1A24A

Solution nmr structure of reduced dsba from escherichia coli, family of 20 structures
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
189
structure length
189
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DSBA
publication title Structure of reduced DsbA from Escherichia coli in solution.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 1998-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a24A00
4FIWA 4BWSA 1FB6A 3HVVA 5KN3A 2HLSA 3A3TA 3ZZXA 4I2UA 2LNTA 4EL1A 3IPZA 1FVKA 2OACA 4V2MA 3M9KA 5ECMB 3E9JB 4EDYA 1TI1A 3QFAC 4NV2A 3UEMA 1XWCA 2GTUA 4ULXA 1O7UA 4V2LA 3FR6A 4WR4A 4GTUA 4JR4A 2P0GA 1XZOA 4K0NA 3TRXA 1XVWA 4ECCA 2C0FA 2QGVA 2OKAA 4POBA 2DJ0A 4MPFA 2WFCA 2FWEA 5HFIA 1U88A 1B8XA 3ME8A 5CRDA 4G9HA 1UC7A 2H1DA 3HY2A 2C3QA 4WBJA 3PGTA 5E4WA 5IMAA 2C3NA 3OR5A 3GMFA 5IO2A 4HUAA 2AAWA 4XS4A 5CREA 4ML1A 1WJKA 2GGTA 1ZZYA 1QQ2A 2LJRA 1XCCA 1XBSA 1GSQA 1W89A 2AV4A 2J23A 3C8EA 2LRCA 4MJAA 2B5XA 4DEJA 5DQYA 1VF2A 3GKMA 5HR3A 1GLPA 4KUNA 2A4VA 5DJMA 3LYKA 5ECQB 2DJ3A 2YV7A 1WRYA 4NXIA 2WJUA 4MF7A 4DSSA 4I6XA 1GLQA 1HNCA 3ZMKA 2DMMA 2CQ9A 1VGLA 3D0ZA 4JEDA 5D9TA 4ZIJA 4EE0A 2VCQA 1PL1A 2VAFA 17GSA 5CO3A 5LCZA 3H1NA 2M46A 2REMA 3RPPA 3KEBA 3PINA 1K0AA 11GSA 1SK2A 4TR1B 3EE2A 1X0RA 2VL2C 2MBTA 4ZL9A 3D22A 3TKQA 4K7NA 2GSSA 4XS6A 3VI5A 3VURA 3ZTLA 1YY7A 1GL8A 1T4YA 4I8BA 2H70A 16GSA 2OBKA 1VRSD 1YKAA 2IMDA 1V98A 2G0FA 1OE8A 1K0DA 3HJMA 3KH7A 2VO4A 2H0HA 2GQLA 1LJRA 3W6GA 1U3AA 2PBJA 2X8HA 1JZWA 2F8FA 1EP8A 3FR3A 4ZBAA 4TR4A 3K8NA 5JWRB 2JZSA 5FT3A 4PQIA 3APSA 4POMA 3RHCA 3VWUA 3QAVA 1ON4A 3H79A 4N30A 2H8LA 2DLXA 2GSRA 2A2SA 1DBYA 5DDLA 4NHWA 1MEKA 4XS4B 1GTIA 4H86A 1VF4A 3MWHA 3TDGA 2NVLA 1Q4JA 4F03A 4F2IA 2L59A 4IS0A 4AJ7A 5D73A 3CTFA 1GP1A 2IFQA 3I43A 2TRCP 4ZB6A 5G2ZA 2E2GA 5FWGA 3EWLA 2GZYA 1O73A 3KZQA 4HZ2A 2ZUPA 4DSSB 1AUCA 2YJHA 2R6KA 5FHIA 1SJIA 1GTAA 2NPBA 2JL4A 6GSUA 4EC0A 1V2AA 2H75A 2ON7A 1B48A 2H6YA 1G0TA 5E59A 3L78A 2EC4A 2H01A 3TKSC 3ERWA 4KCEA 1M2BA 3LWAA 1T7PB 3EU4A 4G2EA 4K6XA 1MD4A 4IQAA 4WXTA 4MF5A 4ZBBA 2WCIA 5GSTA 3HKRA 3C1RA 3DMLA 3KP9A 1NW2A 2PPTA 1WE0A 4ZB8A 4EXJA 1AAZA 1HNBA 1S3CA 3GFKA 4TW5A 4I97A 2J9HA 3GL3A 1J0FA 4GLTA 4K2DA 4Q5FA 3L4NA 5HR0A 3EMXA 3FZ5A 3HA9A 2C4JA 4MJBA 1TRSA 3I6AA 2CVKA 4QL9A 3MAKA 1J08A 4GRFA 3DWVA 3D5JA 5IM9A 3RPNA 1TK8B 2L4QA 4K0GA 4EF0A 4QQ7A 3IA1A 1JLVA 1TI3A 4PUAA 3GTUB 2KUCA 1URMA 2V1MA 2FD3A 4YAPA 1OC8A 3FRCA 3LYPA 3UJ1A 3W8SA 1NHYA 5B7CA 4YQUA 1YZXA 2YJ7A 3CXGA 4RQRA 5J41A 3RDWA 2IFQB 1SKWB 4NV5A 2CAIA 2DBCA 4BPYA 2GQMA 1A2LA 2C80A 1BQ7A 2IMFA 1EV9A 2H19A 2VCTA 2JZRA 1NSWA 3ZITA 2HFDA 1AQWA 4ZB9A 2VLVA 1JHBA 2DC5A 2C0GA 1QUWA 5IMFA 1T00A 3I69A 1B9XC 4OMVA 1WOUA 1JFUA 3M0FA 1SYRA 1RQMA 1TDIA 1PMTA 2B3SA 1T4ZA 4ECJA 5DVBA 2HI7A 5G5EA 2C8UA 5HFGA 5IMCA 4X1UA 3UVHA 3HZ8A 5G31A 3EU3A 2IMEA 4IP1A 1CQHA 1BEDA 4I5QA 4FYCA 5EVOA 1HNAA 1BYEA 3HJOA 2H1BA 3KP8A 2CAQA 1XWGA 3LXTA 4RQXA 5CAXA 1KNGA 2LV3A 2AUVA 5F8BA 2EIOA 2KP1A 4EVMA 3F3RA 2FHEA 4L0WA 4IGJA 1Q98A 4LMWA 1MTCA 2VOCA 4AJ8A 5IPHA 4ZBDA 5HQPA 3TOTA 2XHFA 4TVEA 2TIRA 5IMVA 2X8CA 5KN0A 2I81A 3KTLA 2K9FA 2OE3A 3G7JA 1EP7A 1GWCA 5EL8A 3GX0A 4XS1A 1QGVA 1OVNA 4OO5A 2RUFA 5DCHA 4WKWA 1SK1A 2LS5A 4CDOA 6GSVA 5IO0A 4PNGA 3Q6OA 4J56E 1K0CA 2K6VA 1K3OA 3CSJA 2FUG2 3LQ7A 2XBIA 1T1VA 2H1AA 4WF5A 3G9BA 2ALBA 5DBQA 3TJFA 4JRRA 1XVQA 4F9ZA 3F6FA 4XHMA 1K3YA 1Z7RA 3GSSA 4KB3A 4BVYA 3TJKA 2VCXA 1A0RP 1X5CA 2XPDA 5G1LA 3ME7A 1SKSB 1WPIA 2I9HA 2H76A 4TXOA 5KN2A 5D8IA 3BOAA 1E2YA 5COHA 4MH2A 1TK0B 2CZ2A 2GLRA 1EZKA 2GT5A 5HR1A 1BJXA 1WP0A 3FHKA 1UVZA 3GRXA 3VWWA 3WYWA 2CVDA 1BG5A 1GH2A 3VK9A 2GDRA 4MJCA 2V6KA 5A4UA 5ECKB 3DVXA 1F3BA 3ZL5A 3QFBC 2CV4A 1EV4A 3HD5A 3WD6A 3NZNA 4BA7A 4N0ZA 1GSSA 5JWQB 3UAPA 2RLIA 5A4WA 2X8GA 3ERFA 1TRVA 3TGZA 2NTOA 3FYGA 5CRWA 2DJ2A 3E0UA 1ILOA 2LJKA 2LEGA 4CHSA 2B5EA 3IAM2 1B4QA 1SK0A 2IL3A 1K0MA 4HS1A 3GKKA 4IHUA 2R5GA 2FLSA 3KH9A 3LG6A 2MZCA 4ECBA 1TK5B 2R2JA 4WF4A 3TB2A 4F0CA 2L57A 4IKHA 1GUKA 3O76A 4O5RA 3EVIA 1TRWA 4KAEA 3WT2A 3CYNA 1A2MA 2JADA 2AHEA 4X43A 3DYRA 1TRUA 3LFLA 2YWIA 4JBBA 4MH3A 1G6YA 3FKFA 3EYTA 2F8AA 4POLA 2HRNA 2H73A 2FA8A 1SL1B 1V9WA 1IYIA 1XIYA 1CQGA 3CTGA 4BL7A 2E7PA 3F6DA 1T3BA 1K0OA 2I1UA 2H72A 1G7EA 1AIUA 3DGQA 2H0IA 4WR5A 3KMOA 1PRXA 1M2DA 4RUVA 1Z3EA 4YQVA 6GSTA 3ZIJA 5JWOB 4MMMA 3F9UA 4TXOB 3IHQA 4KSMA 5IIZA 2RUEA 3W8JA 4HQZA 1XW5A 4K7OA 3S9FA 1C72A 3IBHA 5ECLB 5GAPD 1F9MA 4AGSA 5GZZB 4XRAA 4MK3A 2DJ1A 3GX8A 3QPMA 2N5FA 2RIIA 1M0UA 1ZYQB 3C7MA 2K8SA 3PR8A 4TRXA 3M8NA 2I4AA 2JSYA 2NBSA 1TU8A 2PN8A 5CNWA 2LKUA 2IN3A 2K8VA 2VCZA 3LXZA 3WT1A 1IYHA 1YDKA 5DAKA 5EY6A 2PERA 3BJ5A 3A2VA 1PX6A 1KEBA 1Z6MA 5C00A 2VD1A 1YEXA 3APQA 2ZCTA 1O8WA 3HVXA 4Q5QA 1LU4A 5ENUA 5J4UA 3U6VA 2VCVA 3ISOA 1Z5YE 3HDCA 1WMJA 3R2QA 1B4PA 4DSRA 3HYPA 3V1WA 1O8XA 4WBRD 2PMTA 1F2EA 5ELAA 4K8MA 4EDZA 3GTUA 2L6CA 4O7HA 1ST9A 3FW2A 2WGRA 3F0IA 1FHEA 1MDJA 3VLNA 1ACVA 3GNJA 4IN0A 1QFNA 1OAZA 2QKEA 1M2AA 2DMLA 4MP4A 1AQXA 1TTZA 2QC7A 3FEUA 5JCUA 5C04A 2O8VB 1BAYA 2EIQA 4KE3A 4OO4A 2WULA 1QMVA 4ECIA 3CSHA 3LEFA 2XC2A 2CX3A 22GSA 4GSNA 2BTOT 3GN3A 4GSTA 4YQMA 4TOPA 5IPGA 1SJZA 1XWBA 2HSYA 1GSUA 2L5LA 4TR0A 2VD0A 3WGDA 3CRUA 4YH2A 1MDIA 2B1LA 4CW9A 3RBTA 1JLWA 4KDUA 3F3QA 5CRGA 1THXA 1X5DA 1SU9A 4KCAA 3US3A 1A8YA 1O81A 2VM2A 2YZHA 1XOAA 2O89A 18GSA 3A2XA 4J2FA 1M9AA 1YKCA 3Q18A 3GKNA 2M72A 3IXRA 3UBLA 1V58A 3KM6A 4ILFA 5J9CA 5ABRA 5DJLA 4XIHA 3MSZA 3D6IA 2YPMA 3GHAA 1PSQA 4LL4B 5D9VA 5IMDA 4FO5A 5DAKB 4F0BA 3I9V2 3UMAA 2P5QA 1FB0A 2N5AA 3IOSA 3VWXA 4HEA2 2V6OA 2H1GA 1YF1A 1OC9A 1ZMAA 1TXXA 4LMVA 2HE3A 4HDEA 3TCOA 1SD9A 3O3TA 4L5OA 3VI7A 1XWKA 3P7XA 5F05A 2FY6A 2KHPA 1X9SB 2YZUA 5AN1A 1Y6EA 5D9WA 1SYXA 5B6NA 2DIZA 1SL0B 1PD21 3O6TA 3ZVJA 6GSYA 1A23A 3KCMA 2C1YA 3IR4A 4KNDA 3ZREA 1DE2A 2YWOA 2CVBA 2X64A 1S3AA 4Z7XA 1LBKA 5A4VA 1JZOA 4ZXGA 20GSA 1DUGA 2V41A 1U87A 4EUYA 5H5RA 1OKTA 3J7Yk 5ID2B 4PQHA 4RI7A 2DSAA 3EURA 3QD9A 3A2WA 2GZZA 4GQFA 1SENA 2HNLA 1FOVA 3IK9A 4L5LA 1OE7A 4J57E 2CA8A 1YF0A 3ZMLA 4ISDA 2OE0A 4GQCA 1VF1A 1EEJA 3BCKA 3H4KA 13GSA 2GS3A 2ES7A 2IJYA 2AYTA 2HYXA 2MMZA 3F4SA 4GSSA 1M9BA 3FK8A 1VF3A 3EMPA 2FGXA 3NIVA 2C0DA 1XOBA 4MDCA 3KGKA 2FWHA 2BMXA 3Q74A 4QL7A 3TOUA 4ACSA 3UVTA 1TU7A 4PNFA 1OC9B 2IWTA 4KX4A 3L9UA 1FO5A 4FYBA 3IRAA 2HZFA 2HXKA 4BVXA 2L4CA 1O85A 2R4VA 2I3YA 1QXHA 3DD3A 4TR3A 2EIRA 4F82A 1V40A 4PX1A 2LQQA 5DQSA 5INYA 5ECHB 1K0BA 5IOWA 4NMUA 1O6JA 1ZYEA 1E6BA 2Z9SA 3IDVA 1G7OA 3TJBA 2GQKA 3TKRA 5F0GA 2PGTA 3GH9A 3A5WA 5D9XA 5IMZA 2LNSA 3Q19A 5DCGA 2H30A 1MDKA 2WDUA 1PQNA 2D2ZA 3QOUA 5A5KA 5CRHA 1NM3A 3J7Yb 4JZQA 1WIKA 3DEXA 1GRXA 2O85A 2FA4A 1J9BA 1M99A 5GAND 1YEPA 5ECOB 3VPTA 2VLUA 2LUSA 2DJKA 5ECPB 2L6DA 6GSXA 3UL3A 5J5NA 1SL2B 4DSQA 3FZ4A 2MYGA 4WEYA 2AB6A 3QR6A 3D4MA 3UARA 3ZFLA 3UBKA 2G2QA 1U6TA 4V1Ap 7GSSA 2FWGA 2TRXA 1EEMA 4PUFC 4GXZA 4MZWA 2YWNA 2XPEA 6GSWA 2LQOA 3FR9A 2IMIA 1TOFA 1EOHA 3EC3A 4E8EA 1U3IA 4I2TA 3M3MA 4KA0A 1KBNA 4PURA 1V57A 4P3YB 5G1KA 4XRDA 3KD0A 1AC1A 3APOA 2HZEA 4MCUA 4XTSA 3HXSA 2GT6A 2CT6A 4EO3A 2YWMA 3H8QA 1JZDA 4OCEA 2E0QA 2P5RA 2H6ZA 2YANA 3DRNA 4ZL7A 3BD2A 2HRFA 5D93A 5ECSA 1KTEA 1USBA 3VWVA 1GNEA 1X5EA 2VL2A 1HD2A 4GF0A 2WS2A 1EGOA 1BX9A 2VUPA 4L0UA 1AW9A 3D4TA 3C71A 1R26A 1A2JA 1M7TA 1AQVA 3GH6A 1K3LA 1X9WB 2WB9A 4OCFA 5D96A 3TKSE 5HR2A 5DALA 2MMOA 1Y25A 1X9MB 1WWJA 1UN2A 4HOJA 2LTKA 4JU5A 3QCPA 1R5AA 2F3MA 4X0XA 1OYJA 4IP6A 4AF2A 2PWJA 5AIVA 3IE3A 1PL2A 4K9ZA 3MDKA 3HZ4A 3ZFBA 1NHOA 1PGTA 3ERGA 1ML6A 2GSTA 3P90A 3L9SA 4JR6A 2VM1A 2GSQA 2K18A 3TJGA 2MMAA 3TKPA 1ZGNA 3LORA 2QSIA 1XW6A 1THOA 3F63A 3VPQA 3FY7A 3UOMA 2XBQA 4ML6A 3G7YA 3TUEA 1DE1A 1ERTA 3RHBA 2B7KA 1F37A 1XPVA 3HJPA 10GSA 2JSZA 1ERVA 5F06A 1ZOFA 4N11A 4O32A 1GSFA 5CP1A 1TJDA 3KTBA 3GSTA 4PGTA 2B6MA 2FWFA 4Q5NA 4D73A 19GSA 1OC3A 3WGEA 4FH8A 1G6WA 4OFNA 4N10A 3DXBA 3SBCA 2F51A 5F07A 1N2AA 3HCZA 2YCDA 2HZEB 5L71A 3IAS2 3HVSA 3TKSA 4N0VA 2B5YA 4KGIA 4V1Ag 3F8UA 3TRPA 4TKYA 3KJYA 1ERUA 3LSZA 1H4OA 2H66A 5IQYA 4WETA 5JCGA 2PVOC 2OBIA 2R3XA 4OFTA 2O87A 4ZL8A 2VL3A 4Q5RA 3CBUA 6GSSA 4HU7A 5DALB 3EINA 1GNWA 1I9DA 3TJJA 2RM6A 2PVQA 4IJIA 3C73A 4YAVA 5J3RA 4NPBA 3PH9A 1PKWA 3N5OA 1W4VA 2LRTA 3BBYA 3LGCA 3ZIVA 4K7IA 1XWAA 2O7KA 3ZYWA 5ID2A 3BCIA 4MZBA 1GUHA 3QAWA 3ZLPA 3RAZA 2F9SA 4LL1B 2PUKC 3QAGA 1EWXA 1T8EB 3LJRA 2VL9A 4MJEA 4ID0A 2KOKA 2BJXA 3FZAA 3DVWA 4KH7A 4HU9A 1F3AA 3F4RA 4DVCA 1S3DA 4NHZA 2GZPA 3CSIA 1XW9A 2C3TA 5B8AA 2PU9C 3TRQA 1AXDA 5HFKA 3GURA 3HHVA 3AY8A 4NWYA 4RI6A 3WGXA 5H5QA 4IW9A 1YJ6A 2JACA 4E8HA 1N8JA 1PX7A 1Z7PA 5B6MA 3GIXA 4KDXA 1FW1A 4D73B 2WRTA 4HI7A 2ON5A 2P31A 1GSDA 3G7IA 1RW1A 2VIMA 1JZRA 2B1KA 4ZILA 1OKDA 4MF6A 1UA5A 4GWRA 3D21A 3ZRDA 4IJ3A 3IC4A 4EKZA 1B9YC 2KLXA 2MBSA 1SJ6A 2OJLA 4AJ6A 2E2MA 3DKSA 4MZCA 3M1GA 4FYUA 1XFLA 3GL5A 4TN8A 4BWQA 2HT9A 1XXUA 5KEJA 2VLTA 4KDYA 4PXOA 4IVFA 4K1FA 1YQ1A 1GULA 1DSBA 4POKA 3M9JA 1R7HA 8GSSA 1H75A 1FAAA 3JCML 1GTUA 3CMIA 4G19A 1A0FA 2AJQB 2RM5A 1EOGA 4L8EA 2YN1A 2YV9A 1ZL9A 2YP6A 5EPFA 1R4WA 5G5FA 5H5SA 1GUMA 1TP9A 1F6MC 3KXOA 4KW6A 1HQOA 1RK4A 3GV1A 3IV4A 1A8LA 2H0GA 14GSA 1FVJA 3MNGA 2R37A 4G10A 1Z6NA 2VCWA 2JU5A 4HZ4A 5GSSA 5CYYA 2YOIA 3C1SA 3NOFA 2OE1A 4LLRA 4TXVA 2OADA 1SKRB 3VFIA 3L9VA 3KIJA 2LRNA 3E3EA 3GYKA 3FZ9A 1ZCPA 4OWYA 1HYUA 5ECRB 1R5PA 2LSTA 3KMNA 1MD3A 3QMXA 1I5GA 12GSA 2HSHA 2B7JA 2LJAA 4HJMA 5J9BA 5G30A 3H93A 3P8WA 5ECNB 2CZ3A 4IQ1A 3IK7A 2OA7A 5AISA 3QDNA 2H6XA 4IELA 2GVPA 5ECIB 3ZVJD 2CX4A 1A24A 1PN9A 2DJJA 1FG4A 5AIXA 2FNOA 3F4TA 2KP2A 2JZTA 4LA1A 3GUSA 2NDOA 1ABAA 3U5RE 3SWLA 2A2RA 5IOXA 1TKDB 1GTBA 4O92A 4OD7A 4MLYA 4KSOA 2C0EA 5LD0A 3GA4A 1K0NA 2M80A 1PA3A 2V2GA 2H71A 4IBPA 1Z9HA 5ELGA 2IMKA 2H74A 1EGRA 5KN1A 3UIWA 9GSSA 2L5OA 2X99A 3N9JA 3GKXA 1TW9A 3L0HA 2ZNMA 5B8BA 3ED3A 5AGYA 4JE1A 1GSYA 2MMNA 2YNXA 1SD8A 4XCSA 3P2AA 2IPAA 3DIEA 1QK8A 2DIYA 2IIYA 3CRTA 4OFMA 4PQ1A 4MABA 1GSEA 4TR1A 1PKZA 4HQSA 5LNKe 2FCHA 2WZ9A 4MPGA 4MA9A 4NAXA 4HJ2A 1ERWA 2V32A 4V2NA 2N5BA 4GCIA 5JCWA
chains in the Genus database with same CATH superfamily
4FIWA 4BWSA 1FB6A 3HVVA 5KN3A 2HLSA 3A3TA 3ZZXA 4I2UA 5KOXA 2LNTA 4EL1A 3IPZA 1FVKA 2OACA 4V2MA 3M9KA 5ECMB 3E9JB 4EDYA 1TI1A 3QFAC 4NV2A 3UEMA 1XWCA 2GTUA 4ULXA 1O7UA 4V2LA 3FR6A 4WR4A 4GTUA 4JR4A 2P0GA 1XZOA 4K0NA 3TRXA 1XVWA 4ECCA 4O5QA 2C0FA 2QGVA 2OKAA 4POBA 2DJ0A 4MPFA 2WFCA 2FWEA 5HFIA 1U88A 1B8XA 2QA1A 3ME8A 5CRDA 4G9HA 1UC7A 2H1DA 3HY2A 2C3QA 4WBJA 3PGTA 5E4WA 5IMAA 2C3NA 3OR5A 3GMFA 5IO2A 4HUAA 2AAWA 4XS4A 5CREA 4G0LA 4ML1A 1WJKA 2GGTA 1ZZYA 1QQ2A 2LJRA 1XCCA 1XBSA 1GSQA 1W89A 2AV4A 2J23A 3C8EA 2LRCA 4MJAA 2B5XA 4DEJA 5DQYA 1VF2A 3GKMA 5HR3A 2HSMA 1GLPA 4KUNA 2A4VA 5DJMA 3LYKA 5ECQB 2DJ3A 2YV7A 1WRYA 4NXIA 2WJUA 4MF7A 4DSSA 4I6XA 1GLQA 1HNCA 3ZMKA 2DMMA 2CQ9A 1VGLA 3D0ZA 4JEDA 5D9TA 4ZIJA 4EE0A 2VCQA 1PL1A 2VAFA 17GSA 5CO3A 5BRTA 5LCZA 4BVYB 3H1NA 2M46A 2REMA 3RPPA 3KEBA 3PINA 1K0AA 11GSA 1SK2A 4TR1B 3EE2A 4USSA 1X0RA 2VL2C 2MBTA 3A5IA 4ZL9A 3D22A 3TKQA 4K7NA 2GSSA 4XS6A 3VI5A 3VURA 3ZTLA 1YY7A 2HRKA 1GL8A 1T4YA 4I8BA 2H70A 16GSA 2OBKA 1VRSD 1YKAA 2IMDA 1V98A 2G0FA 1OE8A 1K0DA 3HJMA 3KH7A 5BMUA 2VO4A 2H0HA 2GQLA 1LJRA 3W6GA 1U3AA 2PBJA 2X8HA 1JZWA 2F8FA 1EP8A 3FR3A 4ZBAA 4TR4A 3HVNA 3K8NA 5JWRB 2JZSA 5FT3A 4PQIA 3APSA 4POMA 3RHCA 3VWUA 3QAVA 1ON4A 3H79A 4N30A 2H8LA 2DLXA 2GSRA 2A2SA 1DBYA 5DDLA 4NHWA 2X49A 1MEKA 4XS4B 1GTIA 4H86A 1VF4A 3MWHA 3TDGA 2NVLA 1Q4JA 4F03A 4F2IA 2L59A 4IS0A 4AJ7A 4CY6A 5D73A 3CTFA 1GP1A 2IFQA 3I43A 4K5RA 2TRCP 4ZB6A 5G2ZA 2E2GA 3LW9A 5FWGA 3EWLA 2GZYA 1O73A 3KZQA 4HZ2A 4BL7B 2ZUPA 4DSSB 1AUCA 2YJHA 2R6KA 5FHIA 1SJIA 1GTAA 2NPBA 2JL4A 6GSUA 4EC0A 1V2AA 2H75A 2ON7A 1B48A 2H6YA 1G0TA 5E59A 3L78A 2EC4A 2H01A 3TKSC 3ERWA 4KCEA 1M2BA 3LWAA 1T7PB 3EU4A 4G2EA 4K6XA 1MD4A 4IQAA 4WXTA 4MF5A 4ZBBA 2WCIA 5GSTA 3HKRA 3C1RA 3DMLA 3KP9A 1NW2A 2PPTA 1WE0A 4ZB8A 4EXJA 3MIXA 1AAZA 1HNBA 4HSCX 1S3CA 3GFKA 4TW5A 4I97A 2J9HA 3GL3A 1J0FA 4GLTA 4K2DA 4Q5FA 3L4NA 5HR0A 3EMXA 3FZ5A 3HA9A 2C4JA 4MJBA 1TRSA 3I6AA 3CQFA 2CVKA 4QL9A 2DKHA 3MAKA 1J08A 4GRFA 3DWVA 3D5JA 5IM9A 3RPNA 1TK8B 2L4QA 4K0GA 5KOWA 4EF0A 4QQ7A 3IA1A 1M3JA 1JLVA 1TI3A 4PUAA 3GTUB 2KUCA 1URMA 2V1MA 2FD3A 4YAPA 1OC8A 3FRCA 3LYPA 3UJ1A 3W8SA 1NHYA 5B7CA 4YQUA 1YZXA 2YJ7A 3CXGA 4RQRA 5J41A 3RDWA 2IFQB 1SKWB 4NV5A 2CAIA 2DBCA 4BPYA 2GQMA 4X4JA 1A2LA 2C80A 1BQ7A 2IMFA 1EV9A 4FQUA 2H19A 2VCTA 2JZRA 1NSWA 3ZITA 2HFDA 1AQWA 4ZB9A 2VLVA 1JHBA 2DC5A 2C0GA 1QUWA 5IMFA 1T00A 3I69A 1B9XC 4OMVA 1WOUA 1JFUA 3M0FA 1SYRA 1RQMA 1TDIA 1PMTA 2B3SA 1T4ZA 4ECJA 5DVBA 2HI7A 5G5EA 2C8UA 5HFGA 5IMCA 4X1UA 3UVHA 3HZ8A 5G31A 3EU3A 2IMEA 4IP1A 1CQHA 1BEDA 4I5QA 4FYCA 5EVOA 1HNAA 1BYEA 3HJOA 2H1BA 3KP8A 2CAQA 1XWGA 3LXTA 4RQXA 5CAXA 1KNGA 2LV3A 2AUVA 5F8BA 2EIOA 2KP1A 4EVMA 3F3RA 2FHEA 4L0WA 4IGJA 1Q98A 4LMWA 1MTCA 2VOCA 4AJ8A 1PFOA 5IPHA 4ZBDA 5HQPA 3TOTA 2XHFA 4TVEA 2TIRA 5IMVA 2X8CA 5KN0A 2I81A 3KTLA 2K9FA 2OE3A 3G7JA 1EP7A 1GWCA 5EL8A 3GX0A 4XS1A 2A2PA 1QGVA 1OVNA 4OO5A 2RUFA 5DCHA 4WKWA 1SK1A 2LS5A 4CDOA 6GSVA 5IO0A 4PNGA 3Q6OA 4J56E 1K0CA 2K6VA 1K3OA 3CSJA 2FUG2 3LQ7A 2XBIA 1T1VA 2H1AA 4WF5A 3G9BA 2ALBA 5DBQA 3TJFA 4JRRA 1XVQA 4F9ZA 3F6FA 4XHMA 1K3YA 1Z7RA 3GSSA 4KB3A 4BVYA 3TJKA 2VCXA 3IHGA 1A0RP 1X5CA 2XPDA 5G1LA 2R0GA 3ME7A 1SKSB 1WPIA 2I9HA 4YKGA 2H76A 4TXOA 5KN2A 5D8IA 3BOAA 1E2YA 5COHA 4MH2A 1TK0B 2CZ2A 2GLRA 1EZKA 2GT5A 5HR1A 1BJXA 1WP0A 3FHKA 1UVZA 3GRXA 3VWWA 3WYWA 2CVDA 1BG5A 4Z2RA 1GH2A 3VK9A 2GDRA 4MJCA 2V6KA 5A4UA 5ECKB 3DVXA 1F3BA 3ZL5A 3QFBC 2CV4A 1EV4A 3HD5A 3WD6A 3NZNA 4BA7A 4N0ZA 1GSSA 5JWQB 3UAPA 2RLIA 5A4WA 2X8GA 3ERFA 1TRVA 3TGZA 2NTOA 3FYGA 5CRWA 2DJ2A 3E0UA 1ILOA 2LJKA 2LEGA 4CHSA 2B5EA 3IAM2 1B4QA 1SK0A 2IL3A 1K0MA 4HS1A 3GKKA 4IHUA 2R5GA 2FLSA 3KH9A 3LG6A 2MZCA 4ECBA 1TK5B 2R2JA 4WF4A 3TB2A 4F0CA 2L57A 4IKHA 1GUKA 3O76A 4O5RA 3EVIA 1TRWA 4KAEA 3WT2A 3CYNA 1A2MA 2JADA 2AHEA 4X43A 3DYRA 1TRUA 3LFLA 2YWIA 4JBBA 4MH3A 1G6YA 3FKFA 3EYTA 2F8AA 4POLA 2HRNA 2H73A 2FA8A 1SL1B 1V9WA 1IYIA 1XIYA 1CQGA 3CTGA 3EPTA 4BL7A 2E7PA 3F6DA 1T3BA 1K0OA 2I1UA 2H72A 1G7EA 1AIUA 3DGQA 2H0IA 4G0IA 4WR5A 3KMOA 1PRXA 1M2DA 4RUVA 1Z3EA 4YQVA 6GSTA 3ZIJA 5JWOB 4MMMA 3F9UA 2DKIA 4TXOB 3IHQA 4KSMA 5IIZA 2RUEA 3W8JA 4HQZA 1XW5A 4K7OA 3S9FA 1C72A 3IBHA 5ECLB 5GAPD 1F9MA 4AGSA 5GZZB 4XRAA 4MK3A 2DJ1A 4K2XA 3GX8A 3QPMA 2N5FA 2RIIA 1M0UA 1ZYQB 3C7MA 2K8SA 3PR8A 4TRXA 3M8NA 2I4AA 2JSYA 2NBSA 1TU8A 2PN8A 5CNWA 2LKUA 2IN3A 2K8VA 2VCZA 3LXZA 3WT1A 1IYHA 1YDKA 5DAKA 5EY6A 2PERA 3BJ5A 3A2VA 1PX6A 1KEBA 1Z6MA 5C00A 2VD1A 1YEXA 3APQA 2ZCTA 1O8WA 3HVXA 4Q5QA 1LU4A 5ENUA 5J4UA 3U6VA 2VCVA 3ISOA 1Z5YE 3HDCA 1WMJA 3R2QA 1B4PA 4DSRA 3HYPA 3V1WA 1O8XA 4WBRD 2PMTA 1F2EA 5ELAA 4K8MA 4EDZA 3GTUA 2L6CA 4Z2UA 4O7HA 1ST9A 3FW2A 2WGRA 3F0IA 1FHEA 1MDJA 1ZYNA 3VLNA 1ACVA 4IN0A 3GNJA 1QFNA 1OAZA 2QKEA 1M2AA 2DMLA 4MP4A 1AQXA 1TTZA 2QC7A 3FEUA 5JCUA 5C04A 2O8VB 1BAYA 2EIQA 4KE3A 4OO4A 2WULA 1QMVA 4ECIA 3CSHA 3LEFA 2XC2A 2CX3A 22GSA 4GSNA 2BTOT 3GN3A 4GSTA 4YQMA 4TOPA 5IPGA 1SJZA 1XWBA 2HSYA 1GSUA 2L5LA 4TR0A 2VD0A 3WGDA 3CRUA 4YH2A 1MDIA 2B1LA 4CW9A 3RBTA 1JLWA 4KDUA 3F3QA 5CRGA 1THXA 1X5DA 1SU9A 4KCAA 3US3A 1A8YA 1O81A 2VM2A 2YZHA 4YKFA 1XOAA 2O89A 18GSA 3A2XA 4J2FA 1M9AA 1YKCA 1M3IA 3Q18A 1ZYPA 3GKNA 2M72A 3IXRA 3UBLA 1V58A 3KM6A 4ILFA 5J9CA 5ABRA 5DJLA 4XIHA 3MSZA 3D6IA 2YPMA 3GHAA 1PSQA 4LL4B 5D9VA 5IMDA 4FO5A 5DAKB 4F0BA 3I9V2 3UMAA 2P5QA 1FB0A 2N5AA 3IOSA 3VWXA 4HEA2 2V6OA 2H1GA 1YF1A 1OC9A 4CY8A 1ZMAA 1TXXA 4LMVA 2HE3A 3PPUA 4HDEA 3TCOA 1SD9A 3O3TA 4L5OA 3VI7A 1XWKA 3P7XA 5F05A 4EIPA 2FY6A 2KHPA 1X9SB 2YZUA 5AN1A 1Y6EA 5D9WA 1SYXA 5B6NA 2DIZA 1SL0B 1PD21 3O6TA 3ZVJA 6GSYA 1A23A 3KCMA 2C1YA 3IR4A 4KNDA 3ZREA 1DE2A 2YWOA 2CVBA 2X64A 1S3AA 4Z7XA 1LBKA 5A4VA 1JZOA 4ZXGA 20GSA 1DUGA 2V41A 1U87A 4EUYA 5H5RA 1OKTA 3J7Yk 5ID2B 4PQHA 4RI7A 2DSAA 3EURA 3QD9A 3A2WA 2GZZA 4GQFA 1SENA 2HNLA 1FOVA 3IK9A 4L5LA 1OE7A 4J57E 2CA8A 1YF0A 3ZMLA 4ISDA 2OE0A 4GQCA 1VF1A 1EEJA 3BCKA 3H4KA 13GSA 2GS3A 2ES7A 4BIKA 2IJYA 2AYTA 2HYXA 2MMZA 3F4SA 4GSSA 1M9BA 3FK8A 1VF3A 3EMPA 2FGXA 3NIVA 4A5PA 2C0DA 1XOBA 4MDCA 3KGKA 2FWHA 2BMXA 3Q74A 4QL7A 3TOUA 4ACSA 4PTSA 3UVTA 1TU7A 4PNFA 1OC9B 2IWTA 4KX4A 3L9UA 1FO5A 4FYBA 3IRAA 4KF9A 2HZFA 2HXKA 4BVXA 2L4CA 1O85A 2R4VA 2I3YA 2R0CA 1QXHA 3DD3A 4TR3A 2EIRA 4F82A 1V40A 4PX1A 2LQQA 5DQSA 5INYA 5ECHB 1K0BA 5IOWA 4NMUA 1O6JA 1ZYEA 1E6BA 2Z9SA 3IDVA 1G7OA 3TJBA 2GQKA 3TKRA 5F0GA 2PGTA 3GH9A 3A5WA 5D9XA 5IMZA 2LNSA 3Q19A 5DCGA 3MYDA 2H30A 1MDKA 2WDUA 1PQNA 2D2ZA 3QOUA 5A5KA 5CRHA 1NM3A 3J7Yb 4JZQA 1WIKA 3DEXA 1GRXA 2O85A 1S3RA 2FA4A 1J9BA 1M99A 5GAND 1YEPA 5ECOB 3VPTA 2VLUA 2LUSA 2DJKA 5ECPB 2L6DA 6GSXA 3UL3A 5J5NA 1SL2B 4DSQA 3FZ4A 1PN0A 2MYGA 4WEYA 2AB6A 3QR6A 3D4MA 3UARA 3ZFLA 3UBKA 2G2QA 1U6TA 4V1Ap 7GSSA 2FWGA 2TRXA 1EEMA 4PUFC 4GXZA 4MZWA 2YWNA 2XPEA 6GSWA 2LQOA 3FR9A 2IMIA 1TOFA 1EOHA 3EC3A 4E8EA 1U3IA 4I2TA 3M3MA 4KA0A 1KBNA 4PURA 1V57A 4P3YB 5G1KA 4XRDA 3KD0A 1AC1A 3APOA 2HZEA 4MCUA 4XTSA 3HXSA 2GT6A 2CT6A 4EO3A 2YWMA 3H8QA 1JZDA 4OCEA 4Z2TA 2E0QA 2P5RA 2H6ZA 2YANA 3DRNA 4ZL7A 3BD2A 2HRFA 5D93A 5ECSA 1KTEA 1USBA 3VWVA 1GNEA 1X5EA 2R0PA 1HD2A 2VL2A 4GF0A 2WS2A 1EGOA 1BX9A 2VUPA 4L0UA 1AW9A 3D4TA 3C71A 1R26A 1A2JA 1M7TA 1AQVA 3GH6A 1K3LA 1X9WB 2WB9A 4OCFA 5D96A 3TKSE 4BVXB 5HR2A 5DALA 2MMOA 1Y25A 1X9MB 1WWJA 1UN2A 4HOJA 2LTKA 4JU5A 3QCPA 1R5AA 2F3MA 4X0XA 1OYJA 4IP6A 4AF2A 2PWJA 5AIVA 3IE3A 1PL2A 4K9ZA 3MDKA 3HZ4A 3ZFBA 1NHOA 4O5UA 1PGTA 3ERGA 4MNNA 1ML6A 2GSTA 3P90A 3L9SA 4JR6A 2VM1A 2GSQA 2K18A 3TJGA 2MMAA 3TKPA 1ZGNA 3LORA 2QSIA 1XW6A 1THOA 3F63A 3VPQA 3FY7A 3UOMA 2XBQA 4ML6A 3G7YA 3TUEA 1DE1A 1ERTA 3RHBA 2B7KA 3IC8A 1F37A 1XPVA 3HJPA 10GSA 2JSZA 1ERVA 5F06A 1ZOFA 4N11A 4O32A 1GSFA 5CP1A 1TJDA 3KTBA 3GSTA 4PGTA 2B6MA 2FWFA 4Q5NA 4D73A 19GSA 1OC3A 3WGEA 4FH8A 1G6WA 4OFNA 4G0KA 4N10A 3DXBA 3SBCA 2F51A 5F07A 1N2AA 3HCZA 2YCDA 2HZEB 5L71A 3IAS2 3HVSA 3TKSA 4N0VA 2B5YA 4KGIA 4V1Ag 3F8UA 3TRPA 4TKYA 3KJYA 1ERUA 4EIQA 3LSZA 1H4OA 2H66A 5IQYA 4WETA 5JCGA 2PVOC 2OBIA 2R3XA 4OFTA 2O87A 4ZL8A 2VL3A 4Q5RA 3CBUA 6GSSA 4HU7A 5DALB 3EINA 1GNWA 1I9DA 3TJJA 2RM6A 2PVQA 4IJIA 3C73A 4YAVA 5J3RA 4NPBA 3PH9A 1PKWA 3N5OA 1W4VA 2LRTA 3BBYA 3LGCA 3ZIVA 4K7IA 1XWAA 2O7KA 3ZYWA 5ID2A 3BCIA 4MZBA 1GUHA 3QAWA 3ZLPA 3RAZA 2F9SA 4LL1B 2PUKC 3QAGA 1EWXA 4K5SA 1T8EB 3LJRA 2VL9A 4MJEA 4ID0A 2KOKA 2BJXA 3FZAA 3DVWA 4KH7A 4HU9A 1F3AA 3F4RA 4DVCA 1S3DA 4NHZA 2GZPA 3CSIA 1XW9A 2C3TA 5B8AA 2PU9C 3TRQA 1AXDA 5HFKA 3GURA 3HHVA 3AY8A 4NWYA 4RI6A 3WGXA 5H5QA 4IW9A 1YJ6A 2QA2A 2JACA 4E8HA 1N8JA 1PX7A 1Z7PA 5B6MA 3GIXA 3FMWA 4KDXA 1FW1A 4D73B 2WRTA 4HI7A 2ON5A 2P31A 1GSDA 3G7IA 1RW1A 2VIMA 1JZRA 2B1KA 4ZILA 1OKDA 4MF6A 1UA5A 4GWRA 3D21A 3ZRDA 4IJ3A 3IC4A 4EKZA 4ICYA 1B9YC 2KLXA 2MBSA 1SJ6A 2OJLA 4AJ6A 2E2MA 3DKSA 4MZCA 3M1GA 4FYUA 1XFLA 3GL5A 4TN8A 4BWQA 2HT9A 1XXUA 5KEJA 2VLTA 4KDYA 4PXOA 4IVFA 4K1FA 1YQ1A 1GULA 1DSBA 4POKA 3M9JA 1R7HA 8GSSA 1H75A 1FAAA 3JCML 1GTUA 3CMIA 4G19A 1A0FA 2AJQB 2RM5A 1EOGA 4L8EA 2YN1A 2YV9A 1ZL9A 2YP6A 5EPFA 1R4WA 5G5FA 5H5SA 1GUMA 1TP9A 1F6MC 3KXOA 4KW6A 1HQOA 1RK4A 3GV1A 3IV4A 1A8LA 2H0GA 14GSA 1FVJA 3MNGA 2R37A 4G10A 1Z6NA 2VCWA 2JU5A 4HZ4A 5GSSA 5CYYA 2YOIA 3C1SA 3NOFA 2OE1A 4LLRA 4TXVA 2OADA 1SKRB 3VFIA 3L9VA 2HRAA 3KIJA 2LRNA 3E3EA 3GYKA 3FZ9A 1ZCPA 2UZ8A 4OWYA 1XG8A 1HYUA 5ECRB 1R5PA 1FOHA 2LSTA 3KMNA 1MD3A 3QMXA 1I5GA 12GSA 2HSHA 2B7JA 2LJAA 4HJMA 5J9BA 5G30A 3H93A 3P8WA 5ECNB 2CZ3A 4IQ1A 3IK7A 2OA7A 5AISA 3QDNA 2H6XA 4IELA 2GVPA 5ECIB 3ZVJD 2CX4A 1A24A 1PN9A 2DJJA 1FG4A 5AIXA 2FNOA 3F4TA 2X4AA 2KP2A 2JZTA 4LA1A 3GUSA 2NDOA 1ABAA 3U5RE 3SWLA 2A2RA 5IOXA 1TKDB 1GTBA 4O92A 4OD7A 4MLYA 4KSOA 2C0EA 5LD0A 3GA4A 1K0NA 3R3EA 2M80A 1PA3A 2V2GA 2H71A 4IBPA 1Z9HA 5ELGA 2IMKA 2H74A 1EGRA 5KN1A 2A4HA 3UIWA 9GSSA 2L5OA 2X99A 3N9JA 3GKXA 1TW9A 3L0HA 2ZNMA 5B8BA 3ED3A 5AGYA 4JE1A 1GSYA 2MMNA 2YNXA 1SD8A 4XCSA 3P2AA 2IPAA 3DIEA 1QK8A 2DIYA 2IIYA 3CRTA 4OFMA 4PQ1A 4MABA 1GSEA 4TR1A 1PKZA 4HQSA 5LNKe 2FCHA 2WZ9A 4MPGA 4MA9A 4NAXA 4HJ2A 1ERWA 2V32A 4V2NA 2N5BA 4GCIA 5JCWA
chains in the Genus database with same CATH topology
4FIWA 4BWSA 1FB6A 3HVVA 5KN3A 2HLSA 3A3TA 3ZZXA 4I2UA 5KOXA 2LNTA 4EL1A 3IPZA 1FVKA 2OACA 4V2MA 3M9KA 5ECMB 3E9JB 4EDYA 1TI1A 3QFAC 4NV2A 3UEMA 1XWCA 2GTUA 4ULXA 1O7UA 4V2LA 3FR6A 4WR4A 4GTUA 4JR4A 2P0GA 1XZOA 4K0NA 3TRXA 1XVWA 4ECCA 4O5QA 2C0FA 2QGVA 2OKAA 4POBA 2DJ0A 4MPFA 2WFCA 2FWEA 5HFIA 1U88A 1B8XA 2QA1A 3ME8A 5CRDA 4G9HA 1UC7A 2H1DA 3HY2A 2C3QA 4WBJA 3PGTA 5E4WA 5IMAA 2C3NA 3OR5A 3GMFA 5IO2A 4HUAA 2AAWA 4XS4A 5CREA 4G0LA 4ML1A 1WJKA 2GGTA 1ZZYA 1QQ2A 2LJRA 1XCCA 1XBSA 1GSQA 1W89A 2AV4A 2J23A 3C8EA 2LRCA 4MJAA 2B5XA 4DEJA 5DQYA 1VF2A 3GKMA 5HR3A 2HSMA 1GLPA 4KUNA 2A4VA 5DJMA 3LYKA 5ECQB 2DJ3A 2YV7A 1WRYA 4NXIA 2WJUA 4MF7A 4DSSA 4I6XA 1GLQA 1HNCA 3ZMKA 2DMMA 2CQ9A 1VGLA 3D0ZA 4JEDA 5D9TA 4ZIJA 4EE0A 2VCQA 1PL1A 2VAFA 17GSA 5CO3A 5BRTA 5LCZA 4BVYB 3H1NA 2M46A 2REMA 3RPPA 3KEBA 3PINA 1K0AA 11GSA 1SK2A 4TR1B 3EE2A 4USSA 1X0RA 2VL2C 2MBTA 3A5IA 4ZL9A 3D22A 3TKQA 4K7NA 2GSSA 4XS6A 3VI5A 3VURA 3ZTLA 1YY7A 2HRKA 1GL8A 1T4YA 4I8BA 2H70A 16GSA 2OBKA 1VRSD 1YKAA 2IMDA 1V98A 2G0FA 1OE8A 1K0DA 3HJMA 3KH7A 5BMUA 2VO4A 2H0HA 2GQLA 1LJRA 3W6GA 1U3AA 2PBJA 2X8HA 1JZWA 2F8FA 1EP8A 3FR3A 4ZBAA 4TR4A 3K8NA 5JWRB 2JZSA 5FT3A 4PQIA 3APSA 4POMA 3RHCA 3VWUA 3QAVA 1ON4A 3H79A 4N30A 2H8LA 2DLXA 2GSRA 2A2SA 1DBYA 5DDLA 4NHWA 2X49A 1MEKA 4XS4B 1GTIA 4H86A 1VF4A 3MWHA 3TDGA 2NVLA 1Q4JA 4F03A 4F2IA 2L59A 4IS0A 4AJ7A 4CY6A 5D73A 3CTFA 1GP1A 2IFQA 3I43A 4K5RA 2TRCP 4ZB6A 5G2ZA 2E2GA 3LW9A 5FWGA 3EWLA 2GZYA 1O73A 3KZQA 4HZ2A 4BL7B 2ZUPA 4DSSB 1AUCA 2YJHA 2R6KA 5FHIA 1SJIA 1GTAA 2NPBA 2JL4A 6GSUA 4EC0A 1V2AA 2H75A 2ON7A 1B48A 2H6YA 1G0TA 5E59A 3L78A 2EC4A 2H01A 3TKSC 3ERWA 4KCEA 1M2BA 3LWAA 1T7PB 3EU4A 4G2EA 4K6XA 1MD4A 4IQAA 4WXTA 4MF5A 4ZBBA 2WCIA 5GSTA 3HKRA 3C1RA 3DMLA 3KP9A 1NW2A 2PPTA 1WE0A 4ZB8A 4EXJA 3MIXA 1AAZA 1HNBA 1S3CA 3GFKA 4TW5A 4I97A 2J9HA 3GL3A 1J0FA 4GLTA 4K2DA 4Q5FA 3L4NA 5HR0A 3EMXA 3FZ5A 3HA9A 2C4JA 4MJBA 1TRSA 3I6AA 2CVKA 4QL9A 2DKHA 3MAKA 1J08A 4GRFA 3DWVA 3D5JA 5IM9A 3RPNA 1TK8B 2L4QA 4K0GA 5KOWA 4EF0A 4QQ7A 3IA1A 1JLVA 1TI3A 4PUAA 3GTUB 2KUCA 1URMA 2V1MA 2FD3A 4YAPA 1OC8A 3FRCA 3LYPA 3UJ1A 3W8SA 1NHYA 5B7CA 4YQUA 1YZXA 2YJ7A 3CXGA 4RQRA 5J41A 3RDWA 2IFQB 1SKWB 4NV5A 2CAIA 2DBCA 4BPYA 2GQMA 4X4JA 1A2LA 2C80A 1BQ7A 2IMFA 1EV9A 4FQUA 2H19A 2VCTA 2JZRA 1NSWA 3ZITA 2HFDA 1AQWA 4ZB9A 2VLVA 1JHBA 2DC5A 2C0GA 1QUWA 5IMFA 1T00A 3I69A 1B9XC 4OMVA 1WOUA 1JFUA 3M0FA 1SYRA 1RQMA 1TDIA 1PMTA 2B3SA 1T4ZA 4ECJA 5DVBA 2HI7A 5G5EA 2C8UA 5HFGA 5IMCA 4X1UA 3UVHA 3HZ8A 5G31A 3EU3A 2IMEA 4IP1A 1CQHA 1BEDA 4I5QA 4FYCA 5EVOA 1HNAA 1BYEA 3HJOA 2H1BA 3KP8A 2CAQA 1XWGA 3LXTA 4RQXA 5CAXA 1KNGA 2LV3A 2AUVA 5F8BA 2EIOA 2KP1A 4EVMA 3F3RA 2FHEA 4L0WA 4IGJA 1Q98A 4LMWA 1MTCA 2VOCA 4AJ8A 5IPHA 4ZBDA 5HQPA 3TOTA 2XHFA 4TVEA 2TIRA 5IMVA 2X8CA 5KN0A 2I81A 3KTLA 2K9FA 2OE3A 3G7JA 1EP7A 1GWCA 5EL8A 3GX0A 4XS1A 2A2PA 1QGVA 1OVNA 4OO5A 2RUFA 5DCHA 4WKWA 1SK1A 2LS5A 4CDOA 6GSVA 5IO0A 4PNGA 3Q6OA 4J56E 1K0CA 2K6VA 1K3OA 3CSJA 2FUG2 3LQ7A 2XBIA 1T1VA 2H1AA 4WF5A 3G9BA 2ALBA 5DBQA 3TJFA 4JRRA 1XVQA 4F9ZA 3F6FA 4XHMA 1K3YA 1Z7RA 3GSSA 4KB3A 4BVYA 3TJKA 2VCXA 3IHGA 1A0RP 1X5CA 2XPDA 5G1LA 2R0GA 3ME7A 1SKSB 1WPIA 2I9HA 4YKGA 2H76A 4TXOA 5KN2A 5D8IA 3BOAA 1E2YA 5COHA 4MH2A 1TK0B 2CZ2A 2GLRA 1EZKA 2GT5A 5HR1A 1BJXA 1WP0A 3FHKA 1UVZA 3GRXA 3VWWA 3WYWA 2CVDA 1BG5A 4Z2RA 1GH2A 3VK9A 2GDRA 4MJCA 2V6KA 5A4UA 5ECKB 3DVXA 1F3BA 3ZL5A 3QFBC 2CV4A 1EV4A 3HD5A 3WD6A 3NZNA 4BA7A 4N0ZA 1GSSA 5JWQB 3UAPA 2RLIA 5A4WA 2X8GA 3ERFA 1TRVA 3TGZA 2NTOA 3FYGA 5CRWA 2DJ2A 3E0UA 1ILOA 2LJKA 2LEGA 4CHSA 2B5EA 3IAM2 1B4QA 1SK0A 2IL3A 1K0MA 4HS1A 3GKKA 4IHUA 2R5GA 2FLSA 3KH9A 3LG6A 2MZCA 4ECBA 1TK5B 2R2JA 4WF4A 3TB2A 4F0CA 2L57A 4IKHA 1GUKA 3O76A 4O5RA 3EVIA 1TRWA 4KAEA 3WT2A 3CYNA 1A2MA 2JADA 2AHEA 4X43A 3DYRA 1TRUA 3LFLA 2YWIA 4JBBA 4MH3A 1G6YA 3FKFA 3EYTA 2F8AA 4POLA 2HRNA 2H73A 2FA8A 1SL1B 1V9WA 1IYIA 1XIYA 1CQGA 3CTGA 3EPTA 4BL7A 2E7PA 3F6DA 1T3BA 1K0OA 2I1UA 2H72A 1G7EA 1AIUA 3DGQA 2H0IA 4G0IA 4WR5A 3KMOA 1PRXA 1M2DA 4RUVA 1Z3EA 4YQVA 6GSTA 3ZIJA 5JWOB 4MMMA 3F9UA 2DKIA 4TXOB 3IHQA 4KSMA 5IIZA 2RUEA 3W8JA 4HQZA 1XW5A 4K7OA 3S9FA 1C72A 3IBHA 5ECLB 5GAPD 1F9MA 4AGSA 5GZZB 4XRAA 4MK3A 2DJ1A 4K2XA 3GX8A 3QPMA 2N5FA 2RIIA 1M0UA 1ZYQB 3C7MA 2K8SA 3PR8A 4TRXA 3M8NA 2I4AA 2JSYA 2NBSA 1TU8A 2PN8A 5CNWA 2LKUA 2IN3A 2K8VA 2VCZA 3LXZA 3WT1A 1IYHA 1YDKA 5DAKA 5EY6A 2PERA 3BJ5A 3A2VA 1PX6A 1KEBA 1Z6MA 5C00A 2VD1A 1YEXA 3APQA 2ZCTA 1O8WA 3HVXA 4Q5QA 1LU4A 5ENUA 5J4UA 3U6VA 2VCVA 3ISOA 1Z5YE 3HDCA 1WMJA 3R2QA 1B4PA 4DSRA 3HYPA 3V1WA 1O8XA 4WBRD 2PMTA 1F2EA 5ELAA 4K8MA 4EDZA 3GTUA 2L6CA 4Z2UA 4O7HA 1ST9A 3FW2A 2WGRA 3F0IA 1FHEA 1MDJA 1ZYNA 3VLNA 1ACVA 4IN0A 3GNJA 1QFNA 1OAZA 2QKEA 1M2AA 2DMLA 4MP4A 1AQXA 1TTZA 2QC7A 3FEUA 5JCUA 5C04A 2O8VB 1BAYA 2EIQA 4KE3A 4OO4A 2WULA 1QMVA 4ECIA 3CSHA 3LEFA 2XC2A 2CX3A 22GSA 4GSNA 2BTOT 3GN3A 4GSTA 4YQMA 4TOPA 5IPGA 1SJZA 1XWBA 2HSYA 1GSUA 2L5LA 4TR0A 2VD0A 3WGDA 3CRUA 4YH2A 1MDIA 2B1LA 4CW9A 3RBTA 1JLWA 4KDUA 3F3QA 5CRGA 1THXA 1X5DA 1SU9A 4KCAA 3US3A 1A8YA 1O81A 2VM2A 2YZHA 4YKFA 1XOAA 2O89A 18GSA 3A2XA 4J2FA 1M9AA 1YKCA 3Q18A 1ZYPA 3GKNA 2M72A 3IXRA 3UBLA 1V58A 3KM6A 4ILFA 5J9CA 5ABRA 5DJLA 4XIHA 3MSZA 3D6IA 2YPMA 3GHAA 1PSQA 4LL4B 5D9VA 5IMDA 4FO5A 5DAKB 4F0BA 3I9V2 3UMAA 2P5QA 1FB0A 2N5AA 3IOSA 3VWXA 4HEA2 2V6OA 2H1GA 1YF1A 1OC9A 4CY8A 1ZMAA 1TXXA 4LMVA 2HE3A 3PPUA 4HDEA 3TCOA 1SD9A 3O3TA 4L5OA 3VI7A 1XWKA 3P7XA 5F05A 4EIPA 2FY6A 2KHPA 1X9SB 2YZUA 5AN1A 1Y6EA 5D9WA 1SYXA 5B6NA 2DIZA 1SL0B 1PD21 3O6TA 3ZVJA 6GSYA 1A23A 3KCMA 2C1YA 3IR4A 4KNDA 3ZREA 1DE2A 2YWOA 2CVBA 2X64A 1S3AA 4Z7XA 1LBKA 5A4VA 1JZOA 4ZXGA 20GSA 1DUGA 2V41A 1U87A 4EUYA 5H5RA 1OKTA 3J7Yk 5ID2B 4PQHA 4RI7A 2DSAA 3EURA 3QD9A 3A2WA 2GZZA 4GQFA 1SENA 2HNLA 1FOVA 3IK9A 4L5LA 1OE7A 4J57E 2CA8A 1YF0A 3ZMLA 4ISDA 2OE0A 4GQCA 1VF1A 1EEJA 3BCKA 3H4KA 13GSA 2GS3A 2ES7A 2IJYA 2AYTA 2HYXA 2MMZA 3F4SA 4GSSA 1M9BA 3FK8A 1VF3A 3EMPA 2FGXA 3NIVA 4A5PA 2C0DA 1XOBA 4MDCA 3KGKA 2FWHA 2BMXA 3Q74A 4QL7A 3TOUA 4ACSA 4PTSA 3UVTA 1TU7A 4PNFA 1OC9B 2IWTA 4KX4A 3L9UA 1FO5A 4FYBA 3IRAA 4KF9A 2HZFA 2HXKA 4BVXA 2L4CA 1O85A 2R4VA 2I3YA 2R0CA 1QXHA 3DD3A 4TR3A 2EIRA 4F82A 1V40A 4PX1A 2LQQA 5DQSA 5INYA 5ECHB 1K0BA 5IOWA 4NMUA 1O6JA 1ZYEA 1E6BA 2Z9SA 3IDVA 1G7OA 3TJBA 2GQKA 3TKRA 5F0GA 2PGTA 3GH9A 3A5WA 5D9XA 5IMZA 2LNSA 3Q19A 5DCGA 3MYDA 2H30A 1MDKA 2WDUA 1PQNA 2D2ZA 3QOUA 5A5KA 5CRHA 1NM3A 3J7Yb 4JZQA 1WIKA 3DEXA 1GRXA 2O85A 2FA4A 1J9BA 1M99A 5GAND 1YEPA 5ECOB 3VPTA 2VLUA 2LUSA 2DJKA 5ECPB 2L6DA 6GSXA 3UL3A 5J5NA 1SL2B 4DSQA 3FZ4A 1PN0A 2MYGA 4WEYA 2AB6A 3QR6A 3D4MA 3UARA 3ZFLA 3UBKA 2G2QA 1U6TA 4V1Ap 7GSSA 2FWGA 2TRXA 1EEMA 4PUFC 4GXZA 4MZWA 2YWNA 2XPEA 6GSWA 2LQOA 3FR9A 2IMIA 1TOFA 1EOHA 3EC3A 4E8EA 1U3IA 4I2TA 3M3MA 4KA0A 1KBNA 4PURA 1V57A 4P3YB 5G1KA 4XRDA 3KD0A 1AC1A 3APOA 2HZEA 4MCUA 4XTSA 3HXSA 2GT6A 2CT6A 4EO3A 2YWMA 3H8QA 1JZDA 4OCEA 4Z2TA 2E0QA 2P5RA 2H6ZA 2YANA 3DRNA 4ZL7A 3BD2A 2HRFA 5D93A 5ECSA 1KTEA 1USBA 3VWVA 1GNEA 1X5EA 2R0PA 1HD2A 2VL2A 4GF0A 2WS2A 1EGOA 1BX9A 2VUPA 4L0UA 1AW9A 3D4TA 3C71A 1R26A 1A2JA 1M7TA 1AQVA 3GH6A 1K3LA 1X9WB 2WB9A 4OCFA 5D96A 3TKSE 4BVXB 5HR2A 5DALA 2MMOA 1Y25A 1X9MB 1WWJA 1UN2A 4HOJA 2LTKA 4JU5A 3QCPA 1R5AA 2F3MA 4X0XA 1OYJA 4IP6A 4AF2A 2PWJA 5AIVA 3IE3A 1PL2A 4K9ZA 3MDKA 3HZ4A 3ZFBA 1NHOA 4O5UA 1PGTA 3ERGA 4MNNA 1ML6A 2GSTA 3P90A 3L9SA 4JR6A 2VM1A 2GSQA 2K18A 3TJGA 2MMAA 3TKPA 1ZGNA 3LORA 2QSIA 1XW6A 1THOA 3F63A 3VPQA 3FY7A 3UOMA 2XBQA 4ML6A 3G7YA 3TUEA 1DE1A 1ERTA 3RHBA 2B7KA 3IC8A 1F37A 1XPVA 3HJPA 10GSA 2JSZA 1ERVA 5F06A 1ZOFA 4N11A 4O32A 1GSFA 5CP1A 1TJDA 3KTBA 3GSTA 4PGTA 2B6MA 2FWFA 4Q5NA 4D73A 19GSA 1OC3A 3WGEA 4FH8A 1G6WA 4OFNA 4G0KA 4N10A 3DXBA 3SBCA 2F51A 5F07A 1N2AA 3HCZA 2YCDA 2HZEB 5L71A 3IAS2 3HVSA 3TKSA 4N0VA 2B5YA 4KGIA 4V1Ag 3F8UA 3TRPA 4TKYA 3KJYA 1ERUA 4EIQA 3LSZA 1H4OA 2H66A 5IQYA 4WETA 5JCGA 2PVOC 2OBIA 2R3XA 4OFTA 2O87A 4ZL8A 2VL3A 4Q5RA 3CBUA 6GSSA 4HU7A 5DALB 3EINA 1GNWA 1I9DA 3TJJA 2RM6A 2PVQA 4IJIA 3C73A 4YAVA 5J3RA 4NPBA 3PH9A 1PKWA 3N5OA 1W4VA 2LRTA 3BBYA 3LGCA 3ZIVA 4K7IA 1XWAA 2O7KA 3ZYWA 5ID2A 3BCIA 4MZBA 1GUHA 3QAWA 3ZLPA 3RAZA 2F9SA 4LL1B 2PUKC 3QAGA 1EWXA 4K5SA 1T8EB 3LJRA 2VL9A 4MJEA 4ID0A 2KOKA 2BJXA 3FZAA 3DVWA 4KH7A 4HU9A 1F3AA 3F4RA 4DVCA 1S3DA 4NHZA 2GZPA 3CSIA 1XW9A 2C3TA 5B8AA 2PU9C 3TRQA 1AXDA 5HFKA 3GURA 3HHVA 3AY8A 4NWYA 4RI6A 3WGXA 5H5QA 4IW9A 1YJ6A 2QA2A 2JACA 4E8HA 1N8JA 1PX7A 1Z7PA 5B6MA 3GIXA 3FMWA 4KDXA 1FW1A 4D73B 2WRTA 4HI7A 2ON5A 2P31A 1GSDA 3G7IA 1RW1A 2VIMA 1JZRA 2B1KA 4ZILA 1OKDA 4MF6A 1UA5A 4GWRA 3D21A 3ZRDA 4IJ3A 3IC4A 4EKZA 4ICYA 1B9YC 2KLXA 2MBSA 1SJ6A 2OJLA 4AJ6A 2E2MA 3DKSA 4MZCA 3M1GA 4FYUA 1XFLA 3GL5A 4TN8A 4BWQA 2HT9A 1XXUA 5KEJA 2VLTA 4KDYA 4PXOA 4IVFA 4K1FA 1YQ1A 1GULA 1DSBA 4POKA 3M9JA 1R7HA 8GSSA 1H75A 1FAAA 3JCML 1GTUA 3CMIA 4G19A 1A0FA 2AJQB 2RM5A 1EOGA 4L8EA 2YN1A 2YV9A 1ZL9A 2YP6A 5EPFA 1R4WA 5G5FA 5H5SA 1GUMA 1TP9A 1F6MC 3KXOA 4KW6A 1HQOA 1RK4A 3GV1A 3IV4A 1A8LA 2H0GA 14GSA 1FVJA 3MNGA 2R37A 4G10A 1Z6NA 2VCWA 2JU5A 4HZ4A 5GSSA 5CYYA 2YOIA 3C1SA 3NOFA 2OE1A 4LLRA 4TXVA 2OADA 1SKRB 3VFIA 3L9VA 2HRAA 3KIJA 2LRNA 3E3EA 3GYKA 3FZ9A 1ZCPA 2UZ8A 4OWYA 1HYUA 5ECRB 1R5PA 1FOHA 2LSTA 3KMNA 1MD3A 3QMXA 1I5GA 12GSA 2HSHA 2B7JA 2LJAA 4HJMA 5J9BA 5G30A 3H93A 3P8WA 5ECNB 2CZ3A 4IQ1A 3IK7A 2OA7A 5AISA 3QDNA 2H6XA 4IELA 2GVPA 5ECIB 3ZVJD 2CX4A 1A24A 1PN9A 2DJJA 1FG4A 5AIXA 2FNOA 3F4TA 2X4AA 2KP2A 2JZTA 4LA1A 3GUSA 2NDOA 1ABAA 3U5RE 3SWLA 2A2RA 5IOXA 1TKDB 1GTBA 4O92A 4OD7A 4MLYA 4KSOA 2C0EA 5LD0A 3GA4A 1K0NA 3R3EA 2M80A 1PA3A 2V2GA 2H71A 4IBPA 1Z9HA 5ELGA 2IMKA 2H74A 1EGRA 5KN1A 2A4HA 3UIWA 9GSSA 2L5OA 2X99A 3N9JA 3GKXA 1TW9A 3L0HA 2ZNMA 5B8BA 3ED3A 5AGYA 4JE1A 1GSYA 2MMNA 2YNXA 1SD8A 4XCSA 3P2AA 2IPAA 3DIEA 1QK8A 2DIYA 2IIYA 3CRTA 4OFMA 4PQ1A 4MABA 1GSEA 4TR1A 1PKZA 4HQSA 5LNKe 2FCHA 2WZ9A 4MPGA 4MA9A 4NAXA 4HJ2A 1ERWA 2V32A 4V2NA 2N5BA 4GCIA 5JCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIW A;  4BWS A;  1FB6 A;  3HVV A;  5KN3 A;  2HLS A;  3A3T A;  3ZZX A;  4I2U A;  2LNT A;  4EL1 A;  3IPZ A;  1FVK A;  2OAC A;  4V2M A;  3M9K A;  5ECM B;  3E9J B;  4EDY A;  1TI1 A;  3QFA C;  4NV2 A;  3UEM A;  1XWC A;  2GTU A;  4ULX A;  1O7U A;  4V2L A;  3FR6 A;  4WR4 A;  4GTU A;  4JR4 A;  2P0G A;  1XZO A;  4K0N A;  3TRX A;  1XVW A;  4ECC A;  2C0F A;  2QGV A;  2OKA A;  4POB A;  2DJ0 A;  4MPF A;  2WFC A;  2FWE A;  5HFI A;  1U88 A;  1B8X A;  3ME8 A;  5CRD A;  4G9H A;  1UC7 A;  2H1D A;  3HY2 A;  2C3Q A;  4WBJ A;  3PGT A;  5E4W A;  5IMA A;  2C3N A;  3OR5 A;  3GMF A;  5IO2 A;  4HUA A;  2AAW A;  4XS4 A;  5CRE A;  4ML1 A;  1WJK A;  2GGT A;  1ZZY A;  1QQ2 A;  2LJR A;  1XCC A;  1XBS A;  1GSQ A;  1W89 A;  2AV4 A;  2J23 A;  3C8E A;  2LRC A;  4MJA A;  2B5X A;  4DEJ A;  5DQY A;  1VF2 A;  3GKM A;  5HR3 A;  1GLP A;  4KUN A;  2A4V A;  5DJM A;  3LYK A;  5ECQ B;  2DJ3 A;  2YV7 A;  1WRY A;  4NXI A;  2WJU A;  4MF7 A;  4DSS A;  4I6X A;  1GLQ A;  1HNC A;  3ZMK A;  2DMM A;  2CQ9 A;  1VGL A;  3D0Z A;  4JED A;  5D9T A;  4ZIJ A;  4EE0 A;  2VCQ A;  1PL1 A;  2VAF A;  17GS A;  5CO3 A;  5LCZ A;  3H1N A;  2M46 A;  2REM A;  3RPP A;  3KEB A;  3PIN A;  1K0A A;  11GS A;  1SK2 A;  4TR1 B;  3EE2 A;  1X0R A;  2VL2 C;  2MBT A;  4ZL9 A;  3D22 A;  3TKQ A;  4K7N A;  2GSS A;  4XS6 A;  3VI5 A;  3VUR A;  3ZTL A;  1YY7 A;  1GL8 A;  1T4Y A;  4I8B A;  2H70 A;  16GS A;  2OBK A;  1VRS D;  1YKA A;  2IMD A;  1V98 A;  2G0F A;  1OE8 A;  1K0D A;  3HJM A;  3KH7 A;  2VO4 A;  2H0H A;  2GQL A;  1LJR A;  3W6G A;  1U3A A;  2PBJ A;  2X8H A;  1JZW A;  2F8F A;  1EP8 A;  3FR3 A;  4ZBA A;  4TR4 A;  3K8N A;  5JWR B;  2JZS A;  5FT3 A;  4PQI A;  3APS A;  4POM A;  3RHC A;  3VWU A;  3QAV A;  1ON4 A;  3H79 A;  4N30 A;  2H8L A;  2DLX A;  2GSR A;  2A2S A;  1DBY A;  5DDL A;  4NHW A;  1MEK A;  4XS4 B;  1GTI A;  4H86 A;  1VF4 A;  3MWH A;  3TDG A;  2NVL A;  1Q4J A;  4F03 A;  4F2I A;  2L59 A;  4IS0 A;  4AJ7 A;  5D73 A;  3CTF A;  1GP1 A;  2IFQ A;  3I43 A;  2TRC P;  4ZB6 A;  5G2Z A;  2E2G A;  5FWG A;  3EWL A;  2GZY A;  1O73 A;  3KZQ A;  4HZ2 A;  2ZUP A;  4DSS B;  1AUC A;  2YJH A;  2R6K A;  5FHI A;  1SJI A;  1GTA A;  2NPB A;  2JL4 A;  6GSU A;  4EC0 A;  1V2A A;  2H75 A;  2ON7 A;  1B48 A;  2H6Y A;  1G0T A;  5E59 A;  3L78 A;  2EC4 A;  2H01 A;  3TKS C;  3ERW A;  4KCE A;  1M2B A;  3LWA A;  1T7P B;  3EU4 A;  4G2E A;  4K6X A;  1MD4 A;  4IQA A;  4WXT A;  4MF5 A;  4ZBB A;  2WCI A;  5GST A;  3HKR A;  3C1R A;  3DML A;  3KP9 A;  1NW2 A;  2PPT A;  1WE0 A;  4ZB8 A;  4EXJ A;  1AAZ A;  1HNB A;  1S3C A;  3GFK A;  4TW5 A;  4I97 A;  2J9H A;  3GL3 A;  1J0F A;  4GLT A;  4K2D A;  4Q5F A;  3L4N A;  5HR0 A;  3EMX A;  3FZ5 A;  3HA9 A;  2C4J A;  4MJB A;  1TRS A;  3I6A A;  2CVK A;  4QL9 A;  3MAK A;  1J08 A;  4GRF A;  3DWV A;  3D5J A;  5IM9 A;  3RPN A;  1TK8 B;  2L4Q A;  4K0G A;  4EF0 A;  4QQ7 A;  3IA1 A;  1JLV A;  1TI3 A;  4PUA A;  3GTU B;  2KUC A;  1URM A;  2V1M A;  2FD3 A;  4YAP A;  1OC8 A;  3FRC A;  3LYP A;  3UJ1 A;  3W8S A;  1NHY A;  5B7C A;  4YQU A;  1YZX A;  2YJ7 A;  3CXG A;  4RQR A;  5J41 A;  3RDW A;  2IFQ B;  1SKW B;  4NV5 A;  2CAI A;  2DBC A;  4BPY A;  2GQM A;  1A2L A;  2C80 A;  1BQ7 A;  2IMF A;  1EV9 A;  2H19 A;  2VCT A;  2JZR A;  1NSW A;  3ZIT A;  2HFD A;  1AQW A;  4ZB9 A;  2VLV A;  1JHB A;  2DC5 A;  2C0G A;  1QUW A;  5IMF A;  1T00 A;  3I69 A;  1B9X C;  4OMV A;  1WOU A;  1JFU A;  3M0F A;  1SYR A;  1RQM A;  1TDI A;  1PMT A;  2B3S A;  1T4Z A;  4ECJ A;  5DVB A;  2HI7 A;  5G5E A;  2C8U A;  5HFG A;  5IMC A;  4X1U A;  3UVH A;  3HZ8 A;  5G31 A;  3EU3 A;  2IME A;  4IP1 A;  1CQH A;  1BED A;  4I5Q A;  4FYC A;  5EVO A;  1HNA A;  1BYE A;  3HJO A;  2H1B A;  3KP8 A;  2CAQ A;  1XWG A;  3LXT A;  4RQX A;  5CAX A;  1KNG A;  2LV3 A;  2AUV A;  5F8B A;  2EIO A;  2KP1 A;  4EVM A;  3F3R A;  2FHE A;  4L0W A;  4IGJ A;  1Q98 A;  4LMW A;  1MTC A;  2VOC A;  4AJ8 A;  5IPH A;  4ZBD A;  5HQP A;  3TOT A;  2XHF A;  4TVE A;  2TIR A;  5IMV A;  2X8C A;  5KN0 A;  2I81 A;  3KTL A;  2K9F A;  2OE3 A;  3G7J A;  1EP7 A;  1GWC A;  5EL8 A;  3GX0 A;  4XS1 A;  1QGV A;  1OVN A;  4OO5 A;  2RUF A;  5DCH A;  4WKW A;  1SK1 A;  2LS5 A;  4CDO A;  6GSV A;  5IO0 A;  4PNG A;  3Q6O A;  4J56 E;  1K0C A;  2K6V A;  1K3O A;  3CSJ A;  2FUG 2;  3LQ7 A;  2XBI A;  1T1V A;  2H1A A;  4WF5 A;  3G9B A;  2ALB A;  5DBQ A;  3TJF A;  4JRR A;  1XVQ A;  4F9Z A;  3F6F A;  4XHM A;  1K3Y A;  1Z7R A;  3GSS A;  4KB3 A;  4BVY A;  3TJK A;  2VCX A;  1A0R P;  1X5C A;  2XPD A;  5G1L A;  3ME7 A;  1SKS B;  1WPI A;  2I9H A;  2H76 A;  4TXO A;  5KN2 A;  5D8I A;  3BOA A;  1E2Y A;  5COH A;  4MH2 A;  1TK0 B;  2CZ2 A;  2GLR A;  1EZK A;  2GT5 A;  5HR1 A;  1BJX A;  1WP0 A;  3FHK A;  1UVZ A;  3GRX A;  3VWW A;  3WYW A;  2CVD A;  1BG5 A;  1GH2 A;  3VK9 A;  2GDR A;  4MJC A;  2V6K A;  5A4U A;  5ECK B;  3DVX A;  1F3B A;  3ZL5 A;  3QFB C;  2CV4 A;  1EV4 A;  3HD5 A;  3WD6 A;  3NZN A;  4BA7 A;  4N0Z A;  1GSS A;  5JWQ B;  3UAP A;  2RLI A;  5A4W A;  2X8G A;  3ERF A;  1TRV A;  3TGZ A;  2NTO A;  3FYG A;  5CRW A;  2DJ2 A;  3E0U A;  1ILO A;  2LJK A;  2LEG A;  4CHS A;  2B5E A;  3IAM 2;  1B4Q A;  1SK0 A;  2IL3 A;  1K0M A;  4HS1 A;  3GKK A;  4IHU A;  2R5G A;  2FLS A;  3KH9 A;  3LG6 A;  2MZC A;  4ECB A;  1TK5 B;  2R2J A;  4WF4 A;  3TB2 A;  4F0C A;  2L57 A;  4IKH A;  1GUK A;  3O76 A;  4O5R A;  3EVI A;  1TRW A;  4KAE A;  3WT2 A;  3CYN A;  1A2M A;  2JAD A;  2AHE A;  4X43 A;  3DYR A;  1TRU A;  3LFL A;  2YWI A;  4JBB A;  4MH3 A;  1G6Y A;  3FKF A;  3EYT A;  2F8A A;  4POL A;  2HRN A;  2H73 A;  2FA8 A;  1SL1 B;  1V9W A;  1IYI A;  1XIY A;  1CQG A;  3CTG A;  4BL7 A;  2E7P A;  3F6D A;  1T3B A;  1K0O A;  2I1U A;  2H72 A;  1G7E A;  1AIU A;  3DGQ A;  2H0I A;  4WR5 A;  3KMO A;  1PRX A;  1M2D A;  4RUV A;  1Z3E A;  4YQV A;  6GST A;  3ZIJ A;  5JWO B;  4MMM A;  3F9U A;  4TXO B;  3IHQ A;  4KSM A;  5IIZ A;  2RUE A;  3W8J A;  4HQZ A;  1XW5 A;  4K7O A;  3S9F A;  1C72 A;  3IBH A;  5ECL B;  5GAP D;  1F9M A;  4AGS A;  5GZZ B;  4XRA A;  4MK3 A;  2DJ1 A;  3GX8 A;  3QPM A;  2N5F A;  2RII A;  1M0U A;  1ZYQ B;  3C7M A;  2K8S A;  3PR8 A;  4TRX A;  3M8N A;  2I4A A;  2JSY A;  2NBS A;  1TU8 A;  2PN8 A;  5CNW A;  2LKU A;  2IN3 A;  2K8V A;  2VCZ A;  3LXZ A;  3WT1 A;  1IYH A;  1YDK A;  5DAK A;  5EY6 A;  2PER A;  3BJ5 A;  3A2V A;  1PX6 A;  1KEB A;  1Z6M A;  5C00 A;  2VD1 A;  1YEX A;  3APQ A;  2ZCT A;  1O8W A;  3HVX A;  4Q5Q A;  1LU4 A;  5ENU A;  5J4U A;  3U6V A;  2VCV A;  3ISO A;  1Z5Y E;  3HDC A;  1WMJ A;  3R2Q A;  1B4P A;  4DSR A;  3HYP A;  3V1W A;  1O8X A;  4WBR D;  2PMT A;  1F2E A;  5ELA A;  4K8M A;  4EDZ A;  3GTU A;  2L6C A;  4O7H A;  1ST9 A;  3FW2 A;  2WGR A;  3F0I A;  1FHE A;  1MDJ A;  3VLN A;  1ACV A;  3GNJ A;  4IN0 A;  1QFN A;  1OAZ A;  2QKE A;  1M2A A;  2DML A;  4MP4 A;  1AQX A;  1TTZ A;  2QC7 A;  3FEU A;  5JCU A;  5C04 A;  2O8V B;  1BAY A;  2EIQ A;  4KE3 A;  4OO4 A;  2WUL A;  1QMV A;  4ECI A;  3CSH A;  3LEF A;  2XC2 A;  2CX3 A;  22GS A;  4GSN A;  2BTO T;  3GN3 A;  4GST A;  4YQM A;  4TOP A;  5IPG A;  1SJZ A;  1XWB A;  2HSY A;  1GSU A;  2L5L A;  4TR0 A;  2VD0 A;  3WGD A;  3CRU A;  4YH2 A;  1MDI A;  2B1L A;  4CW9 A;  3RBT A;  1JLW A;  4KDU A;  3F3Q A;  5CRG A;  1THX A;  1X5D A;  1SU9 A;  4KCA A;  3US3 A;  1A8Y A;  1O81 A;  2VM2 A;  2YZH A;  1XOA A;  2O89 A;  18GS A;  3A2X A;  4J2F A;  1M9A A;  1YKC A;  3Q18 A;  3GKN A;  2M72 A;  3IXR A;  3UBL A;  1V58 A;  3KM6 A;  4ILF A;  5J9C A;  5ABR A;  5DJL A;  4XIH A;  3MSZ A;  3D6I A;  2YPM A;  3GHA A;  1PSQ A;  4LL4 B;  5D9V A;  5IMD A;  4FO5 A;  5DAK B;  4F0B A;  3I9V 2;  3UMA A;  2P5Q A;  1FB0 A;  2N5A A;  3IOS A;  3VWX A;  4HEA 2;  2V6O A;  2H1G A;  1YF1 A;  1OC9 A;  1ZMA A;  1TXX A;  4LMV A;  2HE3 A;  4HDE A;  3TCO A;  1SD9 A;  3O3T A;  4L5O A;  3VI7 A;  1XWK A;  3P7X A;  5F05 A;  2FY6 A;  2KHP A;  1X9S B;  2YZU A;  5AN1 A;  1Y6E A;  5D9W A;  1SYX A;  5B6N A;  2DIZ A;  1SL0 B;  1PD2 1;  3O6T A;  3ZVJ A;  6GSY A;  1A23 A;  3KCM A;  2C1Y A;  3IR4 A;  4KND A;  3ZRE A;  1DE2 A;  2YWO A;  2CVB A;  2X64 A;  1S3A A;  4Z7X A;  1LBK A;  5A4V A;  1JZO A;  4ZXG A;  20GS A;  1DUG A;  2V41 A;  1U87 A;  4EUY A;  5H5R A;  1OKT A;  3J7Y k;  5ID2 B;  4PQH A;  4RI7 A;  2DSA A;  3EUR A;  3QD9 A;  3A2W A;  2GZZ A;  4GQF A;  1SEN A;  2HNL A;  1FOV A;  3IK9 A;  4L5L A;  1OE7 A;  4J57 E;  2CA8 A;  1YF0 A;  3ZML A;  4ISD A;  2OE0 A;  4GQC A;  1VF1 A;  1EEJ A;  3BCK A;  3H4K A;  13GS A;  2GS3 A;  2ES7 A;  2IJY A;  2AYT A;  2HYX A;  2MMZ A;  3F4S A;  4GSS A;  1M9B A;  3FK8 A;  1VF3 A;  3EMP A;  2FGX A;  3NIV A;  2C0D A;  1XOB A;  4MDC A;  3KGK A;  2FWH A;  2BMX A;  3Q74 A;  4QL7 A;  3TOU A;  4ACS A;  3UVT A;  1TU7 A;  4PNF A;  1OC9 B;  2IWT A;  4KX4 A;  3L9U A;  1FO5 A;  4FYB A;  3IRA A;  2HZF A;  2HXK A;  4BVX A;  2L4C A;  1O85 A;  2R4V A;  2I3Y A;  1QXH A;  3DD3 A;  4TR3 A;  2EIR A;  4F82 A;  1V40 A;  4PX1 A;  2LQQ A;  5DQS A;  5INY A;  5ECH B;  1K0B A;  5IOW A;  4NMU A;  1O6J A;  1ZYE A;  1E6B A;  2Z9S A;  3IDV A;  1G7O A;  3TJB A;  2GQK A;  3TKR A;  5F0G A;  2PGT A;  3GH9 A;  3A5W A;  5D9X A;  5IMZ A;  2LNS A;  3Q19 A;  5DCG A;  2H30 A;  1MDK A;  2WDU A;  1PQN A;  2D2Z A;  3QOU A;  5A5K A;  5CRH A;  1NM3 A;  3J7Y b;  4JZQ A;  1WIK A;  3DEX A;  1GRX A;  2O85 A;  2FA4 A;  1J9B A;  1M99 A;  5GAN D;  1YEP A;  5ECO B;  3VPT A;  2VLU A;  2LUS A;  2DJK A;  5ECP B;  2L6D A;  6GSX A;  3UL3 A;  5J5N A;  1SL2 B;  4DSQ A;  3FZ4 A;  2MYG A;  4WEY A;  2AB6 A;  3QR6 A;  3D4M A;  3UAR A;  3ZFL A;  3UBK A;  2G2Q A;  1U6T A;  4V1A p;  7GSS A;  2FWG A;  2TRX A;  1EEM A;  4PUF C;  4GXZ A;  4MZW A;  2YWN A;  2XPE A;  6GSW A;  2LQO A;  3FR9 A;  2IMI A;  1TOF A;  1EOH A;  3EC3 A;  4E8E A;  1U3I A;  4I2T A;  3M3M A;  4KA0 A;  1KBN A;  4PUR A;  1V57 A;  4P3Y B;  5G1K A;  4XRD A;  3KD0 A;  1AC1 A;  3APO A;  2HZE A;  4MCU A;  4XTS A;  3HXS A;  2GT6 A;  2CT6 A;  4EO3 A;  2YWM A;  3H8Q A;  1JZD A;  4OCE A;  2E0Q A;  2P5R A;  2H6Z A;  2YAN A;  3DRN A;  4ZL7 A;  3BD2 A;  2HRF A;  5D93 A;  5ECS A;  1KTE A;  1USB A;  3VWV A;  1GNE A;  1X5E A;  2VL2 A;  1HD2 A;  4GF0 A;  2WS2 A;  1EGO A;  1BX9 A;  2VUP A;  4L0U A;  1AW9 A;  3D4T A;  3C71 A;  1R26 A;  1A2J A;  1M7T A;  1AQV A;  3GH6 A;  1K3L A;  1X9W B;  2WB9 A;  4OCF A;  5D96 A;  3TKS E;  5HR2 A;  5DAL A;  2MMO A;  1Y25 A;  1X9M B;  1WWJ A;  1UN2 A;  4HOJ A;  2LTK A;  4JU5 A;  3QCP A;  1R5A A;  2F3M A;  4X0X A;  1OYJ A;  4IP6 A;  4AF2 A;  2PWJ A;  5AIV A;  3IE3 A;  1PL2 A;  4K9Z A;  3MDK A;  3HZ4 A;  3ZFB A;  1NHO A;  1PGT A;  3ERG A;  1ML6 A;  2GST A;  3P90 A;  3L9S A;  4JR6 A;  2VM1 A;  2GSQ A;  2K18 A;  3TJG A;  2MMA A;  3TKP A;  1ZGN A;  3LOR A;  2QSI A;  1XW6 A;  1THO A;  3F63 A;  3VPQ A;  3FY7 A;  3UOM A;  2XBQ A;  4ML6 A;  3G7Y A;  3TUE A;  1DE1 A;  1ERT A;  3RHB A;  2B7K A;  1F37 A;  1XPV A;  3HJP A;  10GS A;  2JSZ A;  1ERV A;  5F06 A;  1ZOF A;  4N11 A;  4O32 A;  1GSF A;  5CP1 A;  1TJD A;  3KTB A;  3GST A;  4PGT A;  2B6M A;  2FWF A;  4Q5N A;  4D73 A;  19GS A;  1OC3 A;  3WGE A;  4FH8 A;  1G6W A;  4OFN A;  4N10 A;  3DXB A;  3SBC A;  2F51 A;  5F07 A;  1N2A A;  3HCZ A;  2YCD A;  2HZE B;  5L71 A;  3IAS 2;  3HVS A;  3TKS A;  4N0V A;  2B5Y A;  4KGI A;  4V1A g;  3F8U A;  3TRP A;  4TKY A;  3KJY A;  1ERU A;  3LSZ A;  1H4O A;  2H66 A;  5IQY A;  4WET A;  5JCG A;  2PVO C;  2OBI A;  2R3X A;  4OFT A;  2O87 A;  4ZL8 A;  2VL3 A;  4Q5R A;  3CBU A;  6GSS A;  4HU7 A;  5DAL B;  3EIN A;  1GNW A;  1I9D A;  3TJJ A;  2RM6 A;  2PVQ A;  4IJI A;  3C73 A;  4YAV A;  5J3R A;  4NPB A;  3PH9 A;  1PKW A;  3N5O A;  1W4V A;  2LRT A;  3BBY A;  3LGC A;  3ZIV A;  4K7I A;  1XWA A;  2O7K A;  3ZYW A;  5ID2 A;  3BCI A;  4MZB A;  1GUH A;  3QAW A;  3ZLP A;  3RAZ A;  2F9S A;  4LL1 B;  2PUK C;  3QAG A;  1EWX A;  1T8E B;  3LJR A;  2VL9 A;  4MJE A;  4ID0 A;  2KOK A;  2BJX A;  3FZA A;  3DVW A;  4KH7 A;  4HU9 A;  1F3A A;  3F4R A;  4DVC A;  1S3D A;  4NHZ A;  2GZP A;  3CSI A;  1XW9 A;  2C3T A;  5B8A A;  2PU9 C;  3TRQ A;  1AXD A;  5HFK A;  3GUR A;  3HHV A;  3AY8 A;  4NWY A;  4RI6 A;  3WGX A;  5H5Q A;  4IW9 A;  1YJ6 A;  2JAC A;  4E8H A;  1N8J A;  1PX7 A;  1Z7P A;  5B6M A;  3GIX A;  4KDX A;  1FW1 A;  4D73 B;  2WRT A;  4HI7 A;  2ON5 A;  2P31 A;  1GSD A;  3G7I A;  1RW1 A;  2VIM A;  1JZR A;  2B1K A;  4ZIL A;  1OKD A;  4MF6 A;  1UA5 A;  4GWR A;  3D21 A;  3ZRD A;  4IJ3 A;  3IC4 A;  4EKZ A;  1B9Y C;  2KLX A;  2MBS A;  1SJ6 A;  2OJL A;  4AJ6 A;  2E2M A;  3DKS A;  4MZC A;  3M1G A;  4FYU A;  1XFL A;  3GL5 A;  4TN8 A;  4BWQ A;  2HT9 A;  1XXU A;  5KEJ A;  2VLT A;  4KDY A;  4PXO A;  4IVF A;  4K1F A;  1YQ1 A;  1GUL A;  1DSB A;  4POK A;  3M9J A;  1R7H A;  8GSS A;  1H75 A;  1FAA A;  3JCM L;  1GTU A;  3CMI A;  4G19 A;  1A0F A;  2AJQ B;  2RM5 A;  1EOG A;  4L8E A;  2YN1 A;  2YV9 A;  1ZL9 A;  2YP6 A;  5EPF A;  1R4W A;  5G5F A;  5H5S A;  1GUM A;  1TP9 A;  1F6M C;  3KXO A;  4KW6 A;  1HQO A;  1RK4 A;  3GV1 A;  3IV4 A;  1A8L A;  2H0G A;  14GS A;  1FVJ A;  3MNG A;  2R37 A;  4G10 A;  1Z6N A;  2VCW A;  2JU5 A;  4HZ4 A;  5GSS A;  5CYY A;  2YOI A;  3C1S A;  3NOF A;  2OE1 A;  4LLR A;  4TXV A;  2OAD A;  1SKR B;  3VFI A;  3L9V A;  3KIJ A;  2LRN A;  3E3E A;  3GYK A;  3FZ9 A;  1ZCP A;  4OWY A;  1HYU A;  5ECR B;  1R5P A;  2LST A;  3KMN A;  1MD3 A;  3QMX A;  1I5G A;  12GS A;  2HSH A;  2B7J A;  2LJA A;  4HJM A;  5J9B A;  5G30 A;  3H93 A;  3P8W A;  5ECN B;  2CZ3 A;  4IQ1 A;  3IK7 A;  2OA7 A;  5AIS A;  3QDN A;  2H6X A;  4IEL A;  2GVP A;  5ECI B;  3ZVJ D;  2CX4 A;  1A24 A;  1PN9 A;  2DJJ A;  1FG4 A;  5AIX A;  2FNO A;  3F4T A;  2KP2 A;  2JZT A;  4LA1 A;  3GUS A;  2NDO A;  1ABA A;  3U5R E;  3SWL A;  2A2R A;  5IOX A;  1TKD B;  1GTB A;  4O92 A;  4OD7 A;  4MLY A;  4KSO A;  2C0E A;  5LD0 A;  3GA4 A;  1K0N A;  2M80 A;  1PA3 A;  2V2G A;  2H71 A;  4IBP A;  1Z9H A;  5ELG A;  2IMK A;  2H74 A;  1EGR A;  5KN1 A;  3UIW A;  9GSS A;  2L5O A;  2X99 A;  3N9J A;  3GKX A;  1TW9 A;  3L0H A;  2ZNM A;  5B8B A;  3ED3 A;  5AGY A;  4JE1 A;  1GSY A;  2MMN A;  2YNX A;  1SD8 A;  4XCS A;  3P2A A;  2IPA A;  3DIE A;  1QK8 A;  2DIY A;  2IIY A;  3CRT A;  4OFM A;  4PQ1 A;  4MAB A;  1GSE A;  4TR1 A;  1PKZ A;  4HQS A;  5LNK e;  2FCH A;  2WZ9 A;  4MPG A;  4MA9 A;  4NAX A;  4HJ2 A;  1ERW A;  2V32 A;  4V2N A;  2N5B A;  4GCI A;  5JCW A; 
#chains in the Genus database with same CATH topology
 4FIW A;  4BWS A;  1FB6 A;  3HVV A;  5KN3 A;  2HLS A;  3A3T A;  3ZZX A;  4I2U A;  5KOX A;  2LNT A;  4EL1 A;  3IPZ A;  1FVK A;  2OAC A;  4V2M A;  3M9K A;  5ECM B;  3E9J B;  4EDY A;  1TI1 A;  3QFA C;  4NV2 A;  3UEM A;  1XWC A;  2GTU A;  4ULX A;  1O7U A;  4V2L A;  3FR6 A;  4WR4 A;  4GTU A;  4JR4 A;  2P0G A;  1XZO A;  4K0N A;  3TRX A;  1XVW A;  4ECC A;  4O5Q A;  2C0F A;  2QGV A;  2OKA A;  4POB A;  2DJ0 A;  4MPF A;  2WFC A;  2FWE A;  5HFI A;  1U88 A;  1B8X A;  2QA1 A;  3ME8 A;  5CRD A;  4G9H A;  1UC7 A;  2H1D A;  3HY2 A;  2C3Q A;  4WBJ A;  3PGT A;  5E4W A;  5IMA A;  2C3N A;  3OR5 A;  3GMF A;  5IO2 A;  4HUA A;  2AAW A;  4XS4 A;  5CRE A;  4G0L A;  4ML1 A;  1WJK A;  2GGT A;  1ZZY A;  1QQ2 A;  2LJR A;  1XCC A;  1XBS A;  1GSQ A;  1W89 A;  2AV4 A;  2J23 A;  3C8E A;  2LRC A;  4MJA A;  2B5X A;  4DEJ A;  5DQY A;  1VF2 A;  3GKM A;  5HR3 A;  2HSM A;  1GLP A;  4KUN A;  2A4V A;  5DJM A;  3LYK A;  5ECQ B;  2DJ3 A;  2YV7 A;  1WRY A;  4NXI A;  2WJU A;  4MF7 A;  4DSS A;  4I6X A;  1GLQ A;  1HNC A;  3ZMK A;  2DMM A;  2CQ9 A;  1VGL A;  3D0Z A;  4JED A;  5D9T A;  4ZIJ A;  4EE0 A;  2VCQ A;  1PL1 A;  2VAF A;  17GS A;  5CO3 A;  5BRT A;  5LCZ A;  4BVY B;  3H1N A;  2M46 A;  2REM A;  3RPP A;  3KEB A;  3PIN A;  1K0A A;  11GS A;  1SK2 A;  4TR1 B;  3EE2 A;  4USS A;  1X0R A;  2VL2 C;  2MBT A;  3A5I A;  4ZL9 A;  3D22 A;  3TKQ A;  4K7N A;  2GSS A;  4XS6 A;  3VI5 A;  3VUR A;  3ZTL A;  1YY7 A;  2HRK A;  1GL8 A;  1T4Y A;  4I8B A;  2H70 A;  16GS A;  2OBK A;  1VRS D;  1YKA A;  2IMD A;  1V98 A;  2G0F A;  1OE8 A;  1K0D A;  3HJM A;  3KH7 A;  5BMU A;  2VO4 A;  2H0H A;  2GQL A;  1LJR A;  3W6G A;  1U3A A;  2PBJ A;  2X8H A;  1JZW A;  2F8F A;  1EP8 A;  3FR3 A;  4ZBA A;  4TR4 A;  3HVN A;  3K8N A;  5JWR B;  2JZS A;  5FT3 A;  4PQI A;  3APS A;  4POM A;  3RHC A;  3VWU A;  3QAV A;  1ON4 A;  3H79 A;  4N30 A;  2H8L A;  2DLX A;  2GSR A;  2A2S A;  1DBY A;  5DDL A;  4NHW A;  2X49 A;  1MEK A;  4XS4 B;  1GTI A;  4H86 A;  1VF4 A;  3MWH A;  3TDG A;  2NVL A;  1Q4J A;  4F03 A;  4F2I A;  2L59 A;  4IS0 A;  4AJ7 A;  4CY6 A;  5D73 A;  3CTF A;  1GP1 A;  2IFQ A;  3I43 A;  4K5R A;  2TRC P;  4ZB6 A;  5G2Z A;  2E2G A;  3LW9 A;  5FWG A;  3EWL A;  2GZY A;  1O73 A;  3KZQ A;  4HZ2 A;  4BL7 B;  2ZUP A;  4DSS B;  1AUC A;  2YJH A;  2R6K A;  5FHI A;  1SJI A;  1GTA A;  2NPB A;  2JL4 A;  6GSU A;  4EC0 A;  1V2A A;  2H75 A;  2ON7 A;  1B48 A;  2H6Y A;  1G0T A;  5E59 A;  3L78 A;  2EC4 A;  2H01 A;  3TKS C;  3ERW A;  4KCE A;  1M2B A;  3LWA A;  1T7P B;  3EU4 A;  4G2E A;  4K6X A;  1MD4 A;  4IQA A;  4WXT A;  4MF5 A;  4ZBB A;  2WCI A;  5GST A;  3HKR A;  3C1R A;  3DML A;  3KP9 A;  1NW2 A;  2PPT A;  1WE0 A;  4ZB8 A;  4EXJ A;  3MIX A;  1AAZ A;  1HNB A;  4HSC X;  1S3C A;  3GFK A;  4TW5 A;  4I97 A;  2J9H A;  3GL3 A;  1J0F A;  4GLT A;  4K2D A;  4Q5F A;  3L4N A;  5HR0 A;  3EMX A;  3FZ5 A;  3HA9 A;  2C4J A;  4MJB A;  1TRS A;  3I6A A;  3CQF A;  2CVK A;  4QL9 A;  2DKH A;  3MAK A;  1J08 A;  4GRF A;  3DWV A;  3D5J A;  5IM9 A;  3RPN A;  1TK8 B;  2L4Q A;  4K0G A;  5KOW A;  4EF0 A;  4QQ7 A;  3IA1 A;  1M3J A;  1JLV A;  1TI3 A;  4PUA A;  3GTU B;  2KUC A;  1URM A;  2V1M A;  2FD3 A;  4YAP A;  1OC8 A;  3FRC A;  3LYP A;  3UJ1 A;  3W8S A;  1NHY A;  5B7C A;  4YQU A;  1YZX A;  2YJ7 A;  3CXG A;  4RQR A;  5J41 A;  3RDW A;  2IFQ B;  1SKW B;  4NV5 A;  2CAI A;  2DBC A;  4BPY A;  2GQM A;  4X4J A;  1A2L A;  2C80 A;  1BQ7 A;  2IMF A;  1EV9 A;  4FQU A;  2H19 A;  2VCT A;  2JZR A;  1NSW A;  3ZIT A;  2HFD A;  1AQW A;  4ZB9 A;  2VLV A;  1JHB A;  2DC5 A;  2C0G A;  1QUW A;  5IMF A;  1T00 A;  3I69 A;  1B9X C;  4OMV A;  1WOU A;  1JFU A;  3M0F A;  1SYR A;  1RQM A;  1TDI A;  1PMT A;  2B3S A;  1T4Z A;  4ECJ A;  5DVB A;  2HI7 A;  5G5E A;  2C8U A;  5HFG A;  5IMC A;  4X1U A;  3UVH A;  3HZ8 A;  5G31 A;  3EU3 A;  2IME A;  4IP1 A;  1CQH A;  1BED A;  4I5Q A;  4FYC A;  5EVO A;  1HNA A;  1BYE A;  3HJO A;  2H1B A;  3KP8 A;  2CAQ A;  1XWG A;  3LXT A;  4RQX A;  5CAX A;  1KNG A;  2LV3 A;  2AUV A;  5F8B A;  2EIO A;  2KP1 A;  4EVM A;  3F3R A;  2FHE A;  4L0W A;  4IGJ A;  1Q98 A;  4LMW A;  1MTC A;  2VOC A;  4AJ8 A;  1PFO A;  5IPH A;  4ZBD A;  5HQP A;  3TOT A;  2XHF A;  4TVE A;  2TIR A;  5IMV A;  2X8C A;  5KN0 A;  2I81 A;  3KTL A;  2K9F A;  2OE3 A;  3G7J A;  1EP7 A;  1GWC A;  5EL8 A;  3GX0 A;  4XS1 A;  2A2P A;  1QGV A;  1OVN A;  4OO5 A;  2RUF A;  5DCH A;  4WKW A;  1SK1 A;  2LS5 A;  4CDO A;  6GSV A;  5IO0 A;  4PNG A;  3Q6O A;  4J56 E;  1K0C A;  2K6V A;  1K3O A;  3CSJ A;  2FUG 2;  3LQ7 A;  2XBI A;  1T1V A;  2H1A A;  4WF5 A;  3G9B A;  2ALB A;  5DBQ A;  3TJF A;  4JRR A;  1XVQ A;  4F9Z A;  3F6F A;  4XHM A;  1K3Y A;  1Z7R A;  3GSS A;  4KB3 A;  4BVY A;  3TJK A;  2VCX A;  3IHG A;  1A0R P;  1X5C A;  2XPD A;  5G1L A;  2R0G A;  3ME7 A;  1SKS B;  1WPI A;  2I9H A;  4YKG A;  2H76 A;  4TXO A;  5KN2 A;  5D8I A;  3BOA A;  1E2Y A;  5COH A;  4MH2 A;  1TK0 B;  2CZ2 A;  2GLR A;  1EZK A;  2GT5 A;  5HR1 A;  1BJX A;  1WP0 A;  3FHK A;  1UVZ A;  3GRX A;  3VWW A;  3WYW A;  2CVD A;  1BG5 A;  4Z2R A;  1GH2 A;  3VK9 A;  2GDR A;  4MJC A;  2V6K A;  5A4U A;  5ECK B;  3DVX A;  1F3B A;  3ZL5 A;  3QFB C;  2CV4 A;  1EV4 A;  3HD5 A;  3WD6 A;  3NZN A;  4BA7 A;  4N0Z A;  1GSS A;  5JWQ B;  3UAP A;  2RLI A;  5A4W A;  2X8G A;  3ERF A;  1TRV A;  3TGZ A;  2NTO A;  3FYG A;  5CRW A;  2DJ2 A;  3E0U A;  1ILO A;  2LJK A;  2LEG A;  4CHS A;  2B5E A;  3IAM 2;  1B4Q A;  1SK0 A;  2IL3 A;  1K0M A;  4HS1 A;  3GKK A;  4IHU A;  2R5G A;  2FLS A;  3KH9 A;  3LG6 A;  2MZC A;  4ECB A;  1TK5 B;  2R2J A;  4WF4 A;  3TB2 A;  4F0C A;  2L57 A;  4IKH A;  1GUK A;  3O76 A;  4O5R A;  3EVI A;  1TRW A;  4KAE A;  3WT2 A;  3CYN A;  1A2M A;  2JAD A;  2AHE A;  4X43 A;  3DYR A;  1TRU A;  3LFL A;  2YWI A;  4JBB A;  4MH3 A;  1G6Y A;  3FKF A;  3EYT A;  2F8A A;  4POL A;  2HRN A;  2H73 A;  2FA8 A;  1SL1 B;  1V9W A;  1IYI A;  1XIY A;  1CQG A;  3CTG A;  3EPT A;  4BL7 A;  2E7P A;  3F6D A;  1T3B A;  1K0O A;  2I1U A;  2H72 A;  1G7E A;  1AIU A;  3DGQ A;  2H0I A;  4G0I A;  4WR5 A;  3KMO A;  1PRX A;  1M2D A;  4RUV A;  1Z3E A;  4YQV A;  6GST A;  3ZIJ A;  5JWO B;  4MMM A;  3F9U A;  2DKI A;  4TXO B;  3IHQ A;  4KSM A;  5IIZ A;  2RUE A;  3W8J A;  4HQZ A;  1XW5 A;  4K7O A;  3S9F A;  1C72 A;  3IBH A;  5ECL B;  5GAP D;  1F9M A;  4AGS A;  5GZZ B;  4XRA A;  4MK3 A;  2DJ1 A;  4K2X A;  3GX8 A;  3QPM A;  2N5F A;  2RII A;  1M0U A;  1ZYQ B;  3C7M A;  2K8S A;  3PR8 A;  4TRX A;  3M8N A;  2I4A A;  2JSY A;  2NBS A;  1TU8 A;  2PN8 A;  5CNW A;  2LKU A;  2IN3 A;  2K8V A;  2VCZ A;  3LXZ A;  3WT1 A;  1IYH A;  1YDK A;  5DAK A;  5EY6 A;  2PER A;  3BJ5 A;  3A2V A;  1PX6 A;  1KEB A;  1Z6M A;  5C00 A;  2VD1 A;  1YEX A;  3APQ A;  2ZCT A;  1O8W A;  3HVX A;  4Q5Q A;  1LU4 A;  5ENU A;  5J4U A;  3U6V A;  2VCV A;  3ISO A;  1Z5Y E;  3HDC A;  1WMJ A;  3R2Q A;  1B4P A;  4DSR A;  3HYP A;  3V1W A;  1O8X A;  4WBR D;  2PMT A;  1F2E A;  5ELA A;  4K8M A;  4EDZ A;  3GTU A;  2L6C A;  4Z2U A;  4O7H A;  1ST9 A;  3FW2 A;  2WGR A;  3F0I A;  1FHE A;  1MDJ A;  1ZYN A;  3VLN A;  1ACV A;  4IN0 A;  3GNJ A;  1QFN A;  1OAZ A;  2QKE A;  1M2A A;  2DML A;  4MP4 A;  1AQX A;  1TTZ A;  2QC7 A;  3FEU A;  5JCU A;  5C04 A;  2O8V B;  1BAY A;  2EIQ A;  4KE3 A;  4OO4 A;  2WUL A;  1QMV A;  4ECI A;  3CSH A;  3LEF A;  2XC2 A;  2CX3 A;  22GS A;  4GSN A;  2BTO T;  3GN3 A;  4GST A;  4YQM A;  4TOP A;  5IPG A;  1SJZ A;  1XWB A;  2HSY A;  1GSU A;  2L5L A;  4TR0 A;  2VD0 A;  3WGD A;  3CRU A;  4YH2 A;  1MDI A;  2B1L A;  4CW9 A;  3RBT A;  1JLW A;  4KDU A;  3F3Q A;  5CRG A;  1THX A;  1X5D A;  1SU9 A;  4KCA A;  3US3 A;  1A8Y A;  1O81 A;  2VM2 A;  2YZH A;  4YKF A;  1XOA A;  2O89 A;  18GS A;  3A2X A;  4J2F A;  1M9A A;  1YKC A;  1M3I A;  3Q18 A;  1ZYP A;  3GKN A;  2M72 A;  3IXR A;  3UBL A;  1V58 A;  3KM6 A;  4ILF A;  5J9C A;  5ABR A;  5DJL A;  4XIH A;  3MSZ A;  3D6I A;  2YPM A;  3GHA A;  1PSQ A;  4LL4 B;  5D9V A;  5IMD A;  4FO5 A;  5DAK B;  4F0B A;  3I9V 2;  3UMA A;  2P5Q A;  1FB0 A;  2N5A A;  3IOS A;  3VWX A;  4HEA 2;  2V6O A;  2H1G A;  1YF1 A;  1OC9 A;  4CY8 A;  1ZMA A;  1TXX A;  4LMV A;  2HE3 A;  3PPU A;  4HDE A;  3TCO A;  1SD9 A;  3O3T A;  4L5O A;  3VI7 A;  1XWK A;  3P7X A;  5F05 A;  4EIP A;  2FY6 A;  2KHP A;  1X9S B;  2YZU A;  5AN1 A;  1Y6E A;  5D9W A;  1SYX A;  5B6N A;  2DIZ A;  1SL0 B;  1PD2 1;  3O6T A;  3ZVJ A;  6GSY A;  1A23 A;  3KCM A;  2C1Y A;  3IR4 A;  4KND A;  3ZRE A;  1DE2 A;  2YWO A;  2CVB A;  2X64 A;  1S3A A;  4Z7X A;  1LBK A;  5A4V A;  1JZO A;  4ZXG A;  20GS A;  1DUG A;  2V41 A;  1U87 A;  4EUY A;  5H5R A;  1OKT A;  3J7Y k;  5ID2 B;  4PQH A;  4RI7 A;  2DSA A;  3EUR A;  3QD9 A;  3A2W A;  2GZZ A;  4GQF A;  1SEN A;  2HNL A;  1FOV A;  3IK9 A;  4L5L A;  1OE7 A;  4J57 E;  2CA8 A;  1YF0 A;  3ZML A;  4ISD A;  2OE0 A;  4GQC A;  1VF1 A;  1EEJ A;  3BCK A;  3H4K A;  13GS A;  2GS3 A;  2ES7 A;  4BIK A;  2IJY A;  2AYT A;  2HYX A;  2MMZ A;  3F4S A;  4GSS A;  1M9B A;  3FK8 A;  1VF3 A;  3EMP A;  2FGX A;  3NIV A;  4A5P A;  2C0D A;  1XOB A;  4MDC A;  3KGK A;  2FWH A;  2BMX A;  3Q74 A;  4QL7 A;  3TOU A;  4ACS A;  4PTS A;  3UVT A;  1TU7 A;  4PNF A;  1OC9 B;  2IWT A;  4KX4 A;  3L9U A;  1FO5 A;  4FYB A;  3IRA A;  4KF9 A;  2HZF A;  2HXK A;  4BVX A;  2L4C A;  1O85 A;  2R4V A;  2I3Y A;  2R0C A;  1QXH A;  3DD3 A;  4TR3 A;  2EIR A;  4F82 A;  1V40 A;  4PX1 A;  2LQQ A;  5DQS A;  5INY A;  5ECH B;  1K0B A;  5IOW A;  4NMU A;  1O6J A;  1ZYE A;  1E6B A;  2Z9S A;  3IDV A;  1G7O A;  3TJB A;  2GQK A;  3TKR A;  5F0G A;  2PGT A;  3GH9 A;  3A5W A;  5D9X A;  5IMZ A;  2LNS A;  3Q19 A;  5DCG A;  3MYD A;  2H30 A;  1MDK A;  2WDU A;  1PQN A;  2D2Z A;  3QOU A;  5A5K A;  5CRH A;  1NM3 A;  3J7Y b;  4JZQ A;  1WIK A;  3DEX A;  1GRX A;  2O85 A;  1S3R A;  2FA4 A;  1J9B A;  1M99 A;  5GAN D;  1YEP A;  5ECO B;  3VPT A;  2VLU A;  2LUS A;  2DJK A;  5ECP B;  2L6D A;  6GSX A;  3UL3 A;  5J5N A;  1SL2 B;  4DSQ A;  3FZ4 A;  1PN0 A;  2MYG A;  4WEY A;  2AB6 A;  3QR6 A;  3D4M A;  3UAR A;  3ZFL A;  3UBK A;  2G2Q A;  1U6T A;  4V1A p;  7GSS A;  2FWG A;  2TRX A;  1EEM A;  4PUF C;  4GXZ A;  4MZW A;  2YWN A;  2XPE A;  6GSW A;  2LQO A;  3FR9 A;  2IMI A;  1TOF A;  1EOH A;  3EC3 A;  4E8E A;  1U3I A;  4I2T A;  3M3M A;  4KA0 A;  1KBN A;  4PUR A;  1V57 A;  4P3Y B;  5G1K A;  4XRD A;  3KD0 A;  1AC1 A;  3APO A;  2HZE A;  4MCU A;  4XTS A;  3HXS A;  2GT6 A;  2CT6 A;  4EO3 A;  2YWM A;  3H8Q A;  1JZD A;  4OCE A;  4Z2T A;  2E0Q A;  2P5R A;  2H6Z A;  2YAN A;  3DRN A;  4ZL7 A;  3BD2 A;  2HRF A;  5D93 A;  5ECS A;  1KTE A;  1USB A;  3VWV A;  1GNE A;  1X5E A;  2R0P A;  1HD2 A;  2VL2 A;  4GF0 A;  2WS2 A;  1EGO A;  1BX9 A;  2VUP A;  4L0U A;  1AW9 A;  3D4T A;  3C71 A;  1R26 A;  1A2J A;  1M7T A;  1AQV A;  3GH6 A;  1K3L A;  1X9W B;  2WB9 A;  4OCF A;  5D96 A;  3TKS E;  4BVX B;  5HR2 A;  5DAL A;  2MMO A;  1Y25 A;  1X9M B;  1WWJ A;  1UN2 A;  4HOJ A;  2LTK A;  4JU5 A;  3QCP A;  1R5A A;  2F3M A;  4X0X A;  1OYJ A;  4IP6 A;  4AF2 A;  2PWJ A;  5AIV A;  3IE3 A;  1PL2 A;  4K9Z A;  3MDK A;  3HZ4 A;  3ZFB A;  1NHO A;  4O5U A;  1PGT A;  3ERG A;  4MNN A;  1ML6 A;  2GST A;  3P90 A;  3L9S A;  4JR6 A;  2VM1 A;  2GSQ A;  2K18 A;  3TJG A;  2MMA A;  3TKP A;  1ZGN A;  3LOR A;  2QSI A;  1XW6 A;  1THO A;  3F63 A;  3VPQ A;  3FY7 A;  3UOM A;  2XBQ A;  4ML6 A;  3G7Y A;  3TUE A;  1DE1 A;  1ERT A;  3RHB A;  2B7K A;  3IC8 A;  1F37 A;  1XPV A;  3HJP A;  10GS A;  2JSZ A;  1ERV A;  5F06 A;  1ZOF A;  4N11 A;  4O32 A;  1GSF A;  5CP1 A;  1TJD A;  3KTB A;  3GST A;  4PGT A;  2B6M A;  2FWF A;  4Q5N A;  4D73 A;  19GS A;  1OC3 A;  3WGE A;  4FH8 A;  1G6W A;  4OFN A;  4G0K A;  4N10 A;  3DXB A;  3SBC A;  2F51 A;  5F07 A;  1N2A A;  3HCZ A;  2YCD A;  2HZE B;  5L71 A;  3IAS 2;  3HVS A;  3TKS A;  4N0V A;  2B5Y A;  4KGI A;  4V1A g;  3F8U A;  3TRP A;  4TKY A;  3KJY A;  1ERU A;  4EIQ A;  3LSZ A;  1H4O A;  2H66 A;  5IQY A;  4WET A;  5JCG A;  2PVO C;  2OBI A;  2R3X A;  4OFT A;  2O87 A;  4ZL8 A;  2VL3 A;  4Q5R A;  3CBU A;  6GSS A;  4HU7 A;  5DAL B;  3EIN A;  1GNW A;  1I9D A;  3TJJ A;  2RM6 A;  2PVQ A;  4IJI A;  3C73 A;  4YAV A;  5J3R A;  4NPB A;  3PH9 A;  1PKW A;  3N5O A;  1W4V A;  2LRT A;  3BBY A;  3LGC A;  3ZIV A;  4K7I A;  1XWA A;  2O7K A;  3ZYW A;  5ID2 A;  3BCI A;  4MZB A;  1GUH A;  3QAW A;  3ZLP A;  3RAZ A;  2F9S A;  4LL1 B;  2PUK C;  3QAG A;  1EWX A;  4K5S A;  1T8E B;  3LJR A;  2VL9 A;  4MJE A;  4ID0 A;  2KOK A;  2BJX A;  3FZA A;  3DVW A;  4KH7 A;  4HU9 A;  1F3A A;  3F4R A;  4DVC A;  1S3D A;  4NHZ A;  2GZP A;  3CSI A;  1XW9 A;  2C3T A;  5B8A A;  2PU9 C;  3TRQ A;  1AXD A;  5HFK A;  3GUR A;  3HHV A;  3AY8 A;  4NWY A;  4RI6 A;  3WGX A;  5H5Q A;  4IW9 A;  1YJ6 A;  2QA2 A;  2JAC A;  4E8H A;  1N8J A;  1PX7 A;  1Z7P A;  5B6M A;  3GIX A;  3FMW A;  4KDX A;  1FW1 A;  4D73 B;  2WRT A;  4HI7 A;  2ON5 A;  2P31 A;  1GSD A;  3G7I A;  1RW1 A;  2VIM A;  1JZR A;  2B1K A;  4ZIL A;  1OKD A;  4MF6 A;  1UA5 A;  4GWR A;  3D21 A;  3ZRD A;  4IJ3 A;  3IC4 A;  4EKZ A;  4ICY A;  1B9Y C;  2KLX A;  2MBS A;  1SJ6 A;  2OJL A;  4AJ6 A;  2E2M A;  3DKS A;  4MZC A;  3M1G A;  4FYU A;  1XFL A;  3GL5 A;  4TN8 A;  4BWQ A;  2HT9 A;  1XXU A;  5KEJ A;  2VLT A;  4KDY A;  4PXO A;  4IVF A;  4K1F A;  1YQ1 A;  1GUL A;  1DSB A;  4POK A;  3M9J A;  1R7H A;  8GSS A;  1H75 A;  1FAA A;  3JCM L;  1GTU A;  3CMI A;  4G19 A;  1A0F A;  2AJQ B;  2RM5 A;  1EOG A;  4L8E A;  2YN1 A;  2YV9 A;  1ZL9 A;  2YP6 A;  5EPF A;  1R4W A;  5G5F A;  5H5S A;  1GUM A;  1TP9 A;  1F6M C;  3KXO A;  4KW6 A;  1HQO A;  1RK4 A;  3GV1 A;  3IV4 A;  1A8L A;  2H0G A;  14GS A;  1FVJ A;  3MNG A;  2R37 A;  4G10 A;  1Z6N A;  2VCW A;  2JU5 A;  4HZ4 A;  5GSS A;  5CYY A;  2YOI A;  3C1S A;  3NOF A;  2OE1 A;  4LLR A;  4TXV A;  2OAD A;  1SKR B;  3VFI A;  3L9V A;  2HRA A;  3KIJ A;  2LRN A;  3E3E A;  3GYK A;  3FZ9 A;  1ZCP A;  2UZ8 A;  4OWY A;  1XG8 A;  1HYU A;  5ECR B;  1R5P A;  1FOH A;  2LST A;  3KMN A;  1MD3 A;  3QMX A;  1I5G A;  12GS A;  2HSH A;  2B7J A;  2LJA A;  4HJM A;  5J9B A;  5G30 A;  3H93 A;  3P8W A;  5ECN B;  2CZ3 A;  4IQ1 A;  3IK7 A;  2OA7 A;  5AIS A;  3QDN A;  2H6X A;  4IEL A;  2GVP A;  5ECI B;  3ZVJ D;  2CX4 A;  1A24 A;  1PN9 A;  2DJJ A;  1FG4 A;  5AIX A;  2FNO A;  3F4T A;  2X4A A;  2KP2 A;  2JZT A;  4LA1 A;  3GUS A;  2NDO A;  1ABA A;  3U5R E;  3SWL A;  2A2R A;  5IOX A;  1TKD B;  1GTB A;  4O92 A;  4OD7 A;  4MLY A;  4KSO A;  2C0E A;  5LD0 A;  3GA4 A;  1K0N A;  3R3E A;  2M80 A;  1PA3 A;  2V2G A;  2H71 A;  4IBP A;  1Z9H A;  5ELG A;  2IMK A;  2H74 A;  1EGR A;  5KN1 A;  2A4H A;  3UIW A;  9GSS A;  2L5O A;  2X99 A;  3N9J A;  3GKX A;  1TW9 A;  3L0H A;  2ZNM A;  5B8B A;  3ED3 A;  5AGY A;  4JE1 A;  1GSY A;  2MMN A;  2YNX A;  1SD8 A;  4XCS A;  3P2A A;  2IPA A;  3DIE A;  1QK8 A;  2DIY A;  2IIY A;  3CRT A;  4OFM A;  4PQ1 A;  4MAB A;  1GSE A;  4TR1 A;  1PKZ A;  4HQS A;  5LNK e;  2FCH A;  2WZ9 A;  4MPG A;  4MA9 A;  4NAX A;  4HJ2 A;  1ERW A;  2V32 A;  4V2N A;  2N5B A;  4GCI A;  5JCW A; 
#chains in the Genus database with same CATH homology
 4FIW A;  4BWS A;  1FB6 A;  3HVV A;  5KN3 A;  2HLS A;  3A3T A;  3ZZX A;  4I2U A;  5KOX A;  2LNT A;  4EL1 A;  3IPZ A;  1FVK A;  2OAC A;  4V2M A;  3M9K A;  5ECM B;  3E9J B;  4EDY A;  1TI1 A;  3QFA C;  4NV2 A;  3UEM A;  1XWC A;  2GTU A;  4ULX A;  1O7U A;  4V2L A;  3FR6 A;  4WR4 A;  4GTU A;  4JR4 A;  2P0G A;  1XZO A;  4K0N A;  3TRX A;  1XVW A;  4ECC A;  4O5Q A;  2C0F A;  2QGV A;  2OKA A;  4POB A;  2DJ0 A;  4MPF A;  2WFC A;  2FWE A;  5HFI A;  1U88 A;  1B8X A;  2QA1 A;  3ME8 A;  5CRD A;  4G9H A;  1UC7 A;  2H1D A;  3HY2 A;  2C3Q A;  4WBJ A;  3PGT A;  5E4W A;  5IMA A;  2C3N A;  3OR5 A;  3GMF A;  5IO2 A;  4HUA A;  2AAW A;  4XS4 A;  5CRE A;  4G0L A;  4ML1 A;  1WJK A;  2GGT A;  1ZZY A;  1QQ2 A;  2LJR A;  1XCC A;  1XBS A;  1GSQ A;  1W89 A;  2AV4 A;  2J23 A;  3C8E A;  2LRC A;  4MJA A;  2B5X A;  4DEJ A;  5DQY A;  1VF2 A;  3GKM A;  5HR3 A;  2HSM A;  1GLP A;  4KUN A;  2A4V A;  5DJM A;  3LYK A;  5ECQ B;  2DJ3 A;  2YV7 A;  1WRY A;  4NXI A;  2WJU A;  4MF7 A;  4DSS A;  4I6X A;  1GLQ A;  1HNC A;  3ZMK A;  2DMM A;  2CQ9 A;  1VGL A;  3D0Z A;  4JED A;  5D9T A;  4ZIJ A;  4EE0 A;  2VCQ A;  1PL1 A;  2VAF A;  17GS A;  5CO3 A;  5BRT A;  5LCZ A;  4BVY B;  3H1N A;  2M46 A;  2REM A;  3RPP A;  3KEB A;  3PIN A;  1K0A A;  11GS A;  1SK2 A;  4TR1 B;  3EE2 A;  4USS A;  1X0R A;  2VL2 C;  2MBT A;  3A5I A;  4ZL9 A;  3D22 A;  3TKQ A;  4K7N A;  2GSS A;  4XS6 A;  3VI5 A;  3VUR A;  3ZTL A;  1YY7 A;  2HRK A;  1GL8 A;  1T4Y A;  4I8B A;  2H70 A;  16GS A;  2OBK A;  1VRS D;  1YKA A;  2IMD A;  1V98 A;  2G0F A;  1OE8 A;  1K0D A;  3HJM A;  3KH7 A;  5BMU A;  2VO4 A;  2H0H A;  2GQL A;  1LJR A;  3W6G A;  1U3A A;  2PBJ A;  2X8H A;  1JZW A;  2F8F A;  1EP8 A;  3FR3 A;  4ZBA A;  4TR4 A;  3K8N A;  5JWR B;  2JZS A;  5FT3 A;  4PQI A;  3APS A;  4POM A;  3RHC A;  3VWU A;  3QAV A;  1ON4 A;  3H79 A;  4N30 A;  2H8L A;  2DLX A;  2GSR A;  2A2S A;  1DBY A;  5DDL A;  4NHW A;  2X49 A;  1MEK A;  4XS4 B;  1GTI A;  4H86 A;  1VF4 A;  3MWH A;  3TDG A;  2NVL A;  1Q4J A;  4F03 A;  4F2I A;  2L59 A;  4IS0 A;  4AJ7 A;  4CY6 A;  5D73 A;  3CTF A;  1GP1 A;  2IFQ A;  3I43 A;  4K5R A;  2TRC P;  4ZB6 A;  5G2Z A;  2E2G A;  3LW9 A;  5FWG A;  3EWL A;  2GZY A;  1O73 A;  3KZQ A;  4HZ2 A;  4BL7 B;  2ZUP A;  4DSS B;  1AUC A;  2YJH A;  2R6K A;  5FHI A;  1SJI A;  1GTA A;  2NPB A;  2JL4 A;  6GSU A;  4EC0 A;  1V2A A;  2H75 A;  2ON7 A;  1B48 A;  2H6Y A;  1G0T A;  5E59 A;  3L78 A;  2EC4 A;  2H01 A;  3TKS C;  3ERW A;  4KCE A;  1M2B A;  3LWA A;  1T7P B;  3EU4 A;  4G2E A;  4K6X A;  1MD4 A;  4IQA A;  4WXT A;  4MF5 A;  4ZBB A;  2WCI A;  5GST A;  3HKR A;  3C1R A;  3DML A;  3KP9 A;  1NW2 A;  2PPT A;  1WE0 A;  4ZB8 A;  4EXJ A;  3MIX A;  1AAZ A;  1HNB A;  1S3C A;  3GFK A;  4TW5 A;  4I97 A;  2J9H A;  3GL3 A;  1J0F A;  4GLT A;  4K2D A;  4Q5F A;  3L4N A;  5HR0 A;  3EMX A;  3FZ5 A;  3HA9 A;  2C4J A;  4MJB A;  1TRS A;  3I6A A;  2CVK A;  4QL9 A;  2DKH A;  3MAK A;  1J08 A;  4GRF A;  3DWV A;  3D5J A;  5IM9 A;  3RPN A;  1TK8 B;  2L4Q A;  4K0G A;  5KOW A;  4EF0 A;  4QQ7 A;  3IA1 A;  1JLV A;  1TI3 A;  4PUA A;  3GTU B;  2KUC A;  1URM A;  2V1M A;  2FD3 A;  4YAP A;  1OC8 A;  3FRC A;  3LYP A;  3UJ1 A;  3W8S A;  1NHY A;  5B7C A;  4YQU A;  1YZX A;  2YJ7 A;  3CXG A;  4RQR A;  5J41 A;  3RDW A;  2IFQ B;  1SKW B;  4NV5 A;  2CAI A;  2DBC A;  4BPY A;  2GQM A;  4X4J A;  1A2L A;  2C80 A;  1BQ7 A;  2IMF A;  1EV9 A;  4FQU A;  2H19 A;  2VCT A;  2JZR A;  1NSW A;  3ZIT A;  2HFD A;  1AQW A;  4ZB9 A;  2VLV A;  1JHB A;  2DC5 A;  2C0G A;  1QUW A;  5IMF A;  1T00 A;  3I69 A;  1B9X C;  4OMV A;  1WOU A;  1JFU A;  3M0F A;  1SYR A;  1RQM A;  1TDI A;  1PMT A;  2B3S A;  1T4Z A;  4ECJ A;  5DVB A;  2HI7 A;  5G5E A;  2C8U A;  5HFG A;  5IMC A;  4X1U A;  3UVH A;  3HZ8 A;  5G31 A;  3EU3 A;  2IME A;  4IP1 A;  1CQH A;  1BED A;  4I5Q A;  4FYC A;  5EVO A;  1HNA A;  1BYE A;  3HJO A;  2H1B A;  3KP8 A;  2CAQ A;  1XWG A;  3LXT A;  4RQX A;  5CAX A;  1KNG A;  2LV3 A;  2AUV A;  5F8B A;  2EIO A;  2KP1 A;  4EVM A;  3F3R A;  2FHE A;  4L0W A;  4IGJ A;  1Q98 A;  4LMW A;  1MTC A;  2VOC A;  4AJ8 A;  5IPH A;  4ZBD A;  5HQP A;  3TOT A;  2XHF A;  4TVE A;  2TIR A;  5IMV A;  2X8C A;  5KN0 A;  2I81 A;  3KTL A;  2K9F A;  2OE3 A;  3G7J A;  1EP7 A;  1GWC A;  5EL8 A;  3GX0 A;  4XS1 A;  2A2P A;  1QGV A;  1OVN A;  4OO5 A;  2RUF A;  5DCH A;  4WKW A;  1SK1 A;  2LS5 A;  4CDO A;  6GSV A;  5IO0 A;  4PNG A;  3Q6O A;  4J56 E;  1K0C A;  2K6V A;  1K3O A;  3CSJ A;  2FUG 2;  3LQ7 A;  2XBI A;  1T1V A;  2H1A A;  4WF5 A;  3G9B A;  2ALB A;  5DBQ A;  3TJF A;  4JRR A;  1XVQ A;  4F9Z A;  3F6F A;  4XHM A;  1K3Y A;  1Z7R A;  3GSS A;  4KB3 A;  4BVY A;  3TJK A;  2VCX A;  3IHG A;  1A0R P;  1X5C A;  2XPD A;  5G1L A;  2R0G A;  3ME7 A;  1SKS B;  1WPI A;  2I9H A;  4YKG A;  2H76 A;  4TXO A;  5KN2 A;  5D8I A;  3BOA A;  1E2Y A;  5COH A;  4MH2 A;  1TK0 B;  2CZ2 A;  2GLR A;  1EZK A;  2GT5 A;  5HR1 A;  1BJX A;  1WP0 A;  3FHK A;  1UVZ A;  3GRX A;  3VWW A;  3WYW A;  2CVD A;  1BG5 A;  4Z2R A;  1GH2 A;  3VK9 A;  2GDR A;  4MJC A;  2V6K A;  5A4U A;  5ECK B;  3DVX A;  1F3B A;  3ZL5 A;  3QFB C;  2CV4 A;  1EV4 A;  3HD5 A;  3WD6 A;  3NZN A;  4BA7 A;  4N0Z A;  1GSS A;  5JWQ B;  3UAP A;  2RLI A;  5A4W A;  2X8G A;  3ERF A;  1TRV A;  3TGZ A;  2NTO A;  3FYG A;  5CRW A;  2DJ2 A;  3E0U A;  1ILO A;  2LJK A;  2LEG A;  4CHS A;  2B5E A;  3IAM 2;  1B4Q A;  1SK0 A;  2IL3 A;  1K0M A;  4HS1 A;  3GKK A;  4IHU A;  2R5G A;  2FLS A;  3KH9 A;  3LG6 A;  2MZC A;  4ECB A;  1TK5 B;  2R2J A;  4WF4 A;  3TB2 A;  4F0C A;  2L57 A;  4IKH A;  1GUK A;  3O76 A;  4O5R A;  3EVI A;  1TRW A;  4KAE A;  3WT2 A;  3CYN A;  1A2M A;  2JAD A;  2AHE A;  4X43 A;  3DYR A;  1TRU A;  3LFL A;  2YWI A;  4JBB A;  4MH3 A;  1G6Y A;  3FKF A;  3EYT A;  2F8A A;  4POL A;  2HRN A;  2H73 A;  2FA8 A;  1SL1 B;  1V9W A;  1IYI A;  1XIY A;  1CQG A;  3CTG A;  3EPT A;  4BL7 A;  2E7P A;  3F6D A;  1T3B A;  1K0O A;  2I1U A;  2H72 A;  1G7E A;  1AIU A;  3DGQ A;  2H0I A;  4G0I A;  4WR5 A;  3KMO A;  1PRX A;  1M2D A;  4RUV A;  1Z3E A;  4YQV A;  6GST A;  3ZIJ A;  5JWO B;  4MMM A;  3F9U A;  2DKI A;  4TXO B;  3IHQ A;  4KSM A;  5IIZ A;  2RUE A;  3W8J A;  4HQZ A;  1XW5 A;  4K7O A;  3S9F A;  1C72 A;  3IBH A;  5ECL B;  5GAP D;  1F9M A;  4AGS A;  5GZZ B;  4XRA A;  4MK3 A;  2DJ1 A;  4K2X A;  3GX8 A;  3QPM A;  2N5F A;  2RII A;  1M0U A;  1ZYQ B;  3C7M A;  2K8S A;  3PR8 A;  4TRX A;  3M8N A;  2I4A A;  2JSY A;  2NBS A;  1TU8 A;  2PN8 A;  5CNW A;  2LKU A;  2IN3 A;  2K8V A;  2VCZ A;  3LXZ A;  3WT1 A;  1IYH A;  1YDK A;  5DAK A;  5EY6 A;  2PER A;  3BJ5 A;  3A2V A;  1PX6 A;  1KEB A;  1Z6M A;  5C00 A;  2VD1 A;  1YEX A;  3APQ A;  2ZCT A;  1O8W A;  3HVX A;  4Q5Q A;  1LU4 A;  5ENU A;  5J4U A;  3U6V A;  2VCV A;  3ISO A;  1Z5Y E;  3HDC A;  1WMJ A;  3R2Q A;  1B4P A;  4DSR A;  3HYP A;  3V1W A;  1O8X A;  4WBR D;  2PMT A;  1F2E A;  5ELA A;  4K8M A;  4EDZ A;  3GTU A;  2L6C A;  4Z2U A;  4O7H A;  1ST9 A;  3FW2 A;  2WGR A;  3F0I A;  1FHE A;  1MDJ A;  1ZYN A;  3VLN A;  1ACV A;  4IN0 A;  3GNJ A;  1QFN A;  1OAZ A;  2QKE A;  1M2A A;  2DML A;  4MP4 A;  1AQX A;  1TTZ A;  2QC7 A;  3FEU A;  5JCU A;  5C04 A;  2O8V B;  1BAY A;  2EIQ A;  4KE3 A;  4OO4 A;  2WUL A;  1QMV A;  4ECI A;  3CSH A;  3LEF A;  2XC2 A;  2CX3 A;  22GS A;  4GSN A;  2BTO T;  3GN3 A;  4GST A;  4YQM A;  4TOP A;  5IPG A;  1SJZ A;  1XWB A;  2HSY A;  1GSU A;  2L5L A;  4TR0 A;  2VD0 A;  3WGD A;  3CRU A;  4YH2 A;  1MDI A;  2B1L A;  4CW9 A;  3RBT A;  1JLW A;  4KDU A;  3F3Q A;  5CRG A;  1THX A;  1X5D A;  1SU9 A;  4KCA A;  3US3 A;  1A8Y A;  1O81 A;  2VM2 A;  2YZH A;  4YKF A;  1XOA A;  2O89 A;  18GS A;  3A2X A;  4J2F A;  1M9A A;  1YKC A;  3Q18 A;  1ZYP A;  3GKN A;  2M72 A;  3IXR A;  3UBL A;  1V58 A;  3KM6 A;  4ILF A;  5J9C A;  5ABR A;  5DJL A;  4XIH A;  3MSZ A;  3D6I A;  2YPM A;  3GHA A;  1PSQ A;  4LL4 B;  5D9V A;  5IMD A;  4FO5 A;  5DAK B;  4F0B A;  3I9V 2;  3UMA A;  2P5Q A;  1FB0 A;  2N5A A;  3IOS A;  3VWX A;  4HEA 2;  2V6O A;  2H1G A;  1YF1 A;  1OC9 A;  4CY8 A;  1ZMA A;  1TXX A;  4LMV A;  2HE3 A;  3PPU A;  4HDE A;  3TCO A;  1SD9 A;  3O3T A;  4L5O A;  3VI7 A;  1XWK A;  3P7X A;  5F05 A;  4EIP A;  2FY6 A;  2KHP A;  1X9S B;  2YZU A;  5AN1 A;  1Y6E A;  5D9W A;  1SYX A;  5B6N A;  2DIZ A;  1SL0 B;  1PD2 1;  3O6T A;  3ZVJ A;  6GSY A;  1A23 A;  3KCM A;  2C1Y A;  3IR4 A;  4KND A;  3ZRE A;  1DE2 A;  2YWO A;  2CVB A;  2X64 A;  1S3A A;  4Z7X A;  1LBK A;  5A4V A;  1JZO A;  4ZXG A;  20GS A;  1DUG A;  2V41 A;  1U87 A;  4EUY A;  5H5R A;  1OKT A;  3J7Y k;  5ID2 B;  4PQH A;  4RI7 A;  2DSA A;  3EUR A;  3QD9 A;  3A2W A;  2GZZ A;  4GQF A;  1SEN A;  2HNL A;  1FOV A;  3IK9 A;  4L5L A;  1OE7 A;  4J57 E;  2CA8 A;  1YF0 A;  3ZML A;  4ISD A;  2OE0 A;  4GQC A;  1VF1 A;  1EEJ A;  3BCK A;  3H4K A;  13GS A;  2GS3 A;  2ES7 A;  2IJY A;  2AYT A;  2HYX A;  2MMZ A;  3F4S A;  4GSS A;  1M9B A;  3FK8 A;  1VF3 A;  3EMP A;  2FGX A;  3NIV A;  4A5P A;  2C0D A;  1XOB A;  4MDC A;  3KGK A;  2FWH A;  2BMX A;  3Q74 A;  4QL7 A;  3TOU A;  4ACS A;  4PTS A;  3UVT A;  1TU7 A;  4PNF A;  1OC9 B;  2IWT A;  4KX4 A;  3L9U A;  1FO5 A;  4FYB A;  3IRA A;  4KF9 A;  2HZF A;  2HXK A;  4BVX A;  2L4C A;  1O85 A;  2R4V A;  2I3Y A;  2R0C A;  1QXH A;  3DD3 A;  4TR3 A;  2EIR A;  4F82 A;  1V40 A;  4PX1 A;  2LQQ A;  5DQS A;  5INY A;  5ECH B;  1K0B A;  5IOW A;  4NMU A;  1O6J A;  1ZYE A;  1E6B A;  2Z9S A;  3IDV A;  1G7O A;  3TJB A;  2GQK A;  3TKR A;  5F0G A;  2PGT A;  3GH9 A;  3A5W A;  5D9X A;  5IMZ A;  2LNS A;  3Q19 A;  5DCG A;  3MYD A;  2H30 A;  1MDK A;  2WDU A;  1PQN A;  2D2Z A;  3QOU A;  5A5K A;  5CRH A;  1NM3 A;  3J7Y b;  4JZQ A;  1WIK A;  3DEX A;  1GRX A;  2O85 A;  2FA4 A;  1J9B A;  1M99 A;  5GAN D;  1YEP A;  5ECO B;  3VPT A;  2VLU A;  2LUS A;  2DJK A;  5ECP B;  2L6D A;  6GSX A;  3UL3 A;  5J5N A;  1SL2 B;  4DSQ A;  3FZ4 A;  1PN0 A;  2MYG A;  4WEY A;  2AB6 A;  3QR6 A;  3D4M A;  3UAR A;  3ZFL A;  3UBK A;  2G2Q A;  1U6T A;  4V1A p;  7GSS A;  2FWG A;  2TRX A;  1EEM A;  4PUF C;  4GXZ A;  4MZW A;  2YWN A;  2XPE A;  6GSW A;  2LQO A;  3FR9 A;  2IMI A;  1TOF A;  1EOH A;  3EC3 A;  4E8E A;  1U3I A;  4I2T A;  3M3M A;  4KA0 A;  1KBN A;  4PUR A;  1V57 A;  4P3Y B;  5G1K A;  4XRD A;  3KD0 A;  1AC1 A;  3APO A;  2HZE A;  4MCU A;  4XTS A;  3HXS A;  2GT6 A;  2CT6 A;  4EO3 A;  2YWM A;  3H8Q A;  1JZD A;  4OCE A;  4Z2T A;  2E0Q A;  2P5R A;  2H6Z A;  2YAN A;  3DRN A;  4ZL7 A;  3BD2 A;  2HRF A;  5D93 A;  5ECS A;  1KTE A;  1USB A;  3VWV A;  1GNE A;  1X5E A;  2R0P A;  1HD2 A;  2VL2 A;  4GF0 A;  2WS2 A;  1EGO A;  1BX9 A;  2VUP A;  4L0U A;  1AW9 A;  3D4T A;  3C71 A;  1R26 A;  1A2J A;  1M7T A;  1AQV A;  3GH6 A;  1K3L A;  1X9W B;  2WB9 A;  4OCF A;  5D96 A;  3TKS E;  4BVX B;  5HR2 A;  5DAL A;  2MMO A;  1Y25 A;  1X9M B;  1WWJ A;  1UN2 A;  4HOJ A;  2LTK A;  4JU5 A;  3QCP A;  1R5A A;  2F3M A;  4X0X A;  1OYJ A;  4IP6 A;  4AF2 A;  2PWJ A;  5AIV A;  3IE3 A;  1PL2 A;  4K9Z A;  3MDK A;  3HZ4 A;  3ZFB A;  1NHO A;  4O5U A;  1PGT A;  3ERG A;  4MNN A;  1ML6 A;  2GST A;  3P90 A;  3L9S A;  4JR6 A;  2VM1 A;  2GSQ A;  2K18 A;  3TJG A;  2MMA A;  3TKP A;  1ZGN A;  3LOR A;  2QSI A;  1XW6 A;  1THO A;  3F63 A;  3VPQ A;  3FY7 A;  3UOM A;  2XBQ A;  4ML6 A;  3G7Y A;  3TUE A;  1DE1 A;  1ERT A;  3RHB A;  2B7K A;  3IC8 A;  1F37 A;  1XPV A;  3HJP A;  10GS A;  2JSZ A;  1ERV A;  5F06 A;  1ZOF A;  4N11 A;  4O32 A;  1GSF A;  5CP1 A;  1TJD A;  3KTB A;  3GST A;  4PGT A;  2B6M A;  2FWF A;  4Q5N A;  4D73 A;  19GS A;  1OC3 A;  3WGE A;  4FH8 A;  1G6W A;  4OFN A;  4G0K A;  4N10 A;  3DXB A;  3SBC A;  2F51 A;  5F07 A;  1N2A A;  3HCZ A;  2YCD A;  2HZE B;  5L71 A;  3IAS 2;  3HVS A;  3TKS A;  4N0V A;  2B5Y A;  4KGI A;  4V1A g;  3F8U A;  3TRP A;  4TKY A;  3KJY A;  1ERU A;  4EIQ A;  3LSZ A;  1H4O A;  2H66 A;  5IQY A;  4WET A;  5JCG A;  2PVO C;  2OBI A;  2R3X A;  4OFT A;  2O87 A;  4ZL8 A;  2VL3 A;  4Q5R A;  3CBU A;  6GSS A;  4HU7 A;  5DAL B;  3EIN A;  1GNW A;  1I9D A;  3TJJ A;  2RM6 A;  2PVQ A;  4IJI A;  3C73 A;  4YAV A;  5J3R A;  4NPB A;  3PH9 A;  1PKW A;  3N5O A;  1W4V A;  2LRT A;  3BBY A;  3LGC A;  3ZIV A;  4K7I A;  1XWA A;  2O7K A;  3ZYW A;  5ID2 A;  3BCI A;  4MZB A;  1GUH A;  3QAW A;  3ZLP A;  3RAZ A;  2F9S A;  4LL1 B;  2PUK C;  3QAG A;  1EWX A;  4K5S A;  1T8E B;  3LJR A;  2VL9 A;  4MJE A;  4ID0 A;  2KOK A;  2BJX A;  3FZA A;  3DVW A;  4KH7 A;  4HU9 A;  1F3A A;  3F4R A;  4DVC A;  1S3D A;  4NHZ A;  2GZP A;  3CSI A;  1XW9 A;  2C3T A;  5B8A A;  2PU9 C;  3TRQ A;  1AXD A;  5HFK A;  3GUR A;  3HHV A;  3AY8 A;  4NWY A;  4RI6 A;  3WGX A;  5H5Q A;  4IW9 A;  1YJ6 A;  2QA2 A;  2JAC A;  4E8H A;  1N8J A;  1PX7 A;  1Z7P A;  5B6M A;  3GIX A;  3FMW A;  4KDX A;  1FW1 A;  4D73 B;  2WRT A;  4HI7 A;  2ON5 A;  2P31 A;  1GSD A;  3G7I A;  1RW1 A;  2VIM A;  1JZR A;  2B1K A;  4ZIL A;  1OKD A;  4MF6 A;  1UA5 A;  4GWR A;  3D21 A;  3ZRD A;  4IJ3 A;  3IC4 A;  4EKZ A;  4ICY A;  1B9Y C;  2KLX A;  2MBS A;  1SJ6 A;  2OJL A;  4AJ6 A;  2E2M A;  3DKS A;  4MZC A;  3M1G A;  4FYU A;  1XFL A;  3GL5 A;  4TN8 A;  4BWQ A;  2HT9 A;  1XXU A;  5KEJ A;  2VLT A;  4KDY A;  4PXO A;  4IVF A;  4K1F A;  1YQ1 A;  1GUL A;  1DSB A;  4POK A;  3M9J A;  1R7H A;  8GSS A;  1H75 A;  1FAA A;  3JCM L;  1GTU A;  3CMI A;  4G19 A;  1A0F A;  2AJQ B;  2RM5 A;  1EOG A;  4L8E A;  2YN1 A;  2YV9 A;  1ZL9 A;  2YP6 A;  5EPF A;  1R4W A;  5G5F A;  5H5S A;  1GUM A;  1TP9 A;  1F6M C;  3KXO A;  4KW6 A;  1HQO A;  1RK4 A;  3GV1 A;  3IV4 A;  1A8L A;  2H0G A;  14GS A;  1FVJ A;  3MNG A;  2R37 A;  4G10 A;  1Z6N A;  2VCW A;  2JU5 A;  4HZ4 A;  5GSS A;  5CYY A;  2YOI A;  3C1S A;  3NOF A;  2OE1 A;  4LLR A;  4TXV A;  2OAD A;  1SKR B;  3VFI A;  3L9V A;  2HRA A;  3KIJ A;  2LRN A;  3E3E A;  3GYK A;  3FZ9 A;  1ZCP A;  2UZ8 A;  4OWY A;  1HYU A;  5ECR B;  1R5P A;  1FOH A;  2LST A;  3KMN A;  1MD3 A;  3QMX A;  1I5G A;  12GS A;  2HSH A;  2B7J A;  2LJA A;  4HJM A;  5J9B A;  5G30 A;  3H93 A;  3P8W A;  5ECN B;  2CZ3 A;  4IQ1 A;  3IK7 A;  2OA7 A;  5AIS A;  3QDN A;  2H6X A;  4IEL A;  2GVP A;  5ECI B;  3ZVJ D;  2CX4 A;  1A24 A;  1PN9 A;  2DJJ A;  1FG4 A;  5AIX A;  2FNO A;  3F4T A;  2X4A A;  2KP2 A;  2JZT A;  4LA1 A;  3GUS A;  2NDO A;  1ABA A;  3U5R E;  3SWL A;  2A2R A;  5IOX A;  1TKD B;  1GTB A;  4O92 A;  4OD7 A;  4MLY A;  4KSO A;  2C0E A;  5LD0 A;  3GA4 A;  1K0N A;  3R3E A;  2M80 A;  1PA3 A;  2V2G A;  2H71 A;  4IBP A;  1Z9H A;  5ELG A;  2IMK A;  2H74 A;  1EGR A;  5KN1 A;  2A4H A;  3UIW A;  9GSS A;  2L5O A;  2X99 A;  3N9J A;  3GKX A;  1TW9 A;  3L0H A;  2ZNM A;  5B8B A;  3ED3 A;  5AGY A;  4JE1 A;  1GSY A;  2MMN A;  2YNX A;  1SD8 A;  4XCS A;  3P2A A;  2IPA A;  3DIE A;  1QK8 A;  2DIY A;  2IIY A;  3CRT A;  4OFM A;  4PQ1 A;  4MAB A;  1GSE A;  4TR1 A;  1PKZ A;  4HQS A;  5LNK e;  2FCH A;  2WZ9 A;  4MPG A;  4MA9 A;  4NAX A;  4HJ2 A;  1ERW A;  2V32 A;  4V2N A;  2N5B A;  4GCI A;  5JCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...