2KAIB

Refined 2.5 angstroms x-ray crystal structure of the complex formed by porcine kallikrein a and the bovine pancreatic trypsin inhibitor. crystallization, patterson search, structure determination, refinement, structure and comparison with its components and with the bovine trypsin-pancreatic trypsin inhibitor complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
152
structure length
152
Chain Sequence
ADGKDYSHDLMLLRLQSPAKITDAVKVLELPTQEPELGSTCEASGWGSIEPGPDDFEFPDEIQCVQLTLLQNTFCADAHPDKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWIDDTITENP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KALLIKREIN A
publication title Refined 2.5 A X-ray crystal structure of the complex formed by porcine kallikrein A and the bovine pancreatic trypsin inhibitor. Crystallization, Patterson search, structure determination, refinement, structure and comparison with its components and with the bovine trypsin-pancreatic trypsin inhibitor complex
pubmed doi rcsb
source organism Sus scrofa
molecule tags Complex (proteinase-inhibitor)
total genus 29
structure length 152
sequence length 152
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 1984-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2kaiB00
4XSKU 3RXIA 3O8CA 3LGWA 2XWBI 5F6MA 5FPSA 3M5LA 3AW0A 4HZHA 1AVXA 1A5IA 1FLEE 1OWHA 3LGYA 2Z94A 4I8KA 1A7SA 1EZXC 1VGCC 3AAUA 3MNCA 4QT8C 5FCRA 1EASA 1WTHD 1YBWA 2AS9A 4MTBA 1KSNA 3U1IB 2FXRA 1RTLA 3SJOA 1Y3YA 1EPTC 1KXEA 2CMYA 4I32A 2ZHDA 1NPMA 2ZHEH 3PO1C 1MTNB 3M3VA 2PGQB 1C5UA 3P8FA 1QB9A 3RXRA 1S5SA 1WU1A 5K0HA 1UK4A 4GUXA 5A8XA 3PWCA 1ZPZA 2HLCA 1O35A 2SNWA 3TNTA 2ODQA 3VGCC 2BDYA 2BD4A 3VXEH 2FX4A 2G51A 1PQAA 3F68H 1OWEA 3NKKA 2ANWA 2ZU5A 3KQBA 2BD5A 4XE4A 4FVDA 4WF8A 1OWIA 3EQ0H 4IN1A 3SNBA 1V2LT 5A0AE 3RUOA 1BTHH 2ZGJA 1CBWC 3PM3A 3ZZBA 1AE5A 2VIPA 1N1LA 2Z3CA 1NN6A 3UOUA 1TNLA 2OLGA 2FP7B 4A92A 3ATIA 1BOQA 3KQEA 4ZHMU 2J9NA 3UWIA 2OC0A 1TPPA 4ESTE 2BD2A 2FEQH 1UTLM 1YYY1 2ZI2H 1HAPH 3TJVA 2BY5X 2ZTXA 4MQAA 2BDCA 1AO5A 1G3DA 2B0FA 3KNXA 4IN2A 1O34A 2PLXA 4K2YA 2HPQH 3Q00A 1SGFG 1ETRH 3KQDA 1BA8B 1T8LA 2GCTC 3DD2H 1DUAA 4FVBA 5FX5A 4CRCA 1C2LA 1ABIH 1XKAC 5DGJA 1L4ZA 4JYTA 4XDEA 1AMHA 1TGNA 1AWHB 1W14U 1YC0A 2GTBA 4RKOB 4Y8YA 3P95A 2ZC9H 2FX6A 1P01A 2OP9A 1GHBG 4R8TB 3LGIA 1BIOA 3LGVA 1SGDE 4Z6AH 3EGKH 5L6NH 3FANA 4KGAA 2HNTE 2Y5GA 2ZFTA 5CHAB 3P8GA 3RU4E 4CRBA 1RIWB 4FUCA 3TGKE 4UFEH 2RG3A 4K3JA 2PGBB 5CMXH 1AKSB 1TPSA 3ZZAA 2VGCB 3S9BA 2VIOA 1C1MA 1RXPA 2FOCA 4AB8A 1C1WH 2PHBA 1HV7A 1IQFA 1TNIA 1GI5A 1G32B 1C4U2 1G3EA 1F5RA 1H4WA 3VB5A 1BRCE 3KQCA 1HXEH 1K1NA 1O39A 3RP2A 3SNCA 4ZKOU 1NROH 1TMTH 7GCHF 1O2TA 3GOVB 1AI8H 3SV7A 3RXUA 4CHAC 3A7XA 2RA0A 4CH2B 4K1TA 1MKWK 1J8AA 3LJJA 3L6PA 1BJUA 3DT0H 3E3TA 3RXSA 4ZH8A 2WV5A 4GHQA 4Y79A 5DJ7A 1H9LB 1KTSB 4OS5A 4KELA 2QIQA 1WOFA 2G4TA 1BB0B 3PYHA 1ZSKA 3GCTF 1GPZA 4E06H 4Y6DA 2SGFE 3K6ZA 5A0CA 4WMDA 1FNIA 1MTSA 2OQUA 1SGCA 8LPRA 3GICB 1MTVA 2Y7ZA 2Z9IA 1QRXA 3K2UA 1NRQH 1KXCA 2ODPA 5E2PA 3BTGE 4ZXXH 2LPRA 1SI5H 1ZSLA 3KEEA 4FUDA 3SU0A 4IS5A 1CVWH 2ZF0H 1CGJE 5E0JA 2F83A 1ZLRA 2BDIA 1XVOA 1Z8IB 5DP7A 1TX8A 2J94A 3BTHE 1AFQC 2CF8H 1QJ7B 5DPAA 1PPBH 2G81E 1S85A 4YLQH 3F9GA 3MOCA 1MU6B 2GVFA 3UR9A 3NUMA 1AHTH 3MNXA 1A3BH 1JMOH 4I7YH 4A6LA 1AD8H 1QCPA 1SL3A 1G36A 1GMCF 2XCFA 2V3HH 2BVSH 4OS2A 1V2KT 3M3TA 2Z6BD 3H7TA 2A31A 1AVWA 1K2I1 3U9AH 2A4RA 1L1GA 3BG4B 1DPOA 1F92A 1SR5C 1EOJA 4NIXA 1IHTH 2FI5E 4KP0A 1QRZA 1C1OA 2CJIA 4DURA 3MMGA 2P8OC 2I6QA 2R2WU 1W7GH 1XX9A 3NPSA 3P17H 4CH8B 2QA9E 1VCWA 2ANYA 5JYIA 2NU0E 3ATLA 1GCDA 2A45B 1NRNH 1LVBA 3UQVA 2FO9A 1LVYA 1MAXA 1W13U 1ESTA 1WSSH 2Y81A 4IC6A 4X6PA 1QB6A 1S6HA 4X2XA 4YZUA 3SNDA 1C1UH 4MNXA 1SMFE 2AMQA 1OSSA 3E91A 5AFYH 3PTNA 5GIBA 4R0IA 2ZDNA 1HAOH 5ESTE 1JBUH 2W3IA 2W5EA 5JB8S 4NIVA 1T7CA 1LPZB 1Y3XA 4SGAE 1TRNA 1C9PA 3RXVA 4J1YA 2AYWA 3SGBE 2ZGHA 1Z6JH 2P95A 1FY8E 1TYNA 5DG6A 1AUTC 2GDDA 1P0SH 2P3UB 5HM2A 1HGTH 3GYMA 2C3SA 1LO6A 2SGAA 1WV7H 4DIIH 3ZVAA 1J16A 2VIQA 1O2ZA 1FY5A 3AASA 3FP7E 2ESTE 1ELBA 1THSH 1OS8A 1O2SA 1KXFA 1OOKB 1CA0C 1BRBE 1DVAH 4B74A 1O38A 4CRAA 1A2CH 4JZDH 1P04A 5GPIB 1DY9A 1GL1A 1GGDC 1GJCB 2G00A 1DXWA 3M37A 3MH4A 3SNEA 1XUJA 4DCDA 3RXMA 1ARCA 1SGPE 4K8YA 1BHXB 2JKHA 3RXGA 1F0SA 4VGCC 4NCYA 1IQNA 1ZRBA 4UONA 3GYLB 1IQLA 1C1QA 1PFXC 1WTGH 2OXSA 3M3SA 3QZQA 5EGMA 3SW2B 1P9SA 2PUXB 2GX4A 5DP3A 1UTJA 1GVKB 1GBKA 3LOXA 1E37B 4HFPB 1J9CH 5EW2H 3M36A 1G3CA 1AFEH 1OPHB 3DUXH 3PB1E 1PPFE 2F3CE 2BLVA 2AGGX 2BMGB 4DJZB 2ZCLP 4B76A 3MYWA 1PPGE 2SGQE 1S6FA 4CREA 8KME2 1BTWA 4IMZA 3P6ZB 1TGCA 1GG6B 1LCYA 4OS7A 4MPXA 1PYTC 3ZZ5A 2TIOA 3A7YA 3PTBA 4DGJA 1AKSA 6CHAB 3QK1A 1RFNA 2PKSC 1UCYH 1OXGA 1SOZA 3AW1A 4X6OA 1OWKA 4AX9H 4GLYA 1LKAA 4ISOA 3BIUH 2ZCKP 2ZKSA 2B7DH 2PW8H 4D76A 1GI1A 1ESBA 3T62A 1F7ZA 2QXGA 3SQHE 2ZDMA 4X1SU 3RMOH 1SLVB 1G37A 3SHAH 2A2QH 2BY6X 1ANEA 3VB6A 1NU9A 3ZZDA 1LPKB 4TPIZ 1HPGA 4NSVA 3E1XB 1MCVA 1AU8A 2RCEA 3E6PH 2O8LA 5C67A 2BDGA 4HI3A 1HXFH 4F4OC 1P09A 1O2RA 4E05H 1BUIA 3WY8A 1SLXB 2XNIA 2BVRH 2G4UA 3C1KA 3MH6A 3MTYA 3BSQA 3LONA 1V2QT 1GBHA 1DX5M 1W2KH 1ELDE 2BHGA 3ZZ3A 1FZZA 3KGPA 1Z6EA 2Y5HA 1FN8A 5G4BA 3GDVA 1TA6A 4CRDA 4BAQB 3SU2A 1SGNE 5C5OA 4IGDA 4ASHA 5C1UA 3S9CA 4DOQA 3TGJE 2GT7A 3AVZA 2QN5T 3RC6A 3U98H 1D9IA 3D23A 1XMNB 3ITIA 1V2JT 1Z8GA 3I78A 1GJ7B 2Z9LA 2BVXH 1Z71A 4U32A 1GBEA 2BY9X 1P05A 2EI7A 4TWYA 1VR1H 2H9HA 1C2GA 3GCNA 2W3KA 3H5CB 1MTWA 1NTPA 5GCHG 1Q3XA 5L30H 1CHOF 4ABDA 3ESTA 5A2MH 3ZYDA 5L2ZH 4O9VA 2WPMS 1SGYE 4I31A 2ODYB 2BOHB 3RMLH 7ESTE 2A0QB 1HUTH 3ZVDA 1BTYA 1DM4B 2XCNA 2FLRH 5ESBA 1O5EH 1HAZB 1ZGVA 4MNVA 1QL8A 1ESAA 1P3CA 1HJAC 4I8GA 2OBQA 2Y7XA 3U8TH 1O3OA 3M5OA 2B8OH 4ABBA 1S0RA 3FZDA 3RXKA 1OP8A 5E0HA 5EQSA 5F8ZA 2AGIX 1AZZA 1RS0A 3RXAA 3MO6A 1N6XA 2W26A 1EJMA 2PSYA 4K1EA 3BTME 1C2IA 1EJNA 1TGBA 2A4GA 1SQAA 3VB7A 1FI8A 2BB4A 4TY6A 1W0YH 4FUBA 5JBCS 4JYUH 3Q76A 4NG9H 1BMLA 3TK5A 3OYPA 2PFEA 3HGPA 1M9UA 2F9UA 3UY9A 5EU8A 1AN1E 4XFQA 5A09A 3UR6A 4ABGA 1VITH 3SU1A 1G2LA 3PWBA 1YLDA 1RJXB 1C2EA 1K28D 1E38B 2C4FH 5DP9A 2H2ZA 3S0NA 1RGQA 5JPMH 2VH6A 2H5DA 1TPAE 1AIXH 3SV8A 3VXFH 4WH8A 3ATMA 4GVUA 2ZWLH 2XWAA 1FDPA 3EE0B 1W10U 3LIWA 2WUBA 4Y11E 3L33A 1NZQH 2O8TA 2FOMB 1FQ3A 2ZFSA 4Y8XA 4X8TH 1RTFB 4Q2KA 1D3QB 1QNJA 3RXCA 1GVZA 2ZU3A 1LHEH 1HAXB 1ID5H 2OC1A 5C1YA 2FOEA 1V2RT 1AZ8A 3CS7A 2F9PA 1W8BH 4TPYA 1GMDG 3MNSA 4NWKA 1E35B 5TCCA 4TWWA 4ABEA 1UVTH 1TAWA 2PUQH 4AG2A 3RXJA 1QJ6B 3QDZB 5AVDA 1CT0E 3R0FA 4XBBA 2CXVA 2GMTB 4U2WA 4AORA 1FMGA 4WMFA 1A0JA 3UREA 1F0RA 2PSXA 1GJ9B 4AGKA 5FPTA 1HJ9A 4BTUB 1ZOMA 3NXPA 4ZAEA 3TIUA 1PJPA 1GBCA 3OY5U 2CV3A 2JETB 1FY1A 1XKBC 2A7CA 1GI8B 1NFXA 1PPHE 2NU1E 4WJG2 1UCYK 3Q77A 3TJNA 4X8VH 1O3DA 1NO9H 2R0LA 3D65E 4OGYA 3SZNA 1UHBB 2C8XB 1T32A 2R3YA 1O3IA 4KTCA 3FAOA 3S7KB 2C90B 4WH6A 3LPRA 4K5ZA 1C5TA 1BMNH 1H8IH 1EP6A 1HIAB 1F0TA 1VGCB 1GBLA 3A7TA 3F9FA 1T31A 3OU0A 1O3BA 1UO6A 5JBBS 1NU7B 2ALVA 2ALPA 3D62A 3DFJA 1ZR0A 1EPTB 4Y7BA 3HGNA 2ZPRA 3LGUA 2P3FH 4NZQA 2BLQA 3PO1B 3T25A 2QF3A 2Y5FA 1SG8B 3UIRA 4X8UH 2G8TA 1CE5A 6GCHG 2FMJA 3AAVA 3VGCB 1GJBB 1BITA 1NRPH 1L2EA 1NFUA 4AZ2B 4UDWH 5T3HA 1EOLA 1AGJA 4E7NA 1GWAA 4LK4A 1O3JA 3ZZ4A 4H6SB 1DWCH 1WCZA 2VWMA 1TLDA 3VPKA 1YPLH 5F03A 1CBWB 1U6QA 1ZTKA 2DUCA 2SFAA 1HJ8A 1Y3UA 1CHGA 1MBMA 1ELAA 2P16A 5LH8A 2CGAA 1TBZH 4Z0KA 5FPYA 1DITH 1MBQA 8GCHF 1O2YA 3RXQA 4AOQA 1EAXA 1W0ZU 4IBLH 3E90B 1H9HE 4CR5A 2LNCA 5EXLA 4NIWA 4ZKNU 4ABAA 2ZZUH 1B5GH 1Z7KA 1ZZZA 5FXLA 1SFIA 1GJDB 2GCTB 5TJXA 4AFZA 3RU4T 1ANDA 3B8JA 1O0DH 3SJKA 4AFUA 1UK3A 2A7HA 3BF6H 1ZMNA 3RC5A 1V6DA 4X1RU 3SV6A 1QA7A 1O5AB 4LZ1H 1KLIH 1ZMJA 1Y3WA 4XBCA 5FCKA 1GBAA 1UTKA 2UUFB 1MU8B 1K1LA 2V6NA 2XTTB 1GVLA 1TX6A 2QYIA 3SUGA 2FIRH 3ZVBA 1H8DH 3SQEE 3RXEA 5EQQA 3O8DA 4JK6A 3KL6A 3SV2H 3T26A 4BTTB 1C1VH 1C5YB 5LPEA 4JZEH 1O2OA 2KAIB 3TLOA 2J4IA 3M5MA 3QLPH 2A1DB 5GWZA 2UWPA 7LPRA 1GDQA 3SGAE 3MU0A 4NA8A 1O3FA 3UOPA 4A7IB 1VJAU 3QGNB 2ZDAH 2NU2E 4FXGH 2BY8X 2Q6FA 3MHWU 5GCHF 1A5HA 1A46H 1S82A 4YOJA 2O8WA 1O3CA 4B71A 1ZPCA 1QIXB 1TOCB 3TJOA 4CHAB 3PMJA 1SQOA 2ANMH 1C5SA 1CU1A 4K60A 1T8MA 2BD8A 2VWLA 2F9NA 5DKMA 3BTFE 2ZO3H 1FY3A 1HAGE 1ANBA 1O5CB 1EAIA 2GV6A 1HAVB 1O2IA 3HATH 1LTOA 4YOIA 2W7SA 4AGJA 3ZYEA 3QX5H 1FJSA 3BTDE 1YPKH 5F8TA 3SU6A 3A88A 1HAIH 1NESE 3U1JB 1AB9C 1BBRE 3A83A 3TVJB 4ABIA 3D49H 9ESTA 1F2SE 2SNVA 2A32A 2PV9B 1PPCE 2STBE 3LC3A 1IAUA 4I8HA 2FESH 5C2ZA 3TK6A 2C8WB 4CBOA 3ZVEA 1TB6H 2C8YB 1G2MA 2A4OA 1EUFA 4F49A 2V3OH 2VVVA 1KLJH 2Z3DA 1AFQB 4A1TA 4FU9A 3SU5A 2G55A 1HCGA 4ZUHA 3Q3YA 1GCTC 2UUYA 1C9TA 3S7HB 1DICA 1SLUB 1W11U 3Q3KA 1JIRA 3PMBB 2GZ9A 1D6WA 4MPWA 1D3TB 2WUCA 1WQSA 1SGIB 4O03A 3NZIA 3FZZA 5EXNA 2A4QA 1FAXA 4ZROA 2FODA 4Q7XA 5E2OA 1SPJA 3B9FH 1NC6A 4NFFA 1BZXE 1ELGA 2HRVA 1P2QA 2SGDE 2ZFRH 1BCUH 2C8ZB 1A0LA 3GY3A 1V2PT 5C3NA 2P8OB 3A7VA 1HRTH 3E0PB 2TBSA 3GCHC 3ENSB 1UVPA 1GMDF 1GHYH 1SLWB 3RC4A 1C2MA 1O2XA 3TJUA 3BEIB 1CGHA 1V2TT 2ZU4A 3EYDA 1GBBA 2VB0A 5HMAA 1HIAA 4Y71A 4ABJA 4Q7ZA 2OC8A 2XBWA 3ZZ7A 1BRAA 2Y6TA 3SHCH 1C5LH 5JBAS 1PQ5A 3GISB 4CR9A 2BY7X 3IITA 2BD9A 2BXUH 4WMEA 1XUKA 2BM2A 4CRFA 2GDEH 2NU4E 1ZTJA 5DO4H 3HPTB 1O3MA 3MO3A 1YF4A 3EA8A 1UTMA 3RDZA 1C1RA 1CQQA 2EEKA 5DP8A 3O8RA 1LVOA 1SGEE 1C5WB 4TYDA 2DE9A 4H6TA 4YT6H 1Z1IA 1VCQA 3URDA 2ASUB 4DIHH 1ZTLA 3BEFB 3SUEA 1GJ5H 1ZHPA 5LPRA 1GI2A 1TNKA 4ZKRU 3EAJA 3ZZ8A 2PTNA 3MWIU 1QL9A 5EODA 2F9BH 1GI4A 1Y5AT 4A1XA 1JRSA 3UWJH 2TGAA 4MG3A 4XOJA 2UWLA 1DOJA 1BTUA 4YM9A 5C20A 1XUHA 1CA0B 1P10A 1EQ9A 1LQDB 2ZPSA 2GP9B 1LQEA 1ACBE 2FLBH 3UPEA 5ETXA 2VINA 2HGTH 3NK8A 4GAWA 1C5RA 1GGDB 1EP5A 2QAAA 2A5AA 3ZV8A 1XUFA 2O8MA 1BTXA 3E0NB 2XYAA 1D6RA 1WAYB 4VGCB 2XC0A 3P8NA 1MCTA 1X7AC 4BAMB 3RLYH 1TGTA 4X2VA 4O97A 1SGTA 3SU4A 1PQ8A 1FV9A 3UUZA 2ZPQA 4INHA 1OP0A 3IWMA 1UK2A 2J38A 1C5VA 1THRH 4WWYA 3PMAB 1TONA 1GHBF 2JH6D 1ELTA 1O3PB 3EDXB 4UD9H 1TFXA 1ETSH 3BTKE 4AB9A 2Z9KA 1YCPM 3HKJB 1F5LA 4J2YB 4KKDA 3HK6B 3A89A 1ZGIA 1MKXK 2ANKH 1GL0E 1IQJA 2PKSB 2ZHWH 1KY9A 2KAIA 1H1BA 2RDLA 4B1TA 1TBRH 4NA9H 4FUHA 2P94A 1SFQB 2QXIA 1NFWA 1DLEA 3ZVCA 1AQ7A 4D8NA 2D26C 2BLOA 1L1JA 9LPRA 1O36A 2H1UA 4GSOA 1GDUA 2A5IA 4BTIB 1O2UA 2G5NA 2GGVB 1TNHA 3H7OA 3V12A 2ZU1A 4X1NU 3C27B 2J34A 4K69A 5BPEA 4B73A 4BAOB 4AYVB 3F1SB 2QXHA 3FFGA 2VVUA 2C93B 1KDQB 1WBGB 2FTLE 3GDSA 4MPVA 1YPMH 4AFQA 5EOKA 2AERH 1HAVA 3SI4H 1N8OC 1P2KA 2ZDLA 3T27A 2IN2A 4I8JA 2AGEX 3RMNH 3DA9B 1FN6A 2OC7A 3QTVH 3OSYA 3IG6B 1EJAA 3FVFB 5HXFA 2GCHG 1V2UT 1EAWA 3LU9B 1HBTH 1OKXA 4H42U 3RU4D 1MQ5A 2ZCHP 1TX7A 1SBWA 1O2GH 3GY2A 3FP6E 2FYRA 5AHGH 1GJ4H 1TABE 4PROA 1GMHG 2IJOB 1S0QA 1VZQH 4BXSA 2CHAC 3RXTA 2AEIH 3GCTG 1O33A 4FUJA 1GHXH 1EZSC 1TMBH 3A8BA 1C2JA 3P92A 3PROA 6ESTA 4B2BA 5LPFA 1FXYA 3U8RH 1LHDH 2HOBA 4B75A 1BJVA 2GZ7A 3F9HA 3A81A 4D7FA 3ELAH 1O3HA 1EAUA 2FZZA 1J15A 1C1TA 3KCGH 4THNH 3TNSA 4NZLA 4FUEA 1O5FH 1CGIE 1QB1A 4Y10E 3W94A 2TPIZ 4E7RG 2PTCE 1WQVH 1QBOA 1YPHC 2F9VA 1HJAB 1MD7A 3KHVA 3TU7H 2TGPZ 4YESB 2TGDA 1KXDA 3SOSA 4NFEA 1OWDA 1D3PB 2B5TB 3G01A 3TH2H 3LC5A 1KYNA 1O31A 1GDNA 1WYKA 3TH4H 1HLTH 1MTUA 3MH7A 1SQTA 2BX4A 1ZRKA 1MUEB 1HYLA 5J4QA 2ZNKH 2FOFA 4YO9A 2QC2A 1C5QA 2WPIS 3SI3H 1IQKA 4X2WA 1V2VT 1QURH 2J95A 1PPEE 4DG4A 2HPPH 3A86A 2VVCA 1DDJA 2R0KA 2WYJA 1NM6A 3GY5A 1H9IE 1MZAA 2BX3A 1C2KA 4FU8A 3CP7A 1ZHRA 1L1NA 4K8BA 3GDUA 1P12E 1FY4A 1EZQA 2NWNA 2YNBA 5EQRA 3V13A 4FU7A 2BQ6B 2BYAX 4KTSA 3SV9A 5F8XA 2VJ1A 1SHHB 2B9LA 2Z3EA 2ZEBA 1ELEE 1ETTH 4BANB 3SUFA 2IOTA 3O8BA 4Y7AA 2ZA5A 3RXHA 5TCAA 4XBDA 5JDUB 2VH0A 2K1QA 1NT1A 1GJAB 1O2LA 1V2MT 4OS1A 4Q80A 1DLKB 1MTNC 4DW2U 4ZXYH 3PLBA 1Y5BT 1Y59T 2YNAA 3LDXH 3OY6U 4WXVA 1NRRH 2ZG0H 3BN9A 2AIPA 1IQMA 1TNGA 4LXBH 1GI7B 1O3KA 5E8EH 2HVXA 1YLCA 3QO6A 2Y80A 1NFYA 3LGTA 3M7QA 3LKWA 1FONA 1MH0A 3DFLA 1O30A 1KIGH 3HK3B 5EPNA 3T2NA 4LZ4B 1DSTA 3VB3A 1BTPA 4A1VA 1C1SA 1F0UA 1O5DH 1MAYA 4K1SA 1W12U 5IYTA 4AG1A 1BBRH 5B6OA 1GI3A 1T4UH 3E8LA 1ORFA 1OYTH 3MU8A 1Y5UT 2CN0H 2TGTA 4Y76A 4UFFH 1DANH 3UTUH 3NWUA 4RN6A 3STJA 1GBDA 1YKTA 2PKAB 2R9PA 1ANCA 1GBJA 2W7UA 2YOLA 3GY8A 1ZSJA 1C5OH 1K1MA 2FDAA 1AY6H 3M61U 1V2ST 2ZGCA 3A80A 1C1PA 1C2DA 1BQYA 1OWJA 5L2YH 1XUIA 3UNSA 4MNWA 2A2XH 1GI9B 2OINA 2EI8A 1BTZA 2ZHQH 2ZTYA 1EX3A 2OD3B 4B2AA 1YPHE 1DFPA 1O2PA 1DXPA 1Z8JB 2FS8A 3KF2A 1HAHH 2GZ8A 3P8OA 2ZECA 2EI6A 1FUJA 1MZDA 3TK9A 4I8LA 1P11E 2FI4E 5ABWA 1SHYA 1UTOA 3I29A 4DY7B 1KTTB 5A8YA 1IQHA 1TWXB 2BTCE 4X2YA 1TRYA 5CHAC 3B23B 1RIWC 4JZFH 4X6NA 2SGPE 1C2FA 1K1OA 2J92A 2VGCC 2OCVB 4X1PU 1UTPA 1VCPA 4JZIA 1VJ9U 1YPGH 3UFAA 4X6MA 4A5TS 1C5XB 1GHVH 1KDQA 3SBKA 1VITG 3ATKA 2BDAA 3MU5A 1NY22 6LPRA 5AFZH 3SJ8A 4OS4A 1P2NA 5DP5A 1BHXF 4ZHLU 1BDAA 3M35A 2VIDA 3CENA 3Q3XA 1A5GH 1WUNH 1LPGB 3QTOH 2Y82A 8ESTE 1K9OE 2BZ6H 1C4V2 2FI3E 2JH0D 1W3CA 2XRCA 1ABJH 3SNAA 3BTWE 1TE0A 5JBTA 1O2QA 1TPOA 4NA7A 1LMWB 2VIVA 1JWTA 2FOGA 5A0BA 3P70B 1L4DA 1QL7A 1TALA 1QBVH 1HDTH 2D2DA 1QGFA 1JOUB 1UVOA 5H4IB 5HYOA 1UMAH 2ZHFH 5IDKA 1DWEH 3ZV9A 3SJ9A 3QN7A 1MKXH 5SGAE 2BOKA 2VWNA 4INKA 2QF0A 1V2WT 2CF9H 1LHCH 2GCHF 4ZMAH 3ZVFA 3KIDU 1QRWA 1PPZA 1GBTA 3K65B 1XXDA 2R2MB 1TQ7B 1YPEH 1O2WA 1C5ZB 1GMHF 4U01A 1O37A 1A0HB 3MU1A 1P03A 2XW9A 4WVPE 1S84A 4O3UA 3RXOA 3LT3A 1AE8H 1LVMA 2AMPA 1CHOG 1T4VH 4X8SH 1OP2A 3V3MA 3GY7A 1SOTA 4ISHH 4ZKSU 1KXAA 4LOYH 2BZAA 4Y0YE 1TIOA 4GHTA 3BG4C 2M5TA 2ZQ1A 1THPB 1AWFH 2BQ7B 2G52A 1ELVA 5FBIA 3A8CA 1O5GH 5EXMA 5E0GA 2UWOA 4GCHG 1SVPA 1P06A 1UTNA 2P3TB 4RKJB 3ZZ9A 3MO9A 3BTEE 1CA8B 1O3NA 4MVNA 1QY6A 1EXFA 1S83A 1B0EA 1GJ6A 4OGXA 2QV1A 1YCPK 4ISLA 1QQUA 3RXBA 3URCA 3NCLA 2BQWB 2XBVA 3TPIZ 1E36B 1K22H 4YLUA 1CSOE 3ODFA 4AFSA 1AB9B 1MQ6A 5AF9H 1YM0A 1GI6A 1YP9A 4D7GA 3RM0H 2XC5A 1GHAG 2ZQ2A 1NS3A 1TRMA 2V35A 1TNJA 3RM2H 3GY4A 2FYQA 1D4PB 1SGFA 1UVSH 1IOEA 4UEHH 1TA2A 1O32A 2HWLB 1QA0A 3KN2A 1DY8A 1BBRK 5T6GA 1QR3E 1O3EA 1ZJDA 3V7TA 4U30A 1SC8U 1TQ0B 1GCTB 1ZPBA 1PYTD 3TGIE 1O3LA 4AN7A 1GBMA 4BNRA 1UHBA 4JK5A 1EKBB 1Z8RA 3GCOA 1CT4E 4X1QU 2DE8A 4BAHB 2PWXA 1JIMA 3ATWA 3UQOA 5BRRE 5C5NA 2G5VA 1TBQH 5HGGA 1A1RA 1OX1A 4Y0ZE 2VNTA 2ZU2A 5I25A 4M7GA 1QJ1B 5FAHA 3SU3A 1A3EH 2TRMA 3TH3H 1B7XB 1EPTA 2PKAA 1FPCH 3QWCH 4O3TA 5GXPA 1D3DB 3MNBA 3K6YA 1GHZA 1QQ4A 2O8UA 1O3AA 2PR3A 3QGJA 1ZYOA 2ZDVH 1O5BB 1J17T 2FOAA 3GCHB 4DT7B 5C1XA 1A4WH 5GDSH 1BMMH 1LHFH 1ZMLA 4WY3A 4JMYA 1TGSZ 4INLA 1RTKA 2WV4A 1RD3B 5PTPA 2QGRA 2BD3A 1LKBA 1C1NA 3A87A 3ODDA 1O2KA 1C5NH 3MU4A 3PMHB 4ISIH 5DK1A 3MFJA 2BLWA 2VU8E 1L0ZA 1V2NT 4Y8ZA 1JRTA 3OTJE 4NWLA 1GJ8B 3E16B 1XM1A 1J14A 1G9IE 3FP8E 1DSUA 1MD8A 5I46H 1HFDA 1TMUH 2FWWA 1GG6C 6GCHF 1EZUC 3N7OA 1QTFA 2BD7A 6CHAC 2WYGA 2XC4A 5DP6A 5JB9S 3PLPA 3BIVH 4IMQA 3SJIA 1A61H 2GT8A 1DUEA 4BAKB 1ZJKA 2ILNA 2UUKB 1OYQA 1DWBH 1SSXA 3BEUA 4UFDH 2AIQA 3MI4A 3RLWH 2ZFFH 3A7WA 1FIWA 2STAE 1GHWH 3SO3A 4ISNA 1V2OT 3U8OH 1FPHH 3LH1A 1K1IA 2WINI 4B2CA 1V3XA 2Q6GA 4JYVH 3A85A 2ZGXH 2VIWA 1ELCA 1Z1JA 2HNTF 3RXLA 4H4FA 2F9OA 1HAYB 2FOBA 1QFKH 2J2UA 3A7ZA 5DP4A 4FUFA 3STIA 2EC9H 2OQ5A 2A7JA 1GBFA 1SB1H 2ZP0H 1K1PA 4NSYA 3ZZCA 1RRKA 1DS2E 4I33A 4X0WU 3ZVGA 2OUAA 5GJ4B 3T28A 1N6YA 3MH5A 5J4SA 1P2IA 1IQIA 1HB0B 2OBOA 4IW4E 2P59A 1K21H 1VITF 3T29A 2WPLS 1P3EA 3SORA 4CRGA 2GV7A 2ZGBH 3PV4A 1T8OA 8GCHG 4D9QA 1G30B 2GD4B 1XXFA 5FX6A 1DT2A 1E34B 2UUJB 1O2HA 2P93A 3A84A 5T6FA 2A5KA 4BXWA 1CO7E 1O2JA 2FOHA 1SGRE 2SGEE 2IPHA 3I77A 4NIYA 1JXPA 1INCA 1LDTT 2WPJS 3DHKH 1BT7A 2FTMA 1PQ7A 1QHRB 2H9TH 1P2OA 5FHTA 1EB2A 1ZHMA 4JCNA 1C2HA 2XBXA 5EW1H 3BTTE 1T8NA 3RXFA 1O2MA 2Q1JA 3M7TA 2EA3A 2ULLA 4IC5A 3BG8A 2I6SA 1TOMH 4WXIA 1Q31A 4YT7H 3SGQE 1C4Y2 1LHGH 1F5KU 7GCHG 3RXDA 1MMJN 2ZDKA 4KTUA 1G3BA 1KXBA 4NGAH 4FUGA 1ARBA 1AVGH 1IQGA 4MPUA 3RXPA 1XUGA 1AUJA 2AMDA 4UE7H 1KLTA 2OTVA 4RSPA 3T5FH 3L3TA 2JH5D 2QXJA 1ELFA 3ZZ6A 3LH3A 2RA3A 1P8VC 3SN8A 3A8DA 2H9EH 4SGBE 2Z9JA 2O9QA 3UNRA 1P2JA 3A8AA 1E0FD 5K7RA 2XXLA 3JZ2B 2AFQB 1N8OB 1O3GA 2ZFQH 3F6UH 2QCYA 4GPGA 3V0XA 4UFGH 1DWDH 2GKVE 3M5NA 5EPYA 3S69A 1EATA 3UNQA 2V0BA 2BXTH 1P9UA 5T6DA 1SGQE 2R3UA 3OX7U 5HM9A 2BDBA 3QZRA 1Q2WA 4YTAA 5LGOA 1YGCH 3F9EA 4FUIA 1NRSH 4GCHF 3JZ1B 4ZHAA 4D9RA 1UJ1A 2FM2A 3QUMP 2BDHA 7KMEH 1IQEA 3BTQE 2CHAB 4MLFB 2H6MA 3VB4A 4ABFA 3CS0A 1UTQA 1UVUH 1MKWH 2AH4X 4HTCH 3R3GB 1GMCG 4TY7A 3VEQB 3K9XB 1P2MA 3RMMH 1Y8TA 1W7XH 1YPJH 3BV9B 1GI0A 4HGCA 1FIZA 1O2VA 1GHAF 1O2NA 4DVAU 3A82A 4OS6A 3EA9A 1EB1H 1K1JA 4AYYB 1B0FA 3EA7A 2HALA 1CT2E 3SUDA 2F91A 4YOGA 2ZIQH 4CBNA 3LJOA 2D8WA 2THFB 2QY0B 3W95A 2H5CA 2XBYA 1FAKH 4MNYA 3GY6A 1QBNA 2Z9GA 1GBIA 2WPKS 2ZFPH 2NU3E 2Z7FE 5EG4A 2FPZA 1UCYE 3VFEA 3PLKA 1S81A 5CE1A 2GMTC 1C5PA 1HNEE 2HNTC 2FS9A 4BOHA 5FBEA 3M7UA 4Q7YA 1BRUP 1DE7H 1P57B 1IHSH 2D1JA 3HKIB 1P02A 5A8ZA 2JETC 4MDSA 2ZTZA 3S9AA 4ABHA 1C5MD 1YCPH 3TITA 4JZ1A 2Q6DA 1XVMA 2VWOA 1Y3VA 3U69H 2WPHS 1BMAA
chains in the Genus database with same CATH superfamily
4XSKU 1YY3A 3RXIA 3O8CA 3LGWA 2XWBI 5F6MA 5FPSA 1KMHB 2WZQA 3M5LA 3AW0A 4HZHA 1AVXA 2J5UA 1A5IA 1FLEE 1OWHA 3LGYA 2Z94A 4I8KA 1A7SA 1EZXC 1VGCC 2IPQX 3AAUA 3MNCA 4QT8C 5FCRA 5CDFE 1EASA 1WTHD 1YBWA 2AS9A 4MTBA 1KSNA 3U1IB 3F0OA 2FXRA 1RTLA 3SJOA 1Y3YA 1EPTC 1KXEA 2CMYA 4I32A 2ZHDA 1NPMA 2ZHEH 3PO1C 1MTNB 3M3VA 2PGQB 1C5UA 3P8FA 1QB9A 3RXRA 1S5SA 1WU1A 5K0HA 1UK4A 4GUXA 5A8XA 2J98A 3PWCA 1ZPZA 2HLCA 1O35A 2SNWA 3TNTA 2ODQA 3VGCC 2BDYA 2BD4A 3VXEH 1FX0B 2FX4A 2G51A 1PQAA 3F68H 1OWEA 3NKKA 2ANWA 2ZU5A 3KQBA 2BD5A 4XE4A 4FVDA 4WF8A 4Z1MD 1OWIA 3EQ0H 4IN1A 3SNBA 1V2LT 5A0AE 3RUOA 1BTHH 2ZGJA 1CBWC 3PM3A 3ZZBA 1AE5A 2VIPA 1N1LA 2Z3CA 1NN6A 3UOUA 1TNLA 2OLGA 2FP7B 4A92A 3ATIA 1BOQA 3KQEA 4ZHMU 3W1EA 2J9NA 3UWIA 2OC0A 1TPPA 4ESTE 2BD2A 2FEQH 1UTLM 1YYY1 2ZI2H 1HAPH 3TJVA 2BY5X 2ZTXA 4MQAA 2BDCA 3OTPA 1AO5A 1G3DA 2B0FA 3KNXA 4IN2A 1O34A 2PLXA 4K2YA 2HPQH 3Q00A 1SGFG 1ETRH 3KQDA 1BA8B 1T8LA 2GCTC 3DD2H 1DUAA 4FVBA 3H09A 5FX5A 4CRCA 1C2LA 1ABIH 1XKAC 5DGJA 1L4ZA 4JYTA 4XDEA 1AMHA 1TGNA 1AWHB 1W14U 1YC0A 2GTBA 4RKOB 4Y8YA 3P95A 2ZC9H 2FX6A 1P01A 2OP9A 1GHBG 4R8TB 3LGIA 1BIOA 3LGVA 1SGDE 2QF4A 3DSOA 4Z6AH 4YXWD 3EGKH 5L6NH 3FANA 4KGAA 2HNTE 2Y5GA 2CK3D 2ZFTA 5CHAB 3P8GA 5EJ1A 3RU4E 4CRBA 1RIWB 4FUCA 3TGKE 2JIZD 4UFEH 2RG3A 4K3JA 1WDIA 2PGBB 5CMXH 1AKSB 1TPSA 3ZZAA 2VGCB 3S9BA 2VIOA 1C1MA 1RXPA 2FOCA 4AB8A 1C1WH 2PHBA 3OEED 1HV7A 1IQFA 1TNIA 1GI5A 3PV5A 1G32B 1C4U2 4RT1A 1G3EA 1F5RA 1H4WA 3VB5A 1BRCE 3KQCA 1HXEH 1K1NA 1O39A 3RP2A 3SNCA 4ZKOU 1NROH 1TMTH 7GCHF 1O2TA 3GOVB 1AI8H 3SV7A 3RXUA 4CHAC 3A7XA 2RA0A 4CH2B 4K1TA 1MKWK 1J8AA 3LJJA 3L6PA 1BJUA 3DT0H 3E3TA 3RXSA 4ZH8A 5KECA 2WV5A 4GHQA 4Y79A 5DJ7A 5FL7D 1H9LB 1KTSB 4OS5A 4KELA 2QIQA 1WOFA 2G4TA 1BB0B 3PYHA 1ZSKA 3GCTF 1GPZA 4E06H 4Y6DA 2SGFE 3K6ZA 4FOUC 5A0CA 4WMDA 1FNIA 1MTSA 2OQUA 1SGCA 8LPRA 3GICB 1MTVA 2Y7ZA 2Z9IA 2HVYB 1QRXA 3K2UA 1NRQH 1KXCA 2HLDD 2ODPA 5E2PA 3BTGE 4ZXXH 2LPRA 1SI5H 1ZSLA 3KEEA 4FUDA 3SU0A 4IS5A 1CVWH 2ZF0H 1CGJE 4RT0A 5E0JA 2F83A 1ZLRA 2BDIA 1XVOA 1WXRA 1Z8IB 5DP7A 1TX8A 2J94A 3BTHE 1AFQC 2CF8H 2JDID 1QJ7B 5DPAA 1PPBH 2G81E 1S85A 4YLQH 3F9GA 3MOCA 2J97A 1MU6B 2GVFA 3UR9A 3NUMA 1AHTH 3MNXA 1A3BH 1JMOH 4I7YH 4A6LA 1AD8H 1QCPA 1SL3A 1G36A 1GMCF 2XCFA 2V3HH 2BVSH 4OS2A 1V2KT 3M3TA 2Z6BD 3H7TA 2A31A 1AVWA 1K2I1 3U9AH 2A4RA 1L1GA 3BG4B 1DPOA 1F92A 1SR5C 1EOJA 4NIXA 1IHTH 2FI5E 4KP0A 1QRZA 1C1OA 2CJIA 4DURA 3MMGA 2P8OC 2I6QA 2R2WU 1W7GH 1XX9A 3NPSA 3P17H 4CH8B 2QA9E 1VCWA 2ANYA 5JYIA 2NU0E 3ATLA 1GCDA 2A45B 1NRNH 1LVBA 3UQVA 2FO9A 1LVYA 1MAXA 1W13U 1ESTA 1WSSH 2Y81A 4IC6A 4X6PA 1QB6A 1S6HA 4X2XA 4ACAA 4YZUA 3SNDA 1C1UH 4MNXA 1SMFE 2AMQA 1OSSA 3E91A 5AFYH 3PTNA 5GIBA 4R0IA 2ZDNA 1HAOH 4ZCNA 5ESTE 1JBUH 2W3IA 2W5EA 5JB8S 4NIVA 1T7CA 1LPZB 1Y3XA 4SGAE 1TRNA 1C9PA 3RXVA 4J1YA 2AYWA 3SGBE 2ZGHA 1Z6JH 2P95A 1FY8E 1TYNA 5DG6A 1AUTC 2GDDA 1P0SH 2P3UB 5HM2A 1HGTH 3CNRA 3GYMA 2C3SA 1LO6A 2SGAA 1WV7H 5HKKD 4DIIH 3ZVAA 1J16A 2VIQA 1O2ZA 1FY5A 3AASA 3FP7E 2ESTE 1ELBA 1THSH 1OS8A 1O2SA 1KXFA 1OOKB 1CA0C 1BRBE 1DVAH 4B74A 2LP6A 1O38A 4CRAA 1A2CH 4JZDH 1P04A 5GPIB 2WV9A 1DY9A 1GL1A 1GGDC 1GJCB 2G00A 1DXWA 3M37A 3MH4A 3SNEA 1XUJA 1H8ED 4DCDA 3RXMA 1ARCA 1SGPE 4K8YA 1BHXB 2JKHA 3RXGA 1F0SA 4VGCC 4NCYA 1IQNA 1ZRBA 4UONA 3GYLB 1IQLA 1C1QA 1PFXC 1WTGH 2OXSA 3M3SA 3QZQA 5EGMA 3SW2B 2YMSD 1P9SA 2PUXB 2GX4A 5DP3A 1UTJA 1GVKB 1GBKA 3LOXA 1E37B 4HFPB 1J9CH 5EW2H 3M36A 1W0KD 1G3CA 1AFEH 1OPHB 2WHXA 3DUXH 3PB1E 1PPFE 2F3CE 2BLVA 3WWBA 2AGGX 2BMGB 4DJZB 2ZCLP 4B76A 3MYWA 4ASUD 1PPGE 2SGQE 1S6FA 4CREA 8KME2 1BTWA 4IMZA 3P6ZB 1TGCA 1GG6B 1LCYA 1YLNA 4OS7A 4MPXA 1PYTC 3ZZ5A 2TIOA 3A7YA 3PTBA 4DGJA 1AKSA 6CHAB 3QK1A 1RFNA 2PKSC 1UCYH 1OXGA 3N99A 1SOZA 3AW1A 4X6OA 1OWKA 4AX9H 4GLYA 1LKAA 4ISOA 3BIUH 2ZCKP 2ZKSA 2B7DH 2PW8H 4TT3D 4D76A 2WPDD 1GI1A 1ESBA 3T62A 1F7ZA 2QXGA 3SQHE 2ZDMA 4X1SU 3RMOH 1SLVB 1G37A 3SHAH 2A2QH 3F2GA 2BY6X 1ANEA 3VB6A 1NU9A 3ZZDA 1LPKB 4TPIZ 1HPGA 4NSVA 3E1XB 1MCVA 1AU8A 2RCEA 3E6PH 2O8LA 5C67A 2BDGA 4HI3A 1HXFH 4F4OC 1P09A 1O2RA 4E05H 1BUIA 3VG8A 3WY8A 1SLXB 2XNIA 2BVRH 3F0PA 2G4UA 3C1KA 3MH6A 3MTYA 3BSQA 3LONA 1V2QT 1GBHA 1DX5M 1W2KH 1ELDE 2BHGA 3ZZ3A 1FZZA 3KGPA 1Z6EA 2Y5HA 1FN8A 5G4BA 3GDVA 1TA6A 4CRDA 4BAQB 3SU2A 1SGNE 5C5OA 4IGDA 4ASHA 5C1UA 3S9CA 4DOQA 3TGJE 2GT7A 3AVZA 2QN5T 3RC6A 3U98H 1D9IA 3D23A 1XMNB 3ITIA 1V2JT 1Z8GA 3I78A 1GJ7B 2Z9LA 2BVXH 1Z71A 4U32A 1GBEA 2BY9X 1P05A 2EI7A 4TWYA 1VR1H 2H9HA 1C2GA 3GCNA 2W3KA 3H5CB 1MTWA 1NTPA 5GCHG 1Q3XA 5L30H 1CHOF 4ABDA 3ESTA 5A2MH 4Q4LA 3ZYDA 5L2ZH 4O9VA 2OK5A 2WPMS 1SGYE 4I31A 2ODYB 2BOHB 3RMLH 7ESTE 2A0QB 1HUTH 3ZVDA 1BTYA 1DM4B 2XCNA 2FLRH 5ESBA 1O5EH 1HAZB 1ZGVA 4MNVA 1QL8A 3AK5A 1ESAA 1P3CA 1HJAC 4I8GA 2OBQA 2Y7XA 3U8TH 1O3OA 3M5OA 5HIYA 2B8OH 4ABBA 1S0RA 3FZDA 2W6JD 3RXKA 1OP8A 5E0HA 5EQSA 5F8ZA 2AGIX 1AZZA 1RS0A 3RXAA 3MO6A 1N6XA 2W26A 1EJMA 2PSYA 4K1EA 3BTME 1C2IA 1EJNA 1TGBA 2A4GA 1SQAA 3VB7A 1FI8A 2BB4A 4TY6A 1W0YH 4FUBA 5JBCS 4JYUH 3Q76A 4NG9H 1BMLA 3TK5A 3OYPA 2PFEA 3HGPA 1M9UA 2F9UA 3UY9A 5EU8A 1AN1E 4XFQA 5A09A 3UR6A 4ABGA 1VITH 3SU1A 1G2LA 3PWBA 2F4LA 1YLDA 1RJXB 1C2EA 1K28D 1E38B 2C4FH 5DP9A 2H2ZA 3S0NA 1RGQA 5JPMH 2VH6A 2H5DA 1TPAE 1AIXH 3SV8A 3VXFH 4HG6A 3ATMA 4GVUA 4WH8A 2ZWLH 5GNDA 2XWAA 1FDPA 3EE0B 1W10U 3LIWA 2WUBA 4Y11E 3L33A 1NZQH 2O8TA 2FOMB 2XNDD 1FQ3A 2ZFSA 4Y8XA 3SZEA 4X8TH 1RTFB 4Q2KA 1D3QB 1QNJA 3RXCA 1GVZA 2ZU3A 1LHEH 1HAXB 1ID5H 2OC1A 5C1YA 2FOEA 1V2RT 1AZ8A 3CS7A 2F9PA 1W8BH 4TPYA 1GMDG 3MNSA 4NWKA 1E35B 5TCCA 4TWWA 4ABEA 1UVTH 1TAWA 2PUQH 4AG2A 3RXJA 1QJ6B 5CHBA 3QDZB 5AVDA 1CT0E 3R0FA 4XBBA 2CXVA 2GMTB 4U2WA 4AORA 1FMGA 4WMFA 1A0JA 3UREA 1F0RA 2PSXA 1GJ9B 4AGKA 5FPTA 1HJ9A 4BTUB 1ZOMA 3NXPA 4ZAEA 3TIUA 1PJPA 1GBCA 3OY5U 2CV3A 2JETB 1FY1A 1XKBC 2A7CA 1GI8B 1NFXA 1PPHE 2NU1E 4WJG2 1UCYK 3Q77A 3TJNA 4X8VH 1O3DA 1NO9H 2R0LA 3D65E 4OGYA 3SZNA 1UHBB 2C8XB 1T32A 2R3YA 1O3IA 4KTCA 3FAOA 3S7KB 2C90B 4WH6A 3LPRA 4OM9A 4K5ZA 1C5TA 5KEDA 1BMNH 1H8IH 2KCAA 1EP6A 1HIAB 1F0TA 1VGCB 1GBLA 3A7TA 3F9FA 1T31A 3OU0A 1O3BA 1UO6A 5JBBS 1NU7B 2ALVA 2ALPA 3D62A 3DFJA 3FO8D 1ZR0A 1EPTB 4Y7BA 3HGNA 2ZPRA 3LGUA 2P3FH 4NZQA 2BLQA 3PO1B 3T25A 2QF3A 2Y5FA 1SG8B 3UIRA 4X8UH 2G8TA 1CE5A 6GCHG 2FMJA 3AAVA 3VGCB 1GJBB 1BITA 1NRPH 1L2EA 1NFUA 4AZ2B 4UDWH 5T3HA 1EOLA 1AGJA 4E7NA 4F55A 1GWAA 4LK4A 1O3JA 3ZZ4A 4H6SB 2L6OA 1DWCH 1WCZA 3F3BA 2VWMA 1TLDA 3VPKA 1YPLH 5F03A 1CBWB 1U6QA 1ZTKA 2DUCA 2SFAA 1HJ8A 1Y3UA 1CHGA 1MBMA 1ELAA 2P16A 5LH8A 2CGAA 1TBZH 4Z0KA 5FPYA 1DITH 1MBQA 8GCHF 1O2YA 3RXQA 4AOQA 1EAXA 1W0ZU 4IBLH 3E90B 1H9HE 4CR5A 2LNCA 5EXLA 4NIWA 4ZKNU 4ABAA 2ZZUH 1B5GH 1QZ8A 1Z7KA 1ZZZA 5FXLA 1SFIA 1GJDB 2GCTB 5TJXA 4AFZA 3RU4T 1ANDA 3B8JA 1O0DH 3SJKA 4AFUA 1UK3A 2A7HA 3BF6H 1NBME 1ZMNA 3RC5A 1V6DA 4X1RU 3SV6A 3WWFA 1QA7A 1O5AB 4LZ1H 1KLIH 1ZMJA 1Y3WA 4XBCA 5FCKA 1GBAA 1UTKA 2UUFB 1MU8B 1K1LA 2V6NA 2XTTB 1GVLA 1TX6A 2KZ4A 2QYIA 3SUGA 2FIRH 3ZVBA 1H8DH 2VBCA 3SQEE 3RXEA 5EQQA 3O8DA 4JK6A 3KL6A 3SV2H 3T26A 4BTTB 1C1VH 1C5YB 3EE7A 5LPEA 4B6FA 4JZEH 1O2OA 2KAIB 3TLOA 2J4IA 3M5MA 3OE7D 3ZIAD 2A1DB 3QLPH 5GWZA 2UWPA 7LPRA 1GDQA 3SGAE 3MU0A 4NA8A 1O3FA 3UOPA 4A7IB 1VJAU 3QGNB 2ZDAH 2NU2E 2QF5A 4FXGH 2BY8X 2Q6FA 3MHWU 5GCHF 1A5HA 1A46H 1S82A 4YOJA 4DT4A 2O8WA 1O3CA 4B71A 1ZPCA 1QIXB 1TOCB 3TJOA 4CHAB 3PMJA 1SQOA 2ANMH 1C5SA 1CU1A 4K60A 1T8MA 2BD8A 3OAAD 2VWLA 2F9NA 5DKMA 3BTFE 2ZO3H 1FY3A 1HAGE 1ANBA 1O5CB 1EAIA 2GV6A 1HAVB 1O2IA 3HATH 1LTOA 4YOIA 2W7SA 4AGJA 3ZYEA 5C94A 3QX5H 1FJSA 3BTDE 5DN6D 1YPKH 5F8TA 3MQKC 3SU6A 1VKYA 2EY4C 3A88A 1HAIH 1NESE 3U1JB 1AB9C 1BBRE 3A83A 3TVJB 4ABIA 3D49H 9ESTA 1F2SE 2SNVA 2A32A 2PV9B 1PPCE 2STBE 3LC3A 1IAUA 4I8HA 2FESH 5C2ZA 3TK6A 2C8WB 4CBOA 3ZVEA 1TB6H 2C8YB 1G2MA 2A4OA 1EUFA 4F49A 2V3OH 2VVVA 1KLJH 2Z3DA 1AFQB 4A1TA 4FU9A 3SU5A 2G55A 1HCGA 4ZUHA 3Q3YA 1GCTC 2UUYA 1C9TA 3S7HB 1DICA 2JJ1D 1SLUB 1W11U 3Q3KA 1JIRA 3PMBB 2GZ9A 1D6WA 2K0QA 4MPWA 1D3TB 2WUCA 1WQSA 1SGIB 4O03A 3NZIA 3FZZA 5EXNA 2A4QA 1FAXA 4ZROA 2FODA 4Q7XA 2RDEA 5E2OA 1SPJA 3B9FH 1NC6A 4NFFA 1BZXE 1ELGA 2HRVA 1P2QA 2SGDE 2ZFRH 1BCUH 5T1VA 2C8ZB 1A0LA 3GY3A 1V2PT 5C3NA 2P8OB 3A7VA 1HRTH 3E0PB 2TBSA 3GCHC 3ENSB 1UVPA 4P00A 1GMDF 1GHYH 1SLWB 3RC4A 1C2MA 4XD7D 1O2XA 3TJUA 3BEIB 1CGHA 1COWD 1V2TT 2ZU4A 3EYDA 1GBBA 2VB0A 5HMAA 1HIAA 4Y71A 4ABJA 4Q7ZA 2OC8A 2XBWA 3ZZ7A 1BRAA 2Y6TA 3SHCH 1OHHD 1C5LH 5JBAS 1PQ5A 3GISB 4CR9A 2BY7X 3IITA 2BD9A 2BXUH 4WMEA 1XUKA 2BM2A 4CRFA 3FN8A 3DSPA 2GDEH 2NU4E 1ZTJA 5DO4H 3HPTB 1O3MA 3MO3A 1YF4A 3EA8A 1UTMA 3RDZA 1C1RA 1CQQA 2EEKA 5DP8A 3O8RA 1LVOA 1SGEE 1C5WB 4TYDA 2DE9A 4H6TA 4YT6H 1Z1IA 1VCQA 3URDA 2ASUB 4DIHH 1ZTLA 3BEFB 3SUEA 1GJ5H 1ZHPA 5LPRA 1GI2A 1TNKA 4ZKRU 3EAJA 3ZZ8A 2PTNA 3MWIU 1QL9A 5EODA 2F9BH 1GI4A 1Y5AT 4A1XA 1JRSA 3UWJH 2TGAA 4MG3A 4XOJA 2UWLA 1DOJA 1BTUA 4YM9A 5C20A 1XUHA 1CA0B 1P10A 1EQ9A 1LQDB 2ZPSA 2GP9B 1LQEA 1ACBE 2FLBH 3UPEA 5EJLA 5ETXA 2VINA 2HGTH 3NK8A 4GAWA 1C5RA 1GGDB 1EP5A 2QAAA 2A5AA 3ZV8A 1XUFA 2O8MA 1BTXA 3E0NB 2XYAA 1D6RA 1WAYB 2V7QD 4VGCB 2XC0A 3P8NA 1MCTA 1X7AC 4BAMB 3RLYH 1TGTA 4X2VA 4O97A 1BMFD 1SGTA 3SU4A 1PQ8A 1FV9A 3UUZA 3KQ5A 2ZPQA 4INHA 1OP0A 3IWMA 1UK2A 2J38A 2J98B 1C5VA 1THRH 4WWYA 3PMAB 1TONA 1GHBF 2JH6D 1ELTA 1O3PB 3EDXB 4UD9H 1TFXA 1ETSH 3BTKE 4AB9A 2Z9KA 1YCPM 3HKJB 5C17A 1F5LA 4J2YB 4KKDA 3HK6B 3A89A 1ZGIA 1MKXK 2ANKH 1GL0E 1IQJA 2PKSB 3PV2A 2ZHWH 1KY9A 2KAIA 1H1BA 2RDLA 4B1TA 1TBRH 5EJZA 4NA9H 4FUHA 2P94A 1SFQB 2QXIA 1NFWA 1DLEA 1S6LA 3ZVCA 1AQ7A 4D8NA 2D26C 2BLOA 1L1JA 9LPRA 5EIYA 1O36A 2H1UA 4GSOA 1GDUA 2A5IA 4BTIB 1O2UA 2G5NA 2GGVB 1TNHA 3H7OA 3V12A 2ZU1A 4X1NU 3C27B 2J34A 4K69A 5BPEA 4B73A 4BAOB 3PRDA 4AYVB 3F1SB 2QXHA 3FFGA 2VVUA 2C93B 1KDQB 1WBGB 2FTLE 3GDSA 2YMSC 4MPVA 1YPMH 4AFQA 5EOKA 2AERH 1HAVA 3SI4H 1N8OC 1P2KA 2ZDLA 3T27A 2IN2A 4I8JA 2AGEX 3RMNH 4Q63A 3DA9B 1FN6A 2OC7A 3QTVH 2M2AA 3IG6B 3OSYA 1EJAA 3FVFB 5HXFA 2GCHG 1V2UT 1EAWA 3LU9B 1HBTH 1OKXA 4H42U 3RU4D 1MQ5A 2ZCHP 1TX7A 1SBWA 1O2GH 3GY2A 3FP6E 2FYRA 5AHGH 1GJ4H 1TABE 4PROA 4XRNA 1GMHG 2IJOB 1S0QA 1VZQH 4BXSA 2CHAC 3RXTA 2GJGA 2L74A 2AEIH 3GCTG 1O33A 4FUJA 1GHXH 1EZSC 1TMBH 3A8BA 1C2JA 3P92A 3PROA 6ESTA 4B2BA 1SKYE 5LPFA 1FXYA 3U8RH 1LHDH 2HOBA 4B75A 1YWUA 3SYJA 1BJVA 2GZ7A 3F9HA 3A81A 4D7FA 3ELAH 1O3HA 1EAUA 2FZZA 1J15A 1C1TA 3KCGH 4THNH 3TNSA 4NZLA 2PP6A 4FUEA 1O5FH 1CGIE 1QB1A 3PRBA 4Y10E 3W94A 2TPIZ 4E7RG 2PTCE 1WQVH 1QBOA 1YPHC 2F9VA 1HJAB 1MD7A 3KHVA 3UB0A 3TU7H 2KFWA 2TGPZ 4YESB 2TGDA 1KXDA 3SOSA 4NFEA 1OWDA 4AC9A 1D3PB 2B5TB 3G01A 3TH2H 3LC5A 1KYNA 1O31A 1GDNA 1WYKA 3TH4H 1HLTH 1MTUA 3MH7A 1SQTA 2BX4A 1ZRKA 1MUEB 1HYLA 5J4QA 2ZNKH 2FOFA 4YO9A 3OEHD 2QC2A 1C5QA 2WPIS 3SI3H 1IQKA 4X2WA 1V2VT 1QURH 2J95A 1PPEE 3UAIC 4DG4A 2HPPH 3A86A 2VVCA 1DDJA 2R0KA 2WYJA 1NM6A 3GY5A 1H9IE 1MZAA 2BX3A 1C2KA 4FU8A 3CP7A 1ZHRA 1L1NA 4K8BA 3GDUA 1P12E 1FY4A 1EZQA 2NWNA 2YNBA 5EQRA 3V13A 4FU7A 2BQ6B 2BYAX 4KTSA 1H8HD 3SV9A 5F8XA 2VJ1A 1SHHB 2B9LA 2Z3EA 2ZEBA 2K8IA 1ELEE 1ETTH 4BANB 3SUFA 2IOTA 3O8BA 4Y7AA 2ZA5A 3RXHA 5TCAA 4XBDA 5JDUB 2VH0A 2K1QA 1NT1A 1GJAB 1O2LA 1V2MT 4OS1A 4Q80A 1DLKB 1MTNC 2XOKD 4DW2U 4ZXYH 3PLBA 1Y5BT 1Y59T 2YNAA 3LDXH 3OY6U 4WXVA 1NRRH 2ZG0H 3BN9A 2AIPA 1IQMA 1TNGA 4LXBH 1GI7B 1O3KA 5E8EH 2HVXA 1YLCA 1UW7A 3QO6A 2Y80A 1NFYA 3LGTA 3M7QA 3LKWA 1FONA 1MH0A 3DFLA 1O30A 1KIGH 3HK3B 5EPNA 3T2NA 4LZ4B 1DSTA 3VB3A 3U28C 1BTPA 2RFKC 4A1VA 1C1SA 1F0UA 1O5DH 1MAYA 4K1SA 1W12U 5IYTA 4AG1A 1BBRH 3N7EA 5B6OA 1GI3A 1T4UH 3E8LA 1ORFA 1OYTH 3MU8A 1Y5UT 2CN0H 2TGTA 4Y76A 4UFFH 1DANH 3UTUH 3NWUA 4RN6A 5DSFA 3STJA 1GBDA 1YKTA 2PKAB 2R9PA 1ANCA 1GBJA 2W7UA 2YOLA 3GY8A 1ZSJA 1C5OH 5C0UA 1K1MA 2FDAA 1AY6H 3M61U 1V2ST 2ZGCA 3A80A 1C1PA 1C2DA 1BQYA 1OWJA 5L2YH 1XUIA 3UNSA 4MNWA 2A2XH 1GI9B 2OINA 2EI8A 1SQRA 1BTZA 2ZHQH 2ZTYA 1EX3A 2OD3B 4B2AA 1YPHE 1DFPA 2EQNA 1O2PA 1DXPA 1Z8JB 2FS8A 3KF2A 1HAHH 2GZ8A 3P8OA 2ZECA 2EI6A 1FUJA 1MZDA 3TK9A 4I8LA 1P11E 2FI4E 5ABWA 1SHYA 1UTOA 3GS9A 4ACBA 3I29A 4DY7B 1KTTB 5A8YA 1IQHA 1TWXB 2BTCE 4X2YA 1TRYA 5CHAC 3B23B 1RIWC 4JZFH 2AHME 4X6NA 2SGPE 1C2FA 1K1OA 2J92A 2VGCC 2OCVB 4X1PU 4B6EA 1UTPA 1VCPA 4JZIA 1VJ9U 1YPGH 3UFAA 4X6MA 4A5TS 1C5XB 1GHVH 1KDQA 3F2FA 3SBKA 4M9FA 1VITG 3ATKA 2BDAA 3MU5A 1NY22 6LPRA 5AFZH 3SJ8A 4OS4A 1P2NA 5DP5A 1BHXF 4ZHLU 1BDAA 3M35A 3DCLA 2VIDA 3CENA 3Q3XA 1A5GH 1WUNH 1LPGB 3QTOH 2Y82A 8ESTE 1K9OE 2BZ6H 1C4V2 2FI3E 2JH0D 1W3CA 2XRCA 1ABJH 3SNAA 3BTWE 1TE0A 5JBTA 1O2QA 1TPOA 4NA7A 1LMWB 2VIVA 1JWTA 2FOGA 5A0BA 3P70B 1L4DA 1QL7A 2V3MA 1TALA 1QBVH 1HDTH 2D2DA 1QGFA 1JOUB 1UVOA 5H4IB 5HYOA 1UMAH 2ZHFH 5IDKA 5HIZA 1DWEH 3ZV9A 3SJ9A 3QN7A 1MKXH 5SGAE 2BOKA 2VWNA 4INKA 2QF0A 1V2WT 2CF9H 1LHCH 2GCHF 4ZMAH 3ZVFA 4I86A 3KIDU 1QRWA 1PPZA 1GBTA 3K65B 1XXDA 2R2MB 2F43B 1TQ7B 1YPEH 1O2WA 1C5ZB 1GMHF 4U01A 1O37A 1A0HB 3MU1A 1P03A 2XW9A 4WVPE 3N7DA 1S84A 1E1QD 4O3UA 3LT3A 3RXOA 1AE8H 1LVMA 2AMPA 1CHOG 1T4VH 3FKSD 4X8SH 1OP2A 3V3MA 3GY7A 1SOTA 3NRLA 4ISHH 4ZKSU 1KXAA 4LOYH 2BZAA 4Y0YE 1TIOA 4GHTA 3BG4C 2M5TA 2ZQ1A 1THPB 1AWFH 2BQ7B 2G52A 1ELVA 5FBIA 3A8CA 1O5GH 5EXMA 5E0GA 2UWOA 4GCHG 1SVPA 1P06A 1UTNA 2P3TB 4RKJB 3ZZ9A 3MO9A 3BTEE 1CA8B 1O3NA 4MVNA 1QY6A 1EXFA 1S83A 1B0EA 1GJ6A 4OGXA 2QV1A 1YCPK 4ISLA 1QQUA 3RXBA 3URCA 3NCLA 2BQWB 2XBVA 3TPIZ 1E36B 1K22H 4YLUA 4P02A 1CSOE 3ODFA 4AFSA 1AB9B 1MQ6A 5AF9H 3KYFA 1YM0A 1GI6A 1YP9A 4D7GA 3RM0H 2XC5A 1GHAG 2ZQ2A 2KM0A 1NS3A 1TRMA 2V35A 1TNJA 3RM2H 3GY4A 2FYQA 1D4PB 1SGFA 1UVSH 1IOEA 4UEHH 1TA2A 1O32A 2HWLB 1QA0A 3KN2A 1DY8A 1BBRK 3F2HA 5T6GA 1QR3E 1O3EA 1ZJDA 3V7TA 1K0HA 4U30A 1SC8U 1TQ0B 1GCTB 1ZPBA 1PYTD 3TGIE 1O3LA 4AN7A 1GBMA 3DSGA 4BNRA 1UHBA 4JK5A 1EKBB 1Z8RA 3GCOA 1CT4E 4X1QU 2DE8A 4BAHB 2PWXA 1JIMA 3ATWA 3UQOA 5BRRE 5C5NA 2G5VA 1TBQH 3FOAA 5HGGA 1A1RA 1OX1A 4Y0ZE 2VNTA 2ZU2A 5I25A 4M7GA 1QJ1B 5FAHA 3SU3A 1A3EH 2TRMA 3TH3H 1B7XB 1EPTA 2PKAA 1FPCH 3QWCH 4O3TA 5GXPA 1D3DB 3MNBA 3K6YA 1GHZA 1QQ4A 2O8UA 1O3AA 2PR3A 3QGJA 1ZYOA 2ZDVH 1O5BB 1J17T 2FOAA 3GCHB 4DT7B 5C1XA 2IJD1 1A4WH 5GDSH 1BMMH 1LHFH 1ZMLA 4WY3A 2KCOA 4JMYA 1TGSZ 4INLA 1RTKA 2WV4A 1RD3B 5PTPA 2QGRA 2BD3A 1LKBA 1C1NA 3A87A 3ODDA 1O2KA 1C5NH 3MU4A 3PMHB 4ISIH 5DK1A 3MFJA 2BLWA 2VU8E 4FETA 1L0ZA 1V2NT 4Y8ZA 1JRTA 3OTJE 4NWLA 1GJ8B 3E16B 1XM1A 1J14A 2JJ2D 1G9IE 3FP8E 1DSUA 1MD8A 5I46H 1HFDA 1TMUH 2FWWA 1GG6C 5KGOA 1EZUC 6GCHF 3N7OA 1QTFA 2BD7A 3OFND 6CHAC 2WYGA 2XC4A 5DP6A 2QE7D 3PLPA 5JB9S 3BIVH 4IMQA 3SJIA 1A61H 2GT8A 1DUEA 4BAKB 1ZJKA 2ILNA 2UUKB 1OYQA 1DWBH 1SSXA 3BEUA 4UFDH 2AIQA 2WSSD 3MI4A 3RLWH 2ZFFH 3A7WA 1FIWA 2STAE 1GHWH 3SO3A 4ISNA 4RI0A 1V2OT 3U8OH 1FPHH 3LH1A 3WW7A 1K1IA 2WINI 4B2CA 2KCYA 1V3XA 2Q6GA 4JYVH 3A85A 4F48B 2ZGXH 2VIWA 1ELCA 1Z1JA 2HNTF 2KR7A 3RXLA 4H4FA 2F9OA 1HAYB 2FOBA 1QFKH 2J2UA 3A7ZA 5DP4A 4FUFA 3STIA 2EC9H 2OQ5A 2A7JA 1GBFA 1SB1H 2ZP0H 1K1PA 4NSYA 3ZZCA 1RRKA 1DS2E 4I33A 4X0WU 3ZVGA 2OUAA 5GJ4B 3T28A 1N6YA 3MH5A 5J4SA 1P2IA 1IQIA 1HB0B 2OBOA 4IW4E 2P59A 1K21H 1VITF 3T29A 2WPLS 1P3EA 3SORA 4CRGA 2GV7A 2ZGBH 3PV4A 1T8OA 8GCHG 4D9QA 1G30B 2GD4B 1XXFA 5FX6A 1EFRD 1DT2A 1E34B 2UUJB 1O2HA 2P93A 3A84A 5T6FA 2A5KA 3KYGA 4BXWA 1CO7E 1O2JA 2FOHA 1SGRE 2SGEE 2IPHA 3I77A 4NIYA 1JXPA 1INCA 1LDTT 2WPJS 3DHKH 1BT7A 2FTMA 1PQ7A 1QHRB 2H9TH 1P2OA 5FHTA 1EB2A 1ZHMA 4JCNA 1C2HA 2XBXA 5EW1H 3BTTE 1T8NA 3RXFA 1O2MA 2Q1JA 3M7TA 2EA3A 2ULLA 4IC5A 3BG8A 2KX4A 2I6SA 1TOMH 4WXIA 1Q31A 4YT7H 3SGQE 1C4Y2 1LHGH 1F5KU 7GCHG 3RXDA 1MMJN 2ZDKA 4KTUA 1G3BA 1KXBA 4NGAH 4FUGA 5C0TA 1ARBA 1AVGH 1IQGA 4TSFD 4MPUA 3RXPA 1XUGA 1AUJA 1MABB 2AMDA 4UE7H 1KLTA 2OTVA 4RSPA 3T5FH 3L3TA 2JH5D 2QXJA 1ELFA 3ZZ6A 3LH3A 2RA3A 1E79D 1P8VC 3SN8A 3A8DA 2H9EH 4SGBE 1NBMD 2Z9JA 2YMSB 2O9QA 3UNRA 1P2JA 3A8AA 1E0FD 5K7RA 2XXLA 3JZ2B 2AFQB 1N8OB 1O3GA 2ZFQH 3F6UH 2QCYA 4GPGA 3V0XA 4UFGH 1DWDH 2GKVE 3M5NA 5EPYA 3S69A 1EATA 3UNQA 2V0BA 2BXTH 1P9UA 5F53A 5T6DA 1SGQE 2R3UA 3OX7U 5HM9A 2BDBA 3QZRA 1Q2WA 4YTAA 5LGOA 1YGCH 3F9EA 4FUIA 1NRSH 4GCHF 3JZ1B 4ZHAA 4D9RA 1UJ1A 2FM2A 3QUMP 2BDHA 7KMEH 1IQEA 3BTQE 2CHAB 4MLFB 2H6MA 3VB4A 4ABFA 2LELA 3CS0A 1UTQA 1UVUH 1MKWH 2AH4X 4HTCH 3R3GB 1GMCG 4TY7A 3VEQB 3K9XB 1P2MA 3RMMH 1Y8TA 1W7XH 1YPJH 3BV9B 1GI0A 4HGCA 1FIZA 1O2VA 1GHAF 1O2NA 4DVAU 3A82A 4OS6A 3EA9A 1EB1H 1K1JA 4AYYB 1B0FA 3EA7A 2HALA 1CT2E 3SUDA 2F91A 4YOGA 2ZIQH 4CBNA 3LJOA 2D8WA 2THFB 2QY0B 3W95A 2H5CA 2XBYA 1FAKH 4MNYA 3GY6A 1QBNA 2Z9GA 1GBIA 2WPKS 2ZFPH 2NU3E 2Z7FE 2W6ID 5EG4A 2FPZA 1UCYE 3VFEA 3PLKA 1S81A 5CE1A 2GMTC 1C5PA 1HNEE 1W0JD 2HNTC 2FS9A 4BOHA 5FBEA 3M7UA 4Q7YA 5B6LA 1BRUP 1E1RD 2KCPA 1DE7H 1P57B 1IHSH 2D1JA 3HKIB 1P02A 5A8ZA 2JETC 4MDSA 2ZTZA 3S9AA 4ABHA 1C5MD 5IK2D 1YCPH 3TITA 4JZ1A 2Q6DA 1XVMA 2VWOA 1Y3VA 3U69H 2WPHS 1BMAA
chains in the Genus database with same CATH topology
4XSKU 3RXIA 3O8CA 3LGWA 2XWBI 5F6MA 5FPSA 3M5LA 3AW0A 4HZHA 1AVXA 1A5IA 1FLEE 1OWHA 3LGYA 2Z94A 4I8KA 1A7SA 1EZXC 1VGCC 3AAUA 3MNCA 4QT8C 5FCRA 1EASA 1WTHD 1YBWA 2AS9A 4MTBA 1KSNA 3U1IB 2FXRA 1RTLA 3SJOA 1Y3YA 1EPTC 1KXEA 2CMYA 4I32A 2ZHDA 1NPMA 2ZHEH 3PO1C 1MTNB 3M3VA 2PGQB 1C5UA 3P8FA 1QB9A 3RXRA 1S5SA 1WU1A 5K0HA 1UK4A 4GUXA 5A8XA 3PWCA 1ZPZA 2HLCA 1O35A 2SNWA 3TNTA 2ODQA 3VGCC 2BDYA 2BD4A 3VXEH 2FX4A 2G51A 1PQAA 3F68H 1OWEA 3NKKA 2ANWA 2ZU5A 3KQBA 2BD5A 4XE4A 4FVDA 4WF8A 1OWIA 3EQ0H 4IN1A 3SNBA 1V2LT 5A0AE 3RUOA 1BTHH 2ZGJA 1CBWC 3PM3A 3ZZBA 1AE5A 2VIPA 1N1LA 2Z3CA 1NN6A 3UOUA 1TNLA 2OLGA 2FP7B 4A92A 3ATIA 1BOQA 3KQEA 4ZHMU 2J9NA 3UWIA 2OC0A 1TPPA 4ESTE 2BD2A 2FEQH 1UTLM 1YYY1 2ZI2H 1HAPH 3TJVA 2BY5X 2ZTXA 4MQAA 2BDCA 1AO5A 1G3DA 2B0FA 3KNXA 4IN2A 1O34A 2PLXA 4K2YA 2HPQH 3Q00A 1SGFG 1ETRH 3KQDA 1BA8B 1T8LA 2GCTC 3DD2H 1DUAA 4FVBA 5FX5A 4CRCA 1C2LA 1ABIH 1XKAC 5DGJA 1L4ZA 4JYTA 4XDEA 1AMHA 1TGNA 1AWHB 1W14U 1YC0A 2GTBA 4RKOB 4Y8YA 3P95A 2ZC9H 2FX6A 1P01A 2OP9A 1GHBG 4R8TB 3LGIA 1BIOA 3LGVA 1SGDE 4Z6AH 3EGKH 5L6NH 3FANA 4KGAA 2HNTE 2Y5GA 2ZFTA 5CHAB 3P8GA 3RU4E 4CRBA 1RIWB 4FUCA 3TGKE 4UFEH 2RG3A 4K3JA 2PGBB 5CMXH 1AKSB 1TPSA 3ZZAA 2VGCB 3S9BA 2VIOA 1C1MA 1RXPA 2FOCA 4AB8A 1C1WH 2PHBA 1HV7A 1IQFA 1TNIA 1GI5A 1G32B 1C4U2 1G3EA 1F5RA 1H4WA 3VB5A 1BRCE 3KQCA 1HXEH 1K1NA 1O39A 3RP2A 3SNCA 4ZKOU 1NROH 1TMTH 7GCHF 1O2TA 3GOVB 1AI8H 3SV7A 3RXUA 4CHAC 3A7XA 2RA0A 4CH2B 4K1TA 1MKWK 1J8AA 3LJJA 3L6PA 1BJUA 3DT0H 3E3TA 3RXSA 4ZH8A 2WV5A 4GHQA 4Y79A 5DJ7A 1H9LB 1KTSB 4OS5A 4KELA 2QIQA 1WOFA 2G4TA 1BB0B 3PYHA 1ZSKA 3GCTF 1GPZA 4E06H 4Y6DA 2SGFE 3K6ZA 5A0CA 4WMDA 1FNIA 1MTSA 2OQUA 1SGCA 8LPRA 3GICB 1MTVA 2Y7ZA 2Z9IA 1QRXA 3K2UA 1NRQH 1KXCA 2ODPA 5E2PA 3BTGE 4ZXXH 2LPRA 1SI5H 1ZSLA 3KEEA 4FUDA 3SU0A 4IS5A 1CVWH 2ZF0H 1CGJE 5E0JA 2F83A 1ZLRA 2BDIA 1XVOA 1Z8IB 5DP7A 1TX8A 2J94A 3BTHE 1AFQC 2CF8H 1QJ7B 5DPAA 1PPBH 2G81E 1S85A 4YLQH 3F9GA 3MOCA 1MU6B 2GVFA 3UR9A 3NUMA 1AHTH 3MNXA 1A3BH 1JMOH 4I7YH 4A6LA 1AD8H 1QCPA 1SL3A 1G36A 1GMCF 2XCFA 2V3HH 2BVSH 4OS2A 1V2KT 3M3TA 2Z6BD 3H7TA 2A31A 1AVWA 1K2I1 3U9AH 2A4RA 1L1GA 3BG4B 1DPOA 1F92A 1SR5C 1EOJA 4NIXA 1IHTH 2FI5E 4KP0A 1QRZA 1C1OA 2CJIA 4DURA 3MMGA 2P8OC 2I6QA 2R2WU 1W7GH 1XX9A 3NPSA 3P17H 4CH8B 2QA9E 1VCWA 2ANYA 5JYIA 2NU0E 3ATLA 1GCDA 2A45B 1NRNH 1LVBA 3UQVA 2FO9A 1LVYA 1MAXA 1W13U 1ESTA 1WSSH 2Y81A 4IC6A 4X6PA 1QB6A 1S6HA 4X2XA 4YZUA 3SNDA 1C1UH 4MNXA 1SMFE 2AMQA 1OSSA 3E91A 5AFYH 3PTNA 5GIBA 4R0IA 2ZDNA 1HAOH 5ESTE 1JBUH 2W3IA 2W5EA 5JB8S 4NIVA 1T7CA 1LPZB 1Y3XA 4SGAE 1TRNA 1C9PA 3RXVA 4J1YA 2AYWA 3SGBE 2ZGHA 1Z6JH 2P95A 1FY8E 1TYNA 5DG6A 1AUTC 2GDDA 1P0SH 2P3UB 5HM2A 1HGTH 3GYMA 2C3SA 1LO6A 2SGAA 1WV7H 4DIIH 3ZVAA 1J16A 2VIQA 1O2ZA 1FY5A 3AASA 3FP7E 2ESTE 1ELBA 1THSH 1OS8A 1O2SA 1KXFA 1OOKB 1CA0C 1BRBE 1DVAH 4B74A 1O38A 4CRAA 1A2CH 4JZDH 1P04A 5GPIB 1DY9A 1GL1A 1GGDC 1GJCB 2G00A 1DXWA 3M37A 3MH4A 3SNEA 1XUJA 4DCDA 3RXMA 1ARCA 1SGPE 4K8YA 1BHXB 2JKHA 3RXGA 1F0SA 4VGCC 4NCYA 1IQNA 1ZRBA 4UONA 3GYLB 1IQLA 1C1QA 1PFXC 1WTGH 2OXSA 3M3SA 3QZQA 5EGMA 3SW2B 1P9SA 2PUXB 2GX4A 5DP3A 1UTJA 1GVKB 1GBKA 3LOXA 1E37B 4HFPB 1J9CH 5EW2H 3M36A 1G3CA 1AFEH 1OPHB 3DUXH 3PB1E 1PPFE 2F3CE 2BLVA 2AGGX 2BMGB 4DJZB 2ZCLP 4B76A 3MYWA 1PPGE 2SGQE 1S6FA 4CREA 8KME2 1BTWA 4IMZA 3P6ZB 1TGCA 1GG6B 1LCYA 4OS7A 4MPXA 1PYTC 3ZZ5A 2TIOA 3A7YA 3PTBA 4DGJA 1AKSA 6CHAB 3QK1A 1RFNA 2PKSC 1UCYH 1OXGA 1SOZA 3AW1A 4X6OA 1OWKA 4AX9H 4GLYA 1LKAA 4ISOA 3BIUH 2ZCKP 2ZKSA 2B7DH 2PW8H 4D76A 1GI1A 1ESBA 3T62A 1F7ZA 2QXGA 3SQHE 2ZDMA 4X1SU 3RMOH 1SLVB 1G37A 3SHAH 2A2QH 2BY6X 1ANEA 3VB6A 1NU9A 3ZZDA 1LPKB 4TPIZ 1HPGA 4NSVA 3E1XB 1MCVA 1AU8A 2RCEA 3E6PH 2O8LA 5C67A 2BDGA 4HI3A 1HXFH 4F4OC 1P09A 1O2RA 4E05H 1BUIA 3WY8A 1SLXB 2XNIA 2BVRH 2G4UA 3C1KA 3MH6A 3MTYA 3BSQA 3LONA 1V2QT 1GBHA 1DX5M 1W2KH 1ELDE 2BHGA 3ZZ3A 1FZZA 3KGPA 1Z6EA 2Y5HA 1FN8A 5G4BA 3GDVA 1TA6A 4CRDA 4BAQB 3SU2A 1SGNE 5C5OA 4IGDA 4ASHA 5C1UA 3S9CA 4DOQA 3TGJE 2GT7A 3AVZA 2QN5T 3RC6A 3U98H 1D9IA 3D23A 1XMNB 3ITIA 1V2JT 1Z8GA 3I78A 1GJ7B 2Z9LA 2BVXH 1Z71A 4U32A 1GBEA 2BY9X 1P05A 2EI7A 4TWYA 1VR1H 2H9HA 1C2GA 3GCNA 2W3KA 3H5CB 1MTWA 1NTPA 5GCHG 1Q3XA 5L30H 1CHOF 4ABDA 3ESTA 5A2MH 3ZYDA 5L2ZH 4O9VA 2WPMS 1SGYE 4I31A 2ODYB 2BOHB 3RMLH 7ESTE 2A0QB 1HUTH 3ZVDA 1BTYA 1DM4B 2XCNA 2FLRH 5ESBA 1O5EH 1HAZB 1ZGVA 4MNVA 1QL8A 1ESAA 1P3CA 1HJAC 4I8GA 2OBQA 2Y7XA 3U8TH 1O3OA 3M5OA 2B8OH 4ABBA 1S0RA 3FZDA 3RXKA 1OP8A 5E0HA 5EQSA 5F8ZA 2AGIX 1AZZA 1RS0A 3RXAA 3MO6A 1N6XA 2W26A 1EJMA 2PSYA 4K1EA 3BTME 1C2IA 1EJNA 1TGBA 2A4GA 1SQAA 3VB7A 1FI8A 2BB4A 4TY6A 1W0YH 4FUBA 5JBCS 4JYUH 3Q76A 4NG9H 1BMLA 3TK5A 3OYPA 2PFEA 3HGPA 1M9UA 2F9UA 3UY9A 5EU8A 1AN1E 4XFQA 5A09A 3UR6A 4ABGA 1VITH 3SU1A 1G2LA 3PWBA 1YLDA 1RJXB 1C2EA 1K28D 1E38B 2C4FH 5DP9A 2H2ZA 3S0NA 1RGQA 5JPMH 2VH6A 2H5DA 1TPAE 1AIXH 3SV8A 3VXFH 4WH8A 3ATMA 4GVUA 2ZWLH 2XWAA 1FDPA 3EE0B 1W10U 3LIWA 2WUBA 4Y11E 3L33A 1NZQH 2O8TA 2FOMB 1FQ3A 2ZFSA 4Y8XA 4X8TH 1RTFB 4Q2KA 1D3QB 1QNJA 3RXCA 1GVZA 2ZU3A 1LHEH 1HAXB 1ID5H 2OC1A 5C1YA 2FOEA 1V2RT 1AZ8A 3CS7A 2F9PA 1W8BH 4TPYA 1GMDG 3MNSA 4NWKA 1E35B 5TCCA 4TWWA 4ABEA 1UVTH 1TAWA 2PUQH 4AG2A 3RXJA 1QJ6B 3QDZB 5AVDA 1CT0E 3R0FA 4XBBA 2CXVA 2GMTB 4U2WA 4AORA 1FMGA 4WMFA 1A0JA 3UREA 1F0RA 2PSXA 1GJ9B 4AGKA 5FPTA 1HJ9A 4BTUB 1ZOMA 3NXPA 4ZAEA 3TIUA 1PJPA 1GBCA 3OY5U 2CV3A 2JETB 1FY1A 1XKBC 2A7CA 1GI8B 1NFXA 1PPHE 2NU1E 4WJG2 1UCYK 3Q77A 3TJNA 4X8VH 1O3DA 1NO9H 2R0LA 3D65E 4OGYA 3SZNA 1UHBB 2C8XB 1T32A 2R3YA 1O3IA 4KTCA 3FAOA 3S7KB 2C90B 4WH6A 3LPRA 4K5ZA 1C5TA 1BMNH 1H8IH 1EP6A 1HIAB 1F0TA 1VGCB 1GBLA 3A7TA 3F9FA 1T31A 3OU0A 1O3BA 1UO6A 5JBBS 1NU7B 2ALVA 2ALPA 3D62A 3DFJA 1ZR0A 1EPTB 4Y7BA 3HGNA 2ZPRA 3LGUA 2P3FH 4NZQA 2BLQA 3PO1B 3T25A 2QF3A 2Y5FA 1SG8B 3UIRA 4X8UH 2G8TA 1CE5A 6GCHG 2FMJA 3AAVA 3VGCB 1GJBB 1BITA 1NRPH 1L2EA 1NFUA 4AZ2B 4UDWH 5T3HA 1EOLA 1AGJA 4E7NA 1GWAA 4LK4A 1O3JA 3ZZ4A 4H6SB 1DWCH 1WCZA 2VWMA 1TLDA 3VPKA 1YPLH 5F03A 1CBWB 1U6QA 1ZTKA 2DUCA 2SFAA 1HJ8A 1Y3UA 1CHGA 1MBMA 1ELAA 2P16A 5LH8A 2CGAA 1TBZH 4Z0KA 5FPYA 1DITH 1MBQA 8GCHF 1O2YA 3RXQA 4AOQA 1EAXA 1W0ZU 4IBLH 3E90B 1H9HE 4CR5A 2LNCA 5EXLA 4NIWA 4ZKNU 4ABAA 2ZZUH 1B5GH 1Z7KA 1ZZZA 5FXLA 1SFIA 1GJDB 2GCTB 5TJXA 4AFZA 3RU4T 1ANDA 3B8JA 1O0DH 3SJKA 4AFUA 1UK3A 2A7HA 3BF6H 1ZMNA 3RC5A 1V6DA 4X1RU 3SV6A 1QA7A 1O5AB 4LZ1H 1KLIH 1ZMJA 1Y3WA 4XBCA 5FCKA 1GBAA 1UTKA 2UUFB 1MU8B 1K1LA 2V6NA 2XTTB 1GVLA 1TX6A 2QYIA 3SUGA 2FIRH 3ZVBA 1H8DH 3SQEE 3RXEA 5EQQA 3O8DA 4JK6A 3KL6A 3SV2H 3T26A 4BTTB 1C1VH 1C5YB 5LPEA 4JZEH 1O2OA 2KAIB 3TLOA 2J4IA 3M5MA 3QLPH 2A1DB 5GWZA 2UWPA 7LPRA 1GDQA 3SGAE 3MU0A 4NA8A 1O3FA 3UOPA 4A7IB 1VJAU 3QGNB 2ZDAH 2NU2E 4FXGH 2BY8X 2Q6FA 3MHWU 5GCHF 1A5HA 1A46H 1S82A 4YOJA 2O8WA 1O3CA 4B71A 1ZPCA 1QIXB 1TOCB 3TJOA 4CHAB 3PMJA 1SQOA 2ANMH 1C5SA 1CU1A 4K60A 1T8MA 2BD8A 2VWLA 2F9NA 5DKMA 3BTFE 2ZO3H 1FY3A 1HAGE 1ANBA 1O5CB 1EAIA 2GV6A 1HAVB 1O2IA 3HATH 1LTOA 4YOIA 2W7SA 4AGJA 3ZYEA 3QX5H 1FJSA 3BTDE 1YPKH 5F8TA 3SU6A 3A88A 1HAIH 1NESE 3U1JB 1AB9C 1BBRE 3A83A 3TVJB 4ABIA 3D49H 9ESTA 1F2SE 2SNVA 2A32A 2PV9B 1PPCE 2STBE 3LC3A 1IAUA 4I8HA 2FESH 5C2ZA 3TK6A 2C8WB 4CBOA 3ZVEA 1TB6H 2C8YB 1G2MA 2A4OA 1EUFA 4F49A 2V3OH 2VVVA 1KLJH 2Z3DA 1AFQB 4A1TA 4FU9A 3SU5A 2G55A 1HCGA 4ZUHA 3Q3YA 1GCTC 2UUYA 1C9TA 3S7HB 1DICA 1SLUB 1W11U 3Q3KA 1JIRA 3PMBB 2GZ9A 1D6WA 4MPWA 1D3TB 2WUCA 1WQSA 1SGIB 4O03A 3NZIA 3FZZA 5EXNA 2A4QA 1FAXA 4ZROA 2FODA 4Q7XA 5E2OA 1SPJA 3B9FH 1NC6A 4NFFA 1BZXE 1ELGA 2HRVA 1P2QA 2SGDE 2ZFRH 1BCUH 2C8ZB 1A0LA 3GY3A 1V2PT 5C3NA 2P8OB 3A7VA 1HRTH 3E0PB 2TBSA 3GCHC 3ENSB 1UVPA 1GMDF 1GHYH 1SLWB 3RC4A 1C2MA 1O2XA 3TJUA 3BEIB 1CGHA 1V2TT 2ZU4A 3EYDA 1GBBA 2VB0A 5HMAA 1HIAA 4Y71A 4ABJA 4Q7ZA 2OC8A 2XBWA 3ZZ7A 1BRAA 2Y6TA 3SHCH 1C5LH 5JBAS 1PQ5A 3GISB 4CR9A 2BY7X 3IITA 2BD9A 2BXUH 4WMEA 1XUKA 2BM2A 4CRFA 2GDEH 2NU4E 1ZTJA 5DO4H 3HPTB 1O3MA 3MO3A 1YF4A 3EA8A 1UTMA 3RDZA 1C1RA 1CQQA 2EEKA