4OS4A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk603 (bicyclic 1)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os4A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os4A01
2W7UA 1A61H 2XBXA 2ZECA 3SORA 1HAIH 2FLBH 3SHCH 4WMDA 2AMQA 1LKAA 1LVMA 1UVUH 4FUCA 4NWLA 2A4OA 3UFAA 1M9UA 1AQ7A 4Y11E 2W3KA 1HV7A 3P8FA 3PMJA 5FPYA 1KSNA 3SW2B 4OS5A 1HAOH 5GXPA 1T31A 1IQLA 2ZFTA 4ASHA 2VINA 5CHAB 1NN6A 3ZZ4A 1PQ5A 3ZZAA 4GUXA 1LVOA 3SOSA 4CRFA 2GGVB 1LHDH 2WPIS 1V3XA 1E36B 1EXFA 2QGRA 3A8DA 3MO3A 2IOTA 3LONA 2ILNA 2O8UA 4JYUH 5HMAA 3LJOA 2CV3A 1O2YA 2I6SA 2QXIA 2F83A 4A1VA 2C3SA 3P92A 1T8NA 4ZHMU 5DP4A 1MU8B 3RXSA 1TRYA 3GICB 2ZFRH 3QGJA 1PQ8A 1KLIH 3UREA 1L1GA 1QCPA 2IN2A 1GI7B 1SGIB 2ZU3A 2OXSA 2DE8A 2GZ9A 1O31A 1ETSH 2HNTE 3BTTE 5A8YA 2AYWA 3MH5A 4HGCA 3R3GB 1TNJA 1XUGA 2UWOA 1GI8B 1RFNA 2ZF0H 1OSSA 1EB2A 1G9IE 4K3JA 4JZ1A 4FU8A 1GJ9B 1CO7E 3VGCB 1QA7A 5EPNA 3SI4H 1V2VT 4A6LA 2QF0A 1XX9A 2ZTYA 3BTWE 1C1OA 2XBWA 5DP9A 1UTJA 2GX4A 3ZV8A 3T26A 1DY9A 3RXVA 2D26C 2FWWA 1PPZA 2ZFFH 3SUEA 1SQTA 1P12E 1EAIA 4NFFA 2V3OH 1FMGA 1GCDA 1T8MA 2EEKA 3TH4H 4ISOA 2GZ8A 2V6NA 3MU0A 1JIRA 4X1SU 1ZGIA 1RRKA 4Y79A 5FBIA 3VB6A 1J9CH 2Y7XA 1IQFA 2ODYB 4FXGH 3RC5A 1BTZA 1C2KA 3ATKA 4NZQA 1DICA 1C5OH 2GCHG 2F9PA 3ZYDA 3OSYA 3SJ8A 1MMJN 2ANWA 3UR9A 2FI3E 2PKAA 5AFZH 1VITH 3FZDA 3PMAB 1LVBA 1XUIA 3AVZA 1O2IA 4I8GA 1HDTH 1BZXE 1O2JA 3KQCA 3SJ9A 1BQYA 1THSH 2KAIA 5DK1A 3QO6A 4UE7H 4FUBA 3TGIE 5AF9H 3PWCA 1F5RA 1GMDF 5EODA 4GVUA 1GL1A 1WAYB 1QNJA 3BF6H 2BX4A 1GBIA 1OP8A 1GI0A 1XXFA 3DFLA 3RP2A 3VGCC 2F9NA 1CHOG 1ZOMA 3KQBA 5J4SA 2XRCA 3VFEA 4KKDA 1A4WH 1P06A 1ABIH 3P70B 3AW1A 1GHXH 1RXPA 3TPIZ 4UONA 2P3TB 3B9FH 2OC7A 1W0ZU 1HXFH 3EQ0H 4O97A 1G30B 4WF8A 1W0YH 4F4OC 2NU0E 3VB4A 9ESTA 5T3HA 2ZG0H 3TU7H 4NG9H 3M36A 1B7XB 3T29A 3FVFB 4K69A 1WUNH 2WYGA 4K2YA 1HGTH 2GV6A 1QGFA 3SV6A 1GVKB 2Z7FE 3A8AA 4CRGA 3LPRA 5C2ZA 4IW4E 4O9VA 8ESTE 1CGJE 2BDIA 2HNTF 2ZIQH 3MMGA 1L0ZA 1C5ZB 1VITG 1RTFB 2R3UA 4UFGH 1ANCA 3PTNA 3V7TA 3H7OA 5E8EH 2P94A 2SNWA 1TNIA 3NWUA 1BJVA 4B75A 5FPTA 1SG8B 4MNWA 3RDZA 1YPJH 5EPYA 1CA0C 4YOIA 1LKBA 3ZZ8A 5EW1H 2Z3CA 1C1UH 1TAWA 1MTNB 2A7CA 4CRAA 1BOQA 4TYDA 1GCTB 1A5GH 1O2WA 1XVMA 2CMYA 3BTHE 3GCTF 3KHVA 1N6YA 3SU5A 4RKJB 2P93A 2GP9B 2OC1A 2QYIA 3BG8A 1FY5A 4BAQB 1AN1E 1FI8A 1JOUB 9LPRA 1G2MA 3F9GA 4NA7A 1DOJA 1NROH 5C20A 4Q7ZA 1KXBA 2GT8A 4FUIA 4BAOB 2BD2A 1GGDB 3ZVFA 1ZMNA 3LGIA 3SNAA 4INLA 1C1WH 1GI2A 2VIWA 2FTMA 3P17H 2Y5FA 3MU4A 2GD4B 4INKA 2F9UA 1O33A 1QB1A 7GCHG 2ZDKA 1O2SA 3FP8E 3Q00A 2AMDA 1SMFE 1F92A 2AS9A 3UWIA 1HXEH 3ATIA 5J4QA 1EOLA 1O5GH 3BSQA 4J2YB 1YCPM 1MD8A 1OWKA 4ZH8A 1WTGH 3DA9B 1W7XH 1BHXF 1O34A 2XCNA 5DP5A 4TPYA 3TGJE 1NS3A 2BX3A 2PHBA 1GCTC 1TPAE 1J17T 1S5SA 1V2KT 3FANA 1VGCB 3E3TA 5GWZA 5DP7A 3QX5H 3GDVA 1SGNE 2NU2E 4AYVB 1OS8A 4YO9A 4IS5A 1H9HE 1GGDC 2IPHA 5EGMA 2P95A 4KTUA 1Y3UA 2OBOA 2OBQA 2TGTA 4D7GA 1W11U 1DSUA 1RD3B 2ZGBH 1QA0A 5ABWA 1QRZA 1EJNA 2ZHWH 2ZTXA 2GDEH 1GMHG 1T4VH 1SGFG 3U8RH 1TOCB 1MKXK 3UUZA 2PUQH 3F1SB 1DLEA 2FOMB 4YOGA 1F0TA 4AB9A 2VH0A 1C5SA 2FOEA 2FIRH 1HAYB 3SJKA 1BBRK 3DUXH 4BNRA 3UTUH 5E0GA 3PLKA 2ZFSA 1KDQA 4QT8C 1FUJA 1CHGA 1E37B 1UK3A 1GBEA 1C4Y2 1OX1A 3F9EA 3VB7A 4CH8B 4ABJA 3UWJH 4X8VH 1GVZA 5L30H 3A89A 1OWIA 2BQ7B 1P10A 1VGCC 2H6MA 3F68H 3MTYA 1GJBB 3BTFE 2SFAA 3PLBA 1EB1H 2FX4A 1RS0A 1GBDA 4TPIZ 1WQVH 3CS0A 1TRMA 3ZZ3A 4WY3A 1KXFA 1GBLA 1QBVH 4CR5A 1V6DA 4IGDA 3SV2H 4I33A 4GPGA 1PFXC 4E7NA 1AGJA 1GHBF 1XMNB 5C1UA 4SGBE 2BY9X 3RLYH 4MVNA 3UOUA 3ZZDA 1IQMA 4AFSA 2R2WU 2FESH 3RXAA 1UVSH 4GLYA 4DOQA 1J15A 1TQ0B 1V2NT 2O9QA 4MNXA 3LGUA 1LHFH 4Z6AH 2SGDE 1P9SA 2ZDAH 4AX9H 2OQUA 1QJ7B 1DWCH 1P8VC 3MO6A 1GDQA 1SLUB 1AUJA 1SGCA 1P03A 1HJ8A 2FOBA 4BTIB 3NXPA 3LU9B 2ZHEH 2Q6DA 1GHYH 2VJ1A 2LNCA 2G52A 1O3PB 1K1OA 2P16A 2IJOB 4CH2B 1ESTA 5I46H 3OU0A 3Q3KA 3A7VA 4FUGA 5TCCA 1K1JA 2GMTC 2PW8H 1C1SA 2Y5HA 2C8XB 2Q6FA 1UMAH 1V2OT 1EZQA 3SNBA 4MNVA 1NZQH 1K22H 4NCYA 3KNXA 4B2CA 1L4DA 1TMUH 5JBBS 5E2OA 4JMYA 4AG2A 5K0HA 1O3IA 1NFUA 3SU2A 1LQEA 2FYRA 2H2ZA 2A2QH 1GJDB 4KP0A 2G4UA 1HBTH 4NWKA 5EG4A 1HUTH 1L1NA 1L1JA 3SGBE 3ZZ6A 3DT0H 1ZMJA 3SUGA 1O32A 3E16B 3NZIA 6CHAB 1HFDA 3MI4A 2V0BA 1W8BH 5GDSH 3T5FH 5JBCS 2AEIH 4ABBA 3RXKA 1A0HB 1CVWH 2ZKSA 1FAKH 1ZPBA 2EC9H 4MPWA 2YNAA 2WPKS 1RGQA 1BTYA 1TABE 1TQ7B 1WOFA 1SFIA 4UD9H 1BRUP 2QXGA 3U1IB 3BTQE 1E38B 1QURH 1DT2A 2PSXA 3EAJA 1YLDA 3E91A 4ZXXH 2Y7ZA 3O8BA 4K1TA 1C5YB 1O2KA 3G01A 3QN7A 3OYPA 3M3SA 1F0UA 1TX7A 3TK9A 4NGAH 1UCYH 4F49A 3ZV9A 1TGCA 1O3FA 3BV9B 4D7FA 8LPRA 2AFQB 2HVXA 3T2NA 4Q80A 1C5PA 2Z9IA 1CA8B 2ZCHP 6CHAC 4CHAB 3ZYEA 4YM9A 4GHQA 1GJ5H 3M7QA 1NFWA 1PQAA 2BLOA 1NTPA 1WU1A 3RXPA 1K2I1 4I8LA 2WUBA 3L6PA 4AGKA 2RCEA 3KQDA 3VEQB 3V12A 1SL3A 2WPMS 2PGQB 1GJ8B 4JZDH 1MQ5A 2ZGJA 4J1YA 4OS6A 1C1QA 1E35B 2A45B 1QJ6B 3O8CA 1C5LH 1C5WB 3QTOH 4WVPE 1O2MA 2BXUH 2CF8H 1TGTA 5C5OA 3ZVEA 1DPOA 1FQ3A 3UR6A 1YPEH 2OCVB 3MU5A 1VCPA 2QF3A 2QXHA 1SGFA 5FAHA 1IHSH 1F2SE 2ZI2H 2HNTC 2A5IA 1C5XB 1TPOA 2TIOA 4K8YA 1ABJH 3A7XA 1HAZB 3TK6A 3U69H 1GMCF 1SGEE 2A32A 2JETB 1P57B 1O2TA 3VXFH 2G55A 1GBBA 1UCYE 1O3MA 3DHKH 4XSKU 1HB0B 3MH6A 1MAXA 2Y82A 3BEFB 1D3TB 4MNYA 3RUOA 4CHAC 1GDUA 4NIYA 5T6DA 2VWNA 4IBLH 2W26A 1GJAB 2A7HA 2BD9A 2SGEE 1O2UA 3AASA 4WWYA 3BN9A 1LHCH 4Y7BA 3RXMA 2AGEX 2JH0D 4BTUB 2VH6A 2AIQA 2WPLS 1Y59T 2ZTZA 1UHBA 1IQGA 2XW9A 1LVYA 4X6NA 3MNSA 2R3YA 3MNXA 4DT7B 1GMDG 3KEEA 3TLOA 1SGPE 4K8BA 1ANDA 4X1QU 1YCPK 2A2XH 1O3AA 2ZNKH 1TNLA 4XBCA 3RXEA 3A84A 1P2QA 4A1TA 1W14U 1FIWA 3IWMA 3FP7E 4ABHA 3D62A 1O0DH 4RKOB 2QAAA 1SLXB 5A8ZA 4NSYA 1FLEE 1Z8GA 2JETC 1MKWH 4BXWA 1GL0E 1GI5A 3RXTA 4JYTA 3TH2H 3S9BA 4CRCA 2RG3A 2FYQA 3ZVAA 3A7WA 3PTBA 4ABDA 2J95A 1Q3XA 1TMTH 1AI8H 1THPB 1O2ZA 2OC8A 3H7TA 5JBAS 2G00A 1DE7H 4ABIA 1L2EA 4XBDA 4FUJA 2J4IA 1GHAF 3TJOA 1BMNH 1O3KA 1K28D 1YPLH 4JZIA 4UEHH 1O3CA 3FZZA 1AFQB 2WPHS 1C4U2 2NU3E 3HGNA 1O2QA 3STJA 1C2HA 2BOHB 4R8TB 1OWDA 4Y76A 1LPKB 4FU7A 2EI8A 5SGAE 1GJ6A 2VIVA 4X1RU 1BMAA 3BTGE 1FN8A 1YLCA 3LGWA 1QR3E 3U98H 4H6TA 3GOVB 5DKMA 1GI3A 3A7TA 4LOYH 1TBZH 3RMMH 1ZJKA 3GCTG 1BB0B 4UDWH 3UY9A 1BRCE 1AKSB 4MQAA 2QCYA 2SGAA 4D9RA 1EKBB 2C4FH 3LIWA 2HPQH 5A0AE 2F9BH 5JB9S 3TNTA 1UVPA 1S83A 5F6MA 1MAYA 3SJOA 3P8GA 1P3CA 3S9CA 5GIBA 1BTPA 3SGQE 4BOHA 4LZ4B 1G32B 1C2EA 1GHWH 3ODDA 1PPFE 4WXVA 2GT7A 4KTSA 2FI4E 1EAWA 3ENSB 3LGYA 3UNRA 1KIGH 4B2BA 1QBNA 4YESB 1AFQC 1C1TA 1IQHA 4Q7XA 1AIXH 1CA0B 5JB8S 1DX5M 5C67A 1KXCA 1LHEH 1A46H 2ZQ1A 3SHAH 2FMJA 3MH7A 1B5GH 1BJUA 1V2UT 5A0BA 3RXOA 5C3NA 2VWMA 4ZUHA 2Q1JA 2TPIZ 1D9IA 5T6FA 1EP6A 2A5KA 1QL9A 2SGQE 2QC2A 1UVOA 3B8JA 3KGPA 1HAGE 4HZHA 4HTCH 5A0CA 2WINI 4YLUA 1YPKH 1IQIA 3K2UA 3BIVH 3MNBA 1J14A 1G3DA 5EXNA 1C5QA 3U9AH 4K1EA 3ZZ9A 5TJXA 5DG6A 1C5NH 4Y10E 3RXHA 4OGXA 1ELFA 1Z71A 2C8YB 3GYLB 1AUTC 2XCFA 1DANH 4Q7YA 4HFPB 4DCDA 1DVAH 1O30A 2LPRA 4IC5A 1C1PA 3HATH 2ZZUH 1P2IA 1EASA 2ZCLP 1SGYE 2XTTB 1GBCA 3A87A 5DP6A 3TIUA 1UHBB 3E0NB 1EAXA 3GY5A 1Y3VA 4AORA 1QTFA 4JZFH 4Y8XA 4Y8ZA 3T25A 5TCAA 3RC6A 3AAVA 1YYY1 1HLTH 3UQOA 1W3CA 1O2RA 1UTQA 2FX6A 5DO4H 3OY5U 1NFYA 5EU8A 3TJNA 2OLGA 3SI3H 3URCA 4LK4A 1FY8E 4U32A 4M7GA 3UNQA 2ZU2A 3A85A 1BDAA 3TK5A 5JPMH 1YM0A 1PPHE 4O3UA 1C2MA 1SLWB 4VGCB 5F03A 2M5TA 2ESTE 3PMBB 1C2IA 2Z6BD 2EI6A 2ZPRA 1P0SH 3GCOA 5JDUB 4MDSA 4H6SB 2FEQH 2VWOA 1EJMA 1MBMA 3UQVA 1FN6A 3PYHA 3BEUA 1ZGVA 1GHBG 2BB4A 5FCKA 2G51A 1O3GA 2TGPZ 2P59A 1Q2WA 3RMNH 1SGRE 2D8WA 2ZU4A 1Y5AT 2G81E 1VR1H 1TBQH 3FP6E 4GSOA 1JMOH 5EW2H 1CQQA 1O3NA 1EX3A 1F5LA 1IQEA 2VIDA 5L2ZH 3LC3A 1HAHH 1V2RT 4X1PU 1CBWB 1LPZB 1UO6A 4RSPA 2W5EA 1FAXA 1S6HA 1DXPA 5LPRA 4MPUA 5FCRA 4NA9H 1Y3XA 4ZKRU 3RXBA 1CGHA 4B2AA 1WBGB 1TWXB 4OS4A 4WJG2 2RDLA 3LDXH 2Z94A 3NKKA 4VGCC 1XXDA 3F9FA 5H4IB 4XBBA 1DM4B 1T32A 1TPSA 1TOMH 4DGJA 1PPBH 1MUEB 2Z3DA 3V0XA 2UUFB 3MNCA 1J8AA 2H9EH 2VB0A 3HPTB 4NSVA 2BVSH 4ISNA 3SU0A 4IMZA 3RMOH 2Z9LA 4IC6A 5IDKA 2H5CA 2AMPA 3RC4A 1G36A 4GCHF 4LZ1H 2TGDA 2VIOA 3A82A 1HIAB 2BVXH 3EA8A 1F0SA 2FS9A 2P3FH 5BPEA 1Y3WA 1FY1A 1WV7H 1BTWA 4X6PA 3R0FA 3LKWA 2QY0B 2WUCA 2ANMH 3SGAE 1CGIE 1CBWC 4JK5A 2VIQA 1ELEE 4X2VA 2XBYA 1GBKA 7ESTE 4AFQA 3B23B 1P05A 3ODFA 2GMTB 3A8CA 5CMXH 4X2WA 3HGPA 3MFJA 3SZNA 1D4PB 4NIXA 2XC4A 3Q76A 1HAVA 2K1QA 3EGKH 3RXDA 5G4BA 3ZVCA 2XWBI 3A86A 3M7UA 1P02A 4Q2KA 3W95A 2BD8A 3BTME 2SGFE 1O2GH 1Z6JH 2VGCB 4X1NU 1WTHD 2F9VA 2P8OB 1AD8H 1MZDA 1RTKA 3RM2H 4INHA 1UTPA 1A0LA 3ZVDA 2THFB 2B7DH 2BM2A 3A7YA 1SPJA 1OWEA 3MOCA 4U30A 3QDZB 2PGBB 1LO6A 2FO9A 2UUKB 4Y71A 4BXSA 4ABFA 2R0LA 2YNBA 2NWNA 1YPGH 1DDJA 1GJ4H 1Z6EA 1O39A 3S7KB 1EP5A 4PROA 1N8OC 1NRQH 3C1KA 3V13A 2HPPH 1ZPZA 1EATA 3I29A 1AE8H 1O3DA 1C2GA 4X0WU 4CRDA 4DW2U 3KF2A 1MH0A 1EZXC 1F7ZA 3S7HB 1GG6B 1FDPA 5E2PA 1IQJA 3P8OA 2BY5X 1LMWB 3GY6A 4LXBH 2ZDVH 1PJPA 1GBAA 5L6NH 1LDTT 1SGTA 1VJ9U 1O5CB 1TA2A 4Y0ZE 1FONA 4YTAA 2BDBA 2VGCC 5GCHF 1P2OA 3ZZ7A 2P8OC 1GMCG 3I77A 1LQDB 2A5AA 4WH6A 1ZJDA 1OWJA 1GVLA 2XYAA 2G5NA 4MPVA 4ZHLU 1X7AC 2D2DA 1TX8A 1ELCA 2ZPSA 1IAUA 4Y0YE 2O8LA 2GKVE 2J94A 5FHTA 2TBSA 2STBE 3ITIA 5HGGA 2OTVA 3AW0A 1ZR0A 1G3BA 5C1XA 1C1RA 2DE9A 2BD5A 1DS2E 1DWBH 1RTLA 2CHAB 1O5BB 3LGTA 4BAKB 3PO1C 1BTXA 1QQUA 4TWWA 1W13U 1S0RA 1TE0A 1OKXA 3NK8A 1INCA 3NUMA 1UVTH 2WV5A 1C4V2 3GCHB 1P11E 3GY7A 2FOFA 3A81A 1GG6C 2Y6TA 4AG1A 2FXRA 1WCZA 2BD7A 2AGIX 3WY8A 1LHGH 1DUAA 3RXFA 1ESAA 1PPGE 1C2DA 2A31A 1AKSA 1QY6A 2ANKH 3CS7A 4WH8A 1Z7KA 7LPRA 2Z3EA 4K60A 2J9NA 1MU6B 2BDCA 1O5DH 1VJAU 1O3HA 1UK2A 4FU9A 1BRBE 2ZC9H 1GBTA 1GPZA 2HRVA 3PROA 4ZXYH 2B8OH 1KYNA 3CENA 1ZSJA 1AY6H 1ZHPA 1GHAG 3VB5A 2FOAA 3TITA 2F9OA 3ATMA 1YP9A 3T27A 3L3TA 2FZZA 2CHAC 1EQ9A 1ZSLA 2ZHFH 4ABAA 1HAVB 1ZZZA 1NU7B 2FPZA 3GCHC 3BTEE 1SHHB 1ELDE 2VVCA 1KTTB 4ZAEA 1XUKA 1GDNA 1ANEA 3KL6A 3LH1A 4GHTA 1IOEA 4XOJA 1FPHH 4ABEA 2TRMA 1BRAA 1UCYK 3Q3XA 1P2KA 3RXJA 4X8SH 3BIUH 5L2YH 2BHGA 4U2WA 2CXVA 4KELA 4E7RG 1V2PT 2SNVA 1ARCA 1FNIA 1TGNA 2BVRH 5EOKA 2R0KA 3MU1A 2Y5GA 2ALPA 1QRWA 3AAUA 3ZVGA 2OUAA 4BAMB 4BANB 1Z8RA 1GJCB 1TNGA 4YT6H 1V2JT 4ZMAH 3LT3A 1C1VH 1AVGH 1TGBA 1FV9A 1QHRB 1OXGA 4CREA 2XC5A 1RJXB 4B1TA 4ZKNU 3MO9A 1DWDH 1OP0A 3NCLA 3EA7A 3L33A 1ETTH 2ZQ2A 2PTCE 2W7SA 1G3CA 1PPEE 3EYDA 1H8DH 3VPKA 3UIRA 4MLFB 3URDA 2C8WB 1OP2A 1TX6A 2Z9GA 1JRSA 1MQ6A 1QFKH 2BDGA 1P04A 4ZHAA 1S85A 2ZP0H 3A83A 4BTTB 5AFYH 1J16A 1N1LA 2BZ6H 2DUCA 2QIQA 4AN7A 4I31A 3RMLH 2FI5E 4ABGA 6GCHF 3T28A 4HI3A 2I6QA 3MH4A 1MZAA 1HPGA 1F0RA 4X2YA 1O2OA 4IN2A 1YC0A 3GY8A 1XKAC 2ODQA 3M3TA 2QV1A 3ZZBA 2BXTH 5EQQA 5C1YA 2R9PA 2ZHDA 1KXAA 1C5VA 2FOCA 2XC0A 4B76A 1QB9A 2O8WA 1TA6A 4OS2A 1HAXB 4NIWA 1C2JA 3UPEA 4DIIH 5GJ4B 2OD3B 5HM9A 4H42U 3RXCA 1SI5H 2VNTA 4JZEH 1AWHB 5CE1A 4B73A 3KIDU 4A92A 4WXIA 4A1XA 1YPMH 2WV4A 4DIHH 2ZPQA 5PTPA 3IG6B 1XUJA 2ZHQH 2PTNA 1TALA 1QJ1B 1T7CA 1AZ8A 5LPFA 2JH6D 2OP9A 1GI4A 2PV9B 1SQAA 1TRNA 5GPIB 1BUIA 3TJUA 1BCUH 1SSXA 4CBOA 1A0JA 3TJVA 2VVUA 3M5MA 5ESBA 8GCHG 1MKWK 4ISIH 4XE4A 3GDUA 1TIOA 1WYKA 1UTKA 3OX7U 1E34B 1THRH 2B5TB 2YOLA 3LC5A 3RU4D 3E1XB 2UUYA 1C2FA 2G4TA 2FM2A 1P2JA 4THNH 1KLTA 2FOHA 3D65E 4CR9A 2CGAA 5CHAC 1JIMA 3E0PB 3RXGA 4I32A 1D6RA 1DY8A 1P2NA 3RXLA 2WYJA 2V3HH 3Q3YA 1MBQA 1E0FD 2ZA5A 1D3DB 1H9IE 4R0IA 1TNHA 3QLPH 3MWIU 1NC6A 1AVXA 3V3MA 1HIAA 1DXWA 2GVFA 2XBVA 1BITA 2O8TA 4YZUA 4I8JA 8KME2 1AU8A 3SV8A 1KXDA 1EPTB 1QRXA 4AFUA 1FPCH 3M5LA 4O3TA 1ZHMA 1P09A 1A5HA 3HK6B 3KN2A 3P6ZB 1WQSA 4YOJA 2ZO3H 1O3LA 1NM6A 1ORFA 1YF4A 4NZLA 1ARBA 1FJSA 3CP7A 1F5KU 1V2MT 1W12U 4UFEH 3ATLA 1S84A 4TY7A 4AFZA 1V2ST 1TB6H 2BY6X 1A2CH 3RXUA 1HJ9A 1N6XA 2ZCKP 2P3UB 4UFFH 1ELBA 1GBFA 3EE0B 2ULLA 1OYTH 2FODA 1OPHB 2PSYA 1H4WA 1MTVA 1O2LA 3U1JB 1AMHA 2H9HA 2G5VA 4AGJA 4D76A 2STAE 4MG3A 4FVDA 1YKTA 1XUHA 2C90B 3K65B 3QK1A 5AVDA 1Y5UT 2BTCE 4GCHG 2F91A 1OWHA 2HALA 3SNEA 2QXJA 3NPSA 5EQSA 1ZTJA 1HYLA 2AERH 3W94A 3M61U 1D3QB 2ZU1A 4B74A 5LGOA 3SU6A 4KGAA 3E90B 3SUFA 3GY2A 4K1SA 4A7IB 4ZKOU 1EPTC 5LPEA 1V2WT 1ID5H 5F8TA 6ESTA 1O2VA 3GY4A 8GCHF 2BQ6B 5DPAA 1Y3YA 3EDXB 1O37A 1FXYA 2J34A 1K1LA 3QTVH 2V35A 2ANYA 1VZQH 3P95A 3U8OH 4WMFA 5A09A 4CBNA 2SGPE 2OINA 1KLJH 2BDHA 1O3BA 1EAUA 5IYTA 3P8NA 1SB1H 1C5RA 1QB6A 1W10U 1W2KH 3SN8A 1B0FA 3MHWU 2F3CE 3GISB 4JK6A 3LH3A 3PV4A 1ELAA 3PM3A 1EZUC 1K1MA 3F6UH 3KQEA 4SGAE 3SU3A 4E06H 3K9XB 2GCHF 3M3VA 3K6YA 3OTJE 4UFDH 5ESTE 1SBWA 1JBUH 3M37A 2BZAA 4X6OA 1XM1A 3D49H 2BD4A 1PYTD 1AZZA 1ZSKA 3ATWA 3STIA 3SU4A 1ANBA 3SQEE 1IQNA 4OGYA 1MKXH 3S0NA 4ESTE 2WPJS 2ZDLA 1BTHH 2UUJB 3PB1E 3S69A 2Z9JA 1JWTA 6LPRA 4D9QA 2QA9E 4ISLA 5FBEA 1FY4A 1U6QA 3A88A 1IHTH 1BBRH 1TMBH 1CU1A 4X2XA 3TVJB 2GTBA 2ZDMA 2AH4X 2VVVA 1UK4A 1CHOF 2NU1E 5JYIA 4OS1A 1K1NA 1MTNC 3PMHB 1SOTA 1H8IH 1SR5C 3A7ZA 1ZPCA 4AZ2B 3SNDA 2BOKA 2B9LA 1S81A 2GZ7A 4RN6A 1NT1A 1O36A 4DG4A 4FUFA 5B6OA 4JCNA 2ZDNA 1Y8TA 2A0QB 4ZKSU 1TYNA 5GCHG 2B0FA 2J2UA 3N7OA 1AE5A 4GAWA 1D3PB 3M5NA 1AWFH 1H9LB 1QIXB 1SHYA 2A4RA 1G37A 4OS7A 3ZZCA 5FPSA 3BEIB 4WMEA 1Z1IA 2Q6GA 1O5EH 1QL8A 2ALVA 2PKAB 5C5NA 1NESE 1O2PA 1Q31A 2A4GA 1O38A 3RM0H 1BT7A 2W3IA 1VITF 2FP7B 3SJIA 5JBTA 1K21H 1A7SA 2KAIB 1P2MA 2CJIA 4DY7B 2TGAA 1O3JA 5DP8A 3SV9A 2PKSB 5I25A 4I7YH 5E0JA 1N8OB 1A3EH 2Y81A 1CSOE 2O8MA 1IQKA 1GJ7B 3ELAH 3M5OA 1RIWB 1NO9H 1SFQB 1C5TA 2PR3A 1O35A 1BMLA 1SOZA 1BBRE 3QGNB 3LGVA 4IN1A 5DGJA 5K7RA 1S0QA 2XWAA 1BTUA 1HRTH 1MCTA 1KTSB 2J38A 4FUDA 1VCQA 1AO5A 1PQ7A 1XKBC 2VU8E 4X8TH 5DP3A 1C1MA 3SV7A 5HYOA 1S6FA 1KXEA 1A5IA 1DUEA 3MU8A 2BQWB 3UNSA 3SNCA 1EJAA 4Y6DA 1JXPA 2QN5T 1LTOA 2GCTB 2XNIA 1GI1A 5BRRE 5LH8A 2C8ZB 2GV7A 3A80A 3SUDA 1GHZA 3GCNA 2HLCA 1K1PA 2RA3A 1ZLRA 4ZROA 3M7TA 2BLQA 2Y80A 1ZYOA 3I78A 4K5ZA 1NRNH 7GCHF 3SU1A 3Q77A 1TBRH 1KY9A 1FZZA 1L4ZA 1DSTA 1G2LA 1OOKB 2PFEA 1T8LA 1K1IA 1GI9B 3SBKA 2H9TH 2PKSC 1S82A 2H5DA 7KMEH 1HJAB 2CN0H 3IITA 3FAOA 1ETRH 4O03A 1TNKA 2RA0A 1UTMA 2A1DB 3PO1B 1SLVB 4Y7AA 1RIWC 2D1JA 5EXLA 1O2HA 1TGSZ 1T8OA 1LPGB 3VB3A 2ZFQH 3GY3A 3VXEH 3RLWH 3RXIA 5DJ7A 2R2MB 1AVWA 2A4QA 2CF9H 2FOGA 4B71A 2HOBA 1QQ4A 3LJJA 3GYMA 1W7GH 3DFJA 1OYQA 3ESTA 2GDDA 4FUEA 4CRBA 2ZWLH 2AGGX 1MCVA 1K9OE 2BLVA 1C2LA 3SO3A 2VIPA 1NRSH 1FIZA 3QUMP 4XDEA 3MYWA 2GCTC 2BYAX 1UTNA 2PLXA 1MTUA 1GHVH 2JH5D 1GBHA 1P01A 1O3EA 2JKHA 4KTCA 4MTBA 3QZRA 1SC8U 1GMHF 1Z8JB 1GBMA 1ZMLA 1SGQE 1C9TA 2Z9KA 1YPHC 2C93B 1PPCE 4NA8A 1ZTKA 4BAHB 3E6PH 5EXMA 1BIOA 1AB9B 5F8XA 4NFEA 1Y5BT 4TWYA 1SQOA 1CE5A 1MD7A 1HJAC 2BDAA 5A2MH 2BY8X 1TONA 4Y8YA 3ZZ5A 2OQ5A 2ZU5A 1O5FH 1V2TT 2OC0A 3C27B 1P9UA 3H5CB 1BA8B 1ESBA 3F9HA 5F8ZA 4E05H 1DLKB 3O8RA 1ZRBA 3E8LA 3KCGH 2ZFPH 1GWAA 3TH3H 4MPXA 3DD2H 3QWCH 4AB8A 3UOPA 4I8KA 4AOQA 1HCGA 1GBJA 1V2QT 6GCHG 1ELTA 4A5TS 2AIPA 4DURA 5FX6A 5FX5A 3TGKE 2FTLE 3PLPA 1NPMA 2ZEBA 3EA9A 4DJZB 2XXLA 3QZQA 2PWXA 5E0HA 2BY7X 3OY6U 1SGDE 1B0EA 3TNSA 1YBWA 1ELVA 1P3EA 1T4UH 2EI7A 1DFPA 1LCYA 3LOXA 3RU4E 1DWEH 1FY3A 1BMMH 1O3OA 1EZSC 4X8UH 4YT7H 1MTWA 4FVBA 1AB9C 1JRTA 1V2LT 1NRPH 1UTOA 1AHTH 1TPPA 3BG4B 3RU4T 5HXFA 1H1BA 1C5MD 1KDQB 5A8XA 3HKIB 3SQHE 1O2XA 4H4FA 2BD3A 1ZRKA 5FXLA 1NU9A 3HK3B 4U01A 1Z8IB 2EA3A 1VCWA 2G8TA 1QBOA 1O5AB 2UWLA 1NFXA 1HNEE 1O2NA 4NIVA 5HM2A 4YLQH 3BTKE 4X6MA 3JZ2B 1XVOA 3ZVBA 1EPTA 3HKJB 2ZGHA 1EUFA 3GDSA 4XFQA 2UWPA 2H1UA 3RXQA 1EOJA 2BLWA 3T62A 2ZGCA 4JYVH 4ISHH 1XUFA 1NRRH 1YPHE 2ASUB 5EQRA 3D23A 1TFXA 3U8TH 4FUHA 2VWLA 2HWLB 3RXRA 5ETXA 1GI6A 2FS8A 1ACBE 1YCPH 1ZTLA 2FDAA 4IMQA 3BTDE 1A1RA 1QL7A 1CT2E 1G3EA 1WSSH 1PYTC 2A7JA 1UJ1A 4DVAU 1CT0E 4I8HA 3K6ZA 2FLRH 1AFEH 1TLDA 1ZHRA 5AHGH 4AYYB 1C5UA 3O8DA 1CT4E 4Z0KA 3JZ1B 2NU4E 4TY6A 3BG4C 3S9AA 1Z1JA 3FFGA 1SVPA 1BHXB 1A3BH 5T6GA 1HAPH 2ZGXH 1DITH 1YGCH 2PUXB 2BMGB 1MTSA 3PWBA 2BDYA 1C1NA 1C9PA 1ELGA 1NY22 3M35A 1D6WA 2HGTH 2ODPA 1UTLM 3A8BA 2J92A 4D8NA
chains in the Genus database with same CATH superfamily
2W7UA 1A61H 2XBXA 2ZECA 3SORA 1HAIH 2FLBH 3SHCH 4WMDA 2AMQA 1LKAA 1LVMA 1UVUH 4FUCA 4NWLA 2A4OA 3UFAA 1M9UA 1AQ7A 4AC9A 4Y11E 2W3KA 1HV7A 3P8FA 3PMJA 5FPYA 1KSNA 3SW2B 4OS5A 1HAOH 5GXPA 1T31A 1IQLA 2ZFTA 4ASHA 2VINA 5CHAB 1NN6A 3ZZ4A 1PQ5A 3DSPA 3ZZAA 4GUXA 1LVOA 4P02A 3SOSA 4CRFA 2GGVB 1LHDH 2WPIS 1V3XA 1E36B 1EXFA 2QGRA 3A8DA 3MO3A 2IOTA 1MABB 3LONA 2ILNA 2O8UA 4JYUH 5HMAA 3LJOA 3OAAD 1QZ8A 2CV3A 1O2YA 2I6SA 2QXIA 3DCLA 2F83A 4A1VA 2C3SA 3P92A 1T8NA 4ZHMU 3NRLA 5DP4A 1MU8B 3RXSA 1TRYA 3GICB 2ZFRH 3QGJA 1PQ8A 1KLIH 3UREA 2KX4A 1L1GA 1QCPA 2IN2A 1GI7B 1SGIB 2ZU3A 2OXSA 2DE8A 2GZ9A 1O31A 1ETSH 2HNTE 3BTTE 5A8YA 2AYWA 3MH5A 4HGCA 1YY3A 3R3GB 1TNJA 1XUGA 2HLDD 2UWOA 1GI8B 1RFNA 2ZF0H 1OSSA 1EB2A 1G9IE 4K3JA 4JZ1A 4FU8A 1GJ9B 1CO7E 3VGCB 4TT3D 1QA7A 5EPNA 3SI4H 1V2VT 5HIZA 4A6LA 2QF0A 4ZCNA 1XX9A 2ZTYA 3BTWE 1C1OA 2XBWA 5DP9A 1UTJA 2GX4A 3ZV8A 3T26A 1DY9A 3RXVA 2D26C 2FWWA 1PPZA 2ZFFH 3SUEA 1SQTA 1P12E 1EAIA 2XNDD 4NFFA 2V3OH 1FMGA 1GCDA 1T8MA 2EEKA 3TH4H 4ISOA 2GZ8A 2V6NA 3MU0A 1JIRA 4X1SU 1ZGIA 1RRKA 4Y79A 5FBIA 3VB6A 1J9CH 2Y7XA 1IQFA 1UW7A 2ODYB 3FO8D 2KCOA 4FXGH 3RC5A 1BTZA 1C2KA 3ATKA 4NZQA 1DICA 1C5OH 2GCHG 2F9PA 3ZYDA 4ASUD 3OSYA 3SJ8A 1MMJN 2ANWA 3UR9A 2FI3E 2PKAA 5AFZH 1VITH 3FZDA 3PMAB 1E79D 1LVBA 1XUIA 3AVZA 1O2IA 4I8GA 1HDTH 2QF4A 1BZXE 1O2JA 3KQCA 3SJ9A 1BQYA 1THSH 2KAIA 5DK1A 3QO6A 4UE7H 4FUBA 3TGIE 5AF9H 3PWCA 1F5RA 1GMDF 5EODA 4GVUA 1GL1A 1WAYB 1QNJA 3BF6H 2KCYA 2BX4A 1GBIA 1OP8A 1GI0A 1XXFA 3DFLA 3KYFA 3RP2A 3VGCC 2F9NA 1CHOG 1ZOMA 3KQBA 5J4SA 2XRCA 3VFEA 4KKDA 3AK5A 1A4WH 1P06A 1ABIH 3P70B 3AW1A 1GHXH 1RXPA 3TPIZ 4UONA 2P3TB 3B9FH 2OC7A 1W0ZU 1HXFH 3EQ0H 4O97A 1G30B 4WF8A 1W0YH 4F4OC 2NU0E 3VB4A 9ESTA 5T3HA 2ZG0H 3TU7H 4NG9H 3M36A 1B7XB 3T29A 3EE7A 3FVFB 4K69A 1WUNH 2WYGA 4K2YA 1HGTH 2GV6A 1QGFA 3SV6A 1GVKB 2Z7FE 3A8AA 4CRGA 3LPRA 5C2ZA 4IW4E 4O9VA 8ESTE 1CGJE 2BDIA 2HNTF 2ZIQH 3MMGA 1L0ZA 1C5ZB 1VITG 1RTFB 2R3UA 4UFGH 1ANCA 3PTNA 3V7TA 3H7OA 5E8EH 2P94A 2SNWA 1TNIA 3NWUA 1BJVA 4B75A 4Q4LA 5FPTA 1SG8B 4MNWA 3RDZA 1YPJH 5EPYA 1CA0C 4YOIA 1LKBA 3ZZ8A 5EW1H 2Z3CA 1C1UH 1TAWA 1MTNB 2A7CA 4CRAA 1BOQA 4TYDA 1GCTB 1A5GH 1O2WA 1XVMA 2CMYA 3BTHE 3GCTF 3KHVA 1N6YA 3SU5A 4B6FA 4RKJB 2P93A 2GP9B 2OC1A 2QYIA 3BG8A 5C0UA 1FY5A 1COWD 4BAQB 3UAIC 1AN1E 3F0PA 1FI8A 1JOUB 1WDIA 9LPRA 1G2MA 3F9GA 4NA7A 1DOJA 1NROH 5C20A 4Q7ZA 1KXBA 2GT8A 4FUIA 4HG6A 2BD2A 4BAOB 1GGDB 3ZVFA 1ZMNA 3LGIA 3SNAA 2LP6A 4INLA 1C1WH 1GI2A 2VIWA 2FTMA 3P17H 2Y5FA 3MU4A 2GD4B 4INKA 2F9UA 1O33A 1QB1A 7GCHG 2ZDKA 1O2SA 3FP8E 3Q00A 2AMDA 1SMFE 1F92A 2AS9A 3UWIA 1HXEH 3ATIA 5J4QA 1EOLA 1O5GH 3BSQA 4J2YB 1YCPM 1MD8A 1OWKA 4ZH8A 1WTGH 3DA9B 1W7XH 1BHXF 3VG8A 1O34A 2XCNA 5DP5A 4TPYA 3TGJE 1NS3A 3OEED 2BX3A 2PHBA 1GCTC 1TPAE 1J17T 1S5SA 1V2KT 3FANA 1VGCB 3E3TA 5GWZA 2M2AA 5DP7A 3QX5H 5KECA 3GDVA 1SGNE 2NU2E 4AYVB 1OS8A 4YO9A 4IS5A 1H9HE 1GGDC 2IPHA 5EGMA 2P95A 4KTUA 1Y3UA 2OBOA 2OBQA 2TGTA 4D7GA 1W11U 1DSUA 2EY4C 1RD3B 1QA0A 2ZGBH 5ABWA 1QRZA 1EJNA 2ZHWH 2ZTXA 2GDEH 1GMHG 1T4VH 1SGFG 3U8RH 1TOCB 1MKXK 3UUZA 2PUQH 3F1SB 1DLEA 2FOMB 4YOGA 1F0TA 4AB9A 2VH0A 1C5SA 2FOEA 2FIRH 1HAYB 3SJKA 1BBRK 3DUXH 4BNRA 3N7EA 3UTUH 5E0GA 3PLKA 2ZFSA 4I86A 1KDQA 4QT8C 1FUJA 1CHGA 1E37B 1UK3A 1GBEA 1C4Y2 1OX1A 3F9EA 3VB7A 4CH8B 4M9FA 4ABJA 3UWJH 4X8VH 1GVZA 5L30H 3A89A 1OWIA 2BQ7B 1P10A 1VGCC 2H6MA 3F68H 3MTYA 1GJBB 3BTFE 2SFAA 3PLBA 3N99A 1EB1H 2FX4A 1RS0A 1GBDA 4TPIZ 1WQVH 3CS0A 1TRMA 3ZZ3A 4WY3A 1KXFA 1GBLA 1QBVH 4CR5A 1V6DA 4IGDA 3SV2H 3MQKC 4I33A 4GPGA 1PFXC 4E7NA 1AGJA 1GHBF 1XMNB 5C1UA 4SGBE 2BY9X 2WV9A 3RLYH 4MVNA 3UOUA 3ZZDA 1IQMA 4AFSA 2R2WU 2FESH 2JIZD 3RXAA 1UVSH 4GLYA 4DOQA 1J15A 1TQ0B 1V2NT 2O9QA 4MNXA 3LGUA 1LHFH 4Z6AH 2SGDE 1P9SA 2ZDAH 4AX9H 2OQUA 1QJ7B 1DWCH 1P8VC 3MO6A 1GDQA 1SLUB 1AUJA 1SGCA 1P03A 1HJ8A 2FOBA 4BTIB 3NXPA 3LU9B 2ZHEH 2Q6DA 1GHYH 2VJ1A 2LNCA 2G52A 1O3PB 1K1OA 3FOAA 2P16A 2IJOB 2QE7D 4CH2B 1ESTA 5I46H 3OU0A 3Q3KA 3A7VA 4FUGA 5TCCA 3H09A 1K1JA 2GMTC 2PW8H 1C1SA 2Y5HA 2C8XB 2Q6FA 1UMAH 1V2OT 1EZQA 3SNBA 4MNVA 1NZQH 1K22H 4NCYA 3KNXA 4B2CA 1L4DA 1TMUH 5JBBS 5E2OA 4JMYA 4AG2A 5K0HA 1O3IA 1NFUA 3SU2A 1LQEA 3OTPA 2FYRA 2H2ZA 2A2QH 1GJDB 4KP0A 2G4UA 1HBTH 4NWKA 5EG4A 1HUTH 3PRBA 1L1NA 1L1JA 5CHBA 3WW7A 3SGBE 4ACBA 2J98B 3ZZ6A 3DT0H 1ZMJA 3SUGA 1O32A 3E16B 3NZIA 6CHAB 1HFDA 3MI4A 2V0BA 1W8BH 5GDSH 3T5FH 5JBCS 2AEIH 2IJD1 4ABBA 3RXKA 1A0HB 1CVWH 2QF5A 2ZKSA 1FAKH 1ZPBA 1NBMD 2EC9H 4MPWA 2YNAA 2WPKS 1RGQA 1BTYA 1TABE 1TQ7B 2YMSD 1WOFA 1SFIA 4UD9H 1BRUP 2QXGA 3U1IB 3BTQE 1E38B 1QURH 1DT2A 2PSXA 3EAJA 1YLDA 3E91A 4ZXXH 2Y7ZA 3O8BA 4K1TA 1C5YB 1O2KA 3G01A 3QN7A 3OYPA 3M3SA 1F0UA 1TX7A 3TK9A 4NGAH 1UCYH 4F49A 2KFWA 3ZV9A 1TGCA 1O3FA 3BV9B 4D7FA 8LPRA 2AFQB 2HVXA 3T2NA 4Q80A 1C5PA 2Z9IA 1CA8B 2ZCHP 6CHAC 4CHAB 3ZYEA 4YM9A 4GHQA 1GJ5H 3M7QA 1NFWA 1PQAA 2BLOA 1NTPA 1WU1A 3RXPA 1K2I1 2KCPA 2WUBA 4I8LA 3L6PA 4AGKA 2RCEA 3KQDA 2OK5A 3VEQB 3V12A 1SL3A 2WPMS 2PGQB 1GJ8B 4JZDH 1MQ5A 2ZGJA 4J1YA 4OS6A 1C1QA 1E35B 4DT4A 2A45B 1QJ6B 3O8CA 1C5LH 1C5WB 3QTOH 4WVPE 1O2MA 2BXUH 2CF8H 1TGTA 5C5OA 3ZVEA 1DPOA 1FQ3A 3UR6A 1YPEH 2OCVB 3MU5A 2WPDD 1VCPA 2QF3A 2QXHA 1SGFA 5FAHA 1IHSH 1F2SE 2ZI2H 2HNTC 2A5IA 1C5XB 1TPOA 2TIOA 4K8YA 1ABJH 3A7XA 1HAZB 3TK6A 3U69H 1GMCF 1SGEE 2A32A 2JETB 1P57B 1O2TA 3VXFH 2G55A 2WSSD 1GBBA 1UCYE 1O3MA 3DHKH 4XSKU 1HB0B 2WZQA 3MH6A 1MAXA 2Y82A 2KCAA 1D3TB 3BEFB 4MNYA 3RUOA 4CHAC 1GDUA 4NIYA 5T6DA 2VWNA 4IBLH 2W26A 1GJAB 2A7HA 2BD9A 2SGEE 1O2UA 3AASA 1EFRD 4WWYA 3BN9A 1LHCH 4Y7BA 3RXMA 2AGEX 2JH0D 4BTUB 2VH6A 2AIQA 2WPLS 1Y59T 2ZTZA 1H8HD 1UHBA 1IQGA 2XW9A 1LVYA 4X6NA 3MNSA 2R3YA 3MNXA 4RI0A 4DT7B 1GMDG 3KEEA 3TLOA 1SGPE 4K8BA 1ANDA 4X1QU 1YCPK 2A2XH 1O3AA 2ZNKH 1TNLA 4XBCA 3RXEA 3A84A 5EJZA 1P2QA 4A1TA 1W14U 1FIWA 3IWMA 2WHXA 3FP7E 2IPQX 4ABHA 3D62A 1O0DH 4RKOB 2QAAA 1SLXB 5A8ZA 4NSYA 1FLEE 1Z8GA 2JETC 1MKWH 4BXWA 1GL0E 2VBCA 1GI5A 3RXTA 4JYTA 3TH2H 3S9BA 2K0QA 4CRCA 2RG3A 2FYQA 3ZVAA 3A7WA 3PTBA 4ABDA 2J95A 1VKYA 1Q3XA 1TMTH 1AI8H 1THPB 1O2ZA 2OC8A 3H7TA 5JBAS 2G00A 1DE7H 4ABIA 1L2EA 4XBDA 4FUJA 2J4IA 1GHAF 3TJOA 1BMNH 1O3KA 1K28D 1YPLH 4JZIA 4UEHH 1O3CA 3FZZA 1AFQB 2WPHS 1C4U2 2NU3E 3HGNA 1O2QA 3STJA 1C2HA 2BOHB 4R8TB 1OWDA 4Y76A 1LPKB 1WXRA 4FU7A 2EI8A 5SGAE 1GJ6A 2VIVA 4X1RU 1BMAA 3BTGE 1FN8A 1YLCA 3LGWA 1QR3E 3U98H 4H6TA 3GOVB 4XRNA 1GI3A 3A7TA 4LOYH 5DKMA 1TBZH 3RMMH 1ZJKA 3GCTG 1BB0B 4UDWH 3UY9A 1BRCE 1AKSB 4MQAA 2QCYA 2SGAA 4D9RA 1EKBB 2C4FH 3LIWA 2HPQH 5A0AE 2F9BH 5JB9S 3TNTA 1UVPA 1S83A 5F6MA 1MAYA 3SJOA 3P8GA 1P3CA 3S9CA 5GIBA 1BTPA 3SGQE 3OEHD 4BOHA 4LZ4B 1G32B 1C2EA 1GHWH 3ODDA 1PPFE 4WXVA 2GT7A 5T1VA 4KTSA 2YMSB 2FI4E 1EAWA 3WWFA 3ENSB 3LGYA 4FETA 3UNRA 1KIGH 4B2BA 1QBNA 4YESB 1AFQC 1C1TA 1IQHA 4Q7XA 1AIXH 1CA0B 5JB8S 1DX5M 5C67A 1KXCA 1LHEH 1A46H 2ZQ1A 3SHAH 2FMJA 3MH7A 1B5GH 1BJUA 1V2UT 5A0BA 3RXOA 4B6EA 2VWMA 5C3NA 4ZUHA 2Q1JA 2TPIZ 1D9IA 5T6FA 1EP6A 2A5KA 1K0HA 1QL9A 2SGQE 2QC2A 1UVOA 3KQ5A 5DSFA 3B8JA 3KGPA 1HAGE 4HZHA 4HTCH 5A0CA 2WINI 4YLUA 1YPKH 1IQIA 3K2UA 3BIVH 3MNBA 4FOUC 1J14A 1G3DA 5EXNA 3KYGA 1C5QA 3U9AH 4K1EA 4ACAA 3ZZ9A 5TJXA 5DG6A 1C5NH 4Y10E 3RXHA 4OGXA 3DSGA 1ELFA 1Z71A 2C8YB 3GYLB 1AUTC 2XCFA 1DANH 4Q7YA 4HFPB 4DCDA 1DVAH 1O30A 2LPRA 4IC5A 1C1PA 3HATH 2ZZUH 5FL7D 1P2IA 1EASA 2ZCLP 1SGYE 2XTTB 1GBCA 3A87A 5DP6A 2YMSC 3TIUA 1UHBB 3E0NB 1EAXA 3GY5A 1Y3VA 4AORA 1QTFA 4JZFH 4Y8XA 4Y8ZA 3T25A 5TCAA 3RC6A 3AAVA 1YYY1 1HLTH 3UQOA 1W3CA 1O2RA 1FX0B 1UTQA 3PV2A 2FX6A 5DO4H 3OY5U 1NFYA 5EU8A 3TJNA 2OLGA 3SI3H 3URCA 4LK4A 1FY8E 4U32A 2JJ2D 4M7GA 3UNQA 2ZU2A 3A85A 2RDEA 1BDAA 3TK5A 5JPMH 3F3BA 1YM0A 4F48B 1PPHE 2KM0A 4O3UA 1C2MA 1SLWB 2F4LA 4VGCB 5F03A 2M5TA 2ESTE 3PMBB 1C2IA 2Z6BD 2EI6A 2ZPRA 1P0SH 3GCOA 3SYJA 5JDUB 4MDSA 4H6SB 2FEQH 2VWOA 1EJMA 1MBMA 3UQVA 1FN6A 3PYHA 3BEUA 1ZGVA 1GHBG 2BB4A 1KMHB 5FCKA 2G51A 5B6LA 1O3GA 2TGPZ 2J98A 1Q2WA 2P59A 3RMNH 1SGRE 1E1RD 2D8WA 2ZU4A 1Y5AT 2G81E 1VR1H 1TBQH 3FP6E 2GJGA 4GSOA 1JMOH 3OFND 5EW2H 1CQQA 1O3NA 1EX3A 1F5LA 1IQEA 2VIDA 5L2ZH 3LC3A 1HAHH 1V2RT 4X1PU 1CBWB 1LPZB 1UO6A 4RSPA 2W5EA 1FAXA 1S6HA 1DXPA 5LPRA 1NBME 1BMFD 4MPUA 5FCRA 4NA9H 1Y3XA 4ZKRU 3RXBA 1CGHA 4B2AA 1WBGB 1TWXB 4OS4A 4WJG2 2RDLA 3LDXH 2Z94A 3NKKA 4VGCC 1XXDA 3F9FA 5H4IB 3CNRA 4XBBA 1DM4B 1T32A 1TPSA 2F43B 1TOMH 4DGJA 1S6LA 2V7QD 1PPBH 1MUEB 2Z3DA 3V0XA 2UUFB 3MNCA 1J8AA 2H9EH 2VB0A 3HPTB 4NSVA 2BVSH 4ISNA 5GNDA 3SU0A 4IMZA 3RMOH 2Z9LA 4IC6A 5IDKA 2H5CA 2AMPA 3RC4A 1G36A 4GCHF 2KR7A 4LZ1H 2HVYB 2TGDA 2VIOA 3A82A 1HIAB 2BVXH 3EA8A 3W1EA 1F0SA 2FS9A 2P3FH 5BPEA 3WWBA 1Y3WA 1FY1A 1WV7H 1BTWA 4X6PA 3R0FA 3LKWA 2QY0B 2WUCA 2ANMH 3SGAE 1CGIE 1CBWC 4JK5A 2VIQA 1ELEE 4X2VA 2XBYA 1GBKA 7ESTE 4AFQA 3B23B 1P05A 3F2GA 3ODFA 2GMTB 3A8CA 5CMXH 4X2WA 3HGPA 3MFJA 3SZNA 1D4PB 4NIXA 2XC4A 3Q76A 1HAVA 2K1QA 3EGKH 3F0OA 3RXDA 5G4BA 3ZVCA 2L74A 2XWBI 3A86A 3M7UA 1P02A 4Q2KA 3W95A 2BD8A 3BTME 2SGFE 1O2GH 2CK3D 1Z6JH 2VGCB 4X1NU 1WTHD 2F9VA 2P8OB 1AD8H 1MZDA 1RTKA 3RM2H 4INHA 3ZIAD 1UTPA 1A0LA 3ZVDA 2THFB 2B7DH 2BM2A 3A7YA 1SPJA 1OWEA 3MOCA 4U30A 3QDZB 2PGBB 1LO6A 2FO9A 2UUKB 4Y71A 4BXSA 4ABFA 2R0LA 2YNBA 2NWNA 1YPGH 1DDJA 1GJ4H 1Z6EA 1O39A 3S7KB 1EP5A 4PROA 1SKYE 1N8OC 1NRQH 3C1KA 3V13A 2HPPH 1ZPZA 1EATA 3I29A 1AE8H 1O3DA 1C2GA 4X0WU 4CRDA 4DW2U 3KF2A 5IK2D 1MH0A 1EZXC 1F7ZA 3S7HB 5CDFE 1GG6B 1FDPA 5E2PA 1IQJA 3P8OA 2BY5X 1LMWB 3GY6A 4LXBH 2ZDVH 1PJPA 1GBAA 5L6NH 1LDTT 1SGTA 1VJ9U 1O5CB 2RFKC 1TA2A 4Y0ZE 1FONA 2K8IA 4YTAA 2BDBA 2VGCC 5GCHF 1P2OA 3ZZ7A 2P8OC 1GMCG 3I77A 1LQDB 2A5AA 4WH6A 1ZJDA 1OWJA 1GVLA 2XYAA 2G5NA 4MPVA 4OM9A 4ZHLU 1X7AC 2D2DA 1TX8A 1ELCA 2ZPSA 1IAUA 4Y0YE 2O8LA 2GKVE 2J94A 5FHTA 2TBSA 2STBE 3ITIA 5HGGA 2OTVA 3AW0A 1ZR0A 1G3BA 5C1XA 1C1RA 2DE9A 2BD5A 4P00A 1DS2E 1DWBH 1RTLA 2CHAB 1O5BB 3LGTA 4BAKB 3PO1C 1BTXA 1QQUA 4TWWA 1W13U 1S0RA 1TE0A 1OKXA 3NK8A 1INCA 3NUMA 1UVTH 1OHHD 2WV5A 1C4V2 3GCHB 1P11E 3GY7A 2FOFA 3A81A 1GG6C 2Y6TA 4AG1A 2FXRA 1WCZA 2BD7A 2AGIX 3WY8A 1LHGH 1DUAA 3RXFA 1ESAA 1PPGE 1C2DA 2A31A 1AKSA 1QY6A 2ANKH 3CS7A 4WH8A 1Z7KA 7LPRA 2Z3EA 4K60A 2J9NA 1MU6B 2BDCA 1O5DH 1VJAU 1O3HA 1UK2A 4FU9A 1BRBE 2ZC9H 1GBTA 1GPZA 2HRVA 3PROA 4ZXYH 5HKKD 2B8OH 1KYNA 4Q63A 3CENA 1ZSJA 1AY6H 1ZHPA 1GHAG 3VB5A 2FOAA 3TITA 2F9OA 3ATMA 1YP9A 3T27A 3L3TA 2FZZA 2CHAC 1EQ9A 1ZSLA 2ZHFH 4ABAA 1HAVB 5DN6D 1ZZZA 1NU7B 2FPZA 3GCHC 3BTEE 1SHHB 4RT0A 1ELDE 2VVCA 1KTTB 4ZAEA 1XUKA 1GDNA 1ANEA 3KL6A 3LH1A 4GHTA 1IOEA 4XOJA 1FPHH 4ABEA 2TRMA 1BRAA 1UCYK 3Q3XA 1P2KA 3RXJA 4YXWD 4X8SH 3BIUH 5L2YH 2BHGA 2EQNA 4U2WA 2CXVA 4KELA 4E7RG 1V2PT 2SNVA 1ARCA 1FNIA 1TGNA 2BVRH 5EOKA 2R0KA 3MU1A 2Y5GA 2ALPA 1QRWA 3AAUA 3ZVGA 2OUAA 4BAMB 4BANB 1Z8RA 1GJCB 1TNGA 4YT6H 1V2JT 4ZMAH 3LT3A 1C1VH 1AVGH 1TGBA 1FV9A 1QHRB 1OXGA 4CREA 2XC5A 1RJXB 4TSFD 4B1TA 4ZKNU 3MO9A 1DWDH 1OP0A 3NCLA 3EA7A 3L33A 1ETTH 2ZQ2A 2PTCE 2W7SA 1G3CA 1PPEE 3EYDA 1H8DH 3VPKA 3UIRA 4MLFB 3URDA 2C8WB 1OP2A 1TX6A 2Z9GA 1JRSA 1MQ6A 1QFKH 2BDGA 1P04A 4ZHAA 3DSOA 1S85A 2ZP0H 3A83A 4BTTB 5AFYH 1J16A 1N1LA 2BZ6H 2DUCA 2QIQA 4AN7A 4I31A 3RMLH 2FI5E 3U28C 4ABGA 6GCHF 3T28A 4HI3A 2I6QA 3MH4A 1MZAA 1HPGA 1F0RA 4X2YA 1O2OA 4IN2A 1YC0A 3FN8A 3GY8A 1XKAC 2ODQA 2V3MA 2QV1A 3M3TA 5KGOA 3ZZBA 2BXTH 5EQQA 5C1YA 2R9PA 2ZHDA 1KXAA 1C5VA 2FOCA 2XC0A 4B76A 1QB9A 2O8WA 1TA6A 4OS2A 1HAXB 4NIWA 1C2JA 3UPEA 4DIIH 5GJ4B 2OD3B 5HM9A 4H42U 3RXCA 1SI5H 2VNTA 4JZEH 1AWHB 5CE1A 4B73A 3KIDU 4A92A 4WXIA 4A1XA 1YPMH 2WV4A 4DIHH 2ZPQA 5PTPA 3IG6B 1XUJA 2ZHQH 2PTNA 1TALA 1QJ1B 1T7CA 1AZ8A 5LPFA 2JH6D 2OP9A 1GI4A 2PV9B 1SQAA 1TRNA 5GPIB 1BUIA 3TJUA 1BCUH 1SSXA 4CBOA 1A0JA 3TJVA 2VVUA 3M5MA 5ESBA 8GCHG 1MKWK 4ISIH 4XE4A 3GDUA 1TIOA 1WYKA 1UTKA 3OX7U 1E34B 1THRH 2B5TB 2YOLA 3LC5A 3RU4D 3E1XB 2UUYA 1C2FA 2G4TA 2FM2A 1P2JA 4THNH 1KLTA 2FOHA 3D65E 4CR9A 2CGAA 5CHAC 1JIMA 1W0KD 3E0PB 3RXGA 2KZ4A 4I32A 1D6RA 1DY8A 1P2NA 3RXLA 2WYJA 2V3HH 3GS9A 3Q3YA 1MBQA 1E0FD 2ZA5A 5EJLA 1H8ED 1D3DB 1H9IE 4R0IA 1TNHA 3QLPH 3MWIU 1NC6A 1AVXA 3V3MA 1HIAA 5KEDA 1DXWA 2GVFA 2XBVA 1BITA 2O8TA 4YZUA 4I8JA 8KME2 1AU8A 1YLNA 3SV8A 1KXDA 1YWUA 1EPTB 1QRXA 4AFUA 1FPCH 3M5LA 4O3TA 1ZHMA 1P09A 1A5HA 3HK6B 3KN2A 3P6ZB 1WQSA 4YOJA 2ZO3H 1O3LA 1NM6A 1ORFA 1YF4A 4NZLA 1ARBA 1FJSA 3CP7A 1F5KU 1V2MT 1W12U 4UFEH 1E1QD 1S84A 3ATLA 4TY7A 4AFZA 1V2ST 2LELA 1TB6H 2BY6X 1A2CH 2JJ1D 3RXUA 1HJ9A 1N6XA 2ZCKP 2P3UB 4UFFH 1ELBA 1GBFA 3EE0B 2ULLA 1OYTH 2FODA 1OPHB 2PSYA 1H4WA 1MTVA 1O2LA 3U1JB 1AMHA 2H9HA 2G5VA 4AGJA 4D76A 2STAE 4MG3A 4FVDA 1YKTA 1XUHA 2C90B 3K65B 3QK1A 5AVDA 1Y5UT 2BTCE 4GCHG 2F91A 1OWHA 2HALA 3SNEA 2QXJA 3F2HA 5C0TA 3NPSA 5EQSA 1ZTJA 1HYLA 4RT1A 2AERH 3W94A 3M61U 1D3QB 2ZU1A 4B74A 5LGOA 3SU6A 4KGAA 3E90B 3SUFA 3GY2A 4K1SA 4A7IB 4ZKOU 1EPTC 5LPEA 1V2WT 1ID5H 5F8TA 6ESTA 1O2VA 2JDID 3GY4A 8GCHF 2BQ6B 5DPAA 1Y3YA 3EDXB 1O37A 1FXYA 2J34A 1K1LA 3QTVH 2V35A 2ANYA 1VZQH 3P95A 3U8OH 4WMFA 5A09A 4CBNA 2SGPE 2OINA 1KLJH 2BDHA 1O3BA 1EAUA 5IYTA 3P8NA 1SB1H 1C5RA 1QB6A 1W10U 1W2KH 3SN8A 3UB0A 1B0FA 3MHWU 2F3CE 3GISB 4JK6A 3LH3A 3PV4A 1ELAA 3PM3A 1EZUC 1K1MA 3F6UH 3KQEA 4SGAE 3SU3A 4E06H 3K9XB 2GCHF 3M3VA 3K6YA 3OTJE 4UFDH 5ESTE 1SBWA 1JBUH 3PV5A 3M37A 2BZAA 4X6OA 1XM1A 3D49H 2BD4A 1PYTD 1AZZA 1ZSKA 3ATWA 3STIA 3SU4A 1ANBA 3SQEE 1IQNA 4OGYA 1MKXH 3S0NA 4ESTE 2WPJS 2ZDLA 1BTHH 2UUJB 3PB1E 3S69A 5C94A 2Z9JA 1JWTA 6LPRA 4D9QA 2QA9E 4ISLA 5FBEA 2L6OA 1FY4A 1U6QA 3A88A 1IHTH 1BBRH 1TMBH 1CU1A 4X2XA 3TVJB 2GTBA 2ZDMA 2J97A 2AH4X 2VVVA 1UK4A 1CHOF 2NU1E 5JYIA 4OS1A 1K1NA 1MTNC 3PMHB 1SOTA 1H8IH 1SR5C 3A7ZA 1ZPCA 4AZ2B 3SNDA 2BOKA 2B9LA 1S81A 2GZ7A 4RN6A 3SZEA 1NT1A 1O36A 4DG4A 3OE7D 3N7DA 4FUFA 5B6OA 4JCNA 2ZDNA 1Y8TA 2A0QB 4ZKSU 1TYNA 5GCHG 2B0FA 2J2UA 3N7OA 1AE5A 4GAWA 1D3PB 3M5NA 1AWFH 1H9LB 1QIXB 1SHYA 2A4RA 1G37A 4OS7A 3ZZCA 5FPSA 3BEIB 3FKSD 4WMEA 1Z1IA 2Q6GA 1O5EH 1QL8A 2ALVA 2PKAB 5C5NA 1NESE 1O2PA 1Q31A 2A4GA 1O38A 3RM0H 1BT7A 2W3IA 1VITF 2FP7B 3SJIA 5JBTA 1K21H 1A7SA 2KAIB 1P2MA 2CJIA 4DY7B 2TGAA 1O3JA 5DP8A 2PP6A 3SV9A 2PKSB 5I25A 4I7YH 5E0JA 1N8OB 1A3EH 2Y81A 1CSOE 2O8MA 1IQKA 1GJ7B 3ELAH 3M5OA 1RIWB 1NO9H 1SFQB 1C5TA 2PR3A 1O35A 1BMLA 1SOZA 1BBRE 3QGNB 3LGVA 4IN1A 5DGJA 5K7RA 1S0QA 2XWAA 1BTUA 1HRTH 1MCTA 1KTSB 2J38A 4FUDA 1VCQA 1AO5A 1PQ7A 1XKBC 2VU8E 4X8TH 5DP3A 1C1MA 3SV7A 5HYOA 2AHME 1S6FA 1KXEA 1A5IA 1DUEA 3MU8A 2BQWB 3UNSA 3SNCA 1EJAA 4Y6DA 1JXPA 2QN5T 4XD7D 1LTOA 2GCTB 2XNIA 1GI1A 5BRRE 5LH8A 2C8ZB 2GV7A 2J5UA 3A80A 3SUDA 1GHZA 3GCNA 2HLCA 1K1PA 2RA3A 1ZLRA 4ZROA 3M7TA 2BLQA 2Y80A 1ZYOA 3I78A 4K5ZA 1NRNH 7GCHF 3SU1A 3Q77A 1TBRH 1KY9A 1FZZA 1L4ZA 1DSTA 1G2LA 1OOKB 2PFEA 1SQRA 1T8LA 1K1IA 1GI9B 3SBKA 2H9TH 2PKSC 1S82A 2H5DA 7KMEH 1HJAB 2CN0H 3IITA 3FAOA 1ETRH 4O03A 1TNKA 2RA0A 1UTMA 2A1DB 3PO1B 1SLVB 4Y7AA 1RIWC 2D1JA 5EXLA 1O2HA 1TGSZ 1T8OA 1LPGB 3VB3A 2ZFQH 3GY3A 3VXEH 3RLWH 3RXIA 5DJ7A 2R2MB 1AVWA 2A4QA 2CF9H 2FOGA 4B71A 2HOBA 1QQ4A 3LJJA 3GYMA 1W7GH 3DFJA 1OYQA 3ESTA 2GDDA 4FUEA 4CRBA 2ZWLH 2AGGX 1MCVA 2XOKD 1K9OE 2BLVA 3F2FA 1C2LA 3SO3A 2VIPA 1NRSH 1FIZA 3QUMP 4XDEA 3MYWA 2GCTC 2BYAX 1UTNA 2PLXA 1MTUA 1GHVH 2JH5D 1GBHA 1P01A 1O3EA 2JKHA 4KTCA 4MTBA 3QZRA 1SC8U 1GMHF 1Z8JB 1GBMA 1ZMLA 1SGQE 1C9TA 2Z9KA 1YPHC 2C93B 1PPCE 4NA8A 1ZTKA 4BAHB 3E6PH 5EXMA 1BIOA 1AB9B 5F8XA 4NFEA 1Y5BT 4TWYA 1SQOA 1CE5A 1MD7A 1HJAC 2BDAA 5A2MH 2BY8X 1TONA 4Y8YA 3ZZ5A 2OQ5A 2ZU5A 1O5FH 1V2TT 2OC0A 3C27B 1P9UA 3H5CB 1BA8B 1ESBA 1W0JD 3F9HA 5F8ZA 4E05H 1DLKB 3O8RA 1ZRBA 3E8LA 3KCGH 2ZFPH 1GWAA 3TH3H 4MPXA 3DD2H 3QWCH 4AB8A 3UOPA 4I8KA 4AOQA 1HCGA 1GBJA 1V2QT 6GCHG 1ELTA 4A5TS 2AIPA 4DURA 5FX6A 5FX5A 3TGKE 2FTLE 3PLPA 1NPMA 2ZEBA 5HIYA 3EA9A 4DJZB 2XXLA 3QZQA 2PWXA 5E0HA 3PRDA 2BY7X 4F55A 2W6ID 3OY6U 1SGDE 1B0EA 3TNSA 1YBWA 1ELVA 1P3EA 1T4UH 2EI7A 1DFPA 1LCYA 3LOXA 3RU4E 1DWEH 1FY3A 1BMMH 1O3OA 1EZSC 4X8UH 4YT7H 1MTWA 4FVBA 1AB9C 1JRTA 1V2LT 1NRPH 1UTOA 1AHTH 1TPPA 3BG4B 3RU4T 5HXFA 1H1BA 1C5MD 1KDQB 5A8XA 3HKIB 3SQHE 1O2XA 4H4FA 5C17A 2BD3A 1ZRKA 5FXLA 1NU9A 3HK3B 4U01A 1Z8IB 2EA3A 1VCWA 2G8TA 1QBOA 1O5AB 2UWLA 1NFXA 1HNEE 1O2NA 4NIVA 5HM2A 4YLQH 3BTKE 4X6MA 3JZ2B 1XVOA 3ZVBA 5F53A 1EPTA 3HKJB 2ZGHA 1EUFA 3GDSA 4XFQA 2UWPA 2H1UA 3RXQA 1EOJA 2BLWA 3T62A 2ZGCA 4JYVH 4ISHH 1XUFA 1NRRH 1YPHE 2ASUB 5EQRA 3D23A 1TFXA 5EJ1A 3U8TH 4FUHA 2VWLA 2HWLB 3RXRA 5ETXA 1GI6A 2FS8A 1ACBE 1YCPH 1ZTLA 2FDAA 4IMQA 3BTDE 1A1RA 1QL7A 1CT2E 1G3EA 1WSSH 1PYTC 2A7JA 1UJ1A 4DVAU 4Z1MD 1CT0E 4I8HA 3K6ZA 2FLRH 1AFEH 1TLDA 1ZHRA 5AHGH 4AYYB 1C5UA 3O8DA 1CT4E 4Z0KA 3JZ1B 2NU4E 4TY6A 3BG4C 3S9AA 1Z1JA 3FFGA 1SVPA 1BHXB 1A3BH 5EIYA 5T6GA 2W6JD 1HAPH 2ZGXH 1DITH 1YGCH 2PUXB 2BMGB 1MTSA 3PWBA 2BDYA 1C1NA 1C9PA 1ELGA 1NY22 3M35A 1D6WA 2HGTH 2ODPA 1UTLM 3A8BA 2J92A 4D8NA
chains in the Genus database with same CATH topology
2W7UA 1A61H 2XBXA 2ZECA 3SORA 1HAIH 2FLBH 3SHCH 4WMDA 2AMQA 1LKAA 1LVMA 1UVUH 4FUCA 4NWLA 2A4OA 3UFAA 1M9UA 1AQ7A 4Y11E 2W3KA 1HV7A 3P8FA 3PMJA 5FPYA 1KSNA 3SW2B 4OS5A 1HAOH 5GXPA 1T31A 1IQLA 2ZFTA 4ASHA 2VINA 5CHAB 1NN6A 3ZZ4A 1PQ5A 3ZZAA 4GUXA 1LVOA 3SOSA 4CRFA 2GGVB 1LHDH 2WPIS 1V3XA 1E36B 1EXFA 2QGRA 3A8DA 3MO3A 2IOTA 3LONA 2ILNA 2O8UA 4JYUH 5HMAA 3LJOA 2CV3A 1O2YA 2I6SA 2QXIA 2F83A 4A1VA 2C3SA 3P92A 1T8NA 4ZHMU 5DP4A 1MU8B 3RXSA 1TRYA 3GICB 2ZFRH 3QGJA 1PQ8A 1KLIH 3UREA 1L1GA 1QCPA 2IN2A 1GI7B 1SGIB 2ZU3A 2OXSA 2DE8A 2GZ9A 1O31A 1ETSH 2HNTE 3BTTE 5A8YA 2AYWA 3MH5A 4HGCA 3R3GB 1TNJA 1XUGA 2UWOA 1GI8B 1RFNA 2ZF0H 1OSSA 1EB2A 1G9IE 4K3JA 4JZ1A 4FU8A 1GJ9B 1CO7E 3VGCB 1QA7A 5EPNA 3SI4H 1V2VT 4A6LA 2QF0A 1XX9A 2ZTYA 3BTWE 1C1OA 2XBWA 5DP9A 1UTJA 2GX4A 3ZV8A 3T26A 1DY9A 3RXVA 2D26C 2FWWA 1PPZA 2ZFFH 3SUEA 1SQTA 1P12E 1EAIA 4NFFA 2V3OH 1FMGA 1GCDA 1T8MA 2EEKA 3TH4H 4ISOA 2GZ8A 2V6NA 3MU0A 1JIRA 4X1SU 1ZGIA 1RRKA 4Y79A 5FBIA 3VB6A 1J9CH 2Y7XA 1IQFA 2ODYB 4FXGH 3RC5A 1BTZA 1C2KA 3ATKA 4NZQA 1DICA 1C5OH 2GCHG 2F9PA 3ZYDA 3OSYA 3SJ8A 1MMJN 2ANWA 3UR9A 2FI3E 2PKAA 5AFZH 1VITH 3FZDA 3PMAB 1LVBA 1XUIA 3AVZA 1O2IA 4I8GA 1HDTH 1BZXE 1O2JA 3KQCA 3SJ9A 1BQYA 1THSH 2KAIA 5DK1A 3QO6A 4UE7H 4FUBA 3TGIE 5AF9H 3PWCA 1F5RA 1GMDF 5EODA 4GVUA 1GL1A 1WAYB 1QNJA 3BF6H 2BX4A 1GBIA 1OP8A 1GI0A 1XXFA 3DFLA 3RP2A 3VGCC 2F9NA 1CHOG 1ZOMA 3KQBA 5J4SA 2XRCA 3VFEA 4KKDA 1A4WH 1P06A 1ABIH 3P70B 3AW1A 1GHXH 1RXPA 3TPIZ 4UONA 2P3TB 3B9FH 2OC7A 1W0ZU 1HXFH 3EQ0H 4O97A 1G30B 4WF8A 1W0YH 4F4OC 2NU0E 3VB4A 9ESTA 5T3HA 2ZG0H 3TU7H 4NG9H 3M36A 1B7XB 3T29A 3FVFB 4K69A 1WUNH 2WYGA 4K2YA 1HGTH 2GV6A 1QGFA 3SV6A 1GVKB 2Z7FE 3A8AA 4CRGA 3LPRA 5C2ZA 4IW4E 4O9VA 8ESTE 1CGJE 2BDIA 2HNTF 2ZIQH 3MMGA 1L0ZA 1C5ZB 1VITG 1RTFB 2R3UA 4UFGH 1ANCA 3PTNA 3V7TA 3H7OA 5E8EH 2P94A 2SNWA 1TNIA 3NWUA 1BJVA 4B75A 5FPTA 1SG8B 4MNWA 3RDZA 1YPJH 5EPYA 1CA0C 4YOIA 1LKBA 3ZZ8A 5EW1H 2Z3CA 1C1UH 1TAWA 1MTNB 2A7CA 4CRAA 1BOQA 4TYDA 1GCTB 1A5GH 1O2WA 1XVMA 2CMYA 3BTHE 3GCTF 3KHVA 1N6YA 3SU5A 4RKJB 2P93A 2GP9B 2OC1A 2QYIA 3BG8A 1FY5A 4BAQB 1AN1E 1FI8A 1JOUB 9LPRA 1G2MA 3F9GA 4NA7A 1DOJA 1NROH 5C20A 4Q7ZA 1KXBA 2GT8A 4FUIA 4BAOB 2BD2A 1GGDB 3ZVFA 1ZMNA 3LGIA 3SNAA 4INLA 1C1WH 1GI2A 2VIWA 2FTMA 3P17H 2Y5FA 3MU4A 2GD4B 4INKA 2F9UA 1O33A 1QB1A 7GCHG 2ZDKA 1O2SA 3FP8E 3Q00A 2AMDA 1SMFE 1F92A 2AS9A 3UWIA 1HXEH 3ATIA 5J4QA 1EOLA 1O5GH 3BSQA 4J2YB 1YCPM 1MD8A 1OWKA 4ZH8A 1WTGH 3DA9B 1W7XH 1BHXF 1O34A 2XCNA 5DP5A 4TPYA 3TGJE 1NS3A 2BX3A 2PHBA 1GCTC 1TPAE 1J17T 1S5SA 1V2KT 3FANA 1VGCB 3E3TA 5GWZA 5DP7A 3QX5H 3GDVA 1SGNE 2NU2E 4AYVB 1OS8A 4YO9A 4IS5A 1H9HE 1GGDC 2IPHA 5EGMA 2P95A 4KTUA 1Y3UA 2OBOA 2OBQA 2TGTA 4D7GA 1W11U 1DSUA 1RD3B 2ZGBH 1QA0A 5ABWA 1QRZA 1EJNA 2ZHWH 2ZTXA 2GDEH 1GMHG 1T4VH 1SGFG 3U8RH 1TOCB 1MKXK 3UUZA 2PUQH 3F1SB 1DLEA 2FOMB 4YOGA 1F0TA 4AB9A 2VH0A 1C5SA 2FOEA 2FIRH 1HAYB 3SJKA 1BBRK 3DUXH 4BNRA 3UTUH 5E0GA 3PLKA 2ZFSA 1KDQA 4QT8C 1FUJA 1CHGA 1E37B 1UK3A 1GBEA 1C4Y2 1OX1A 3F9EA 3VB7A 4CH8B 4ABJA 3UWJH 4X8VH 1GVZA 5L30H 3A89A 1OWIA 2BQ7B 1P10A 1VGCC 2H6MA 3F68H 3MTYA 1GJBB 3BTFE 2SFAA 3PLBA 1EB1H 2FX4A 1RS0A 1GBDA 4TPIZ 1WQVH 3CS0A 1TRMA 3ZZ3A 4WY3A 1KXFA 1GBLA 1QBVH 4CR5A 1V6DA 4IGDA 3SV2H 4I33A 4GPGA 1PFXC 4E7NA 1AGJA 1GHBF 1XMNB 5C1UA 4SGBE 2BY9X 3RLYH 4MVNA 3UOUA 3ZZDA 1IQMA 4AFSA 2R2WU 2FESH 3RXAA 1UVSH 4GLYA 4DOQA 1J15A 1TQ0B 1V2NT 2O9QA 4MNXA 3LGUA 1LHFH 4Z6AH 2SGDE 1P9SA 2ZDAH 4AX9H 2OQUA 1QJ7B 1DWCH 1P8VC 3MO6A 1GDQA 1SLUB 1AUJA 1SGCA 1P03A 1HJ8A 2FOBA 4BTIB 3NXPA 3LU9B 2ZHEH 2Q6DA 1GHYH 2VJ1A 2LNCA 2G52A 1O3PB 1K1OA 2P16A 2IJOB 4CH2B 1ESTA 5I46H 3OU0A 3Q3KA 3A7VA 4FUGA 5TCCA 1K1JA 2GMTC 2PW8H 1C1SA 2Y5HA 2C8XB 2Q6FA 1UMAH 1V2OT 1EZQA 3SNBA 4MNVA 1NZQH 1K22H 4NCYA 3KNXA 4B2CA 1L4DA 1TMUH 5JBBS 5E2OA 4JMYA 4AG2A 5K0HA 1O3IA 1NFUA 3SU2A 1LQEA 2FYRA 2H2ZA 2A2QH 1GJDB 4KP0A 2G4UA 1HBTH 4NWKA 5EG4A 1HUTH 1L1NA 1L1JA 3SGBE 3ZZ6A 3DT0H 1ZMJA 3SUGA 1O32A 3E16B 3NZIA 6CHAB 1HFDA 3MI4A 2V0BA 1W8BH 5GDSH 3T5FH 5JBCS 2AEIH 4ABBA 3RXKA 1A0HB 1CVWH 2ZKSA 1FAKH 1ZPBA 2EC9H 4MPWA 2YNAA 2WPKS 1RGQA 1BTYA 1TABE 1TQ7B 1WOFA 1SFIA 4UD9H 1BRUP 2QXGA 3U1IB 3BTQE 1E38B 1QURH 1DT2A 2PSXA 3EAJA 1YLDA 3E91A 4ZXXH 2Y7ZA 3O8BA 4K1TA 1C5YB 1O2KA 3G01A 3QN7A 3OYPA 3M3SA 1F0UA 1TX7A 3TK9A 4NGAH 1UCYH 4F49A 3ZV9A 1TGCA 1O3FA 3BV9B 4D7FA 8LPRA 2AFQB 2HVXA 3T2NA 4Q80A 1C5PA 2Z9IA 1CA8B 2ZCHP 6CHAC 4CHAB 3ZYEA 4YM9A 4GHQA 1GJ5H 3M7QA 1NFWA 1PQAA 2BLOA 1NTPA 1WU1A 3RXPA 1K2I1 4I8LA 2WUBA 3L6PA 4AGKA 2RCEA 3KQDA 3VEQB 3V12A 1SL3A 2WPMS 2PGQB 1GJ8B 4JZDH 1MQ5A 2ZGJA 4J1YA 4OS6A 1C1QA 1E35B 2A45B 1QJ6B 3O8CA 1C5LH 1C5WB 3QTOH 4WVPE 1O2MA 2BXUH 2CF8H 1TGTA 5C5OA 3ZVEA 1DPOA 1FQ3A 3UR6A 1YPEH 2OCVB 3MU5A 1VCPA 2QF3A 2QXHA 1SGFA 5FAHA 1IHSH 1F2SE 2ZI2H 2HNTC 2A5IA 1C5XB 1TPOA 2TIOA 4K8YA 1ABJH 3A7XA 1HAZB 3TK6A 3U69H 1GMCF 1SGEE 2A32A 2JETB 1P57B 1O2TA 3VXFH 2G55A 1GBBA 1UCYE 1O3MA 3DHKH 4XSKU 1HB0B 3MH6A 1MAXA 2Y82A 3BEFB 1D3TB 4MNYA 3RUOA 4CHAC 1GDUA 4NIYA 5T6DA 2VWNA 4IBLH 2W26A 1GJAB 2A7HA 2BD9A 2SGEE 1O2UA 3AASA 4WWYA 3BN9A 1LHCH 4Y7BA 3RXMA 2AGEX 2JH0D 4BTUB 2VH6A 2AIQA 2WPLS 1Y59T 2ZTZA 1UHBA 1IQGA 2XW9A 1LVYA 4X6NA 3MNSA 2R3YA 3MNXA 4DT7B 1GMDG 3KEEA 3TLOA 1SGPE 4K8BA 1ANDA 4X1QU 1YCPK 2A2XH 1O3AA 2ZNKH 1TNLA 4XBCA 3RXEA 3A84A 1P2QA 4A1TA 1W14U 1FIWA 3IWMA 3FP7E 4ABHA 3D62A 1O0DH 4RKOB 2QAAA 1SLXB 5A8ZA 4NSYA 1FLEE 1Z8GA 2JETC 1MKWH 4BXWA 1GL0E 1GI5A 3RXTA 4JYTA 3TH2H 3S9BA 4CRCA 2RG3A 2FYQA 3ZVAA 3A7WA 3PTBA 4ABDA 2J95A 1Q3XA 1TMTH 1AI8H 1THPB 1O2ZA 2OC8A 3H7TA 5JBAS 2G00A 1DE7H 4ABIA 1L2EA 4XBDA 4FUJA 2J4IA 1GHAF 3TJOA 1BMNH 1O3KA 1K28D 1YPLH 4JZIA 4UEHH 1O3CA 3FZZA 1AFQB 2WPHS 1C4U2 2NU3E 3HGNA 1O2QA 3STJA 1C2HA 2BOHB 4R8TB 1OWDA 4Y76A 1LPKB 4FU7A 2EI8A 5SGAE 1GJ6A 2VIVA 4X1RU 1BMAA 3BTGE 1FN8A 1YLCA 3LGWA 1QR3E 3U98H 4H6TA 3GOVB 5DKMA 1GI3A 3A7TA 4LOYH 1TBZH 3RMMH 1ZJKA 3GCTG 1BB0B 4UDWH 3UY9A 1BRCE 1AKSB 4MQAA 2QCYA 2SGAA 4D9RA 1EKBB 2C4FH 3LIWA 2HPQH 5A0AE 2F9BH 5JB9S 3TNTA 1UVPA 1S83A 5F6MA 1MAYA 3SJOA 3P8GA 1P3CA 3S9CA 5GIBA 1BTPA 3SGQE 4BOHA 4LZ4B 1G32B 1C2EA 1GHWH 3ODDA 1PPFE 4WXVA 2GT7A 4KTSA 2FI4E 1EAWA 3ENSB 3LGYA 3UNRA 1KIGH 4B2BA 1QBNA 4YESB 1AFQC 1C1TA 1IQHA 4Q7XA 1AIXH 1CA0B 5JB8S 1DX5M 5C67A 1KXCA 1LHEH 1A46H 2ZQ1A 3SHAH 2FMJA 3MH7A 1B5GH 1BJUA 1V2UT 5A0BA 3RXOA 5C3NA 2VWMA 4ZUHA 2Q1JA 2TPIZ 1D9IA 5T6FA 1EP6A 2A5KA 1QL9A 2SGQE 2QC2A 1UVOA 3B8JA 3KGPA 1HAGE 4HZHA 4HTCH 5A0CA 2WINI 4YLUA 1YPKH 1IQIA 3K2UA 3BIVH 3MNBA 1J14A 1G3DA 5EXNA 1C5QA 3U9AH 4K1EA 3ZZ9A 5TJXA 5DG6A 1C5NH 4Y10E 3RXHA 4OGXA 1ELFA 1Z71A 2C8YB 3GYLB 1AUTC 2XCFA 1DANH 4Q7YA 4HFPB 4DCDA 1DVAH 1O30A 2LPRA 4IC5A 1C1PA 3HATH 2ZZUH 1P2IA 1EASA 2ZCLP 1SGYE 2XTTB 1GBCA 3A87A 5DP6A 3TIUA 1UHBB 3E0NB 1EAXA 3GY5A 1Y3VA 4AORA 1QTFA 4JZFH 4Y8XA 4Y8ZA 3T25A 5TCAA 3RC6A 3AAVA 1YYY1 1HLTH 3UQOA 1W3CA 1O2RA 1UTQA 2FX6A 5DO4H 3OY5U 1NFYA 5EU8A 3TJNA 2OLGA 3SI3H 3URCA 4LK4A 1FY8E 4U32A 4M7GA 3UNQA 2ZU2A 3A85A 1BDAA 3TK5A 5JPMH 1YM0A 1PPHE 4O3UA 1C2MA 1SLWB 4VGCB 5F03A 2M5TA 2ESTE 3PMBB 1C2IA 2Z6BD 2EI6A 2ZPRA 1P0SH 3GCOA 5JDUB 4MDSA 4H6SB 2FEQH 2VWOA 1EJMA 1MBMA 3UQVA 1FN6A 3PYHA 3BEUA 1ZGVA 1GHBG 2BB4A 5FCKA 2G51A 1O3GA 2TGPZ 2P59A 1Q2WA 3RMNH 1SGRE 2D8WA 2ZU4A 1Y5AT 2G81E 1VR1H 1TBQH 3FP6E 4GSOA 1JMOH 5EW2H 1CQQA 1O3NA 1EX3A 1F5LA 1IQEA 2VIDA 5L2ZH 3LC3A 1HAHH 1V2RT 4X1PU 1CBWB 1LPZB 1UO6A 4RSPA 2W5EA 1FAXA 1S6HA 1DXPA 5LPRA 4MPUA 5FCRA 4NA9H 1Y3XA 4ZKRU 3RXBA 1CGHA 4B2AA 1WBGB 1TWXB 4OS4A 4WJG2 2RDLA 3LDXH 2Z94A 3NKKA 4VGCC 1XXDA 3F9FA 5H4IB 4XBBA 1DM4B 1T32A 1TPSA 1TOMH 4DGJA 1PPBH 1MUEB 2Z3DA 3V0XA 2UUFB 3MNCA 1J8AA 2H9EH 2VB0A 3HPTB 4NSVA 2BVSH 4ISNA 3SU0A 4IMZA 3RMOH 2Z9LA 4IC6A 5IDKA 2H5CA 2AMPA 3RC4A 1G36A 4GCHF 4LZ1H 2TGDA 2VIOA 3A82A 1HIAB 2BVXH 3EA8A 1F0SA 2FS9A 2P3FH 5BPEA 1Y3WA 1FY1A 1WV7H 1BTWA 4X6PA 3R0FA 3LKWA 2QY0B 2WUCA 2ANMH 3SGAE 1CGIE 1CBWC 4JK5A