGCA 2ZKSA 3P70B 2AH4X 1J14A 1OWKA 3H7TA 3CS0A 4IN1A 2VIVA 2QF0A 1O31A 4LOYH 1TNJA 4Q7YA 5A8XA 4CBNA 3GYLB 1O3NA 1UVSH 1TB6H 1AWHB 3P8OA 3ITIA 4DJZB 3GY7A 5E8EH 3RLYH 3BTTE 2B8OH 3M61U 2VWLA 1TRMA 2BYAX 1GJDB 3SOSA 1F5RA 4R0IA 4MTBA 5K7RA 3T29A 3B8JA 3SI3H 2PW8H 5E2PA 2SNVA 1PPBH 3IWMA 1TIOA 3TK5A 3R0FA 5EXMA 2PR3A 3OYPA 3RUOA 2P95A 1NY22 3UFAA 1BRBE 1TMTH 2FIRH 1O37A 3BIVH 4BAHB 4ZAEA 3BG4B 4FUGA 4XDEA 1YCPM 5FBEA 1FPHH 1NT1A 1U6QA 4GSOA 2BD7A 5GPIB 2OD3B 3PO1B 3TGJE 1OWEA 2J95A 2ZPSA 3MU1A 1Y3WA 5A09A 1SOTA 1Q31A 1EUFA 2C3SA 2FPZA 2PKSC 1MCVA 1MD7A 2NU0E 5HYOA 1KY9A 2GMTB 1CT4E 4OS2A 3BV9B 5CHAC 8ESTE 5HMAA 4AFZA 1OXGA 2Y5FA 2V6NA 4RKOB 4WVPE 1RS0A 1MKWH 4DY7B 3SQHE 4K3JA 1O3EA 1KTTB 2A2QH 2PTCE 3SJ8A 1GDNA 3EA9A 2AERH 2A4GA 1GJBB 1BMNH 1RXPA 3BTWE 5DJ7A 4AOQA 1RRKA 3SUFA 4AGKA 1O2TA 4MQAA 4OGYA 2WUBA 3S69A 4NZQA 2A4OA 4Y8YA 1ESAA 3RXOA 2YNBA 1NESE 4WXIA 1T32A 1KLIH 5AHGH 1O33A 5C1XA 2BD2A 1V2VT 3IG6B 4XBBA 2DE8A 3F9FA 3FP7E 2ZGJA 2D26C 4GVUA 2IN2A 4AFSA 2FYRA 1QRWA 4AB9A 4GCHG 2BHGA 2UUYA 4K2YA 1K1IA 5EXLA 1QQ4A 4Y7AA 1S0RA 2F9NA 1EB1H 1QR3E 1GL1A 4JMYA 4WH8A 3LU9B 3LKWA 1V2TT 2H1UA 4TWYA 4IMQA 5DP6A 1V2RT 3TGIE 1BRUP 2A7JA 3FP6E 3GY5A 5B6OA 1HCGA 4KP0A 1P57B 1BTYA 3OY6U 1K1JA 3QZRA 8GCHG 1P9SA 1FMGA 4NA8A 1NFWA 1UK3A 1JOUB 1S5SA 3L6PA 2H9HA 1EPTC 1ANDA 1GHBG 2ZCLP 1AD8H 3K2UA 2A45B 1D3DB 3TH3H 1W12U 2C4FH 5DP7A 3UNQA 3H5CB 4DW2U 1AVWA 1GHWH 4I7YH 3URDA 2C8YB 4F4OC 4X6MA 1GMCG 1XUKA 3CS7A 4H4FA 1MD8A 4CR9A 3UQOA 1RIWC 3QK1A 2XBXA 3F6UH 3KN2A 4YLQH 1D9IA 3P6ZB 3PLPA 1O2LA 4JYUH 2G55A 4FUIA 1DWEH 1QJ6B 2B0FA 1CO7E 3RXRA 1DSTA 1O5AB 3MI4A 2BQ6B 3DD2H 4NWLA 1FDPA 3BIUH 1ZHPA 3TNSA 3CP7A 1C1UH 4BOHA 2ZFSA 1TQ0B 3ZZBA 1UHBA 5FBIA 2FOHA 2ILNA 1ELAA 2HNTE 4O3TA 3PTNA 1HFDA 1C4V2 2BVXH 4BXWA 1EAWA 2ZCKP 1LVMA 1XX9A 1P2QA 3ZZ3A 1SGQE 1YPKH 1EOLA 1QIXB 3U8OH 2A4RA 3CENA 4NSVA 5EW2H 2W7UA 3FVFB 4K5ZA 1O2PA 1YPJH 2ZWLH 4AB8A 4CRGA 1GJ6A 4WY3A 2QY0B 1V2MT 4F49A 2WPMS 1SPJA 1PYTD 3UPEA 1T7CA 2HNTF 2HRVA 2XCNA 2Z94A 2A1DB 4MPWA 1K1MA 4NFFA 1WQVH 2BDAA 1G3DA 7KMEH 3U98H 1P09A 1DICA 4B2BA 1TNIA 2VWOA 1QL7A 2ZQ1A 5I25A 1DY9A 3OTJE 2YOLA 2W7SA 1AFQC 1OWIA 3LGWA 2F91A 2KAIB 4X2VA 2R3YA 1CA0C 3SGAE 2A32A 2WV5A 2PKSB 3PM3A 4OS7A 1THSH 2B5TB 3SUEA 5C5OA 5CE1A 1DXPA 3TLOA 3GICB 3QTVH 4WWYA 5F6MA 3MNCA 1ABJH 5BPEA 2VNTA 1SGIB 1PPZA 1O2SA 1C5LH 1P05A 3MH7A 1EJNA 2WYGA 3SU0A 2FEQH 2P3TB 1ZSKA 2AMQA 3GCHC 4X6OA 5JB9S 2J34A 3SNDA 2BLOA 2F83A 3QLPH 1WCZA 1O2QA 1EOJA 2WV4A 3SHCH 4YZUA 3RMLH 1HAVA 2GZ9A 1VCWA 2G51A 3RXIA 4BAKB 2XBYA 2OP9A 1SFQB 1JMOH 1SHYA 1UTKA 1LHGH 1SHHB 2PV9B 1MU6B 1CA8B 1T4VH 1QJ1B 4FUJA 4ZHLU 1NFXA 1SGCA 4ABFA 2FI5E 3K65B 1Y3UA 1FJSA 4JYTA 2B9LA 2OTVA 5DKMA 1ZMLA 6LPRA 4Z0KA 1PQ7A 3SGQE 1D3PB 4ABDA 1GBBA 1BBRH 3FP8E 4Y10E 1QBOA 3RXBA 1XUFA 4AGJA 1DY8A 1P2MA 1MZAA 5G4BA 1SVPA 1QA7A 1AVGH 1UCYK 2BD9A 4CRAA 4OS5A 3TK9A 3SHAH 1K28D 2FYQA 1EPTB 2ZO3H 1GJCB 1IHSH 3VB3A 3SJKA 3VXEH 3MU5A 3TVJB 3MU8A 1YPLH 4AN7A 1S84A 2QXIA 1O2HA 4ISOA 1KXDA 2FODA 1O5FH 3QTOH 4KKDA 2PGQB 4KTSA 2W3KA 2AMPA 3RXGA 3AW0A 3QO6A 1XUJA 2BZ6H 1OP8A 1ETRH 1HAXB 3OX7U 1WU1A 4FUCA 7GCHF 1AY6H 3L3TA 3RM0H 3A84A 3MTYA 3UIRA 1O3LA 1B5GH 2VU8E 1AFEH 2XC0A 5FPYA 3C1KA 3O8BA 3ATIA 4DIHH 1D3TB 1GMDF 1QL8A 1RD3B 1C4Y2 4BTUB 1AKSA 1CBWC 1F0SA 4ZKSU 2AIPA 1MBMA 3LGTA 2J2UA 5T6GA 4X1RU 1TONA 2ALVA 2Z9IA 2SGEE 5A0BA 1HUTH 4AX9H 4WMEA 2JH0D 3ATKA 1P2OA 1SI5H 1D3QB 1THRH 2ASUB 2P59A 2BDYA 4BAMB 2XC4A 1UTNA 2ZFTA 1YM0A 2ZDNA 2W5EA 2HPPH 3RU4D 5CMXH 3SNCA 1K1OA 3O8DA 3BTHE 1GJ5H 3GDSA 1UTMA 4I32A 2OBOA 4A1VA 3M3VA 1E0FD 2QXHA 5L2YH 2XYAA 2G8TA 1Y5AT 4D9RA 1UCYE 1P04A 2P93A 1EJMA 2WPJS 2SGDE 2ZGBH 1C5TA 1O5CB 3S7HB 3P8NA 4Z6AH 4AFUA 4ABHA 1K1LA 4ABBA 3UWJH 1C1QA 3ZZ9A 1PJPA 3BTQE 3ZYDA 1CA0B 4HI3A 2ZEBA 1KTSB 2FP7B 2F9OA 2XNIA 2O8LA 2FTMA 3D23A 4B71A 1Y3YA 2FOEA 1J16A 1FPCH 1Z1IA 4X2YA 1LHEH 1WUNH 3LJJA 2HLCA 3ZVGA 2ZU4A 1FZZA 3A89A 4GLYA 4YT7H 4WF8A 3RXSA 1ELTA 1MAYA 1UTLM 1GI3A 3M5LA 1BA8B 4U32A 1HGTH 1W13U 2D2DA 3T2NA 1T4UH 1TRYA 3V12A 3P8GA 3SZNA 5K0HA 3PYHA 6GCHG 3GCHB 3HK6B 4UD9H 3I78A 2UUFB 4B73A 1KXEA 2GP9B 3GY3A 1MBQA 1LHDH 2ZHWH 4THNH 1LHCH 1HJAC 2OCVB 1AIXH 3KF2A 4B75A 3M35A 1KSNA 2WPHS 1L1JA 4MG3A 1OWJA 2XRCA 1CHOG 3PMAB 1Y5UT 3K6ZA 1GI5A 3RXVA 5C67A 5F03A 1NN6A 3KEEA 2SNWA 2VWMA 2CMYA 1LQDB 5GXPA 3VB7A 3MWIU 3GCNA 1C5WB 4O97A 4AZ2B 3BEUA 2Y7ZA 1Z1JA 1MH0A 1UK4A 2RDLA 2GDEH 4NIXA 1S81A 2FI4E 4MVNA 5ETXA 3RXUA 3S9CA 5ESTE 3TH4H 3RXDA 2PSYA 3A88A 2XC5A 4HTCH 2QXGA 3BN9A 3RXKA 3TJVA 1HAIH 1C2KA 1KXBA 1BIOA 1A0JA 2I6QA 1YPMH 1TALA 3VPKA 2O8WA 4X8TH 3UOUA 3ZYEA 1F2SE 1ARCA 1F0TA 1YCPK 3HK3B 4DT7B 2OLGA 3ODFA 3L33A 5GCHG 1AU8A 1O2IA 3R3GB 1AGJA 1INCA 1GHYH 1HAHH 2BTCE 1A61H 1TA6A 3ODDA 1GI7B 3KQCA 2VVUA 2CF8H 3S0NA 1TRNA 5T6FA 1TAWA 1CE5A 1TLDA 1HIAB 3P95A 1O0DH 1AN1E 1O3GA 2FX6A 5E0GA 3EA7A 4UDWH 1DT2A 1O2JA 3LGVA 4CRBA 2ESTE 3NPSA 4E06H 4CH2B 4SGAE 1YBWA 2ODQA 1P2JA 1P2NA 1V2NT 2WPLS 1F92A 1S83A 3RC4A 2GX4A 4A6LA 4VGCC 1TGCA 1IQGA 1CBWB 1BT7A 1Y5BT 4ZMAH 1Z8RA 1E37B 1DPOA 4JZEH 3M7QA 1WAYB 1BJVA 3URCA 5C1YA 3SU3A 1KXAA 2G00A 7LPRA 1TGBA 1V2UT 1MTNB 4IW4E 1QB9A 2BDGA 4NIVA 5FX6A 3HGPA 4ZKNU 1C5VA 1DUAA 1WOFA 4B74A 3EDXB 1HXEH 3EA8A 2FOCA 3MYWA 2I6SA 3SI4H 5EQRA 1C2MA 4ISNA 6CHAB 1TGNA 1NRNH 2R0LA 2GZ7A 3K9XB 1AUTC 2ZDVH 3RMMH 2ZU5A 2GVFA 1NRPH 1E36B 2CHAC 1VITF 2C93B 4CR5A 2ZNKH 2H5CA 1GHAF 1HAGE 2C8XB 1IQNA 9ESTA 1W11U 1TGTA 2BX4A 2R9PA 5H4IB 2EEKA 1FI8A 1F5LA 4ISLA 1ZPZA 2P3FH 1GBLA 2FO9A 4X8VH 5BRRE 1GVLA 1A5HA 3RU4E 3E3TA 1HAPH 1TWXB 4ZROA 1TOMH 1EZQA 1HAOH 1AZZA 1Y59T 2IPHA 1GJ4H 1QB6A 3NUMA 3AW1A 1Y8TA 1BQYA 1P2KA 3EYDA 1NU7B 1O38A 3FZZA 1P02A 1O34A 3UY9A 4FXGH 1A5GH 3A8AA 2AGGX 1XUHA 1O2VA 3PMBB 2QCYA 3GY4A 2C90B 2XCFA 3QWCH 1ZHMA 1BTHH 1EJAA 2W3IA 1PPCE 2J38A 4CBOA 3RXAA 3D65E 4NIYA 1FY5A 1FIZA 3D49H 2FDAA 1HJAB 4E7NA 4O3UA 2GKVE 3LH1A 4H42U 1CGJE 2Y80A 1BJUA 3T26A 1W8BH 4IC5A 1GHVH 1ELFA 2H9EH 3BSQA 4O03A 2QIQA 3GDVA 2FOFA 3GY8A 3ZZAA 2Z6BD 3MO9A 3SQEE 1SMFE 4MNYA 1QJ7B 4Y71A 1K9OE 1C1PA 2XWAA 2BLWA 2ANMH 2CGAA 2A2XH 2ZP0H 2BQ7B 5C2ZA 1Y3VA 1C2HA 2AEIH 3NZIA 4TYDA 5L6NH 1UVPA 1VCQA 2DE9A 1Q3XA 1D6WA 1Z6EA 1GI1A 2Y5HA 1FQ3A 3B23B 1AHTH 3LGUA 1QHRB 5LPRA 2LPRA 2Q6DA 3SV9A 1A3BH 2FX4A 3NKKA 1FN6A 1O2UA 5FCKA 4O9VA 3E0NB 4A1TA 2TGDA 1ESBA 1OX1A 1GI0A 1P11E 3KGPA 2GV6A 3BEFB 3SU5A 1UTOA 2ANYA 4IMZA 2ZA5A 3FFGA 2ODYB 2Z3EA 3TGKE 4ABIA 1KYNA 3A8DA 1OYQA 1G36A 1K2I1 4M7GA 4LZ1H 2H9TH 1SLVB 3A80A 1O2YA 1TBRH 1SSXA 1G3EA 1DWDH 1FNIA 2BDBA 1P12E 4OS1A 1FY8E 1G3BA 2RG3A 4AYYB 4MNVA 2VH6A 1P3EA 1LPKB 4X2XA 2SGQE 1W7GH 5AFZH 1O5DH 1QURH 1VJAU 2ZTZA 3A7YA 2FOMB 1H9LB 1DS2E 1SFIA 2VH0A 3U9AH 1ELGA 1UHBB 1O3IA 3SNAA 1LMWB 1TMBH 1J9CH 1GWAA 1BCUH 3BTKE 1MMJN 2R2MB 1IQIA 1G9IE 1W7XH 5T6DA 3SU1A 2ZU1A 3TPIZ 1TNKA 1GMHF 2VIPA 1CHGA 1T8NA 4YOGA 1QNJA 1SC8U 2WPIS 2O9QA 4DIIH 4NGAH 4NFEA 1GBTA 2IOTA 3M3TA 1GBKA 3M7UA 2VIQA 2H5DA 3RC6A 3EE0B 4ZH8A 5LPEA 1ZGVA 2GCTC 4YT6H 1WTGH 2BQWB 1AWFH 2CHAB 4ZHMU 3Q76A 1L4ZA 3LC3A 3NCLA 4U01A 1T8LA 1V2PT 1MCTA 1O39A 1HLTH 2ZPQA 4YTAA 2ALPA 1O2RA 1DM4B 1FY1A 2BM2A 3V3MA 1GCTC 4X1NU 1UTJA 4ESTE 3A8BA 2PKAB 1SBWA 1IQFA 3VEQB 4Q7ZA 1G32B 1N8OC 2RA0A 3RXQA 4I8KA 1S82A 3QUMP 3S9AA 2F9BH 2ULLA 1BB0B 1A2CH 1LHFH 3VXFH 2UWPA 1J17T 1PPEE 3EGKH 1JWTA 1BZXE 1WV7H 1NZQH 3PROA 2Z7FE 1V2QT 2GCHF 3RXTA 2BZAA 1W2KH 3E16B 2JETC 2XBVA 4K1EA 5T3HA 1DE7H 2HPQH 3GISB 4KELA 1C5ZB 3RM2H 1OOKB 2ZDAH 1KXFA 5CHAB 1S6FA 5EXNA 1DITH 3SBKA 1HAVB 4NSYA 1GBJA 4YESB 4KGAA 3EAJA 3TNTA 4JZIA 5LH8A 2BMGB 1ZMNA 4I8JA 1OWHA 3DFJA 4BTIB 4ZHAA 2P94A 1G3CA 4H6SB 1IHTH 4X1SU 5AFYH 2WPKS 2AS9A 3KQBA 2K1QA 3LT3A 1EAUA 1BTPA 2ANKH 1CT2E 4CH8B 1ZGIA 2KAIA 2EI6A 1O3JA 4XE4A 2OQUA 1MTWA 1ELCA 1ZTJA 4AG1A 1FAKH 3S9BA 1EZSC 5SGAE 1YPGH 5HGGA 1AQ7A 1V2JT 4X0WU 1A46H 2OC0A 3ZZCA 2OC8A 2TIOA 1YC0A 1ACBE 1H9IE 1O3HA 3PTBA 1C5QA 3ZVBA 2FESH 5LGOA 1H8DH 2OUAA 4I33A 2QC2A 2O8UA 3P17H 1C5PA 1C2FA 3U1JB 2D1JA 2ZHQH 2NU2E 1BOQA 1RFNA 1EX3A 1VR1H 4K8YA 3V13A 3G01A 2EI7A 3A85A 1C1SA 1EATA 3F9GA 1BHXB 1C5YB 3GY2A 4NIWA 7ESTE 3I77A 1EP5A 2NU4E 2BY6X 3LC5A 1FY3A 1S85A 1SGNE 3Q77A 7GCHG 2SGAA 2IJOB 4U2WA 2SGPE 3SJ9A 3A81A 1DFPA 1P8VC 5JDUB 1RIWB 1KDQA 5EPYA 1IQEA 2BY5X 1TYNA 1GCDA 1GMDG 1OP0A 1V6DA 2UUJB 1P3CA 3BTDE 4X8SH 1C1MA 1AKSB 1MU8B 4X2WA 1O3PB 4BANB 3UNSA 3SORA 5A8YA 2ZHDA 2GTBA 1OP2A 4I8HA 3SNEA 3BTME 1O2OA 1UCYH 1ZPBA 1KLJH 2ZDKA 1LVYA 3RXMA 5TCAA 1EZUC 4Q7XA 1P10A 2TRMA 2G81E 1NO9H 1N6XA 5FX5A 1ANEA 2SGFE 1H1BA 1FIWA 4INLA 3PMJA 3UREA 2F9PA 4AG2A 1O3OA 1ZRBA 2GCTB 1BBRE 4HZHA 5AVDA 5A0CA 5FPTA 1OSSA 5FPSA 1BMLA 3ZZ7A 1BTUA 1C1RA 3BG8A 4YOIA 4ABGA 1S0QA 1CGHA 2P8OC 4CHAC 2W26A 2A7HA 4ISIH 1EP6A 3RXLA 1GHXH 3E0PB 3PMHB 3LJOA 1LTOA 1F0RA 2EC9H 3PWBA 3GCOA 1GBMA 2BVRH 4WMFA 3U69H 1BUIA 1GCTB 3STIA 3T25A 4FVDA 1ZTKA 3SV2H 1L1NA 4DVAU 4WMDA 1AO5A 2BOHB 3RP2A 4ZUHA 4YM9A 1N8OB 4BAQB 3GY6A 2Y5GA 2ZHFH 2FS8A 3E90B 1O2NA 1UVUH 3RXJA 1FAXA 1ZZZA 1C5NH 1AFQB 1IOEA 2A7CA 1LCYA 1SGEE 3UOPA 2JETB 2OINA 1ZYOA 1OS8A 2Z9JA 1TX8A 1GBDA 4INKA 1XXFA 1TPPA 1D4PB 1QGFA 1GJ7B 3W95A 3KNXA 2TGPZ 3KL6A 1YLDA 1RTFB 4ABEA 1C2EA 3UWIA 1PQ5A 1QCPA 3JZ2B 1CSOE 3LGYA 4X1PU 2J92A 1A3EH 3T62A 4NCYA 5E2OA 1K1PA 1GBEA 1C5MD 1TNGA 5IYTA 4FUDA 1C2LA 3RMNH 3UR6A 5FAHA 3BTEE 3DUXH 3N7OA 3SU6A 1DXWA 4XBCA 3P8FA 5GJ4B 1ARBA 1C2GA 1YPHE 3BTFE 5L30H 1MQ5A 3EQ0H 3KCGH 5IDKA 2JH5D 1QBVH 1ZRKA 2GV7A 1E35B 3SW2B 3NK8A 4J2YB 4K69A 2Z9LA 3VB4A 1P2IA 3ZZ8A 4GHQA 1F0UA 1NPMA 2BXTH 4NA7A 4RSPA 2OQ5A 5I46H 2AGEX 1O5GH 3FZDA 3RLWH 3M3SA 4IGDA 1ZMJA 5C5NA 1HYLA 3SGBE 3O8CA 2AMDA 4UONA 1P03A 4HFPB 1B0EA 1PYTC 3MU4A 2ANWA 2ZDLA 3PLKA 2ZFPH 1ZJKA 2BD3A 3TK6A 1AMHA 1RGQA 4ZXYH 2FI3E 4X1QU 4CRDA 3U8TH 1CT0E 5F8ZA 1DX5M 1UMAH 4E7RG 1CU1A 2XW9A 4MDSA 1J8AA 4OGXA 4RKJB 2BX3A 3MO3A 5JBTA 4CRFA 1ETTH 2J4IA 4JZDH 1JIMA 1HRTH 2AFQB 1IQHA 1ETSH 1ESTA 3ATWA 1KXCA 1XMNB 2WYJA 1GVZA 1HDTH 2ZZUH 4DG4A 4NG9H 2ZTXA 3FAOA 1PFXC 1MKXK 3VB6A 3ZVAA 1DUEA 3A7VA 1Z7KA 1ELBA 1TPOA 4MNWA 2FOBA 3I29A 1GL0E 1GBHA 3BEIB 4J1YA 1TGSZ 1WBGB 4K8BA 1ABIH 1C2IA
chains in the Genus database with same CATH superfamily
3K6YA 1S6LA 2CV3A 2Z9KA 2ZDMA 1YCPH 2IJD1 3U28C 1UTQA 4GPGA 1G2MA 4XBDA 3A86A 2PWXA 2XXLA 1UVOA 6ESTA 3SU4A 3E1XB 5KECA 1T8MA 4KTCA 1ANCA 1WTHD 4UFEH 4UFDH 1BITA 1TE0A 2BDHA 1O5BB 3F0OA 1Y3XA 2P8OB 1V2OT 1YP9A 3KIDU 3RMOH 4CHAB 1GHZA 1VITG 2BB4A 2Y81A 1ZSJA 1GHAG 1HV7A 1IQLA 2Q1JA 1XUGA 1SLWB 1MTUA 2R0KA 2QV1A 3HKJB 4AFQA 2GZ8A 1GG6C 1F5KU 1QFKH 4E05H 3MH4A 2ZG0H 3DFLA 4DT4A 1AE5A 1SQOA 2V3HH 3UTUH 3STJA 2PUXB 1HBTH 1NRQH 3M37A 5DP4A 1PPHE 1NRSH 2A5AA 1WYKA 2G4UA 2ZGHA 1L4DA 3MU0A 1ZR0A 3H09A 1BRAA 1BTWA 3MMGA 2UWLA 3ESTA 1C5SA 2BOKA 2XNDD 1O2KA 2RCEA 4IBLH 1NM6A 2QAAA 1GBFA 5ESBA 2WINI 1TABE 1FLEE 2G4TA 5FXLA 1C1WH 1O2MA 3TITA 2ZGXH 1N1LA 2M5TA 3QGJA 3SU2A 4D7FA 3AVZA 4WXVA 3RC5A 1NFUA 1EXFA 1O3FA 4Q80A 4IC6A 1LKAA 1G37A 1AZ8A 2R2WU 3GOVB 1GJ9B 4Y6DA 4B2AA 1AB9C 1SLUB 1CVWH 5HKKD 1L2EA 3FANA 4OS6A 1MKWK 1SB1H 4A7IB 4FUHA 2QXJA 5JYIA 1SOZA 2BLQA 1QTFA 3ATMA 2PUQH 1BTXA 1UK2A 3HKIB 4BTTB 1ZHRA 5JPMH 2K0QA 2FOGA 2C8ZB 1O3KA 1V2LT 3LGIA 1SGYE 2RFKC 1NS3A 2F9VA 1DWBH 4TPYA 2PLXA 3WY8A 2AGIX 4UEHH 4TY7A 1HB0B 1DLEA 1V3XA 2NU3E 2YMSD 4ZKRU 1QB1A 3MNXA 5AF9H 1MUEB 1TQ7B 3B9FH 3OU0A 3AAUA 1GI2A 3FOAA 3SV8A 3A82A 1IAUA 4IS5A 4WJG2 1ANBA 3AASA 3Q3YA 1C1TA 1D6RA 1B7XB 1DANH 1HNEE 1Q2WA 1YYY1 2CXVA 3DA9B 4CRCA 4TSFD 3OSYA 3SJIA 5JBAS 1QY6A 2V35A 4A92A 1YPEH 3GCTG 1F7ZA 1X7AC 2ZFRH 3O8RA 1PPFE 1V2ST 4YLUA 5C20A 3VGCC 8LPRA 1NROH 4XFQA 3DT0H 3LIWA 2P16A 1WXRA 1SGTA 1SL3A 1V2KT 1ZLRA 4YXWD 2ZQ2A 4P00A 1K21H 1YKTA 1SQAA 1TBQH 2G5VA 3GCTF 1SGPE 4GUXA 1O3DA 2VJ1A 2ODPA 1QQUA 2VWNA 1LQEA 2ZHEH 3T28A 1BHXF 2QE7D 4Y7BA 3RXPA 2PGBB 2Z9GA 1E79D 4FVBA 1O3AA 2ZC9H 3A7WA 4A1XA 2PTNA 1G30B 4D76A 5DP5A 4VGCB 3U8RH 4RT0A 4ISHH 2F3CE 1O36A 1PQ8A 5DGJA 1HXFH 1MTSA 5F8XA 2ZI2H 4GCHF 1RJXB 3KQDA 4B2CA 2PFEA 1W0YH 5EGMA 1P9UA 3QN7A 2HWLB 1OWDA 5DP3A 5L2ZH 1GMHG 3P92A 4CREA 1AE8H 3LPRA 3Q3XA 5DP8A 1A0HB 1O3BA 3ZVEA 1H8IH 1SLXB 2O8MA 3M5OA 3ZVDA 4Y0ZE 2Z3DA 4D8NA 1WQSA 2VVCA 1XUIA 2RDEA 4DOQA 5F8TA 2FLBH 8GCHF 4YO9A 5LPFA 1O30A 2C8WB 1FN8A 4JCNA 5EJ1A 2A31A 2UWOA 2G52A 1KIGH 1GHBF 1RTKA 1TFXA 5DP9A 2K8IA 4DURA 1GG6B 1ORFA 2OC7A 2JKHA 2P3UB 3RXEA 3PB1E 5A2MH 3RU4T 3OEHD 3TU7H 3E91A 2A0QB 1XVOA 1HJ9A 3E6PH 5C1UA 2BD8A 1GMCF 4K60A 1DWCH 2V3OH 5CDFE 3UUZA 4K1TA 4AYVB 1GDQA 1GVKB 1LPZB 4JZFH 1GI4A 2HOBA 5J4SA 1DLKB 5HIYA 3ZZ4A 1GDUA 3C27B 1JRSA 4D9QA 1FONA 1JIRA 2LELA 4M9FA 1C4U2 3UNRA 3JZ1B 1A7SA 2O8TA 3MFJA 1IQJA 2BVSH 2GCHG 5EQQA 3ZV9A 1BMMH 2BDIA 3N99A 3OY5U 1THPB 2STBE 5C3NA 2BY8X 1Z8JB 3TJNA 1HJ8A 5EG4A 4ASHA 1DSUA 3KYGA 4JK6A 5EW1H 2XWBI 1YGCH 3S7KB 3A7XA 4X6NA 1AB9B 3F9HA 4FU9A 3ZV8A 1C5UA 1Z6JH 3LDXH 4FUFA 2RA3A 1ELDE 4WH6A 3MHWU 1GI8B 4ZXXH 4K1SA 1ZOMA 2Z3CA 1A0LA 5EQSA 2BLVA 1YLCA 2HNTC 1IQKA 3MOCA 5JBCS 4ZCNA 1OPHB 1LKBA 2GJGA 1XXDA 2TBSA 2STAE 2QYIA 2PKAA 2YNAA 3QZQA 4Q2KA 1S6HA 1L0ZA 4D7GA 1C2DA 5C94A 2J9NA 1BDAA 4U30A 3ZVCA 1TPSA 1NTPA 1QRZA 4NZLA 2HVXA 1W3CA 1H9HE 4IN2A 1VCPA 3W1EA 5J4QA 1TNHA 3ZZDA 5JB8S 3UQVA 4Y76A 1C5XB 2BY9X 1EFRD 1CQQA 1VGCC 2BD5A 1RTLA 2VGCC 2FXRA 5E0JA 4LXBH 2ZCHP 4AORA 1C1VH 1UTPA 4FUEA 1BBRK 3UB0A 1MAXA 5DO4H 1C2JA 1NRRH 3SV7A 4H6TA 1EQ9A 3SJOA 3VGCB 4XSKU 1EAIA 3LONA 5EU8A 1DDJA 2ZECA 1TBZH 2ZIQH 3N7EA 5GWZA 3SNBA 1QBNA 1GI9B 4X8UH 1GBAA 1TMUH 1ID5H 1UVTH 1TX6A 3ATLA 4JZ1A 2FLRH 5GDSH 3SO3A 2PSXA 1GBCA 2BXUH 4NA9H 2TGAA 3SYJA 1O5EH 1W10U 5DK1A 2FS9A 1JRTA 1C5RA 3QDZB 4DCDA 3A83A 1EZXC 4TY6A 1J15A 4ACAA 1ZSLA 1ELVA 4JK5A 2OXSA 3ZZ6A 1KDQB 1SGFG 3MO6A 2VINA 1UW7A 4RN6A 1YWUA 1CGIE 2XOKD 4LK4A 1O3CA 4SGBE 3IITA 1A5IA 1GGDC 3LOXA 3A7TA 1HAZB 2GGVB 3HPTB 4OS4A 2QGRA 2Y7XA 2TGTA 1HAYB 4JYVH 2BDCA 9LPRA 5A0AE 5DPAA 1C9TA 2A4QA 4UFFH 2GT7A 1G2LA 3F2HA 4XD7D 1TNLA 1GJAB 2B7DH 2AIQA 3M5NA 1W0ZU 2GT8A 1EPTA 1VJ9U 4Y79A 2M2AA 2HGTH 4MNXA 3W94A 1C1NA 5E0HA 2Q6FA 1Z8GA 1M9UA 1VZQH 3ZZ5A 2VIOA 2FZZA 1T31A 1JXPA 3UR9A 1Z71A 4NWKA 5EIYA 1WSSH 1Z8IB 1ZPCA 2JH6D 1XKAC 3MNBA 2BD4A 5ABWA 1A4WH 2LNCA 3F68H 3V0XA 5GIBA 3TH2H 1PPGE 3OFND 1FY4A 5PTPA 1DVAH 3BTGE 3KHVA 2FMJA 2QN5T 1BRCE 4FOUC 3HATH 4ABJA 4MPUA 1LPGB 2D8WA 1UJ1A 1MTNC 1E38B 1GPZA 1O35A 1AI8H 3GS9A 2ZGCA 2NWNA 5KEDA 5EODA 4QT8C 3SV6A 1ZJDA 4LZ4B 4KTUA 1A1RA 2R3UA 3ZIAD 1SR5C 2Y82A 4B6EA 1EB2A 4Y8XA 2G5NA 1W0JD 2J98B 6CHAC 3KQEA 4GAWA 1N6YA 1K22H 1AUJA 1BMAA 3GYMA 1O2ZA 4MLFB 4DGJA 3H7OA 1K1NA 2VIDA 4PROA 4INHA 2ZFFH 1KLTA 2Y6TA 4Y8ZA 3DHKH 2FTLE 3QGNB 1B0FA 5CHBA 1C1OA 2H6MA 1YLNA 5EPNA 1C9PA 4Y0YE 1GI6A 3PWCA 4MPXA 3RDZA 3DCLA 1LO6A 2KX4A 2CJIA 4MPVA 5KGOA 1JBUH 1P0SH 4FUBA 1HPGA 2FWWA 4B76A 3A8CA 3VB5A 1ZTLA 4YOJA 1DOJA 3NWUA 1OKXA 3TJOA 2ZTYA 1QA0A 3E8LA 1SQTA 2SFAA 2F9UA 4GHTA 2UUKB 1O2XA 1T8OA 1VGCB 2VGCB 3BG4C 1L1GA 1NC6A 5TJXA 1AVXA 1O32A 3ENSB 1C5OH 3Q00A 2ZF0H 4XOJA 3SUDA 2A5IA 3PO1C 4B1TA 2HALA 3LH3A 1EKBB 1QL9A 1TX7A 4R8TB 1LVOA 2GD4B 1LDTT 2ZU2A 1O2GH 1P01A 2ZU3A 5DN6D 2TPIZ 1NU9A 3F1SB 4TPIZ 1V2WT 5HM9A 1TA2A 4I8LA 5TCCA 2GMTC 5DSFA 1MQ6A 3SN8A 1TOCB 4BAOB 1XM1A 2ZFQH 2ZPRA 4BNRA 5HXFA 1OYTH 4BXSA 4TWWA 1W14U 3PLBA 6GCHF 1SGDE 3ZVFA 5EOKA 3T27A 3VFEA 1PQAA 3D62A 1BTZA 1NFYA 2BY7X 5GNDA 3RXFA 1LVBA 2A5KA 3M7TA 4X6PA 4AC9A 2FM2A 5JBBS 3TJUA 1CHOF 3MH5A 1XVMA 2CF9H 2XTTB 4ZKOU 3AAVA 3OAAD 1GGDB 2DUCA 2Q6GA 3F9EA 1ELEE 1VITH 5A8ZA 2QA9E 1YPHC 5B6LA 1YF4A 1FUJA 1IQMA 4I31A 2H2ZA 2KCYA 3BF6H 3A7ZA 3M5MA 3T5FH 2WSSD 3RXHA 4UE7H 2KCAA 1SGRE 2PHBA 1H4WA 2GDDA 1KMHB 1EASA 2VB0A 3V7TA 1EAXA 2J94A 3RXCA 2QF5A 3HGNA 5FCRA 1QRXA 2FOAA 2OC1A 4UFGH 4ABAA 3QX5H 5FHTA 2J5UA 1O3MA 4FU7A 5GCHF 3MH6A 1SG8B 2VIWA 1GJ8B 5HM2A 1E34B 3U1IB 3Q3KA 2V0BA 1FXYA 4Y11E 3PV4A 1MTVA 5DG6A 1P06A 1HIAA 2QF3A 3MNSA 3A87A 1FV9A 1O2WA 4F55A 1MKXH 1SGFA 3NXPA 1TPAE 2EA3A 3SUGA 2NU1E 2XBWA 1XKBC 4I8GA 1GBIA 3M36A 2EI8A 1MZDA 2VVVA 4TT3D 3ELAH 2CN0H 4A5TS 2THFB 4FU8A 8KME2 5EJLA 3GDUA 2OBQA 2AYWA 3TIUA 1UO6A 2WUCA 4HGCA 2ZKSA 3P70B 2AH4X 1J14A 1OWKA 3H7TA 3CS0A 4IN1A 2VIVA 2QF0A 1O31A 4LOYH 1TNJA 4Q7YA 5A8XA 4CBNA 3GYLB 1O3NA 1UVSH 1TB6H 1AWHB 3P8OA 3ITIA 4DJZB 3GY7A 5E8EH 3RLYH 3BTTE 2B8OH 3M61U 2VWLA 1TRMA 2BYAX 1GJDB 3SOSA 2HLDD 1F5RA 4R0IA 4MTBA 5K7RA 3T29A 3B8JA 3SI3H 2PW8H 5E2PA 2SNVA 1PPBH 3IWMA 1TIOA 3TK5A 3R0FA 5EXMA 2PR3A 3OYPA 3RUOA 2P95A 1NY22 3UFAA 1BRBE 1TMTH 2FIRH 1O37A 3BIVH 4BAHB 4ZAEA 3BG4B 4FUGA 4XDEA 1YCPM 5FBEA 1FPHH 1NT1A 1U6QA 4GSOA 2BD7A 5GPIB 2OD3B 3PO1B 3TGJE 1OWEA 2J95A 1K0HA 2PP6A 2ZPSA 3MU1A 1Y3WA 5A09A 1SOTA 1Q31A 1EUFA 2C3SA 2FPZA 2PKSC 1MCVA 1MD7A 2NU0E 5HYOA 1KY9A 2GMTB 1CT4E 4OS2A 3BV9B 5CHAC 8ESTE 5HMAA 4AFZA 5T1VA 1OXGA 2Y5FA 2V6NA 4RKOB 4WVPE 1RS0A 1MKWH 4DY7B 3SQHE 4K3JA 1O3EA 1KTTB 2A2QH 2PTCE 3SJ8A 1GDNA 3EA9A 2AERH 2A4GA 1GJBB 1BMNH 1RXPA 3BTWE 5DJ7A 4AOQA 1RRKA 3SUFA 4AGKA 1O2TA 4MQAA 4OGYA 2WUBA 3S69A 4NZQA 2A4OA 4Y8YA 1ESAA 3RXOA 2YNBA 1NESE 4WXIA 1T32A 1KLIH 5AHGH 1O33A 5C1XA 2BD2A 1V2VT 3IG6B 4XBBA 2DE8A 3F9FA 3FP7E 2ZGJA 2D26C 4GVUA 2IN2A 4AFSA 2FYRA 1QRWA 4AB9A 4GCHG 3VG8A 2BHGA 2UUYA 4K2YA 1K1IA 5EXLA 1QQ4A 4Y7AA 1S0RA 1SQRA 1EB1H 1QR3E 2F9NA 2QF4A 1GL1A 4JMYA 4WH8A 3LU9B 3LKWA 1V2TT 2H1UA 4TWYA 4IMQA 5DP6A 5C0UA 1V2RT 2KCOA 3TGIE 1BRUP 2A7JA 3FP6E 3GY5A 5B6OA 1HCGA 4KP0A 1P57B 1BTYA 3OY6U 1K1JA 3QZRA 8GCHG 1P9SA 1FMGA 4NA8A 1NFWA 1UK3A 1JOUB 1S5SA 3L6PA 2H9HA 1EPTC 1ANDA 1GHBG 2ZCLP 1AD8H 3K2UA 2A45B 2L6OA 1D3DB 3TH3H 1W12U 2C4FH 5DP7A 3UNQA 3H5CB 4DW2U 1AVWA 1GHWH 4I7YH 3URDA 2C8YB 4F4OC 4X6MA 1GMCG 1XUKA 3CS7A 4H4FA 1MD8A 4CR9A 3UQOA 1RIWC 1NBMD 3QK1A 2XBXA 3F6UH 3KN2A 4YLQH 1D9IA 3P6ZB 3PLPA 1O2LA 4JYUH 2G55A 4FUIA 4RT1A 1DWEH 1QJ6B 2B0FA 3FN8A 1CO7E 3RXRA 1DSTA 1O5AB 3MI4A 2BQ6B 3DD2H 4NWLA 1FDPA 2WV9A 3BIUH 1ZHPA 3TNSA 3CP7A 1C1UH 4HG6A 4BOHA 2ZFSA 1TQ0B 3ZZBA 1UHBA 5FBIA 2FOHA 2ILNA 1ELAA 2HNTE 4O3TA 3PTNA 1HFDA 1C4V2 2BVXH 4BXWA 1EAWA 1E1RD 2ZCKP 1LVMA 1XX9A 1P2QA 3ZZ3A 1SGQE 1YPKH 1EOLA 1QIXB 3U8OH 2A4RA 1OHHD 3CENA 4NSVA 5EW2H 2JJ2D 2W7UA 3FVFB 4K5ZA 1O2PA 1YPJH 2ZWLH 4AB8A 4ACBA 4CRGA 1GJ6A 4WY3A 2QY0B 1V2MT 4F49A 2WPMS 1SPJA 1PYTD 3UPEA 1T7CA 2HNTF 2HRVA 2XCNA 2Z94A 2A1DB 4MPWA 1K1MA 4NFFA 1WQVH 2BDAA 1G3DA 7KMEH 3U98H 1P09A 1DICA 4B2BA 1TNIA 2VWOA 1QL7A 2ZQ1A 5I25A 4XRNA 1DY9A 3OTJE 3PRDA 2YOLA 2W7SA 1AFQC 1OWIA 3LGWA 2F91A 2KAIB 4X2VA 2R3YA 1CA0C 3SGAE 2A32A 2WV5A 2PKSB 3PM3A 1H8ED 4OS7A 1THSH 2B5TB 3SUEA 3DSOA 5C5OA 5CE1A 1DXPA 3TLOA 3GICB 3QTVH 4WWYA 5F6MA 4P02A 3MNCA 1ABJH 5BPEA 2VNTA 1SGIB 1PPZA 1O2SA 1C5LH 1P05A 3MH7A 1EJNA 2WYGA 3SU0A 2FEQH 2P3TB 1ZSKA 2AMQA 3GCHC 4X6OA 5JB9S 2J34A 3SNDA 2BLOA 2F83A 3QLPH 1WCZA 1O2QA 1EOJA 2WV4A 3SHCH 4YZUA 3RMLH 1HAVA 2GZ9A 1VCWA 2G51A 3RXIA 4BAKB 2XBYA 2OP9A 1SFQB 1JMOH 1SHYA 1UTKA 1LHGH 1SHHB 2EY4C 2PV9B 1MU6B 1CA8B 1T4VH 1QJ1B 4FUJA 2JJ1D 4ZHLU 1NFXA 1SGCA 4ABFA 2FI5E 3K65B 1Y3UA 1FJSA 4JYTA 2B9LA 2OTVA 5DKMA 1ZMLA 6LPRA 4Z0KA 1PQ7A 3SGQE 1D3PB 4ABDA 1GBBA 1BBRH 3FP8E 4Y10E 1QBOA 3RXBA 1XUFA 4AGJA 1DY8A 1P2MA 1MZAA 5G4BA 1SVPA 1QA7A 1AVGH 1UCYK 2BD9A 4CRAA 4OS5A 3TK9A 3SHAH 1K28D 2FYQA 1EPTB 2ZO3H 4B6FA 1GJCB 1IHSH 3VB3A 3SJKA 3VXEH 3MU5A 3TVJB 3MU8A 4ASUD 1YPLH 4AN7A 1S84A 2QXIA 1O2HA 4FETA 4ISOA 1KXDA 2FODA 1O5FH 3QTOH 4KKDA 2PGQB 4KTSA 2W3KA 2AMPA 3RXGA 3AW0A 3QO6A 1XUJA 2BZ6H 1OP8A 1ETRH 1HAXB 2YMSC 3OX7U 5C0TA 3UAIC 1WU1A 4FUCA 7GCHF 1AY6H 3L3TA 4Q63A 3RM0H 3A84A 3MTYA 3UIRA 1O3LA 1B5GH 2VU8E 1AFEH 2XC0A 5FPYA 3C1KA 3O8BA 3ATIA 4DIHH 1D3TB 1GMDF 1QL8A 1RD3B 1C4Y2 4BTUB 1AKSA 1CBWC 1F0SA 4ZKSU 2AIPA 1MBMA 3LGTA 2J2UA 5T6GA 4X1RU 1TONA 2ALVA 2Z9IA 3NRLA 2SGEE 4Q4LA 5A0BA 1HUTH 4AX9H 4WMEA 2JH0D 3ATKA 1P2OA 1SI5H 1NBME 1D3QB 1THRH 2ASUB 2P59A 2BDYA 4BAMB 2XC4A 1UTNA 2ZFTA 1YM0A 2ZDNA 2W5EA 2HPPH 3RU4D 5CMXH 3SNCA 1K1OA 3O8DA 3BTHE 1GJ5H 3GDSA 1UTMA 4I32A 2OBOA 4A1VA 3M3VA 1E0FD 2QXHA 5L2YH 2XYAA 2G8TA 1Y5AT 4D9RA 1UCYE 1P04A 2P93A 1EJMA 2WPJS 2SGDE 2ZGBH 1C5TA 1O5CB 3S7HB 3P8NA 4Z6AH 4AFUA 4ABHA 1K1LA 4ABBA 3UWJH 1C1QA 3MQKC 3ZZ9A 1PJPA 3BTQE 3ZYDA 1CA0B 4HI3A 2ZEBA 1KTSB 2FP7B 2F9OA 2XNIA 2O8LA 2FTMA 3D23A 4B71A 1Y3YA 2FOEA 1J16A 1FPCH 1Z1IA 4X2YA 1LHEH 1WUNH 3LJJA 2HLCA 3ZVGA 2ZU4A 1FZZA 3A89A 4GLYA 4YT7H 4WF8A 3RXSA 2JIZD 1ELTA 1MAYA 1UTLM 1GI3A 3M5LA 1BA8B 4U32A 1HGTH 1W13U 2D2DA 3T2NA 1T4UH 1TRYA 3KYFA 3V12A 3P8GA 3SZNA 5K0HA 3PYHA 6GCHG 3GCHB 3HK6B 4UD9H 3I78A 2UUFB 4B73A 3DSPA 1KXEA 2GP9B 3CNRA 1MBQA 3GY3A 1LHDH 2ZHWH 4THNH 1LHCH 1HJAC 2OCVB 1AIXH 3KF2A 4B75A 3M35A 1KSNA 2WPHS 1L1JA 4MG3A 2V3MA 1OWJA 3FO8D 5F53A 2XRCA 1CHOG 3PMAB 5HIZA 1Y5UT 2J97A 3K6ZA 1GI5A 3RXVA 5C67A 5F03A 1NN6A 3KEEA 2SNWA 2VWMA 2CMYA 3N7DA 1LQDB 5GXPA 3VB7A 3MWIU 3GCNA 1C5WB 4O97A 4AZ2B 3BEUA 2Y7ZA 1Z1JA 1MH0A 1UK4A 2RDLA 2GDEH 4NIXA 1S81A 2FI4E 4MVNA 5ETXA 2WHXA 3RXUA 3S9CA 5ESTE 3TH4H 3F3BA 3RXDA 2PSYA 3A88A 2XC5A 4HTCH 2QXGA 3BN9A 3RXKA 3TJVA 1HAIH 1C2KA 1KXBA 1BIOA 1A0JA 2I6QA 1YPMH 1TALA 2KZ4A 3VPKA 2O8WA 4X8TH 3UOUA 3ZYEA 1F2SE 1ARCA 1F0TA 1YCPK 3HK3B 4DT7B 2OLGA 3ODFA 3L33A 5GCHG 1AU8A 1O2IA 3R3GB 1AGJA 1INCA 1GHYH 1HAHH 2BTCE 1A61H 1TA6A 3ODDA 1GI7B 3KQCA 2VVUA 2CF8H 3S0NA 1TRNA 5T6FA 1TAWA 1CE5A 1TLDA 1HIAB 3P95A 1O0DH 1AN1E 1O3GA 2FX6A 5E0GA 1W0KD 3EA7A 4UDWH 1DT2A 1O2JA 3LGVA 4CRBA 2ESTE 3NPSA 4E06H 4CH2B 4SGAE 1YBWA 1P2JA 1P2NA 1V2NT 2ODQA 2WPLS 1F92A 1S83A 3RC4A 2CK3D 2GX4A 4A6LA 4VGCC 1TGCA 1IQGA 1CBWB 1BT7A 1Y5BT 4ZMAH 1Z8RA 1E37B 1DPOA 4JZEH 3M7QA 1WAYB 1BJVA 3URCA 5C1YA 3SU3A 1KXAA 2G00A 7LPRA 1TGBA 1V2UT 2W6JD 1MTNB 4IW4E 1QB9A 2F43B 3PV5A 2BDGA 4NIVA 5FX6A 3HGPA 4ZKNU 4I86A 1C5VA 1DUAA 1WOFA 4B74A 2KCPA 1HXEH 3EDXB 3EA8A 2FOCA 3MYWA 2I6SA 3SI4H 5EQRA 2WPDD 1C2MA 4ISNA 6CHAB 1TGNA 1NRNH 2R0LA 2EQNA 2GZ7A 3K9XB 1AUTC 2ZDVH 3RMMH 2ZU5A 2GVFA 1NRPH 1E36B 2CHAC 1VITF 2C93B 2W6ID 4CR5A 2ZNKH 2H5CA 1GHAF 1HAGE 2C8XB 1IQNA 9ESTA 1W11U 1TGTA 2BX4A 2R9PA 5H4IB 2HVYB 2EEKA 1FI8A 1F5LA 4ISLA 1ZPZA 2P3FH 1GBLA 2FO9A 4X8VH 5BRRE 1GVLA 1A5HA 3RU4E 3E3TA 1HAPH 1TWXB 4ZROA 1TOMH 1EZQA 1HAOH 1AZZA 1Y59T 2IPHA 1GJ4H 1QB6A 3NUMA 3AW1A 1Y8TA 1BQYA 1P2KA 3EYDA 1NU7B 1O38A 1BMFD 3FZZA 1P02A 1O34A 3UY9A 4FXGH 1A5GH 3A8AA 2AGGX 1XUHA 1O2VA 3PMBB 2QCYA 3GY4A 2C90B 2XCFA 3QWCH 1ZHMA 4RI0A 1BTHH 1EJAA 2W3IA 1PPCE 2J38A 5EJZA 4CBOA 3RXAA 3D65E 4NIYA 1FY5A 1FIZA 3D49H 2FDAA 1HJAB 4E7NA 4O3UA 2GKVE 3LH1A 4H42U 1CGJE 2Y80A 1BJUA 3T26A 1W8BH 4IC5A 1GHVH 1ELFA 2H9EH 3BSQA 4O03A 2QIQA 3GDVA 2FOFA 3GY8A 3ZZAA 2Z6BD 3MO9A 3SQEE 1SMFE 4MNYA 1QJ7B 4Y71A 1K9OE 1C1PA 2XWAA 2BLWA 2ANMH 2CGAA 2A2XH 2ZP0H 2BQ7B 5C2ZA 1Y3VA 1C2HA 2AEIH 3NZIA 4TYDA 5L6NH 1UVPA 1VCQA 2DE9A 1Q3XA 1D6WA 1Z6EA 1GI1A 2Y5HA 1FQ3A 3B23B 1AHTH 3LGUA 1QHRB 5LPRA 2LPRA 2Q6DA 3OTPA 3SV9A 1A3BH 2FX4A 3NKKA 3WW7A 1FN6A 1O2UA 5FCKA 4O9VA 3E0NB 4A1TA 2TGDA 1ESBA 1OX1A 1GI0A 1MABB 1P11E 3KGPA 2GV6A 4Z1MD 3BEFB 3SU5A 1UTOA 2ANYA 4IMZA 2ZA5A 3FFGA 2ODYB 2Z3EA 3TGKE 4ABIA 1KYNA 3A8DA 1COWD 3PRBA 3AK5A 5C17A 1OYQA 1G36A 1K2I1 4M7GA 4LZ1H 2H9TH 1H8HD 1SLVB 3A80A 1O2YA 1TBRH 1SSXA 1G3EA 1DWDH 1FNIA 2BDBA 1P12E 4OS1A 1FY8E 1G3BA 2RG3A 4AYYB 4MNVA 2VH6A 1P3EA 1LPKB 4X2XA 2SGQE 1W7GH 5AFZH 1O5DH 1QURH 1VJAU 2ZTZA 3A7YA 2FOMB 2LP6A 3FKSD 1H9LB 1DS2E 1SFIA 2VH0A 3U9AH 1ELGA 1UHBB 1O3IA 3SNAA 1LMWB 1TMBH 1J9CH 1GWAA 1BCUH 3BTKE 1MMJN 2R2MB 1IQIA 1G9IE 1W7XH 5T6DA 3SU1A 2ZU1A 3TPIZ 1TNKA 1GMHF 2VIPA 1CHGA 1T8NA 4YOGA 1QNJA 1SC8U 2WZQA 2VBCA 2WPIS 2O9QA 1YY3A 4DIIH 4NGAH 4NFEA 1GBTA 2IOTA 3M3TA 1GBKA 3M7UA 2VIQA 2H5DA 3RC6A 3EE0B 4ZH8A 5LPEA 1ZGVA 2GCTC 4YT6H 1SKYE 1WTGH 2BQWB 1AWFH 2CHAB 4ZHMU 3Q76A 1L4ZA 3LC3A 3NCLA 4U01A 1T8LA 1V2PT 1MCTA 1O39A 1HLTH 2ZPQA 4YTAA 2ALPA 1O2RA 1DM4B 1FY1A 2BM2A 3V3MA 1GCTC 4X1NU 1UTJA 4ESTE 3A8BA 2PKAB 1SBWA 1IQFA 1WDIA 3VEQB 4Q7ZA 1G32B 1N8OC 2V7QD 2RA0A 3RXQA 4I8KA 1S82A 3QUMP 3S9AA 2F9BH 2ULLA 1BB0B 1A2CH 1LHFH 3DSGA 3VXFH 2UWPA 1J17T 1PPEE 3EGKH 1JWTA 1BZXE 1WV7H 1NZQH 3PROA 2Z7FE 1V2QT 2GCHF 3RXTA 2BZAA 1W2KH 3E16B 2JETC 2XBVA 4K1EA 5T3HA 1DE7H 2HPQH 3GISB 3WWFA 4KELA 1C5ZB 3RM2H 1OOKB 2ZDAH 1KXFA 5CHAB 1S6FA 5EXNA 1DITH 3SBKA 1HAVB 4NSYA 1GBJA 4YESB 4KGAA 3EAJA 3TNTA 4JZIA 5LH8A 5FL7D 1E1QD 2BMGB 1ZMNA 4I8JA 3OEED 1OWHA 3DFJA 4BTIB 4ZHAA 2P94A 1G3CA 4H6SB 1IHTH 4X1SU 5AFYH 2WPKS 2AS9A 3KQBA 2K1QA 3LT3A 1EAUA 1BTPA 2ANKH 1CT2E 4CH8B 1ZGIA 2KAIA 2EI6A 1O3JA 4XE4A 2OQUA 1MTWA 1ELCA 1ZTJA 4AG1A 1FAKH 3S9BA 1EZSC 5SGAE 1YPGH 5HGGA 1AQ7A 2KM0A 1V2JT 4F48B 4X0WU 1A46H 2OC0A 3ZZCA 2OC8A 2TIOA 1YC0A 1ACBE 1H9IE 1O3HA 3PTBA 1C5QA 3ZVBA 2FESH 5LGOA 1H8DH 2OUAA 4I33A 2QC2A 2O8UA 2JDID 3P17H 1C5PA 1C2FA 3U1JB 2D1JA 2ZHQH 2NU2E 1BOQA 1RFNA 1EX3A 3PV2A 1VR1H 4K8YA 3V13A 3F2GA 2EI7A 3G01A 3A85A 1C1SA 1EATA 3F9GA 1BHXB 1C5YB 3GY2A 4NIWA 7ESTE 3I77A 1EP5A 2NU4E 2BY6X 3LC5A 1FY3A 1S85A 1SGNE 3Q77A 7GCHG 2SGAA 2IJOB 4U2WA 2SGPE 3SJ9A 3A81A 1DFPA 1P8VC 5JDUB 1RIWB 1KDQA 5EPYA 1FX0B 1IQEA 2BY5X 1TYNA 1GCDA 1GMDG 1OP0A 1V6DA 2UUJB 1P3CA 3BTDE 4X8SH 1C1MA 1AKSB 4OM9A 1MU8B 4X2WA 1O3PB 4BANB 3UNSA 3SORA 5A8YA 2ZHDA 2GTBA 1OP2A 4I8HA 3SNEA 3BTME 1O2OA 1UCYH 2L74A 1ZPBA 1KLJH 2ZDKA 1LVYA 3RXMA 5TCAA 1EZUC 4Q7XA 1P10A 2TRMA 2G81E 1NO9H 1N6XA 5FX5A 1ANEA 2SGFE 1H1BA 1FIWA 4INLA 3PMJA 3UREA 2F9PA 4AG2A 1O3OA 1ZRBA 2GCTB 1BBRE 4HZHA 5AVDA 5A0CA 5FPTA 1OSSA 5FPSA 2OK5A 1BMLA 3ZZ7A 1BTUA 1C1RA 3BG8A 4YOIA 4ABGA 1S0QA 1CGHA 5IK2D 2P8OC 4CHAC 2W26A 2A7HA 4ISIH 1EP6A 3RXLA 1GHXH 3E0PB 3PMHB 3LJOA 1LTOA 1F0RA 2EC9H 3PWBA 3GCOA 1GBMA 2BVRH 4WMFA 3U69H 1BUIA 1GCTB 3STIA 3T25A 4FVDA 1ZTKA 3SV2H 1L1NA 4DVAU 4WMDA 1AO5A 2BOHB 3RP2A 4ZUHA 4YM9A 1N8OB 4BAQB 3GY6A 2Y5GA 2ZHFH 2FS8A 3E90B 1QZ8A 1O2NA 1UVUH 3RXJA 1FAXA 1ZZZA 1C5NH 1AFQB 1IOEA 2A7CA 1LCYA 1SGEE 3UOPA 2JETB 2OINA 1ZYOA 1OS8A 3KQ5A 2Z9JA 1TX8A 1GBDA 4INKA 1XXFA 1TPPA 1D4PB 1QGFA 1GJ7B 3OE7D 3W95A 3KNXA 2J98A 2TGPZ 3KL6A 1YLDA 1RTFB 4ABEA 1C2EA 3UWIA 1PQ5A 1QCPA 3JZ2B 1CSOE 3LGYA 4X1PU 2J92A 1A3EH 3T62A 4NCYA 5E2OA 1K1PA 1GBEA 1C5MD 1TNGA 5IYTA 4FUDA 1C2LA 3RMNH 3UR6A 5FAHA 3BTEE 3DUXH 3N7OA 3SU6A 1DXWA 3SZEA 4XBCA 2KR7A 3P8FA 5GJ4B 1ARBA 1C2GA 1YPHE 3BTFE 5L30H 1MQ5A 2KFWA 3EQ0H 3KCGH 5IDKA 2JH5D 1QBVH 1ZRKA 2GV7A 1E35B 3SW2B 3NK8A 4J2YB 4K69A 2Z9LA 3VB4A 1P2IA 3ZZ8A 3EE7A 4GHQA 1F0UA 1NPMA 2BXTH 4NA7A 4RSPA 2OQ5A 5I46H 2AGEX 1O5GH 3FZDA 3RLWH 3M3SA 4IGDA 1ZMJA 5C5NA 1HYLA 2AHME 3SGBE 3O8CA 2AMDA 4UONA 1P03A 4HFPB 1B0EA 3F2FA 1PYTC 3MU4A 3F0PA 2ANWA 2ZDLA 3PLKA 2ZFPH 1ZJKA 2BD3A 3TK6A 1AMHA 1RGQA 4ZXYH 2FI3E 4X1QU 4CRDA 3U8TH 1CT0E 5F8ZA 1DX5M 1UMAH 4E7RG 1CU1A 2XW9A 4MDSA 2IPQX 1J8AA 4OGXA 4RKJB 2BX3A 3MO3A 5JBTA 4CRFA 1ETTH 2J4IA 4JZDH 1JIMA 1HRTH 2AFQB 1IQHA 1ETSH 1ESTA 3ATWA 1KXCA 1XMNB 2WYJA 1GVZA 1HDTH 2ZZUH 1VKYA 2YMSB 4DG4A 4NG9H 2ZTXA 3FAOA 1PFXC 2F4LA 1MKXK 3VB6A 3ZVAA 1DUEA 3A7VA 1Z7KA 1ELBA 1TPOA 4MNWA 2FOBA 3I29A 3WWBA 1GL0E 1GBHA 3BEIB 4J1YA 1TGSZ 1WBGB 4K8BA 1ABIH 1C2IA
chains in the Genus database with same CATH topology
3K6YA 2CV3A 2Z9KA 2ZDMA 1YCPH 1UTQA 4GPGA 1G2MA 4XBDA 3A86A 2PWXA 2XXLA 1UVOA 6ESTA 3SU4A 3E1XB 1T8MA 4KTCA 1ANCA 1WTHD 4UFEH 4UFDH 1BITA 1TE0A 2BDHA 1O5BB 1Y3XA 2P8OB 1V2OT 1YP9A 3KIDU 3RMOH 4CHAB 1GHZA 1VITG 2BB4A 2Y81A 1ZSJA 1GHAG 1HV7A 1IQLA 2Q1JA 1XUGA 1SLWB 1MTUA 2R0KA 2QV1A 3HKJB 4AFQA 2GZ8A 1GG6C 1F5KU 1QFKH 4E05H 3MH4A 2ZG0H 3DFLA 1AE5A 1SQOA 2V3HH 3UTUH 3STJA 2PUXB 1HBTH 1NRQH 3M37A 5DP4A 1PPHE 1NRSH 2A5AA 1WYKA 2G4UA 2ZGHA 1L4DA 3MU0A 1ZR0A 1BRAA 1BTWA 3MMGA 2UWLA 3ESTA 1C5SA 2BOKA 1O2KA 2RCEA 4IBLH 1NM6A 2QAAA 1GBFA 5ESBA 2WINI 1TABE 1FLEE 2G4TA 5FXLA 1C1WH 1O2MA 3TITA 2ZGXH 1N1LA 2M5TA 3QGJA 3SU2A 4D7FA 3AVZA 4WXVA 3RC5A 1NFUA 1EXFA 1O3FA 4Q80A 4IC6A 1LKAA 1G37A 1AZ8A 2R2WU 3GOVB 1GJ9B 4Y6DA 4B2AA 1AB9C 1SLUB 1CVWH 1L2EA 3FANA 4OS6A 1MKWK 1SB1H 4A7IB 4FUHA 2QXJA 5JYIA 1SOZA 2BLQA 1QTFA 3ATMA 2PUQH 1BTXA 1UK2A 3HKIB 4BTTB 1ZHRA 5JPMH 2FOGA 2C8ZB 1O3KA 1V2LT 3LGIA 1SGYE 1NS3A 2F9VA 1DWBH 4TPYA 2PLXA 3WY8A 2AGIX 4UEHH 4TY7A 1HB0B 1DLEA 1V3XA 2NU3E 4ZKRU 1QB1A 3MNXA 5AF9H 1MUEB 1TQ7B 3B9FH 3OU0A 3AAUA 1GI2A 3SV8A 3A82A 1IAUA 4IS5A 4WJG2 1ANBA 3AASA 3Q3YA 1C1TA 1D6RA 1B7XB 1DANH 1HNEE 1Q2WA 1YYY1 2CXVA 3DA9B 4CRCA 5JBAS 3OSYA 3SJIA 1QY6A 2V35A 4A92A 1YPEH 3GCTG 1F7ZA 1X7AC 2ZFRH 3O8RA 1PPFE 1V2ST 4YLUA 5C20A 3VGCC 8LPRA 1NROH 4XFQA 3DT0H 3LIWA 2P16A 1SGTA 1SL3A 1V2KT 1ZLRA 2ZQ2A 1K21H 1YKTA 1SQAA 1TBQH 2G5VA 3GCTF 1SGPE 4GUXA 1O3DA 2VJ1A 2ODPA 1QQUA 2VWNA 1LQEA 2ZHEH 3T28A 1BHXF 4Y7BA 3RXPA 2PGBB 2Z9GA 4FVBA 1O3AA 2ZC9H 3A7WA 4A1XA 2PTNA 1G30B 4D76A 5DP5A 4VGCB 3U8RH 4ISHH 2F3CE 1O36A 1PQ8A 5DGJA 1HXFH 1MTSA 5F8XA 2ZI2H 4GCHF 1RJXB 3KQDA 4B2CA 2PFEA 1W0YH 5EGMA 1P9UA 3QN7A 2HWLB 1OWDA 5DP3A 5L2ZH 1GMHG 3P92A 4CREA 1AE8H 3LPRA 3Q3XA 5DP8A 1A0HB 1O3BA 3ZVEA 1H8IH 1SLXB 2O8MA 3M5OA 3ZVDA 4Y0ZE 2Z3DA 4D8NA 1WQSA 2VVCA 1XUIA 4DOQA 5F8TA 2FLBH 8GCHF 4YO9A 5LPFA 1O30A 2C8WB 1FN8A 4JCNA 2A31A 2UWOA 2G52A 1KIGH 1GHBF 1RTKA 1TFXA 5DP9A 4DURA 1GG6B 1ORFA 2OC7A 2JKHA 2P3UB 3RXEA 3PB1E 5A2MH 3RU4T 3TU7H 3E91A 2A0QB 1XVOA 1HJ9A 3E6PH 5C1UA 2BD8A 1GMCF 4K60A 1DWCH 2V3OH 3UUZA 4K1TA 4AYVB 1GDQA 1GVKB 1LPZB 4JZFH 1GI4A 2HOBA 5J4SA 1DLKB 3ZZ4A 1GDUA 3C27B 1JRSA 4D9QA 1FONA 1JIRA 1C4U2 3UNRA 3JZ1B 1A7SA 2O8TA 3MFJA 1IQJA 2BVSH 2GCHG 5EQQA 3ZV9A 1BMMH 2BDIA 3OY5U 1THPB 2STBE 5C3NA 2BY8X 1Z8JB 3TJNA 1HJ8A 5EG4A 4ASHA 1DSUA 4JK6A 5EW1H 2XWBI 1YGCH 3S7KB 3A7XA 4X6NA 1AB9B 3F9HA 4FU9A 3ZV8A 1C5UA 1Z6JH 3LDXH 4FUFA 2RA3A 1ELDE 4WH6A 3MHWU 1GI8B 4ZXXH 4K1SA 1ZOMA 2Z3CA 1A0LA 5EQSA 2BLVA 1YLCA 2HNTC 1IQKA 3MOCA 5JBCS 1OPHB 1LKBA 1XXDA 2TBSA 2STAE 2QYIA 2PKAA 2YNAA 3QZQA 4Q2KA 1S6HA 1L0ZA 4D7GA 1C2DA 2J9NA 1BDAA 4U30A 3ZVCA 1TPSA 1NTPA 1QRZA 4NZLA 2HVXA 1W3CA 1H9HE 4IN2A 1VCPA 5J4QA 1TNHA 3ZZDA 5JB8S 3UQVA 4Y76A 1C5XB 2BY9X 1CQQA 1VGCC 2BD5A 1RTLA 2VGCC 2FXRA 5E0JA 4LXBH 2ZCHP 4AORA 1C1VH 1UTPA 4FUEA 1BBRK 1MAXA 5DO4H 1C2JA 1NRRH 3SV7A 4H6TA 1EQ9A 3SJOA 3VGCB 4XSKU 1EAIA 3LONA 5EU8A 1DDJA 2ZECA 1TBZH 2ZIQH 5GWZA 3SNBA 1QBNA 1GI9B 4X8UH 1GBAA 1TMUH 1ID5H 1UVTH 1TX6A 3ATLA 4JZ1A 2FLRH 5GDSH 3SO3A 2PSXA 1GBCA 2BXUH 4NA9H 2TGAA 1O5EH 1W10U 5DK1A 2FS9A 1JRTA 1C5RA 3QDZB 4DCDA 3A83A 1EZXC 4TY6A 1J15A 1ZSLA 1ELVA 4JK5A 2OXSA 3ZZ6A 1KDQB 1SGFG 3MO6A 2VINA 4RN6A 1CGIE 4LK4A 1O3CA 4SGBE 3IITA 1A5IA 1GGDC 3LOXA 3A7TA 1HAZB 2GGVB 3HPTB 4OS4A 2QGRA 2Y7XA 2TGTA 1HAYB 4JYVH 2BDCA 9LPRA 5A0AE 5DPAA 1C9TA 2A4QA 4UFFH 2GT7A 1G2LA 1TNLA 1GJAB 2B7DH 2AIQA 3M5NA 1W0ZU 2GT8A 1EPTA 1VJ9U 4Y79A 2HGTH 4MNXA 3W94A 1C1NA 5E0HA 2Q6FA 1Z8GA 1M9UA 1VZQH 3ZZ5A 2VIOA 2FZZA 1T31A 1JXPA 3UR9A 1Z71A 4NWKA 1WSSH 1Z8IB 1ZPCA 2JH6D 1XKAC 3MNBA 2BD4A 5ABWA 1A4WH 2LNCA 3F68H 3V0XA 5GIBA 3TH2H 1PPGE 1FY4A 5PTPA 1DVAH 3BTGE 3KHVA 2FMJA 2QN5T 1BRCE 4ABJA 3HATH 4MPUA 1LPGB 2D8WA 1UJ1A 1MTNC 1E38B 1GPZA 1O35A 1AI8H 2ZGCA 2NWNA 5EODA 4QT8C 3SV6A 1ZJDA 4LZ4B 4KTUA 1A1RA 2R3UA 1SR5C 2Y82A 1EB2A 4Y8XA 2G5NA 6CHAC 3KQEA 4GAWA 1N6YA 1K22H 1AUJA 1BMAA 3GYMA 1O2ZA 4MLFB 4DGJA 3H7OA 1K1NA 2VIDA 4PROA 4INHA 2ZFFH 1KLTA 2Y6TA 4Y8ZA 3DHKH 2FTLE 3QGNB 1B0FA 1C1OA 2H6MA 5EPNA 1C9PA 4Y0YE 1GI6A 3PWCA 4MPXA 3RDZA 1LO6A 2CJIA 4MPVA 1JBUH 1P0SH 4FUBA 1HPGA 2FWWA 4B76A 3A8CA 3VB5A 1ZTLA 4YOJA 1DOJA 3NWUA 1OKXA 3TJOA 2ZTYA 1QA0A 3E8LA 1SQTA 2SFAA 2F9UA 4GHTA 2UUKB 1O2XA 1T8OA 1VGCB 2VGCB 3BG4C 1L1GA 1NC6A 5TJXA 1AVXA 1O32A 3ENSB 1C5OH 3Q00A 2ZF0H 4XOJA 3SUDA 2A5IA 3PO1C 4B1TA 2HALA 3LH3A 1EKBB 1QL9A 1TX7A 4R8TB 1LVOA 2GD4B 1LDTT 2ZU2A 1O2GH 1P01A 2ZU3A 2TPIZ 1NU9A 3F1SB 4TPIZ 1V2WT 5HM9A 1TA2A 4I8LA 5TCCA 2GMTC 1MQ6A 3SN8A 1TOCB 4BAOB 1XM1A 2ZFQH 2ZPRA 4BNRA 5HXFA 1OYTH 4BXSA 4TWWA 1W14U 3PLBA 6GCHF 1SGDE 3ZVFA 5EOKA 3T27A 3VFEA 1PQAA 3D62A 1BTZA 1NFYA 2BY7X 3RXFA 1LVBA 2A5KA 3M7TA 4X6PA 2FM2A 5JBBS 3TJUA 1CHOF 3MH5A 1XVMA 2CF9H 2XTTB 4ZKOU 3AAVA 1GGDB 2DUCA 2Q6GA 3F9EA 1ELEE 1VITH 5A8ZA 2QA9E 1YPHC 1YF4A 1FUJA 1IQMA 4I31A 2H2ZA 3BF6H 3A7ZA 3M5MA 3T5FH 3RXHA 4UE7H 1SGRE 2PHBA 1H4WA 2GDDA 1EASA 2VB0A 3V7TA 1EAXA 2J94A 3RXCA 3HGNA 5FCRA 1QRXA 2FOAA 2OC1A 4UFGH 4ABAA 3QX5H 5FHTA 1O3MA 4FU7A 5GCHF 3MH6A 1SG8B 2VIWA 1GJ8B 5HM2A 1E34B 3U1IB 3Q3KA 2V0BA 1FXYA 4Y11E 3PV4A 1MTVA 5DG6A 1P06A 1HIAA 2QF3A 3MNSA 3A87A 1FV9A 1O2WA 1MKXH 1SGFA 3NXPA 1TPAE 2EA3A 3SUGA 2NU1E 2XBWA 1XKBC 4I8GA 1GBIA 3M36A 2EI8A 1MZDA 2VVVA 3ELAH 2CN0H 4A5TS 2THFB 4FU8A 8KME2 3GDUA 2OBQA 2AYWA 3TIUA 1UO6A 2WUCA 4HGCA 2ZKSA 3P70B 2AH4X 1J14A 1OWKA 3H7TA 3CS0A 4IN1A 2VIVA 2QF0A 1O31A 4LOYH 1TNJA 4Q7YA 5A8XA 4CBNA 3GYLB 1O3NA 1UVSH 1TB6H 1AWHB 3P8OA 3ITIA 4DJZB 3GY7A 5E8EH 3RLYH 3BTTE 2B8OH 3M61U 2VWLA 1TRMA 2BYAX 1GJDB 3SOSA 1F5RA 4R0IA 4MTBA 5K7RA 3T29A 3B8JA 3SI3H 2PW8H 5E2PA 2SNVA 1PPBH 3IWMA 1TIOA 3TK5A 3R0FA 5EXMA 2PR3A 3OYPA 3RUOA 2P95A 1NY22 3UFAA 1BRBE 1TMTH 2FIRH 1O37A 3BIVH 4BAHB 4ZAEA 3BG4B 4FUGA 4XDEA 1YCPM 5FBEA 1FPHH 1NT1A 1U6QA 4GSOA 2BD7A 5GPIB 2OD3B 3PO1B 3TGJE 1OWEA 2J95A 2ZPSA 3MU1A 1Y3WA 5A09A 1SOTA 1Q31A 1EUFA 2C3SA 2FPZA 2PKSC 1MCVA 1MD7A 2NU0E 5HYOA 1KY9A 2GMTB 1CT4E 4OS2A 3BV9B 5CHAC 8ESTE 5HMAA 4AFZA 1OXGA 2Y5FA 2V6NA 4RKOB 4WVPE 1RS0A 1MKWH 4DY7B 3SQHE 4K3JA 1O3EA 1KTTB 2A2QH 2PTCE 3SJ8A 1GDNA 3EA9A 2AERH 2A4GA 1GJBB 1BMNH 1RXPA 3BTWE 5DJ7A 4AOQA 1RRKA 3SUFA 4AGKA 1O2TA 4MQAA 4OGYA 2WUBA 3S69A 4NZQA 2A4OA 4Y8YA 1ESAA 3RXOA 2YNBA 1NESE 4WXIA 1T32A 1KLIH 5AHGH 1O33A 5C1XA 2BD2A 1V2VT 3IG6B 4XBBA 2DE8A 3F9FA 3FP7E 2ZGJA 2D26C 4GVUA 2IN2A 4AFSA 2FYRA 1QRWA 4AB9A 4GCHG 2BHGA 2UUYA 4K2YA 1K1IA 5EXLA 1QQ4A 4Y7AA 1S0RA 2F9NA 1EB1H 1QR3E 1GL1A 4JMYA 4WH8A 3LU9B 3LKWA 1V2TT 2H1UA 4TWYA 4IMQA 5DP6A 1V2RT 3TGIE 1BRUP 2A7JA 3FP6E 3GY5A 5B6OA 1HCGA 4KP0A 1P57B 1BTYA 3OY6U 1K1JA 3QZRA 8GCHG 1P9SA 1FMGA 4NA8A 1NFWA 1UK3A 1JOUB 1S5SA 3L6PA 2H9HA 1EPTC 1ANDA 1GHBG 2ZCLP 1AD8H 3K2UA 2A45B 1D3DB 3TH3H 1W12U 2C4FH 5DP7A 3UNQA 3H5CB 4DW2U 1AVWA 1GHWH 4I7YH 3URDA 2C8YB 4F4OC 4X6MA 1GMCG 1XUKA 3CS7A 4H4FA 1MD8A 4CR9A 3UQOA 1RIWC 3QK1A 2XBXA 3F6UH 3KN2A 4YLQH 1D9IA 3P6ZB 3PLPA 1O2LA 4JYUH 2G55A 4FUIA 1DWEH 1QJ6B 2B0FA 1CO7E 3RXRA 1DSTA 1O5AB 3MI4A 2BQ6B 3DD2H 4NWLA 1FDPA 3BIUH 1ZHPA 3TNSA 3CP7A 1C1UH 4BOHA 2ZFSA 1TQ0B 3ZZBA 1UHBA 5FBIA 2FOHA 2ILNA 1ELAA 2HNTE 4O3TA 3PTNA 1HFDA 1C4V2 2BVXH 4BXWA 1EAWA 2ZCKP 1LVMA 1XX9A 1P2QA 3ZZ3A 1SGQE 1YPKH 1EOLA 1QIXB 3U8OH 2A4RA 3CENA 4NSVA 5EW2H 2W7UA 3FVFB 4K5ZA 1O2PA 1YPJH 2ZWLH 4AB8A 4CRGA 1GJ6A 4WY3A 2QY0B 1V2MT 4F49A 2WPMS 1SPJA 1PYTD 3UPEA 1T7CA 2HNTF 2HRVA 2XCNA 2Z94A 2A1DB 4MPWA 1K1MA 4NFFA 1WQVH 2BDAA 1G3DA 7KMEH 3U98H 1P09A 1DICA 4B2BA 1TNIA 2VWOA 1QL7A 2ZQ1A 5I25A 1DY9A 3OTJE 2YOLA 2W7SA 1AFQC 1OWIA 3LGWA 2F91A 2KAIB 4X2VA 2R3YA 1CA0C 3SGAE 2A32A 2WV5A 2PKSB 3PM3A 4OS7A 1THSH 2B5TB 3SUEA 5C5OA 5CE1A 1DXPA 3TLOA 3GICB 3QTVH 4WWYA 5F6MA 3MNCA 1ABJH 5BPEA 2VNTA 1SGIB 1PPZA 1O2SA 1C5LH 1P05A 3MH7A 1EJNA 2WYGA 3SU0A 2FEQH 2P3TB 1ZSKA 2AMQA 3GCHC 4X6OA 5JB9S 2J34A 3SNDA 2BLOA 2F83A 3QLPH 1WCZA 1O2QA 1EOJA 2WV4A 3SHCH 4YZUA 3RMLH 1HAVA 2GZ9A 1VCWA