2KAIB

Refined 2.5 angstroms x-ray crystal structure of the complex formed by porcine kallikrein a and the bovine pancreatic trypsin inhibitor. crystallization, patterson search, structure determination, refinement, structure and comparison with its components and with the bovine trypsin-pancreatic trypsin inhibitor complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
152
structure length
152
Chain Sequence
ADGKDYSHDLMLLRLQSPAKITDAVKVLELPTQEPELGSTCEASGWGSIEPGPDDFEFPDEIQCVQLTLLQNTFCADAHPDKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWIDDTITENP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (proteinase-inhibitor)
molecule keywords KALLIKREIN A
publication title Refined 2.5 A X-ray crystal structure of the complex formed by porcine kallikrein A and the bovine pancreatic trypsin inhibitor. Crystallization, Patterson search, structure determination, refinement, structure and comparison with its components and with the bovine trypsin-pancreatic trypsin inhibitor complex
pubmed doi rcsb
source organism Sus scrofa
total genus 29
structure length 152
sequence length 152
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 1984-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2kaiB00
1RRKA 1ANCA 3BTEE 1HGTH 3ESTA 1OP2A 1BHXB 4NA8A 5DP4A 2Q6GA 4D8NA 5IDKA 2R3UA 2BD5A 3PMBB 4AZ2B 1OYTH 1LPZB 1AVGH 3SU3A 2OTVA 1QL7A 1L1NA 2VGCC 2SGEE 3HK6B 2XBYA 3GCOA 1QB1A 1W0ZU 3RXIA 1CA0B 5DJ7A 5EXLA 3KQBA 1SGNE 1UVPA 2QV1A 2CHAB 1HNEE 2ZPSA 4Y79A 1C1NA 1DOJA 2QXJA 4R0IA 1FXYA 4Q80A 1GI2A 2XCNA 4IBLH 3TNSA 2OC8A 1HIAB 2PR3A 1KTSB 1UTPA 2BDGA 2ANMH 4AFUA 2PUQH 1TRMA 1MAYA 2FLBH 1C5VA 1XVMA 1AMHA 2QGRA 1DUEA 4TPYA 1KSNA 3ATLA 1AB9B 4UD9H 2ZGBH 2FMJA 2VU8E 3SGAE 3RMNH 4WXVA 2WPMS 1UJ1A 1CVWH 1EX3A 2FOAA 4IN2A 1SLVB 1TAWA 1KLJH 3SNCA 5CE1A 2A0QB 4ZAEA 1HAGE 1LKAA 2IPHA 1UHBA 2Z9JA 1O5CB 1S6HA 3K2UA 1P12E 2OP9A 4SGAE 2BM2A 2QXHA 4X8SH 4TY6A 1YC0A 3ZZ9A 3TK5A 1YLDA 1WQVH 2H5DA 1A5IA 3HGPA 3SNBA 1PQ5A 3KQCA 2BDBA 1CHOF 1C2LA 2O8MA 2FX6A 2G55A 1C5XB 1CGHA 4F4OC 1P0SH 1YYY1 1GBEA 2XTTB 4BAMB 5EGMA 2IN2A 2A4GA 1SGFA 4K8YA 1G3DA 3CENA 1GBAA 1MCTA 2HNTE 1QFKH 5L6NH 2AEIH 1HAIH 1XXFA 1QA0A 2OQ5A 4NFFA 8ESTE 5EXMA 2F9VA 1MU6B 1C5NH 2H9HA 1W0YH 1OYQA 1IAUA 1AE5A 1T31A 2QXIA 1GMHF 1THSH 2C90B 2P3FH 3SN8A 3LIWA 2VGCB 4AOQA 4WMFA 1O5GH 5AFYH 3RUOA 3B8JA 2HALA 1FY4A 1BBRE 1JOUB 1TALA 1UVSH 4K5ZA 2AIQA 1SLWB 1ELFA 2ZHFH 3MNXA 4B1TA 1JBUH 1NU7B 1O2UA 1WV7H 1XM1A 2BOKA 3T25A 2BY5X 1AFQC 5JDUB 4FUHA 3T26A 1YPMH 4DURA 1C4V2 1O3FA 8GCHG 1QJ1B 2KAIA 1ZPZA 1BUIA 2Z3DA 2P93A 4XDEA 2FOBA 1Z6JH 2BDIA 3S9CA 2H5CA 4E05H 1V2TT 1TB6H 4ZKNU 1GBIA 1GBFA 4ZXYH 2H2ZA 1MKXK 1P8VC 3A7ZA 5JBTA 3RXFA 2J38A 1Y3WA 5AVDA 1JXPA 1ZOMA 3P8FA 5DP3A 3TNTA 2YNBA 4ABGA 1P2OA 3RM2H 2BD8A 1O31A 1FQ3A 5GPIB 1V2NT 2AGGX 3FP7E 1J15A 1TYNA 5L2YH 2FS9A 2D2DA 4UFDH 3TH2H 4ISNA 2FPZA 1EZQA 1K1NA 1HBTH 1AZZA 3OU0A 1DT2A 5A8YA 4ZXXH 1GBTA 2J4IA 1Z1JA 2VIPA 1EP5A 2TGPZ 2QAAA 2BZ6H 5FCRA 1K1OA 3BTFE 4AFZA 1MBMA 1V2LT 4BAHB 4X6MA 1QRZA 1TBRH 2ZIQH 3VPKA 5JB8S 1D3DB 1DLEA 4GPGA 4AFQA 1MKWK 1DS2E 1LHCH 1NFWA 2C93B 2OXSA 4FVBA 4X6OA 3D65E 4LXBH 5TCAA 1G3EA 1O2LA 4CRBA 3L3TA 1SGDE 4WY3A 3EAJA 1GCDA 1CSOE 1GBJA 1XX9A 2V0BA 3GDSA 4NWLA 1MH0A 1A7SA 5B6OA 1FONA 2Y5FA 1HAYB 4A1XA 1N8OB 2A4RA 1PPCE 4E7NA 5I25A 1CT4E 3BTGE 1TX8A 1Z8JB 1CHGA 5E0JA 4XBDA 1QURH 1IQFA 1EOLA 1DY9A 1FJSA 1RIWC 3H7TA 1NPMA 4JZFH 5DP6A 4ZROA 1BQYA 2SFAA 4OS6A 2Z9GA 2DE8A 1C1SA 1BITA 3M5MA 1J16A 1TRYA 2BYAX 1VCPA 2EI8A 2VIWA 1BTPA 4A1TA 3O8DA 2A2XH 1D6WA 1PPHE 2ANKH 1MD8A 3A7YA 1ESBA 4K8BA 4OS1A 1O3DA 2A7JA 3KF2A 1EZSC 1GJ4H 1GI1A 2CV3A 4YOIA 1UCYK 3HK3B 1YKTA 4OS4A 4XBCA 1S81A 1E36B 1ZHMA 1WTGH 2BVXH 4CBOA 3BEFB 1THPB 2ZU3A 5SGAE 1BJVA 2C4FH 1AFQB 1P57B 1LHDH 3M36A 1H4WA 2ZP0H 2A5KA 4YLUA 3F9EA 3A7WA 3V7TA 1ZHRA 4KTCA 1FZZA 1ARCA 1O3EA 1XUFA 3STIA 1TBQH 3GY5A 1KDQA 1GJ6A 2XRCA 1EAUA 3P8NA 3A8CA 2BQ6B 2ZDMA 7GCHF 1GWAA 1MTVA 3ZZ8A 1S82A 2FOMB 4AX9H 2JETC 1QA7A 3AW1A 3SJKA 3GY6A 2TRMA 1JIRA 2VB0A 1GCTC 1RD3B 1QGFA 1UTKA 4Q2KA 1ZYOA 1WU1A 2QF3A 1YPKH 2WINI 4BTTB 2ZPRA 3QZQA 2QC2A 3RM0H 1DWBH 3VGCC 3W95A 1YPHC 4YM9A 3P92A 1LQEA 4OGXA 5EG4A 1BTWA 3PTNA 4H42U 3B9FH 5DPAA 4J1YA 1DPOA 1HPGA 2GCTC 3E0PB 1ANEA 3GY2A 4Y7BA 4HGCA 3IITA 1OWJA 1E38B 1VITG 2HVXA 2R0LA 1ZRKA 3MHWU 2ZNKH 1ELVA 4DG4A 5GDSH 5A0AE 2GT8A 2SNVA 1B5GH 4DGJA 5I46H 2ANWA 2HRVA 1FY5A 3SV8A 3SV6A 2B0FA 4FVDA 2WYJA 3U98H 1BTZA 3SV7A 1RIWB 4ZHLU 3ITIA 3ODFA 2OC0A 2G52A 4ABAA 1ID5H 4H4FA 1AY6H 3M3TA 1MTNC 1WBGB 4X8UH 3HPTB 1FY1A 3K6YA 4MNWA 3SU2A 1QBOA 2F9PA 3VB5A 3TGIE 3RXAA 4MDSA 1ZMNA 1IQMA 4HFPB 2BHGA 3PO1B 1T4VH 3BG4B 4D76A 1C1VH 1D3QB 1AI8H 2ANYA 1F92A 3DFLA 2NU3E 1O3NA 5ESBA 3TJOA 2WPKS 1SFQB 3MU0A 4FXGH 2FM2A 3GICB 3PLPA 3A86A 1HV7A 1BHXF 4UFGH 3BTHE 4JCNA 1UVUH 4E7RG 2BX4A 2H9TH 3GDVA 4KTSA 1SC8U 1SHYA 1K21H 2PKAB 4LOYH 3RXMA 1L0ZA 5FBIA 1YLCA 3BSQA 1HB0B 3K9XB 1L1GA 1XUGA 3CS7A 2ZDVH 2ZHWH 3FP6E 1D3PB 2ESTE 1O2MA 3UOUA 3SV9A 5C1XA 1OXGA 3U8RH 1K1LA 3ELAH 4NFEA 3ATWA 3QGJA 3C1KA 4DT7B 1K1MA 2GDDA 3UR6A 4BAOB 2VIQA 5A2MH 1IQLA 1MMJN 4WJG2 3SJ8A 2JETB 4ABHA 1BTXA 2AIPA 1V2KT 3BN9A 4I8KA 1MTSA 2ZFQH 3E90B 1W10U 3AVZA 1O2VA 5LH8A 3KNXA 4ISLA 3TGKE 3S9BA 1O39A 2VWMA 1TIOA 1BRCE 1HJAB 1T4UH 3UFAA 1ELEE 1XXDA 4CR5A 2GT7A 3VGCB 4AB8A 3I77A 3MFJA 1J14A 1ETRH 1AUJA 4IGDA 2Z9KA 4Y0ZE 1QRXA 1HLTH 2FOFA 1YPGH 2GCTB 2FIRH 1OWHA 1G2LA 4BAKB 3TK9A 3NUMA 1ELBA 4Q7YA 2PKSC 1AQ7A 3DUXH 1SFIA 1HAXB 4AGKA 1FPHH 1MZDA 2FX4A 5EXNA 5F03A 1DXPA 4ZUHA 3SU6A 4GAWA 2V3HH 2BQWB 4JZIA 4OS5A 2P16A 4FU7A 2VWOA 4KELA 1KLTA 2EA3A 1P2MA 1YF4A 2TGTA 2ZC9H 1BMLA 2B9LA 4WWYA 2BDYA 4Y76A 1GI7B 1O2HA 4WH6A 1IOEA 4WH8A 1MTNB 5DP9A 3PWBA 1ZTLA 4DY7B 1F0RA 4NIWA 2FTLE 2ZO3H 1TGTA 2R3YA 2PV9B 1D6RA 1RGQA 1KYNA 1NT1A 1KY9A 2ZTYA 2DUCA 1NC6A 1V2ST 1Y3VA 1OPHB 2VIOA 1C1UH 2QYIA 3ZZ3A 1XUJA 3MH6A 5EW1H 1MBQA 4DW2U 1AVXA 1KXEA 1C5LH 1QL9A 2BLWA 5JYIA 1NY22 1O34A 2P95A 3IG6B 1ESTA 3RXEA 4Y10E 1Z7KA 2AGIX 2RG3A 1AB9C 3SNAA 1K1PA 4AB9A 2G5VA 2FYRA 1GHZA 1QNJA 1UMAH 1C5WB 1UTMA 3QN7A 4NSYA 3A80A 2ODQA 1NM6A 1ELGA 1H9LB 5GCHG 1K2I1 1SSXA 8GCHF 3LH3A 3RC6A 4IMZA 2H6MA 5FAHA 4ZHMU 2F83A 1UTQA 4LK4A 1J17T 1ZHPA 4MVNA 2FZZA 3KHVA 1NO9H 1O2ZA 1ANDA 2GP9B 1O35A 1SMFE 2P8OB 2BOHB 1K1IA 4TPIZ 4AFSA 3H7OA 3P95A 1O2XA 2BY7X 5JPMH 3QZRA 1BT7A 2YOLA 1J8AA 3NXPA 1OP0A 1LPKB 4BTIB 1GHBG 5LPFA 3I78A 2BLVA 4YOJA 3LGUA 1O2TA 4ZHAA 1NTPA 2PKSB 3BF6H 2P3TB 4NIVA 2GD4B 1O2RA 1QTFA 1SQOA 2VJ1A 1F7ZA 3EE0B 2VVCA 1PQ7A 3RXBA 1O3IA 1LCYA 1Y3YA 4FUJA 1SBWA 1LVBA 2AYWA 4X1QU 2J92A 4AN7A 3RU4D 2XXLA 4D7FA 4MNVA 1C2FA 1NRRH 2BQ7B 2NU4E 4B75A 4D9RA 2ZDKA 2FOCA 3VFEA 2AGEX 1IQHA 5FXLA 1C5PA 2ZFPH 1QB9A 1SGIB 2BD3A 1KXBA 1FN6A 2A4OA 1QBNA 2G81E 1Y3XA 4I8GA 1GI9B 1TPPA 1ZZZA 2SGQE 4H6SB 1UK4A 2BDHA 3N7OA 1SGTA 3CP7A 2ZFRH 1GJ8B 1GI6A 1LDTT 2AFQB 2W26A 4QT8C 4K3JA 1N6XA 2V3OH 4B76A 1OSSA 1P2JA 1FY8E 2HWLB 1Y59T 1HJ9A 2CJIA 3BTKE 3SUGA 1MAXA 3JZ2B 3FVFB 3HKIB 1N6YA 2ZDAH 4X1RU 2G4TA 2ZFFH 1K22H 2SGFE 2JH6D 2EC9H 1O3MA 3F9FA 1S83A 1YPLH 4INHA 1S0QA 2K1QA 7KMEH 1O2WA 1PYTD 1AZ8A 1MZAA 1U6QA 1EP6A 1P2KA 3RXSA 1V2VT 1SGQE 1MTWA 1V2OT 1PPZA 1GVLA 2BX3A 2RCEA 3STJA 3QK1A 1TABE 1JWTA 2BDAA 2OUAA 3NWUA 4I31A 1C5RA 3EA7A 2RDLA 1BMAA 3AASA 5L30H 2ODYB 3VEQB 1JRTA 1QB6A 1RTLA 1GDNA 1DWEH 1GL1A 3LC5A 4I33A 3RC4A 3UREA 4BANB 1TA2A 1ZTJA 5C2ZA 1G32B 3P17H 2PWXA 3RLWH 3TH4H 2ZF0H 2ZCHP 9ESTA 1N8OC 1C2IA 4LZ1H 3SZNA 2GZ9A 2PHBA 1O3PB 2UWLA 3T29A 1YM0A 1DSTA 1WSSH 2WV5A 1SOTA 1BZXE 2ZQ2A 3F1SB 2NU1E 1C5UA 1NESE 5LPEA 5A0BA 2D1JA 4AG1A 5LGOA 1NFXA 4GSOA 2B5TB 1TMTH 1FUJA 3SNEA 2Z9IA 2O8TA 2XCFA 3RXPA 4KP0A 6CHAB 1D9IA 3UWIA 1VITF 3KL6A 2ILNA 1P03A 1ZJDA 1H8IH 1V2QT 1V6DA 2BB4A 3U8TH 1F0TA 1O3BA 2C3SA 4MG3A 1LMWB 3M7UA 4K1EA 4CRCA 3H5CB 4Z6AH 4O9VA 1UO6A 4TWYA 4O3UA 1AO5A 1HXEH 2W7SA 1W7XH 1EKBB 3M5NA 2GVFA 3E1XB 2FODA 5T6DA 3GCTF 3Q76A 1A61H 2Y5GA 1LHEH 3PLBA 3UNRA 1E37B 1F0UA 3MTYA 3SI3H 3DA9B 3P6ZB 3ZZ6A 2VH6A 2VIVA 3HATH 3SJIA 2XYAA 1Y8TA 5EODA 3FANA 4WXIA 1MCVA 1O2PA 1T7CA 2R0KA 4BXWA 3D23A 1YGCH 2Q1JA 1IQJA 4JMYA 3T27A 2HPPH 3NCLA 4OS7A 3GY7A 3SU5A 1TGCA 1KXAA 1UTJA 1BOQA 1EJNA 3RXJA 1BBRK 2GMTB 1ZMJA 5A8ZA 5T6FA 1PPFE 1ELTA 1V2MT 4Y7AA 4DCDA 3M35A 2PFEA 1MQ6A 2ULLA 3E0NB 3RMMH 1C2JA 3ZV8A 5CHAC 2WV4A 1TNIA 2G8TA 3LGYA 1JIMA 1TFXA 5FCKA 1W13U 4UEHH 4INLA 3B23B 2TIOA 4X2VA 1Z8RA 1C1QA 2R2MB 1C9PA 1O30A 1G3CA 2QCYA 5K7RA 1G3BA 1FLEE 1VR1H 8LPRA 2GDEH 3IWMA 2NWNA 3GY8A 2FI5E 3MNBA 2BZAA 3RLYH 2AS9A 1HYLA 1NN6A 2QN5T 3F68H 2W3KA 1P3EA 3FFGA 3MMGA 2PGBB 1MD7A 3SI4H 4ESTE 1ABJH 1C5QA 5E0GA 4JYUH 3ZVFA 1SL3A 4X8TH 1RTKA 2O8UA 4A6LA 3SHCH 2M5TA 2C8YB 1BTHH 1VJAU 4NIYA 3UQOA 6ESTA 4FU8A 1SGRE 1EASA 3TPIZ 1VGCB 3GDUA 5JBBS 1GHYH 2Z6BD 3PO1C 3BG4C 2ZHEH 1L1JA 1NRSH 1TPSA 2WPHS 3RMOH 2Z94A 1L2EA 2OINA 5JBAS 1GHWH 3RU4E 1WCZA 4B2AA 3MH4A 1K1JA 1CT2E 4GVUA 3LGIA 1O33A 4X1SU 1SLUB 4R8TB 1LHFH 1W14U 2FO9A 1EPTC 1E34B 1WAYB 1O2YA 2XNIA 4IC6A 5ESTE 1C2EA 1GI3A 2SNWA 1GJAB 5FHTA 1OWDA 1YCPH 1KXDA 3RXUA 1L4DA 3RXTA 4OS2A 4MQAA 3S69A 4CBNA 1P01A 2CF9H 3PWCA 2OBQA 4ZH8A 1BRBE 3L33A 5E0HA 1NRPH 1P11E 1TQ7B 1EJAA 5LPRA 3MWIU 1UTLM 1V2RT 3K65B 1HJAC 1CHOG 3Q77A 3TH3H 3ZVBA 2I6SA 2BD4A 1BIOA 1QR3E 1OOKB 1DDJA 4FUIA 4KKDA 3RDZA 1HAOH 1DLKB 2PKAA 1TBZH 2XBVA 3KN2A 2GGVB 2UUJB 4CRGA 5CHAB 2ZECA 1EPTA 1GMCG 4MTBA 4GUXA 3ZZCA 1KXCA 1BCUH 5A8XA 4WF8A 1HAZB 2BLOA 1GVKB 5EW2H 5GCHF 1CT0E 1O2IA 1C5ZB 1DY8A 3OY5U 1G2MA 4HTCH 4Y8YA 2XBXA 1C2GA 5IYTA 4ISHH 4AGJA 1CU1A 2XWAA 5F6MA 1K9OE 3PMAB 1A46H 3ZVEA 4CH8B 3ODDA 3D62A 1TNKA 1F2SE 1SVPA 5DP5A 1ELAA 1GMDF 2A7HA 4AORA 1LO6A 1V2JT 4ABBA 2ZHDA 3T62A 3A87A 5EPYA 2TGAA 3EA9A 1EQ9A 2WUBA 2ASUB 2ZA5A 4X8VH 2FS8A 1GBBA 3Q00A 1GHBF 1LTOA 2W7UA 4ABJA 4XE4A 1GDUA 1ZMLA 2ZG0H 2VWLA 1ELDE 1H1BA 1Z71A 2Y7XA 1FAKH 1CGIE 1WTHD 3F9HA 1A5HA 3RXQA 3PV4A 1C4Y2 1O36A 4Y71A 1C5OH 5K0HA 5A0CA 3QWCH 3Q3KA 5JBCS 1XVOA 3V13A 3A8AA 1ZTKA 3F9GA 3BTME 1NFUA 1SLXB 2F3CE 1RXPA 2HOBA 3OSYA 3GY3A 3DD2H 3UWJH 1EPTB 4E06H 1BA8B 1OWKA 3HGNA 1RTFB 6LPRA 1C5SA 2ZPQA 5CMXH 4CR9A 3NK8A 3CS0A 3GOVB 4IMQA 2QY0B 3GY4A 5GIBA 2AMDA 2BMGB 3TJUA 1Q31A 2C8ZB 1O5FH 1QBVH 2J94A 1VCQA 3MU8A 4YLQH 3ZVGA 2HNTF 2Q6DA 2Y81A 2WPIS 4YT6H 1HJ8A 4KTUA 1C2KA 1XUKA 3QX5H 3P8OA 4O97A 1P10A 2ZCLP 2A7CA 2C8XB 1ANBA 2FOEA 4BTUB 1AE8H 1CA8B 2P8OC 1TRNA 3BTWE 3SORA 1A5GH 1H9HE 2ZEBA 3A84A 2SGPE 3PLKA 3FZDA 3A81A 2ZGHA 1G37A 1CQQA 1TGNA 1GBKA 1DWCH 3ZYEA 1Y3UA 2P94A 5BRRE 2ZTZA 3BTQE 1GI4A 3UNSA 1S85A 3MU4A 4OGYA 3RU4T 1ZGIA 3TGJE 1EZUC 1O38A 2XWBI 1GHAG 2SGDE 3LU9B 2ALVA 3EYDA 3S7HB 2XBWA 1YBWA 1WOFA 1C5TA 1QY6A 4ABEA 3TITA 1Z1IA 3VB3A 1TOMH 1SI5H 2GZ7A 1GBLA 3QTVH 2PTCE 1W12U 3A82A 4GCHG 1AHTH 3U69H 3FP8E 4RKOB 5FPYA 3MNSA 2CF8H 2J95A 1EAIA 2ZGCA 2FDAA 1JRSA 1GJBB 4VGCC 4RKJB 3PTBA 2Z7FE 1EATA 3K6ZA 1PFXC 1G9IE 3OTJE 1MKXH 3E6PH 1IQKA 4U30A 3W94A 4B2CA 2G4UA 2HNTC 2STAE 2GCHG 1SPJA 4F49A 4NA9H 1FY3A 1GJ9B 1ETTH 4ABIA 2J9NA 2Z3CA 1HRTH 4YESB 2GV7A 2D26C 3TIUA 2ALPA 1PPGE 5ABWA 2B7DH 1WQSA 1P02A 1A4WH 3TK6A 2O8LA 3O8RA 3A85A 3QTOH 2O8WA 2BD9A 4CRAA 2OD3B 2VIDA 4SGBE 2CXVA 3MYWA 1TE0A 1C1MA 1B0FA 1P09A 2THFB 4FUCA 2FTMA 2FWWA 1A0LA 2PSXA 1SR5C 3AW0A 1A3BH 4ABFA 3QO6A 2ZFSA 1NRQH 2RA3A 5DO4H 4X0WU 3RXHA 3M5OA 3LPRA 1O3LA 1DFPA 1A0JA 3LH1A 4NWKA 4ABDA 1EB2A 1AU8A 1SOZA 1OWEA 5E8EH 2Y80A 4ISIH 2WUCA 1DUAA 1ABIH 1GVZA 3RXGA 1AWFH 1O3AA 4Z0KA 3L6PA 3TU7H 2ZZUH 1XKAC 2FXRA 3JZ1B 3BEIB 1HCGA 4X2YA 1O2OA 4YTAA 1OS8A 4A92A 1OWIA 3E3TA 2IOTA 1Z8GA 3QGNB 3URCA 1C9TA 3UQVA 1P3CA 2BD7A 5C67A 2PLXA 1NU9A 1T8LA 2STBE 2A2QH 4K60A 4JYTA 4A5TS 1RJXB 1BMNH 3LDXH 1UCYH 1O37A 1SGYE 3T28A 2Y7ZA 3FAOA 4THNH 3BIVH 3A8DA 1LPGB 2OCVB 2A31A 3ATMA 6GCHG 1QRWA 2W3IA 4UONA 3AAVA 3OYPA 1NS3A 2BY8X 2PGQB 5E2PA 6CHAC 1YPJH 5T3HA 2SGAA 2WPJS 3SGQE 3GCHC 1XMNB 3A8BA 4O03A 1KLIH 3TJVA 4VGCB 3SHAH 2HGTH 3A89A 1AGJA 2ZU4A 2AERH 4K69A 1TQ0B 5C20A 1TMBH 1QQ4A 1TPOA 2GKVE 1EJMA 2JKHA 4DJZB 4KGAA 4J2YB 2FESH 1INCA 2BLQA 3LOXA 1QQUA 5F8TA 2A45B 2LNCA 4TWWA 1FAXA 1BDAA 1FIZA 1C1OA 4FUEA 4NA7A 3SU4A 1EAWA 4TY7A 3M37A 5DG6A 5C5OA 1HAVB 3A7VA 1TNJA 4ISOA 3G01A 1GI0A 4MPWA 1T8MA 1P9SA 1P2QA 3UIRA 4NZQA 3LKWA 1AN1E 4Y6DA 4K1TA 1GBMA 1GDQA 1X7AC 2F91A 1S84A 2A5IA 4JK5A 4CRFA 1FMGA 1Y5AT 1UVOA 1EXFA 3E8LA 3KGPA 4MNXA 3LJOA 1ZSJA 5ETXA 4U2WA 5DK1A 2GMTC 1O0DH 3QLPH 4M7GA 2G5NA 1T32A 4YO9A 2H1UA 3PB1E 1J9CH 1F5LA 2J2UA 4IW4E 3MH7A 4WVPE 4IN1A 4XFQA 1LQDB 4ZMAH 3ZZBA 2Z9LA 1W2KH 1LKBA 1TNLA 2R2WU 2JH5D 5C1YA 4AYVB 3PROA 4I8LA 1FPCH 3U8OH 1A0HB 1HDTH 2XW9A 3SNDA 1GGDC 3MI4A 5DGJA 1G36A 1JMOH 3GCNA 4GHTA 1O5AB 3RXDA 3SQHE 1GJCB 4IC5A 3NPSA 3BIUH 1ZPBA 2A32A 4X1NU 1GMCF 1ETSH 1GJDB 3ZVDA 4TYDA 3S7KB 1N1LA 1PQ8A 2TGDA 5F8ZA 1VGCC 3A7XA 2XC5A 3LGTA 1PYTC 3SV2H 3UUZA 3GCHB 1DXWA 2JH0D 1DVAH 1FN8A 3SU0A 2F9OA 2BVRH 1NZQH 1IQIA 1AKSA 1ZR0A 5A09A 4MPXA 3TLOA 2J34A 4UFEH 1TWXB 3M5LA 3M7TA 2ZU1A 3T2NA 4DIIH 1C5MD 4U32A 3RXRA 1MTUA 1O3KA 1YP9A 3MO3A 3P8GA 1UHBB 5GJ4B 1T8NA 1C2MA 2UUFB 3M61U 4RSPA 1O2SA 3SUEA 3D49H 4FUBA 4B73A 5DKMA 2Q6FA 1TNGA 1OX1A 4AG2A 3VB7A 4DIHH 1OP8A 3LC3A 1ZPCA 2TBSA 1CBWC 1S6FA 2PTNA 1Y5UT 4JZDH 2XC0A 1GBHA 3LGWA 1O5DH 1CGJE 2ZQ1A 1D3TB 1ELCA 3SU1A 3BG8A 4BXSA 3LJJA 4PROA 1QHRB 4NSVA 1SGFG 1VITH 3P70B 3O8BA 1TX6A 2FYQA 4D9QA 4UFFH 1H9IE 1O3HA 2BTCE 4YT7H 3A7TA 1S5SA 4FUFA 3TJNA 1V2WT 1TMUH 3ZZ7A 4JZEH 1AD8H 4D7GA 4IS5A 1K28D 5J4SA 2OLGA 3HKJB 2VVVA 1TLDA 3SJ9A 1O2NA 1UVTH 1MUEB 1AKSB 1TGSZ 1C1TA 3OX7U 1Y5BT 5JB9S 8KME2 4X2XA 3U9AH 1GGDB 5C5NA 4RN6A 1HFDA 1GG6C 2V35A 3KEEA 1UK3A 2I6QA 3ENSB 1UCYE 4WMDA 2W5EA 4I8JA 1DX5M 1AIXH 3RC5A 1LHGH 5HMAA 1IHTH 1MQ5A 2XC4A 1F5RA 3SUFA 4UE7H 1UTNA 1ORFA 1TX7A 3MOCA 1C5YB 1GBDA 2CGAA 5HGGA 5C1UA 1HAHH 5HYOA 5L2ZH 1GHAF 5HXFA 2KAIB 1AVWA 1P05A 3MH5A 4A1VA 3RXVA 2ZKSA 4B71A 1O2JA 2AMPA 4I8HA 3Q3XA 1CO7E 2D8WA 3M3SA 3KIDU 4CREA 2FLRH 2ZDNA 1O32A 4GCHF 3DFJA 2P3UB 1XKBC 2ZHQH 1UTOA 4WMEA 3BTTE 1V3XA 3DHKH 3ATKA 2OBOA 5T6GA 1O2QA 3VXFH 1TOCB 5GXPA 1NFYA 3C27B 3T5FH 3MU1A 3U1JB 5C3NA 2A4QA 3KCGH 2RA0A 4MPVA 3LONA 2EI6A 4O3TA 3RXCA 1C2DA 2VINA 3MO6A 1CE5A 3KQDA 4GHQA 3SJOA 1QJ6B 2GCHF 2QXGA 2BY9X 2AMQA 4CHAC 2ZU5A 1SGCA 3GYLB 1O2GH 1CBWB 4HZHA 1KTTB 5DP7A 4NCYA 4MLFB 1YPEH 3V12A 1TA6A 5TCCA 5AF9H 1VCWA 4X2WA 2PSYA 1KIGH 1O3OA 2ZWLH 2FI3E 5HM2A 1FV9A 1AUTC 1W8BH 1WYKA 2BDCA 7LPRA 1ARBA 3UNQA 3OY6U 1VZQH 3PYHA 1BTYA 2BXTH 2G51A 1GJ7B 1AWHB 3GYMA 1PPBH 1QL8A 1BB0B 4NIXA 1ACBE 3S0NA 1C1PA 1PJPA 2ZGXH 3A83A 3PM3A 1P06A 1FDPA 1O3JA 1GG6B 2HPQH 5AHGH 3ZZ4A 1O3CA 1FI8A 4MPUA 1GMHG 3ZYDA 2ZGJA 3MO9A 1ZJKA 2FP7B 1Z8IB 1W11U 3EGKH 1V2PT 2BD2A 1GHVH 2NU2E 5GWZA 1C4U2 4K2YA 2UWOA 1F0SA 2YNAA 2ZI2H 5E2OA 1O5BB 1BTUA 3LT3A 3O8CA 4JK6A 1NRNH 1C2HA 1EB1H 4U01A 3SOSA 1O5EH 2FOGA 2Z3EA 1KDQB 3MNCA 4Y8XA 3ATIA 1P9UA 1TGBA 2QIQA 4B2BA 3ZVAA 1RFNA 2C8WB 4X6NA 2TPIZ 4I7YH 2ODPA 3VB6A 2GZ8A 1SQAA 2FOHA 2OQUA 9LPRA 3GCTG 6GCHF 1HUTH 1ESAA 4DVAU 3AAUA 2ZU2A 1TONA 1UK2A 2PW8H 1LVYA 3KQEA 4FUDA 4JYVH 5FPTA 4MNYA 2O9QA 1KXFA 1GI8B 3SGBE 3EA8A 2NU0E 2UWPA 1B7XB 3RXKA 7ESTE 1L4ZA 2BVSH 3SBKA 1NROH 1SG8B 4Y0YE 3SO3A 2F9NA 1SHHB 4ZKOU 1TNHA 3A88A 2IJOB 2F9UA 4CHAB 3PMJA 2QF0A 4XSKU 2B8OH 4XBBA 3EQ0H 4DOQA 1SB1H 4BOHA 1DSUA 5H4IB 2DE9A 2WPLS 1S0RA 1YCPM 2QA9E 1F5KU 3RXLA 3ZZAA 2PUXB 1TPAE 5EQQA 3ZZ5A 1E35B 1P2IA 1LVMA 3TVJB 4YZUA 1A1RA 5FBEA 3V3MA 1DITH 1GPZA 1M9UA 3F6UH 3S9AA 4X1PU 1C1RA 2CN0H 4CH2B 1DANH 3LGVA 1PPEE 3BTDE 1GCTB 3WY8A 2ZTXA 2BY6X 1PQAA 2G00A 1DWDH 4BAQB 5EU8A 1LVOA 4H6TA 2R9PA 4FU9A 1GHXH 4INKA 5AFZH 4K1SA 1B0EA 1EZXC 3RMLH 1C1WH 5HM9A 2VNTA 3MU5A 4NGAH 2EEKA 2Y5HA 1P2NA 1W7GH 3UY9A 1H8DH 1XUHA 1DICA 1D4PB 3SQEE 1O3GA 1XUIA 3M3VA 4Q7ZA 1FIWA 3DT0H 1IQEA 1QIXB 1VJ9U 4HI3A 2UUKB 2A5AA 3QUMP 1GI5A 1EAXA 1A3EH 4YOGA 3UR9A 1WUNH 3Q3YA 1MU8B 3SUDA 1ZGVA 2WYGA 1QCPA 1AFEH 4NG9H 5EQSA 3URDA 4I32A 3RP2A 3RXOA 4NZLA 2LPRA 1GJ5H 2VVUA 1CA0C 3VXEH 5F8XA 1A2CH 2BXUH 2CHAC 5FPSA 3M7QA 1T8OA 4JZ1A 1W3CA 1BBRH 7GCHG 2GTBA 4A7IB 1THRH 2H9EH 3R3GB 3EDXB 1Z6EA 4XOJA 5EPNA 1MKWH 1P04A 2V6NA 3BEUA 4CRDA 4Y11E 3PMHB 4UDWH 1GL0E 1SGPE 1BJUA 4Q7XA 1YPHE 5J4QA 1G30B 4ZKRU 1IQGA 3ZV9A 1SGEE 2HLCA 5EQRA 1OKXA 3ZZDA 1EUFA 1Q2WA 2A1DB 5BPEA 3FZZA 3BV9B 3E16B 4X6PA 5FX5A 5PTPA 2ZCKP 1ZRBA 5EOKA 2FI4E 5G4BA 2GX4A 4ZKSU 2ZFTA 1HAVA 3GISB 3ZVCA 1ZLRA 3I29A 3VB4A 3R0FA 3UPEA 5DP8A 3U1IB 4LZ4B 1DM4B 2P59A 1HAPH 1HIAA 4ASHA 2FEQH 3SW2B 3E91A 3NKKA 1YCPK 1BMMH 2CMYA 2F9BH 1FNIA 3NZIA 2AH4X 1GMDG 1O2KA 3UOPA 2Y82A 1QJ7B 1SQTA 2OC1A 1E0FD 5FX6A 1BRAA 1IHSH 4BNRA 1RS0A 2VWNA 5TJXA 3V0XA 3QDZB 4FUGA 2ZDLA 1V2UT 3UTUH 2GV6A 4Y8ZA 1Q3XA 4AYYB 1IQNA 2UUYA 2Y6TA 4B74A 2EI7A 4GLYA 1BRUP 1EOJA 1DE7H 1ZSKA 1GBCA 1HXFH 1ZSLA 2OC7A 2VH0A
chains in the Genus database with same CATH superfamily
1RRKA 1ANCA 3BTEE 1HGTH 3ESTA 1OP2A 1BHXB 4NA8A 5DP4A 2Q6GA 4D8NA 5IDKA 2R3UA 2BD5A 3PMBB 4AZ2B 1OYTH 1LPZB 4XD7D 1AVGH 3SU3A 2OTVA 1QL7A 1L1NA 2VGCC 2SGEE 3HK6B 2XBYA 3GCOA 1QB1A 1W0ZU 3RXIA 1CA0B 5DJ7A 5EXLA 3KQBA 1SGNE 1UVPA 3SZEA 2QV1A 2CHAB 1HNEE 2ZPSA 4Y79A 1C1NA 1DOJA 2QXJA 4R0IA 5DN6D 1FXYA 4Q80A 1GI2A 2XCNA 4IBLH 3TNSA 2OC8A 1HIAB 2PR3A 1KTSB 1UTPA 2BDGA 2ANMH 4AFUA 2PUQH 1TRMA 1MAYA 2FLBH 1C5VA 1XVMA 1AMHA 2QGRA 1DUEA 3PV2A 4TPYA 1KSNA 3ATLA 1AB9B 4UD9H 2ZGBH 2FMJA 2VU8E 3SGAE 3RMNH 4WXVA 2WPMS 1UJ1A 1CVWH 1EX3A 2FOAA 4IN2A 1SLVB 1TAWA 1KLJH 3SNCA 5CE1A 2A0QB 4ZAEA 1HAGE 1LKAA 1WXRA 2IPHA 1UHBA 2Z9JA 1O5CB 1S6HA 3K2UA 1P12E 2OP9A 4SGAE 2BM2A 2QXHA 4X8SH 4TY6A 1YC0A 3ZZ9A 3TK5A 1YLDA 1WQVH 2H5DA 1A5IA 3HGPA 3SNBA 1SKYE 3W1EA 1PQ5A 3KQCA 4I86A 2BDBA 1CHOF 1C2LA 2O8MA 2FX6A 2G55A 1C5XB 1CGHA 4F4OC 1P0SH 1YYY1 1GBEA 2XTTB 4BAMB 5EGMA 2IN2A 3MQKC 2A4GA 1SGFA 4K8YA 1G3DA 3CENA 1GBAA 1MCTA 2HNTE 5CDFE 1QFKH 5L6NH 2AEIH 1HAIH 1XXFA 1QA0A 2OQ5A 4NFFA 8ESTE 5EXMA 5IK2D 2W6JD 2F9VA 5HIYA 1MU6B 1C5NH 2YMSC 2H9HA 1W0YH 1OYQA 1IAUA 1AE5A 1T31A 4P00A 2QXIA 1GMHF 1THSH 2C90B 2P3FH 3SN8A 3LIWA 2VGCB 3DSOA 4AOQA 4WMFA 1O5GH 5AFYH 3RUOA 3B8JA 2HALA 1FY4A 1BBRE 1JOUB 1TALA 1UVSH 4K5ZA 2VBCA 2AIQA 1SLWB 1ELFA 2ZHFH 3MNXA 4B1TA 1JBUH 1NU7B 1O2UA 1WV7H 1XM1A 2BOKA 3T25A 2BY5X 1AFQC 5JDUB 4FUHA 3T26A 1YPMH 4DURA 4F48B 1C4V2 1O3FA 8GCHG 1QJ1B 2KAIA 1ZPZA 2OC7A 2Z3DA 2P93A 4XDEA 2FOBA 1Z6JH 2BDIA 3S9CA 2H5CA 4E05H 1V2TT 1TB6H 4ZKNU 1GBIA 1GBFA 4ZXYH 2H2ZA 1MKXK 1P8VC 3A7ZA 5JBTA 3RXFA 2J38A 1Y3WA 5AVDA 1JXPA 1ZOMA 3P8FA 5DP3A 3TNTA 4B6FA 2YNBA 4ABGA 1P2OA 2V7QD 2BD8A 1O31A 1FQ3A 3OFND 5GPIB 1V2NT 3RM2H 2AGGX 3FP7E 1J15A 1TYNA 5L2YH 2FS9A 2D2DA 4UFDH 3TH2H 4ISNA 2FPZA 1EZQA 1K1NA 1HBTH 1AZZA 3OU0A 1DT2A 5A8YA 4ZXXH 1GBTA 2J4IA 1Z1JA 2VIPA 1EP5A 2QF4A 2TGPZ 2QAAA 2BZ6H 5FCRA 1K1OA 3BTFE 4AFZA 1MBMA 1V2LT 4BAHB 4X6MA 1QRZA 1TBRH 2ZIQH 3VPKA 5JB8S 1D3DB 1DLEA 4GPGA 4AFQA 1MKWK 1DS2E 1LHCH 1NFWA 2C93B 2OXSA 4FVBA 4X6OA 3D65E 4LXBH 5TCAA 1G3EA 1O2LA 4CRBA 3L3TA 1SGDE 4WY3A 3EAJA 1GCDA 1CSOE 1GBJA 1XX9A 2V0BA 5C94A 3GDSA 4NWLA 1MH0A 1A7SA 5B6OA 1FONA 2Y5FA 1HAYB 4A1XA 1N8OB 2A4RA 1PPCE 4E7NA 5I25A 1CT4E 3BTGE 1TX8A 1Z8JB 1CHGA 5E0JA 4XBDA 1QURH 1IQFA 1EOLA 2KZ4A 1DY9A 1FJSA 1RIWC 3H7TA 1NPMA 4JZFH 5DP6A 4ZROA 1BQYA 2SFAA 4OS6A 2Z9GA 2DE8A 1C1SA 1BITA 2YMSB 3M5MA 1J16A 1TRYA 2BYAX 1VCPA 2EI8A 2VIWA 1BTPA 4A1TA 3O8DA 2A2XH 1D6WA 1PPHE 2ANKH 1MD8A 3A7YA 1ESBA 4K8BA 4OS1A 1O3DA 2A7JA 3KF2A 1EZSC 1GJ4H 1GI1A 2CV3A 4YOIA 1UCYK 3HK3B 1YKTA 4OS4A 4XBCA 1S81A 1E36B 1ZHMA 1WTGH 2BVXH 4CBOA 3BEFB 1THPB 2ZU3A 5SGAE 1BJVA 2C4FH 1AFQB 2J5UA 1P57B 1LHDH 3M36A 3UAIC 1H4WA 2ZP0H 2A5KA 4YLUA 3F9EA 3A7WA 3V7TA 1ZHRA 4KTCA 1FZZA 1ARCA 1O3EA 1XUFA 3STIA 1TBQH 3GY5A 1KDQA 1GJ6A 2XRCA 1EAUA 3P8NA 3A8CA 2BQ6B 2ZDMA 7GCHF 1GWAA 1MTVA 3ZZ8A 1S82A 2FOMB 4AX9H 2JETC 1QA7A 3AW1A 3SJKA 3GY6A 2TRMA 1JIRA 2VB0A 1GCTC 3OAAD 1RD3B 1QGFA 1UTKA 4Q2KA 1ZYOA 1WU1A 2QF3A 1YPKH 2WINI 4BTTB 2ZPRA 3QZQA 2QC2A 3RM0H 1DWBH 3VGCC 3W95A 1YPHC 4YM9A 3P92A 1LQEA 4OGXA 5EG4A 1BTWA 3PTNA 4H42U 3B9FH 5DPAA 4J1YA 1DPOA 1HPGA 2GCTC 3E0PB 1ANEA 5HKKD 3GY2A 4Y7BA 4HGCA 3IITA 1OWJA 1E38B 2V3MA 3NRLA 1VITG 2HVXA 2R0LA 1ZRKA 3MHWU 2ZNKH 1ELVA 4DG4A 5GDSH 5A0AE 2GT8A 2SNVA 1B5GH 4DGJA 5I46H 2ANWA 2HRVA 1FY5A 5C17A 3SV8A 3SV6A 2B0FA 4FVDA 2WYJA 3U98H 1BTZA 3SV7A 1RIWB 4ZHLU 3ITIA 3ODFA 2OC0A 2G52A 4ABAA 4Q4LA 1ID5H 4H4FA 1AY6H 3M3TA 1MTNC 1WBGB 2IJD1 3OEED 4X8UH 3HPTB 1FY1A 3K6YA 4MNWA 3SU2A 1QBOA 2F9PA 2KX4A 3VB5A 3TGIE 3RXAA 4MDSA 1ZMNA 1IQMA 4HFPB 4RT0A 2BHGA 3PO1B 1T4VH 3BG4B 4D76A 1C1VH 1D3QB 1AI8H 2ANYA 1F92A 3DFLA 1O3NA 2NU3E 5ESBA 3TJOA 2WPKS 1SFQB 3MU0A 4FXGH 2FM2A 3GICB 3PLPA 3A86A 1HV7A 1BHXF 4UFGH 3BTHE 4JCNA 1UVUH 4E7RG 2BX4A 2H9TH 3GDVA 4KTSA 1SC8U 1SHYA 3N7DA 1K21H 2PKAB 2XNDD 4FETA 4LOYH 3RXMA 1L0ZA 2F43B 5FBIA 1YLCA 1BMFD 3BSQA 4OM9A 1HB0B 3K9XB 1L1GA 1XUGA 3CS7A 2ZDVH 2ZHWH 3FP6E 1D3PB 2ESTE 1O2MA 3UOUA 3SV9A 5C1XA 1OXGA 3U8RH 1K1LA 3ELAH 4NFEA 3ATWA 3QGJA 3C1KA 4DT7B 1K1MA 2GDDA 3UR6A 4BAOB 2RDEA 2VIQA 5A2MH 1IQLA 1MMJN 4WJG2 3SJ8A 2JETB 4ABHA 1BTXA 2AIPA 1V2KT 3BN9A 4I8KA 1MTSA 2ZFQH 3E90B 1W10U 3AVZA 1O2VA 2KCYA 5LH8A 3KNXA 4ISLA 3TGKE 3S9BA 1O39A 2VWMA 1TIOA 1BRCE 1HJAB 1T4UH 3UFAA 4Q63A 1ELEE 1XXDA 4CR5A 2GT7A 3VGCB 4AB8A 3I77A 3MFJA 1J14A 1ETRH 1AUJA 4IGDA 2Z9KA 4Y0ZE 1QRXA 1HLTH 2FOFA 1YPGH 2GCTB 2HLDD 2FIRH 1OWHA 1G2LA 4BAKB 3TK9A 3NUMA 1ELBA 4Q7YA 2PKSC 1AQ7A 3DUXH 1SFIA 1HAXB 4AGKA 1FPHH 5KGOA 1MZDA 3PRBA 2FX4A 5EXNA 5F03A 1DXPA 4ZUHA 3SU6A 4GAWA 2V3HH 2BQWB 4JZIA 4OS5A 2P16A 4FU7A 2VWOA 4KELA 1KLTA 2EA3A 1P2MA 1YF4A 2TGTA 2ZC9H 1BMLA 2B9LA 4WWYA 2BDYA 4Y76A 5F53A 1GI7B 1O2HA 4WH6A 1IOEA 4WH8A 1MTNB 5DP9A 3PWBA 2K0QA 1ZTLA 4DY7B 1F0RA 4NIWA 2FTLE 2ZO3H 1TGTA 2R3YA 2PV9B 1D6RA 1RGQA 1KYNA 3SYJA 1NT1A 1KY9A 2ZTYA 2DUCA 3UB0A 1NC6A 1V2ST 1Y3VA 1OPHB 2VIOA 1C1UH 2QYIA 3ZZ3A 1XUJA 3MH6A 5EW1H 1MBQA 4DW2U 1AVXA 1KXEA 1C5LH 1QL9A 2BLWA 5JYIA 1NY22 3GS9A 1O34A 2P95A 3IG6B 1ESTA 3RXEA 4Y10E 1Z7KA 2AGIX 2RG3A 1AB9C 3SNAA 1K1PA 4AB9A 2G5VA 2FYRA 1GHZA 1QNJA 1UMAH 3F0OA 1C5WB 1UTMA 3QN7A 3FKSD 3A80A 4NSYA 2ODQA 1NM6A 1ELGA 1H9LB 5GCHG 1K2I1 1SSXA 8GCHF 3LH3A 3RC6A 4IMZA 2H6MA 5FAHA 4ZHMU 1S6LA 2F83A 1UTQA 4LK4A 1J17T 1ZHPA 4MVNA 2FZZA 3KHVA 1NO9H 1O2ZA 1ANDA 2GP9B 1O35A 1SMFE 2P8OB 2BOHB 1K1IA 4TPIZ 4AFSA 3H7OA 2KCPA 3P95A 1O2XA 2BY7X 5JPMH 3QZRA 1BT7A 2YOLA 1J8AA 3NXPA 1OP0A 1LPKB 4BTIB 1GHBG 5LPFA 3I78A 2BLVA 4YOJA 3LGUA 1O2TA 4ZHAA 1NTPA 2PKSB 3BF6H 2P3TB 4NIVA 2GD4B 1O2RA 1QTFA 1SQOA 2VJ1A 1F7ZA 1NBMD 3EE0B 2VVCA 1PQ7A 3RXBA 1O3IA 1LCYA 1Y3YA 4FUJA 1SBWA 1LVBA 2AYWA 4X1QU 2J92A 4AN7A 3RU4D 2XXLA 3H09A 4D7FA 4MNVA 1C2FA 1NRRH 2BQ7B 2NU4E 4B75A 4D9RA 2ZDKA 2FOCA 3VFEA 2AGEX 1IQHA 5FXLA 1C5PA 2ZFPH 1QB9A 1SGIB 2BD3A 1KXBA 1FN6A 2A4OA 1QBNA 2G81E 1Y3XA 4I8GA 1GI9B 1TPPA 1H8HD 1ZZZA 2SGQE 4H6SB 1UK4A 2BDHA 3N7OA 1YLNA 1SGTA 3CP7A 2ZFRH 1GJ8B 1GI6A 1LDTT 2AFQB 2W26A 4QT8C 4K3JA 1N6XA 2V3OH 4B76A 1OSSA 1P2JA 1FY8E 2HWLB 1Y59T 1HJ9A 2CJIA 3BTKE 3SUGA 1MAXA 3JZ2B 3FVFB 3HKIB 1N6YA 2ZDAH 4X1RU 2G4TA 2ZFFH 1MABB 1K22H 2SGFE 2JH6D 2EC9H 1O3MA 3F9FA 1S83A 1YPLH 4INHA 1S0QA 2K1QA 7KMEH 1O2WA 1PYTD 1AZ8A 1MZAA 1U6QA 1EP6A 1P2KA 3RXSA 1V2VT 1SGQE 3PV5A 1MTWA 3F3BA 1V2OT 1PPZA 1GVLA 2BX3A 2RCEA 3STJA 3QK1A 1TABE 1JWTA 2BDAA 2OUAA 3NWUA 4I31A 1C5RA 3EA7A 2RDLA 4Z1MD 1BMAA 1UW7A 3AASA 5L30H 2ODYB 3VEQB 1JRTA 1QB6A 1RTLA 1GDNA 1DWEH 1GL1A 3LC5A 4I33A 3RC4A 3UREA 4BANB 1TA2A 4RT1A 1ZTJA 5C2ZA 1G32B 3P17H 2PWXA 3RLWH 3TH4H 2ZF0H 2KFWA 2ZCHP 2KCOA 9ESTA 1N8OC 1C2IA 4LZ1H 3SZNA 2GZ9A 2PHBA 1O3PB 2LELA 2UWLA 2W6ID 1YM0A 3T29A 1DSTA 1WSSH 2WV5A 1SOTA 1BZXE 2ZQ2A 3F1SB 2NU1E 4RI0A 1C5UA 3AK5A 1NESE 5LPEA 3WWBA 3DSGA 5A0BA 2D1JA 4AG1A 3F0PA 5LGOA 1NFXA 4GSOA 4ACAA 2B5TB 5C0TA 1TMTH 1FUJA 3SNEA 2Z9IA 5KECA 5GNDA 5T1VA 2O8TA 2XCFA 3RXPA 4KP0A 6CHAB 1D9IA 3UWIA 1VITF 3KL6A 2ILNA 1P03A 1ZJDA 1H8IH 1V2QT 1V6DA 2BB4A 3U8TH 1F0TA 1K0HA 1O3BA 2C3SA 4MG3A 1LMWB 3M7UA 4K1EA 4CRCA 3H5CB 4Z6AH 4O9VA 1UO6A 4TWYA 4O3UA 1AO5A 4YXWD 1HXEH 2W7SA 1W7XH 1EKBB 3M5NA 3OE7D 2GVFA 3E1XB 2FODA 5T6DA 3GCTF 3Q76A 1A61H 4AC9A 2Y5GA 1LHEH 3PLBA 3UNRA 1E37B 1F0UA 3MTYA 3SI3H 3DA9B 3P6ZB 3ZZ6A 2VH6A 2VIVA 3HATH 3SJIA 2XYAA 1Y8TA 5EODA 3FANA 4WXIA 1MCVA 1O2PA 1T7CA 2R0KA 4BXWA 3D23A 1YGCH 2Q1JA 1IQJA 4JMYA 3T27A 2HPPH 3NCLA 4OS7A 3GY7A 3SU5A 1TGCA 1KXAA 1UTJA 1BOQA 1EJNA 3RXJA 1BBRK 2GMTB 4ACBA 1ZMJA 5A8ZA 5T6FA 1PPFE 1ELTA 1V2MT 4Y7AA 4DCDA 2KM0A 3M35A 2PFEA 1MQ6A 2ULLA 3E0NB 3RMMH 1C2JA 3ZV8A 5CHAC 2WV4A 1TNIA 2G8TA 3LGYA 1JIMA 1TFXA 5FCKA 1W13U 4UEHH 4INLA 3B23B 2TIOA 4X2VA 1Z8RA 1C1QA 2R2MB 1C9PA 1O30A 1G3CA 2QCYA 5K7RA 5EJZA 1G3BA 1FLEE 1VR1H 8LPRA 4HG6A 2GDEH 3IWMA 2NWNA 3GY8A 2FI5E 3MNBA 2BZAA 3RLYH 3DCLA 2AS9A 1HYLA 1NN6A 2QN5T 3F68H 2W3KA 1P3EA 3FFGA 3MMGA 2PGBB 1MD7A 3SI4H 4ESTE 1ABJH 1C5QA 5E0GA 4JYUH 3ZVFA 1SL3A 4P02A 4X8TH 1RTKA 2O8UA 4A6LA 3SHCH 2EQNA 2M5TA 2C8YB 1BTHH 1VJAU 4NIYA 3UQOA 6ESTA 4FU8A 1SGRE 1EASA 3TPIZ 1VGCB 3GDUA 5JBBS 1NBME 1GHYH 2Z6BD 3F2HA 3PO1C 3BG4C 2ZHEH 1L1JA 1NRSH 1TPSA 2WPHS 3RMOH 2Z94A 1L2EA 2OINA 5JBAS 1GHWH 5EJLA 3RU4E 1WCZA 4B2AA 3MH4A 1K1JA 1CT2E 4GVUA 3LGIA 1O33A 4X1SU 1SLUB 4R8TB 1LHFH 1W14U 2FO9A 1EPTC 1E34B 1WAYB 1O2YA 2XNIA 4IC6A 5ESTE 1C2EA 1GI3A 2SNWA 1GJAB 5FHTA 1OWDA 1YCPH 1KXDA 3RXUA 1L4DA 3RXTA 4OS2A 4MQAA 3S69A 4CBNA 1P01A 2CF9H 3PWCA 2OBQA 4ZH8A 1BRBE 3L33A 5E0HA 1NRPH 1P11E 1TQ7B 1EJAA 1H8ED 5LPRA 3MWIU 1UTLM 1V2RT 3K65B 1HJAC 1CHOG 3Q77A 3TH3H 3ZVBA 2I6SA 2BD4A 1BIOA 1QR3E 1OOKB 1DDJA 4FUIA 4KKDA 3RDZA 1HAOH 1DLKB 2PKAA 1TBZH 2XBVA 3KN2A 2GGVB 2UUJB 4CRGA 5CHAB 2ZECA 1EPTA 1GMCG 4MTBA 2JJ1D 4GUXA 3ZZCA 2F4LA 1KXCA 1BCUH 5A8XA 4WF8A 1HAZB 2BLOA 1GVKB 5EW2H 5GCHF 1CT0E 1O2IA 1C5ZB 1DY8A 3OY5U 1G2MA 4HTCH 4Y8YA 2XBXA 1C2GA 5IYTA 4ISHH 4AGJA 1CU1A 2XWAA 5F6MA 1K9OE 3PMAB 2M2AA 1A46H 3ZVEA 4CH8B 3ODDA 3D62A 1TNKA 1F2SE 1SVPA 5DP5A 1ELAA 1GMDF 2A7HA 2KR7A 1LO6A 1V2JT 4AORA 4ABBA 2ZHDA 3T62A 3A87A 5EPYA 2TGAA 3EA9A 1EQ9A 3DSPA 2WUBA 2ASUB 2ZA5A 3F2GA 4X8VH 2HVYB 2FS8A 1GBBA 3Q00A 1GHBF 1LTOA 2W7UA 4ABJA 4XE4A 1GDUA 1ZMLA 2ZG0H 2VWLA 1ELDE 1H1BA 3KYGA 1Z71A 2Y7XA 1FAKH 1CGIE 1WTHD 3F9HA 1A5HA 3RXQA 3PV4A 1C4Y2 1O36A 4Y71A 1C5OH 5K0HA 5A0CA 3QWCH 3Q3KA 5JBCS 1XVOA 3V13A 3A8AA 1ZTKA 3PRDA 2JJ2D 4ASUD 3F9GA 3BTME 1NFUA 1SLXB 2F3CE 1RXPA 2HOBA 3OSYA 3GY3A 3DD2H 3UWJH 1EPTB 4E06H 1BA8B 1OWKA 3HGNA 1RTFB 6LPRA 1C5SA 2ZPQA 5CMXH 4CR9A 3NK8A 3CS0A 3GOVB 4IMQA 2QY0B 3GY4A 5GIBA 2AMDA 2BMGB 5CHBA 3TJUA 1Q31A 3U28C 2C8ZB 1O5FH 1QBVH 2J94A 1VCQA 3MU8A 4YLQH 3ZVGA 2HNTF 2Q6DA 2Y81A 2WPIS 4YT6H 1HJ8A 1E1RD 4KTUA 1C2KA 1XUKA 3QX5H 3P8OA 4O97A 1P10A 2ZCLP 2A7CA 2C8XB 1ANBA 2FOEA 4BTUB 1AE8H 1CA8B 2P8OC 1TRNA 3BTWE 3SORA 1A5GH 1H9HE 2ZEBA 3A84A 2SGPE 3PLKA 3FZDA 3A81A 2ZGHA 1G37A 1CQQA 1TGNA 2JDID 1GBKA 1DWCH 3ZYEA 1Y3UA 2P94A 5BRRE 2ZTZA 3BTQE 1GI4A 3FOAA 3UNSA 1S85A 3MU4A 4OGYA 3RU4T 1ZGIA 3TGJE 1EZUC 1O38A 2XWBI 1GHAG 2SGDE 3LU9B 2ALVA 3EYDA 3S7HB 2XBWA 1YBWA 1WOFA 1C5TA 1QY6A 4ABEA 3TITA 1Z1IA 3VB3A 1TOMH 1SI5H 2GZ7A 1GBLA 3QTVH 2PTCE 1W12U 3A82A 4GCHG 1AHTH 3U69H 3FP8E 4RKOB 5FPYA 3MNSA 2CF8H 2J95A 1EAIA 2ZGCA 2FDAA 1JRSA 1GJBB 4VGCC 4RKJB 3PTBA 2Z7FE 1EATA 3K6ZA 1PFXC 1G9IE 1VKYA 3OTJE 1MKXH 3E6PH 1IQKA 4U30A 3W94A 4B2CA 2G4UA 2HNTC 2J97A 2STAE 2GCHG 1SPJA 4F49A 4NA9H 1FY3A 1GJ9B 1ETTH 4ABIA 2J9NA 2Z3CA 1HRTH 4YESB 2GV7A 2D26C 3TIUA 4TT3D 2ALPA 1PPGE 5ABWA 2B7DH 1WQSA 1P02A 1A4WH 3TK6A 2O8LA 3O8RA 3A85A 5B6LA 3QTOH 2O8WA 2BD9A 4CRAA 2OD3B 2VIDA 4SGBE 2CXVA 3MYWA 1TE0A 1C1MA 1B0FA 1P09A 2THFB 4FUCA 2FTMA 2FWWA 1A0LA 2PSXA 1SR5C 3AW0A 1A3BH 4ABFA 3QO6A 2ZFSA 1NRQH 2RA3A 5DO4H 4X0WU 3RXHA 3M5OA 1FX0B 3LPRA 1O3LA 1DFPA 1A0JA 3LH1A 4NWKA 4ABDA 1EB2A 1AU8A 1SOZA 1OWEA 5E8EH 2Y80A 4ISIH 2WUCA 1DUAA 1ABIH 1GVZA 3RXGA 1AWFH 1O3AA 4Z0KA 3L6PA 3TU7H 3FN8A 2ZZUH 1XKAC 2FXRA 3JZ1B 3BEIB 1HCGA 4X2YA 1O2OA 4YTAA 1OS8A 4A92A 1OWIA 3E3TA 1E1QD 2IOTA 1Z8GA 1COWD 3QGNB 3URCA 1C9TA 3UQVA 2XOKD 1P3CA 2BD7A 5C67A 2PLXA 1NU9A 1T8LA 2PP6A 2A2QH 2STBE 4K60A 4JYTA 4A5TS 1RJXB 1BMNH 3LDXH 1UCYH 1O37A 1SGYE 3T28A 2Y7ZA 3FAOA 4THNH 3BIVH 3A8DA 1LPGB 2OCVB 2A31A 3ATMA 6GCHG 1QRWA 2W3IA 4UONA 3AAVA 3OYPA 1NS3A 2BY8X 2PGQB 5E2PA 6CHAC 1YPJH 2QF5A 5T3HA 2SGAA 2WPJS 3SGQE 3GCHC 1XMNB 3A8BA 4O03A 1KLIH 3TJVA 4VGCB 3SHAH 2HGTH 3A89A 1AGJA 2ZU4A 2AERH 4K69A 1TQ0B 5C20A 1TMBH 2CK3D 1QQ4A 1TPOA 2GKVE 1EJMA 2JKHA 4DJZB 4KGAA 4J2YB 2FESH 1INCA 2BLQA 5C0UA 3LOXA 1QQUA 5F8TA 2A45B 2LNCA 4TWWA 1FAXA 1BDAA 1FIZA 1C1OA 4FUEA 4NA7A 3SU4A 1EAWA 2LP6A 4TY7A 3M37A 5DG6A 5C5OA 1HAVB 3A7VA 1TNJA 4ISOA 3G01A 1GI0A 4MPWA 1T8MA 1P9SA 1P2QA 3UIRA 4NZQA 3LKWA 5FL7D 1AN1E 3FO8D 4Y6DA 2WPDD 4K1TA 1GBMA 1GDQA 1X7AC 2F91A 1S84A 2A5IA 4JK5A 4CRFA 1FMGA 1Y5AT 1UVOA 1EXFA 3E8LA 3KGPA 4MNXA 3LJOA 1ZSJA 5ETXA 4U2WA 5DK1A 2GMTC 1O0DH 3QLPH 2YMSD 4M7GA 2G5NA 1T32A 4YO9A 2H1UA 3PB1E 1J9CH 1F5LA 2J2UA 4IW4E 3MH7A 4WVPE 3F2FA 4IN1A 4XFQA 1LQDB 4ZMAH 3ZZBA 1OHHD 4F55A 3CNRA 2Z9LA 1W2KH 1LKBA 1TNLA 2R2WU 2JH5D 5C1YA 4AYVB 3PROA 4I8LA 1FPCH 3U8OH 1A0HB 1HDTH 2XW9A 3SNDA 1GGDC 3MI4A 5DGJA 1G36A 1JMOH 3GCNA 4GHTA 1O5AB 3RXDA 3SQHE 1GJCB 4IC5A 3NPSA 3BIUH 1ZPBA 2A32A 4X1NU 1GMCF 1ETSH 1GJDB 3ZVDA 3WWFA 4TYDA 3S7KB 1N1LA 1PQ8A 2TGDA 5F8ZA 1VGCC 3A7XA 3WW7A 2XC5A 3LGTA 1PYTC 2KCAA 3SV2H 3UUZA 3GCHB 1DXWA 2JH0D 2GJGA 1DVAH 1FN8A 3SU0A 2F9OA 2BVRH 1NZQH 1IQIA 1AKSA 1ZR0A 5A09A 4MPXA 3TLOA 2J34A 4UFEH 1TWXB 3M5LA 3M7TA 2ZU1A 3T2NA 4DIIH 1C5MD 4U32A 3RXRA 1MTUA 1O3KA 1YP9A 3MO3A 3P8GA 1UHBB 5GJ4B 1QZ8A 1T8NA 1C2MA 2UUFB 3M61U 4RSPA 1O2SA 3SUEA 2EY4C 3D49H 4FUBA 4B73A 5DKMA 2Q6FA 1YWUA 1TNGA 1OX1A 4AG2A 3VB7A 4DIHH 1OP8A 3LC3A 1ZPCA 2TBSA 3OEHD 1CBWC 1S6FA 2PTNA 3VG8A 1Y5UT 4JZDH 2XC0A 1GBHA 3LGWA 1O5DH 1CGJE 2ZQ1A 1D3TB 1ELCA 3SU1A 3BG8A 4BXSA 3LJJA 4PROA 1QHRB 4NSVA 1SGFG 1VITH 3P70B 3O8BA 1TX6A 2FYQA 4D9QA 4UFFH 2JIZD 1H9IE 1O3HA 2BTCE 4YT7H 3A7TA 1S5SA 4FUFA 3TJNA 1V2WT 1TMUH 3ZZ7A 4JZEH 1AD8H 4D7GA 4IS5A 1K28D 4DT4A 5J4SA 2OLGA 3HKJB 2VVVA 1TLDA 3SJ9A 1O2NA 1UVTH 1MUEB 1AKSB 1TGSZ 1C1TA 3OX7U 1Y5BT 5JB9S 8KME2 4X2XA 3U9AH 1GGDB 5C5NA 4RN6A 1HFDA 1GG6C 2V35A 3KEEA 1UK3A 2I6QA 3ENSB 1UCYE 4WMDA 2W5EA 4I8JA 1DX5M 1AIXH 3RC5A 1LHGH 5HMAA 1IHTH 4B6EA 2IPQX 1MQ5A 2XC4A 1F5RA 3SUFA 4UE7H 1UTNA 1ORFA 1TX7A 3MOCA 1C5YB 5HIZA 1GBDA 2CGAA 5HGGA 5C1UA 1HAHH 5HYOA 5L2ZH 1GHAF 5HXFA 2KAIB 1AVWA 1P05A 3MH5A 4A1VA 3RXVA 2ZKSA 4B71A 1O2JA 2AMPA 4I8HA 3Q3XA 1CO7E 2D8WA 3M3SA 3KIDU 4CREA 2FLRH 2ZDNA 1O32A 4GCHF 3DFJA 2P3UB 1XKBC 2ZHQH 3OTPA 1UTOA 4WMEA 3BTTE 1V3XA 3DHKH 3ATKA 2OBOA 5T6GA 1O2QA 3VXFH 1TOCB 5GXPA 1NFYA 2AHME 3C27B 3MU1A 3T5FH 3U1JB 5C3NA 2A4QA 3KCGH 2RA0A 4MPVA 3LONA 2EI6A 3KQ5A 4O3TA 3RXCA 1C2DA 2VINA 3MO6A 1CE5A 3KQDA 4GHQA 1W0KD 3SJOA 1QJ6B 2GCHF 2OK5A 2QXGA 2BY9X 2AMQA 4CHAC 2ZU5A 1SGCA 3GYLB 1O2GH 1CBWB 4HZHA 1KTTB 5DP7A 4NCYA 4MLFB 1YPEH 1YY3A 3V12A 1TA6A 5TCCA 5AF9H 1VCWA 4X2WA 2PSYA 1KIGH 1O3OA 2J98A 2ZWLH 2FI3E 5HM2A 1FV9A 3N99A 1AUTC 1W8BH 3KYFA 1WYKA 2BDCA 7LPRA 1ARBA 3UNQA 4M9FA 5KEDA 3OY6U 1VZQH 3PYHA 1BTYA 2BXTH 2G51A 1GJ7B 1AWHB 3GYMA 1PPBH 1QL8A 1BB0B 4NIXA 4ZCNA 1ACBE 3S0NA 5EIYA 1C1PA 1PJPA 2ZGXH 3A83A 3PM3A 1P06A 1FDPA 1O3JA 1GG6B 2HPQH 5AHGH 3ZZ4A 1O3CA 1FI8A 2WSSD 1W0JD 4MPUA 1GMHG 3ZYDA 2ZGJA 3MO9A 1ZJKA 2FP7B 1Z8IB 1W11U 3EGKH 1V2PT 2BD2A 1GHVH 2NU2E 5GWZA 1C4U2 4K2YA 2UWOA 1F0SA 2YNAA 2ZI2H 5E2OA 1O5BB 1BTUA 3LT3A 3O8CA 4JK6A 1NRNH 1C2HA 1EB1H 4U01A 3SOSA 1O5EH 2FOGA 2Z3EA 1KDQB 1WDIA 3MNCA 4Y8XA 3ATIA 1P9UA 1TGBA 2QIQA 4B2BA 3ZVAA 1RFNA 2C8WB 4X6NA 2TPIZ 4I7YH 2ODPA 3VB6A 2GZ8A 1SQAA 2FOHA 2OQUA 9LPRA 3GCTG 2J98B 6GCHF 1HUTH 1ESAA 4DVAU 3AAUA 2ZU2A 3EE7A 1TONA 1UK2A 2PW8H 1LVYA 3KQEA 4FUDA 4JYVH 5FPTA 4MNYA 2QE7D 2O9QA 1KXFA 1GI8B 3SGBE 3EA8A 2NU0E 2UWPA 1B7XB 3RXKA 7ESTE 1L4ZA 2L74A 2BVSH 3SBKA 1NROH 1SG8B 4Y0YE 3SO3A 2F9NA 1SHHB 4ZKOU 1TNHA 3A88A 2IJOB 2F9UA 4CHAB 3PMJA 2QF0A 4XSKU 2B8OH 4XBBA 3EQ0H 4DOQA 1SB1H 4BOHA 1DSUA 5H4IB 1KMHB 2DE9A 2WPLS 1S0RA 1YCPM 2QA9E 2WV9A 1F5KU 3RXLA 3ZZAA 2PUXB 1TPAE 5EQQA 3ZZ5A 1E35B 1P2IA 1LVMA 3TVJB 4YZUA 1A1RA 5FBEA 3V3MA 1DITH 1GPZA 1M9UA 3F6UH 3S9AA 4X1PU 1C1RA 2CN0H 4CH2B 1DANH 3LGVA 1PPEE 3BTDE 1GCTB 3WY8A 2ZTXA 2BY6X 1PQAA 2G00A 1DWDH 4BAQB 5EU8A 1LVOA 4H6TA 2R9PA 4FU9A 1GHXH 4INKA 5AFZH 4K1SA 1B0EA 1EZXC 2RFKC 3RMLH 1C1WH 5HM9A 2VNTA 3MU5A 4NGAH 2EEKA 2Y5HA 1P2NA 1W7GH 3UY9A 1H8DH 1XUHA 1DICA 1D4PB 3SQEE 1O3GA 1XUIA 3M3VA 4Q7ZA 1FIWA 3DT0H 1IQEA 1QIXB 1VJ9U 4HI3A 2UUKB 2A5AA 1EFRD 3QUMP 1GI5A 1EAXA 1A3EH 4YOGA 3UR9A 1WUNH 4TSFD 3Q3YA 1MU8B 3SUDA 3N7EA 5EJ1A 1ZGVA 2WYGA 1QCPA 1AFEH 1SQRA 4NG9H 5EQSA 3URDA 4I32A 3RP2A 3RXOA 4NZLA 2LPRA 1GJ5H 2VVUA 1CA0C 3VXEH 5F8XA 1A2CH 2BXUH 2CHAC 5FPSA 3M7QA 1T8OA 4JZ1A 1W3CA 1BBRH 7GCHG 2GTBA 2WZQA 4A7IB 1THRH 2H9EH 3R3GB 3EDXB 1Z6EA 4XOJA 5EPNA 1MKWH 1P04A 2V6NA 3BEUA 4CRDA 4Y11E 3PMHB 4UDWH 1GL0E 1SGPE 1BJUA 4Q7XA 1YPHE 5J4QA 1G30B 4ZKRU 1IQGA 3ZV9A 1SGEE 2HLCA 5EQRA 1OKXA 3ZZDA 1EUFA 1Q2WA 2A1DB 5BPEA 3FZZA 3BV9B 3E16B 4X6PA 5FX5A 5PTPA 2ZCKP 1ZRBA 2L6OA 5EOKA 2FI4E 5G4BA 2GX4A 4ZKSU 2ZFTA 1HAVA 3GISB 3ZVCA 1ZLRA 3I29A 3VB4A 3R0FA 3UPEA 5DP8A 3U1IB 4LZ4B 1DM4B 2P59A 1HAPH 1HIAA 4ASHA 2FEQH 3SW2B 3E91A 3NKKA 2K8IA 1YCPK 1BMMH 2CMYA 2F9BH 1FNIA 3NZIA 2AH4X 1GMDG 3ZIAD 1O2KA 4XRNA 3UOPA 2Y82A 1QJ7B 4FOUC 5DSFA 1SQTA 2OC1A 1E0FD 5FX6A 1BRAA 1IHSH 4BNRA 1RS0A 2VWNA 5TJXA 3V0XA 3QDZB 2WHXA 4FUGA 2ZDLA 1V2UT 3UTUH 2GV6A 4Y8ZA 1Q3XA 4AYYB 1IQNA 2UUYA 2Y6TA 4B74A 2EI7A 4GLYA 1BRUP 1EOJA 1DE7H 1ZSKA 1E79D 1GBCA 1HXFH 1ZSLA 1BUIA 2VH0A
chains in the Genus database with same CATH topology
1RRKA 1ANCA 3BTEE 1HGTH 3ESTA 1OP2A 1BHXB 4NA8A 5DP4A 2Q6GA 4D8NA 5IDKA 2R3UA 2BD5A 3PMBB 4AZ2B 1OYTH 1LPZB 1AVGH 3SU3A 2OTVA 1QL7A 1L1NA 2VGCC 2SGEE 3HK6B 2XBYA 3GCOA 1QB1A 1W0ZU 3RXIA 1CA0B 5DJ7A 5EXLA 3KQBA 1SGNE 1UVPA 2QV1A 2CHAB 1HNEE 2ZPSA 4Y79A 1C1NA 1DOJA 2QXJA 4R0IA 1FXYA 4Q80A 1GI2A 2XCNA 4IBLH 3TNSA 2OC8A 1HIAB 2PR3A 1KTSB 1UTPA 2BDGA 2ANMH 4AFUA 2PUQH 1TRMA 1MAYA 2FLBH 1C5VA 1XVMA 1AMHA 2QGRA 1DUEA 4TPYA 1KSNA 3ATLA 1AB9B 4UD9H 2ZGBH 2FMJA 2VU8E 3SGAE 3RMNH 4WXVA 2WPMS 1UJ1A 1CVWH 1EX3A 2FOAA 4IN2A 1SLVB 1TAWA 1KLJH 3SNCA 5CE1A 2A0QB 4ZAEA 1HAGE 1LKAA 2IPHA 1UHBA 2Z9JA 1O5CB 1S6HA 3K2UA 1P12E 2OP9A 4SGAE 2BM2A 2QXHA 4X8SH 4TY6A 1YC0A 3ZZ9A 3TK5A 1YLDA 1WQVH 2H5DA 1A5IA 3HGPA 3SNBA 1PQ5A 3KQCA 2BDBA 1CHOF 1C2LA 2O8MA 2FX6A 2G55A 1C5XB 1CGHA 4F4OC 1P0SH 1YYY1 1GBEA 2XTTB 4BAMB 5EGMA 2IN2A 2A4GA 1SGFA 4K8YA 1G3DA 3CENA 1GBAA 1MCTA 2HNTE 1QFKH 5L6NH 2AEIH 1HAIH 1XXFA 1QA0A 2OQ5A 4NFFA 8ESTE 5EXMA 2F9VA 1MU6B 1C5NH 2H9HA 1W0YH 1OYQA 1IAUA 1AE5A 1T31A 2QXIA 1GMHF 1THSH 2C90B 2P3FH 3SN8A 3LIWA 2VGCB 4AOQA 4WMFA 1O5GH 5AFYH 3RUOA 3B8JA 2HALA 1FY4A 1BBRE 1JOUB 1TALA 1UVSH 4K5ZA 2AIQA 1SLWB 1ELFA 2ZHFH 3MNXA 4B1TA 1JBUH 1NU7B 1O2UA 1WV7H 1XM1A 2BOKA 3T25A 2BY5X 1AFQC 5JDUB 4FUHA 3T26A 1YPMH 4DURA 1C4V2 1O3FA 8GCHG 1QJ1B 2KAIA 1ZPZA 1BUIA 2Z3DA 2P93A 4XDEA 2FOBA 1Z6JH 2BDIA 3S9CA 2H5CA 4E05H 1V2TT 1TB6H 4ZKNU 1GBIA 1GBFA 4ZXYH 2H2ZA 1MKXK 1P8VC 3A7ZA 5JBTA 3RXFA 2J38A 1Y3WA 5AVDA 1JXPA 1ZOMA 3P8FA 5DP3A 3TNTA 2YNBA 4ABGA 1P2OA 3RM2H 2BD8A 1O31A 1FQ3A 5GPIB 1V2NT 2AGGX 3FP7E 1J15A 1TYNA 5L2YH 2FS9A 2D2DA 4UFDH 3TH2H 4ISNA 2FPZA 1EZQA 1K1NA 1HBTH 1AZZA 3OU0A 1DT2A 5A8YA 4ZXXH 1GBTA 2J4IA 1Z1JA 2VIPA 1EP5A 2TGPZ 2QAAA 2BZ6H 5FCRA 1K1OA 3BTFE 4AFZA 1MBMA 1V2LT 4BAHB 4X6MA 1QRZA 1TBRH 2ZIQH 3VPKA 5JB8S 1D3DB 1DLEA 4GPGA 4AFQA 1MKWK 1DS2E 1LHCH 1NFWA 2C93B 2OXSA 4FVBA 4X6OA 3D65E 4LXBH 5TCAA 1G3EA 1O2LA 4CRBA 3L3TA 1SGDE 4WY3A 3EAJA 1GCDA 1CSOE 1GBJA 1XX9A 2V0BA 3GDSA 4NWLA 1MH0A 1A7SA 5B6OA 1FONA 2Y5FA 1HAYB 4A1XA 1N8OB 2A4RA 1PPCE 4E7NA 5I25A 1CT4E 3BTGE 1TX8A 1Z8JB 1CHGA 5E0JA 4XBDA 1QURH 1IQFA 1EOLA 1DY9A 1FJSA 1RIWC 3H7TA 1NPMA 4JZFH 5DP6A 4ZROA 1BQYA 2SFAA 4OS6A 2Z9GA 2DE8A 1C1SA 1BITA 3M5MA 1J16A 1TRYA 2BYAX 1VCPA 2EI8A 2VIWA 1BTPA 4A1TA 3O8DA 2A2XH 1D6WA 1PPHE 2ANKH 1MD8A 3A7YA 1ESBA 4K8BA 4OS1A 1O3DA 2A7JA 3KF2A 1EZSC 1GJ4H 1GI1A 2CV3A 4YOIA 1UCYK 3HK3B 1YKTA 4OS4A 4XBCA 1S81A 1E36B 1ZHMA 1WTGH 2BVXH 4CBOA 3BEFB 1THPB 2ZU3A 5SGAE 1BJVA 2C4FH 1AFQB 1P57B 1LHDH 3M36A 1H4WA 2ZP0H 2A5KA 4YLUA 3F9EA 3A7WA 3V7TA 1ZHRA 4KTCA 1FZZA 1ARCA 1O3EA 1XUFA 3STIA 1TBQH 3GY5A 1KDQA 1GJ6A 2XRCA 1EAUA 3P8NA 3A8CA 2BQ6B 2ZDMA 7GCHF 1GWAA 1MTVA 3ZZ8A 1S82A 2FOMB 4AX9H 2JETC 1QA7A 3AW1A 3SJKA 3GY6A 2TRMA 1JIRA 2VB0A 1GCTC 1RD3B 1QGFA 1UTKA 4Q2KA 1ZYOA 1WU1A 2QF3A 1YPKH 2WINI 4BTTB 2ZPRA 3QZQA 2QC2A 3RM0H 1DWBH 3VGCC 3W95A 1YPHC 4YM9A 3P92A 1LQEA 4OGXA 5EG4A 1BTWA 3PTNA 4H42U 3B9FH 5DPAA 4J1YA 1DPOA 1HPGA 2GCTC 3E0PB 1ANEA 3GY2A 4Y7BA 4HGCA 3IITA 1OWJA 1E38B 1VITG 2HVXA 2R0LA 1ZRKA 3MHWU 2ZNKH 1ELVA 4DG4A 5GDSH 5A0AE 2GT8A 2SNVA 1B5GH 4DGJA 5I46H 2ANWA 2HRVA 1FY5A 3SV8A 3SV6A 2B0FA 4FVDA 2WYJA 3U98H 1BTZA 3SV7A 1RIWB 4ZHLU 3ITIA 3ODFA 2OC0A 2G52A 4ABAA 1ID5H 4H4FA 1AY6H 3M3TA 1MTNC 1WBGB 4X8UH 3HPTB 1FY1A 3K6YA 4MNWA 3SU2A 1QBOA 2F9PA 3VB5A 3TGIE 3RXAA 4MDSA 1ZMNA 1IQMA 4HFPB 2BHGA 3PO1B 1T4VH 3BG4B 4D76A 1C1VH 1D3QB 1AI8H 2ANYA 1F92A 3DFLA 2NU3E 1O3NA 5ESBA 3TJOA 2WPKS 1SFQB 3MU0A 4FXGH 2FM2A 3GICB 3PLPA 3A86A 1HV7A 1BHXF 4UFGH 3BTHE 4JCNA 1UVUH 4E7RG 2BX4A 2H9TH 3GDVA 4KTSA 1SC8U 1SHYA 1K21H 2PKAB 4LOYH 3RXMA 1L0ZA 5FBIA 1YLCA 3BSQA 1HB0B 3K9XB 1L1GA 1XUGA 3CS7A 2ZDVH 2ZHWH 3FP6E 1D3PB 2ESTE 1O2MA 3UOUA 3SV9A 5C1XA 1OXGA 3U8RH 1K1LA 3ELAH 4NFEA 3ATWA 3QGJA 3C1KA 4DT7B 1K1MA 2GDDA 3UR6A 4BAOB 2VIQA 5A2MH 1IQLA 1MMJN 4WJG2 3SJ8A 2JETB 4ABHA 1BTXA 2AIPA 1V2KT 3BN9A 4I8KA 1MTSA 2ZFQH 3E90B 1W10U 3AVZA 1O2VA 5LH8A 3KNXA 4ISLA 3TGKE 3S9BA 1O39A 2VWMA 1TIOA 1BRCE 1HJAB 1T4UH 3UFAA 1ELEE 1XXDA 4CR5A 2GT7A 3VGCB 4AB8A 3I77A 3MFJA 1J14A 1ETRH 1AUJA 4IGDA 2Z9KA 4Y0ZE 1QRXA 1HLTH 2FOFA 1YPGH 2GCTB 2FIRH 1OWHA 1G2LA 4BAKB 3TK9A 3NUMA 1ELBA 4Q7YA 2PKSC 1AQ7A 3DUXH 1SFIA 1HAXB 4AGKA 1FPHH 1MZDA 2FX4A 5EXNA 5F03A 1DXPA 4ZUHA 3SU6A 4GAWA 2V3HH 2BQWB 4JZIA 4OS5A 2P16A 4FU7A 2VWOA 4KELA 1KLTA 2EA3A 1P2MA 1YF4A 2TGTA 2ZC9H 1BMLA 2B9LA 4WWYA 2BDYA 4Y76A 1GI7B 1O2HA 4WH6A 1IOEA 4WH8A 1MTNB 5DP9A 3PWBA 1ZTLA 4DY7B 1F0RA 4NIWA 2FTLE 2ZO3H 1TGTA 2R3YA 2PV9B 1D6RA 1RGQA 1KYNA 1NT1A 1KY9A 2ZTYA 2DUCA 1NC6A 1V2ST 1Y3VA 1OPHB 2VIOA 1C1UH 2QYIA 3ZZ3A 1XUJA 3MH6A 5EW1H 1MBQA 4DW2U 1AVXA 1KXEA 1C5LH 1QL9A 2BLWA 5JYIA 1NY22 1O34A 2P95A 3IG6B 1ESTA 3RXEA 4Y10E 1Z7KA 2AGIX 2RG3A 1AB9C 3SNAA 1K1PA 4AB9A 2G5VA 2FYRA 1GHZA 1QNJA 1UMAH 1C5WB 1UTMA 3QN7A 4NSYA 3A80A 2ODQA 1NM6A 1ELGA 1H9LB 5GCHG 1K2I1 1SSXA 8GCHF 3LH3A 3RC6A 4IMZA 2H6MA 5FAHA 4ZHMU 2F83A 1UTQA 4LK4A 1J17T 1ZHPA 4MVNA 2FZZA 3KHVA 1NO9H 1O2ZA 1ANDA 2GP9B 1O35A 1SMFE 2P8OB 2BOHB 1K1IA 4TPIZ 4AFSA 3H7OA 3P95A 1O2XA 2BY7X 5JPMH 3QZRA 1BT7A 2YOLA 1J8AA 3NXPA 1OP0A 1LPKB 4BTIB 1GHBG 5LPFA 3I78A 2BLVA 4YOJA 3LGUA 1O2TA 4ZHAA 1NTPA 2PKSB 3BF6H 2P3TB 4NIVA 2GD4B 1O2RA 1QTFA 1SQOA 2VJ1A 1F7ZA 3EE0B 2VVCA 1PQ7A 3RXBA 1O3IA 1LCYA 1Y3YA 4FUJA 1SBWA 1LVBA 2AYWA 4X1QU 2J92A 4AN7A 3RU4D 2XXLA 4D7FA 4MNVA 1C2FA 1NRRH 2BQ7B 2NU4E 4B75A 4D9RA 2ZDKA 2FOCA 3VFEA 2AGEX 1IQHA 5FXLA 1C5PA 2ZFPH 1QB9A 1SGIB 2BD3A 1KXBA 1FN6A 2A4OA 1QBNA 2G81E 1Y3XA 4I8GA 1GI9B 1TPPA 1ZZZA 2SGQE 4H6SB 1UK4A 2BDHA 3N7OA 1SGTA 3CP7A 2ZFRH 1GJ8B 1GI6A 1LDTT 2AFQB 2W26A 4QT8C 4K3JA 1N6XA 2V3OH 4B76A 1OSSA 1P2JA 1FY8E 2HWLB 1Y59T 1HJ9A 2CJIA 3BTKE 3SUGA 1MAXA 3JZ2B 3FVFB 3HKIB 1N6YA 2ZDAH 4X1RU 2G4TA 2ZFFH 1K22H 2SGFE 2JH6D 2EC9H 1O3MA 3F9FA 1S83A 1YPLH 4INHA 1S0QA 2K1QA 7KMEH 1O2WA 1PYTD 1AZ8A 1MZAA 1U6QA 1EP6A 1P2KA 3RXSA 1V2VT 1SGQE 1MTWA 1V2OT 1PPZA 1GVLA 2BX3A 2RCEA 3STJA 3QK1A 1TABE 1JWTA 2BDAA 2OUAA 3NWUA 4I31A 1C5RA 3EA7A 2RDLA 1BMAA 3AASA 5L30H 2ODYB 3VEQB 1JRTA 1QB6A 1RTLA 1GDNA 1DWEH 1GL1A 3LC5A 4I33A 3RC4A 3UREA 4BANB 1TA2A 1ZTJA 5C2ZA 1G32B 3P17H 2PWXA 3RLWH 3TH4H 2ZF0H 2ZCHP 9ESTA 1N8OC 1C2IA 4LZ1H 3SZNA 2GZ9A 2PHBA 1O3PB 2UWLA 3T29A 1YM0A 1DSTA 1WSSH 2WV5A 1SOTA 1BZXE 2ZQ2A 3F1SB 2NU1E 1C5UA 1NESE 5LPEA 5A0BA 2D1JA 4AG1A 5LGOA 1NFXA 4GSOA 2B5TB 1TMTH 1FUJA 3SNEA 2Z9IA 2O8TA 2XCFA 3RXPA 4KP0A 6CHAB 1D9IA 3UWIA 1VITF 3KL6A 2ILNA 1P03A 1ZJDA 1H8IH 1V2QT 1V6DA 2BB4A 3U8TH 1F0TA 1O3BA 2C3SA 4MG3A 1LMWB 3M7UA 4K1EA 4CRCA 3H5CB 4Z6AH 4O9VA 1UO6A 4TWYA 4O3UA 1AO5A 1HXEH 2W7SA 1W7XH 1EKBB 3M5NA 2GVFA 3E1XB 2FODA 5T6DA 3GCTF 3Q76A 1A61H 2Y5GA 1LHEH 3PLBA 3UNRA 1E37B 1F0UA 3MTYA 3SI3H 3DA9B 3P6ZB 3ZZ6A 2VH6A 2VIVA 3HATH 3SJIA 2XYAA 1Y8TA 5EODA 3FANA 4WXIA 1MCVA 1O2PA 1T7CA 2R0KA 4BXWA 3D23A 1YGCH 2Q1JA 1IQJA 4JMYA 3T27A 2HPPH 3NCLA 4OS7A 3GY7A 3SU5A 1TGCA 1KXAA 1UTJA 1BOQA 1EJNA 3RXJA 1BBRK 2GMTB 1ZMJA 5A8ZA 5T6FA 1PPFE 1ELTA 1V2MT 4Y7AA 4DCDA 3M35A 2PFEA 1MQ6A 2ULLA 3E0NB 3RMMH 1C2JA 3ZV8A 5CHAC 2WV4A 1TNIA 2G8TA 3LGYA 1JIMA 1TFXA 5FCKA 1W13U 4UEHH 4INLA 3B23B 2TIOA 4X2VA 1Z8RA 1C1QA 2R2MB 1C9PA 1O30A 1G3CA 2QCYA 5K7RA 1G3BA 1FLEE 1VR1H 8LPRA 2GDEH 3IWMA 2NWNA 3GY8A 2FI5E 3MNBA 2BZAA 3RLYH 2AS9A 1HYLA 1NN6A 2QN5T 3F68H 2W3KA 1P3EA 3FFGA 3MMGA 2PGBB 1MD7A 3SI4H 4ESTE 1ABJH 1C5QA 5E0GA 4JYUH 3ZVFA 1SL3A 4X8TH 1RTKA 2O8UA 4A6LA 3SHCH 2M5TA 2C8YB 1BTHH 1VJAU 4NIYA 3UQOA 6ESTA 4FU8A 1SGRE 1EASA 3TPIZ 1VGCB 3GDUA 5JBBS 1GHYH 2Z6BD 3PO1C 3BG4C 2ZHEH 1L1JA 1NRSH 1TPSA 2WPHS 3RMOH 2Z94A 1L2EA 2OINA 5JBAS 1GHWH 3RU4E 1WCZA 4B2AA 3MH4A 1K1JA 1CT2E 4GVUA 3LGIA 1O33A 4X1SU 1SLUB 4R8TB 1LHFH 1W14U 2FO9A 1EPTC 1E34B 1WAYB 1O2YA 2XNIA 4IC6A 5ESTE 1C2EA 1GI3A 2SNWA 1GJAB 5FHTA 1OWDA 1YCPH 1KXDA 3RXUA 1L4DA 3RXTA 4OS2A 4MQAA 3S69A 4CBNA 1P01A 2CF9H 3PWCA 2OBQA 4ZH8A 1BRBE 3L33A 5E0HA 1NRPH 1P11E 1TQ7B 1EJAA 5LPRA 3MWIU 1UTLM 1V2RT