3FP7E

Anionic trypsin variant s195a in complex with bovine pancreatic trypsin inhibitor (bpti) cleaved at the scissile bond (lys15-ala16) determined to the 1.46 a resolution limit
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDAGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anionic trypsin-2
publication title Structure of a serine protease poised to resynthesize a peptide bond.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/hydrolase inhibitor
total genus 63
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fp7E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3fp7E02
1MMJN 4ZMAH 5DP9A 1SPJA 1O5GH 1UHBA 4DIHH 1O2JA 2I6SA 3F9EA 4HFPB 2WINI 5EXMA 4FU9A 1C1TA 1EX3A 4Q7ZA 1FY5A 1S81A 1IOEA 1HIAB 4MNYA 1BTXA 4XBCA 5DKMA 2BXTH 2FI3E 3MTYA 3RU4T 4X1SU 2XYAA 2CXVA 1RIWC 1KTTB 1P11E 2VVUA 3M5LA 2Y82A 3ZYEA 4X8UH 1YCPH 4NIWA 1CA8B 4K2YA 3MU0A 2BY6X 2SFAA 3FP6E 2ZGXH 1UTOA 2XC4A 3GY3A 1UO6A 3RM2H 3MNXA 1GPZA 2Q6DA 5EPYA 3TH4H 1GBLA 5BRRE 2TPIZ 4CHAB 2ZGHA 3M61U 1Q3XA 2D26C 4YOGA 1KXAA 2Y5FA 1YPEH 3V3MA 2TGTA 2BVXH 4FUDA 1G3EA 3SBKA 4MDSA 2BZAA 3MWIU 1O36A 3UREA 5FPYA 3B8JA 3ZV8A 4AYVB 1H9LB 2BLOA 1HAHH 4ISHH 1YKTA 1XUJA 3RM0H 2ZDLA 1BRCE 1PYTD 1QGFA 1SOTA 3TIUA 2FM2A 1ZPZA 2BY8X 4CBOA 1SGTA 3QZRA 2AH4X 5ESTE 1QTFA 1O5EH 1FUJA 4LOYH 4BAKB 1TLDA 1P3CA 5C5OA 5DP4A 1XVMA 1W7XH 2NU4E 3E90B 2WV5A 1XKBC 3RU4D 3SUFA 3ENSB 3SJKA 1NROH 4KP0A 4X2VA 3R0FA 1WQSA 1DSTA 4NFFA 3A88A 4YOIA 2O8MA 1MZDA 3GCOA 3RXHA 5C2ZA 3SNAA 3A7VA 1LHEH 4OS1A 1HAXB 2GDEH 3TK5A 4GCHG 1GJDB 3PMJA 3P70B 3K65B 4HGCA 4ABAA 1CGIE 1O39A 2ZDKA 2ZGBH 5F6MA 5C67A 2A7JA 1CBWB 1DT2A 1DLKB 2A4RA 3SOSA 1B7XB 1H9IE 2YOLA 3LDXH 3M7QA 2VB0A 1AWFH 3SJ8A 4X0WU 2W3IA 2GD4B 1IQNA 2ZPSA 5LPFA 3RXRA 1QBVH 1GMCG 4B2AA 5TJXA 3U9AH 1E38B 1YP9A 1GJ7B 2A4OA 1OP0A 2VIOA 2A5KA 5SGAE 2BOKA 1AZ8A 1MU8B 3RXLA 5ABWA 1DUAA 2WUBA 1AKSA 9ESTA 3SGAE 4DT7B 3UQVA 3OU0A 1RD3B 1HUTH 1JRTA 5TCCA 1LKAA 1DLEA 3EGKH 4CH8B 3SUGA 3TK9A 1SGEE 4JZIA 5DP3A 4K69A 4I32A 2BDIA 3V7TA 2GCHG 1CVWH 2K1QA 1O3GA 3ZZ4A 3DUXH 1O2SA 3GDVA 1FPCH 1DPOA 1AU8A 3RUOA 2BD7A 1FY3A 1A3EH 4DY7B 1QL8A 1NESE 2SGDE 2C93B 4KTUA 4R8TB 2OQ5A 1UTQA 4Y11E 4A5TS 2WYGA 3UQOA 2VGCB 1GMHG 1MBMA 3D49H 3RXUA 1EAIA 1CHGA 4X1RU 2ZFRH 3QGNB 1O3MA 1LQDB 1V2PT 4ABJA 1FJSA 1SFQB 2CGAA 1QRZA 2GZ9A 1P2KA 2FESH 1H9HE 1HBTH 1NPMA 5K0HA 1IQHA 2DE8A 4BANB 1RFNA 4F49A 1YPJH 2AYWA 2V3OH 5A0BA 1O3CA 4X8VH 1OWEA 4IN2A 1TGCA 2HPQH 2Y7ZA 1A7SA 1HJAB 1U6QA 5EXNA 1G32B 4B76A 2UWPA 1EATA 2PW8H 2PKSB 3HGPA 8LPRA 1Y3XA 1SGFA 1KSNA 3SU3A 1D6WA 1OP2A 2ZPQA 4QT8C 1HCGA 3A86A 1AY6H 4K8YA 3LU9B 4Q7XA 4ZKNU 3ZZ9A 4KKDA 2FX6A 2BY7X 2ZCLP 2ZECA 2Z7FE 3M5MA 3IWMA 5J4SA 3ZZCA 2ULLA 4CR9A 1KXDA 3GYLB 2FI4E 3QK1A 1PQ5A 1NRQH 2FOAA 1C2FA 1P2QA 1FIWA 3RXMA 1ANCA 1MTUA 2GMTB 5C1YA 1LHFH 1CU1A 1KTSB 5EU8A 2QYIA 2STBE 2VINA 1GVLA 4HZHA 4ZKOU 2PUQH 2BDGA 3MI4A 2ZPRA 4IGDA 1ZSKA 2A7CA 1AI8H 1NRPH 3QX5H 6CHAC 4K1TA 3RXGA 8ESTE 1C2IA 4GCHF 1A4WH 1O2NA 3QUMP 4XDEA 3RXCA 1MAXA 1OSSA 2AGIX 3RC5A 3M3TA 2XCNA 1N8OB 1SQAA 1SG8B 3I77A 4ZHMU 1O3DA 1C1VH 3BTKE 4BAMB 2A4GA 3Q3KA 1F0TA 3NXPA 1N6YA 2ZDNA 1TPOA 3VFEA 1IQJA 1TPSA 2ZDVH 1C5RA 1G2MA 1J16A 4MTBA 1C5MD 5LH8A 2P93A 1HDTH 4X1PU 4ISOA 2AS9A 3UFAA 2OBQA 3OX7U 1GMCF 1O2YA 3LC5A 1F0RA 1C1MA 3MH5A 3E16B 1D3TB 1QA7A 2ZI2H 2FTLE 1P9UA 2OBOA 1RTLA 4B2BA 4FXGH 3FP7E 4I7YH 1EOLA 2TGAA 3NUMA 3BTWE 3DT0H 1J15A 5GJ4B 1LDTT 1YGCH 1IQIA 2XWBI 4INLA 3DFJA 2HOBA 1DE7H 4I8LA 4CHAC 1KXEA 3GCTG 3ZV9A 1PYTC 1Z7KA 1P0SH 5HM2A 3SU5A 4VGCB 1B0FA 2QF0A 2BLWA 4GLYA 3KHVA 2Z9KA 3SU2A 2BQ7B 2H1UA 2GCHF 1C5OH 2QY0B 3E91A 4Z6AH 5B6OA 3ATLA 3M5NA 1AO5A 1W0ZU 1UTPA 1O37A 2OCVB 1LTOA 1G3CA 3AAUA 3SHAH 1P04A 3SI3H 3QLPH 1WOFA 1MTWA 1EZUC 1UVPA 3TU7H 1EXFA 1GCDA 2H6MA 4I8HA 4DG4A 2BVSH 1GMHF 3K6ZA 3PYHA 3QO6A 1Z8JB 3A7WA 3G01A 4JYTA 4WWYA 1UK3A 2R3UA 1J9CH 1A0LA 2NWNA 2GT8A 2ZTXA 2ZTYA 3TJOA 1C9PA 1NRSH 4O3TA 1MKXH 1K1JA 1ZSLA 1ANDA 4U32A 3FFGA 1FY4A 1V2TT 1GL0E 5E0GA 2ZDMA 3TITA 1HLTH 1N6XA 3GOVB 1O2UA 2H9EH 1NN6A 1VITH 1JWTA 2OC1A 3LGTA 1WAYB 2XRCA 1JRSA 2ZO3H 4AB9A 2YNAA 1P8VC 2P16A 4U30A 3RXVA 2PTNA 5J4QA 1ETTH 3CP7A 2ZU3A 4NIVA 4CBNA 1TNGA 4K3JA 4F4OC 1OPHB 2AERH 1CBWC 1P02A 2GZ7A 2NU2E 1AQ7A 3E0NB 4THNH 4DVAU 4NFEA 1S83A 4X8TH 4AOQA 2NU3E 5EPNA 3AW1A 2BY9X 5AVDA 3UNSA 3KGPA 1L2EA 3DA9B 4NSVA 5A2MH 1ZHMA 4U01A 1YPLH 1ZLRA 1IQEA 1SMFE 4D8NA 1WTHD 5F8TA 4BTTB 1EB2A 1O5DH 1HFDA 2HWLB 4OS7A 3LKWA 5JBBS 1Y59T 1ZRBA 2YNBA 1MKXK 1YLDA 1GHAG 4INKA 4XBBA 1CO7E 1NS3A 1Y3VA 2VH6A 1FN6A 1FY1A 1ANBA 1Z8RA 3P6ZB 1BUIA 4YLQH 3ATIA 2ODQA 1TFXA 5G4BA 3T62A 2ANYA 1O2PA 2FO9A 1D9IA 2RA0A 2DUCA 3F68H 1WYKA 1BRUP 3LPRA 4ZKSU 3SU1A 1OKXA 2F9NA 3C1KA 3KF2A 5EW2H 4IN1A 4Y8XA 1C2GA 1C1QA 5F03A 4Y76A 3OTJE 1O2QA 2C4FH 1GL1A 1GBFA 1AKSB 1A3BH 1ZMJA 3PLPA 1W13U 1ELAA 5LPEA 2BX4A 1LPZB 2VGCC 4MPVA 4D76A 1GBAA 2ZFTA 1LKBA 4Q2KA 1O3KA 3ODFA 2AFQB 1DVAH 3OSYA 4ISLA 3E6PH 1W12U 2BZ6H 2QXJA 1O3EA 5IDKA 1TOCB 3GCTF 5AF9H 1CA0B 2WPHS 2C8YB 4XFQA 5GXPA 1GHXH 3MO9A 3L6PA 1XX9A 1GWAA 2HALA 1HJAC 1BRAA 4A92A 1DS2E 1DXWA 2PKSC 2ZQ1A 1TRYA 2FOCA 5L2ZH 2D1JA 1FY8E 1AVGH 3STJA 1TA6A 4YT6H 1A5GH 1W14U 4JK5A 2JH0D 5LPRA 4Y71A 2Y7XA 1YF4A 1ABJH 2H5CA 2ZHEH 2Z9IA 1LVYA 1F7ZA 1OWKA 1O32A 1TWXB 7ESTE 1SLVB 1M9UA 3W94A 3ZZ7A 1EKBB 4BAOB 1Z8GA 3MO6A 1HYLA 1P2MA 4ZAEA 2Z3DA 4IW4E 3MMGA 1GJ9B 5T6FA 1AUTC 3PLBA 2GMTC 2H2ZA 1TB6H 1P2JA 1BZXE 4DGJA 1OX1A 3FVFB 1BBRH 5FXLA 2FX4A 1ETRH 4IBLH 1OOKB 1O38A 2VVVA 1AVWA 2A2XH 1BTUA 1QBNA 4FUBA 2Z6BD 3U1JB 1LCYA 1O35A 1AWHB 2FDAA 3MO3A 1NT1A 1C2EA 5C20A 1K1MA 1N8OC 4OS4A 3MNCA 3HK6B 4ZKRU 5A09A 2BDYA 3MNSA 2OXSA 2ALPA 3EE0B 4AZ2B 1ELDE 1GBHA 2PWXA 1GI5A 2BDBA 1PPBH 3H7TA 3MNBA 3SUEA 1C1RA 1ZHPA 3LJJA 1FAKH 2BD8A 3VB4A 1P05A 2ANWA 3F6UH 1P06A 3VGCB 2TBSA 1K22H 3PLKA 1C1UH 1V2QT 2CF8H 3S0NA 1P2IA 2HPPH 4XBDA 3UNQA 1F5LA 1O2IA 3A81A 4NIYA 1C5ZB 1SBWA 4WXVA 2IOTA 4ZROA 1GHAF 2BD4A 1C5QA 1G37A 4FVBA 1L1NA 1Z6JH 1F92A 3RMMH 3U8RH 5A8ZA 1S84A 2GCTB 4VGCC 1XUIA 2OC0A 1AFEH 3MH4A 3BTHE 2FLBH 1ZYOA 2Y6TA 1YM0A 1GI1A 2VIVA 3B23B 3SU6A 4D9QA 1D3QB 1WCZA 2F9UA 5A8XA 3BN9A 4X1NU 2ZDAH 5FPTA 1NTPA 1ELGA 1FDPA 4ABFA 4WXIA 3U8TH 1DFPA 2ZZUH 1QJ6B 4OS2A 2ZCHP 1QRWA 5DG6A 1RGQA 4AFSA 1V2MT 3RXBA 3DFLA 5FHTA 2B9LA 1GBCA 2BD2A 3BG4C 1KLIH 4DW2U 2PTCE 3N7OA 4M7GA 2FXRA 3GY7A 3L33A 3TGKE 2Z9LA 5JBAS 2XBWA 1GGDB 3MU4A 1O2OA 2P3UB 1C4Y2 3KL6A 1KLTA 4FU7A 1LHDH 1TONA 2FIRH 3IG6B 1YCPK 2PSXA 1QJ7B 2P8OB 1C5XB 3RMNH 3HPTB 4X2XA 1O2WA 3LGYA 4WMEA 1P9SA 4FU8A 4NZQA 4UFDH 1XXDA 4K1SA 2OUAA 1AUJA 1S82A 3EDXB 3LC3A 4WMFA 2CV3A 3SV9A 1SHYA 2UWLA 1QBOA 1FPHH 9LPRA 1GMDG 1WU1A 5T6DA 2QC2A 4ABHA 2EI7A 7KMEH 4K60A 3RXKA 1QJ1B 2BDCA 1GI6A 1H8DH 1TMTH 2XCFA 4I8KA 4JZ1A 3V12A 1GBBA 2FOGA 1DITH 5DP8A 4Y8YA 3K9XB 3T28A 4E7NA 3MH7A 2WUCA 3SORA 1FIZA 4AGJA 1ELBA 1YPHE 3RXAA 1Z8IB 4NWLA 4TPYA 3SJ9A 1MTVA 1NU7B 1GI3A 1TE0A 1QIXB 2AMDA 3TLOA 1V2OT 1SC8U 1KIGH 3FP8E 1OYTH 1MQ6A 3OY6U 4O9VA 2W5EA 2BHGA 1T31A 1MQ5A 1P09A 2R3YA 2R2WU 1O5BB 1QR3E 2GKVE 1DICA 5FAHA 5C3NA 1VITG 2VWMA 2OC8A 1Y5AT 2ZU2A 1EOJA 1DWCH 1AD8H 1QQUA 1C5PA 3HATH 1TBRH 4YOJA 1EP6A 2ZEBA 1EAXA 1ID5H 3CENA 1QFKH 1B5GH 1O2XA 1TGNA 3T29A 1KXFA 1TMBH 2D2DA 1C2KA 4GHTA 2HRVA 1FQ3A 3LOXA 2G4TA 3QTVH 5EODA 1JOUB 1LVMA 2J9NA 2A5IA 3E8LA 3ZZDA 3RMOH 1YPMH 3RC4A 2J38A 2FOFA 4D9RA 3ZZBA 3I29A 4AORA 1BITA 1THRH 5C5NA 1T8NA 4O3UA 2OTVA 1UCYH 4GAWA 3U69H 2SGEE 1P12E 1GI0A 2CN0H 1MAYA 1SQTA 3P8OA 1CA0C 1EP5A 2UUJB 3R3GB 1HJ8A 3VPKA 3UUZA 4AG1A 3TH2H 4CREA 1GJCB 4FUFA 2IPHA 1A0JA 3NPSA 1CQQA 2BD3A 4A1XA 1GHWH 3MYWA 5FCKA 3KQEA 2UUYA 2LNCA 5EOKA 1JMOH 5JDUB 3M7UA 1HRTH 1NRRH 4A1VA 2ZFQH 4X2WA 3BG8A 1O5FH 1TIOA 1C5YB 4B73A 3A80A 2PGQB 3QZQA 2G5VA 5DO4H 1LHCH 2ANMH 2ZIQH 1GG6B 3UTUH 1PJPA 3BTTE 1CT0E 4B2CA 2Y5HA 3FAOA 7GCHG 3UNRA 5A0AE 1K1PA 1IQGA 5K7RA 3P17H 1O3FA 1AVXA 2J4IA 2ODYB 3ATMA 4NA7A 2GDDA 4X6MA 4FUCA 1QA0A 1J17T 1C4U2 1O3OA 4I8JA 1WSSH 2ASUB 4ABGA 4H6SB 1GHZA 1Y5BT 2Z3EA 4MPWA 2R0KA 1TAWA 4ABEA 1UTJA 3A87A 2A0QB 2GX4A 4NA9H 2ZQ2A 3A83A 3U98H 1SGPE 1QHRB 4J2YB 1BIOA 3A85A 4YZUA 2VWOA 5EXLA 4GVUA 3DHKH 1VCPA 1GMDF 4ABDA 1SGFG 2VVCA 4H6TA 5DK1A 1L4ZA 1HAPH 1SR5C 3A7TA 3P8NA 4NG9H 4Y0ZE 2TGDA 1ARCA 1C5WB 1A1RA 5GWZA 1MZAA 1NM6A 4BTIB 1BHXF 4UD9H 1FZZA 2AGGX 3VGCC 1S6HA 2ZC9H 2ZCKP 1OWJA 1C2DA 2VU8E 2RCEA 2ZA5A 1A46H 1MTNC 1SL3A 3S7HB 4U2WA 4XSKU 2ZGJA 3URDA 3EAJA 1DUEA 1TPPA 2G52A 1SLWB 1S0RA 1T32A 2GCTC 1NO9H 1G36A 3ZVAA 1BOQA 4X8SH 1VITF 1O34A 3ESTA 3OYPA 5C1XA 2SGAA 1TX8A 4UDWH 2FTMA 3V0XA 1Z1JA 4WH8A 1Y8TA 1EZSC 5JYIA 1YPHC 4X6PA 6GCHG 3FZZA 2BLQA 3GYMA 1RTKA 4E7RG 1BTHH 2TRMA 4ISIH 1PFXC 2C90B 3V13A 1DY9A 1TQ7B 4AB8A 1OWHA 1EJAA 5ESBA 1AHTH 5HYOA 4UONA 3BTME 3KN2A 3RXEA 5EW1H 1TNLA 1RS0A 1AB9B 3GISB 1QL7A 4AFQA 1V3XA 3T26A 4AFUA 1XM1A 3BG4B 1ELCA 3PO1B 1UJ1A 3T25A 2FEQH 5DGJA 1GGDC 3RXIA 1C2JA 1C5TA 2O8LA 2Q1JA 1BTPA 4YLUA 2VWNA 1V2RT 4K5ZA 4BAQB 4R0IA 3PV4A 4LXBH 3SNEA 2P8OC 3ZVCA 3NKKA 1T8MA 5AFZH 4ISNA 2ZG0H 1BMNH 3NCLA 3PROA 1NFYA 2FYRA 1P01A 1JXPA 3PMBB 1J14A 5ETXA 1XUKA 4JMYA 5FX6A 2ZHWH 4XE4A 3GDUA 1TGSZ 4FUEA 2B5TB 4DURA 1HAIH 2FODA 3SGQE 4NCYA 3SU4A 4DIIH 2W7SA 1MD7A 4FUHA 5GDSH 8GCHG 1GBMA 2WYJA 1GCTB 1E36B 1ZMLA 2J2UA 7GCHF 2CMYA 3VB5A 3A8CA 3RXDA 1O2ZA 1H8IH 2J92A 5T6GA 5C1UA 2V3HH 3GY6A 1IAUA 1GBEA 1FAXA 1O2LA 4B75A 1SGNE 2A31A 4Q7YA 1EJMA 1O3AA 2AMPA 2Y81A 3HKJB 2OLGA 5F8ZA 2HGTH 3TK6A 2Q6GA 1ZOMA 2VIDA 3M37A 2VJ1A 1Z1IA 2AIQA 1S5SA 3TNTA 2G5NA 1K28D 3KQCA 4KELA 1K21H 3O8RA 1O3HA 1Y5UT 2FPZA 1ZR0A 2BD9A 2F91A 4GHQA 1A5IA 4ZHAA 3EQ0H 1O3PB 3LIWA 2GP9B 1BQYA 1EPTA 3SJIA 1OWDA 2ZHFH 1CT2E 1EZXC 4HTCH 2HNTE 2IJOB 1O30A 1ZRKA 1O33A 3TPIZ 2ZFSA 3BSQA 3JZ1B 1RTFB 2P94A 4D7FA 2FOMB 3SN8A 4CRGA 4GUXA 1EASA 1HAVB 5CMXH 3ITIA 1SVPA 2B0FA 3D62A 4IMQA 4A6LA 3RLYH 1FMGA 1D4PB 2TGPZ 3OY5U 1C2MA 4BOHA 1S85A 1FONA 2BM2A 1MU6B 1GJ6A 1A0HB 1ELTA 4D7GA 1BDAA 1PPZA 3SV6A 3A7YA 4CRBA 1SOZA 1K1NA 5PTPA 1J8AA 2ZNKH 4KTSA 1FNIA 3SQEE 1L4DA 3ZVEA 4A1TA 4IC6A 5DP6A 1TOMH 3RXJA 1CSOE 1BTWA 2G00A 1NZQH 3Q00A 2FOEA 5E0HA 1YBWA 1T7CA 1F0SA 4WH6A 1FV9A 1AFQB 1SGRE 1C9TA 4ZXYH 6GCHF 2C8ZB 1BMMH 1OXGA 2Y80A 3RXFA 2PSYA 2QAAA 1G3BA 3SZNA 4CR5A 3GCHB 4CRCA 2OD3B 1V2LT 1XKAC 1HV7A 1KYNA 2VH0A 1V2WT 1BB0B 1T8LA 1VCWA 1ZTKA 1SQOA 1GG6C 3U1IB 4RSPA 4WF8A 3MU8A 4AG2A 2FP7B 1Z6EA 2CF9H 2WPKS 3ODDA 3U8OH 1KY9A 2TIOA 3A8BA 2JKHA 1ZHRA 2D8WA 3A8DA 3EYDA 3TJUA 1C1OA 2WPIS 1P3EA 4XOJA 1NRNH 1V2JT 3M5OA 1ZTLA 1QCPA 1O2HA 1IHTH 2G81E 2J95A 1NFWA 1UTKA 2G8TA 1AE5A 3LGIA 4I8GA 1ZSJA 3IITA 3PB1E 1HPGA 1VJ9U 3TGJE 1ZMNA 3F9GA 1SSXA 1SI5H 2PKAB 1HXEH 5LGOA 3VB3A 3PMHB 1SGCA 1CHOG 3LGVA 8GCHF 3RC6A 2GVFA 3SU0A 2RA3A 3BTDE 1DWEH 4ZUHA 1DX5M 3AW0A 3TH3H 1ARBA 1FN8A 4K1EA 4FUJA 3GY5A 3ATWA 5HXFA 3QWCH 1GJAB 3ZZ8A 1SHHB 4Y10E 4GPGA 1XXFA 2FYQA 5BPEA 3VXFH 2BB4A 2A32A 2BMGB 1ELVA 1DSUA 2XC5A 2Y5GA 2M5TA 4NGAH 1GJBB 3UR6A 1GDNA 1MTNB 1T8OA 4B1TA 2ZFPH 1GHBG 1SGIB 1DANH 3VXEH 4IMZA 1T4UH 3ELAH 1BBRK 2BVRH 3BIVH 4B71A 4JYVH 1GDUA 3PM3A 1NY22 4X2YA 4UFGH 2C3SA 4SGBE 3PTNA 4MNVA 3CS7A 1JIMA 4TWWA 3LJOA 1V2ST 3RLWH 3SUDA 1GI9B 3H7OA 2ZTZA 4CRDA 1AZZA 1IQKA 1TGBA 4KGAA 5DP7A 4J1YA 1GBIA 1GBTA 4Y7BA 6LPRA 1MUEB 1THPB 3MU5A 3S9AA 1C1SA 1QB6A 1SFIA 2HVXA 2A4QA 1AB9C 1NFXA 3EA7A 4O03A 5FX5A 3PMAB 2WPLS 3Q3XA 3QTOH 4MQAA 3PO1C 2PHBA 1JIRA 1V2KT 1O3LA 1VGCB 1XVOA 4Y0YE 2CHAB 1C5NH 3WY8A 3RMLH 2UUKB 1BCUH 3A84A 4B74A 4JZEH 5JB9S 1XMNB 2HNTC 3AASA 2Z9JA 2W7UA 1UVSH 2XBXA 3BV9B 1S6FA 3BIUH 4BNRA 2FOBA 3KIDU 3SQHE 4ASHA 3UIRA 3PTBA 3E0PB 1OP8A 2QF3A 4OGYA 1BMLA 1F5RA 1GI2A 1TBQH 5EQSA 1BBRE 1WV7H 1Y3YA 1MCTA 2EI6A 4NIXA 3S7KB 2VWLA 2BQ6B 1W3CA 2Z3CA 3VEQB 3TGIE 1Y3UA 3ZVBA 4MPXA 1KDQA 4Q80A 3SNDA 1G3DA 2FWWA 2Z9GA 2ZHDA 3MHWU 4OS5A 4X6OA 3RXSA 3MU1A 1HAYB 1DXPA 4LZ4B 1GCTC 1UVOA 1C2HA 1PQ7A 3SI4H 3TJNA 1X7AC 4AYYB 1Y3WA 2FS8A 2PUXB 4I33A 1QL9A 1FLEE 3HK3B 1G2LA 1ETSH 2FOHA 1D3DB 1YPGH 3E1XB 3BTEE 3H5CB 5CHAB 4LZ1H 3SNBA 3RDZA 3GY4A 4JCNA 4Y6DA 3UPEA 3PWBA 1K1IA 4FUIA 1EZQA 2XBYA 3Q3YA 2XNIA 1HGTH 2J94A 1THSH 2FZZA 2G51A 2ODPA 1KLJH 2ZWLH 3RU4E 1HAVA 1W10U 3RXPA 2OC7A 3K6YA 1VJAU 2H5DA 6ESTA 1BRBE 2R0LA 2ZU5A 3AVZA 2QCYA 1NU9A 1CHOF 1SB1H 5EQQA 4TY7A 2ZKSA 1LPKB 4YT7H 2A5AA 1TGTA 1Q2WA 1XUGA 4RN6A 5I25A 1WUNH 1SGYE 1QB1A 3P8GA 1UK4A 1TNJA 5GPIB 1VZQH 1CGHA 1HB0B 3P92A 1NC6A 1BMAA 1K1OA 2KAIA 1AN1E 1G30B 1PQ8A 1HJ9A 2STAE 1LHGH 1YPKH 1N1LA 2XW9A 5E2PA 2JETB 2BYAX 3UWJH 4MNXA 5EGMA 2V0BA 2AIPA 1O5AB 3KEEA 1EPTB 5EG4A 2R9PA 4UE7H 4CH2B 1WQVH 2XTTB 2ZP0H 1VCQA 1GHBF 4YESB 1YYY1 7LPRA 1GI7B 1UK2A 1CGJE 1EJNA 3GICB 3SJOA 2SGQE 3A8AA 2FLRH 1OS8A 2QXIA 1E37B 1AFQC 1O3IA 3GDSA 4ZH8A 1YCPM 3SV7A 5HGGA 1V2NT 1LPGB 2NU1E 4DOQA 3GCHC 1ANEA 5F8XA 3A89A 3M3VA 1KXBA 1TBZH 1H1BA 1JBUH 3SW2B 2QXHA 1ELFA 1ZTJA 2NU0E 1GHVH 3W95A 4I31A 4WVPE 3SV8A 1UVUH 1CT4E 2GZ8A 4AGKA 3FZDA 2WV4A 1P03A 3BEIB 1Z71A 4DCDA 2H9TH 5JPMH 1O3NA 2PKAA 1MKWH 1RRKA 4Y79A 1ACBE 3A7XA 1C5UA 5GCHG 2SNWA 5JB8S 5GIBA 4TPIZ 4AN7A 1S0QA 2QV1A 1GBDA 1K1LA 1QRXA 3JZ2B 4RKJB 5CE1A 3PWCA 4K8BA 2V35A 4UFFH 3SNCA 1V2VT 2HNTF 1BA8B 1UCYK 2EEKA 3C27B 2ANKH 4WY3A 2XBVA 1NFUA 3UR9A 2BXUH 3O8BA 2F9OA 2G55A 3LONA 2EA3A 1IQFA 4E06H 2OINA 2O8UA 2H9HA 4LK4A 1GVZA 5FPSA 3S9BA 3TVJB 2EC9H 5DJ7A 1ESAA 1CE5A 3TJVA 1C1NA 1W2KH 3I78A 2ZF0H 1IHSH 2F3CE 3ATKA 2FMJA 3BF6H 1QNJA 1C5SA 2OQUA 1HIAA 4UEHH 4Y8ZA 1UTLM 5E2OA 1ZPCA 5AHGH 3UWIA 1A61H 2W26A 3NZIA 1G9IE 2QIQA 4RKOB 1DDJA 2WPMS 1PPEE 4BAHB 4MG3A 1BJVA 1MKWK 1AIXH 4ZHLU 5HM9A 1HAOH 1MD8A 2DE9A 1O5CB 2P3FH 5A0CA 3L3TA 4NSYA 1ZGIA 3STIA 3T5FH 1DWDH 1GBJA 3KNXA 4TWYA 4X1QU 2QXGA 1O31A 1A2CH 3F9FA 1O2KA 1C1WH 1UCYE 2QGRA 1L1GA 2QN5T 4KTCA 2W3KA 3O8DA 2PGBB 1HXFH 1L0ZA 8KME2 1ESTA 2JH6D 1DM4B 2CJIA 1UHBB 1RIWB 3D65E 2RDLA 1SGQE 1C5VA 2XXLA 1LO6A 2Q6FA 4WMDA 4GSOA 2BD5A 1GI8B 3NK8A 2P3TB 1ORFA 2GT7A 1EB1H 1GHYH 1VGCC 3UOUA 2CHAC 2IN2A 1RXPA 2GV7A 1XUFA 1O3BA 2BX3A 2A1DB 3LGWA 3CS0A 2O9QA 2PR3A 1TYNA 1ZPBA 1P10A 2FS9A 2VIWA 1TQ0B 1O2VA 5E8EH 3DD2H 1E34B 3A7ZA 3S69A 1C5LH 4JK6A 1FI8A 4JYUH 1K2I1 1O3JA 5EQRA 2BLVA 3UY9A 3BTFE 3BEUA 5JBTA 1PPFE 4BTUB 1UTNA 1TX7A 3HGNA 2I6QA 1LVBA 2EI8A 3M35A 2THFB 3Q77A 3GCNA 1F0UA 2LPRA 2VNTA 3O8CA 1PPHE 4Y7AA 1WTGH 5H4IB 3ZYDA 1GJ5H 1T4VH 5HMAA 3KCGH 1YLCA 1O0DH 1QY6A 2UWOA 4PROA 1E35B 2F9PA 4DJZB 3EA9A 3MH6A 3A82A 2ZU4A 5L30H 2J34A 1SGDE 2JH5D 4INHA 1F2SE 2SNVA 1TRMA 1TABE 2XWAA 5CHAC 5GCHF 5TCAA 1ELEE 1P2OA 3M36A 1KXCA 5DPAA 4IS5A 1KDQB 2F9VA 1UMAH 1C1PA 2BQWB 1DY8A 2C8WB 4NWKA 1TNIA 1TMUH 2VIPA 1O2GH 4CRAA 3F1SB 1F5KU 1EAUA 1ZJKA 1DOJA 1OYQA 1BHXB 5T3HA 3SO3A 3RP2A 1LMWB 2ZFFH 1FXYA 3Q76A 2F83A 1BT7A 1HAGE 1GDQA 4AX9H 2BTCE 1HNEE 5E0JA 3LT3A 4A7IB 1QURH 4BXSA 3QGJA 1TRNA 3GY2A 1DWBH 1QB9A 3VB7A 5FBIA 3EA8A 1BTZA 5DP5A 2GGVB 5I46H 1E0FD 3E3TA 3SHCH 2V6NA 3ZZ3A 2G4UA 4H42U 1RJXB 5AFYH 2R2MB 4BXWA 3LGUA 3QN7A 5A8YA 2JETC 2UUFB 2AGEX 1EPTC 3T27A 2A2QH 1V2UT 3UOPA 4FVDA 1P57B 4MLFB 2BY5X 2GV6A 4MPUA 2Z94A 1D3PB 1TA2A 1YC0A 2OP9A 4UFEH 1O2TA 1PPGE 1PQAA 1D6RA 3ZVDA 3VB6A 1VR1H 3FANA 4OGXA 2KAIB 5L2YH 1B0EA 4E05H 2BDHA 3ZVFA 1ZGVA 1ZJDA 3HKIB 1INCA 1IQMA 4FUGA 2F9BH 1BJUA 3F9HA 1GVKB 4YO9A 1GJ4H 4ESTE 2P59A 2WPJS 1O2MA 4MNWA 4NZLA 1W8BH 2SGFE 1IQLA 1QQ4A 3NWUA 1TALA 4MVNA 2HLCA 4JZDH 4CRFA 1W7GH 2ESTE 1SLXB 3RXQA 3RXTA 3SGBE 4HI3A 1TNKA 3QDZB 2BDAA 1A5HA 2ALVA 3K2UA 3P95A 4ABBA 3KQBA 3M7TA 4JZFH 1OWIA 3KQDA 1W0YH 1ZZZA 1EUFA 2PV9B 1W11U 2VIQA 2P95A 5IYTA 2ZHQH 1HAZB 1V6DA 4SGAE 4X6NA 1AMHA 3B9FH 5FBEA 1H4WA 1GI4A 1LQEA 1LVOA 1UVTH 4AFZA 3TNSA 2ILNA 1PPCE 4WJG2 3MOCA 1P2NA 2O8TA 1GJ8B 5L6NH 2B8OH 4O97A 1TPAE 2FI5E 1ESBA 2A45B 1BTYA 3M3SA 4TYDA 1MH0A 3MFJA 1MCVA 2PFEA 2ZGCA 2PLXA 4YTAA 1SLUB 2AMQA 2AEIH 4H4FA 1WBGB 1TX6A 1C2LA 3URCA 2O8WA 1UTMA 3RXOA 4Z0KA 3D23A 1GBKA 3S9CA 3BEFB 1Q31A 1XUHA 4NA8A 4IC5A 2A7HA 4YM9A 1C4V2 1AE8H 4OS6A 1EAWA 5JBCS 3T2NA 2ZU1A 3ZZAA 2C8XB 5FCRA 1EQ9A 3ZVGA 3GY8A 1ABIH 3AAVA 4ZXXH 1MTSA 3BTGE 1TNHA 2BOHB 3LH1A 2SGPE 3ZZ6A 3P8FA 4TY6A 2QA9E 1MBQA 1L1JA 2GTBA 2XC0A 3ZZ5A 1AGJA 2B7DH 1O2RA 1K9OE 3BTQE 2RG3A 6CHAB 4ABIA 3LH3A 3SV2H
chains in the Genus database with same CATH superfamily
1MMJN 4ZMAH 5DP9A 1SPJA 1O5GH 1UHBA 4DIHH 1O2JA 2I6SA 3F9EA 4HFPB 2WINI 5EXMA 4FU9A 1C1TA 1EX3A 4Q7ZA 1FY5A 1S81A 1IOEA 1HIAB 4MNYA 1BTXA 4XBCA 5DKMA 2BXTH 2FI3E 3MTYA 3RU4T 4X1SU 2XYAA 2CXVA 1RIWC 1KTTB 1P11E 2VVUA 3M5LA 2Y82A 1FX0B 3ZYEA 4X8UH 1YCPH 4NIWA 1CA8B 4K2YA 3MU0A 2BY6X 2SFAA 3FP6E 2ZGXH 1UTOA 2XC4A 3GY3A 1UO6A 3RM2H 3MNXA 1GPZA 2Q6DA 5EPYA 3TH4H 2J98B 1GBLA 5BRRE 2TPIZ 4CHAB 2ZGHA 3M61U 1Q3XA 2D26C 4YOGA 2WHXA 5IK2D 1KXAA 2Y5FA 1YPEH 3V3MA 2TGTA 2BVXH 4FUDA 1G3EA 3SBKA 4MDSA 2BZAA 3MWIU 1O36A 3UREA 5FPYA 3B8JA 3ZV8A 4AYVB 1H9LB 2BLOA 1HAHH 4ISHH 1YKTA 1XUJA 3RM0H 2ZDLA 4B6EA 1BRCE 1PYTD 1QGFA 1SOTA 3TIUA 2FM2A 1ZPZA 2BY8X 4CBOA 3H09A 1SGTA 3QZRA 2AH4X 5ESTE 1QTFA 1O5EH 1FUJA 4LOYH 4BAKB 1TLDA 1P3CA 5C5OA 5DP4A 1XVMA 1W7XH 2NU4E 3E90B 2WV5A 1XKBC 3RU4D 3SUFA 3ENSB 3SJKA 1NROH 4KP0A 4X2VA 3R0FA 5F53A 1WQSA 1DSTA 4NFFA 2V3MA 3A88A 4YOIA 2O8MA 1MZDA 3GCOA 3RXHA 5C2ZA 3SNAA 3A7VA 1LHEH 4OS1A 1HAXB 2GDEH 3TK5A 4GCHG 1GJDB 3PMJA 3P70B 5B6LA 3K65B 4HGCA 3F3BA 4ABAA 1CGIE 1O39A 2ZDKA 2YMSC 2ZGBH 5F6MA 5C67A 2A7JA 1CBWB 1DT2A 1DLKB 2A4RA 3SOSA 1B7XB 1H9IE 2YOLA 3LDXH 3M7QA 2VB0A 1AWFH 3SJ8A 4X0WU 2W3IA 1NBME 2GD4B 1IQNA 2ZPSA 5LPFA 3RXRA 1QBVH 1E79D 1GMCG 4B2AA 5TJXA 3U9AH 1E38B 1YP9A 1GJ7B 2A4OA 1OP0A 2VIOA 2A5KA 5SGAE 2BOKA 1AZ8A 1MU8B 3RXLA 5ABWA 1DUAA 2WUBA 1AKSA 9ESTA 3SGAE 4DT7B 3UQVA 3OU0A 1RD3B 1HUTH 1JRTA 5TCCA 1LKAA 1DLEA 3EGKH 4CH8B 3SUGA 3TK9A 1SGEE 4JZIA 5DP3A 4K69A 4I32A 2BDIA 3PV5A 3V7TA 2GCHG 1CVWH 2K1QA 1O3GA 3ZZ4A 3DUXH 1O2SA 3GDVA 1FPCH 1DPOA 1AU8A 3RUOA 2BD7A 2L74A 1FY3A 1A3EH 4DY7B 1QL8A 1NESE 2SGDE 2C93B 4KTUA 4R8TB 2OQ5A 1UTQA 4Y11E 4A5TS 2WYGA 3UQOA 2IPQX 2VGCB 1GMHG 1MBMA 3D49H 3RXUA 1EAIA 1CHGA 4X1RU 2ZFRH 3QGNB 5C17A 1O3MA 1LQDB 1V2PT 4ABJA 1FJSA 1SFQB 2CGAA 1QRZA 2GZ9A 1P2KA 2FESH 1H9HE 3F2HA 1HBTH 1NPMA 5K0HA 1IQHA 2DE8A 4BANB 1RFNA 4F49A 1YPJH 2AYWA 2V3OH 5A0BA 1O3CA 4X8VH 1OWEA 4IN2A 1TGCA 2HPQH 2Y7ZA 1A7SA 1HJAB 1U6QA 5EXNA 1G32B 4B76A 2UWPA 1EATA 2PW8H 2PKSB 3HGPA 8LPRA 1Y3XA 2HLDD 1SGFA 1KSNA 3SU3A 1D6WA 1OP2A 2ZPQA 4QT8C 1HCGA 3A86A 1AY6H 4K8YA 3LU9B 4Q7XA 4ZKNU 3ZZ9A 4KKDA 3N7EA 1UW7A 2FX6A 2BY7X 2ZCLP 2ZECA 3N7DA 2Z7FE 3M5MA 3IWMA 4F55A 5J4SA 3ZZCA 2ULLA 4CR9A 1KXDA 3GYLB 2FI4E 3QK1A 1PQ5A 1YLNA 1NRQH 2FOAA 1C2FA 1P2QA 3OAAD 2F4LA 1FIWA 3RXMA 1ANCA 1MTUA 2GMTB 5C1YA 1LHFH 1CU1A 1KTSB 3FKSD 5EU8A 2QYIA 2STBE 2VINA 1GVLA 4HZHA 4ZKOU 2PUQH 2BDGA 3MI4A 2ZPRA 4IGDA 1ZSKA 2A7CA 1AI8H 1NRPH 3QX5H 6CHAC 4K1TA 3RXGA 3OE7D 8ESTE 1C2IA 4GCHF 1A4WH 1O2NA 3QUMP 4XDEA 3RXCA 1MAXA 1OSSA 2AGIX 3RC5A 2PP6A 3M3TA 3F0PA 2XCNA 1N8OB 1SQAA 1SG8B 3I77A 4ZHMU 1O3DA 1C1VH 3BTKE 4BAMB 2A4GA 3VG8A 3Q3KA 1F0TA 3NXPA 1N6YA 2ZDNA 1TPOA 3VFEA 1IQJA 1TPSA 2ZDVH 1C5RA 1G2MA 1J16A 4MTBA 1C5MD 5LH8A 2P93A 1HDTH 4X1PU 4ISOA 1KMHB 2AS9A 3UFAA 2OBQA 4F48B 3OX7U 1EFRD 1GMCF 1O2YA 3LC5A 1K0HA 1F0RA 1C1MA 3MH5A 3E16B 1D3TB 1QA7A 2ZI2H 2FTLE 1P9UA 2OBOA 1RTLA 4B2BA 4FXGH 3FP7E 4I7YH 1EOLA 2IJD1 2TGAA 3NUMA 3BTWE 3DT0H 1J15A 5GJ4B 1LDTT 1YGCH 1IQIA 2XWBI 4INLA 3DFJA 2HOBA 1DE7H 2LP6A 4I8LA 4CHAC 1E1QD 1KXEA 3GCTG 3ZV9A 1PYTC 1Z7KA 1P0SH 5HM2A 3SU5A 4VGCB 1B0FA 2QF0A 2BLWA 2L6OA 4GLYA 3KHVA 2Z9KA 3SU2A 2BQ7B 2H1UA 2GCHF 1C5OH 2QY0B 3E91A 4Z6AH 5B6OA 3ATLA 3M5NA 1AO5A 1W0ZU 1UTPA 1S6LA 1O37A 2OCVB 1LTOA 1G3CA 3AAUA 3SHAH 1P04A 3SI3H 3QLPH 1WOFA 1MTWA 1EZUC 1UVPA 3TU7H 1EXFA 1GCDA 2H6MA 4I8HA 4DG4A 2BVSH 2W6JD 1GMHF 3K6ZA 3PYHA 3QO6A 5CHBA 1Z8JB 3A7WA 3G01A 4JYTA 4WWYA 1UK3A 2R3UA 1J9CH 1A0LA 2NWNA 2GT8A 2ZTXA 2ZTYA 3TJOA 1C9PA 3WWFA 1NRSH 4O3TA 1MKXH 1K1JA 1ZSLA 1ANDA 4U32A 3FFGA 1FY4A 1V2TT 1GL0E 5E0GA 5DN6D 2ZDMA 3TITA 1HLTH 1N6XA 3GOVB 1O2UA 2H9EH 1NN6A 1VITH 1JWTA 2OC1A 1E1RD 3LGTA 1WAYB 2XRCA 1JRSA 2KM0A 2ZO3H 4AB9A 2YNAA 1P8VC 2P16A 4U30A 3RXVA 2PTNA 5J4QA 1ETTH 3CP7A 2ZU3A 4NIVA 4CBNA 1TNGA 4K3JA 4F4OC 1OPHB 2AERH 1CBWC 1P02A 2GZ7A 3UB0A 2NU2E 1AQ7A 3E0NB 4THNH 4DVAU 4NFEA 1S83A 4X8TH 2K8IA 4AOQA 2NU3E 5EPNA 3AW1A 2BY9X 5AVDA 3UNSA 3KGPA 1L2EA 3DA9B 4NSVA 5A2MH 1ZHMA 4U01A 1YPLH 1ZLRA 5CDFE 1IQEA 1SMFE 4D8NA 1WTHD 5F8TA 4BTTB 1EB2A 1O5DH 1HFDA 2HWLB 4OS7A 3LKWA 5JBBS 1Y59T 1ZRBA 2YNBA 1MKXK 1YLDA 1GHAG 4INKA 4XBBA 1CO7E 1NS3A 1Y3VA 2VH6A 1FN6A 1FY1A 1ANBA 1Z8RA 3P6ZB 1BUIA 4YLQH 3ATIA 2ODQA 1TFXA 5G4BA 3T62A 2ANYA 1O2PA 2FO9A 1D9IA 2RA0A 2DUCA 1QZ8A 3F68H 1WYKA 1BRUP 3LPRA 4ZKSU 3SU1A 1OKXA 2F9NA 3C1KA 3KF2A 5EW2H 4IN1A 4Y8XA 1C2GA 1C1QA 3UAIC 5F03A 4Y76A 3OTJE 1O2QA 2C4FH 1GL1A 1GBFA 1AKSB 1A3BH 1ZMJA 3PLPA 1W13U 2KCPA 1ELAA 2M2AA 2WZQA 5LPEA 2BX4A 1LPZB 2VGCC 4MPVA 4RT0A 4D76A 1GBAA 2ZFTA 1LKBA 4Q2KA 1O3KA 3ODFA 2AFQB 1DVAH 3OSYA 4ISLA 2LELA 3E6PH 1W12U 2BZ6H 2QXJA 1O3EA 5IDKA 1TOCB 3GCTF 5AF9H 1CA0B 2WPHS 2C8YB 4XFQA 5GXPA 1GHXH 3MO9A 3L6PA 1XX9A 1GWAA 2HALA 1HJAC 1BRAA 4A92A 5DSFA 1DS2E 1VKYA 1DXWA 4Q4LA 2PKSC 2ZQ1A 1TRYA 2FOCA 5L2ZH 2D1JA 1FY8E 1AVGH 3STJA 1TA6A 4YT6H 1A5GH 1W14U 3PRBA 2JH0D 4JK5A 5EJZA 4YXWD 4Y71A 5LPRA 2Y7XA 1YF4A 1ABJH 2H5CA 2ZHEH 2Z9IA 1LVYA 1F7ZA 1OWKA 1O32A 1TWXB 7ESTE 1SLVB 1M9UA 3W94A 3ZZ7A 1EKBB 4BAOB 1Z8GA 3MO6A 1HYLA 1P2MA 4ZAEA 2Z3DA 4IW4E 3MMGA 1GJ9B 5T6FA 1AUTC 3PLBA 2GMTC 2H2ZA 1TB6H 1P2JA 1BZXE 4DGJA 1OX1A 2XNDD 3FVFB 1BBRH 5FXLA 2FX4A 1ETRH 4IBLH 1OOKB 1O38A 2VVVA 1AVWA 2A2XH 2OK5A 1BTUA 1QBNA 4FUBA 2Z6BD 3U1JB 1LCYA 1O35A 1AWHB 2AHME 2FDAA 3MO3A 1NT1A 1C2EA 1WXRA 5C20A 1K1MA 1N8OC 4OS4A 2K0QA 3MNCA 3HK6B 4ZKRU 5A09A 2BDYA 3MNSA 2OXSA 2ALPA 3EE0B 4AZ2B 4XD7D 1ELDE 1GBHA 2PWXA 1GI5A 2BDBA 5FL7D 4TT3D 1PPBH 3H7TA 2QE7D 3MNBA 3SUEA 1C1RA 1ZHPA 3LJJA 1FAKH 2BD8A 3VB4A 1P05A 2ANWA 3F6UH 1P06A 3VGCB 2TBSA 1K22H 3PLKA 1C1UH 3EE7A 1V2QT 2CF8H 3S0NA 1P2IA 2HPPH 4XBDA 3UNQA 1F5LA 1O2IA 3A81A 3U28C 4NIYA 1C5ZB 1SBWA 4WXVA 2J97A 2IOTA 4ZROA 1GHAF 2BD4A 1C5QA 1G37A 4FVBA 1L1NA 1Z6JH 1F92A 3RMMH 3U8RH 5A8ZA 1S84A 2GCTB 4VGCC 1XUIA 2OC0A 1AFEH 3MH4A 3BTHE 2FLBH 1ZYOA 2Y6TA 1YM0A 1GI1A 2VIVA 3B23B 3SU6A 4D9QA 1D3QB 1WCZA 2F9UA 5A8XA 3BN9A 4X1NU 2ZDAH 5FPTA 1NTPA 1ELGA 1FDPA 4ABFA 4WXIA 3U8TH 1DFPA 2ZZUH 1QJ6B 3NRLA 4OS2A 2ZCHP 1QRWA 5DG6A 1RGQA 4AFSA 1V2MT 3RXBA 3DFLA 5FHTA 2B9LA 1GBCA 2BD2A 3BG4C 1KLIH 4DW2U 2PTCE 3N7OA 4M7GA 2FXRA 3GY7A 3L33A 3TGKE 2Z9LA 3DCLA 2EY4C 5JBAS 2XBWA 1GGDB 3MU4A 1O2OA 2P3UB 1C4Y2 3KL6A 1KLTA 4FU7A 1LHDH 1TONA 2FIRH 3IG6B 1YCPK 2PSXA 1QJ7B 2P8OB 1C5XB 3RMNH 2WSSD 3HPTB 4X2XA 1O2WA 3LGYA 4WMEA 4ZCNA 1P9SA 4FU8A 4NZQA 4UFDH 1XXDA 4K1SA 2OUAA 1AUJA 1S82A 3EDXB 1NBMD 3LC3A 4WMFA 2CV3A 2KFWA 3SV9A 1SHYA 2UWLA 1QBOA 1FPHH 9LPRA 1GMDG 1WU1A 5EJLA 3F2GA 5T6DA 2QC2A 4ABHA 2EI7A 7KMEH 4K60A 4TSFD 3RXKA 1QJ1B 2BDCA 1GI6A 1H8DH 1TMTH 2KCAA 2XCFA 4I8KA 4JZ1A 3V12A 1GBBA 2FOGA 1DITH 5DP8A 4Y8YA 3K9XB 3T28A 4E7NA 3MH7A 2WUCA 3SORA 1FIZA 4AGJA 1ELBA 1YPHE 4ACAA 3RXAA 1Z8IB 4NWLA 4TPYA 3SJ9A 1MTVA 1NU7B 1GI3A 1W0JD 1TE0A 1QIXB 2AMDA 3TLOA 1V2OT 1SC8U 1KIGH 3FP8E 1OYTH 5KECA 1MQ6A 3OY6U 4O9VA 2W5EA 2BHGA 1T31A 1MQ5A 5HIYA 1P09A 2R3YA 2R2WU 1O5BB 1QR3E 2GKVE 1DICA 5FAHA 5C3NA 1VITG 1YWUA 2VWMA 2OC8A 1Y5AT 2ZU2A 1EOJA 1DWCH 1AD8H 1QQUA 1C5PA 3HATH 1TBRH 4YOJA 1EP6A 2ZEBA 1EAXA 1ID5H 3CENA 1QFKH 1B5GH 1O2XA 1TGNA 3T29A 1KXFA 1TMBH 2D2DA 1C2KA 4GHTA 2HRVA 1FQ3A 3LOXA 4DT4A 2VBCA 1SQRA 2G4TA 1OHHD 3QTVH 5EODA 1BMFD 1JOUB 1LVMA 2J9NA 2A5IA 3E8LA 3ZZDA 3RMOH 1YPMH 3RC4A 2J38A 2FOFA 4D9RA 3ZZBA 3I29A 4AORA 1BITA 1THRH 5C5NA 1T8NA 4O3UA 2OTVA 1UCYH 4GAWA 3U69H 2SGEE 1P12E 1GI0A 2CN0H 1MAYA 1SQTA 3P8OA 1CA0C 1EP5A 2UUJB 3R3GB 1HJ8A 3VPKA 3UUZA 4AG1A 3TH2H 4CREA 1GJCB 4FUFA 2IPHA 1A0JA 3NPSA 1CQQA 2BD3A 4A1XA 1GHWH 3MYWA 5FCKA 3KQEA 2UUYA 2LNCA 5EOKA 1JMOH 5JDUB 3M7UA 1HRTH 1NRRH 2EQNA 4A1VA 2ZFQH 4X2WA 3BG8A 1O5FH 1TIOA 1C5YB 4B73A 3A80A 2PGQB 3QZQA 2XOKD 2G5VA 5DO4H 1LHCH 2ANMH 2ZIQH 1GG6B 3UTUH 1PJPA 3BTTE 1CT0E 4B2CA 2Y5HA 3FAOA 7GCHG 3UNRA 5A0AE 1K1PA 1IQGA 5K7RA 3P17H 1O3FA 1AVXA 2J4IA 2ODYB 3ATMA 4NA7A 2GDDA 4X6MA 4FUCA 1QA0A 1J17T 1C4U2 1O3OA 4I8JA 1WSSH 2ASUB 4FETA 4ABGA 4H6SB 1GHZA 1Y5BT 2Z3EA 4I86A 4MPWA 2R0KA 1TAWA 4ABEA 1UTJA 3A87A 2A0QB 2GX4A 4NA9H 2ZQ2A 3A83A 3U98H 3WWBA 1SGPE 1QHRB 4J2YB 3WW7A 1BIOA 3A85A 4FOUC 4YZUA 2VWOA 5EXLA 4GVUA 3DHKH 1VCPA 1GMDF 4ABDA 1SGFG 2VVCA 4H6TA 5DK1A 1L4ZA 1HAPH 1SR5C 3A7TA 3P8NA 4NG9H 4Y0ZE 2TGDA 1ARCA 1C5WB 1A1RA 5GWZA 1MZAA 1NM6A 4BTIB 1BHXF 4UD9H 1FZZA 2AGGX 3VGCC 1S6HA 2ZC9H 2ZCKP 1OWJA 1C2DA 2VU8E 2RCEA 2ZA5A 1A46H 1MTNC 1SL3A 4Z1MD 3S7HB 4U2WA 4XSKU 2ZGJA 3URDA 3EAJA 1DUEA 1TPPA 2G52A 5T1VA 1SLWB 1S0RA 1T32A 2GCTC 1NO9H 1G36A 3ZVAA 1BOQA 4X8SH 1VITF 1O34A 3ESTA 3OYPA 5C1XA 3KQ5A 2SGAA 1TX8A 4UDWH 2FTMA 3V0XA 1Z1JA 4XRNA 4WH8A 1Y8TA 1EZSC 5JYIA 4P02A 1YPHC 4X6PA 6GCHG 3FZZA 2BLQA 3GYMA 1RTKA 4E7RG 1BTHH 2TRMA 4ISIH 1PFXC 2C90B 3V13A 1DY9A 1TQ7B 4AB8A 1OWHA 1EJAA 5ESBA 1AHTH 5HYOA 4UONA 3BTME 3KN2A 3RXEA 5EW1H 1TNLA 1RS0A 1AB9B 3GISB 1QL7A 4AFQA 1V3XA 3T26A 4AFUA 1XM1A 3BG4B 1ELCA 3PO1B 1UJ1A 3T25A 2FEQH 5DGJA 1GGDC 3RXIA 1C2JA 1C5TA 2O8LA 2Q1JA 1BTPA 4YLUA 2VWNA 1V2RT 4K5ZA 4BAQB 4R0IA 3PV4A 4LXBH 3SNEA 2P8OC 3ZVCA 3NKKA 1T8MA 5AFZH 4ISNA 2ZG0H 1BMNH 3NCLA 3PROA 1NFYA 2FYRA 4ASUD 1P01A 1JXPA 3DSPA 3PMBB 1J14A 5ETXA 1XUKA 4JMYA 5FX6A 2ZHWH 4XE4A 3GDUA 1TGSZ 4FUEA 2B5TB 4DURA 1HAIH 2FODA 3SGQE 4NCYA 3SU4A 4DIIH 2W7SA 1MD7A 4FUHA 5GDSH 8GCHG 3AK5A 1GBMA 2WYJA 1GCTB 1E36B 1ZMLA 2J2UA 7GCHF 2CMYA 2GJGA 2J5UA 3VB5A 3A8CA 3RXDA 3GS9A 1O2ZA 1H8IH 2J92A 5T6GA 5C1UA 2V3HH 3GY6A 1IAUA 1GBEA 3F2FA 1FAXA 1O2LA 4B75A 1SGNE 2A31A 4Q7YA 1EJMA 1O3AA 2AMPA 3CNRA 2Y81A 3HKJB 2OLGA 5F8ZA 2HGTH 3TK6A 2Q6GA 5C0UA 1ZOMA 2VIDA 3M37A 2VJ1A 1Z1IA 2AIQA 1S5SA 3TNTA 2G5NA 1K28D 3KQCA 4KELA 1K21H 3SYJA 3O8RA 1O3HA 1Y5UT 2FPZA 1ZR0A 2BD9A 2F91A 4GHQA 1A5IA 4ZHAA 3EQ0H 1O3PB 3LIWA 3OFND 2GP9B 1BQYA 5GNDA 1EPTA 3SJIA 1OWDA 2ZHFH 1CT2E 1EZXC 4HTCH 2HNTE 2IJOB 1O30A 1ZRKA 1O33A 3TPIZ 2ZFSA 3BSQA 3JZ1B 1RTFB 2P94A 2YMSD 4D7FA 1H8ED 2FOMB 3SN8A 4CRGA 4GUXA 1EASA 1HAVB 5CMXH 3ITIA 1SVPA 2B0FA 3D62A 4IMQA 4A6LA 3RLYH 1FMGA 1D4PB 2TGPZ 3OY5U 1C2MA 4BOHA 1S85A 1FONA 2BM2A 1MU6B 1GJ6A 1A0HB 3OTPA 1ELTA 4D7GA 1BDAA 1PPZA 3SV6A 2V7QD 3A7YA 4CRBA 1SOZA 1K1NA 5PTPA 1J8AA 2ZNKH 4KTSA 1FNIA 3SQEE 1L4DA 3ZVEA 4A1TA 4IC6A 2RDEA 5DP6A 1TOMH 3RXJA 1CSOE 1BTWA 2G00A 1NZQH 3Q00A 2FOEA 5E0HA 1YBWA 1T7CA 1F0SA 4WH6A 1FV9A 1AFQB 1SGRE 1C9TA 4ZXYH 6GCHF 2C8ZB 1BMMH 1OXGA 2Y80A 3RXFA 2PSYA 1W0KD 1G3BA 1H8HD 2QAAA 3SZNA 4CR5A 3GCHB 4CRCA 2OD3B 1V2LT 1XKAC 1HV7A 1KYNA 2VH0A 4AC9A 1V2WT 1BB0B 1T8LA 1VCWA 1ZTKA 1SQOA 1GG6C 3U1IB 2W6ID 4RSPA 4WF8A 3MU8A 4AG2A 2FP7B 1Z6EA 2CF9H 2WPKS 3ODDA 3U8OH 1KY9A 2TIOA 3A8BA 2JKHA 1ZHRA 2D8WA 3A8DA 3EYDA 3TJUA 1C1OA 2WPIS 1COWD 1P3EA 4XOJA 1NRNH 3PRDA 1V2JT 3M5OA 1ZTLA 1QCPA 1O2HA 3MQKC 1IHTH 2G81E 2J95A 1NFWA 1UTKA 2G8TA 5HIZA 1AE5A 3LGIA 4I8GA 1ZSJA 3IITA 3PB1E 1HPGA 1MABB 5C94A 1VJ9U 2KZ4A 3TGJE 1ZMNA 3F9GA 1SSXA 1SI5H 2PKAB 1HXEH 5LGOA 3VB3A 3PMHB 1SGCA 1CHOG 3LGVA 8GCHF 3RC6A 2GVFA 3SU0A 2RA3A 3BTDE 1DWEH 4ZUHA 1DX5M 3AW0A 3TH3H 1ARBA 1FN8A 4K1EA 4FUJA 3GY5A 3ATWA 5HXFA 2KX4A 3QWCH 1GJAB 3ZZ8A 1SHHB 4Y10E 4GPGA 1XXFA 2FYQA 5BPEA 3VXFH 2WV9A 2BB4A 2A32A 2BMGB 1ELVA 1DSUA 2XC5A 2Y5GA 2M5TA 4NGAH 1GJBB 3UR6A 1GDNA 1MTNB 1T8OA 4B1TA 2ZFPH 1GHBG 1SGIB 1DANH 4RT1A 3VXEH 4IMZA 1T4UH 3ELAH 1BBRK 2BVRH 3BIVH 4B71A 4JYVH 1GDUA 3PM3A 1NY22 4X2YA 4UFGH 2C3SA 4SGBE 3PTNA 4MNVA 3CS7A 1JIMA 4TWWA 3LJOA 1V2ST 3RLWH 3SUDA 1GI9B 3H7OA 2ZTZA 4CRDA 1AZZA 1IQKA 1TGBA 4KGAA 5DP7A 4J1YA 1GBIA 1GBTA 4Y7BA 6LPRA 1MUEB 1THPB 3MU5A 3S9AA 1C1SA 1QB6A 1SFIA 2HVXA 2A4QA 1AB9C 1NFXA 3EA7A 4O03A 5FX5A 3PMAB 2WPLS 3Q3XA 3QTOH 4MQAA 3PO1C 2PHBA 1JIRA 1V2KT 1O3LA 1VGCB 1XVOA 3DSOA 2CHAB 4Y0YE 1C5NH 3WY8A 3RMLH 2UUKB 2JJ1D 1BCUH 3A84A 4B74A 4JZEH 5JB9S 1XMNB 2HNTC 3AASA 2Z9JA 2W7UA 1UVSH 2XBXA 3BV9B 1S6FA 3BIUH 4BNRA 2FOBA 3KIDU 3SQHE 4ASHA 3UIRA 3PTBA 3E0PB 1OP8A 2QF3A 4OGYA 1BMLA 1F5RA 1GI2A 1TBQH 5EQSA 1BBRE 1WV7H 1Y3YA 1MCTA 2EI6A 4NIXA 2HVYB 3S7KB 2VWLA 2BQ6B 1W3CA 2Z3CA 3VEQB 3TGIE 1Y3UA 3ZVBA 2JIZD 4MPXA 1KDQA 4Q80A 3SNDA 1G3DA 2FWWA 2Z9GA 5KGOA 2ZHDA 2RFKC 3MHWU 4OS5A 4X6OA 3RXSA 3MU1A 1HAYB 1DXPA 4LZ4B 1GCTC 1UVOA 3N99A 1C2HA 1PQ7A 3SI4H 3TJNA 1X7AC 4AYYB 1Y3WA 2FS8A 2PUXB 4I33A 1QL9A 1FLEE 3HK3B 1G2LA 1ETSH 2FOHA 1D3DB 1YPGH 3E1XB 3BTEE 3H5CB 5CHAB 4LZ1H 3SNBA 3RDZA 3GY4A 4JCNA 4Y6DA 3UPEA 3PWBA 1K1IA 4FUIA 1EZQA 2XBYA 3Q3YA 2XNIA 1HGTH 2J94A 1THSH 2FZZA 2G51A 2ODPA 1KLJH 2ZWLH 3RU4E 1HAVA 1W10U 3RXPA 2OC7A 3K6YA 5EJ1A 1VJAU 2H5DA 6ESTA 1BRBE 2R0LA 2ZU5A 3AVZA 2QCYA 3ZIAD 1NU9A 1CHOF 1SB1H 5EQQA 4TY7A 2ZKSA 1LPKB 4YT7H 2A5AA 3OEHD 1TGTA 1Q2WA 1XUGA 4RN6A 2KCOA 5I25A 1WUNH 1SGYE 1QB1A 3P8GA 1UK4A 1TNJA 5GPIB 1VZQH 1CGHA 1HB0B 3P92A 1NC6A 1BMAA 1K1OA 2KAIA 1AN1E 1G30B 1PQ8A 1HJ9A 2STAE 1LHGH 1YPKH 1N1LA 2XW9A 5E2PA 2JETB 2BYAX 3UWJH 4MNXA 5EGMA 2V0BA 2AIPA 1O5AB 3KEEA 1EPTB 5EG4A 2R9PA 4UE7H 4CH2B 1WQVH 2XTTB 2ZP0H 1VCQA 1GHBF 4YESB 1YYY1 7LPRA 2QF5A 1GI7B 1UK2A 1CGJE 1EJNA 3GICB 3SJOA 2SGQE 2QF4A 3A8AA 2FLRH 1OS8A 2QXIA 3DSGA 4P00A 1E37B 1AFQC 1O3IA 3GDSA 4ZH8A 1YCPM 3SV7A 5HGGA 1V2NT 1LPGB 2NU1E 3OEED 4DOQA 3GCHC 1ANEA 5F8XA 3A89A 3M3VA 2KCYA 1KXBA 1TBZH 1H1BA 1JBUH 3SW2B 2QXHA 1ELFA 1ZTJA 2NU0E 1GHVH 3W95A 4I31A 4WVPE 3SV8A 1UVUH 1CT4E 2GZ8A 4AGKA 3FZDA 2WV4A 1P03A 3BEIB 1Z71A 4DCDA 2H9TH 5JPMH 4ACBA 1O3NA 3FO8D 2PKAA 1MKWH 1RRKA 4Y79A 1ACBE 3A7XA 1C5UA 5GCHG 2SNWA 5JB8S 5GIBA 4TPIZ 4AN7A 1S0QA 1YY3A 2QV1A 1GBDA 1K1LA 1QRXA 3FN8A 3JZ2B 4RKJB 5CE1A 3PWCA 4K8BA 2V35A 4UFFH 3SNCA 1V2VT 2HNTF 1BA8B 1UCYK 2EEKA 3C27B 2ANKH 4WY3A 2XBVA 1NFUA 3UR9A 2BXUH 3O8BA 2F9OA 2G55A 3LONA 2EA3A 1IQFA 4E06H 2OINA 2O8UA 2H9HA 4LK4A 1GVZA 5FPSA 3S9BA 3TVJB 2EC9H 5DJ7A 1ESAA 1CE5A 3TJVA 1C1NA 5C0TA 1W2KH 3I78A 2ZF0H 1IHSH 2F3CE 3ATKA 2FMJA 3BF6H 1QNJA 1C5SA 2OQUA 1HIAA 4UEHH 4Y8ZA 1UTLM 5E2OA 1ZPCA 5AHGH 3UWIA 1A61H 2W26A 3NZIA 1G9IE 2QIQA 4RKOB 1DDJA 2WPMS 1PPEE 4BAHB 4MG3A 1BJVA 1MKWK 1AIXH 4ZHLU 5HM9A 1HAOH 1MD8A 2DE9A 1O5CB 2P3FH 5A0CA 3L3TA 4NSYA 1ZGIA 3STIA 3T5FH 1DWDH 1GBJA 3KNXA 4TWYA 4X1QU 2J98A 2QXGA 1O31A 1A2CH 3F9FA 1O2KA 1C1WH 5KEDA 1UCYE 2QGRA 1L1GA 2QN5T 4KTCA 2W3KA 3O8DA 2PGBB 2JJ2D 1HXFH 1L0ZA 8KME2 1ESTA 2JH6D 1DM4B 2CJIA 1UHBB 1RIWB 3D65E 2RDLA 1SGQE 1C5VA 2XXLA 1LO6A 2Q6FA 4WMDA 4GSOA 2BD5A 1GI8B 3NK8A 2P3TB 1ORFA 2GT7A 1EB1H 1GHYH 1VGCC 3UOUA 2CHAC 2IN2A 3KYGA 1RXPA 2GV7A 3FOAA 1XUFA 1O3BA 2BX3A 2A1DB 3LGWA 3CS0A 2O9QA 2PR3A 1TYNA 1ZPBA 1P10A 2FS9A 2VIWA 1TQ0B 1O2VA 5E8EH 3DD2H 1E34B 3A7ZA 3S69A 1C5LH 4JK6A 1FI8A 4JYUH 1K2I1 1O3JA 5EQRA 2BLVA 3UY9A 3BTFE 3BEUA 5JBTA 1PPFE 4BTUB 1UTNA 1TX7A 3HGNA 2I6QA 1LVBA 2EI8A 3M35A 4HG6A 2THFB 3Q77A 3GCNA 1F0UA 2LPRA 2VNTA 3O8CA 1SKYE 1PPHE 4Y7AA 1WTGH 5H4IB 3ZYDA 1GJ5H 1T4VH 5HMAA 3KCGH 1YLCA 1O0DH 1QY6A 2UWOA 4PROA 1E35B 2F9PA 4DJZB 3EA9A 3MH6A 3A82A 2ZU4A 5L30H 2J34A 1SGDE 2JH5D 4INHA 1F2SE 2SNVA 1TRMA 1TABE 2XWAA 5CHAC 5GCHF 5TCAA 1ELEE 1P2OA 1WDIA 3M36A 1KXCA 2WPDD 3PV2A 5DPAA 4IS5A 1KDQB 2F9VA 1UMAH 1C1PA 2BQWB 1DY8A 2C8WB 4NWKA 1TNIA 1TMUH 2VIPA 1O2GH 4CRAA 3F1SB 1F5KU 1EAUA 1ZJKA 1DOJA 1OYQA 1BHXB 5T3HA 3SO3A 3RP2A 1LMWB 2ZFFH 1FXYA 3Q76A 2F83A 2YMSB 1BT7A 1HAGE 1GDQA 4AX9H 3KYFA 2BTCE 1HNEE 5E0JA 3LT3A 4A7IB 1QURH 4BXSA 3QGJA 1TRNA 3GY2A 1DWBH 1QB9A 3VB7A 5FBIA 4B6FA 3EA8A 1BTZA 4Q63A 5DP5A 2GGVB 5I46H 1E0FD 3E3TA 3SHCH 2V6NA 3ZZ3A 2G4UA 4H42U 1RJXB 2CK3D 5AFYH 2R2MB 4BXWA 3LGUA 3QN7A 4OM9A 5A8YA 2JETC 2UUFB 4RI0A 2AGEX 2F43B 1EPTC 3T27A 2A2QH 3W1EA 1V2UT 3UOPA 4FVDA 1P57B 4MLFB 2BY5X 2GV6A 4MPUA 2Z94A 5EIYA 1D3PB 1TA2A 1YC0A 2OP9A 2JDID 4UFEH 1O2TA 1PPGE 1PQAA 1D6RA 2KR7A 3ZVDA 3VB6A 1VR1H 3FANA 4OGXA 2KAIB 5L2YH 1B0EA 4E05H 2BDHA 3ZVFA 1ZGVA 1ZJDA 3HKIB 1INCA 1IQMA 4FUGA 2F9BH 1BJUA 3F9HA 1GVKB 4YO9A 1GJ4H 4ESTE 2P59A 2WPJS 1O2MA 4MNWA 4NZLA 1W8BH 2SGFE 1IQLA 1QQ4A 3NWUA 1TALA 4MVNA 2HLCA 4JZDH 4CRFA 1W7GH 2ESTE 1SLXB 3RXQA 3RXTA 3SGBE 4HI3A 1TNKA 3QDZB 2BDAA 1A5HA 2ALVA 3K2UA 3P95A 4ABBA 3KQBA 3M7TA 4JZFH 1OWIA 3KQDA 1W0YH 1ZZZA 1EUFA 2PV9B 1W11U 3SZEA 2VIQA 2P95A 5IYTA 2ZHQH 1HAZB 1V6DA 4SGAE 4X6NA 1AMHA 3B9FH 5FBEA 1H4WA 1GI4A 1LQEA 1LVOA 1UVTH 4AFZA 3TNSA 2ILNA 1PPCE 4WJG2 3MOCA 1P2NA 2O8TA 1GJ8B 5L6NH 2B8OH 4O97A 1TPAE 2FI5E 1ESBA 2A45B 5HKKD 1BTYA 3M3SA 4TYDA 1MH0A 3MFJA 1MCVA 2PFEA 2ZGCA 2PLXA 4YTAA 1SLUB 2AMQA 2AEIH 4H4FA 1WBGB 1TX6A 1C2LA 3URCA 2O8WA 1UTMA 3RXOA 4Z0KA 3D23A 1GBKA 3S9CA 3BEFB 1Q31A 1XUHA 4NA8A 4IC5A 2A7HA 4YM9A 3F0OA 1C4V2 1AE8H 4OS6A 1EAWA 5JBCS 3T2NA 2ZU1A 3ZZAA 2C8XB 5FCRA 1EQ9A 3ZVGA 3GY8A 1ABIH 3AAVA 4ZXXH 1MTSA 3BTGE 1TNHA 2BOHB 3LH1A 2SGPE 3ZZ6A 3P8FA 4TY6A 2QA9E 1MBQA 1L1JA 2GTBA 2XC0A 3ZZ5A 1AGJA 2B7DH 1O2RA 1K9OE 3BTQE 2RG3A 6CHAB 4ABIA 4M9FA 3LH3A 3SV2H
chains in the Genus database with same CATH topology
1MMJN 4ZMAH 5DP9A 1SPJA 1O5GH 1UHBA 4DIHH 1O2JA 2I6SA 3F9EA 4HFPB 2WINI 5EXMA 4FU9A 1C1TA 1EX3A 4Q7ZA 1FY5A 1S81A 1IOEA 1HIAB 4MNYA 1BTXA 4XBCA 5DKMA 2BXTH 2FI3E 3MTYA 3RU4T 4X1SU 2XYAA 2CXVA 1RIWC 1KTTB 1P11E 2VVUA 3M5LA 2Y82A 3ZYEA 4X8UH 1YCPH 4NIWA 1CA8B 4K2YA 3MU0A 2BY6X 2SFAA 3FP6E 2ZGXH 1UTOA 2XC4A 3GY3A 1UO6A 3RM2H 3MNXA 1GPZA 2Q6DA 5EPYA 3TH4H 1GBLA 5BRRE 2TPIZ 4CHAB 2ZGHA 3M61U 1Q3XA 2D26C 4YOGA 1KXAA 2Y5FA 1YPEH 3V3MA 2TGTA 2BVXH 4FUDA 1G3EA 3SBKA 4MDSA 2BZAA 3MWIU 1O36A 3UREA 5FPYA 3B8JA 3ZV8A 4AYVB 1H9LB 2BLOA 1HAHH 4ISHH 1YKTA 1XUJA 3RM0H 2ZDLA 1BRCE 1PYTD 1QGFA 1SOTA 3TIUA 2FM2A 1ZPZA 2BY8X 4CBOA 1SGTA 3QZRA 2AH4X 5ESTE 1QTFA 1O5EH 1FUJA 4LOYH 4BAKB 1TLDA 1P3CA 5C5OA 5DP4A 1XVMA 1W7XH 2NU4E 3E90B 2WV5A 1XKBC 3RU4D 3SUFA 3ENSB 3SJKA 1NROH 4KP0A 4X2VA 3R0FA 1WQSA 1DSTA 4NFFA 3A88A 4YOIA 2O8MA 1MZDA 3GCOA 3RXHA 5C2ZA 3SNAA 3A7VA 1LHEH 4OS1A 1HAXB 2GDEH 3TK5A 4GCHG 1GJDB 3PMJA 3P70B 3K65B 4HGCA 4ABAA 1CGIE 1O39A 2ZDKA 2ZGBH 5F6MA 5C67A 2A7JA 1CBWB 1DT2A 1DLKB 2A4RA 3SOSA 1B7XB 1H9IE 2YOLA 3LDXH 3M7QA 2VB0A 1AWFH 3SJ8A 4X0WU 2W3IA 2GD4B 1IQNA 2ZPSA 5LPFA 3RXRA 1QBVH 1GMCG 4B2AA 5TJXA 3U9AH 1E38B 1YP9A 1GJ7B 2A4OA 1OP0A 2VIOA 2A5KA 5SGAE 2BOKA 1AZ8A 1MU8B 3RXLA 5ABWA 1DUAA 2WUBA 1AKSA 9ESTA 3SGAE 4DT7B 3UQVA 3OU0A 1RD3B 1HUTH 1JRTA 5TCCA 1LKAA 1DLEA 3EGKH 4CH8B 3SUGA 3TK9A 1SGEE 4JZIA 5DP3A 4K69A 4I32A 2BDIA 3V7TA 2GCHG 1CVWH 2K1QA 1O3GA 3ZZ4A 3DUXH 1O2SA 3GDVA 1FPCH 1DPOA 1AU8A 3RUOA 2BD7A 1FY3A 1A3EH 4DY7B 1QL8A 1NESE 2SGDE 2C93B 4KTUA 4R8TB 2OQ5A 1UTQA 4Y11E 4A5TS 2WYGA 3UQOA 2VGCB 1GMHG 1MBMA 3D49H 3RXUA 1EAIA 1CHGA 4X1RU 2ZFRH 3QGNB 1O3MA 1LQDB 1V2PT 4ABJA 1FJSA 1SFQB 2CGAA 1QRZA 2GZ9A 1P2KA 2FESH 1H9HE 1HBTH 1NPMA 5K0HA 1IQHA 2DE8A 4BANB 1RFNA 4F49A 1YPJH 2AYWA 2V3OH 5A0BA 1O3CA 4X8VH 1OWEA 4IN2A 1TGCA 2HPQH 2Y7ZA 1A7SA 1HJAB 1U6QA 5EXNA 1G32B 4B76A 2UWPA 1EATA 2PW8H 2PKSB 3HGPA 8LPRA 1Y3XA 1SGFA 1KSNA 3SU3A 1D6WA 1OP2A 2ZPQA 4QT8C 1HCGA 3A86A 1AY6H 4K8YA 3LU9B 4Q7XA 4ZKNU 3ZZ9A 4KKDA 2FX6A 2BY7X 2ZCLP 2ZECA 2Z7FE 3M5MA 3IWMA 5J4SA 3ZZCA 2ULLA 4CR9A 1KXDA 3GYLB 2FI4E 3QK1A 1PQ5A 1NRQH 2FOAA 1C2FA 1P2QA 1FIWA 3RXMA 1ANCA 1MTUA 2GMTB 5C1YA 1LHFH 1CU1A 1KTSB 5EU8A 2QYIA 2STBE 2VINA 1GVLA 4HZHA 4ZKOU 2PUQH 2BDGA 3MI4A 2ZPRA 4IGDA 1ZSKA 2A7CA 1AI8H 1NRPH 3QX5H 6CHAC 4K1TA 3RXGA 8ESTE 1C2IA 4GCHF 1A4WH 1O2NA 3QUMP 4XDEA 3RXCA 1MAXA 1OSSA 2AGIX 3RC5A 3M3TA 2XCNA 1N8OB 1SQAA 1SG8B 3I77A 4ZHMU 1O3DA 1C1VH 3BTKE 4BAMB 2A4GA 3Q3KA 1F0TA 3NXPA 1N6YA 2ZDNA 1TPOA 3VFEA 1IQJA 1TPSA 2ZDVH 1C5RA 1G2MA 1J16A 4MTBA 1C5MD 5LH8A 2P93A 1HDTH 4X1PU 4ISOA 2AS9A 3UFAA 2OBQA 3OX7U 1GMCF 1O2YA 3LC5A 1F0RA 1C1MA 3MH5A 3E16B 1D3TB 1QA7A 2ZI2H 2FTLE 1P9UA 2OBOA 1RTLA 4B2BA 4FXGH 3FP7E 4I7YH 1EOLA 2TGAA 3NUMA 3BTWE 3DT0H 1J15A 5GJ4B 1LDTT 1YGCH 1IQIA 2XWBI 4INLA 3DFJA 2HOBA 1DE7H 4I8LA 4CHAC 1KXEA 3GCTG 3ZV9A 1PYTC 1Z7KA 1P0SH 5HM2A 3SU5A 4VGCB 1B0FA 2QF0A 2BLWA 4GLYA 3KHVA 2Z9KA 3SU2A 2BQ7B 2H1UA 2GCHF 1C5OH 2QY0B 3E91A 4Z6AH 5B6OA 3ATLA 3M5NA 1AO5A 1W0ZU 1UTPA 1O37A 2OCVB 1LTOA 1G3CA 3AAUA 3SHAH 1P04A 3SI3H 3QLPH 1WOFA 1MTWA 1EZUC 1UVPA 3TU7H 1EXFA 1GCDA 2H6MA 4I8HA 4DG4A 2BVSH 1GMHF 3K6ZA 3PYHA 3QO6A 1Z8JB 3A7WA 3G01A 4JYTA 4WWYA 1UK3A 2R3UA 1J9CH 1A0LA 2NWNA 2GT8A 2ZTXA 2ZTYA 3TJOA 1C9PA 1NRSH 4O3TA 1MKXH 1K1JA 1ZSLA 1ANDA 4U32A 3FFGA 1FY4A 1V2TT 1GL0E 5E0GA 2ZDMA 3TITA 1HLTH 1N6XA 3GOVB 1O2UA 2H9EH 1NN6A 1VITH 1JWTA 2OC1A 3LGTA 1WAYB 2XRCA 1JRSA 2ZO3H 4AB9A 2YNAA 1P8VC 2P16A 4U30A 3RXVA 2PTNA 5J4QA 1ETTH 3CP7A 2ZU3A 4NIVA 4CBNA 1TNGA 4K3JA 4F4OC 1OPHB 2AERH 1CBWC 1P02A 2GZ7A 2NU2E 1AQ7A 3E0NB 4THNH 4DVAU 4NFEA 1S83A 4X8TH 4AOQA 2NU3E 5EPNA 3AW1A 2BY9X 5AVDA 3UNSA 3KGPA 1L2EA 3DA9B 4NSVA 5A2MH 1ZHMA 4U01A 1YPLH 1ZLRA 1IQEA 1SMFE 4D8NA 1WTHD 5F8TA 4BTTB 1EB2A 1O5DH 1HFDA 2HWLB 4OS7A 3LKWA 5JBBS 1Y59T 1ZRBA 2YNBA 1MKXK 1YLDA 1GHAG 4INKA 4XBBA 1CO7E 1NS3A 1Y3VA 2VH6A 1FN6A 1FY1A 1ANBA 1Z8RA 3P6ZB 1BUIA 4YLQH 3ATIA 2ODQA 1TFXA 5G4BA 3T62A 2ANYA 1O2PA 2FO9A 1D9IA 2RA0A 2DUCA 3F68H 1WYKA 1BRUP 3LPRA 4ZKSU 3SU1A 1OKXA 2F9NA 3C1KA 3KF2A 5EW2H 4IN1A 4Y8XA 1C2GA 1C1QA 5F03A 4Y76A 3OTJE 1O2QA 2C4FH 1GL1A 1GBFA 1AKSB 1A3BH 1ZMJA 3PLPA 1W13U 1ELAA 5LPEA 2BX4A 1LPZB 2VGCC 4MPVA 4D76A 1GBAA 2ZFTA 1LKBA 4Q2KA 1O3KA 3ODFA 2AFQB 1DVAH 3OSYA 4ISLA 3E6PH 1W12U 2BZ6H 2QXJA 1O3EA 5IDKA 1TOCB 3GCTF 5AF9H 1CA0B 2WPHS 2C8YB 4XFQA 5GXPA 1GHXH 3MO9A 3L6PA 1XX9A 1GWAA 2HALA 1HJAC 1BRAA 4A92A 1DS2E 1DXWA 2PKSC 2ZQ1A 1TRYA 2FOCA 5L2ZH 2D1JA 1FY8E 1AVGH 3STJA 1TA6A 4YT6H 1A5GH 1W14U 4JK5A 2JH0D 5LPRA 4Y71A 2Y7XA 1YF4A 1ABJH 2H5CA 2ZHEH 2Z9IA 1LVYA 1F7ZA 1OWKA 1O32A 1TWXB 7ESTE 1SLVB 1M9UA 3W94A 3ZZ7A 1EKBB 4BAOB 1Z8GA 3MO6A 1HYLA 1P2MA 4ZAEA 2Z3DA 4IW4E 3MMGA 1GJ9B 5T6FA 1AUTC 3PLBA 2GMTC 2H2ZA 1TB6H 1P2JA 1BZXE 4DGJA 1OX1A 3FVFB 1BBRH 5FXLA 2FX4A 1ETRH 4IBLH 1OOKB 1O38A 2VVVA 1AVWA 2A2XH 1BTUA 1QBNA 4FUBA 2Z6BD 3U1JB 1LCYA 1O35A 1AWHB 2FDAA 3MO3A 1NT1A 1C2EA 5C20A 1K1MA 1N8OC 4OS4A 3MNCA 3HK6B 4ZKRU 5A09A 2BDYA 3MNSA 2OXSA 2ALPA 3EE0B 4AZ2B 1ELDE 1GBHA 2PWXA 1GI5A 2BDBA 1PPBH 3H7TA 3MNBA 3SUEA 1C1RA 1ZHPA 3LJJA 1FAKH 2BD8A 3VB4A 1P05A 2ANWA 3F6UH 1P06A 3VGCB 2TBSA 1K22H 3PLKA 1C1UH 1V2QT 2CF8H 3S0NA 1P2IA 2HPPH 4XBDA 3UNQA 1F5LA 1O2IA 3A81A 4NIYA 1C5ZB 1SBWA 4WXVA 2IOTA 4ZROA 1GHAF 2BD4A 1C5QA 1G37A 4FVBA 1L1NA 1Z6JH 1F92A 3RMMH 3U8RH 5A8ZA 1S84A 2GCTB 4VGCC 1XUIA 2OC0A 1AFEH 3MH4A 3BTHE 2FLBH 1ZYOA 2Y6TA 1YM0A 1GI1A 2VIVA 3B23B 3SU6A 4D9QA 1D3QB 1WCZA 2F9UA 5A8XA 3BN9A 4X1NU 2ZDAH 5FPTA 1NTPA 1ELGA 1FDPA 4ABFA 4WXIA 3U8TH 1DFPA 2ZZUH 1QJ6B 4OS2A 2ZCHP 1QRWA 5DG6A 1RGQA 4AFSA 1V2MT 3RXBA 3DFLA 5FHTA 2B9LA 1GBCA 2BD2A 3BG4C 1KLIH 4DW2U 2PTCE 3N7OA 4M7GA 2FXRA 3GY7A 3L33A 3TGKE 2Z9LA 5JBAS 2XBWA 1GGDB 3MU4A 1O2OA 2P3UB 1C4Y2 3KL6A 1KLTA 4FU7A 1LHDH 1TONA 2FIRH 3IG6B 1YCPK 2PSXA 1QJ7B 2P8OB 1C5XB 3RMNH 3HPTB 4X2XA 1O2WA 3LGYA 4WMEA 1P9SA 4FU8A 4NZQA 4UFDH 1XXDA 4K1SA 2OUAA 1AUJA 1S82A 3EDXB 3LC3A 4WMFA 2CV3A 3SV9A 1SHYA 2UWLA 1QBOA 1FPHH 9LPRA 1GMDG 1WU1A 5T6DA 2QC2A 4ABHA 2EI7A 7KMEH 4K60A 3RXKA 1QJ1B 2BDCA 1GI6A 1H8DH 1TMTH 2XCFA 4I8KA 4JZ1A 3V12A 1GBBA 2FOGA 1DITH 5DP8A 4Y8YA 3K9XB 3T28A 4E7NA 3MH7A 2WUCA 3SORA 1FIZA 4AGJA 1ELBA 1YPHE 3RXAA 1Z8IB 4NWLA 4TPYA 3SJ9A 1MTVA 1NU7B 1GI3A 1TE0A 1QIXB 2AMDA 3TLOA 1V2OT 1SC8U 1KIGH 3FP8E 1OYTH 1MQ6A 3OY6U 4O9VA 2W5EA 2BHGA 1T31A 1MQ5A 1P09A 2R3YA 2R2WU 1O5BB 1QR3E 2GKVE 1DICA 5FAHA 5C3NA 1VITG 2VWMA 2OC8A 1Y5AT 2ZU2A 1EOJA 1DWCH 1AD8H 1QQUA 1C5PA 3HATH 1TBRH 4YOJA 1EP6A 2ZEBA 1EAXA 1ID5H 3CENA 1QFKH 1B5GH 1O2XA 1TGNA 3T29A 1KXFA 1TMBH 2D2DA 1C2KA 4GHTA 2HRVA 1FQ3A 3LOXA 2G4TA 3QTVH 5EODA 1JOUB 1LVMA 2J9NA 2A5IA 3E8LA 3ZZDA 3RMOH 1YPMH 3RC4A 2J38A 2FOFA 4D9RA 3ZZBA 3I29A 4AORA 1BITA 1THRH 5C5NA 1T8NA 4O3UA 2OTVA 1UCYH 4GAWA 3U69H 2SGEE 1P12E 1GI0A 2CN0H 1MAYA 1SQTA 3P8OA 1CA0C 1EP5A 2UUJB 3R3GB 1HJ8A 3VPKA 3UUZA 4AG1A 3TH2H 4CREA 1GJCB 4FUFA 2IPHA 1A0JA 3NPSA 1CQQA 2BD3A 4A1XA 1GHWH 3MYWA 5FCKA 3KQEA 2UUYA 2LNCA 5EOKA 1JMOH 5JDUB 3M7UA 1HRTH 1NRRH 4A1VA 2ZFQH 4X2WA 3BG8A 1O5FH 1TIOA 1C5YB 4B73A 3A80A 2PGQB 3QZQA 2G5VA 5DO4H 1LHCH 2ANMH 2ZIQH 1GG6B 3UTUH 1PJPA 3BTTE 1CT0E 4B2CA 2Y5HA 3FAOA 7GCHG 3UNRA 5A0AE 1K1PA 1IQGA 5K7RA 3P17H 1O3FA 1AVXA 2J4IA 2ODYB 3ATMA 4NA7A 2GDDA 4X6MA 4FUCA 1QA0A 1J17T 1C4U2 1O3OA 4I8JA 1WSSH 2ASUB 4ABGA 4H6SB 1GHZA 1Y5BT 2Z3EA 4MPWA 2R0KA 1TAWA 4ABEA 1UTJA 3A87A 2A0QB 2GX4A 4NA9H 2ZQ2A 3A83A 3U98H 1SGPE 1QHRB 4J2YB 1BIOA 3A85A 4YZUA 2VWOA 5EXLA 4GVUA 3DHKH 1VCPA 1GMDF 4ABDA 1SGFG 2VVCA 4H6TA 5DK1A 1L4ZA 1HAPH 1SR5C 3A7TA 3P8NA 4NG9H 4Y0ZE 2TGDA 1ARCA 1C5WB 1A1RA 5GWZA 1MZAA 1NM6A 4BTIB 1BHXF 4UD9H 1FZZA 2AGGX 3VGCC 1S6HA 2ZC9H 2ZCKP 1OWJA 1C2DA 2VU8E 2RCEA 2ZA5A 1A46H 1MTNC 1SL3A 3S7HB 4U2WA 4XSKU 2ZGJA 3URDA 3EAJA 1DUEA 1TPPA 2G52A 1SLWB 1S0RA 1T32A 2GCTC 1NO9H 1G36A 3ZVAA 1BOQA 4X8SH 1VITF 1O34A 3ESTA 3OYPA 5C1XA 2SGAA