1BJVA

Beta-trypsin complexed with appu
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords BETA-TRYPSIN
publication title Oxyanion-mediated inhibition of serine proteases.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bjvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bjvA02
4NIXA 1EJAA 3LGYA 7ESTE 3MO6A 4NG9H 1GVZA 4ZMAH 1ETRH 3ZZ4A 1LVYA 1EP5A 1KXCA 3K6YA 4X2WA 3ZZ8A 3ELAH 1HB0B 3V13A 1O2TA 1K2I1 3A8CA 5EU8A 1MTUA 3H7OA 3GICB 1AB9C 1GVKB 1QRXA 3M5LA 3RXMA 2C90B 3S9CA 5DG6A 4I8LA 2XNIA 2UUJB 3HK3B 1TQ0B 1MTVA 2UUKB 1QL9A 1O5FH 4INHA 2ULLA 5EXNA 3RLYH 2BDGA 3KQCA 3SV9A 1GBFA 1QL8A 2ZQ1A 5GIBA 3KN2A 1KTSB 1TGCA 4I7YH 2HRVA 4Y0ZE 2JETC 2UWPA 1P3CA 4Q2KA 2BYAX 1B5GH 1QJ7B 2BY5X 2ZFQH 1QRWA 2Z9IA 3ZVEA 4Y7AA 1QFKH 1ZSLA 2FEQH 4DJZB 3LC5A 2QN5T 1BRCE 3ITIA 4YO9A 3T5FH 3GY6A 5EODA 2BD9A 3ESTA 5DP3A 1O3AA 1YBWA 1GBLA 2XC4A 5E8EH 4Y8YA 4MDSA 1O2OA 1Y5BT 2A5KA 4BTIB 1BTWA 3M3SA 3SV2H 1CA0C 4IGDA 1H9LB 4ABHA 2HGTH 1LHGH 1DS2E 2H2ZA 2B7DH 2FLRH 2C8ZB 1DANH 4DY7B 1YPEH 2HOBA 4AG2A 2ZFPH 1CHOF 3SGAE 3VGCC 2RA0A 5A2MH 1AKSA 1PPBH 1U6QA 4DGJA 1DUAA 1JBUH 5IDKA 3GOVB 2PSYA 5LH8A 3W95A 9ESTA 1UTJA 1O2UA 3SN8A 2EI8A 1TNJA 3QTVH 5DP4A 4BAMB 3LOXA 2FS9A 2OC0A 5TCAA 2B0FA 5H4IB 4JZ1A 2WYGA 5EPYA 4ZKNU 1INCA 2H9TH 4CRGA 4RKOB 1C5LH 5TJXA 4Y7BA 1A2CH 4QT8C 2M5TA 4XSKU 3P8GA 1WTHD 2FI3E 4I8KA 3V3MA 1OSSA 4AG1A 1W0ZU 2R2MB 4X8TH 1FAXA 2CMYA 2GCTC 3PTBA 4FVBA 1TGSZ 3M3TA 5SGAE 3OU0A 3TITA 1Q3XA 1D3PB 2NU1E 3RXFA 2BQ7B 1DDJA 3FP8E 1O5AB 2IN2A 4MTBA 3TH3H 3O8BA 2PGQB 3GY5A 1SFQB 1YGCH 1EAXA 3AASA 3ZZCA 3QUMP 3P92A 4D7FA 1MZAA 3EDXB 4BANB 3ATKA 2ZNKH 5EOKA 4DIIH 2BMGB 1S82A 1QTFA 1AUJA 1OWJA 2WPHS 3UUZA 1AD8H 4NA8A 3GCHC 4MVNA 3BTQE 4YZUA 2ODYB 4A7IB 4YM9A 2FIRH 2J92A 5L30H 1P03A 1VCPA 2SGDE 4BXWA 1RFNA 3F9FA 1ZGVA 2J4IA 3M5MA 5DKMA 4J1YA 4CHAC 4X1SU 1W11U 1W3CA 3UTUH 1MTNB 5GWZA 2A4RA 4IC5A 1CBWB 1TIOA 3GCNA 3FFGA 1SMFE 1P12E 2K1QA 4ISLA 3O8DA 4DOQA 5FCRA 3GY2A 4A6LA 3I29A 5G4BA 2AGGX 2GZ8A 1AWHB 1GJ4H 1O0DH 1YPGH 1EPTA 3UY9A 5T6FA 2BY8X 3GYMA 3ZYDA 5LPFA 1RS0A 1LVOA 1CSOE 5GCHG 1OWHA 2QXGA 1IHTH 1L1JA 3BTME 4MNVA 4Y8ZA 3MU1A 3U8RH 1MQ5A 1GG6C 1YPKH 2HWLB 1UTQA 3BTGE 4MPXA 3ZVDA 3ATMA 3SU1A 1Z1IA 1SC8U 2VWNA 1DXPA 1RD3B 5GXPA 3OY6U 1A0LA 1KLJH 1G2MA 3E1XB 3NK8A 2AERH 1GGDC 2XBWA 4Y6DA 4TWYA 2FESH 1QIXB 2A1DB 1MU6B 1TNHA 1DWCH 1C5RA 1CA8B 1EJMA 3ATLA 3SQHE 1MU8B 1AQ7A 3KIDU 2R0KA 1DY8A 1BTYA 1O2NA 4A1XA 2FP7B 2ZG0H 4K60A 1GJCB 1IQHA 2PGBB 2O8TA 3F9EA 1C1UH 1SI5H 2OQUA 2Y5HA 4WJG2 1QR3E 1HUTH 1BTHH 1ESAA 1YLCA 3LJJA 2OLGA 2NU2E 5DPAA 1FY5A 3BIVH 2OTVA 1PPHE 3UOPA 1OPHB 1XVMA 2CF8H 4ZKSU 2SNWA 1LPGB 1Z8GA 1CGHA 3RXPA 3SNCA 3GDUA 3P8NA 1NC6A 5F8ZA 2XXLA 5AFYH 4K1TA 3RXCA 2Y82A 1M9UA 1NFYA 5DP5A 1HAPH 5EXLA 1BDAA 1B0EA 1JMOH 1MUEB 2UWOA 1MAXA 1P2MA 3L6PA 4ZUHA 1XUJA 2WINI 1AVWA 3I78A 1NU7B 3ZVBA 3STIA 2XC0A 2GMTC 3TGKE 3A7TA 3HPTB 2FYQA 3RXHA 1W12U 2WUBA 1PYTC 4YTAA 1GVLA 2FDAA 5PTPA 1GHBG 2VIWA 3W94A 1C5OH 2XTTB 4LZ4B 1BOQA 3A7ZA 1HJ8A 3T27A 3S69A 1NN6A 1C1VH 2AH4X 4Y0YE 1W14U 1T31A 5EQQA 1ELGA 5A8YA 2WPMS 3HKJB 1NRPH 1YCPM 2AIQA 2QY0B 1DWEH 2C93B 3DFLA 1O3NA 4AGKA 1CHGA 3PMBB 2A31A 3A89A 4WMDA 2G5VA 3URCA 2D8WA 2UUYA 3BG4C 1GDQA 1OXGA 2PUXB 1ELBA 3EAJA 5BPEA 5JBCS 1IQMA 2W3KA 3TJUA 1YYY1 1OWIA 1RRKA 4ZROA 2WUCA 1L0ZA 3VB6A 3NZIA 1ZZZA 5GCHF 1E34B 2G55A 1ELAA 3FP7E 2ALVA 3BG8A 3MNBA 1ZJDA 2VWMA 3MNSA 4JZFH 2CF9H 1GCDA 4CREA 4O9VA 3D65E 1NESE 5EQRA 1DSTA 1IOEA 4WXVA 2XC5A 3SQEE 1SL3A 4I33A 3I77A 4AX9H 5C5OA 2BZAA 4CRFA 1GBHA 1BMMH 1ZTKA 1C2HA 2VIDA 1QGFA 3T26A 2CN0H 1EATA 4FU7A 1K9OE 2STBE 1IAUA 3AVZA 3AW0A 4FUBA 4YLUA 4FUDA 2XBVA 2V3HH 4NZQA 2O8LA 4NWLA 2Z7FE 4UDWH 1O35A 3TK5A 4F49A 1K21H 1BHXF 2H9HA 1P05A 1MCTA 1B7XB 1ANDA 1HDTH 2SGQE 3A83A 4WY3A 3RXJA 3SV7A 3RXTA 1W13U 1Q2WA 1BIOA 3GY7A 2ANWA 2SGEE 1EX3A 2PKAA 1F2SE 1O33A 1AFQC 1BT7A 1ETSH 1QL7A 2Q6DA 4O3UA 2BY6X 3URDA 2QAAA 2GP9B 2ANYA 1QQ4A 2BDYA 1TPAE 4NA7A 1P9UA 2HALA 2O8UA 1SGNE 1BTPA 1NPMA 2QV1A 1FXYA 4LXBH 3Q3XA 2Y7XA 4UONA 1ELCA 2CXVA 3LC3A 1N6XA 1RGQA 1TX7A 2CJIA 4IBLH 4AN7A 4NIYA 1JXPA 4GCHF 2ZI2H 4X8UH 5DP8A 1V6DA 1ELFA 5JBAS 1GHBF 3DUXH 3MYWA 3OY5U 1HRTH 5F03A 3SJKA 1LQEA 1A46H 1PPZA 2H5DA 2OQ5A 3ATIA 3TH2H 1C1NA 4YT6H 1EAWA 1UVUH 4RKJB 1P2QA 1PPCE 3MO9A 3LGIA 3M35A 1S84A 1RIWC 3MH6A 3M7UA 2AFQB 3BTDE 4ZKRU 3ZZ3A 4IMQA 5C5NA 3RP2A 2A5AA 1N1LA 3A88A 1D9IA 2QXIA 3BSQA 2B8OH 1O37A 1TBRH 4ABGA 5L2YH 3RXDA 2Z6BD 1GHVH 4R8TB 4IN2A 1MCVA 1S5SA 3RXVA 2PTNA 1P06A 3VB4A 1RTKA 4Y71A 3RUOA 4AGJA 2R0LA 2FOAA 2ZDKA 1GDUA 2OBOA 4CRBA 4JK6A 1O3JA 2G81E 2FI4E 3VPKA 4VGCB 3TK9A 1Q31A 3SU2A 4WVPE 1NZQH 2EI7A 2GT7A 1C4V2 1FQ3A 1SGYE 3PWCA 1XMNB 1L4DA 3A87A 1FN8A 2G51A 4U2WA 3VB3A 2PTCE 2AMQA 3UWJH 4MNWA 2Q6FA 3DFJA 1EZXC 2P8OB 3E16B 1Z6EA 2ZQ2A 3D23A 4UFEH 4X2VA 4E06H 1ZPBA 5GJ4B 1MH0A 2A7HA 2IOTA 5CMXH 3BEUA 1A0HB 3D62A 3TGJE 3SGBE 2BX4A 2ZECA 4JZIA 2QA9E 4OGYA 3AAUA 5I46H 3PLPA 1JIRA 3K65B 1ETTH 1HXEH 3BTFE 1UTKA 1SBWA 1GBTA 1VCQA 1P2NA 1ZPCA 2O9QA 2ZGXH 4BAKB 1O2SA 8KME2 3LKWA 4AFZA 1O2MA 1FIWA 1FZZA 2ZDAH 3RC5A 3HK6B 5HMAA 2G4UA 1LO6A 3BF6H 6GCHG 3QLPH 1C5WB 1FY4A 1YPMH 3FZDA 1V3XA 1ARCA 4NZLA 2G00A 1P11E 1UO6A 1EP6A 1C5QA 1HJAB 3JZ1B 1J17T 1EQ9A 1ABJH 2XWAA 2AMPA 2C4FH 1W2KH 4O97A 1O3HA 2PFEA 2JH6D 4PROA 4U30A 1SGTA 5DK1A 5FPSA 2FPZA 5BRRE 2EC9H 1Z71A 2CV3A 4TWWA 1MKWK 1ZJKA 4TPIZ 5EXMA 4ABEA 2ZGBH 2ZU1A 3T29A 2ZP0H 3RXOA 1AB9B 3RC6A 1YPHC 1D3DB 2VH6A 1BZXE 4WH6A 4LZ1H 4H4FA 1O3BA 1HAIH 1BRBE 1GI9B 1GHZA 1HGTH 4YOGA 3AW1A 4I32A 3ZZBA 1O2JA 3U1IB 3LGTA 1P3EA 1UTPA 8GCHG 5EQSA 1HAVB 2FOMB 1JWTA 3A8BA 2GV6A 5FPYA 3BTTE 2PHBA 2F9NA 3NWUA 2OC1A 5L2ZH 1AN1E 1TNIA 5B6OA 4JYVH 3M7TA 2FWWA 1DWBH 2QIQA 4IN1A 2JETB 1GHWH 1S83A 3HATH 1DXWA 3HGNA 3S7KB 1C2GA 1SHYA 2A2XH 4KTSA 3HGPA 1O2QA 3F9HA 2RDLA 2GDDA 3BTWE 5EG4A 1G3CA 1FIZA 1NFUA 2PKSC 1UTOA 3IG6B 3FAOA 4YLQH 1Z6JH 2A4OA 3F1SB 4JZDH 1PQ7A 1O5CB 4AZ2B 1MTWA 4K5ZA 2AGEX 4X6PA 1DLEA 1P01A 3DT0H 1V2NT 4B2CA 1ZMJA 2XCFA 4CH2B 1CGIE 1TFXA 4THNH 3SU4A 2BHGA 2W7SA 3UPEA 2WYJA 1ACBE 1ELVA 4IW4E 2ZKSA 3LDXH 1ZSJA 4HGCA 1THPB 1WTGH 4OS7A 2TGDA 3VGCB 3PROA 5HXFA 1P04A 2B5TB 2B9LA 2HNTC 1NFXA 1K1JA 1O34A 1O3FA 1EASA 1OP0A 3AAVA 1AU8A 2BDCA 3U69H 5EW2H 1QHRB 1QJ6B 1UK3A 3RXSA 1GMDF 1XKAC 2Z3EA 1HYLA 1J15A 1JRSA 2A4QA 3SNBA 1A3BH 4OS4A 7GCHG 4ABBA 8LPRA 1GBDA 3KQEA 4HZHA 2A0QB 3TNSA 1TLDA 1ELEE 3G01A 2Y5FA 1TBZH 4Y8XA 1NRRH 2H5CA 1P9SA 1GMCG 3MU5A 5GDSH 1O3DA 2ZCKP 1V2TT 1OYQA 4O3TA 1SVPA 2GCTB 1SQAA 4FUIA 1VGCC 1ZMNA 2A4GA 1XKBC 1O2PA 4B76A 1SGDE 3DD2H 1AE8H 2P3UB 1V2UT 1VJAU 3EA8A 1O3PB 1EOLA 1HCGA 1PJPA 3GY3A 1O3CA 3E6PH 1C5TA 2W5EA 3E91A 4MG3A 2FOHA 4NSVA 2JKHA 4DIHH 1FY8E 1XUKA 3RXRA 2XBXA 2P59A 5AHGH 2QGRA 4RN6A 1LCYA 1GBBA 1SB1H 3UNQA 5HM2A 4DURA 3PMJA 2OC8A 3RU4T 3GCHB 5C1XA 2W7UA 2GKVE 2ZHFH 3P8FA 1Y3XA 3RXUA 5DP6A 4CRCA 5JPMH 3U9AH 4X2YA 4CRDA 4I31A 2FZZA 3OYPA 1P2KA 1H8IH 1V2LT 2C3SA 2QC2A 3QGNB 3EE0B 2OD3B 2VGCB 4K1SA 2VVUA 2QXHA 4XBBA 1KLIH 1GBMA 1HAZB 2VVVA 1KIGH 1V2RT 4ISIH 4J2YB 1BHXB 1CBWC 1D4PB 3BEFB 2ALPA 3RXAA 3Q77A 1WCZA 3UNRA 1O5DH 2XCNA 2FLBH 4BOHA 3UNSA 4E05H 5E0HA 2ZGHA 2BD2A 4OS6A 4BXSA 1EAUA 3SU5A 1C1RA 1TONA 2Q1JA 2WV4A 3VEQB 3SJIA 2F9PA 1QJ1B 1DICA 2G5NA 5C1YA 5JB9S 2YOLA 1V2QT 6CHAC 1OWEA 3SBKA 2TIOA 1ANBA 3LIWA 1FAKH 4AFQA 4B73A 1GG6B 4D9QA 1VITG 2AMDA 1HAHH 5C3NA 1HAOH 1F7ZA 1G3EA 1V2OT 1T4UH 3TH4H 1MTSA 5ESBA 3CS7A 2RG3A 1SGEE 2GTBA 2QYIA 1GGDB 3P6ZB 1LDTT 2FX6A 2V6NA 1EPTC 2VINA 1GPZA 4H42U 1L1GA 1YPHE 1QBVH 2OBQA 3MNXA 1FLEE 5FHTA 2BQ6B 4JCNA 1F5KU 2ZTXA 3VXFH 2F9VA 2Z9LA 1O2HA 1D6WA 2VVCA 1FN6A 4IMZA 1K1NA 4R0IA 3QGJA 2OUAA 3QDZB 1O3OA 4CR9A 4K8BA 1IQKA 2BDBA 1PQ8A 1IQJA 1AUTC 4FUJA 1ID5H 2ZEBA 5EPNA 2CGAA 4OGXA 2VWLA 1P2JA 1GMCF 4YT7H 3UQVA 1FDPA 1MKXK 2OP9A 4LOYH 1TNKA 3IITA 1G32B 2F9OA 4X8VH 2QXJA 3PB1E 1N8OB 5I25A 3A8DA 2SGPE 1VITH 2QF3A 3QTOH 2AYWA 3SHCH 1WBGB 3VB5A 1LHDH 6LPRA 1JRTA 3SV6A 3PLKA 2ZPRA 4NCYA 1O39A 3MU8A 2WPKS 2BOKA 5FX5A 1P8VC 2GMTB 4D9RA 1O3EA 1UVOA 1V2JT 2WPJS 5DO4H 3SW2B 2G8TA 1PPFE 2FMJA 1D3TB 1V2VT 1AFEH 1GBJA 2H6MA 3NKKA 2OCVB 2PV9B 1NRSH 2GCHG 2NWNA 1AZZA 3K9XB 2GZ7A 1AI8H 2PW8H 1C2FA 1SLUB 1XX9A 1ZOMA 3KQDA 3MMGA 1UK4A 4K69A 1C1TA 3LH3A 4KP0A 5A8XA 4U32A 1TA6A 1EUFA 2ZCLP 4WF8A 1C5MD 1IHSH 2J9NA 3A7WA 3LU9B 1QBNA 3SORA 1GMHG 2HLCA 3PO1C 4FVDA 1G9IE 1UTLM 4FU9A 2ZPSA 3MHWU 2GZ9A 2ZCHP 3TGIE 1Y3UA 2BTCE 1V2MT 1TPOA 1WU1A 1GJAB 4MPVA 4A92A 1BMAA 2R2WU 2FI5E 2PUQH 2ZA5A 3MH5A 4NGAH 4Y76A 1MKWH 1NU9A 3FVFB 1C5NH 3S0NA 1G36A 4Z6AH 6ESTA 1Y5UT 2CHAC 3H7TA 3SUGA 1QQUA 2PR3A 1QB6A 2BD4A 1SOTA 3M36A 2R3UA 4DG4A 1EB1H 1H8DH 1KDQB 3KNXA 4XFQA 4BNRA 1HLTH 1YM0A 1O2KA 3ODDA 3RXIA 1GCTC 2R9PA 2P3TB 1A3EH 3OX7U 5FBIA 4XOJA 4X1RU 1UK2A 1LHEH 1V2PT 3GY4A 3RMMH 3PM3A 1SFIA 1UCYE 1ZR0A 5AFZH 1YPLH 3U98H 1BBRE 3SI4H 2WPLS 1OYTH 1BJUA 3OSYA 2ZU4A 4GUXA 4YOIA 1BTUA 5J4SA 4XBCA 2Q6GA 2OXSA 2Y7ZA 2F91A 1XUFA 2Y5GA 1A5GH 1DWDH 3ZVFA 5FBEA 2H1UA 3ENSB 4ZAEA 1SGRE 4Y79A 2BX3A 1KTTB 1ZMLA 3K6ZA 1ZSKA 4MPWA 3DA9B 2TBSA 1HAXB 1GJBB 1JIMA 4B74A 1G2LA 1MBMA 3E0NB 2XW9A 3SHAH 1HAGE 4X6MA 1CO7E 2XWBI 4WMEA 1ZGIA 1AMHA 5E2PA 4FU8A 3R3GB 3ZV8A 1F5LA 2ZDLA 1P10A 4BAOB 4IC6A 2ASUB 2BLVA 1HAYB 1NT1A 5TCCA 1SGFG 4Y10E 2I6QA 3KL6A 1HIAA 3TPIZ 1HXFH 3B9FH 7KMEH 3P95A 3PYHA 4ZKOU 1AZ8A 1W8BH 1YC0A 3N7OA 1SLXB 1OKXA 1X7AC 2W3IA 1QB9A 1TOCB 1O2YA 1J14A 1DPOA 1GL0E 3QWCH 1DT2A 1OS8A 1OOKB 4INLA 4OS2A 2ZTYA 3TJVA 5IYTA 2LNCA 4AB8A 5HM9A 1YCPK 1C5ZB 2BVSH 1T8NA 1HIAB 1SR5C 3FANA 2P3FH 1AHTH 5CHAC 4ASHA 2UUFB 4KELA 1C2IA 4JZEH 1K28D 1RIWB 5F8XA 1RTFB 1GMHF 3SZNA 1EB2A 2BDIA 2F9BH 1V2WT 1C1WH 1KYNA 3PTNA 1G3DA 4I8GA 5FAHA 5A0CA 4U01A 1BRUP 4NFFA 4DCDA 5LPEA 1TRYA 2FM2A 1EAIA 2LPRA 5EGMA 4Z0KA 4ABFA 3BEIB 4HI3A 4INKA 4X6NA 1WOFA 4GSOA 4ZH8A 1BB0B 3GISB 1DVAH 4ESTE 1QURH 1OP8A 2J95A 2VIOA 1KXEA 2ZGJA 1VZQH 3A85A 1C5SA 1EOJA 1MBQA 1WYKA 4K1EA 4UFFH 1T8LA 1TMUH 5T6GA 3STJA 7LPRA 2ANKH 3GDVA 1A4WH 4A5TS 1C4Y2 2ZZUH 1GI5A 1HNEE 1S81A 1FY1A 2XBYA 1LPKB 1TGNA 5ESTE 1FONA 3QO6A 2Y6TA 2QCYA 1FPCH 2XYAA 3RXBA 3SGQE 3Q76A 2AIPA 2BD3A 4TYDA 1C1QA 1O5GH 3WY8A 2ZU3A 3KHVA 1SQTA 1UCYK 1CT0E 5FPTA 1SLWB 2C8XB 1DM4B 2FOBA 3PMAB 4JMYA 3SJ8A 4ABAA 2ZU5A 1QA7A 2PLXA 2FYRA 1BBRK 1A5HA 2BD7A 2ODPA 2SNVA 1LQDB 5E0JA 2VWOA 4B2BA 3RC4A 1GBCA 1BITA 1C1PA 3ZZ9A 1O3KA 3P70B 3RM0H 1ZRBA 3E0PB 3SNDA 1RJXB 1ZLRA 4Q7XA 3ZVAA 4Q7YA 5E2OA 2ZFFH 2D26C 2ZO3H 1C2JA 1TMTH 3EA9A 1DOJA 2Z9JA 3LJOA 2GVFA 1J16A 1TGBA 1C2EA 1O2LA 2ZIQH 4B75A 2G52A 1VR1H 2VIQA 4NSYA 2G4TA 3CENA 2VNTA 1HAVA 1HJAC 4UE7H 1BTXA 2ZU2A 3FZZA 3L33A 2ZHDA 3CP7A 3LT3A 1ESBA 1IQEA 3C1KA 1MQ6A 3A82A 3EA7A 1VJ9U 2BLOA 1ANEA 4HFPB 5JYIA 3TIUA 3O8RA 2DE9A 4D8NA 1IQNA 4YOJA 2BDHA 3UQOA 2C8WB 1TABE 1NFWA 1HV7A 2EI6A 2ILNA 3C27B 3NXPA 2THFB 3M3VA 1K22H 4DW2U 1TNLA 1MKXH 2J38A 3RLWH 3MWIU 4AORA 1ZHPA 4UD9H 4X0WU 3RMOH 1TAWA 4CRAA 3A80A 1IQLA 4XE4A 2P94A 1GJ7B 3F68H 1ELDE 5AVDA 1THSH 4CBNA 1CGJE 2NU0E 3BTKE 3RM2H 2F3CE 3RXKA 3SU6A 1KXFA 1XUHA 1BCUH 1TGTA 2UWLA 2Z9KA 3A81A 4DT7B 3A7XA 2P95A 1NO9H 2XRCA 1K1PA 2Y80A 2PKSB 3SU0A 5F8TA 2FTMA 1TX8A 1NRQH 3MH7A 3ZVCA 1CA0B 1BA8B 1Z8RA 4NIVA 3TU7H 3A84A 1DUEA 4ZXXH 1H1BA 1YP9A 2ZF0H 1RXPA 1NM6A 1Y3YA 2TGPZ 1WSSH 2ZDNA 1V2KT 1K1OA 5A0AE 1G30B 1YPJH 3S9BA 1O2IA 1CVWH 3ZZ5A 2FOGA 1A5IA 1W7XH 1ZRKA 2WV5A 4OS1A 3BTHE 2I6SA 3TJNA 2IPHA 4ABJA 1UTNA 2GX4A 1Y5AT 1O30A 1A0JA 1PPGE 3MI4A 1YF4A 4X1PU 4F4OC 3T2NA 1TRNA 1ZHRA 1GI0A 1A7SA 1XXFA 3MU0A 3ZZDA 3B23B 4BAHB 3P8OA 1SHHB 6GCHF 2WPIS 1P02A 5DJ7A 1TB6H 3BN9A 1UVTH 3M7QA 4CH8B 3T62A 4O03A 3TLOA 3GCOA 3S7HB 4WWYA 1AKSB 1JOUB 2R3YA 1A61H 4X2XA 1GBIA 4X6OA 2EA3A 5JBTA 3ZV9A 1H9IE 1VGCB 3KF2A 1GBKA 4XBDA 1T7CA 5HGGA 3M5NA 1GHYH 3SNEA 2AS9A 2ESTE 2OC7A 3RDZA 1B0FA 1EXFA 3HKIB 5CE1A 4FUEA 5DP7A 3ZYEA 2Z9GA 3QZRA 4WMFA 1P57B 1N6YA 4GLYA 2STAE 3OTJE 2QF0A 3LH1A 3QK1A 1YKTA 2ZFRH 1DE7H 4M7GA 5E0GA 1EZUC 1C2KA 4LK4A 2VH0A 1TOMH 4ISOA 5C20A 4CHAB 1MAYA 2FXRA 4Y11E 2P93A 3T28A 1DSUA 4UFGH 1G37A 1MTNC 3EQ0H 8GCHF 3K2UA 1T32A 3FP6E 4ISHH 1XXDA 2GD4B 4MLFB 1IQGA 1E0FD 1C9TA 1ZYOA 1L2EA 1GHAG 4BTUB 3LGVA 2VGCC 4OS5A 1OP2A 2JH5D 2Z3CA 3GY8A 3EYDA 1CQQA 1Z8JB 1SG8B 1T8OA 2JH0D 3MU4A 3M37A 1SQOA 2ZHEH 1VCWA 3E3TA 5K7RA 2DE8A 1QB1A 2BD5A 1C5PA 1MMJN 1UVPA 4UEHH 6CHAB 1C5YB 2TPIZ 3UOUA 1Y3VA 3GCTG 1GJ6A 1TWXB 2NU3E 1O3GA 3GYLB 5T6DA 3UIRA 4MNYA 3A7VA 2A7CA 2ZFSA 1YCPH 2PWXA 3SJOA 1PPEE 4GPGA 4FUFA 1AO5A 4FUGA 4GHQA 1O2WA 1UVSH 1C5XB 1O3MA 1FJSA 1WV7H 2F9UA 3RXEA 3NCLA 1J9CH 2FOFA 5A09A 2YNBA 1EPTB 1F0SA 5ABWA 2BD8A 1GI1A 2YNAA 1QNJA 1O5BB 4I8HA 4KGAA 1Z8IB 3LONA 1SLVB 2W26A 1FV9A 3F6UH 4B2AA 2FOCA 1C5VA 1Z7KA 3MTYA 1C2DA 1NTPA 1O2VA 1TYNA 4HTCH 7GCHF 1S0QA 5FXLA 4X1NU 4Q7ZA 1QY6A 1KXDA 4NWKA 2D1JA 2VJ1A 4FUHA 1KXBA 1SGCA 1FMGA 1H9HE 4AYVB 1EKBB 3SOSA 2BZ6H 4FUCA 3U8TH 1O2ZA 8ESTE 1DFPA 4D7GA 1C9PA 3Q3YA 1HFDA 2TRMA 5A0BA 2FO9A 1DY9A 3S9AA 1LHCH 3F9GA 2J34A 1ABIH 4D76A 3PV4A 2ZGCA 1F0RA 2VIVA 2V35A 2EEKA 5HYOA 1HJ9A 1SOZA 3BIUH 2FX4A 1GJ8B 1G3BA 1LHFH 2V3OH 3KCGH 3NPSA 1MD8A 4KKDA 1UMAH 2O8WA 1BTZA 1TQ7B 1C1MA 3SUEA 1GWAA 3M61U 1F0TA 3RU4E 1GDNA 1PQ5A 1N8OC 1TE0A 2ODQA 2ZWLH 1LVBA 1GI6A 3Q00A 4AFSA 1K1MA 2ZC9H 1TRMA 4KTCA 1WAYB 1O2XA 1RTLA 2BM2A 3UWIA 4TPYA 1O2RA 4AFUA 1Y8TA 2D2DA 3SNAA 1ZPZA 1OWKA 1UCYH 4AB9A 1D6RA 2ANMH 4SGAE 2HNTE 3O8CA 4A1TA 5F6MA 1S0RA 1BBRH 1WQSA 1L1NA 1W0YH 3V7TA 2HNTF 4GCHG 2FTLE 1K1LA 5J4QA 4XDEA 4NA9H 3KQBA 4GAWA 5LGOA 5JBBS 9LPRA 1SGIB 1SGQE 1CT2E 3ATWA 3PLBA 1GI7B 3UREA 2RCEA 2BY9X 2J2UA 3RU4D 2ZDVH 1FUJA 3V12A 5C2ZA 3BG4B 1WUNH 1KDQA 1ORFA 1GHAF 1SGFA 3JZ2B 4KTUA 3PO1B 3SI3H 1OWDA 1SGPE 1E35B 5FCKA 1EJNA 1AIXH 1XUIA 5DP9A 1DITH 2ZTZA 3QN7A 1TALA 1QA0A 1S6FA 2A2QH 1GHXH 1IQFA 1P0SH 3ODFA 1Y3WA 2GT8A 1LVMA 4H6SB 1VITF 3PWBA 3GCTF 1LMWB 1ZTLA 1FPHH 1QBOA 2CHAB 3CS0A 3ZZ6A 2BOHB 4JYUH 2VIPA 2C8YB 1S6HA 3H5CB 5L6NH 3ZVGA 1TNGA 2KAIA 5C1UA 1QCPA 2ZPQA 3LGUA 2BQWB 3EGKH 1C5UA 4MPUA 4ZHMU 1EZQA 3T25A 2ZHQH 1GCTB 2BLQA 1TBQH 2BXUH 1ELTA 1XUGA 1XVOA 1ZTJA 2RA3A 3DHKH 5LPRA 1CE5A 2H9EH 3R0FA 4Q80A 1C1SA 3TNTA 1K1IA 3UFAA 2Z94A 2J94A 5K0HA 1GJ5H 1E38B 2BVXH 1ANCA 1GJDB 2A7JA 3QZQA 4DVAU 2KAIB 4I8JA 4NFEA 4JK5A 1NROH 4MNXA 1AE5A 3IWMA 1O32A 2GV7A 1FNIA 1T8MA 4ZHAA 1V2ST 2FODA 1E36B 2BB4A 2GGVB 4IS5A 2DUCA 1BRAA 3L3TA 3A7YA 1AFQB 1GI8B 1C1OA 4K3JA 1Y59T 3E8LA 3U8OH 1NY22 1GI3A 1UHBA 2O8MA 3MFJA 1P09A 1A1RA 2HPPH 3QX5H 2VU8E 1IQIA 1ARBA 2SGAA 4BTTB 1O3LA 1YLDA 4CR5A 1Z1JA 5GPIB 1WQVH 1HBTH 1O3IA 3SU3A 1BJVA 4TY6A 1TA2A 4ZHLU 1GI4A 1F0UA 5FX6A 1AY6H 1HPGA 2BY7X 4E7RG 2FOEA 2FS8A 1F5RA 2AGIX 3PMHB 1L4ZA 1O2GH 4FXGH 2GCHF 1UHBB 4NIWA 2VB0A 1C4U2 3UR6A 1P2IA 3V0XA 2PKAB 4UFDH 2ZFTA 4WH8A 2BVRH 3D49H 3TVJB 1KXAA 2A45B 1E37B 1ZHMA 4TY7A 3U1JB 3LPRA 5JB8S 2IJOB 1O31A 1GBAA 1TX6A 1DLKB 5CHAB 3RXGA 4ZXYH 2Z3DA 3B8JA 4MQAA 5C67A 2Y81A 3TK6A 4ABDA 1MZDA 1NS3A 3MO3A 1BMNH 3LGWA 5ETXA 1GJ9B 3GDSA 4GVUA 1O5EH 3M5OA 4K8YA 3ZZ7A 4GHTA 1BUIA 1ESTA 1PFXC 3Q3KA 3A86A 4B71A 3BTEE 3KEEA 3VFEA 1LTOA 1D3QB 5AF9H 4A1VA 1XM1A 3BV9B 2BLWA 4AYYB 1KSNA 4RSPA 3RMNH 4BAQB 3VB7A 2BXTH 2ZDMA 1LKBA 1J8AA 1AVXA 1SSXA 4VGCC 3SUDA 3SV8A 1GL1A 4JYTA 1PQAA 1SPJA 4CBOA 2NU4E 2F83A 2BDAA 2A32A 2TGAA 4X8SH 1EZSC 4YESB 2ZHWH 1BMLA 1S85A 5T3HA 2SFAA 3MNCA 3TJOA 2PSXA 1W10U 5DGJA 4AOQA 1W7GH 5EW1H 4ABIA 1CHOG 1UJ1A 4WXIA 3VXEH 2P8OC 1P2OA 5A8ZA 3P17H 4K2YA 2P16A 1FY3A 1GI2A 1T4VH 3ZZAA 2TGTA 3SO3A 4E7NA 1TPSA 3RXQA 1O38A 3SJ9A 3RMLH 2SGFE 3SUFA 2OINA 1LPZB 5JDUB 2HPQH 1UTMA 1OX1A 3UR9A 4SGBE 1GBEA 1NRNH 3E90B 1FI8A 3MH4A 1TMBH 1C2LA 1DX5M 2AEIH 4X1QU 1O36A 2HVXA 1H4WA 1GMDG 3MOCA 3A8AA 1LKAA 1THRH 2V0BA 3KGPA 4B1TA 1KLTA 1PYTD 1AVGH 4ISNA 1F92A 2A5IA 1C2MA 1KY9A 4H6TA 1CU1A 1BQYA 1AGJA 1TPPA 3RXLA 1AWFH 1QRZA 1CT4E 3NUMA 2GDEH 1MD7A
chains in the Genus database with same CATH superfamily
4NIXA 1EJAA 3LGYA 7ESTE 3MO6A 4NG9H 1GVZA 4ZMAH 1ETRH 3ZZ4A 1LVYA 1EP5A 1KXCA 3K6YA 4X2WA 4FETA 3ZZ8A 3ELAH 2YMSB 1HB0B 3V13A 1O2TA 1K2I1 3A8CA 5EU8A 1MTUA 3H7OA 3GICB 1AB9C 1GVKB 1QRXA 3M5LA 3RXMA 2C90B 3S9CA 5DG6A 4I8LA 2XNIA 2UUJB 3HK3B 1TQ0B 1MTVA 2UUKB 5DN6D 1QL9A 1O5FH 4INHA 2ULLA 5EXNA 3RLYH 2BDGA 3KQCA 3SV9A 1GBFA 1QL8A 2ZQ1A 5GIBA 3KN2A 1KTSB 1TGCA 4I7YH 2HRVA 4Y0ZE 2JETC 2UWPA 1P3CA 4Q2KA 2BYAX 1B5GH 1QJ7B 2BY5X 2ZFQH 1QRWA 2Z9IA 3ZVEA 4Y7AA 1QFKH 1ZSLA 2FEQH 4DJZB 3LC5A 2QN5T 1BRCE 3ITIA 4YO9A 3T5FH 3GY6A 5EODA 2BD9A 3ESTA 5DP3A 1O3AA 1YBWA 1GBLA 2XC4A 5E8EH 4Y8YA 4MDSA 1O2OA 1Y5BT 2A5KA 4BTIB 1BTWA 3M3SA 4M9FA 3SV2H 1CA0C 4IGDA 1H9LB 4ABHA 2HGTH 1LHGH 1DS2E 2H2ZA 3WW7A 2B7DH 2FLRH 2C8ZB 1DANH 4DY7B 1YPEH 2HOBA 4AG2A 2ZFPH 1CHOF 3SGAE 3VGCC 2RA0A 5A2MH 1AKSA 1PPBH 1MABB 1U6QA 4DGJA 1DUAA 5C0UA 1JBUH 5IDKA 3GOVB 2PSYA 5LH8A 3W95A 9ESTA 1VKYA 1UTJA 1O2UA 3SN8A 3WWFA 2EI8A 1TNJA 3QTVH 5DP4A 4BAMB 3LOXA 2FS9A 2OC0A 5TCAA 2B0FA 5H4IB 4JZ1A 2QF4A 2WYGA 2LELA 5EPYA 4ZKNU 1INCA 2H9TH 4CRGA 4RKOB 1C5LH 5TJXA 4Y7BA 1A2CH 4QT8C 2M5TA 4XSKU 3P8GA 1WTHD 2FI3E 4I8KA 3V3MA 1OSSA 4AG1A 1W0ZU 2R2MB 4X8TH 2PP6A 4ACBA 1FAXA 2CMYA 2GCTC 3PTBA 4FVBA 1TGSZ 3M3TA 5SGAE 3OU0A 3TITA 1Q3XA 1D3PB 2NU1E 3RXFA 2BQ7B 1DDJA 4ACAA 3FP8E 1O5AB 2IN2A 4MTBA 3TH3H 3O8BA 2PGQB 3GY5A 1SFQB 1YGCH 1EAXA 2WSSD 3AASA 3ZZCA 3QUMP 3P92A 4D7FA 1MZAA 3EDXB 4BANB 3ATKA 2ZNKH 5EOKA 4DIIH 2BMGB 1FX0B 1S82A 1QTFA 1AUJA 1OWJA 2WPHS 3UUZA 1AD8H 4NA8A 3GCHC 4MVNA 3BTQE 4YZUA 2ODYB 3GS9A 4A7IB 4YM9A 2FIRH 2J92A 5L30H 1P03A 1VCPA 2SGDE 4BXWA 1RFNA 3F9FA 1ZGVA 2J4IA 3M5MA 5DKMA 4J1YA 4CHAC 4X1SU 4Q4LA 1W11U 1WXRA 1W3CA 3UTUH 1MTNB 5GWZA 2A4RA 3OTPA 4IC5A 1CBWB 1TIOA 3GCNA 3DCLA 2KM0A 3FFGA 1SMFE 1P12E 2K1QA 4ISLA 3O8DA 4DOQA 5FCRA 3GY2A 4A6LA 3I29A 5G4BA 2AGGX 2GZ8A 1AWHB 1GJ4H 1O0DH 1YPGH 3OAAD 1EPTA 3UY9A 5T6FA 2BY8X 3GYMA 3ZYDA 5LPFA 1RS0A 1LVOA 1CSOE 4F48B 5GCHG 1OWHA 2QXGA 1IHTH 1L1JA 3MQKC 3PRBA 3BTME 4MNVA 4Y8ZA 3MU1A 3U8RH 1MQ5A 1GG6C 1YPKH 2HWLB 1UTQA 3BTGE 4MPXA 3ZVDA 3ATMA 3SU1A 1Z1IA 1SC8U 4ASUD 2VWNA 1DXPA 1RD3B 5GXPA 3OY6U 3OEED 1A0LA 1NBME 1SQRA 1KLJH 1G2MA 3E1XB 3NK8A 2AERH 1GGDC 2XBWA 3OEHD 4TWYA 2FESH 1QIXB 4Y6DA 2A1DB 1MU6B 2WPDD 1TNHA 1DWCH 1C5RA 1CA8B 1EJMA 3ATLA 2WV9A 3SQHE 1MU8B 1AQ7A 2WZQA 3KIDU 2R0KA 1DY8A 1BTYA 1O2NA 4A1XA 2FP7B 2ZG0H 4K60A 1GJCB 2RFKC 1IQHA 2PGBB 2O8TA 3F9EA 1C1UH 5HIZA 1SI5H 4Z1MD 2OQUA 2KCPA 2Y5HA 1QR3E 4WJG2 1HUTH 1BTHH 1ESAA 1YLCA 3LJJA 2OLGA 2NU2E 5DPAA 1FY5A 3BIVH 2OTVA 1PPHE 3UOPA 1OPHB 1XVMA 2CF8H 2VBCA 4ZKSU 2SNWA 1LPGB 1Z8GA 1CGHA 3RXPA 3SNCA 3GDUA 3P8NA 1NC6A 5F8ZA 2XXLA 5AFYH 4K1TA 3RXCA 2Y82A 1M9UA 1NFYA 5DP5A 1HAPH 5EXLA 1BDAA 1B0EA 1JMOH 1MUEB 2UWOA 1MAXA 1P2MA 3L6PA 4ZUHA 1XUJA 2WINI 5F53A 1AVWA 3I78A 1NU7B 4B6EA 3ZVBA 3STIA 2XC0A 2GMTC 3TGKE 3A7TA 3HPTB 2FYQA 3RXHA 1W12U 2WUBA 1PYTC 4YTAA 1GVLA 2FDAA 5PTPA 1GHBG 2VIWA 1W0JD 3W94A 1C5OH 2XTTB 4LZ4B 1BOQA 3A7ZA 1HJ8A 3T27A 3S69A 1NN6A 1C1VH 2AH4X 4Y0YE 1W14U 1T31A 3DSPA 5EQQA 1ELGA 5A8YA 2WPMS 3HKJB 1NRPH 1YCPM 2AIQA 2QY0B 1DWEH 2C93B 2AHME 3DFLA 1O3NA 4AGKA 1CHGA 3PMBB 2A31A 3A89A 4WMDA 2G5VA 3URCA 2D8WA 2UUYA 3BG4C 1GDQA 1OXGA 2PUXB 1ELBA 3EAJA 5BPEA 5JBCS 1IQMA 2W3KA 3TJUA 1YYY1 1OWIA 1RRKA 4ZROA 2WUCA 1L0ZA 3VB6A 3NZIA 1ZZZA 5GCHF 1E34B 2G55A 1ELAA 3FP7E 2ALVA 3BG8A 3MNBA 1ZJDA 2VWMA 3MNSA 4JZFH 2EQNA 2CF9H 1GCDA 4CREA 4O9VA 5C94A 3D65E 3DSOA 2WHXA 1NESE 5EQRA 1DSTA 1IOEA 4WXVA 2XC5A 3SQEE 1SL3A 4I33A 3I77A 4AX9H 5C5OA 2BZAA 4CRFA 1GBHA 1BMMH 1ZTKA 1C2HA 2VIDA 1QGFA 3T26A 2CN0H 1EATA 4FU7A 1K9OE 2STBE 1IAUA 1EFRD 3AVZA 3FN8A 3AW0A 4FUBA 1W0KD 4YLUA 4FUDA 2XBVA 2V3HH 4NZQA 2O8LA 3OFND 4NWLA 2Z7FE 4UDWH 1O35A 3TK5A 4F49A 1K21H 1BHXF 2H9HA 1P05A 5EJLA 1MCTA 3ZIAD 1B7XB 1ANDA 1HDTH 2SGQE 3A83A 4WY3A 3RXJA 3SV7A 3RXTA 3SYJA 1W13U 1Q2WA 1BIOA 3GY7A 2ANWA 2SGEE 1EX3A 2PKAA 1F2SE 1O33A 1AFQC 1BT7A 1ETSH 1QL7A 2Q6DA 4O3UA 2BY6X 3URDA 2QAAA 5CHBA 3PV2A 2GP9B 2ANYA 1QQ4A 2BDYA 1TPAE 4NA7A 1P9UA 2HALA 2O8UA 1SGNE 1BTPA 1NPMA 2QV1A 1FXYA 4LXBH 3Q3XA 2Y7XA 4UONA 1ELCA 2CXVA 3LC3A 1N6XA 1RGQA 1TX7A 2CJIA 4IBLH 4AN7A 3FO8D 2V3MA 4NIYA 1JXPA 4GCHF 2ZI2H 4X8UH 5DP8A 1V6DA 1ELFA 5JBAS 1GHBF 3N7DA 3DUXH 3MYWA 3OY5U 1HRTH 5F03A 5B6LA 3SJKA 1LQEA 1A46H 1PPZA 2H5DA 2OQ5A 3ATIA 3TH2H 1C1NA 4YT6H 1EAWA 1UVUH 4RKJB 1P2QA 1PPCE 3MO9A 3LGIA 3M35A 1S84A 3UB0A 1RIWC 3MH6A 3M7UA 2AFQB 3BTDE 4ZKRU 3ZZ3A 4IMQA 5C5NA 3RP2A 2A5AA 1N1LA 3A88A 1D9IA 2QXIA 3BSQA 2B8OH 1O37A 1TBRH 4ABGA 5L2YH 3RXDA 2Z6BD 1GHVH 4R8TB 4IN2A 1MCVA 1S5SA 3RXVA 2PTNA 1P06A 3VB4A 1RTKA 4Y71A 3RUOA 4AGJA 2R0LA 2FOAA 2ZDKA 1GDUA 2OBOA 4CRBA 4JK6A 1O3JA 2G81E 2FI4E 3VPKA 4VGCB 3TK9A 1SKYE 1Q31A 3SU2A 4WVPE 1NZQH 2EI7A 2GT7A 1C4V2 1FQ3A 1SGYE 3PWCA 1XMNB 1L4DA 3A87A 1FN8A 2G51A 4U2WA 3VB3A 2PTCE 2AMQA 3UWJH 4MNWA 2Q6FA 3DFJA 1EZXC 2P8OB 3E16B 4ZCNA 1Z6EA 2ZQ2A 2QE7D 3D23A 1YLNA 4UFEH 4X2VA 4E06H 1ZPBA 5GJ4B 1MH0A 2A7HA 2IOTA 5CMXH 3BEUA 1A0HB 4HG6A 3D62A 3TGJE 3SGBE 2BX4A 2ZECA 4JZIA 2QA9E 4OGYA 3AAUA 5I46H 3PLPA 1JIRA 3K65B 1ETTH 1HXEH 3BTFE 1UTKA 1SBWA 1GBTA 1VCQA 1P2NA 1ZPCA 3KYGA 2O9QA 2ZGXH 4BAKB 1O2SA 8KME2 3LKWA 4AFZA 1O2MA 1FIWA 1FZZA 2ZDAH 3RC5A 3HK6B 5HMAA 2G4UA 1LO6A 3BF6H 6GCHG 3QLPH 1C5WB 1FY4A 1YPMH 3FZDA 1V3XA 1ARCA 4NZLA 4YXWD 2G00A 1P11E 1UO6A 1EP6A 1C5QA 1HJAB 3JZ1B 1J17T 1EQ9A 1ABJH 2XWAA 2AMPA 2C4FH 1W2KH 4O97A 1O3HA 3UAIC 5C17A 2PFEA 2JH6D 4PROA 4U30A 3PV5A 1SGTA 5DK1A 5FPSA 2FPZA 5BRRE 2EC9H 1Z71A 2CV3A 4TWWA 1MKWK 1ZJKA 4TPIZ 5EXMA 4ABEA 2ZGBH 2ZU1A 3T29A 2ZP0H 3RXOA 1AB9B 3RC6A 1YPHC 1D3DB 2VH6A 1BZXE 4WH6A 4LZ1H 4H4FA 1O3BA 1HAIH 1BRBE 1GI9B 1GHZA 1HGTH 4YOGA 3AW1A 4I32A 3ZZBA 1O2JA 3U1IB 2K8IA 3LGTA 1P3EA 1UTPA 2K0QA 8GCHG 5EQSA 1HAVB 2FOMB 1JWTA 3A8BA 2GV6A 5FPYA 3BTTE 2PHBA 2F9NA 3NWUA 2OC1A 5L2ZH 1AN1E 1TNIA 5B6OA 4JYVH 3M7TA 2FWWA 1DWBH 2QIQA 4IN1A 2JETB 1GHWH 1S83A 3HATH 1DXWA 3HGNA 3S7KB 3F2HA 1C2GA 1SHYA 2A2XH 4KTSA 3HGPA 1O2QA 4RI0A 3F9HA 2RDLA 2GDDA 2KCOA 3BTWE 5EG4A 1G3CA 1FIZA 1NFUA 2PKSC 1UTOA 3IG6B 3FAOA 4YLQH 1Z6JH 2A4OA 3F1SB 4JZDH 1PQ7A 1O5CB 4AZ2B 1MTWA 4K5ZA 2AGEX 4X6PA 1DLEA 1P01A 2JIZD 1V2NT 3DT0H 4B2CA 4B6FA 1ZMJA 2XCFA 4CH2B 1CGIE 1TFXA 4THNH 3SU4A 2BHGA 2W7SA 3UPEA 2WYJA 1ACBE 1ELVA 4IW4E 2F4LA 2ZKSA 3LDXH 1ZSJA 4HGCA 1THPB 1WTGH 4OS7A 2TGDA 3VGCB 3PROA 5HXFA 1P04A 2B5TB 2B9LA 2HNTC 1NFXA 1K1JA 1O34A 1O3FA 1EASA 1OP0A 3AAVA 1AU8A 2BDCA 3U69H 5EW2H 1QHRB 1QJ6B 1UK3A 3RXSA 1GMDF 1XKAC 2Z3EA 1HYLA 1J15A 1JRSA 2A4QA 3SNBA 1A3BH 4OS4A 7GCHG 4ABBA 8LPRA 1GBDA 3KQEA 2IPQX 4HZHA 2A0QB 3TNSA 1TLDA 1ELEE 3G01A 2Y5FA 1TBZH 4Y8XA 1NRRH 2H5CA 1P9SA 1GMCG 3MU5A 5GDSH 1O3DA 2ZCKP 1V2TT 1OYQA 4O3TA 1SVPA 2GCTB 1SQAA 4FUIA 1VGCC 1ZMNA 2A4GA 1XKBC 1O2PA 4B76A 1SGDE 3DD2H 1AE8H 2P3UB 1V2UT 1VJAU 3EA8A 1O3PB 1EOLA 1HCGA 1KMHB 1PJPA 3GY3A 1O3CA 3E6PH 5C0TA 1C5TA 2W5EA 3E91A 4MG3A 2FOHA 4NSVA 2JKHA 4DIHH 1FY8E 1XUKA 3RXRA 2XBXA 2P59A 5AHGH 2QGRA 4RN6A 1LCYA 1GBBA 1SB1H 3UNQA 3N99A 5HM2A 4DURA 3PMJA 2KFWA 2OC8A 3RU4T 3GCHB 5C1XA 2J98A 2W7UA 2GKVE 2ZHFH 3P8FA 1Y3XA 2M2AA 3RXUA 5DP6A 4CRCA 5JPMH 3U9AH 4X2YA 4CRDA 4I31A 2FZZA 3OYPA 1P2KA 1H8IH 1V2LT 2C3SA 2QC2A 3QGNB 3EE0B 3EE7A 2OD3B 2VGCB 4K1SA 2VVUA 2QXHA 4XBBA 5EJZA 1KLIH 1GBMA 1HAZB 2VVVA 1KIGH 1V2RT 4ISIH 4J2YB 1BHXB 1CBWC 1D4PB 3BEFB 2ALPA 3RXAA 3Q77A 1WCZA 3UNRA 1O5DH 2XCNA 2FLBH 2J98B 4BOHA 3UNSA 4E05H 5E0HA 2ZGHA 2BD2A 4OS6A 4BXSA 1EAUA 3SU5A 1C1RA 1TONA 2Q1JA 2WV4A 3VEQB 5T1VA 2F9PA 1QJ1B 1DICA 2G5NA 3SJIA 5C1YA 5JB9S 2YOLA 1V2QT 6CHAC 1OWEA 3SBKA 2TIOA 1ANBA 3LIWA 1FAKH 4AFQA 4B73A 1GG6B 4D9QA 1VITG 2AMDA 1HAHH 5C3NA 3PRDA 1HAOH 1F7ZA 1G3EA 1V2OT 1T4UH 1S6LA 3TH4H 1MTSA 5ESBA 3CS7A 2RG3A 1SGEE 2GTBA 2QYIA 1GGDB 3P6ZB 1LDTT 2FX6A 2V6NA 1EPTC 2VINA 1GPZA 4H42U 1L1GA 1YPHE 1QBVH 2OBQA 3MNXA 1FLEE 5FHTA 2BQ6B 4JCNA 1F5KU 2ZTXA 3VXFH 2F9VA 2Z9LA 1O2HA 1D6WA 2VVCA 1FN6A 4IMZA 3CNRA 1K1NA 4R0IA 3QGJA 2OUAA 1H8HD 1E1RD 3QDZB 1O3OA 4CR9A 4K8BA 1IQKA 2BDBA 1PQ8A 1IQJA 1AUTC 4FUJA 1ID5H 5KECA 2ZEBA 5EPNA 2CGAA 3F2FA 4OGXA 2VWLA 1P2JA 1GMCF 4YT7H 2YMSD 3UQVA 3F3BA 3AK5A 1FDPA 1MKXK 2OP9A 4LOYH 1TNKA 2KCAA 3IITA 1G32B 2F9OA 4X8VH 2QXJA 3PB1E 1N8OB 5I25A 3A8DA 2SGPE 1VITH 2QF3A 3QTOH 2AYWA 3SHCH 1WBGB 3VB5A 1LHDH 6LPRA 1JRTA 3SV6A 3PLKA 2ZPRA 4NCYA 1O39A 3MU8A 2WPKS 2BOKA 5FX5A 1P8VC 2GMTB 4D9RA 1O3EA 1UVOA 1V2JT 2WPJS 5DO4H 3SW2B 2G8TA 1PPFE 2FMJA 1D3TB 1V2VT 1AFEH 1GBJA 2H6MA 3NKKA 2OCVB 2PV9B 1NRSH 2GCHG 2NWNA 1AZZA 3K9XB 2KZ4A 2GZ7A 1AI8H 2PW8H 1C2FA 1SLUB 1XX9A 1ZOMA 3KQDA 3MMGA 1UK4A 4K69A 1C1TA 3LH3A 4KP0A 5A8XA 4U32A 1TA6A 1EUFA 2ZCLP 4WF8A 1C5MD 1IHSH 2J9NA 3A7WA 3LU9B 1QBNA 3SORA 1GMHG 2HLCA 3PO1C 4FVDA 1G9IE 1UTLM 4FU9A 2ZPSA 3MHWU 2GZ9A 2ZCHP 3TGIE 1Y3UA 2BTCE 1V2MT 1TPOA 1WU1A 1GJAB 4MPVA 4A92A 1BMAA 2R2WU 2QF5A 2FI5E 2PUQH 2ZA5A 3MH5A 4NGAH 4Y76A 1MKWH 1NU9A 3FVFB 1C5NH 3S0NA 1G36A 4Z6AH 6ESTA 1Y5UT 2CHAC 3H7TA 3SUGA 1QQUA 2PR3A 1QB6A 2BD4A 1SOTA 3M36A 2R3UA 4DG4A 1EB1H 1H8DH 1KDQB 3KNXA 4XFQA 4BNRA 1HLTH 1YM0A 1O2KA 3ODDA 3RXIA 1GCTC 2R9PA 2P3TB 1A3EH 3OX7U 5FBIA 4XOJA 4X1RU 1UK2A 1LHEH 1V2PT 3GY4A 3RMMH 3PM3A 1SFIA 1UCYE 1ZR0A 5AFZH 1YPLH 3U98H 1BBRE 3SI4H 2WPLS 1OYTH 1BJUA 3OSYA 2ZU4A 4GUXA 4YOIA 2HVYB 1BTUA 5J4SA 4XBCA 2Q6GA 2OXSA 2Y7ZA 2F91A 1XUFA 2Y5GA 1A5GH 1DWDH 3ZVFA 5FBEA 2H1UA 3ENSB 4ZAEA 1SGRE 4Y79A 2BX3A 1KTTB 1ZMLA 3DSGA 3K6ZA 1ZSKA 4MPWA 5DSFA 2V7QD 3DA9B 2TBSA 1HAXB 1GJBB 1JIMA 4B74A 1G2LA 1MBMA 3E0NB 2XW9A 3SHAH 1HAGE 4X6MA 1CO7E 2XWBI 4WMEA 1ZGIA 1AMHA 5E2PA 4FU8A 3R3GB 3ZV8A 1F5LA 2ZDLA 1P10A 4BAOB 4IC6A 2ASUB 2BLVA 1HAYB 3W1EA 1NT1A 5TCCA 1SGFG 4Y10E 2I6QA 3KL6A 1HIAA 3TPIZ 1HXFH 2XNDD 3B9FH 7KMEH 3P95A 2HLDD 3PYHA 4ZKOU 1AZ8A 1W8BH 1YC0A 3N7OA 1SLXB 1OKXA 1X7AC 2W3IA 1QB9A 1TOCB 1O2YA 1J14A 1DPOA 1GL0E 3QWCH 1DT2A 1OS8A 1OOKB 4INLA 4OS2A 2ZTYA 3H09A 3TJVA 5IYTA 2LNCA 4AB8A 5HM9A 1YCPK 1C5ZB 2BVSH 1T8NA 1HIAB 1SR5C 3FANA 2P3FH 1AHTH 5CHAC 4ASHA 2UUFB 4KELA 2JJ1D 1C2IA 4JZEH 1K28D 1RIWB 5F8XA 1RTFB 1GMHF 3SZNA 1EB2A 2BDIA 2F9BH 1V2WT 1C1WH 1KYNA 3PTNA 1G3DA 4I8GA 5FAHA 5A0CA 4U01A 1BRUP 4NFFA 4TSFD 4DCDA 5LPEA 1TRYA 2FM2A 1EAIA 2LPRA 5EGMA 4Z0KA 2L74A 4I86A 4ABFA 3BEIB 4HI3A 4INKA 4X6NA 1WOFA 4GSOA 4ZH8A 1BB0B 3GISB 1DVAH 4ESTE 1QURH 1OP8A 2J95A 2VIOA 1KXEA 2ZGJA 1VZQH 3A85A 1C5SA 1EOJA 1MBQA 1WYKA 4K1EA 4UFFH 1T8LA 1TMUH 5T6GA 3STJA 7LPRA 2JDID 2ANKH 3GDVA 1A4WH 4A5TS 1C4Y2 2ZZUH 1GI5A 1HNEE 1S81A 1FY1A 2XBYA 1LPKB 1TGNA 5ESTE 1FONA 3QO6A 2Y6TA 2QCYA 1FPCH 2XYAA 3RXBA 3SGQE 3F0OA 3Q76A 2KR7A 2AIPA 2BD3A 4TYDA 1C1QA 1O5GH 3WY8A 2ZU3A 3KHVA 1SQTA 1UCYK 1CT0E 5FPTA 1SLWB 2C8XB 1DM4B 2FOBA 3PMAB 4JMYA 3SJ8A 4ABAA 2ZU5A 1QA7A 2PLXA 2FYRA 1BBRK 1A5HA 2BD7A 2ODPA 2SNVA 1LQDB 5E0JA 2VWOA 4B2BA 3RC4A 1GBCA 1BITA 1C1PA 3ZZ9A 1O3KA 2XOKD 3P70B 3RM0H 1ZRBA 3E0PB 3SNDA 1RJXB 1ZLRA 4Q7XA 3ZVAA 4Q7YA 5E2OA 2ZFFH 2D26C 2ZO3H 1C2JA 1TMTH 3EA9A 1DOJA 2Z9JA 3LJOA 2GVFA 1J16A 1TGBA 1C2EA 3SZEA 1O2LA 2ZIQH 4B75A 2G52A 1VR1H 2VIQA 4NSYA 2G4TA 3CENA 2VNTA 1HAVA 1HJAC 4UE7H 1BTXA 2ZU2A 3FZZA 3L33A 2ZHDA 3CP7A 3LT3A 1ESBA 1IQEA 3C1KA 1MQ6A 3A82A 3EA7A 1VJ9U 2BLOA 2YMSC 1ANEA 4HFPB 5JYIA 3TIUA 3O8RA 2DE9A 4P00A 4D8NA 1IQNA 4YOJA 2BDHA 3UQOA 2C8WB 1TABE 1NFWA 1HV7A 2EI6A 2ILNA 3C27B 3NXPA 2THFB 3M3VA 1K22H 4DW2U 1TNLA 2RDEA 1MKXH 2J38A 3RLWH 3MWIU 4AORA 1ZHPA 4UD9H 4TT3D 4X0WU 3RMOH 1TAWA 4CRAA 3A80A 1IQLA 4XE4A 2P94A 1GJ7B 3F68H 1ELDE 5AVDA 1THSH 4CBNA 1CGJE 2NU0E 4Q63A 3BTKE 3RM2H 2F3CE 3RXKA 3SU6A 1KXFA 1XUHA 1BCUH 1TGTA 2UWLA 2Z9KA 3A81A 4DT7B 3A7XA 2P95A 1NO9H 2XRCA 1K1PA 2Y80A 2PKSB 3SU0A 5F8TA 2FTMA 1TX8A 1NRQH 3MH7A 3ZVCA 1CA0B 1BA8B 1Z8RA 4NIVA 3TU7H 3A84A 1DUEA 4ZXXH 1H1BA 1YP9A 2ZF0H 4RT0A 1RXPA 1NM6A 1Y3YA 2TGPZ 1WSSH 2ZDNA 1V2KT 1K1OA 5A0AE 1G30B 1YPJH 3S9BA 1O2IA 1CVWH 3ZZ5A 2FOGA 1A5IA 1W7XH 1ZRKA 2WV5A 4OS1A 3BTHE 2I6SA 3TJNA 2IPHA 4ABJA 1UTNA 2GX4A 1Y5AT 1O30A 1A0JA 1PPGE 3MI4A 1YF4A 4X1PU 4F4OC 2JJ2D 1TRNA 3T2NA 5IK2D 1ZHRA 1GI0A 1A7SA 3WWBA 1XXFA 2J97A 3MU0A 3ZZDA 3B23B 4BAHB 3P8OA 1SHHB 2W6JD 6GCHF 2WPIS 4XD7D 1P02A 5DJ7A 1TB6H 3BN9A 1UVTH 3M7QA 4CH8B 3T62A 4O03A 3TLOA 3GCOA 3S7HB 4WWYA 1AKSB 1JOUB 2R3YA 1A61H 4X2XA 1GBIA 4X6OA 2EA3A 5JBTA 3ZV9A 1H9IE 1VGCB 3KF2A 4RT1A 1GBKA 4XBDA 1T7CA 4P02A 5HGGA 3M5NA 1GHYH 3SNEA 2AS9A 2ESTE 2OC7A 3RDZA 1B0FA 1EXFA 3HKIB 5CE1A 4FUEA 5DP7A 3ZYEA 2Z9GA 3QZRA 4WMFA 1P57B 1N6YA 4GLYA 2STAE 3OTJE 2QF0A 3LH1A 3QK1A 1YKTA 2ZFRH 1DE7H 4M7GA 5E0GA 1EZUC 1C2KA 4LK4A 2VH0A 1TOMH 4ISOA 5C20A 4CHAB 1MAYA 2FXRA 4Y11E 2P93A 3T28A 1DSUA 4UFGH 1G37A 1MTNC 3EQ0H 8GCHF 3K2UA 1T32A 3FP6E 4ISHH 5KGOA 1XXDA 2GD4B 4MLFB 1IQGA 2KCYA 1E0FD 1C9TA 1ZYOA 1L2EA 1GHAG 4BTUB 3LGVA 2IJD1 2VGCC 4OS5A 1OP2A 2JH5D 2Z3CA 3GY8A 3EYDA 1CQQA 4XRNA 1Z8JB 1SG8B 1T8OA 2JH0D 3MU4A 3M37A 3KQ5A 1SQOA 2ZHEH 2CK3D 1VCWA 3E3TA 5K7RA 2DE8A 1QB1A 2BD5A 1C5PA 1MMJN 1UVPA 4UEHH 6CHAB 1C5YB 2TPIZ 3UOUA 1Y3VA 3GCTG 1GJ6A 1TWXB 2NU3E 1O3GA 3F2GA 3GYLB 5T6DA 3UIRA 4MNYA 3A7VA 2A7CA 2ZFSA 1YCPH 2PWXA 3SJOA 1PPEE 4GPGA 4FUFA 1AO5A 4FUGA 4GHQA 1O2WA 1UVSH 1WDIA 1C5XB 1O3MA 1FJSA 1WV7H 2F9UA 3RXEA 3NCLA 1J9CH 2FOFA 5A09A 2YNBA 1EPTB 1F0SA 5ABWA 2BD8A 1GI1A 3FOAA 2YNAA 4OM9A 1QNJA 1O5BB 4I8HA 4KGAA 1Z8IB 3LONA 1SLVB 2W26A 1FV9A 3F6UH 4B2AA 2FOCA 1C5VA 3KYFA 1Z7KA 3MTYA 1C2DA 1NTPA 1O2VA 1TYNA 4HTCH 7GCHF 5EIYA 1S0QA 1COWD 3NRLA 5FXLA 4X1NU 4Q7ZA 1QY6A 1KXDA 4NWKA 2D1JA 2VJ1A 4FUHA 1KXBA 1SGCA 1QZ8A 1FMGA 1H9HE 4AYVB 1EKBB 3SOSA 2BZ6H 4FUCA 3U8TH 1O2ZA 8ESTE 1DFPA 2W6ID 4D7GA 1C9PA 3Q3YA 1HFDA 2TRMA 5A0BA 2FO9A 1NBMD 1DY9A 3S9AA 1LHCH 3F9GA 2J34A 1ABIH 4D76A 3PV4A 2ZGCA 1F0RA 2VIVA 2V35A 2EEKA 5HYOA 1HJ9A 1SOZA 3BIUH 2FX4A 1E1QD 1GJ8B 1G3BA 1LHFH 2V3OH 3KCGH 3NPSA 1MD8A 4KKDA 1UMAH 2O8WA 1BTZA 2OK5A 1TQ7B 1C1MA 3SUEA 1GWAA 3M61U 1F0TA 3RU4E 1GDNA 1PQ5A 1N8OC 1TE0A 2ODQA 2ZWLH 1LVBA 1GI6A 3Q00A 4AFSA 1K1MA 2ZC9H 1TRMA 4KTCA 1WAYB 1O2XA 1RTLA 2BM2A 3UWIA 4TPYA 1O2RA 4AFUA 1Y8TA 2D2DA 3SNAA 4AC9A 1ZPZA 1OWKA 1UCYH 4AB9A 1D6RA 2ANMH 4SGAE 2HNTE 3O8CA 4A1TA 5F6MA 1S0RA 1BBRH 1WQSA 1L1NA 1W0YH 3V7TA 2HNTF 4GCHG 2FTLE 1K1LA 5J4QA 4XDEA 4NA9H 3KQBA 4GAWA 5LGOA 5JBBS 9LPRA 1SGIB 1SGQE 1CT2E 3ATWA 3PLBA 1GI7B 5HIYA 3UREA 2RCEA 2BY9X 2J2UA 2F43B 3RU4D 2ZDVH 1FUJA 3V12A 5C2ZA 3BG4B 1WUNH 1KDQA 1ORFA 1GHAF 1SGFA 3JZ2B 4KTUA 3PO1B 3SI3H 1OWDA 1SGPE 1E35B 5FCKA 1EJNA 1AIXH 1XUIA 5DP9A 1DITH 2ZTZA 3QN7A 5HKKD 2EY4C 1TALA 1QA0A 1S6FA 2A2QH 1GHXH 5KEDA 1IQFA 1P0SH 3ODFA 1Y3WA 2GT8A 1LVMA 4H6SB 1VITF 3PWBA 3GCTF 1LMWB 1ZTLA 1FPHH 1QBOA 2CHAB 3CS0A 3ZZ6A 3OE7D 2BOHB 4JYUH 2VIPA 2C8YB 1S6HA 3H5CB 5L6NH 3ZVGA 1TNGA 2GJGA 2KAIA 5C1UA 1QCPA 2ZPQA 3LGUA 2BQWB 3EGKH 1C5UA 4MPUA 4ZHMU 1EZQA 3T25A 2ZHQH 1GCTB 2BLQA 1TBQH 2BXUH 1ELTA 1XUGA 1XVOA 1ZTJA 1E79D 2RA3A 3DHKH 5LPRA 1CE5A 2H9EH 3R0FA 4Q80A 1C1SA 3TNTA 4F55A 1K1IA 3UFAA 2Z94A 2J94A 5K0HA 1GJ5H 4FOUC 1E38B 2BVXH 1ANCA 1GJDB 2A7JA 3QZQA 4DVAU 2KAIB 4I8JA 4NFEA 4JK5A 1NROH 4MNXA 1AE5A 3IWMA 1O32A 2GV7A 1FNIA 1T8MA 4ZHAA 1V2ST 2FODA 1E36B 2BB4A 2GGVB 4IS5A 2DUCA 1BRAA 2LP6A 3L3TA 3A7YA 1AFQB 1GI8B 1C1OA 4K3JA 1Y59T 3E8LA 3U8OH 1NY22 1GI3A 1UHBA 2O8MA 3MFJA 1P09A 1A1RA 2HPPH 3QX5H 2VU8E 1IQIA 1ARBA 2SGAA 4BTTB 1O3LA 1YLDA 4CR5A 1Z1JA 5GPIB 1WQVH 1HBTH 1O3IA 3SU3A 1BJVA 4TY6A 1TA2A 4ZHLU 1H8ED 1GI4A 5FL7D 1F0UA 5FX6A 1AY6H 1HPGA 2BY7X 4E7RG 2FOEA 2FS8A 1F5RA 2AGIX 3PMHB 1L4ZA 1O2GH 4FXGH 2GCHF 1UHBB 4NIWA 2VB0A 2L6OA 1C4U2 3UR6A 3VG8A 1P2IA 3V0XA 2PKAB 4UFDH 2ZFTA 4WH8A 2BVRH 3D49H 3TVJB 1KXAA 2A45B 1E37B 1ZHMA 4TY7A 3N7EA 1YY3A 3LPRA 3U1JB 5JB8S 2IJOB 1O31A 1GBAA 1TX6A 1DLKB 5CHAB 3RXGA 4ZXYH 2Z3DA 3B8JA 3FKSD 4MQAA 5C67A 2Y81A 3TK6A 4ABDA 1MZDA 1NS3A 3MO3A 1BMNH 3LGWA 5ETXA 1GJ9B 3GDSA 4GVUA 1O5EH 3M5OA 4K8YA 3ZZ7A 4GHTA 1BUIA 1ESTA 1PFXC 3Q3KA 3A86A 2KX4A 4B71A 3BTEE 3KEEA 3VFEA 1LTOA 1D3QB 5AF9H 4A1VA 1XM1A 3BV9B 2BLWA 4AYYB 1KSNA 4RSPA 5EJ1A 3RMNH 4BAQB 3VB7A 2BXTH 2ZDMA 1LKBA 1J8AA 1K0HA 1AVXA 1SSXA 4VGCC 3SUDA 3SV8A 1GL1A 4JYTA 1PQAA 1SPJA 4CBOA 2NU4E 2F83A 2BDAA 2A32A 2TGAA 4X8SH 1EZSC 1YWUA 4YESB 2ZHWH 1BMLA 1S85A 5T3HA 2SFAA 3MNCA 3TJOA 2PSXA 1W10U 5DGJA 4AOQA 1W7GH 5EW1H 4ABIA 1CHOG 1UJ1A 4WXIA 3VXEH 2P8OC 1P2OA 5A8ZA 3F0PA 3P17H 4K2YA 2P16A 1FY3A 1GI2A 1T4VH 1UW7A 3ZZAA 2TGTA 3SO3A 4E7NA 1TPSA 3RXQA 1O38A 3SJ9A 3RMLH 2SGFE 3SUFA 2OINA 1LPZB 5JDUB 2HPQH 1UTMA 1OX1A 3UR9A 4SGBE 1GBEA 1NRNH 3U28C 3E90B 1FI8A 3MH4A 1TMBH 1C2LA 1DX5M 2AEIH 4X1QU 1O36A 2HVXA 1H4WA 1GMDG 5CDFE 3MOCA 3A8AA 1LKAA 1THRH 2V0BA 3KGPA 4B1TA 1KLTA 1PYTD 1AVGH 4ISNA 1F92A 2A5IA 1BMFD 1OHHD 1C2MA 1KY9A 4H6TA 1CU1A 1BQYA 2J5UA 1AGJA 1TPPA 3RXLA 1AWFH 5GNDA 1QRZA 1CT4E 3NUMA 2GDEH 4DT4A 1MD7A
chains in the Genus database with same CATH topology
4NIXA 1EJAA 3LGYA 7ESTE 3MO6A 4NG9H 1GVZA 4ZMAH 1ETRH 3ZZ4A 1LVYA 1EP5A 1KXCA 3K6YA 4X2WA 3ZZ8A 3ELAH 1HB0B 3V13A 1O2TA 1K2I1 3A8CA 5EU8A 1MTUA 3H7OA 3GICB 1AB9C 1GVKB 1QRXA 3M5LA 3RXMA 2C90B 3S9CA 5DG6A 4I8LA 2XNIA 2UUJB 3HK3B 1TQ0B 1MTVA 2UUKB 1QL9A 1O5FH 4INHA 2ULLA 5EXNA 3RLYH 2BDGA 3KQCA 3SV9A 1GBFA 1QL8A 2ZQ1A 5GIBA 3KN2A 1KTSB 1TGCA 4I7YH 2HRVA 4Y0ZE 2JETC 2UWPA 1P3CA 4Q2KA 2BYAX 1B5GH 1QJ7B 2BY5X 2ZFQH 1QRWA 2Z9IA 3ZVEA 4Y7AA 1QFKH 1ZSLA 2FEQH 4DJZB 3LC5A 2QN5T 1BRCE 3ITIA 4YO9A 3T5FH 3GY6A 5EODA 2BD9A 3ESTA 5DP3A 1O3AA 1YBWA 1GBLA 2XC4A 5E8EH 4Y8YA 4MDSA 1O2OA 1Y5BT 2A5KA 4BTIB 1BTWA 3M3SA 3SV2H 1CA0C 4IGDA 1H9LB 4ABHA 2HGTH 1LHGH 1DS2E 2H2ZA 2B7DH 2FLRH 2C8ZB 1DANH 4DY7B 1YPEH 2HOBA 4AG2A 2ZFPH 1CHOF 3SGAE 3VGCC 2RA0A 5A2MH 1AKSA 1PPBH 1U6QA 4DGJA 1DUAA 1JBUH 5IDKA 3GOVB 2PSYA 5LH8A 3W95A 9ESTA 1UTJA 1O2UA 3SN8A 2EI8A 1TNJA 3QTVH 5DP4A 4BAMB 3LOXA 2FS9A 2OC0A 5TCAA 2B0FA 5H4IB 4JZ1A 2WYGA 5EPYA 4ZKNU 1INCA 2H9TH 4CRGA 4RKOB 1C5LH 5TJXA 4Y7BA 1A2CH 4QT8C 2M5TA 4XSKU 3P8GA 1WTHD 2FI3E 4I8KA 3V3MA 1OSSA 4AG1A 1W0ZU 2R2MB 4X8TH 1FAXA 2CMYA 2GCTC 3PTBA 4FVBA 1TGSZ 3M3TA 5SGAE 3OU0A 3TITA 1Q3XA 1D3PB 2NU1E 3RXFA 2BQ7B 1DDJA 3FP8E 1O5AB 2IN2A 4MTBA 3TH3H 3O8BA 2PGQB 3GY5A 1SFQB 1YGCH 1EAXA 3AASA 3ZZCA 3QUMP 3P92A 4D7FA 1MZAA 3EDXB 4BANB 3ATKA 2ZNKH 5EOKA 4DIIH 2BMGB 1S82A 1QTFA 1AUJA 1OWJA 2WPHS 3UUZA 1AD8H 4NA8A 3GCHC 4MVNA 3BTQE 4YZUA 2ODYB 4A7IB 4YM9A 2FIRH 2J92A 5L30H 1P03A 1VCPA 2SGDE 4BXWA 1RFNA 3F9FA 1ZGVA 2J4IA 3M5MA 5DKMA 4J1YA 4CHAC 4X1SU 1W11U 1W3CA 3UTUH 1MTNB 5GWZA 2A4RA 4IC5A 1CBWB 1TIOA 3GCNA 3FFGA 1SMFE 1P12E 2K1QA 4ISLA 3O8DA 4DOQA 5FCRA 3GY2A 4A6LA 3I29A 5G4BA 2AGGX 2GZ8A 1AWHB 1GJ4H 1O0DH 1YPGH 1EPTA 3UY9A 5T6FA 2BY8X 3GYMA 3ZYDA 5LPFA 1RS0A 1LVOA 1CSOE 5GCHG 1OWHA 2QXGA 1IHTH 1L1JA 3BTME 4MNVA 4Y8ZA 3MU1A 3U8RH 1MQ5A 1GG6C 1YPKH 2HWLB 1UTQA 3BTGE 4MPXA 3ZVDA 3ATMA 3SU1A 1Z1IA 1SC8U 2VWNA 1DXPA 1RD3B 5GXPA 3OY6U 1A0LA 1KLJH 1G2MA 3E1XB 3NK8A 2AERH 1GGDC 2XBWA 4Y6DA 4TWYA 2FESH 1QIXB 2A1DB 1MU6B 1TNHA 1DWCH 1C5RA 1CA8B 1EJMA 3ATLA 3SQHE 1MU8B 1AQ7A 3KIDU 2R0KA 1DY8A 1BTYA 1O2NA 4A1XA 2FP7B 2ZG0H 4K60A 1GJCB 1IQHA 2PGBB 2O8TA 3F9EA 1C1UH 1SI5H 2OQUA 2Y5HA 4WJG2 1QR3E 1HUTH 1BTHH 1ESAA 1YLCA 3LJJA 2OLGA 2NU2E 5DPAA 1FY5A 3BIVH 2OTVA 1PPHE 3UOPA 1OPHB 1XVMA 2CF8H 4ZKSU 2SNWA 1LPGB 1Z8GA 1CGHA 3RXPA 3SNCA 3GDUA 3P8NA 1NC6A 5F8ZA 2XXLA 5AFYH 4K1TA 3RXCA 2Y82A 1M9UA 1NFYA 5DP5A 1HAPH 5EXLA 1BDAA 1B0EA 1JMOH 1MUEB 2UWOA 1MAXA 1P2MA 3L6PA 4ZUHA 1XUJA 2WINI 1AVWA 3I78A 1NU7B 3ZVBA 3STIA 2XC0A 2GMTC 3TGKE 3A7TA 3HPTB 2FYQA 3RXHA 1W12U 2WUBA 1PYTC 4YTAA 1GVLA 2FDAA 5PTPA 1GHBG 2VIWA 3W94A 1C5OH 2XTTB 4LZ4B 1BOQA 3A7ZA 1HJ8A 3T27A 3S69A 1NN6A 1C1VH 2AH4X 4Y0YE 1W14U 1T31A 5EQQA 1ELGA 5A8YA 2WPMS 3HKJB 1NRPH 1YCPM 2AIQA 2QY0B 1DWEH 2C93B 3DFLA 1O3NA 4AGKA 1CHGA 3PMBB 2A31A 3A89A 4WMDA 2G5VA 3URCA 2D8WA 2UUYA 3BG4C 1GDQA 1OXGA 2PUXB 1ELBA 3EAJA 5BPEA 5JBCS 1IQMA 2W3KA 3TJUA 1YYY1 1OWIA 1RRKA 4ZROA 2WUCA 1L0ZA 3VB6A 3NZIA 1ZZZA 5GCHF 1E34B 2G55A 1ELAA 3FP7E 2ALVA 3BG8A 3MNBA 1ZJDA 2VWMA 3MNSA 4JZFH 2CF9H 1GCDA 4CREA 4O9VA 3D65E 1NESE 5EQRA 1DSTA 1IOEA 4WXVA 2XC5A 3SQEE 1SL3A 4I33A 3I77A 4AX9H 5C5OA 2BZAA 4CRFA 1GBHA 1BMMH 1ZTKA 1C2HA 2VIDA 1QGFA 3T26A 2CN0H 1EATA 4FU7A 1K9OE 2STBE 1IAUA 3AVZA 3AW0A 4FUBA 4YLUA 4FUDA 2XBVA 2V3HH 4NZQA 2O8LA 4NWLA 2Z7FE 4UDWH 1O35A 3TK5A 4F49A 1K21H 1BHXF 2H9HA 1P05A 1MCTA 1B7XB 1ANDA 1HDTH 2SGQE 3A83A 4WY3A 3RXJA 3SV7A 3RXTA 1W13U 1Q2WA 1BIOA 3GY7A 2ANWA 2SGEE 1EX3A 2PKAA 1F2SE 1O33A 1AFQC 1BT7A 1ETSH 1QL7A 2Q6DA 4O3UA 2BY6X 3URDA 2QAAA 2GP9B 2ANYA 1QQ4A 2BDYA 1TPAE 4NA7A 1P9UA 2HALA 2O8UA 1SGNE 1BTPA 1NPMA 2QV1A 1FXYA 4LXBH 3Q3XA 2Y7XA 4UONA 1ELCA 2CXVA 3LC3A 1N6XA 1RGQA 1TX7A 2CJIA 4IBLH 4AN7A 4NIYA 1JXPA 4GCHF 2ZI2H 4X8UH 5DP8A 1V6DA 1ELFA 5JBAS 1GHBF 3DUXH 3MYWA 3OY5U 1HRTH 5F03A 3SJKA 1LQEA 1A46H 1PPZA 2H5DA 2OQ5A 3ATIA 3TH2H 1C1NA 4YT6H 1EAWA 1UVUH 4RKJB 1P2QA 1PPCE 3MO9A 3LGIA 3M35A 1S84A 1RIWC 3MH6A 3M7UA 2AFQB 3BTDE 4ZKRU 3ZZ3A 4IMQA 5C5NA 3RP2A 2A5AA 1N1LA 3A88A 1D9IA 2QXIA 3BSQA 2B8OH 1O37A 1TBRH 4ABGA 5L2YH 3RXDA 2Z6BD 1GHVH 4R8TB 4IN2A 1MCVA 1S5SA 3RXVA 2PTNA 1P06A 3VB4A 1RTKA 4Y71A 3RUOA 4AGJA 2R0LA 2FOAA 2ZDKA 1GDUA 2OBOA 4CRBA 4JK6A 1O3JA 2G81E 2FI4E 3VPKA 4VGCB 3TK9A 1Q31A 3SU2A 4WVPE 1NZQH 2EI7A 2GT7A 1C4V2 1FQ3A 1SGYE 3PWCA 1XMNB 1L4DA 3A87A 1FN8A 2G51A 4U2WA 3VB3A 2PTCE 2AMQA 3UWJH 4MNWA 2Q6FA 3DFJA 1EZXC 2P8OB 3E16B 1Z6EA 2ZQ2A 3D23A 4UFEH 4X2VA 4E06H 1ZPBA 5GJ4B 1MH0A 2A7HA 2IOTA 5CMXH 3BEUA 1A0HB 3D62A 3TGJE 3SGBE 2BX4A 2ZECA 4JZIA 2QA9E 4OGYA 3AAUA 5I46H 3PLPA 1JIRA 3K65B 1ETTH 1HXEH 3BTFE 1UTKA 1SBWA 1GBTA 1VCQA 1P2NA 1ZPCA 2O9QA 2ZGXH 4BAKB 1O2SA 8KME2 3LKWA 4AFZA 1O2MA 1FIWA 1FZZA 2ZDAH 3RC5A 3HK6B 5HMAA 2G4UA 1LO6A 3BF6H 6GCHG 3QLPH 1C5WB 1FY4A 1YPMH 3FZDA 1V3XA 1ARCA 4NZLA 2G00A 1P11E 1UO6A 1EP6A 1C5QA 1HJAB 3JZ1B 1J17T 1EQ9A 1ABJH 2XWAA 2AMPA 2C4FH 1W2KH 4O97A 1O3HA 2PFEA 2JH6D 4PROA 4U30A 1SGTA 5DK1A 5FPSA 2FPZA 5BRRE 2EC9H 1Z71A 2CV3A 4TWWA 1MKWK 1ZJKA 4TPIZ 5EXMA 4ABEA 2ZGBH 2ZU1A 3T29A 2ZP0H 3RXOA 1AB9B 3RC6A 1YPHC 1D3DB 2VH6A 1BZXE 4WH6A 4LZ1H 4H4FA 1O3BA 1HAIH 1BRBE 1GI9B 1GHZA 1HGTH 4YOGA 3AW1A 4I32A 3ZZBA 1O2JA 3U1IB 3LGTA 1P3EA 1UTPA 8GCHG 5EQSA 1HAVB 2FOMB 1JWTA 3A8BA 2GV6A 5FPYA 3BTTE 2PHBA 2F9NA 3NWUA 2OC1A 5L2ZH 1AN1E 1TNIA 5B6OA 4JYVH 3M7TA 2FWWA 1DWBH 2QIQA 4IN1A 2JETB 1GHWH 1S83A 3HATH 1DXWA 3HGNA 3S7KB 1C2GA 1SHYA 2A2XH 4KTSA 3HGPA 1O2QA 3F9HA 2RDLA 2GDDA 3BTWE 5EG4A 1G3CA 1FIZA 1NFUA 2PKSC 1UTOA 3IG6B 3FAOA 4YLQH 1Z6JH 2A4OA 3F1SB 4JZDH 1PQ7A 1O5CB 4AZ2B 1MTWA 4K5ZA 2AGEX 4X6PA 1DLEA 1P01A 3DT0H 1V2NT 4B2CA 1ZMJA 2XCFA 4CH2B 1CGIE 1TFXA 4THNH 3SU4A 2BHGA 2W7SA 3UPEA 2WYJA 1ACBE 1ELVA 4IW4E 2ZKSA 3LDXH 1ZSJA 4HGCA 1THPB 1WTGH 4OS7A 2TGDA 3VGCB 3PROA 5HXFA 1P04A 2B5TB 2B9LA 2HNTC 1NFXA 1K1JA 1O34A 1O3FA 1EASA 1OP0A 3AAVA 1AU8A 2BDCA 3U69H 5EW2H 1QHRB 1QJ6B 1UK3A 3RXSA 1GMDF 1XKAC 2Z3EA 1HYLA 1J15A 1JRSA 2A4QA 3SNBA 1A3BH 4OS4A 7GCHG 4ABBA 8LPRA 1GBDA 3KQEA 4HZHA 2A0QB 3TNSA 1TLDA 1ELEE 3G01A 2Y5FA 1TBZH 4Y8XA 1NRRH 2H5CA 1P9SA 1GMCG 3MU5A 5GDSH 1O3DA 2ZCKP 1V2TT 1OYQA 4O3TA 1SVPA 2GCTB 1SQAA 4FUIA 1VGCC 1ZMNA 2A4GA 1XKBC 1O2PA 4B76A 1SGDE 3DD2H 1AE8H 2P3UB 1V2UT 1VJAU 3EA8A 1O3PB 1EOLA 1HCGA 1PJPA 3GY3A 1O3CA 3E6PH 1C5TA 2W5EA 3E91A 4MG3A 2FOHA 4NSVA 2JKHA 4DIHH 1FY8E 1XUKA 3RXRA 2XBXA 2P59A 5AHGH 2QGRA 4RN6A 1LCYA 1GBBA 1SB1H 3UNQA 5HM2A 4DURA 3PMJA 2OC8A 3RU4T 3GCHB 5C1XA 2W7UA 2GKVE 2ZHFH 3P8FA 1Y3XA 3RXUA 5DP6A 4CRCA 5JPMH 3U9AH 4X2YA 4CRDA 4I31A 2FZZA 3OYPA 1P2KA 1H8IH 1V2LT 2C3SA 2QC2A 3QGNB 3EE0B 2OD3B 2VGCB 4K1SA 2VVUA 2QXHA 4XBBA 1KLIH 1GBMA 1HAZB 2VVVA 1KIGH 1V2RT 4ISIH 4J2YB 1BHXB 1CBWC 1D4PB 3BEFB 2ALPA 3RXAA 3Q77A 1WCZA 3UNRA 1O5DH 2XCNA 2FLBH 4BOHA 3UNSA 4E05H 5E0HA 2ZGHA 2BD2A 4OS6A 4BXSA 1EAUA 3SU5A 1C1RA 1TONA 2Q1JA 2WV4A 3VEQB 3SJIA 2F9PA 1QJ1B 1DICA 2G5NA 5C1YA 5JB9S 2YOLA 1V2QT 6CHAC 1OWEA 3SBKA 2TIOA 1ANBA 3LIWA 1FAKH 4AFQA 4B73A 1GG6B 4D9QA 1VITG 2AMDA 1HAHH 5C3NA 1HAOH 1F7ZA 1G3EA 1V2OT 1T4UH 3TH4H 1MTSA 5ESBA 3CS7A 2RG3A 1SGEE 2GTBA 2QYIA 1GGDB 3P6ZB 1LDTT 2FX6A 2V6NA 1EPTC 2VINA 1GPZA 4H42U 1L1GA 1YPHE 1QBVH 2OBQA 3MNXA 1FLEE 5FHTA 2BQ6B 4JCNA 1F5KU 2ZTXA 3VXFH 2F9VA 2Z9LA 1O2HA 1D6WA 2VVCA 1FN6A 4IMZA 1K1NA 4R0IA 3QGJA 2OUAA 3QDZB 1O3OA 4CR9A 4K8BA 1IQKA 2BDBA 1PQ8A 1IQJA 1AUTC 4FUJA 1ID5H 2ZEBA 5EPNA 2CGAA 4OGXA 2VWLA 1P2JA 1GMCF 4YT7H 3UQVA 1FDPA 1MKXK 2OP9A 4LOYH 1TNKA 3IITA 1G32B 2F9OA 4X8VH 2QXJA 3PB1E 1N8OB 5I25A 3A8DA 2SGPE 1VITH 2QF3A 3QTOH 2AYWA 3SHCH 1WBGB 3VB5A 1LHDH 6LPRA 1JRTA 3SV6A 3PLKA 2ZPRA 4NCYA 1O39A 3MU8A 2WPKS 2BOKA 5FX5A 1P8VC 2GMTB 4D9RA 1O3EA 1UVOA 1V2JT 2WPJS 5DO4H 3SW2B 2G8TA 1PPFE 2FMJA 1D3TB 1V2VT 1AFEH 1GBJA 2H6MA 3NKKA 2OCVB 2PV9B 1NRSH 2GCHG 2NWNA 1AZZA 3K9XB 2GZ7A 1AI8H 2PW8H 1C2FA 1SLUB 1XX9A 1ZOMA 3KQDA 3MMGA 1UK4A 4K69A 1C1TA