2EIOA

Design of disulfide-linked thioredoxin dimers and multimers through analysis of crystal contacts
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKCFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin 1
publication title Design of Disulfide-linked Thioredoxin Dimers and Multimers Through Analysis of Crystal Contacts
pubmed doi rcsb
source organism Escherichia coli
total genus 26
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2eioA00
2FHEA 1K3LA 3QR6A 1ON4A 1QXHA 1X9MB 3L78A 5ECSA 3NIVA 2B1KA 1SKSB 2PN8A 1B4PA 2YPMA 4TRXA 4LMVA 1FG4A 1XBSA 3O3TA 4OFTA 2FWGA 1YEXA 3IV4A 3VWXA 4TR0A 3QFBC 3D21A 3M9JA 2WULA 4EUYA 3ZTLA 5D73A 1WJKA 1ST9A 4FIWA 4ECIA 2KP1A 1KNGA 1MEKA 3NOFA 2H01A 3GH9A 5DDLA 3RHBA 4EC0A 2YZHA 6GSTA 1TRVA 3TRQA 4ZL8A 4KE3A 1O7UA 4KCEA 2VUPA 4PUAA 1I5GA 3TRPA 1AC1A 2GT5A 2VIMA 4LLRA 1SK0A 1BYEA 5DVBA 4V2NA 4MZBA 4POBA 2JZSA 2FD3A 4FH8A 4TOPA 3EURA 5ELAA 4XS6A 5IPGA 4HZ2A 2GQLA 2VCWA 3EYTA 3FR6A 4Z7XA 2K6VA 4EDYA 5DAKA 2YWIA 2HZEA 4RI7A 2OE3A 4NMUA 1VF3A 3FYGA 2GSTA 4CDOA 4WF5A 1SD9A 14GSA 1WWJA 5JCGA 1S3DA 1NHOA 4I2TA 1V40A 3BCIA 3ZMLA 2VD1A 4PNFA 3IAS2 1XZOA 4RUVA 2HT9A 4X43A 1XW5A 2O85A 1TU7A 1GL8A 4F9ZA 1QGVA 4PX1A 3EC3A 3LFLA 1EEMA 4PUFC 3ERGA 1USBA 1GH2A 3RAZA 1B4QA 5AN1A 2O8VB 2R2JA 1FVKA 3KCMA 4I2UA 2HRFA 4DSSB 4NAXA 3FEUA 3KM6A 4Q5NA 1O8XA 4BWQA 3FZ4A 2I3YA 3GRXA 2VD0A 3DYRA 5ID2B 3N9JA 3F8UA 2EIQA 3HDCA 2GSQA 1ACVA 2L5LA 2REMA 1QFNA 2MBTA 1R4WA 1HNAA 3EINA 2QC7A 3IC4A 2TRXA 2RIIA 3KIJA 4G9HA 2C0EA 4XTSA 2DMMA 1A24A 1UVZA 2LEGA 5H5RA 4ML1A 1URMA 3GH6A 4F0BA 2Z9SA 5A4VA 3QCPA 20GSA 3QMXA 4O7HA 4G19A 2E7PA 1C72A 2N5FA 4O32A 4P3YB 1JZDA 1OAZA 1XIYA 2IMDA 4POMA 4MCUA 4PQIA 2MYGA 4H86A 4IGJA 4AJ7A 3IR4A 11GSA 5G1LA 2B3SA 2E2MA 2NDOA 4V1Ag 3ZIVA 1GSUA 4K8MA 2JL4A 1WRYA 2CV4A 2OE0A 3IHQA 1EV9A 4ML6A 3H93A 4ZBAA 4WEYA 2P31A 1UC7A 2RM5A 5F05A 4MZCA 3WT2A 2YWNA 2DJJA 2WGRA 2B5XA 3ZL5A 5EPFA 1K0NA 2OACA 1OE8A 5F06A 4Q5FA 2CT6A 3IBHA 2H1GA 3GNJA 4IKHA 2QSIA 4WBRD 1CQGA 3GN3A 5IMFA 2YANA 2CX3A 4OCFA 3DWVA 1DSBA 1WE0A 1O73A 3C8EA 4ID0A 3W8JA 3GKNA 4FYBA 2GZPA 1VF2A 3TDGA 4ECBA 1NM3A 5GAPD 3H1NA 1GULA 2F51A 2XPDA 3HJOA 1NW2A 5ECIB 3TUEA 1OC9B 4X1UA 3CTFA 2HRNA 4GQCA 4BA7A 1Z9HA 3C1RA 2FCHA 3IOSA 4OO4A 5ENUA 3I43A 4HJMA 1YKAA 5FHIA 2P5QA 4KGIA 1PL2A 1MTCA 3QD9A 3M1GA 3VFIA 1SL2B 2WB9A 1XOBA 3DVXA 4MA9A 3M8NA 2VCXA 1EOHA 4ZB8A 5LD0A 4MMMA 1Z6NA 1AXDA 3HJPA 4TXVA 3GL3A 2GZZA 9GSSA 2VO4A 3EU3A 3FRCA 6GSVA 3EWLA 3PGTA 2D2ZA 2K9FA 2NVLA 2YJ7A 1OKTA 1GTAA 1AQWA 5KN2A 2PMTA 4O92A 3MAKA 2ON7A 1A8LA 2VCQA 2L4CA 2R4VA 2MMZA 2XHFA 2CVBA 2PUKC 1GLPA 3ZIJA 4O5RA 1SENA 2V6KA 2IMIA 3IDVA 1U88A 2VLUA 3D0ZA 3F6FA 2IFQA 3TJKA 3GA4A 1K3OA 1TDIA 1PGTA 5D96A 2VOCA 4WR5A 3IPZA 3ME8A 3RPPA 3LGCA 4ZIJA 4LA1A 5DJMA 1MD3A 3GFKA 4ZXGA 2VL9A 3HZ8A 2LKUA 2RLIA 3V1WA 3LJRA 2BTOT 4XIHA 2LRCA 1OC3A 2FY6A 3HYPA 5D9WA 4LL4B 2VL2A 4EO3A 2E0QA 3P2AA 3EMPA 1TK5B 3ZRDA 2WDUA 1PQNA 4HJ2A 2L6CA 2PBJA 1F37A 1O85A 4IELA 5HFKA 1A0RP 3TGZA 1ABAA 1PD21 2GQKA 2IMFA 19GSA 5DAKB 3ME7A 2HZEB 4K9ZA 4EKZA 1HD2A 3GV1A 2YV7A 3FZAA 4YQMA 3PR8A 3UIWA 3M3MA 4FYCA 1AAZA 2JADA 4RQXA 3G7JA 3TCOA 3D4TA 3D22A 5KN3A 4MH2A 4POKA 1TI1A 3F9UA 2YOIA 2KOKA 3HZ4A 1XW9A 2HNLA 4MP4A 3GTUA 1XVQA 10GSA 4IVFA 4TR4A 1EEJA 1Z6MA 1K0AA 2AYTA 2LRTA 3KP8A 1J08A 3WGDA 3VK9A 3PH9A 3BD2A 2GS3A 4ACSA 4MF5A 3ZZXA 2HSHA 3WYWA 1B48A 1QUWA 1PN9A 3KMOA 3QOUA 1CQHA 2JU5A 3F4RA 2I9HA 2V32A 3H79A 2FLSA 3FW2A 4NPBA 3H4KA 2YNXA 3D5JA 2B1LA 1SD8A 3LSZA 4L0UA 1A2JA 4YAPA 5B6MA 5CO3A 1E6BA 1M2BA 4MH3A 2LTKA 5FWGA 3KJYA 2FNOA 1AW9A 1GSQA 3G7IA 3MNGA 1TRWA 1WP0A 4J56E 2CAIA 4JE1A 5AIVA 4FYUA 2FA8A 3QDNA 4IP6A 1RK4A 4TR1B 2QKEA 4OD7A 2DSAA 4J2FA 2CZ3A 4RI6A 3L0HA 5GSTA 1GP1A 2I81A 3UAPA 17GSA 1FVJA 4WF4A 5ECPB 5KEJA 3JCML 4ZL9A 2YP6A 1WMJA 5ECNB 1FB0A 2DC5A 4K7OA 5FT3A 1BEDA 2B7KA 1G0TA 4OMVA 4NHZA 4PQHA 2MMNA 3LORA 4GWRA 5JWQB 2F3MA 2CAQA 4CW9A 2GGTA 4XS4A 4IQ1A 4I6XA 5D93A 2FGXA 3ZYWA 2VLTA 4GLTA 4V1Ap 1F6MC 2J9HA 2N5AA 1V58A 2IWTA 2GLRA 3I9V2 4WBJA 1I9DA 3S9FA 6GSWA 1OE7A 1F3AA 2H19A 4KDUA 5J4UA 3CSHA 1SYXA 1TKDB 3LWAA 3VWVA 1SL0B 2A2SA 3GSTA 3TJJA 3C1SA 4ZBDA 4AJ8A 4L8EA 2C4JA 1TW9A 1JHBA 1A23A 4DVCA 3SBCA 3KEBA 3FZ5A 2AAWA 2RUFA 4GRFA 3I6AA 2L57A 1IYHA 2V41A 3TKRA 4ZB9A 3CRUA 3UL3A 5ECOB 3ZFBA 3IXRA 2DJKA 5B7CA 2BMXA 2CQ9A 2L4QA 3Q74A 5IMCA 1YKCA 1TTZA 2DJ3A 4DSQA 5IMZA 5LNKe 4NV5A 4AJ6A 1YJ6A 3QPMA 5H5SA 2WJUA 3L9SA 4OO5A 1U6TA 3QAGA 4PNGA 1WIKA 2IL3A 2PU9C 6GSXA 3GX0A 3TKQA 1A8YA 2C3TA 2WFCA 2VCTA 1PA3A 3WD6A 2VM2A 5C04A 2GVPA 3A2XA 3DD3A 5DJLA 1RQMA 3TRXA 4Q5RA 1V57A 1PKWA 4K7IA 1T3BA 4TVEA 2MMOA 2DMLA 2LQQA 1BJXA 2H0HA 5JWOB 1YY7A 1PRXA 4XHMA 1GUMA 1GTBA 5DALA 2JZTA 2H1BA 3KP9A 2IFQB 2LSTA 4MF6A 1PSQA 4KNDA 4YH2A 5J9BA 3Q6OA 2O7KA 3IAM2 3FZ9A 1UA5A 1XWAA 2H76A 1XWKA 3E9JB 13GSA 3U6VA 5AGYA 1K0MA 1GSDA 4WETA 1O81A 2CA8A 4MJCA 2OKAA 4AGSA 3LXTA 5DCGA 3DGQA 2XC2A 3VI5A 1YZXA 6GSYA 2LUSA 1KBNA 5G5EA 3MSZA 2WRTA 4D73A 4ZILA 3Q18A 1M99A 2X64A 4EL1A 4TKYA 2IIYA 1FO5A 2GDRA 5E4WA 1JZWA 2QGVA 2LJAA 1MD4A 1B9YC 1LJRA 1EWXA 2WZ9A 4KDXA 2K18A 4IN0A 4K0NA 4KSOA 3IRAA 4MABA 2FUG2 3TKSA 2VM1A 4JR4A 2H66A 3TKSE 1TJDA 1ZYQB 3KGKA 5INYA 1YEPA 1M9BA 2AUVA 1NHYA 5IQYA 1ZL9A 2XBIA 18GSA 2JSZA 4HU9A 3C7MA 5B8BA 3A2VA 5IO2A 4FO5A 2OA7A 1TRUA 2ZNMA 1HQOA 5ECLB 3L4NA 4JU5A 3DMLA 3ZFLA 4N10A 1M2AA 2C0GA 5D8IA 3U5RE 3BJ5A 3CXGA 1G6WA 4MJAA 5H5QA 1SU9A 3GTUB 3IA1A 1TRSA 5CRGA 2WS2A 2KLXA 4IP1A 1ERUA 4EF0A 3RDWA 3GHAA 4I8BA 2TRCP 1MDJA 2F8AA 1J0FA 5DBQA 2C3NA 4DSSA 4MZWA 1DBYA 1A2LA 2H30A 2CVDA 5HFGA 4E8HA 5ID2A 5CP1A 3L9UA 2VL2C 3F4SA 4HS1A 2XPEA 4BVYA 3VPQA 1OKDA 4TW5A 4L5LA 3ERFA 4NHWA 1JZOA 2C0DA 2H71A 2VLVA 1HYUA 1Y6EA 3HVVA 5ELGA 1F9MA 2A4VA 4KDYA 3VURA 4KAEA 1Z5YE 3FHKA 2X8CA 2MBSA 1PMTA 1Q98A 2WCIA 3TJBA 1TK8B 4NWYA 3UARA 1SJ6A 3QFAC 3ISOA 4G10A 4ECCA 5KN0A 3C73A 2L6DA 3UBLA 2H75A 2VL3A 1TU8A 5EL8A 2CVKA 3GKKA 1YF0A 4K0GA 1XWBA 1YDKA 2IPAA 1BX9A 1JLVA 1ZYEA 2OADA 5AIXA 1YQ1A 4QL7A 1V2AA 1KTEA 1ZCPA 3KMNA 1ML6A 4LMWA 3F63A 4F82A 4PURA 1K0DA 1EGOA 2YN1A 5L71A 3CSJA 2JACA 2DJ0A 5A5KA 1GLQA 2IN3A 2GSSA 2OE1A 2DJ2A 4L5OA 2R37A 3DVWA 3G9BA 4XS4B 2C80A 2FWFA 4OFNA 1THOA 4K1FA 3BBYA 4IJ3A 2KP2A 4YQUA 2H6ZA 5J9CA 3HKRA 1ILOA 3UVHA 4IS0A 3E3EA 5G31A 4IBPA 4OWYA 4PXOA 1DE2A 1XOAA 1SYRA 1VF4A 4G2EA 2BJXA 3H8QA 3BOAA 3TOTA 5F8BA 4KSMA 1T4YA 3O76A 2LJKA 4NV2A 2PPTA 1SK2A 3HD5A 1OC9A 5C00A 5CYYA 1WOUA 3HHVA 1EP8A 2FWHA 1G6YA 1ERTA 2K8VA 4HZ4A 3RPNA 1AIUA 1VF1A 1M2DA 2GSRA 3NZNA 2LJRA 2PGTA 3ERWA 2RUEA 3RHCA 2VCVA 1QQ2A 3LYKA 2X8GA 4WXTA 4F03A 1TK0B 2O87A 5EVOA 5LCZA 3FKFA 4XCSA 4N30A 3KH9A 1EZKA 1NSWA 2B5YA 1X5DA 1GSYA 1X5EA 2DJ1A 1A0FA 2NPBA 4ISDA 3F3QA 4GSSA 1A2MA 3WGXA 1SJIA 4Q5QA 1VGLA 5G5FA 1U87A 1SKWB 5EY6A 1LU4A 1T4ZA 4TR3A 2HZFA 4DSRA 5D9TA 1B8XA 3ZLPA 3EE2A 3ZVJD 1R5PA 2GQMA 1HNCA 3UEMA 1G7EA 2IMEA 4KX4A 2V6OA 3CMIA 2G2QA 2JZRA 2RM6A 1F3BA 1M0UA 5G30A 5IPHA 3VPTA 2VCZA 2H0GA 4QL9A 5DALB 5JWRB 4HI7A 2A2RA 4N0ZA 3CSIA 4V2LA 4KW6A 5E59A 1K0OA 3DIEA 2H72A 1DUGA 2LQOA 2H6XA 2OJLA 5A4WA 3N5OA 5GAND 1R26A 2CX4A 2F9SA 4JZQA 4JRRA 1SKRB 3GURA 4K2DA 3HY2A 3M9KA 3RBTA 1GRXA 3LG6A 3VWUA 5ECKB 3GX8A 2EIOA 1VRSD 3MDKA 5IOWA 3TB2A 4L0WA 4MJBA 3APOA 4D73B 4EE0A 2NBSA 4X0XA 4HDEA 4YQVA 2X99A 4GSNA 2R3XA 3TJGA 1GTIA 4PGTA 5J5NA 1PX7A 1H4OA 1EV4A 2H8LA 3F0IA 4EXJA 1GNEA 4WKWA 12GSA 3KXOA 3FR3A 1T1VA 4KA0A 1V9WA 1X0RA 5G2ZA 2OBKA 1U3AA 4YAVA 2VAFA 2HFDA 1AQVA 1KEBA 2B7JA 3BCKA 3OR5A 4F2IA 4I5QA 1O8WA 1N8JA 3EMXA 2K8SA 1O6JA 1W4VA 2M72A 2J23A 4OFMA 4POLA 3DXBA 3GUSA 5IMDA 3KD0A 2LS5A 4GF0A 2H74A 5A4UA 2HLSA 4BVXA 4BPYA 5D9VA 1K3YA 4KB3A 1XVWA 2P0GA 1ERWA 3CRTA 16GSA 3L9VA 4TXOA 2MMAA 1LBKA 2YV9A 2HE3A 3P90A 2LNSA 4E8EA 1GNWA 4KCAA 22GSA 4N11A 3LXZA 3UJ1A 5J3RA 4GQFA 3F3RA 1Z7RA 1M7TA 4IW9A 1ZZYA 1M9AA 3FK8A 5IO0A 4EVMA 4MF7A 1Y25A 1W89A 5JCUA 2M80A 3US3A 5DCHA 3KH7A 2ZUPA 3TKSC 1Q4JA 3D4MA 1XCCA 1PKZA 2C1YA 2GTUA 1FB6A 1BAYA 2IMKA 3SWLA 2P5RA 4MPFA 2ALBA 2B5EA 5HR2A 1SL1B 4K7NA 3TJFA 4JBBA 3FR9A 1HNBA 1XWGA 1TXXA 2YWMA 2FA4A 2PVQA 2O89A 2LRNA 2M46A 3MWHA 3DEXA 4HQSA 4HUAA 2AV4A 3FY7A 5AISA 1DE1A 4TR1A 3F4TA 2YCDA 4DEJA 4KUNA 3J7Yk 4ILFA 3UVTA 1RW1A 1GSFA 1T00A 5IOXA 5GSSA 1G7OA 1OYJA 2X8HA 1WPIA 1PL1A 5HR1A 3CYNA 1FAAA 1JZRA 3CTGA 1ERVA 1OC8A 4IQAA 5GZZB 4IJIA 4ECJA 2KHPA 1R7HA 2GT6A 2LV3A 2DLXA 3KZQA 4GSTA 4F0CA 1QK8A 2R5GA 3UBKA 3VLNA 5IIZA 3W6GA 1GWCA 3ZREA 4HEA2 3K8NA 1EP7A 3HVSA 2H70A 3EVIA 2I4AA 4ZB6A 4ZBBA 2ES7A 3TKPA 2ZCTA 5CREA 2MZCA 3IE3A 4ZL7A 2DBCA 5DQSA 4CHSA 2PVOC 3G7YA 3W8SA 5ABRA 3F6DA 4HOJA 3M0FA 3ZITA 4HQZA 1H75A 3E0UA 1FOVA 3Q19A 1XXUA 1X9SB 1J9BA 4V2MA 3GYKA 1THXA 2F8FA 5JCWA 5HFIA 4GTUA 3A2WA 3CBUA 3HXSA 1E2YA 2DIZA 2NTOA 1MDKA 3PINA 5HQPA 2ON5A 1SK1A 2TIRA 5IMVA 2KUCA 1V98A 2GZYA 3J7Yb 2YZUA 5COHA 3HVXA 2YWOA 2AHEA 4MDCA 4HU7A 4MJEA 4XRDA 2PWJA 2N5BA 1TI3A 1K0BA 1ZOFA 3HCZA 2IJYA 5F07A 1Z3EA 4PQ1A 3VWWA 3KTLA 1BG5A 5F0GA 2H0IA 2L5OA 3GKXA 4KH7A 1EGRA 1PX6A 4GXZA 1ZMAA 3GSSA 2C3QA 4J57E 4AF2A 3TOUA 5J41A 1Z7PA 3KTBA 2AJQB 2I1UA 3ZVJA 5CRDA 1S3AA 1B9XC 1S3CA 1GSEA 4JR6A 6GSSA 3P7XA 3DRNA 4NXIA 3IK7A 2EIRA 5ECQB 5HR3A 3GMFA 5CNWA 1QMVA 2H1AA 1FHEA 5HR0A 2AB6A 4ULXA 2XBQA 4BL7A 1X5CA 2DIYA 2H6YA 1OVNA 3AY8A 3I69A 1EOGA 2B6MA 3C71A 5ECMB 1AQXA 3QAVA 4JEDA 4XRAA 1R5AA 3IK9A 5B6NA 3P8WA 4TN8A 2LNTA 1UN2A 8GSSA 2V2GA 5ECHB 4GCIA 2E2GA 1JFUA 3EU4A 3LEFA 1FW1A 2JSYA 3WGEA 1BQ7A 4MK3A 4WR4A 2HI7A 5B8AA 2L59A 1XPVA 5CRWA 5KN1A 5D9XA 2HSYA 2C0FA 4OCEA 5CAXA 1XWCA 3DKSA 3HA9A 3R2QA 1U3IA 7GSSA 3HJMA 5G1KA 2HYXA 3GIXA 3APQA 1AUCA 2EC4A 2OBIA 3ED3A 2V1MA 1TOFA 2H73A 3O6TA 4EDZA 5DQYA 3GL5A 1N2AA 3A5WA 1MDIA 2C8UA 2PERA 1XW6A 4XS1A 3UOMA 5IM9A 4TXOB 2H1DA 4BWSA 3UMAA 4QQ7A 3VI7A 3APSA 3LYPA 1GUKA 2HXKA 6GSUA 2FWEA 1ZGNA 1T8EB 2R6KA 4MPGA 1IYIA 1TP9A 3WT1A 1GSSA 1SJZA 5CRHA 3LQ7A 1X9WB 1JLWA 1GTUA 4K6XA 4N0VA 1T7PB 1K0CA 1GUHA 3GKMA 2G0FA 2YJHA 5IMAA 1YF1A 2CZ2A 4I97A 4LL1B 3QAWA 3A3TA 4MLYA 3D6IA 4RQRA 1F2EA 1XFLA 3ZMKA 5ECRB 4IHUA
chains in the Genus database with same CATH superfamily
2FHEA 1K3LA 3QR6A 1ON4A 1QXHA 1X9MB 3L78A 5ECSA 3NIVA 2B1KA 1SKSB 2PN8A 1B4PA 2YPMA 4TRXA 4LMVA 1FG4A 1XBSA 3O3TA 4OFTA 2FWGA 1YEXA 3IV4A 3VWXA 4TR0A 3QFBC 3D21A 3M9JA 2WULA 4EUYA 3ZTLA 5D73A 1WJKA 1ST9A 2HRKA 4FIWA 4ECIA 2KP1A 1KNGA 1MEKA 3NOFA 2H01A 3GH9A 5DDLA 3RHBA 4EC0A 2YZHA 6GSTA 1TRVA 3TRQA 4ZL8A 4G0LA 4KE3A 1O7UA 4KCEA 2VUPA 4PUAA 1I5GA 3TRPA 1AC1A 2GT5A 2VIMA 4LLRA 1SK0A 1BYEA 5DVBA 4V2NA 4MZBA 4POBA 2JZSA 2FD3A 4FH8A 4TOPA 3EURA 5ELAA 4XS6A 5IPGA 4HZ2A 2GQLA 2DKIA 2VCWA 3EYTA 3FR6A 4A5PA 4Z7XA 2K6VA 4EDYA 2A4HA 4Z2TA 5DAKA 2YWIA 2HZEA 4RI7A 2OE3A 4NMUA 1VF3A 3FYGA 2GSTA 4CDOA 4WF5A 1SD9A 14GSA 1WWJA 5JCGA 1S3DA 1NHOA 4I2TA 1V40A 4K5RA 3BCIA 3ZMLA 2VD1A 4PNFA 3IAS2 1XZOA 4RUVA 2HT9A 4X43A 1XW5A 2O85A 1TU7A 1GL8A 4F9ZA 1QGVA 4PX1A 3EC3A 3LFLA 1EEMA 4PUFC 3ERGA 1USBA 1GH2A 3RAZA 1B4QA 5AN1A 2O8VB 2R2JA 1FVKA 3KCMA 4I2UA 2HRFA 4DSSB 4NAXA 3FEUA 3KM6A 4Q5NA 1O8XA 4BWQA 3FZ4A 2I3YA 3GRXA 2VD0A 3DYRA 5ID2B 3N9JA 3F8UA 2EIQA 3HDCA 2GSQA 1ACVA 2L5LA 2REMA 1QFNA 2MBTA 1R4WA 1HNAA 4BVYB 3EINA 2QC7A 3IC4A 2TRXA 2RIIA 3EPTA 3KIJA 4G9HA 2C0EA 4XTSA 2DMMA 1A24A 1UVZA 2LEGA 5H5RA 4ML1A 1URMA 3GH6A 4F0BA 2Z9SA 5A4VA 3QCPA 20GSA 3QMXA 4O7HA 4G19A 2E7PA 1C72A 2N5FA 4O32A 4P3YB 1JZDA 1OAZA 1XIYA 2IMDA 4POMA 4MCUA 4PQIA 2MYGA 4H86A 4IGJA 4AJ7A 3IR4A 11GSA 5G1LA 2B3SA 2E2MA 2NDOA 4V1Ag 3ZIVA 1GSUA 4K8MA 2JL4A 1WRYA 2CV4A 2OE0A 3IHQA 1EV9A 4ML6A 3H93A 4ZBAA 4WEYA 2P31A 1UC7A 2RM5A 5F05A 4MZCA 3WT2A 2YWNA 2DJJA 2WGRA 2B5XA 3ZL5A 5EPFA 1K0NA 2OACA 1OE8A 5F06A 4CY8A 4Q5FA 2CT6A 3IBHA 2H1GA 3GNJA 4IKHA 2QSIA 4WBRD 1CQGA 3GN3A 5IMFA 2YANA 2CX3A 4OCFA 3DWVA 1DSBA 1WE0A 1O73A 3C8EA 4ID0A 3W8JA 3GKNA 4FYBA 2GZPA 1VF2A 3TDGA 4ECBA 1NM3A 5GAPD 3H1NA 1GULA 2F51A 2XPDA 3HJOA 1NW2A 5ECIB 3TUEA 1OC9B 4X1UA 3CTFA 2HRNA 4GQCA 4BA7A 1Z9HA 3C1RA 2FCHA 3IOSA 4OO4A 5ENUA 3I43A 4HJMA 1YKAA 5FHIA 2P5QA 4KGIA 1PL2A 1MTCA 3QD9A 3M1GA 3VFIA 1SL2B 2WB9A 1XOBA 3DVXA 4MA9A 3M8NA 2VCXA 1EOHA 4ZB8A 5LD0A 4MMMA 1Z6NA 1AXDA 3HJPA 4TXVA 3GL3A 1ZYNA 2GZZA 9GSSA 2VO4A 4G0KA 3EU3A 3FRCA 6GSVA 3EWLA 3PGTA 2D2ZA 2K9FA 2NVLA 2YJ7A 1OKTA 1GTAA 1AQWA 4USSA 5KN2A 2PMTA 4O92A 3MAKA 2ON7A 1A8LA 2VCQA 2L4CA 2R4VA 1PN0A 2MMZA 2XHFA 2CVBA 2PUKC 1GLPA 4K2XA 3ZIJA 4O5RA 1SENA 2V6KA 2IMIA 2R0PA 3IDVA 1U88A 2VLUA 3D0ZA 3F6FA 2IFQA 3TJKA 3GA4A 1K3OA 1TDIA 1PGTA 5D96A 2VOCA 4WR5A 3IPZA 3ME8A 3RPPA 3LGCA 4ZIJA 4LA1A 5DJMA 1MD3A 3GFKA 4ZXGA 2VL9A 3HZ8A 2LKUA 4K5SA 2RLIA 4EIQA 2R0CA 3V1WA 4O5QA 3LJRA 2BTOT 4XIHA 2LRCA 1OC3A 2FY6A 3HYPA 5D9WA 4LL4B 2VL2A 4EO3A 2E0QA 3P2AA 3EMPA 1TK5B 3ZRDA 2WDUA 1PQNA 4HJ2A 2L6CA 2PBJA 1F37A 1O85A 4IELA 5HFKA 1A0RP 3TGZA 1ABAA 1PD21 2GQKA 2IMFA 19GSA 5DAKB 3ME7A 2HZEB 4K9ZA 4EKZA 1HD2A 3GV1A 2YV7A 3FZAA 4YQMA 3PR8A 4Z2UA 3UIWA 3M3MA 4FYCA 1AAZA 2JADA 4RQXA 3G7JA 3TCOA 3D4TA 3D22A 5KN3A 4MH2A 4POKA 1TI1A 3F9UA 2YOIA 2KOKA 3HZ4A 1XW9A 3MYDA 2HNLA 4MP4A 3GTUA 1XVQA 10GSA 5KOWA 4IVFA 4TR4A 1EEJA 1Z6MA 1K0AA 4X4JA 2AYTA 2LRTA 3KP8A 1J08A 3WGDA 3VK9A 3PH9A 3BD2A 2GS3A 4ACSA 4MF5A 3ZZXA 2HSHA 3WYWA 1B48A 1QUWA 1PN9A 3KMOA 3QOUA 1CQHA 2JU5A 3F4RA 2I9HA 2V32A 3H79A 2FLSA 3FW2A 4NPBA 3H4KA 2YNXA 3D5JA 2B1LA 1SD8A 3LSZA 4L0UA 3LW9A 1A2JA 4YAPA 4G0IA 5B6MA 5CO3A 1E6BA 1M2BA 4MH3A 2LTKA 5FWGA 3KJYA 2FNOA 1AW9A 1GSQA 3G7IA 3MNGA 1TRWA 1WP0A 4J56E 2CAIA 4JE1A 5AIVA 3R3EA 4FYUA 2FA8A 3QDNA 4IP6A 1RK4A 4TR1B 2QKEA 4OD7A 2DSAA 4J2FA 2CZ3A 4RI6A 3L0HA 5GSTA 1GP1A 2I81A 3UAPA 17GSA 1FVJA 4WF4A 5ECPB 1M3IA 5KEJA 4Z2RA 3JCML 4ZL9A 2YP6A 1WMJA 5ECNB 1FB0A 2DC5A 4K7OA 5FT3A 1BEDA 2B7KA 1G0TA 4OMVA 4NHZA 4PQHA 2MMNA 3LORA 4GWRA 5JWQB 2F3MA 2CAQA 4CW9A 2GGTA 4XS4A 4IQ1A 2DKHA 3HVNA 4I6XA 5D93A 2FGXA 3ZYWA 2VLTA 4GLTA 4V1Ap 1F6MC 2J9HA 2N5AA 1V58A 2IWTA 2GLRA 3I9V2 4WBJA 1I9DA 3S9FA 6GSWA 1OE7A 1F3AA 2H19A 4KDUA 5J4UA 3CSHA 1SYXA 1TKDB 3LWAA 3VWVA 1SL0B 2A2SA 3GSTA 3TJJA 3C1SA 4ZBDA 4AJ8A 4L8EA 2C4JA 1TW9A 1JHBA 1A23A 4DVCA 3SBCA 3KEBA 3FZ5A 2AAWA 2RUFA 4GRFA 3I6AA 2L57A 1IYHA 2V41A 3TKRA 4ZB9A 3CRUA 3UL3A 2R0GA 5ECOB 3ZFBA 3IXRA 2DJKA 5B7CA 2BMXA 2CQ9A 2L4QA 3Q74A 5IMCA 1YKCA 1TTZA 2DJ3A 4DSQA 5IMZA 5LNKe 4NV5A 4AJ6A 1YJ6A 3QPMA 5H5SA 2WJUA 3L9SA 4OO5A 1U6TA 3QAGA 4PNGA 1WIKA 2IL3A 4FQUA 2PU9C 6GSXA 3GX0A 3TKQA 1A8YA 2C3TA 2WFCA 2VCTA 1PA3A 3WD6A 2VM2A 5C04A 2GVPA 4PTSA 3A2XA 3DD3A 5DJLA 1RQMA 3TRXA 4Q5RA 1V57A 1PKWA 4K7IA 1T3BA 4TVEA 2MMOA 2DMLA 2LQQA 1BJXA 2H0HA 5JWOB 1YY7A 1PRXA 4XHMA 1GUMA 1GTBA 5DALA 1S3RA 2JZTA 2H1BA 3KP9A 2IFQB 2LSTA 4MF6A 1PSQA 4KNDA 4YH2A 5J9BA 3Q6OA 2O7KA 3IAM2 3FZ9A 1UA5A 1XWAA 2H76A 1XWKA 3E9JB 13GSA 3U6VA 5AGYA 1K0MA 1GSDA 4WETA 1O81A 2CA8A 4MJCA 2OKAA 4AGSA 3LXTA 5DCGA 3PPUA 4BL7B 3DGQA 2XC2A 3VI5A 1YZXA 6GSYA 2LUSA 1KBNA 5G5EA 3MSZA 2WRTA 4D73A 4ZILA 3Q18A 1M99A 2X64A 4EL1A 4TKYA 2IIYA 1FO5A 2GDRA 5E4WA 1JZWA 2QGVA 2LJAA 1MD4A 1B9YC 1LJRA 1EWXA 2WZ9A 4KDXA 2K18A 4IN0A 4K0NA 4KSOA 3IRAA 4MABA 2FUG2 3TKSA 2VM1A 4JR4A 2H66A 3TKSE 1TJDA 1ZYQB 2HRAA 3KGKA 5INYA 1YEPA 1M9BA 2AUVA 1NHYA 5IQYA 1ZL9A 2XBIA 18GSA 2JSZA 4HU9A 3C7MA 5B8BA 3A2VA 5IO2A 4FO5A 2OA7A 1TRUA 2ZNMA 1HQOA 5ECLB 3L4NA 4JU5A 3DMLA 3ZFLA 4N10A 1M2AA 2C0GA 5D8IA 3U5RE 3BJ5A 3CXGA 1G6WA 4MJAA 5H5QA 1SU9A 3GTUB 3IA1A 1TRSA 5CRGA 2WS2A 2KLXA 4IP1A 1ERUA 4EF0A 3RDWA 3GHAA 4I8BA 2TRCP 1MDJA 2F8AA 1J0FA 5DBQA 2C3NA 4DSSA 4MZWA 1DBYA 1A2LA 2H30A 2CVDA 5HFGA 4E8HA 5ID2A 5CP1A 3L9UA 2VL2C 3F4SA 4HS1A 2XPEA 4BVYA 3VPQA 1OKDA 4TW5A 4L5LA 1XG8A 3ERFA 4NHWA 1JZOA 2C0DA 2H71A 2VLVA 1HYUA 1Y6EA 3HVVA 5ELGA 1F9MA 2A4VA 4KDYA 3VURA 4KAEA 1Z5YE 3FHKA 2X8CA 2MBSA 1PMTA 1Q98A 2WCIA 3TJBA 1TK8B 4NWYA 3UARA 1SJ6A 3QFAC 3ISOA 4G10A 4ECCA 5KN0A 3C73A 2L6DA 3UBLA 2H75A 2VL3A 1TU8A 5EL8A 4KF9A 2CVKA 3GKKA 1YF0A 4K0GA 1XWBA 1YDKA 2IPAA 1BX9A 1JLVA 1ZYEA 2OADA 4YKFA 5AIXA 1YQ1A 4QL7A 1V2AA 4EIPA 1KTEA 1ZCPA 3KMNA 1ML6A 4LMWA 3F63A 4F82A 4PURA 1K0DA 2A2PA 2YN1A 1EGOA 5L71A 3CSJA 2JACA 2DJ0A 5A5KA 1GLQA 2IN3A 2GSSA 2OE1A 2DJ2A 4L5OA 2R37A 3DVWA 3G9BA 4XS4B 2C80A 2FWFA 4OFNA 1THOA 4K1FA 4HSCX 3BBYA 4IJ3A 2KP2A 4YQUA 2H6ZA 5J9CA 3HKRA 1ILOA 3UVHA 4IS0A 3E3EA 5G31A 4IBPA 4OWYA 4PXOA 1DE2A 1XOAA 1SYRA 1VF4A 4G2EA 2BJXA 3H8QA 3BOAA 3TOTA 5F8BA 4KSMA 1T4YA 3O76A 2LJKA 4NV2A 2PPTA 1SK2A 3HD5A 1OC9A 5C00A 5CYYA 1WOUA 3HHVA 1EP8A 2FWHA 1G6YA 1ERTA 2K8VA 4HZ4A 3RPNA 1AIUA 1VF1A 1M2DA 2GSRA 3NZNA 2LJRA 2PGTA 3ERWA 2RUEA 3RHCA 2VCVA 1QQ2A 3LYKA 2X8GA 4WXTA 4F03A 1TK0B 2O87A 5EVOA 5LCZA 3FKFA 4XCSA 4N30A 3KH9A 1EZKA 1NSWA 2B5YA 1X5DA 1GSYA 1X5EA 2DJ1A 1A0FA 2NPBA 4ISDA 3F3QA 4GSSA 1A2MA 3WGXA 1SJIA 4Q5QA 1VGLA 5G5FA 1U87A 1SKWB 5EY6A 1LU4A 1T4ZA 4TR3A 2HZFA 4DSRA 5D9TA 1B8XA 3ZLPA 3EE2A 3ZVJD 1R5PA 2GQMA 1HNCA 3UEMA 1G7EA 2IMEA 4KX4A 2V6OA 3CMIA 2G2QA 2JZRA 2RM6A 1F3BA 1M0UA 5G30A 5IPHA 3VPTA 2VCZA 3IHGA 2H0GA 4QL9A 5DALB 5JWRB 4HI7A 2A2RA 4BIKA 4N0ZA 3CSIA 4V2LA 4KW6A 5E59A 1K0OA 3DIEA 2H72A 1DUGA 2LQOA 2H6XA 2OJLA 5A4WA 3N5OA 5GAND 5BMUA 1R26A 2CX4A 2F9SA 4JZQA 4JRRA 1SKRB 3GURA 4K2DA 3HY2A 3M9KA 3RBTA 1GRXA 3LG6A 3VWUA 5ECKB 3GX8A 2EIOA 1VRSD 3MDKA 5IOWA 3TB2A 4L0WA 4MJBA 3APOA 4D73B 4EE0A 2NBSA 4X0XA 4HDEA 4YQVA 2X99A 4GSNA 2R3XA 3TJGA 1GTIA 4PGTA 5J5NA 1PX7A 1H4OA 3IC8A 1EV4A 2H8LA 3F0IA 4EXJA 1GNEA 4WKWA 2UZ8A 12GSA 3KXOA 3FR3A 1T1VA 4KA0A 1V9WA 1X0RA 5G2ZA 2OBKA 1U3AA 4YAVA 1M3JA 2VAFA 2HFDA 1AQVA 1KEBA 2B7JA 3BCKA 3OR5A 4F2IA 4I5QA 1O8WA 1N8JA 3EMXA 2K8SA 1O6JA 2QA2A 1PFOA 1W4VA 2M72A 2J23A 4OFMA 4POLA 3DXBA 3GUSA 5IMDA 3KD0A 2LS5A 4GF0A 2H74A 5A4UA 2HLSA 4BVXA 4BPYA 5D9VA 5KOXA 1K3YA 4KB3A 1XVWA 2P0GA 1ERWA 3CRTA 16GSA 3L9VA 4TXOA 2MMAA 1LBKA 2YV9A 2HE3A 3P90A 2LNSA 4E8EA 4YKGA 1GNWA 4KCAA 22GSA 4N11A 3LXZA 3UJ1A 5J3RA 4GQFA 3F3RA 4MNNA 1Z7RA 1M7TA 4IW9A 1ZZYA 1M9AA 3FK8A 2X4AA 5IO0A 4EVMA 4MF7A 1Y25A 1W89A 5JCUA 2M80A 2HSMA 3US3A 5DCHA 3KH7A 2ZUPA 3TKSC 1Q4JA 3D4MA 1XCCA 1PKZA 4CY6A 2C1YA 5BRTA 2GTUA 4O5UA 1FB6A 1BAYA 2IMKA 3SWLA 2P5RA 4MPFA 2ALBA 2B5EA 5HR2A 1SL1B 4K7NA 3TJFA 4JBBA 3FR9A 1HNBA 1XWGA 1TXXA 2YWMA 2FA4A 2PVQA 2O89A 2LRNA 2M46A 3MWHA 3DEXA 4HQSA 4HUAA 2AV4A 3FY7A 5AISA 1DE1A 4TR1A 3F4TA 2YCDA 4DEJA 4KUNA 3J7Yk 4ILFA 3UVTA 1RW1A 1GSFA 1T00A 5IOXA 5GSSA 1ZYPA 1G7OA 1OYJA 2X8HA 1WPIA 1PL1A 5HR1A 3CYNA 1FAAA 1JZRA 3CTGA 1ERVA 1OC8A 4IQAA 5GZZB 4IJIA 4ECJA 2KHPA 1R7HA 2GT6A 2LV3A 2DLXA 3KZQA 4GSTA 4F0CA 1QK8A 2R5GA 3UBKA 3VLNA 5IIZA 3W6GA 1GWCA 3ZREA 4HEA2 3K8NA 1EP7A 3HVSA 2H70A 3EVIA 2I4AA 4ZB6A 4ZBBA 2ES7A 3TKPA 2ZCTA 5CREA 2MZCA 3IE3A 4ZL7A 2DBCA 5DQSA 4CHSA 2PVOC 3G7YA 3W8SA 5ABRA 3F6DA 4HOJA 3FMWA 3M0FA 3ZITA 4HQZA 1H75A 3E0UA 1FOVA 3Q19A 1XXUA 1X9SB 1J9BA 4V2MA 3GYKA 1THXA 2F8FA 5JCWA 5HFIA 4GTUA 3A2WA 3CBUA 3HXSA 1E2YA 2DIZA 2NTOA 1MDKA 3PINA 5HQPA 2ON5A 1SK1A 2TIRA 5IMVA 2KUCA 1V98A 2GZYA 3J7Yb 2YZUA 5COHA 3HVXA 2YWOA 2AHEA 4MDCA 4HU7A 4MJEA 4XRDA 2PWJA 2N5BA 1TI3A 1K0BA 1ZOFA 3HCZA 2IJYA 5F07A 1Z3EA 4PQ1A 3VWWA 3KTLA 1BG5A 5F0GA 2H0IA 2L5OA 3GKXA 4KH7A 1EGRA 1PX6A 4GXZA 1ZMAA 3GSSA 2C3QA 4J57E 4AF2A 3TOUA 5J41A 1Z7PA 3KTBA 2AJQB 2I1UA 3ZVJA 5CRDA 1S3AA 1B9XC 1S3CA 4ICYA 1GSEA 4JR6A 6GSSA 3P7XA 3DRNA 4NXIA 3IK7A 2EIRA 5ECQB 5HR3A 3GMFA 5CNWA 1QMVA 2H1AA 1FHEA 5HR0A 2AB6A 4ULXA 2XBQA 4BL7A 1X5CA 2DIYA 2H6YA 1OVNA 3AY8A 3I69A 1EOGA 2QA1A 2B6MA 3C71A 5ECMB 1AQXA 3QAVA 4JEDA 4XRAA 1R5AA 3IK9A 5B6NA 3P8WA 4TN8A 2LNTA 2X49A 1UN2A 8GSSA 2V2GA 5ECHB 4GCIA 2E2GA 1JFUA 3EU4A 3LEFA 1FW1A 2JSYA 3WGEA 1BQ7A 4MK3A 4WR4A 2HI7A 5B8AA 2L59A 3A5IA 1XPVA 5CRWA 5KN1A 5D9XA 2HSYA 2C0FA 4OCEA 5CAXA 1XWCA 3DKSA 3HA9A 3R2QA 1U3IA 7GSSA 3MIXA 3HJMA 5G1KA 2HYXA 3GIXA 3APQA 1AUCA 2EC4A 2OBIA 3ED3A 2V1MA 1TOFA 2H73A 3O6TA 4EDZA 5DQYA 3GL5A 4BVXB 1N2AA 3A5WA 1MDIA 2C8UA 2PERA 1XW6A 4XS1A 3UOMA 5IM9A 4TXOB 2H1DA 4BWSA 3UMAA 4QQ7A 3VI7A 3APSA 3LYPA 1GUKA 2HXKA 6GSUA 2FWEA 1ZGNA 1T8EB 2R6KA 4MPGA 1IYIA 1TP9A 3WT1A 1GSSA 1SJZA 5CRHA 3LQ7A 1X9WB 1FOHA 1JLWA 1GTUA 4K6XA 4N0VA 3CQFA 1T7PB 1K0CA 1GUHA 3GKMA 2G0FA 2YJHA 5IMAA 1YF1A 2CZ2A 4I97A 4LL1B 3QAWA 3A3TA 4MLYA 3D6IA 4RQRA 1F2EA 1XFLA 3ZMKA 5ECRB 4IHUA
chains in the Genus database with same CATH topology
2FHEA 1K3LA 3QR6A 1ON4A 1QXHA 1X9MB 3L78A 5ECSA 3NIVA 2B1KA 1SKSB 2PN8A 1B4PA 2YPMA 4TRXA 4LMVA 1FG4A 1XBSA 3O3TA 4OFTA 2FWGA 1YEXA 3IV4A 3VWXA 4TR0A 3QFBC 3D21A 3M9JA 2WULA 4EUYA 3ZTLA 5D73A 1WJKA 1ST9A 2HRKA 4FIWA 4ECIA 2KP1A 1KNGA 1MEKA 3NOFA 2H01A 3GH9A 5DDLA 3RHBA 4EC0A 2YZHA 6GSTA 1TRVA 3TRQA 4ZL8A 4G0LA 4KE3A 1O7UA 4KCEA 2VUPA 4PUAA 1I5GA 3TRPA 1AC1A 2GT5A 2VIMA 4LLRA 1SK0A 1BYEA 5DVBA 4V2NA 4MZBA 4POBA 2JZSA 2FD3A 4FH8A 4TOPA 3EURA 5ELAA 4XS6A 5IPGA 4HZ2A 2GQLA 2DKIA 2VCWA 3EYTA 3FR6A 4A5PA 4Z7XA 2K6VA 4EDYA 2A4HA 4Z2TA 5DAKA 2YWIA 2HZEA 4RI7A 2OE3A 4NMUA 1VF3A 3FYGA 2GSTA 4CDOA 4WF5A 1SD9A 14GSA 1WWJA 5JCGA 1S3DA 1NHOA 4I2TA 1V40A 4K5RA 3BCIA 3ZMLA 2VD1A 4PNFA 3IAS2 1XZOA 4RUVA 2HT9A 4X43A 1XW5A 2O85A 1TU7A 1GL8A 4F9ZA 1QGVA 4PX1A 3EC3A 3LFLA 1EEMA 4PUFC 3ERGA 1USBA 1GH2A 3RAZA 1B4QA 5AN1A 2O8VB 2R2JA 1FVKA 3KCMA 4I2UA 2HRFA 4DSSB 4NAXA 3FEUA 3KM6A 4Q5NA 1O8XA 4BWQA 3FZ4A 2I3YA 3GRXA 2VD0A 3DYRA 5ID2B 3N9JA 3F8UA 2EIQA 3HDCA 2GSQA 1ACVA 2L5LA 2REMA 1QFNA 2MBTA 1R4WA 1HNAA 4BVYB 3EINA 2QC7A 3IC4A 2TRXA 2RIIA 3EPTA 3KIJA 4G9HA 2C0EA 4XTSA 2DMMA 1A24A 1UVZA 2LEGA 5H5RA 4ML1A 1URMA 3GH6A 4F0BA 2Z9SA 5A4VA 3QCPA 20GSA 3QMXA 4O7HA 4G19A 2E7PA 1C72A 2N5FA 4O32A 4P3YB 1JZDA 1OAZA 1XIYA 2IMDA 4POMA 4MCUA 4PQIA 2MYGA 4H86A 4IGJA 4AJ7A 3IR4A 11GSA 5G1LA 2B3SA 2E2MA 2NDOA 4V1Ag 3ZIVA 1GSUA 4K8MA 2JL4A 1WRYA 2CV4A 2OE0A 3IHQA 1EV9A 4ML6A 3H93A 4ZBAA 4WEYA 2P31A 1UC7A 2RM5A 5F05A 4MZCA 3WT2A 2YWNA 2DJJA 2WGRA 2B5XA 3ZL5A 5EPFA 1K0NA 2OACA 1OE8A 5F06A 4CY8A 4Q5FA 2CT6A 3IBHA 2H1GA 3GNJA 4IKHA 2QSIA 4WBRD 1CQGA 3GN3A 5IMFA 2YANA 2CX3A 4OCFA 3DWVA 1DSBA 1WE0A 1O73A 3C8EA 4ID0A 3W8JA 3GKNA 4FYBA 2GZPA 1VF2A 3TDGA 4ECBA 1NM3A 5GAPD 3H1NA 1GULA 2F51A 2XPDA 3HJOA 1NW2A 5ECIB 3TUEA 1OC9B 4X1UA 3CTFA 2HRNA 4GQCA 4BA7A 1Z9HA 3C1RA 2FCHA 3IOSA 4OO4A 5ENUA 3I43A 4HJMA 1YKAA 5FHIA 2P5QA 4KGIA 1PL2A 1MTCA 3QD9A 3M1GA 3VFIA 1SL2B 2WB9A 1XOBA 3DVXA 4MA9A 3M8NA 2VCXA 1EOHA 4ZB8A 5LD0A 4MMMA 1Z6NA 1AXDA 3HJPA 4TXVA 3GL3A 1ZYNA 2GZZA 9GSSA 2VO4A 4G0KA 3EU3A 3FRCA 6GSVA 3EWLA 3PGTA 2D2ZA 2K9FA 2NVLA 2YJ7A 1OKTA 1GTAA 1AQWA 4USSA 5KN2A 2PMTA 4O92A 3MAKA 2ON7A 1A8LA 2VCQA 2L4CA 2R4VA 1PN0A 2MMZA 2XHFA 2CVBA 2PUKC 1GLPA 4K2XA 3ZIJA 4O5RA 1SENA 2V6KA 2IMIA 2R0PA 3IDVA 1U88A 2VLUA 3D0ZA 3F6FA 2IFQA 3TJKA 3GA4A 1K3OA 1TDIA 1PGTA 5D96A 2VOCA 4WR5A 3IPZA 3ME8A 3RPPA 3LGCA 4ZIJA 4LA1A 5DJMA 1MD3A 3GFKA 4ZXGA 2VL9A 3HZ8A 2LKUA 4K5SA 2RLIA 4EIQA 2R0CA 3V1WA 4O5QA 3LJRA 2BTOT 4XIHA 2LRCA 1OC3A 2FY6A 3HYPA 5D9WA 4LL4B 2VL2A 4EO3A 2E0QA 3P2AA 3EMPA 1TK5B 3ZRDA 2WDUA 1PQNA 4HJ2A 2L6CA 2PBJA 1F37A 1O85A 4IELA 5HFKA 1A0RP 3TGZA 1ABAA 1PD21 2GQKA 2IMFA 19GSA 5DAKB 3ME7A 2HZEB 4K9ZA 4EKZA 1HD2A 3GV1A 2YV7A 3FZAA 4YQMA 3PR8A 4Z2UA 3UIWA 3M3MA 4FYCA 1AAZA 2JADA 4RQXA 3G7JA 3TCOA 3D4TA 3D22A 5KN3A 4MH2A 4POKA 1TI1A 3F9UA 2YOIA 2KOKA 3HZ4A 1XW9A 3MYDA 2HNLA 4MP4A 3GTUA 1XVQA 10GSA 5KOWA 4IVFA 4TR4A 1EEJA 1Z6MA 1K0AA 4X4JA 2AYTA 2LRTA 3KP8A 1J08A 3WGDA 3VK9A 3PH9A 3BD2A 2GS3A 4ACSA 4MF5A 3ZZXA 2HSHA 3WYWA 1B48A 1QUWA 1PN9A 3KMOA 3QOUA 1CQHA 2JU5A 3F4RA 2I9HA 2V32A 3H79A 2FLSA 3FW2A 4NPBA 3H4KA 2YNXA 3D5JA 2B1LA 1SD8A 3LSZA 4L0UA 3LW9A 1A2JA 4YAPA 4G0IA 5B6MA 5CO3A 1E6BA 1M2BA 4MH3A 2LTKA 5FWGA 3KJYA 2FNOA 1AW9A 1GSQA 3G7IA 3MNGA 1TRWA 1WP0A 4J56E 2CAIA 4JE1A 5AIVA 3R3EA 4FYUA 2FA8A 3QDNA 4IP6A 1RK4A 4TR1B 2QKEA 4OD7A 2DSAA 4J2FA 2CZ3A 4RI6A 3L0HA 5GSTA 1GP1A 2I81A 3UAPA 17GSA 1FVJA 4WF4A 5ECPB 5KEJA 4Z2RA 3JCML 4ZL9A 2YP6A 1WMJA 5ECNB 1FB0A 2DC5A 4K7OA 5FT3A 1BEDA 2B7KA 1G0TA 4OMVA 4NHZA 4PQHA 2MMNA 3LORA 4GWRA 5JWQB 2F3MA 2CAQA 4CW9A 2GGTA 4XS4A 4IQ1A 2DKHA 4I6XA 5D93A 2FGXA 3ZYWA 2VLTA 4GLTA 4V1Ap 1F6MC 2J9HA 2N5AA 1V58A 2IWTA 2GLRA 3I9V2 4WBJA 1I9DA 3S9FA 6GSWA 1OE7A 1F3AA 2H19A 4KDUA 5J4UA 3CSHA 1SYXA 1TKDB 3LWAA 3VWVA 1SL0B 2A2SA 3GSTA 3TJJA 3C1SA 4ZBDA 4AJ8A 4L8EA 2C4JA 1TW9A 1JHBA 1A23A 4DVCA 3SBCA 3KEBA 3FZ5A 2AAWA 2RUFA 4GRFA 3I6AA 2L57A 1IYHA 2V41A 3TKRA 4ZB9A 3CRUA 3UL3A 2R0GA 5ECOB 3ZFBA 3IXRA 2DJKA 5B7CA 2BMXA 2CQ9A 2L4QA 3Q74A 5IMCA 1YKCA 1TTZA 2DJ3A 4DSQA 5IMZA 5LNKe 4NV5A 4AJ6A 1YJ6A 3QPMA 5H5SA 2WJUA 3L9SA 4OO5A 1U6TA 3QAGA 4PNGA 1WIKA 2IL3A 4FQUA 2PU9C 6GSXA 3GX0A 3TKQA 1A8YA 2C3TA 2WFCA 2VCTA 1PA3A 3WD6A 2VM2A 5C04A 2GVPA 4PTSA 3A2XA 3DD3A 5DJLA 1RQMA 3TRXA 4Q5RA 1V57A 1PKWA 4K7IA 1T3BA 4TVEA 2MMOA 2DMLA 2LQQA 1BJXA 2H0HA 5JWOB 1YY7A 1PRXA 4XHMA 1GUMA 1GTBA 5DALA 2JZTA 2H1BA 3KP9A 2IFQB 2LSTA 4MF6A 1PSQA 4KNDA 4YH2A 5J9BA 3Q6OA 2O7KA 3IAM2 3FZ9A 1UA5A 1XWAA 2H76A 1XWKA 3E9JB 13GSA 3U6VA 5AGYA 1K0MA 1GSDA 4WETA 1O81A 2CA8A 4MJCA 2OKAA 4AGSA 3LXTA 5DCGA 3PPUA 4BL7B 3DGQA 2XC2A 3VI5A 1YZXA 6GSYA 2LUSA 1KBNA 5G5EA 3MSZA 2WRTA 4D73A 4ZILA 3Q18A 1M99A 2X64A 4EL1A 4TKYA 2IIYA 1FO5A 2GDRA 5E4WA 1JZWA 2QGVA 2LJAA 1MD4A 1B9YC 1LJRA 1EWXA 2WZ9A 4KDXA 2K18A 4IN0A 4K0NA 4KSOA 3IRAA 4MABA 2FUG2 3TKSA 2VM1A 4JR4A 2H66A 3TKSE 1TJDA 1ZYQB 2HRAA 3KGKA 5INYA 1YEPA 1M9BA 2AUVA 1NHYA 5IQYA 1ZL9A 2XBIA 18GSA 2JSZA 4HU9A 3C7MA 5B8BA 3A2VA 5IO2A 4FO5A 2OA7A 1TRUA 2ZNMA 1HQOA 5ECLB 3L4NA 4JU5A 3DMLA 3ZFLA 4N10A 1M2AA 2C0GA 5D8IA 3U5RE 3BJ5A 3CXGA 1G6WA 4MJAA 5H5QA 1SU9A 3GTUB 3IA1A 1TRSA 5CRGA 2WS2A 2KLXA 4IP1A 1ERUA 4EF0A 3RDWA 3GHAA 4I8BA 2TRCP 1MDJA 2F8AA 1J0FA 5DBQA 2C3NA 4DSSA 4MZWA 1DBYA 1A2LA 2H30A 2CVDA 5HFGA 4E8HA 5ID2A 5CP1A 3L9UA 2VL2C 3F4SA 4HS1A 2XPEA 4BVYA 3VPQA 1OKDA 4TW5A 4L5LA 3ERFA 4NHWA 1JZOA 2C0DA 2H71A 2VLVA 1HYUA 1Y6EA 3HVVA 5ELGA 1F9MA 2A4VA 4KDYA 3VURA 4KAEA 1Z5YE 3FHKA 2X8CA 2MBSA 1PMTA 1Q98A 2WCIA 3TJBA 1TK8B 4NWYA 3UARA 1SJ6A 3QFAC 3ISOA 4G10A 4ECCA 5KN0A 3C73A 2L6DA 3UBLA 2H75A 2VL3A 1TU8A 5EL8A 4KF9A 2CVKA 3GKKA 1YF0A 4K0GA 1XWBA 1YDKA 2IPAA 1BX9A 1JLVA 1ZYEA 2OADA 4YKFA 5AIXA 1YQ1A 4QL7A 1V2AA 4EIPA 1KTEA 1ZCPA 3KMNA 1ML6A 4LMWA 3F63A 4F82A 4PURA 1K0DA 2A2PA 2YN1A 1EGOA 5L71A 3CSJA 2JACA 2DJ0A 5A5KA 1GLQA 2IN3A 2GSSA 2OE1A 2DJ2A 4L5OA 2R37A 3DVWA 3G9BA 4XS4B 2C80A 2FWFA 4OFNA 1THOA 4K1FA 3BBYA 4IJ3A 2KP2A 4YQUA 2H6ZA 5J9CA 3HKRA 1ILOA 3UVHA 4IS0A 3E3EA 5G31A 4IBPA 4OWYA 4PXOA 1DE2A 1XOAA 1SYRA 1VF4A 4G2EA 2BJXA 3H8QA 3BOAA 3TOTA 5F8BA 4KSMA 1T4YA 3O76A 2LJKA 4NV2A 2PPTA 1SK2A 3HD5A 1OC9A 5C00A 5CYYA 1WOUA 3HHVA 1EP8A 2FWHA 1G6YA 1ERTA 2K8VA 4HZ4A 3RPNA 1AIUA 1VF1A 1M2DA 2GSRA 3NZNA 2LJRA 2PGTA 3ERWA 2RUEA 3RHCA 2VCVA 1QQ2A 3LYKA 2X8GA 4WXTA 4F03A 1TK0B 2O87A 5EVOA 5LCZA 3FKFA 4XCSA 4N30A 3KH9A 1EZKA 1NSWA 2B5YA 1X5DA 1GSYA 1X5EA 2DJ1A 1A0FA 2NPBA 4ISDA 3F3QA 4GSSA 1A2MA 3WGXA 1SJIA 4Q5QA 1VGLA 5G5FA 1U87A 1SKWB 5EY6A 1LU4A 1T4ZA 4TR3A 2HZFA 4DSRA 5D9TA 1B8XA 3ZLPA 3EE2A 3ZVJD 1R5PA 2GQMA 1HNCA 3UEMA 1G7EA 2IMEA 4KX4A 2V6OA 3CMIA 2G2QA 2JZRA 2RM6A 1F3BA 1M0UA 5G30A 5IPHA 3VPTA 2VCZA 3IHGA 2H0GA 4QL9A 5DALB 5JWRB 4HI7A 2A2RA 4N0ZA 3CSIA 4V2LA 4KW6A 5E59A 1K0OA 3DIEA 2H72A 1DUGA 2LQOA 2H6XA 2OJLA 5A4WA 3N5OA 5GAND 5BMUA 1R26A 2CX4A 2F9SA 4JZQA 4JRRA 1SKRB 3GURA 4K2DA 3HY2A 3M9KA 3RBTA 1GRXA 3LG6A 3VWUA 5ECKB 3GX8A 2EIOA 1VRSD 3MDKA 5IOWA 3TB2A 4L0WA 4MJBA 3APOA 4D73B 4EE0A 2NBSA 4X0XA 4HDEA 4YQVA 2X99A 4GSNA 2R3XA 3TJGA 1GTIA 4PGTA 5J5NA 1PX7A 1H4OA 3IC8A 1EV4A 2H8LA 3F0IA 4EXJA 1GNEA 4WKWA 2UZ8A 12GSA 3KXOA 3FR3A 1T1VA 4KA0A 1V9WA 1X0RA 5G2ZA 2OBKA 1U3AA 4YAVA 2VAFA 2HFDA 1AQVA 1KEBA 2B7JA 3BCKA 3OR5A 4F2IA 4I5QA 1O8WA 1N8JA 3EMXA 2K8SA 1O6JA 2QA2A 1W4VA 2M72A 2J23A 4OFMA 4POLA 3DXBA 3GUSA 5IMDA 3KD0A 2LS5A 4GF0A 2H74A 5A4UA 2HLSA 4BVXA 4BPYA 5D9VA 5KOXA 1K3YA 4KB3A 1XVWA 2P0GA 1ERWA 3CRTA 16GSA 3L9VA 4TXOA 2MMAA 1LBKA 2YV9A 2HE3A 3P90A 2LNSA 4E8EA 4YKGA 1GNWA 4KCAA 22GSA 4N11A 3LXZA 3UJ1A 5J3RA 4GQFA 3F3RA 4MNNA 1Z7RA 1M7TA 4IW9A 1ZZYA 1M9AA 3FK8A 2X4AA 5IO0A 4EVMA 4MF7A 1Y25A 1W89A 5JCUA 2M80A 2HSMA 3US3A 5DCHA 3KH7A 2ZUPA 3TKSC 1Q4JA 3D4MA 1XCCA 1PKZA 4CY6A 2C1YA 5BRTA 2GTUA 4O5UA 1FB6A 1BAYA 2IMKA 3SWLA 2P5RA 4MPFA 2ALBA 2B5EA 5HR2A 1SL1B 4K7NA 3TJFA 4JBBA 3FR9A 1HNBA 1XWGA 1TXXA 2YWMA 2FA4A 2PVQA 2O89A 2LRNA 2M46A 3MWHA 3DEXA 4HQSA 4HUAA 2AV4A 3FY7A 5AISA 1DE1A 4TR1A 3F4TA 2YCDA 4DEJA 4KUNA 3J7Yk 4ILFA 3UVTA 1RW1A 1GSFA 1T00A 5IOXA 5GSSA 1ZYPA 1G7OA 1OYJA 2X8HA 1WPIA 1PL1A 5HR1A 3CYNA 1FAAA 1JZRA 3CTGA 1ERVA 1OC8A 4IQAA 5GZZB 4IJIA 4ECJA 2KHPA 1R7HA 2GT6A 2LV3A 2DLXA 3KZQA 4GSTA 4F0CA 1QK8A 2R5GA 3UBKA 3VLNA 5IIZA 3W6GA 1GWCA 3ZREA 4HEA2 3K8NA 1EP7A 3HVSA 2H70A 3EVIA 2I4AA 4ZB6A 4ZBBA 2ES7A 3TKPA 2ZCTA 5CREA 2MZCA 3IE3A 4ZL7A 2DBCA 5DQSA 4CHSA 2PVOC 3G7YA 3W8SA 5ABRA 3F6DA 4HOJA 3FMWA 3M0FA 3ZITA 4HQZA 1H75A 3E0UA 1FOVA 3Q19A 1XXUA 1X9SB 1J9BA 4V2MA 3GYKA 1THXA 2F8FA 5JCWA 5HFIA 4GTUA 3A2WA 3CBUA 3HXSA 1E2YA 2DIZA 2NTOA 1MDKA 3PINA 5HQPA 2ON5A 1SK1A 2TIRA 5IMVA 2KUCA 1V98A 2GZYA 3J7Yb 2YZUA 5COHA 3HVXA 2YWOA 2AHEA 4MDCA 4HU7A 4MJEA 4XRDA 2PWJA 2N5BA 1TI3A 1K0BA 1ZOFA 3HCZA 2IJYA 5F07A 1Z3EA 4PQ1A 3VWWA 3KTLA 1BG5A 5F0GA 2H0IA 2L5OA 3GKXA 4KH7A 1EGRA 1PX6A 4GXZA 1ZMAA 3GSSA 2C3QA 4J57E 4AF2A 3TOUA 5J41A 1Z7PA 3KTBA 2AJQB 2I1UA 3ZVJA 5CRDA 1S3AA 1B9XC 1S3CA 4ICYA 1GSEA 4JR6A 6GSSA 3P7XA 3DRNA 4NXIA 3IK7A 2EIRA 5ECQB 5HR3A 3GMFA 5CNWA 1QMVA 2H1AA 1FHEA 5HR0A 2AB6A 4ULXA 2XBQA 4BL7A 1X5CA 2DIYA 2H6YA 1OVNA 3AY8A 3I69A 1EOGA 2QA1A 2B6MA 3C71A 5ECMB 1AQXA 3QAVA 4JEDA 4XRAA 1R5AA 3IK9A 5B6NA 3P8WA 4TN8A 2LNTA 2X49A 1UN2A 8GSSA 2V2GA 5ECHB 4GCIA 2E2GA 1JFUA 3EU4A 3LEFA 1FW1A 2JSYA 3WGEA 1BQ7A 4MK3A 4WR4A 2HI7A 5B8AA 2L59A 3A5IA 1XPVA 5CRWA 5KN1A 5D9XA 2HSYA 2C0FA 4OCEA 5CAXA 1XWCA 3DKSA 3HA9A 3R2QA 1U3IA 7GSSA 3MIXA 3HJMA 5G1KA 2HYXA 3GIXA 3APQA 1AUCA 2EC4A 2OBIA 3ED3A 2V1MA 1TOFA 2H73A 3O6TA 4EDZA 5DQYA 3GL5A 4BVXB 1N2AA 3A5WA 1MDIA 2C8UA 2PERA 1XW6A 4XS1A 3UOMA 5IM9A 4TXOB 2H1DA 4BWSA 3UMAA 4QQ7A 3VI7A 3APSA 3LYPA 1GUKA 2HXKA 6GSUA 2FWEA 1ZGNA 1T8EB 2R6KA 4MPGA 1IYIA 1TP9A 3WT1A 1GSSA 1SJZA 5CRHA 3LQ7A 1X9WB 1FOHA 1JLWA 1GTUA 4K6XA 4N0VA 1T7PB 1K0CA 1GUHA 3GKMA 2G0FA 2YJHA 5IMAA 1YF1A 2CZ2A 4I97A 4LL1B 3QAWA 3A3TA 4MLYA 3D6IA 4RQRA 1F2EA 1XFLA 3ZMKA 5ECRB 4IHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHE A;  1K3L A;  3QR6 A;  1ON4 A;  1QXH A;  1X9M B;  3L78 A;  5ECS A;  3NIV A;  2B1K A;  1SKS B;  2PN8 A;  1B4P A;  2YPM A;  4TRX A;  4LMV A;  1FG4 A;  1XBS A;  3O3T A;  4OFT A;  2FWG A;  1YEX A;  3IV4 A;  3VWX A;  4TR0 A;  3QFB C;  3D21 A;  3M9J A;  2WUL A;  4EUY A;  3ZTL A;  5D73 A;  1WJK A;  1ST9 A;  4FIW A;  4ECI A;  2KP1 A;  1KNG A;  1MEK A;  3NOF A;  2H01 A;  3GH9 A;  5DDL A;  3RHB A;  4EC0 A;  2YZH A;  6GST A;  1TRV A;  3TRQ A;  4ZL8 A;  4KE3 A;  1O7U A;  4KCE A;  2VUP A;  4PUA A;  1I5G A;  3TRP A;  1AC1 A;  2GT5 A;  2VIM A;  4LLR A;  1SK0 A;  1BYE A;  5DVB A;  4V2N A;  4MZB A;  4POB A;  2JZS A;  2FD3 A;  4FH8 A;  4TOP A;  3EUR A;  5ELA A;  4XS6 A;  5IPG A;  4HZ2 A;  2GQL A;  2VCW A;  3EYT A;  3FR6 A;  4Z7X A;  2K6V A;  4EDY A;  5DAK A;  2YWI A;  2HZE A;  4RI7 A;  2OE3 A;  4NMU A;  1VF3 A;  3FYG A;  2GST A;  4CDO A;  4WF5 A;  1SD9 A;  14GS A;  1WWJ A;  5JCG A;  1S3D A;  1NHO A;  4I2T A;  1V40 A;  3BCI A;  3ZML A;  2VD1 A;  4PNF A;  3IAS 2;  1XZO A;  4RUV A;  2HT9 A;  4X43 A;  1XW5 A;  2O85 A;  1TU7 A;  1GL8 A;  4F9Z A;  1QGV A;  4PX1 A;  3EC3 A;  3LFL A;  1EEM A;  4PUF C;  3ERG A;  1USB A;  1GH2 A;  3RAZ A;  1B4Q A;  5AN1 A;  2O8V B;  2R2J A;  1FVK A;  3KCM A;  4I2U A;  2HRF A;  4DSS B;  4NAX A;  3FEU A;  3KM6 A;  4Q5N A;  1O8X A;  4BWQ A;  3FZ4 A;  2I3Y A;  3GRX A;  2VD0 A;  3DYR A;  5ID2 B;  3N9J A;  3F8U A;  2EIQ A;  3HDC A;  2GSQ A;  1ACV A;  2L5L A;  2REM A;  1QFN A;  2MBT A;  1R4W A;  1HNA A;  3EIN A;  2QC7 A;  3IC4 A;  2TRX A;  2RII A;  3KIJ A;  4G9H A;  2C0E A;  4XTS A;  2DMM A;  1A24 A;  1UVZ A;  2LEG A;  5H5R A;  4ML1 A;  1URM A;  3GH6 A;  4F0B A;  2Z9S A;  5A4V A;  3QCP A;  20GS A;  3QMX A;  4O7H A;  4G19 A;  2E7P A;  1C72 A;  2N5F A;  4O32 A;  4P3Y B;  1JZD A;  1OAZ A;  1XIY A;  2IMD A;  4POM A;  4MCU A;  4PQI A;  2MYG A;  4H86 A;  4IGJ A;  4AJ7 A;  3IR4 A;  11GS A;  5G1L A;  2B3S A;  2E2M A;  2NDO A;  4V1A g;  3ZIV A;  1GSU A;  4K8M A;  2JL4 A;  1WRY A;  2CV4 A;  2OE0 A;  3IHQ A;  1EV9 A;  4ML6 A;  3H93 A;  4ZBA A;  4WEY A;  2P31 A;  1UC7 A;  2RM5 A;  5F05 A;  4MZC A;  3WT2 A;  2YWN A;  2DJJ A;  2WGR A;  2B5X A;  3ZL5 A;  5EPF A;  1K0N A;  2OAC A;  1OE8 A;  5F06 A;  4Q5F A;  2CT6 A;  3IBH A;  2H1G A;  3GNJ A;  4IKH A;  2QSI A;  4WBR D;  1CQG A;  3GN3 A;  5IMF A;  2YAN A;  2CX3 A;  4OCF A;  3DWV A;  1DSB A;  1WE0 A;  1O73 A;  3C8E A;  4ID0 A;  3W8J A;  3GKN A;  4FYB A;  2GZP A;  1VF2 A;  3TDG A;  4ECB A;  1NM3 A;  5GAP D;  3H1N A;  1GUL A;  2F51 A;  2XPD A;  3HJO A;  1NW2 A;  5ECI B;  3TUE A;  1OC9 B;  4X1U A;  3CTF A;  2HRN A;  4GQC A;  4BA7 A;  1Z9H A;  3C1R A;  2FCH A;  3IOS A;  4OO4 A;  5ENU A;  3I43 A;  4HJM A;  1YKA A;  5FHI A;  2P5Q A;  4KGI A;  1PL2 A;  1MTC A;  3QD9 A;  3M1G A;  3VFI A;  1SL2 B;  2WB9 A;  1XOB A;  3DVX A;  4MA9 A;  3M8N A;  2VCX A;  1EOH A;  4ZB8 A;  5LD0 A;  4MMM A;  1Z6N A;  1AXD A;  3HJP A;  4TXV A;  3GL3 A;  2GZZ A;  9GSS A;  2VO4 A;  3EU3 A;  3FRC A;  6GSV A;  3EWL A;  3PGT A;  2D2Z A;  2K9F A;  2NVL A;  2YJ7 A;  1OKT A;  1GTA A;  1AQW A;  5KN2 A;  2PMT A;  4O92 A;  3MAK A;  2ON7 A;  1A8L A;  2VCQ A;  2L4C A;  2R4V A;  2MMZ A;  2XHF A;  2CVB A;  2PUK C;  1GLP A;  3ZIJ A;  4O5R A;  1SEN A;  2V6K A;  2IMI A;  3IDV A;  1U88 A;  2VLU A;  3D0Z A;  3F6F A;  2IFQ A;  3TJK A;  3GA4 A;  1K3O A;  1TDI A;  1PGT A;  5D96 A;  2VOC A;  4WR5 A;  3IPZ A;  3ME8 A;  3RPP A;  3LGC A;  4ZIJ A;  4LA1 A;  5DJM A;  1MD3 A;  3GFK A;  4ZXG A;  2VL9 A;  3HZ8 A;  2LKU A;  2RLI A;  3V1W A;  3LJR A;  2BTO T;  4XIH A;  2LRC A;  1OC3 A;  2FY6 A;  3HYP A;  5D9W A;  4LL4 B;  2VL2 A;  4EO3 A;  2E0Q A;  3P2A A;  3EMP A;  1TK5 B;  3ZRD A;  2WDU A;  1PQN A;  4HJ2 A;  2L6C A;  2PBJ A;  1F37 A;  1O85 A;  4IEL A;  5HFK A;  1A0R P;  3TGZ A;  1ABA A;  1PD2 1;  2GQK A;  2IMF A;  19GS A;  5DAK B;  3ME7 A;  2HZE B;  4K9Z A;  4EKZ A;  1HD2 A;  3GV1 A;  2YV7 A;  3FZA A;  4YQM A;  3PR8 A;  3UIW A;  3M3M A;  4FYC A;  1AAZ A;  2JAD A;  4RQX A;  3G7J A;  3TCO A;  3D4T A;  3D22 A;  5KN3 A;  4MH2 A;  4POK A;  1TI1 A;  3F9U A;  2YOI A;  2KOK A;  3HZ4 A;  1XW9 A;  2HNL A;  4MP4 A;  3GTU A;  1XVQ A;  10GS A;  4IVF A;  4TR4 A;  1EEJ A;  1Z6M A;  1K0A A;  2AYT A;  2LRT A;  3KP8 A;  1J08 A;  3WGD A;  3VK9 A;  3PH9 A;  3BD2 A;  2GS3 A;  4ACS A;  4MF5 A;  3ZZX A;  2HSH A;  3WYW A;  1B48 A;  1QUW A;  1PN9 A;  3KMO A;  3QOU A;  1CQH A;  2JU5 A;  3F4R A;  2I9H A;  2V32 A;  3H79 A;  2FLS A;  3FW2 A;  4NPB A;  3H4K A;  2YNX A;  3D5J A;  2B1L A;  1SD8 A;  3LSZ A;  4L0U A;  1A2J A;  4YAP A;  5B6M A;  5CO3 A;  1E6B A;  1M2B A;  4MH3 A;  2LTK A;  5FWG A;  3KJY A;  2FNO A;  1AW9 A;  1GSQ A;  3G7I A;  3MNG A;  1TRW A;  1WP0 A;  4J56 E;  2CAI A;  4JE1 A;  5AIV A;  4FYU A;  2FA8 A;  3QDN A;  4IP6 A;  1RK4 A;  4TR1 B;  2QKE A;  4OD7 A;  2DSA A;  4J2F A;  2CZ3 A;  4RI6 A;  3L0H A;  5GST A;  1GP1 A;  2I81 A;  3UAP A;  17GS A;  1FVJ A;  4WF4 A;  5ECP B;  5KEJ A;  3JCM L;  4ZL9 A;  2YP6 A;  1WMJ A;  5ECN B;  1FB0 A;  2DC5 A;  4K7O A;  5FT3 A;  1BED A;  2B7K A;  1G0T A;  4OMV A;  4NHZ A;  4PQH A;  2MMN A;  3LOR A;  4GWR A;  5JWQ B;  2F3M A;  2CAQ A;  4CW9 A;  2GGT A;  4XS4 A;  4IQ1 A;  4I6X A;  5D93 A;  2FGX A;  3ZYW A;  2VLT A;  4GLT A;  4V1A p;  1F6M C;  2J9H A;  2N5A A;  1V58 A;  2IWT A;  2GLR A;  3I9V 2;  4WBJ A;  1I9D A;  3S9F A;  6GSW A;  1OE7 A;  1F3A A;  2H19 A;  4KDU A;  5J4U A;  3CSH A;  1SYX A;  1TKD B;  3LWA A;  3VWV A;  1SL0 B;  2A2S A;  3GST A;  3TJJ A;  3C1S A;  4ZBD A;  4AJ8 A;  4L8E A;  2C4J A;  1TW9 A;  1JHB A;  1A23 A;  4DVC A;  3SBC A;  3KEB A;  3FZ5 A;  2AAW A;  2RUF A;  4GRF A;  3I6A A;  2L57 A;  1IYH A;  2V41 A;  3TKR A;  4ZB9 A;  3CRU A;  3UL3 A;  5ECO B;  3ZFB A;  3IXR A;  2DJK A;  5B7C A;  2BMX A;  2CQ9 A;  2L4Q A;  3Q74 A;  5IMC A;  1YKC A;  1TTZ A;  2DJ3 A;  4DSQ A;  5IMZ A;  5LNK e;  4NV5 A;  4AJ6 A;  1YJ6 A;  3QPM A;  5H5S A;  2WJU A;  3L9S A;  4OO5 A;  1U6T A;  3QAG A;  4PNG A;  1WIK A;  2IL3 A;  2PU9 C;  6GSX A;  3GX0 A;  3TKQ A;  1A8Y A;  2C3T A;  2WFC A;  2VCT A;  1PA3 A;  3WD6 A;  2VM2 A;  5C04 A;  2GVP A;  3A2X A;  3DD3 A;  5DJL A;  1RQM A;  3TRX A;  4Q5R A;  1V57 A;  1PKW A;  4K7I A;  1T3B A;  4TVE A;  2MMO A;  2DML A;  2LQQ A;  1BJX A;  2H0H A;  5JWO B;  1YY7 A;  1PRX A;  4XHM A;  1GUM A;  1GTB A;  5DAL A;  2JZT A;  2H1B A;  3KP9 A;  2IFQ B;  2LST A;  4MF6 A;  1PSQ A;  4KND A;  4YH2 A;  5J9B A;  3Q6O A;  2O7K A;  3IAM 2;  3FZ9 A;  1UA5 A;  1XWA A;  2H76 A;  1XWK A;  3E9J B;  13GS A;  3U6V A;  5AGY A;  1K0M A;  1GSD A;  4WET A;  1O81 A;  2CA8 A;  4MJC A;  2OKA A;  4AGS A;  3LXT A;  5DCG A;  3DGQ A;  2XC2 A;  3VI5 A;  1YZX A;  6GSY A;  2LUS A;  1KBN A;  5G5E A;  3MSZ A;  2WRT A;  4D73 A;  4ZIL A;  3Q18 A;  1M99 A;  2X64 A;  4EL1 A;  4TKY A;  2IIY A;  1FO5 A;  2GDR A;  5E4W A;  1JZW A;  2QGV A;  2LJA A;  1MD4 A;  1B9Y C;  1LJR A;  1EWX A;  2WZ9 A;  4KDX A;  2K18 A;  4IN0 A;  4K0N A;  4KSO A;  3IRA A;  4MAB A;  2FUG 2;  3TKS A;  2VM1 A;  4JR4 A;  2H66 A;  3TKS E;  1TJD A;  1ZYQ B;  3KGK A;  5INY A;  1YEP A;  1M9B A;  2AUV A;  1NHY A;  5IQY A;  1ZL9 A;  2XBI A;  18GS A;  2JSZ A;  4HU9 A;  3C7M A;  5B8B A;  3A2V A;  5IO2 A;  4FO5 A;  2OA7 A;  1TRU A;  2ZNM A;  1HQO A;  5ECL B;  3L4N A;  4JU5 A;  3DML A;  3ZFL A;  4N10 A;  1M2A A;  2C0G A;  5D8I A;  3U5R E;  3BJ5 A;  3CXG A;  1G6W A;  4MJA A;  5H5Q A;  1SU9 A;  3GTU B;  3IA1 A;  1TRS A;  5CRG A;  2WS2 A;  2KLX A;  4IP1 A;  1ERU A;  4EF0 A;  3RDW A;  3GHA A;  4I8B A;  2TRC P;  1MDJ A;  2F8A A;  1J0F A;  5DBQ A;  2C3N A;  4DSS A;  4MZW A;  1DBY A;  1A2L A;  2H30 A;  2CVD A;  5HFG A;  4E8H A;  5ID2 A;  5CP1 A;  3L9U A;  2VL2 C;  3F4S A;  4HS1 A;  2XPE A;  4BVY A;  3VPQ A;  1OKD A;  4TW5 A;  4L5L A;  3ERF A;  4NHW A;  1JZO A;  2C0D A;  2H71 A;  2VLV A;  1HYU A;  1Y6E A;  3HVV A;  5ELG A;  1F9M A;  2A4V A;  4KDY A;  3VUR A;  4KAE A;  1Z5Y E;  3FHK A;  2X8C A;  2MBS A;  1PMT A;  1Q98 A;  2WCI A;  3TJB A;  1TK8 B;  4NWY A;  3UAR A;  1SJ6 A;  3QFA C;  3ISO A;  4G10 A;  4ECC A;  5KN0 A;  3C73 A;  2L6D A;  3UBL A;  2H75 A;  2VL3 A;  1TU8 A;  5EL8 A;  2CVK A;  3GKK A;  1YF0 A;  4K0G A;  1XWB A;  1YDK A;  2IPA A;  1BX9 A;  1JLV A;  1ZYE A;  2OAD A;  5AIX A;  1YQ1 A;  4QL7 A;  1V2A A;  1KTE A;  1ZCP A;  3KMN A;  1ML6 A;  4LMW A;  3F63 A;  4F82 A;  4PUR A;  1K0D A;  1EGO A;  2YN1 A;  5L71 A;  3CSJ A;  2JAC A;  2DJ0 A;  5A5K A;  1GLQ A;  2IN3 A;  2GSS A;  2OE1 A;  2DJ2 A;  4L5O A;  2R37 A;  3DVW A;  3G9B A;  4XS4 B;  2C80 A;  2FWF A;  4OFN A;  1THO A;  4K1F A;  3BBY A;  4IJ3 A;  2KP2 A;  4YQU A;  2H6Z A;  5J9C A;  3HKR A;  1ILO A;  3UVH A;  4IS0 A;  3E3E A;  5G31 A;  4IBP A;  4OWY A;  4PXO A;  1DE2 A;  1XOA A;  1SYR A;  1VF4 A;  4G2E A;  2BJX A;  3H8Q A;  3BOA A;  3TOT A;  5F8B A;  4KSM A;  1T4Y A;  3O76 A;  2LJK A;  4NV2 A;  2PPT A;  1SK2 A;  3HD5 A;  1OC9 A;  5C00 A;  5CYY A;  1WOU A;  3HHV A;  1EP8 A;  2FWH A;  1G6Y A;  1ERT A;  2K8V A;  4HZ4 A;  3RPN A;  1AIU A;  1VF1 A;  1M2D A;  2GSR A;  3NZN A;  2LJR A;  2PGT A;  3ERW A;  2RUE A;  3RHC A;  2VCV A;  1QQ2 A;  3LYK A;  2X8G A;  4WXT A;  4F03 A;  1TK0 B;  2O87 A;  5EVO A;  5LCZ A;  3FKF A;  4XCS A;  4N30 A;  3KH9 A;  1EZK A;  1NSW A;  2B5Y A;  1X5D A;  1GSY A;  1X5E A;  2DJ1 A;  1A0F A;  2NPB A;  4ISD A;  3F3Q A;  4GSS A;  1A2M A;  3WGX A;  1SJI A;  4Q5Q A;  1VGL A;  5G5F A;  1U87 A;  1SKW B;  5EY6 A;  1LU4 A;  1T4Z A;  4TR3 A;  2HZF A;  4DSR A;  5D9T A;  1B8X A;  3ZLP A;  3EE2 A;  3ZVJ D;  1R5P A;  2GQM A;  1HNC A;  3UEM A;  1G7E A;  2IME A;  4KX4 A;  2V6O A;  3CMI A;  2G2Q A;  2JZR A;  2RM6 A;  1F3B A;  1M0U A;  5G30 A;  5IPH A;  3VPT A;  2VCZ A;  2H0G A;  4QL9 A;  5DAL B;  5JWR B;  4HI7 A;  2A2R A;  4N0Z A;  3CSI A;  4V2L A;  4KW6 A;  5E59 A;  1K0O A;  3DIE A;  2H72 A;  1DUG A;  2LQO A;  2H6X A;  2OJL A;  5A4W A;  3N5O A;  5GAN D;  1R26 A;  2CX4 A;  2F9S A;  4JZQ A;  4JRR A;  1SKR B;  3GUR A;  4K2D A;  3HY2 A;  3M9K A;  3RBT A;  1GRX A;  3LG6 A;  3VWU A;  5ECK B;  3GX8 A;  2EIO A;  1VRS D;  3MDK A;  5IOW A;  3TB2 A;  4L0W A;  4MJB A;  3APO A;  4D73 B;  4EE0 A;  2NBS A;  4X0X A;  4HDE A;  4YQV A;  2X99 A;  4GSN A;  2R3X A;  3TJG A;  1GTI A;  4PGT A;  5J5N A;  1PX7 A;  1H4O A;  1EV4 A;  2H8L A;  3F0I A;  4EXJ A;  1GNE A;  4WKW A;  12GS A;  3KXO A;  3FR3 A;  1T1V A;  4KA0 A;  1V9W A;  1X0R A;  5G2Z A;  2OBK A;  1U3A A;  4YAV A;  2VAF A;  2HFD A;  1AQV A;  1KEB A;  2B7J A;  3BCK A;  3OR5 A;  4F2I A;  4I5Q A;  1O8W A;  1N8J A;  3EMX A;  2K8S A;  1O6J A;  1W4V A;  2M72 A;  2J23 A;  4OFM A;  4POL A;  3DXB A;  3GUS A;  5IMD A;  3KD0 A;  2LS5 A;  4GF0 A;  2H74 A;  5A4U A;  2HLS A;  4BVX A;  4BPY A;  5D9V A;  1K3Y A;  4KB3 A;  1XVW A;  2P0G A;  1ERW A;  3CRT A;  16GS A;  3L9V A;  4TXO A;  2MMA A;  1LBK A;  2YV9 A;  2HE3 A;  3P90 A;  2LNS A;  4E8E A;  1GNW A;  4KCA A;  22GS A;  4N11 A;  3LXZ A;  3UJ1 A;  5J3R A;  4GQF A;  3F3R A;  1Z7R A;  1M7T A;  4IW9 A;  1ZZY A;  1M9A A;  3FK8 A;  5IO0 A;  4EVM A;  4MF7 A;  1Y25 A;  1W89 A;  5JCU A;  2M80 A;  3US3 A;  5DCH A;  3KH7 A;  2ZUP A;  3TKS C;  1Q4J A;  3D4M A;  1XCC A;  1PKZ A;  2C1Y A;  2GTU A;  1FB6 A;  1BAY A;  2IMK A;  3SWL A;  2P5R A;  4MPF A;  2ALB A;  2B5E A;  5HR2 A;  1SL1 B;  4K7N A;  3TJF A;  4JBB A;  3FR9 A;  1HNB A;  1XWG A;  1TXX A;  2YWM A;  2FA4 A;  2PVQ A;  2O89 A;  2LRN A;  2M46 A;  3MWH A;  3DEX A;  4HQS A;  4HUA A;  2AV4 A;  3FY7 A;  5AIS A;  1DE1 A;  4TR1 A;  3F4T A;  2YCD A;  4DEJ A;  4KUN A;  3J7Y k;  4ILF A;  3UVT A;  1RW1 A;  1GSF A;  1T00 A;  5IOX A;  5GSS A;  1G7O A;  1OYJ A;  2X8H A;  1WPI A;  1PL1 A;  5HR1 A;  3CYN A;  1FAA A;  1JZR A;  3CTG A;  1ERV A;  1OC8 A;  4IQA A;  5GZZ B;  4IJI A;  4ECJ A;  2KHP A;  1R7H A;  2GT6 A;  2LV3 A;  2DLX A;  3KZQ A;  4GST A;  4F0C A;  1QK8 A;  2R5G A;  3UBK A;  3VLN A;  5IIZ A;  3W6G A;  1GWC A;  3ZRE A;  4HEA 2;  3K8N A;  1EP7 A;  3HVS A;  2H70 A;  3EVI A;  2I4A A;  4ZB6 A;  4ZBB A;  2ES7 A;  3TKP A;  2ZCT A;  5CRE A;  2MZC A;  3IE3 A;  4ZL7 A;  2DBC A;  5DQS A;  4CHS A;  2PVO C;  3G7Y A;  3W8S A;  5ABR A;  3F6D A;  4HOJ A;  3M0F A;  3ZIT A;  4HQZ A;  1H75 A;  3E0U A;  1FOV A;  3Q19 A;  1XXU A;  1X9S B;  1J9B A;  4V2M A;  3GYK A;  1THX A;  2F8F A;  5JCW A;  5HFI A;  4GTU A;  3A2W A;  3CBU A;  3HXS A;  1E2Y A;  2DIZ A;  2NTO A;  1MDK A;  3PIN A;  5HQP A;  2ON5 A;  1SK1 A;  2TIR A;  5IMV A;  2KUC A;  1V98 A;  2GZY A;  3J7Y b;  2YZU A;  5COH A;  3HVX A;  2YWO A;  2AHE A;  4MDC A;  4HU7 A;  4MJE A;  4XRD A;  2PWJ A;  2N5B A;  1TI3 A;  1K0B A;  1ZOF A;  3HCZ A;  2IJY A;  5F07 A;  1Z3E A;  4PQ1 A;  3VWW A;  3KTL A;  1BG5 A;  5F0G A;  2H0I A;  2L5O A;  3GKX A;  4KH7 A;  1EGR A;  1PX6 A;  4GXZ A;  1ZMA A;  3GSS A;  2C3Q A;  4J57 E;  4AF2 A;  3TOU A;  5J41 A;  1Z7P A;  3KTB A;  2AJQ B;  2I1U A;  3ZVJ A;  5CRD A;  1S3A A;  1B9X C;  1S3C A;  1GSE A;  4JR6 A;  6GSS A;  3P7X A;  3DRN A;  4NXI A;  3IK7 A;  2EIR A;  5ECQ B;  5HR3 A;  3GMF A;  5CNW A;  1QMV A;  2H1A A;  1FHE A;  5HR0 A;  2AB6 A;  4ULX A;  2XBQ A;  4BL7 A;  1X5C A;  2DIY A;  2H6Y A;  1OVN A;  3AY8 A;  3I69 A;  1EOG A;  2B6M A;  3C71 A;  5ECM B;  1AQX A;  3QAV A;  4JED A;  4XRA A;  1R5A A;  3IK9 A;  5B6N A;  3P8W A;  4TN8 A;  2LNT A;  1UN2 A;  8GSS A;  2V2G A;  5ECH B;  4GCI A;  2E2G A;  1JFU A;  3EU4 A;  3LEF A;  1FW1 A;  2JSY A;  3WGE A;  1BQ7 A;  4MK3 A;  4WR4 A;  2HI7 A;  5B8A A;  2L59 A;  1XPV A;  5CRW A;  5KN1 A;  5D9X A;  2HSY A;  2C0F A;  4OCE A;  5CAX A;  1XWC A;  3DKS A;  3HA9 A;  3R2Q A;  1U3I A;  7GSS A;  3HJM A;  5G1K A;  2HYX A;  3GIX A;  3APQ A;  1AUC A;  2EC4 A;  2OBI A;  3ED3 A;  2V1M A;  1TOF A;  2H73 A;  3O6T A;  4EDZ A;  5DQY A;  3GL5 A;  1N2A A;  3A5W A;  1MDI A;  2C8U A;  2PER A;  1XW6 A;  4XS1 A;  3UOM A;  5IM9 A;  4TXO B;  2H1D A;  4BWS A;  3UMA A;  4QQ7 A;  3VI7 A;  3APS A;  3LYP A;  1GUK A;  2HXK A;  6GSU A;  2FWE A;  1ZGN A;  1T8E B;  2R6K A;  4MPG A;  1IYI A;  1TP9 A;  3WT1 A;  1GSS A;  1SJZ A;  5CRH A;  3LQ7 A;  1X9W B;  1JLW A;  1GTU A;  4K6X A;  4N0V A;  1T7P B;  1K0C A;  1GUH A;  3GKM A;  2G0F A;  2YJH A;  5IMA A;  1YF1 A;  2CZ2 A;  4I97 A;  4LL1 B;  3QAW A;  3A3T A;  4MLY A;  3D6I A;  4RQR A;  1F2E A;  1XFL A;  3ZMK A;  5ECR B;  4IHU A; 
#chains in the Genus database with same CATH topology
 2FHE A;  1K3L A;  3QR6 A;  1ON4 A;  1QXH A;  1X9M B;  3L78 A;  5ECS A;  3NIV A;  2B1K A;  1SKS B;  2PN8 A;  1B4P A;  2YPM A;  4TRX A;  4LMV A;  1FG4 A;  1XBS A;  3O3T A;  4OFT A;  2FWG A;  1YEX A;  3IV4 A;  3VWX A;  4TR0 A;  3QFB C;  3D21 A;  3M9J A;  2WUL A;  4EUY A;  3ZTL A;  5D73 A;  1WJK A;  1ST9 A;  2HRK A;  4FIW A;  4ECI A;  2KP1 A;  1KNG A;  1MEK A;  3NOF A;  2H01 A;  3GH9 A;  5DDL A;  3RHB A;  4EC0 A;  2YZH A;  6GST A;  1TRV A;  3TRQ A;  4ZL8 A;  4G0L A;  4KE3 A;  1O7U A;  4KCE A;  2VUP A;  4PUA A;  1I5G A;  3TRP A;  1AC1 A;  2GT5 A;  2VIM A;  4LLR A;  1SK0 A;  1BYE A;  5DVB A;  4V2N A;  4MZB A;  4POB A;  2JZS A;  2FD3 A;  4FH8 A;  4TOP A;  3EUR A;  5ELA A;  4XS6 A;  5IPG A;  4HZ2 A;  2GQL A;  2DKI A;  2VCW A;  3EYT A;  3FR6 A;  4A5P A;  4Z7X A;  2K6V A;  4EDY A;  2A4H A;  4Z2T A;  5DAK A;  2YWI A;  2HZE A;  4RI7 A;  2OE3 A;  4NMU A;  1VF3 A;  3FYG A;  2GST A;  4CDO A;  4WF5 A;  1SD9 A;  14GS A;  1WWJ A;  5JCG A;  1S3D A;  1NHO A;  4I2T A;  1V40 A;  4K5R A;  3BCI A;  3ZML A;  2VD1 A;  4PNF A;  3IAS 2;  1XZO A;  4RUV A;  2HT9 A;  4X43 A;  1XW5 A;  2O85 A;  1TU7 A;  1GL8 A;  4F9Z A;  1QGV A;  4PX1 A;  3EC3 A;  3LFL A;  1EEM A;  4PUF C;  3ERG A;  1USB A;  1GH2 A;  3RAZ A;  1B4Q A;  5AN1 A;  2O8V B;  2R2J A;  1FVK A;  3KCM A;  4I2U A;  2HRF A;  4DSS B;  4NAX A;  3FEU A;  3KM6 A;  4Q5N A;  1O8X A;  4BWQ A;  3FZ4 A;  2I3Y A;  3GRX A;  2VD0 A;  3DYR A;  5ID2 B;  3N9J A;  3F8U A;  2EIQ A;  3HDC A;  2GSQ A;  1ACV A;  2L5L A;  2REM A;  1QFN A;  2MBT A;  1R4W A;  1HNA A;  4BVY B;  3EIN A;  2QC7 A;  3IC4 A;  2TRX A;  2RII A;  3EPT A;  3KIJ A;  4G9H A;  2C0E A;  4XTS A;  2DMM A;  1A24 A;  1UVZ A;  2LEG A;  5H5R A;  4ML1 A;  1URM A;  3GH6 A;  4F0B A;  2Z9S A;  5A4V A;  3QCP A;  20GS A;  3QMX A;  4O7H A;  4G19 A;  2E7P A;  1C72 A;  2N5F A;  4O32 A;  4P3Y B;  1JZD A;  1OAZ A;  1XIY A;  2IMD A;  4POM A;  4MCU A;  4PQI A;  2MYG A;  4H86 A;  4IGJ A;  4AJ7 A;  3IR4 A;  11GS A;  5G1L A;  2B3S A;  2E2M A;  2NDO A;  4V1A g;  3ZIV A;  1GSU A;  4K8M A;  2JL4 A;  1WRY A;  2CV4 A;  2OE0 A;  3IHQ A;  1EV9 A;  4ML6 A;  3H93 A;  4ZBA A;  4WEY A;  2P31 A;  1UC7 A;  2RM5 A;  5F05 A;  4MZC A;  3WT2 A;  2YWN A;  2DJJ A;  2WGR A;  2B5X A;  3ZL5 A;  5EPF A;  1K0N A;  2OAC A;  1OE8 A;  5F06 A;  4CY8 A;  4Q5F A;  2CT6 A;  3IBH A;  2H1G A;  3GNJ A;  4IKH A;  2QSI A;  4WBR D;  1CQG A;  3GN3 A;  5IMF A;  2YAN A;  2CX3 A;  4OCF A;  3DWV A;  1DSB A;  1WE0 A;  1O73 A;  3C8E A;  4ID0 A;  3W8J A;  3GKN A;  4FYB A;  2GZP A;  1VF2 A;  3TDG A;  4ECB A;  1NM3 A;  5GAP D;  3H1N A;  1GUL A;  2F51 A;  2XPD A;  3HJO A;  1NW2 A;  5ECI B;  3TUE A;  1OC9 B;  4X1U A;  3CTF A;  2HRN A;  4GQC A;  4BA7 A;  1Z9H A;  3C1R A;  2FCH A;  3IOS A;  4OO4 A;  5ENU A;  3I43 A;  4HJM A;  1YKA A;  5FHI A;  2P5Q A;  4KGI A;  1PL2 A;  1MTC A;  3QD9 A;  3M1G A;  3VFI A;  1SL2 B;  2WB9 A;  1XOB A;  3DVX A;  4MA9 A;  3M8N A;  2VCX A;  1EOH A;  4ZB8 A;  5LD0 A;  4MMM A;  1Z6N A;  1AXD A;  3HJP A;  4TXV A;  3GL3 A;  1ZYN A;  2GZZ A;  9GSS A;  2VO4 A;  4G0K A;  3EU3 A;  3FRC A;  6GSV A;  3EWL A;  3PGT A;  2D2Z A;  2K9F A;  2NVL A;  2YJ7 A;  1OKT A;  1GTA A;  1AQW A;  4USS A;  5KN2 A;  2PMT A;  4O92 A;  3MAK A;  2ON7 A;  1A8L A;  2VCQ A;  2L4C A;  2R4V A;  1PN0 A;  2MMZ A;  2XHF A;  2CVB A;  2PUK C;  1GLP A;  4K2X A;  3ZIJ A;  4O5R A;  1SEN A;  2V6K A;  2IMI A;  2R0P A;  3IDV A;  1U88 A;  2VLU A;  3D0Z A;  3F6F A;  2IFQ A;  3TJK A;  3GA4 A;  1K3O A;  1TDI A;  1PGT A;  5D96 A;  2VOC A;  4WR5 A;  3IPZ A;  3ME8 A;  3RPP A;  3LGC A;  4ZIJ A;  4LA1 A;  5DJM A;  1MD3 A;  3GFK A;  4ZXG A;  2VL9 A;  3HZ8 A;  2LKU A;  4K5S A;  2RLI A;  4EIQ A;  2R0C A;  3V1W A;  4O5Q A;  3LJR A;  2BTO T;  4XIH A;  2LRC A;  1OC3 A;  2FY6 A;  3HYP A;  5D9W A;  4LL4 B;  2VL2 A;  4EO3 A;  2E0Q A;  3P2A A;  3EMP A;  1TK5 B;  3ZRD A;  2WDU A;  1PQN A;  4HJ2 A;  2L6C A;  2PBJ A;  1F37 A;  1O85 A;  4IEL A;  5HFK A;  1A0R P;  3TGZ A;  1ABA A;  1PD2 1;  2GQK A;  2IMF A;  19GS A;  5DAK B;  3ME7 A;  2HZE B;  4K9Z A;  4EKZ A;  1HD2 A;  3GV1 A;  2YV7 A;  3FZA A;  4YQM A;  3PR8 A;  4Z2U A;  3UIW A;  3M3M A;  4FYC A;  1AAZ A;  2JAD A;  4RQX A;  3G7J A;  3TCO A;  3D4T A;  3D22 A;  5KN3 A;  4MH2 A;  4POK A;  1TI1 A;  3F9U A;  2YOI A;  2KOK A;  3HZ4 A;  1XW9 A;  3MYD A;  2HNL A;  4MP4 A;  3GTU A;  1XVQ A;  10GS A;  5KOW A;  4IVF A;  4TR4 A;  1EEJ A;  1Z6M A;  1K0A A;  4X4J A;  2AYT A;  2LRT A;  3KP8 A;  1J08 A;  3WGD A;  3VK9 A;  3PH9 A;  3BD2 A;  2GS3 A;  4ACS A;  4MF5 A;  3ZZX A;  2HSH A;  3WYW A;  1B48 A;  1QUW A;  1PN9 A;  3KMO A;  3QOU A;  1CQH A;  2JU5 A;  3F4R A;  2I9H A;  2V32 A;  3H79 A;  2FLS A;  3FW2 A;  4NPB A;  3H4K A;  2YNX A;  3D5J A;  2B1L A;  1SD8 A;  3LSZ A;  4L0U A;  3LW9 A;  1A2J A;  4YAP A;  4G0I A;  5B6M A;  5CO3 A;  1E6B A;  1M2B A;  4MH3 A;  2LTK A;  5FWG A;  3KJY A;  2FNO A;  1AW9 A;  1GSQ A;  3G7I A;  3MNG A;  1TRW A;  1WP0 A;  4J56 E;  2CAI A;  4JE1 A;  5AIV A;  3R3E A;  4FYU A;  2FA8 A;  3QDN A;  4IP6 A;  1RK4 A;  4TR1 B;  2QKE A;  4OD7 A;  2DSA A;  4J2F A;  2CZ3 A;  4RI6 A;  3L0H A;  5GST A;  1GP1 A;  2I81 A;  3UAP A;  17GS A;  1FVJ A;  4WF4 A;  5ECP B;  1M3I A;  5KEJ A;  4Z2R A;  3JCM L;  4ZL9 A;  2YP6 A;  1WMJ A;  5ECN B;  1FB0 A;  2DC5 A;  4K7O A;  5FT3 A;  1BED A;  2B7K A;  1G0T A;  4OMV A;  4NHZ A;  4PQH A;  2MMN A;  3LOR A;  4GWR A;  5JWQ B;  2F3M A;  2CAQ A;  4CW9 A;  2GGT A;  4XS4 A;  4IQ1 A;  2DKH A;  3HVN A;  4I6X A;  5D93 A;  2FGX A;  3ZYW A;  2VLT A;  4GLT A;  4V1A p;  1F6M C;  2J9H A;  2N5A A;  1V58 A;  2IWT A;  2GLR A;  3I9V 2;  4WBJ A;  1I9D A;  3S9F A;  6GSW A;  1OE7 A;  1F3A A;  2H19 A;  4KDU A;  5J4U A;  3CSH A;  1SYX A;  1TKD B;  3LWA A;  3VWV A;  1SL0 B;  2A2S A;  3GST A;  3TJJ A;  3C1S A;  4ZBD A;  4AJ8 A;  4L8E A;  2C4J A;  1TW9 A;  1JHB A;  1A23 A;  4DVC A;  3SBC A;  3KEB A;  3FZ5 A;  2AAW A;  2RUF A;  4GRF A;  3I6A A;  2L57 A;  1IYH A;  2V41 A;  3TKR A;  4ZB9 A;  3CRU A;  3UL3 A;  2R0G A;  5ECO B;  3ZFB A;  3IXR A;  2DJK A;  5B7C A;  2BMX A;  2CQ9 A;  2L4Q A;  3Q74 A;  5IMC A;  1YKC A;  1TTZ A;  2DJ3 A;  4DSQ A;  5IMZ A;  5LNK e;  4NV5 A;  4AJ6 A;  1YJ6 A;  3QPM A;  5H5S A;  2WJU A;  3L9S A;  4OO5 A;  1U6T A;  3QAG A;  4PNG A;  1WIK A;  2IL3 A;  4FQU A;  2PU9 C;  6GSX A;  3GX0 A;  3TKQ A;  1A8Y A;  2C3T A;  2WFC A;  2VCT A;  1PA3 A;  3WD6 A;  2VM2 A;  5C04 A;  2GVP A;  4PTS A;  3A2X A;  3DD3 A;  5DJL A;  1RQM A;  3TRX A;  4Q5R A;  1V57 A;  1PKW A;  4K7I A;  1T3B A;  4TVE A;  2MMO A;  2DML A;  2LQQ A;  1BJX A;  2H0H A;  5JWO B;  1YY7 A;  1PRX A;  4XHM A;  1GUM A;  1GTB A;  5DAL A;  1S3R A;  2JZT A;  2H1B A;  3KP9 A;  2IFQ B;  2LST A;  4MF6 A;  1PSQ A;  4KND A;  4YH2 A;  5J9B A;  3Q6O A;  2O7K A;  3IAM 2;  3FZ9 A;  1UA5 A;  1XWA A;  2H76 A;  1XWK A;  3E9J B;  13GS A;  3U6V A;  5AGY A;  1K0M A;  1GSD A;  4WET A;  1O81 A;  2CA8 A;  4MJC A;  2OKA A;  4AGS A;  3LXT A;  5DCG A;  3PPU A;  4BL7 B;  3DGQ A;  2XC2 A;  3VI5 A;  1YZX A;  6GSY A;  2LUS A;  1KBN A;  5G5E A;  3MSZ A;  2WRT A;  4D73 A;  4ZIL A;  3Q18 A;  1M99 A;  2X64 A;  4EL1 A;  4TKY A;  2IIY A;  1FO5 A;  2GDR A;  5E4W A;  1JZW A;  2QGV A;  2LJA A;  1MD4 A;  1B9Y C;  1LJR A;  1EWX A;  2WZ9 A;  4KDX A;  2K18 A;  4IN0 A;  4K0N A;  4KSO A;  3IRA A;  4MAB A;  2FUG 2;  3TKS A;  2VM1 A;  4JR4 A;  2H66 A;  3TKS E;  1TJD A;  1ZYQ B;  2HRA A;  3KGK A;  5INY A;  1YEP A;  1M9B A;  2AUV A;  1NHY A;  5IQY A;  1ZL9 A;  2XBI A;  18GS A;  2JSZ A;  4HU9 A;  3C7M A;  5B8B A;  3A2V A;  5IO2 A;  4FO5 A;  2OA7 A;  1TRU A;  2ZNM A;  1HQO A;  5ECL B;  3L4N A;  4JU5 A;  3DML A;  3ZFL A;  4N10 A;  1M2A A;  2C0G A;  5D8I A;  3U5R E;  3BJ5 A;  3CXG A;  1G6W A;  4MJA A;  5H5Q A;  1SU9 A;  3GTU B;  3IA1 A;  1TRS A;  5CRG A;  2WS2 A;  2KLX A;  4IP1 A;  1ERU A;  4EF0 A;  3RDW A;  3GHA A;  4I8B A;  2TRC P;  1MDJ A;  2F8A A;  1J0F A;  5DBQ A;  2C3N A;  4DSS A;  4MZW A;  1DBY A;  1A2L A;  2H30 A;  2CVD A;  5HFG A;  4E8H A;  5ID2 A;  5CP1 A;  3L9U A;  2VL2 C;  3F4S A;  4HS1 A;  2XPE A;  4BVY A;  3VPQ A;  1OKD A;  4TW5 A;  4L5L A;  1XG8 A;  3ERF A;  4NHW A;  1JZO A;  2C0D A;  2H71 A;  2VLV A;  1HYU A;  1Y6E A;  3HVV A;  5ELG A;  1F9M A;  2A4V A;  4KDY A;  3VUR A;  4KAE A;  1Z5Y E;  3FHK A;  2X8C A;  2MBS A;  1PMT A;  1Q98 A;  2WCI A;  3TJB A;  1TK8 B;  4NWY A;  3UAR A;  1SJ6 A;  3QFA C;  3ISO A;  4G10 A;  4ECC A;  5KN0 A;  3C73 A;  2L6D A;  3UBL A;  2H75 A;  2VL3 A;  1TU8 A;  5EL8 A;  4KF9 A;  2CVK A;  3GKK A;  1YF0 A;  4K0G A;  1XWB A;  1YDK A;  2IPA A;  1BX9 A;  1JLV A;  1ZYE A;  2OAD A;  4YKF A;  5AIX A;  1YQ1 A;  4QL7 A;  1V2A A;  4EIP A;  1KTE A;  1ZCP A;  3KMN A;  1ML6 A;  4LMW A;  3F63 A;  4F82 A;  4PUR A;  1K0D A;  2A2P A;  2YN1 A;  1EGO A;  5L71 A;  3CSJ A;  2JAC A;  2DJ0 A;  5A5K A;  1GLQ A;  2IN3 A;  2GSS A;  2OE1 A;  2DJ2 A;  4L5O A;  2R37 A;  3DVW A;  3G9B A;  4XS4 B;  2C80 A;  2FWF A;  4OFN A;  1THO A;  4K1F A;  4HSC X;  3BBY A;  4IJ3 A;  2KP2 A;  4YQU A;  2H6Z A;  5J9C A;  3HKR A;  1ILO A;  3UVH A;  4IS0 A;  3E3E A;  5G31 A;  4IBP A;  4OWY A;  4PXO A;  1DE2 A;  1XOA A;  1SYR A;  1VF4 A;  4G2E A;  2BJX A;  3H8Q A;  3BOA A;  3TOT A;  5F8B A;  4KSM A;  1T4Y A;  3O76 A;  2LJK A;  4NV2 A;  2PPT A;  1SK2 A;  3HD5 A;  1OC9 A;  5C00 A;  5CYY A;  1WOU A;  3HHV A;  1EP8 A;  2FWH A;  1G6Y A;  1ERT A;  2K8V A;  4HZ4 A;  3RPN A;  1AIU A;  1VF1 A;  1M2D A;  2GSR A;  3NZN A;  2LJR A;  2PGT A;  3ERW A;  2RUE A;  3RHC A;  2VCV A;  1QQ2 A;  3LYK A;  2X8G A;  4WXT A;  4F03 A;  1TK0 B;  2O87 A;  5EVO A;  5LCZ A;  3FKF A;  4XCS A;  4N30 A;  3KH9 A;  1EZK A;  1NSW A;  2B5Y A;  1X5D A;  1GSY A;  1X5E A;  2DJ1 A;  1A0F A;  2NPB A;  4ISD A;  3F3Q A;  4GSS A;  1A2M A;  3WGX A;  1SJI A;  4Q5Q A;  1VGL A;  5G5F A;  1U87 A;  1SKW B;  5EY6 A;  1LU4 A;  1T4Z A;  4TR3 A;  2HZF A;  4DSR A;  5D9T A;  1B8X A;  3ZLP A;  3EE2 A;  3ZVJ D;  1R5P A;  2GQM A;  1HNC A;  3UEM A;  1G7E A;  2IME A;  4KX4 A;  2V6O A;  3CMI A;  2G2Q A;  2JZR A;  2RM6 A;  1F3B A;  1M0U A;  5G30 A;  5IPH A;  3VPT A;  2VCZ A;  3IHG A;  2H0G A;  4QL9 A;  5DAL B;  5JWR B;  4HI7 A;  2A2R A;  4BIK A;  4N0Z A;  3CSI A;  4V2L A;  4KW6 A;  5E59 A;  1K0O A;  3DIE A;  2H72 A;  1DUG A;  2LQO A;  2H6X A;  2OJL A;  5A4W A;  3N5O A;  5GAN D;  5BMU A;  1R26 A;  2CX4 A;  2F9S A;  4JZQ A;  4JRR A;  1SKR B;  3GUR A;  4K2D A;  3HY2 A;  3M9K A;  3RBT A;  1GRX A;  3LG6 A;  3VWU A;  5ECK B;  3GX8 A;  2EIO A;  1VRS D;  3MDK A;  5IOW A;  3TB2 A;  4L0W A;  4MJB A;  3APO A;  4D73 B;  4EE0 A;  2NBS A;  4X0X A;  4HDE A;  4YQV A;  2X99 A;  4GSN A;  2R3X A;  3TJG A;  1GTI A;  4PGT A;  5J5N A;  1PX7 A;  1H4O A;  3IC8 A;  1EV4 A;  2H8L A;  3F0I A;  4EXJ A;  1GNE A;  4WKW A;  2UZ8 A;  12GS A;  3KXO A;  3FR3 A;  1T1V A;  4KA0 A;  1V9W A;  1X0R A;  5G2Z A;  2OBK A;  1U3A A;  4YAV A;  1M3J A;  2VAF A;  2HFD A;  1AQV A;  1KEB A;  2B7J A;  3BCK A;  3OR5 A;  4F2I A;  4I5Q A;  1O8W A;  1N8J A;  3EMX A;  2K8S A;  1O6J A;  2QA2 A;  1PFO A;  1W4V A;  2M72 A;  2J23 A;  4OFM A;  4POL A;  3DXB A;  3GUS A;  5IMD A;  3KD0 A;  2LS5 A;  4GF0 A;  2H74 A;  5A4U A;  2HLS A;  4BVX A;  4BPY A;  5D9V A;  5KOX A;  1K3Y A;  4KB3 A;  1XVW A;  2P0G A;  1ERW A;  3CRT A;  16GS A;  3L9V A;  4TXO A;  2MMA A;  1LBK A;  2YV9 A;  2HE3 A;  3P90 A;  2LNS A;  4E8E A;  4YKG A;  1GNW A;  4KCA A;  22GS A;  4N11 A;  3LXZ A;  3UJ1 A;  5J3R A;  4GQF A;  3F3R A;  4MNN A;  1Z7R A;  1M7T A;  4IW9 A;  1ZZY A;  1M9A A;  3FK8 A;  2X4A A;  5IO0 A;  4EVM A;  4MF7 A;  1Y25 A;  1W89 A;  5JCU A;  2M80 A;  2HSM A;  3US3 A;  5DCH A;  3KH7 A;  2ZUP A;  3TKS C;  1Q4J A;  3D4M A;  1XCC A;  1PKZ A;  4CY6 A;  2C1Y A;  5BRT A;  2GTU A;  4O5U A;  1FB6 A;  1BAY A;  2IMK A;  3SWL A;  2P5R A;  4MPF A;  2ALB A;  2B5E A;  5HR2 A;  1SL1 B;  4K7N A;  3TJF A;  4JBB A;  3FR9 A;  1HNB A;  1XWG A;  1TXX A;  2YWM A;  2FA4 A;  2PVQ A;  2O89 A;  2LRN A;  2M46 A;  3MWH A;  3DEX A;  4HQS A;  4HUA A;  2AV4 A;  3FY7 A;  5AIS A;  1DE1 A;  4TR1 A;  3F4T A;  2YCD A;  4DEJ A;  4KUN A;  3J7Y k;  4ILF A;  3UVT A;  1RW1 A;  1GSF A;  1T00 A;  5IOX A;  5GSS A;  1ZYP A;  1G7O A;  1OYJ A;  2X8H A;  1WPI A;  1PL1 A;  5HR1 A;  3CYN A;  1FAA A;  1JZR A;  3CTG A;  1ERV A;  1OC8 A;  4IQA A;  5GZZ B;  4IJI A;  4ECJ A;  2KHP A;  1R7H A;  2GT6 A;  2LV3 A;  2DLX A;  3KZQ A;  4GST A;  4F0C A;  1QK8 A;  2R5G A;  3UBK A;  3VLN A;  5IIZ A;  3W6G A;  1GWC A;  3ZRE A;  4HEA 2;  3K8N A;  1EP7 A;  3HVS A;  2H70 A;  3EVI A;  2I4A A;  4ZB6 A;  4ZBB A;  2ES7 A;  3TKP A;  2ZCT A;  5CRE A;  2MZC A;  3IE3 A;  4ZL7 A;  2DBC A;  5DQS A;  4CHS A;  2PVO C;  3G7Y A;  3W8S A;  5ABR A;  3F6D A;  4HOJ A;  3FMW A;  3M0F A;  3ZIT A;  4HQZ A;  1H75 A;  3E0U A;  1FOV A;  3Q19 A;  1XXU A;  1X9S B;  1J9B A;  4V2M A;  3GYK A;  1THX A;  2F8F A;  5JCW A;  5HFI A;  4GTU A;  3A2W A;  3CBU A;  3HXS A;  1E2Y A;  2DIZ A;  2NTO A;  1MDK A;  3PIN A;  5HQP A;  2ON5 A;  1SK1 A;  2TIR A;  5IMV A;  2KUC A;  1V98 A;  2GZY A;  3J7Y b;  2YZU A;  5COH A;  3HVX A;  2YWO A;  2AHE A;  4MDC A;  4HU7 A;  4MJE A;  4XRD A;  2PWJ A;  2N5B A;  1TI3 A;  1K0B A;  1ZOF A;  3HCZ A;  2IJY A;  5F07 A;  1Z3E A;  4PQ1 A;  3VWW A;  3KTL A;  1BG5 A;  5F0G A;  2H0I A;  2L5O A;  3GKX A;  4KH7 A;  1EGR A;  1PX6 A;  4GXZ A;  1ZMA A;  3GSS A;  2C3Q A;  4J57 E;  4AF2 A;  3TOU A;  5J41 A;  1Z7P A;  3KTB A;  2AJQ B;  2I1U A;  3ZVJ A;  5CRD A;  1S3A A;  1B9X C;  1S3C A;  4ICY A;  1GSE A;  4JR6 A;  6GSS A;  3P7X A;  3DRN A;  4NXI A;  3IK7 A;  2EIR A;  5ECQ B;  5HR3 A;  3GMF A;  5CNW A;  1QMV A;  2H1A A;  1FHE A;  5HR0 A;  2AB6 A;  4ULX A;  2XBQ A;  4BL7 A;  1X5C A;  2DIY A;  2H6Y A;  1OVN A;  3AY8 A;  3I69 A;  1EOG A;  2QA1 A;  2B6M A;  3C71 A;  5ECM B;  1AQX A;  3QAV A;  4JED A;  4XRA A;  1R5A A;  3IK9 A;  5B6N A;  3P8W A;  4TN8 A;  2LNT A;  2X49 A;  1UN2 A;  8GSS A;  2V2G A;  5ECH B;  4GCI A;  2E2G A;  1JFU A;  3EU4 A;  3LEF A;  1FW1 A;  2JSY A;  3WGE A;  1BQ7 A;  4MK3 A;  4WR4 A;  2HI7 A;  5B8A A;  2L59 A;  3A5I A;  1XPV A;  5CRW A;  5KN1 A;  5D9X A;  2HSY A;  2C0F A;  4OCE A;  5CAX A;  1XWC A;  3DKS A;  3HA9 A;  3R2Q A;  1U3I A;  7GSS A;  3MIX A;  3HJM A;  5G1K A;  2HYX A;  3GIX A;  3APQ A;  1AUC A;  2EC4 A;  2OBI A;  3ED3 A;  2V1M A;  1TOF A;  2H73 A;  3O6T A;  4EDZ A;  5DQY A;  3GL5 A;  4BVX B;  1N2A A;  3A5W A;  1MDI A;  2C8U A;  2PER A;  1XW6 A;  4XS1 A;  3UOM A;  5IM9 A;  4TXO B;  2H1D A;  4BWS A;  3UMA A;  4QQ7 A;  3VI7 A;  3APS A;  3LYP A;  1GUK A;  2HXK A;  6GSU A;  2FWE A;  1ZGN A;  1T8E B;  2R6K A;  4MPG A;  1IYI A;  1TP9 A;  3WT1 A;  1GSS A;  1SJZ A;  5CRH A;  3LQ7 A;  1X9W B;  1FOH A;  1JLW A;  1GTU A;  4K6X A;  4N0V A;  3CQF A;  1T7P B;  1K0C A;  1GUH A;  3GKM A;  2G0F A;  2YJH A;  5IMA A;  1YF1 A;  2CZ2 A;  4I97 A;  4LL1 B;  3QAW A;  3A3T A;  4MLY A;  3D6I A;  4RQR A;  1F2E A;  1XFL A;  3ZMK A;  5ECR B;  4IHU A; 
#chains in the Genus database with same CATH homology
 2FHE A;  1K3L A;  3QR6 A;  1ON4 A;  1QXH A;  1X9M B;  3L78 A;  5ECS A;  3NIV A;  2B1K A;  1SKS B;  2PN8 A;  1B4P A;  2YPM A;  4TRX A;  4LMV A;  1FG4 A;  1XBS A;  3O3T A;  4OFT A;  2FWG A;  1YEX A;  3IV4 A;  3VWX A;  4TR0 A;  3QFB C;  3D21 A;  3M9J A;  2WUL A;  4EUY A;  3ZTL A;  5D73 A;  1WJK A;  1ST9 A;  2HRK A;  4FIW A;  4ECI A;  2KP1 A;  1KNG A;  1MEK A;  3NOF A;  2H01 A;  3GH9 A;  5DDL A;  3RHB A;  4EC0 A;  2YZH A;  6GST A;  1TRV A;  3TRQ A;  4ZL8 A;  4G0L A;  4KE3 A;  1O7U A;  4KCE A;  2VUP A;  4PUA A;  1I5G A;  3TRP A;  1AC1 A;  2GT5 A;  2VIM A;  4LLR A;  1SK0 A;  1BYE A;  5DVB A;  4V2N A;  4MZB A;  4POB A;  2JZS A;  2FD3 A;  4FH8 A;  4TOP A;  3EUR A;  5ELA A;  4XS6 A;  5IPG A;  4HZ2 A;  2GQL A;  2DKI A;  2VCW A;  3EYT A;  3FR6 A;  4A5P A;  4Z7X A;  2K6V A;  4EDY A;  2A4H A;  4Z2T A;  5DAK A;  2YWI A;  2HZE A;  4RI7 A;  2OE3 A;  4NMU A;  1VF3 A;  3FYG A;  2GST A;  4CDO A;  4WF5 A;  1SD9 A;  14GS A;  1WWJ A;  5JCG A;  1S3D A;  1NHO A;  4I2T A;  1V40 A;  4K5R A;  3BCI A;  3ZML A;  2VD1 A;  4PNF A;  3IAS 2;  1XZO A;  4RUV A;  2HT9 A;  4X43 A;  1XW5 A;  2O85 A;  1TU7 A;  1GL8 A;  4F9Z A;  1QGV A;  4PX1 A;  3EC3 A;  3LFL A;  1EEM A;  4PUF C;  3ERG A;  1USB A;  1GH2 A;  3RAZ A;  1B4Q A;  5AN1 A;  2O8V B;  2R2J A;  1FVK A;  3KCM A;  4I2U A;  2HRF A;  4DSS B;  4NAX A;  3FEU A;  3KM6 A;  4Q5N A;  1O8X A;  4BWQ A;  3FZ4 A;  2I3Y A;  3GRX A;  2VD0 A;  3DYR A;  5ID2 B;  3N9J A;  3F8U A;  2EIQ A;  3HDC A;  2GSQ A;  1ACV A;  2L5L A;  2REM A;  1QFN A;  2MBT A;  1R4W A;  1HNA A;  4BVY B;  3EIN A;  2QC7 A;  3IC4 A;  2TRX A;  2RII A;  3EPT A;  3KIJ A;  4G9H A;  2C0E A;  4XTS A;  2DMM A;  1A24 A;  1UVZ A;  2LEG A;  5H5R A;  4ML1 A;  1URM A;  3GH6 A;  4F0B A;  2Z9S A;  5A4V A;  3QCP A;  20GS A;  3QMX A;  4O7H A;  4G19 A;  2E7P A;  1C72 A;  2N5F A;  4O32 A;  4P3Y B;  1JZD A;  1OAZ A;  1XIY A;  2IMD A;  4POM A;  4MCU A;  4PQI A;  2MYG A;  4H86 A;  4IGJ A;  4AJ7 A;  3IR4 A;  11GS A;  5G1L A;  2B3S A;  2E2M A;  2NDO A;  4V1A g;  3ZIV A;  1GSU A;  4K8M A;  2JL4 A;  1WRY A;  2CV4 A;  2OE0 A;  3IHQ A;  1EV9 A;  4ML6 A;  3H93 A;  4ZBA A;  4WEY A;  2P31 A;  1UC7 A;  2RM5 A;  5F05 A;  4MZC A;  3WT2 A;  2YWN A;  2DJJ A;  2WGR A;  2B5X A;  3ZL5 A;  5EPF A;  1K0N A;  2OAC A;  1OE8 A;  5F06 A;  4CY8 A;  4Q5F A;  2CT6 A;  3IBH A;  2H1G A;  3GNJ A;  4IKH A;  2QSI A;  4WBR D;  1CQG A;  3GN3 A;  5IMF A;  2YAN A;  2CX3 A;  4OCF A;  3DWV A;  1DSB A;  1WE0 A;  1O73 A;  3C8E A;  4ID0 A;  3W8J A;  3GKN A;  4FYB A;  2GZP A;  1VF2 A;  3TDG A;  4ECB A;  1NM3 A;  5GAP D;  3H1N A;  1GUL A;  2F51 A;  2XPD A;  3HJO A;  1NW2 A;  5ECI B;  3TUE A;  1OC9 B;  4X1U A;  3CTF A;  2HRN A;  4GQC A;  4BA7 A;  1Z9H A;  3C1R A;  2FCH A;  3IOS A;  4OO4 A;  5ENU A;  3I43 A;  4HJM A;  1YKA A;  5FHI A;  2P5Q A;  4KGI A;  1PL2 A;  1MTC A;  3QD9 A;  3M1G A;  3VFI A;  1SL2 B;  2WB9 A;  1XOB A;  3DVX A;  4MA9 A;  3M8N A;  2VCX A;  1EOH A;  4ZB8 A;  5LD0 A;  4MMM A;  1Z6N A;  1AXD A;  3HJP A;  4TXV A;  3GL3 A;  1ZYN A;  2GZZ A;  9GSS A;  2VO4 A;  4G0K A;  3EU3 A;  3FRC A;  6GSV A;  3EWL A;  3PGT A;  2D2Z A;  2K9F A;  2NVL A;  2YJ7 A;  1OKT A;  1GTA A;  1AQW A;  4USS A;  5KN2 A;  2PMT A;  4O92 A;  3MAK A;  2ON7 A;  1A8L A;  2VCQ A;  2L4C A;  2R4V A;  1PN0 A;  2MMZ A;  2XHF A;  2CVB A;  2PUK C;  1GLP A;  4K2X A;  3ZIJ A;  4O5R A;  1SEN A;  2V6K A;  2IMI A;  2R0P A;  3IDV A;  1U88 A;  2VLU A;  3D0Z A;  3F6F A;  2IFQ A;  3TJK A;  3GA4 A;  1K3O A;  1TDI A;  1PGT A;  5D96 A;  2VOC A;  4WR5 A;  3IPZ A;  3ME8 A;  3RPP A;  3LGC A;  4ZIJ A;  4LA1 A;  5DJM A;  1MD3 A;  3GFK A;  4ZXG A;  2VL9 A;  3HZ8 A;  2LKU A;  4K5S A;  2RLI A;  4EIQ A;  2R0C A;  3V1W A;  4O5Q A;  3LJR A;  2BTO T;  4XIH A;  2LRC A;  1OC3 A;  2FY6 A;  3HYP A;  5D9W A;  4LL4 B;  2VL2 A;  4EO3 A;  2E0Q A;  3P2A A;  3EMP A;  1TK5 B;  3ZRD A;  2WDU A;  1PQN A;  4HJ2 A;  2L6C A;  2PBJ A;  1F37 A;  1O85 A;  4IEL A;  5HFK A;  1A0R P;  3TGZ A;  1ABA A;  1PD2 1;  2GQK A;  2IMF A;  19GS A;  5DAK B;  3ME7 A;  2HZE B;  4K9Z A;  4EKZ A;  1HD2 A;  3GV1 A;  2YV7 A;  3FZA A;  4YQM A;  3PR8 A;  4Z2U A;  3UIW A;  3M3M A;  4FYC A;  1AAZ A;  2JAD A;  4RQX A;  3G7J A;  3TCO A;  3D4T A;  3D22 A;  5KN3 A;  4MH2 A;  4POK A;  1TI1 A;  3F9U A;  2YOI A;  2KOK A;  3HZ4 A;  1XW9 A;  3MYD A;  2HNL A;  4MP4 A;  3GTU A;  1XVQ A;  10GS A;  5KOW A;  4IVF A;  4TR4 A;  1EEJ A;  1Z6M A;  1K0A A;  4X4J A;  2AYT A;  2LRT A;  3KP8 A;  1J08 A;  3WGD A;  3VK9 A;  3PH9 A;  3BD2 A;  2GS3 A;  4ACS A;  4MF5 A;  3ZZX A;  2HSH A;  3WYW A;  1B48 A;  1QUW A;  1PN9 A;  3KMO A;  3QOU A;  1CQH A;  2JU5 A;  3F4R A;  2I9H A;  2V32 A;  3H79 A;  2FLS A;  3FW2 A;  4NPB A;  3H4K A;  2YNX A;  3D5J A;  2B1L A;  1SD8 A;  3LSZ A;  4L0U A;  3LW9 A;  1A2J A;  4YAP A;  4G0I A;  5B6M A;  5CO3 A;  1E6B A;  1M2B A;  4MH3 A;  2LTK A;  5FWG A;  3KJY A;  2FNO A;  1AW9 A;  1GSQ A;  3G7I A;  3MNG A;  1TRW A;  1WP0 A;  4J56 E;  2CAI A;  4JE1 A;  5AIV A;  3R3E A;  4FYU A;  2FA8 A;  3QDN A;  4IP6 A;  1RK4 A;  4TR1 B;  2QKE A;  4OD7 A;  2DSA A;  4J2F A;  2CZ3 A;  4RI6 A;  3L0H A;  5GST A;  1GP1 A;  2I81 A;  3UAP A;  17GS A;  1FVJ A;  4WF4 A;  5ECP B;  5KEJ A;  4Z2R A;  3JCM L;  4ZL9 A;  2YP6 A;  1WMJ A;  5ECN B;  1FB0 A;  2DC5 A;  4K7O A;  5FT3 A;  1BED A;  2B7K A;  1G0T A;  4OMV A;  4NHZ A;  4PQH A;  2MMN A;  3LOR A;  4GWR A;  5JWQ B;  2F3M A;  2CAQ A;  4CW9 A;  2GGT A;  4XS4 A;  4IQ1 A;  2DKH A;  4I6X A;  5D93 A;  2FGX A;  3ZYW A;  2VLT A;  4GLT A;  4V1A p;  1F6M C;  2J9H A;  2N5A A;  1V58 A;  2IWT A;  2GLR A;  3I9V 2;  4WBJ A;  1I9D A;  3S9F A;  6GSW A;  1OE7 A;  1F3A A;  2H19 A;  4KDU A;  5J4U A;  3CSH A;  1SYX A;  1TKD B;  3LWA A;  3VWV A;  1SL0 B;  2A2S A;  3GST A;  3TJJ A;  3C1S A;  4ZBD A;  4AJ8 A;  4L8E A;  2C4J A;  1TW9 A;  1JHB A;  1A23 A;  4DVC A;  3SBC A;  3KEB A;  3FZ5 A;  2AAW A;  2RUF A;  4GRF A;  3I6A A;  2L57 A;  1IYH A;  2V41 A;  3TKR A;  4ZB9 A;  3CRU A;  3UL3 A;  2R0G A;  5ECO B;  3ZFB A;  3IXR A;  2DJK A;  5B7C A;  2BMX A;  2CQ9 A;  2L4Q A;  3Q74 A;  5IMC A;  1YKC A;  1TTZ A;  2DJ3 A;  4DSQ A;  5IMZ A;  5LNK e;  4NV5 A;  4AJ6 A;  1YJ6 A;  3QPM A;  5H5S A;  2WJU A;  3L9S A;  4OO5 A;  1U6T A;  3QAG A;  4PNG A;  1WIK A;  2IL3 A;  4FQU A;  2PU9 C;  6GSX A;  3GX0 A;  3TKQ A;  1A8Y A;  2C3T A;  2WFC A;  2VCT A;  1PA3 A;  3WD6 A;  2VM2 A;  5C04 A;  2GVP A;  4PTS A;  3A2X A;  3DD3 A;  5DJL A;  1RQM A;  3TRX A;  4Q5R A;  1V57 A;  1PKW A;  4K7I A;  1T3B A;  4TVE A;  2MMO A;  2DML A;  2LQQ A;  1BJX A;  2H0H A;  5JWO B;  1YY7 A;  1PRX A;  4XHM A;  1GUM A;  1GTB A;  5DAL A;  2JZT A;  2H1B A;  3KP9 A;  2IFQ B;  2LST A;  4MF6 A;  1PSQ A;  4KND A;  4YH2 A;  5J9B A;  3Q6O A;  2O7K A;  3IAM 2;  3FZ9 A;  1UA5 A;  1XWA A;  2H76 A;  1XWK A;  3E9J B;  13GS A;  3U6V A;  5AGY A;  1K0M A;  1GSD A;  4WET A;  1O81 A;  2CA8 A;  4MJC A;  2OKA A;  4AGS A;  3LXT A;  5DCG A;  3PPU A;  4BL7 B;  3DGQ A;  2XC2 A;  3VI5 A;  1YZX A;  6GSY A;  2LUS A;  1KBN A;  5G5E A;  3MSZ A;  2WRT A;  4D73 A;  4ZIL A;  3Q18 A;  1M99 A;  2X64 A;  4EL1 A;  4TKY A;  2IIY A;  1FO5 A;  2GDR A;  5E4W A;  1JZW A;  2QGV A;  2LJA A;  1MD4 A;  1B9Y C;  1LJR A;  1EWX A;  2WZ9 A;  4KDX A;  2K18 A;  4IN0 A;  4K0N A;  4KSO A;  3IRA A;  4MAB A;  2FUG 2;  3TKS A;  2VM1 A;  4JR4 A;  2H66 A;  3TKS E;  1TJD A;  1ZYQ B;  2HRA A;  3KGK A;  5INY A;  1YEP A;  1M9B A;  2AUV A;  1NHY A;  5IQY A;  1ZL9 A;  2XBI A;  18GS A;  2JSZ A;  4HU9 A;  3C7M A;  5B8B A;  3A2V A;  5IO2 A;  4FO5 A;  2OA7 A;  1TRU A;  2ZNM A;  1HQO A;  5ECL B;  3L4N A;  4JU5 A;  3DML A;  3ZFL A;  4N10 A;  1M2A A;  2C0G A;  5D8I A;  3U5R E;  3BJ5 A;  3CXG A;  1G6W A;  4MJA A;  5H5Q A;  1SU9 A;  3GTU B;  3IA1 A;  1TRS A;  5CRG A;  2WS2 A;  2KLX A;  4IP1 A;  1ERU A;  4EF0 A;  3RDW A;  3GHA A;  4I8B A;  2TRC P;  1MDJ A;  2F8A A;  1J0F A;  5DBQ A;  2C3N A;  4DSS A;  4MZW A;  1DBY A;  1A2L A;  2H30 A;  2CVD A;  5HFG A;  4E8H A;  5ID2 A;  5CP1 A;  3L9U A;  2VL2 C;  3F4S A;  4HS1 A;  2XPE A;  4BVY A;  3VPQ A;  1OKD A;  4TW5 A;  4L5L A;  3ERF A;  4NHW A;  1JZO A;  2C0D A;  2H71 A;  2VLV A;  1HYU A;  1Y6E A;  3HVV A;  5ELG A;  1F9M A;  2A4V A;  4KDY A;  3VUR A;  4KAE A;  1Z5Y E;  3FHK A;  2X8C A;  2MBS A;  1PMT A;  1Q98 A;  2WCI A;  3TJB A;  1TK8 B;  4NWY A;  3UAR A;  1SJ6 A;  3QFA C;  3ISO A;  4G10 A;  4ECC A;  5KN0 A;  3C73 A;  2L6D A;  3UBL A;  2H75 A;  2VL3 A;  1TU8 A;  5EL8 A;  4KF9 A;  2CVK A;  3GKK A;  1YF0 A;  4K0G A;  1XWB A;  1YDK A;  2IPA A;  1BX9 A;  1JLV A;  1ZYE A;  2OAD A;  4YKF A;  5AIX A;  1YQ1 A;  4QL7 A;  1V2A A;  4EIP A;  1KTE A;  1ZCP A;  3KMN A;  1ML6 A;  4LMW A;  3F63 A;  4F82 A;  4PUR A;  1K0D A;  2A2P A;  2YN1 A;  1EGO A;  5L71 A;  3CSJ A;  2JAC A;  2DJ0 A;  5A5K A;  1GLQ A;  2IN3 A;  2GSS A;  2OE1 A;  2DJ2 A;  4L5O A;  2R37 A;  3DVW A;  3G9B A;  4XS4 B;  2C80 A;  2FWF A;  4OFN A;  1THO A;  4K1F A;  3BBY A;  4IJ3 A;  2KP2 A;  4YQU A;  2H6Z A;  5J9C A;  3HKR A;  1ILO A;  3UVH A;  4IS0 A;  3E3E A;  5G31 A;  4IBP A;  4OWY A;  4PXO A;  1DE2 A;  1XOA A;  1SYR A;  1VF4 A;  4G2E A;  2BJX A;  3H8Q A;  3BOA A;  3TOT A;  5F8B A;  4KSM A;  1T4Y A;  3O76 A;  2LJK A;  4NV2 A;  2PPT A;  1SK2 A;  3HD5 A;  1OC9 A;  5C00 A;  5CYY A;  1WOU A;  3HHV A;  1EP8 A;  2FWH A;  1G6Y A;  1ERT A;  2K8V A;  4HZ4 A;  3RPN A;  1AIU A;  1VF1 A;  1M2D A;  2GSR A;  3NZN A;  2LJR A;  2PGT A;  3ERW A;  2RUE A;  3RHC A;  2VCV A;  1QQ2 A;  3LYK A;  2X8G A;  4WXT A;  4F03 A;  1TK0 B;  2O87 A;  5EVO A;  5LCZ A;  3FKF A;  4XCS A;  4N30 A;  3KH9 A;  1EZK A;  1NSW A;  2B5Y A;  1X5D A;  1GSY A;  1X5E A;  2DJ1 A;  1A0F A;  2NPB A;  4ISD A;  3F3Q A;  4GSS A;  1A2M A;  3WGX A;  1SJI A;  4Q5Q A;  1VGL A;  5G5F A;  1U87 A;  1SKW B;  5EY6 A;  1LU4 A;  1T4Z A;  4TR3 A;  2HZF A;  4DSR A;  5D9T A;  1B8X A;  3ZLP A;  3EE2 A;  3ZVJ D;  1R5P A;  2GQM A;  1HNC A;  3UEM A;  1G7E A;  2IME A;  4KX4 A;  2V6O A;  3CMI A;  2G2Q A;  2JZR A;  2RM6 A;  1F3B A;  1M0U A;  5G30 A;  5IPH A;  3VPT A;  2VCZ A;  3IHG A;  2H0G A;  4QL9 A;  5DAL B;  5JWR B;  4HI7 A;  2A2R A;  4N0Z A;  3CSI A;  4V2L A;  4KW6 A;  5E59 A;  1K0O A;  3DIE A;  2H72 A;  1DUG A;  2LQO A;  2H6X A;  2OJL A;  5A4W A;  3N5O A;  5GAN D;  5BMU A;  1R26 A;  2CX4 A;  2F9S A;  4JZQ A;  4JRR A;  1SKR B;  3GUR A;  4K2D A;  3HY2 A;  3M9K A;  3RBT A;  1GRX A;  3LG6 A;  3VWU A;  5ECK B;  3GX8 A;  2EIO A;  1VRS D;  3MDK A;  5IOW A;  3TB2 A;  4L0W A;  4MJB A;  3APO A;  4D73 B;  4EE0 A;  2NBS A;  4X0X A;  4HDE A;  4YQV A;  2X99 A;  4GSN A;  2R3X A;  3TJG A;  1GTI A;  4PGT A;  5J5N A;  1PX7 A;  1H4O A;  3IC8 A;  1EV4 A;  2H8L A;  3F0I A;  4EXJ A;  1GNE A;  4WKW A;  2UZ8 A;  12GS A;  3KXO A;  3FR3 A;  1T1V A;  4KA0 A;  1V9W A;  1X0R A;  5G2Z A;  2OBK A;  1U3A A;  4YAV A;  2VAF A;  2HFD A;  1AQV A;  1KEB A;  2B7J A;  3BCK A;  3OR5 A;  4F2I A;  4I5Q A;  1O8W A;  1N8J A;  3EMX A;  2K8S A;  1O6J A;  2QA2 A;  1W4V A;  2M72 A;  2J23 A;  4OFM A;  4POL A;  3DXB A;  3GUS A;  5IMD A;  3KD0 A;  2LS5 A;  4GF0 A;  2H74 A;  5A4U A;  2HLS A;  4BVX A;  4BPY A;  5D9V A;  5KOX A;  1K3Y A;  4KB3 A;  1XVW A;  2P0G A;  1ERW A;  3CRT A;  16GS A;  3L9V A;  4TXO A;  2MMA A;  1LBK A;  2YV9 A;  2HE3 A;  3P90 A;  2LNS A;  4E8E A;  4YKG A;  1GNW A;  4KCA A;  22GS A;  4N11 A;  3LXZ A;  3UJ1 A;  5J3R A;  4GQF A;  3F3R A;  4MNN A;  1Z7R A;  1M7T A;  4IW9 A;  1ZZY A;  1M9A A;  3FK8 A;  2X4A A;  5IO0 A;  4EVM A;  4MF7 A;  1Y25 A;  1W89 A;  5JCU A;  2M80 A;  2HSM A;  3US3 A;  5DCH A;  3KH7 A;  2ZUP A;  3TKS C;  1Q4J A;  3D4M A;  1XCC A;  1PKZ A;  4CY6 A;  2C1Y A;  5BRT A;  2GTU A;  4O5U A;  1FB6 A;  1BAY A;  2IMK A;  3SWL A;  2P5R A;  4MPF A;  2ALB A;  2B5E A;  5HR2 A;  1SL1 B;  4K7N A;  3TJF A;  4JBB A;  3FR9 A;  1HNB A;  1XWG A;  1TXX A;  2YWM A;  2FA4 A;  2PVQ A;  2O89 A;  2LRN A;  2M46 A;  3MWH A;  3DEX A;  4HQS A;  4HUA A;  2AV4 A;  3FY7 A;  5AIS A;  1DE1 A;  4TR1 A;  3F4T A;  2YCD A;  4DEJ A;  4KUN A;  3J7Y k;  4ILF A;  3UVT A;  1RW1 A;  1GSF A;  1T00 A;  5IOX A;  5GSS A;  1ZYP A;  1G7O A;  1OYJ A;  2X8H A;  1WPI A;  1PL1 A;  5HR1 A;  3CYN A;  1FAA A;  1JZR A;  3CTG A;  1ERV A;  1OC8 A;  4IQA A;  5GZZ B;  4IJI A;  4ECJ A;  2KHP A;  1R7H A;  2GT6 A;  2LV3 A;  2DLX A;  3KZQ A;  4GST A;  4F0C A;  1QK8 A;  2R5G A;  3UBK A;  3VLN A;  5IIZ A;  3W6G A;  1GWC A;  3ZRE A;  4HEA 2;  3K8N A;  1EP7 A;  3HVS A;  2H70 A;  3EVI A;  2I4A A;  4ZB6 A;  4ZBB A;  2ES7 A;  3TKP A;  2ZCT A;  5CRE A;  2MZC A;  3IE3 A;  4ZL7 A;  2DBC A;  5DQS A;  4CHS A;  2PVO C;  3G7Y A;  3W8S A;  5ABR A;  3F6D A;  4HOJ A;  3FMW A;  3M0F A;  3ZIT A;  4HQZ A;  1H75 A;  3E0U A;  1FOV A;  3Q19 A;  1XXU A;  1X9S B;  1J9B A;  4V2M A;  3GYK A;  1THX A;  2F8F A;  5JCW A;  5HFI A;  4GTU A;  3A2W A;  3CBU A;  3HXS A;  1E2Y A;  2DIZ A;  2NTO A;  1MDK A;  3PIN A;  5HQP A;  2ON5 A;  1SK1 A;  2TIR A;  5IMV A;  2KUC A;  1V98 A;  2GZY A;  3J7Y b;  2YZU A;  5COH A;  3HVX A;  2YWO A;  2AHE A;  4MDC A;  4HU7 A;  4MJE A;  4XRD A;  2PWJ A;  2N5B A;  1TI3 A;  1K0B A;  1ZOF A;  3HCZ A;  2IJY A;  5F07 A;  1Z3E A;  4PQ1 A;  3VWW A;  3KTL A;  1BG5 A;  5F0G A;  2H0I A;  2L5O A;  3GKX A;  4KH7 A;  1EGR A;  1PX6 A;  4GXZ A;  1ZMA A;  3GSS A;  2C3Q A;  4J57 E;  4AF2 A;  3TOU A;  5J41 A;  1Z7P A;  3KTB A;  2AJQ B;  2I1U A;  3ZVJ A;  5CRD A;  1S3A A;  1B9X C;  1S3C A;  4ICY A;  1GSE A;  4JR6 A;  6GSS A;  3P7X A;  3DRN A;  4NXI A;  3IK7 A;  2EIR A;  5ECQ B;  5HR3 A;  3GMF A;  5CNW A;  1QMV A;  2H1A A;  1FHE A;  5HR0 A;  2AB6 A;  4ULX A;  2XBQ A;  4BL7 A;  1X5C A;  2DIY A;  2H6Y A;  1OVN A;  3AY8 A;  3I69 A;  1EOG A;  2QA1 A;  2B6M A;  3C71 A;  5ECM B;  1AQX A;  3QAV A;  4JED A;  4XRA A;  1R5A A;  3IK9 A;  5B6N A;  3P8W A;  4TN8 A;  2LNT A;  2X49 A;  1UN2 A;  8GSS A;  2V2G A;  5ECH B;  4GCI A;  2E2G A;  1JFU A;  3EU4 A;  3LEF A;  1FW1 A;  2JSY A;  3WGE A;  1BQ7 A;  4MK3 A;  4WR4 A;  2HI7 A;  5B8A A;  2L59 A;  3A5I A;  1XPV A;  5CRW A;  5KN1 A;  5D9X A;  2HSY A;  2C0F A;  4OCE A;  5CAX A;  1XWC A;  3DKS A;  3HA9 A;  3R2Q A;  1U3I A;  7GSS A;  3MIX A;  3HJM A;  5G1K A;  2HYX A;  3GIX A;  3APQ A;  1AUC A;  2EC4 A;  2OBI A;  3ED3 A;  2V1M A;  1TOF A;  2H73 A;  3O6T A;  4EDZ A;  5DQY A;  3GL5 A;  4BVX B;  1N2A A;  3A5W A;  1MDI A;  2C8U A;  2PER A;  1XW6 A;  4XS1 A;  3UOM A;  5IM9 A;  4TXO B;  2H1D A;  4BWS A;  3UMA A;  4QQ7 A;  3VI7 A;  3APS A;  3LYP A;  1GUK A;  2HXK A;  6GSU A;  2FWE A;  1ZGN A;  1T8E B;  2R6K A;  4MPG A;  1IYI A;  1TP9 A;  3WT1 A;  1GSS A;  1SJZ A;  5CRH A;  3LQ7 A;  1X9W B;  1FOH A;  1JLW A;  1GTU A;  4K6X A;  4N0V A;  1T7P B;  1K0C A;  1GUH A;  3GKM A;  2G0F A;  2YJH A;  5IMA A;  1YF1 A;  2CZ2 A;  4I97 A;  4LL1 B;  3QAW A;  3A3T A;  4MLY A;  3D6I A;  4RQR A;  1F2E A;  1XFL A;  3ZMK A;  5ECR B;  4IHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...