2EIOA

Design of disulfide-linked thioredoxin dimers and multimers through analysis of crystal contacts
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
b'DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKCFLDANLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin 1
publication title Design of Disulfide-linked Thioredoxin Dimers and Multimers Through Analysis of Crystal Contacts
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 26
structure length 107
sequence length 107
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2eioA00
1B8XA 1F6MC 3Q6OA 5E59A 2C3NA 3IPZA 2HZEA 2LJAA 2HZEB 5JCGA 16GSA 4HDEA 3CSIA 3KMNA 5G5EA 1AXDA 1GUKA 4K7IA 4ILFA 1SL1B 5ECNB 2K8VA 3L9UA 2B1KA 2I9HA 3IAM2 3ZVJD 2OADA 1AUCA 3VWWA 3C7MA 1PKZA 3CRTA 3DMLA 1YKAA 1NHYA 3NOFA 5FHIA 5D9XA 1XBSA 3M1GA 17GSA 1PMTA 5JCUA 1GSSA 3EVIA 1VF1A 1WE0A 2H01A 1A0FA 4EL1A 4K7OA 2I1UA 4JEDA 4K7NA 1TTZA 1A2MA 3ZITA 5GAND 1YKCA 8GSSA 2VD1A 2LNTA 4TR1A 4TR1B 2RUFA 4HI7A 2NPBA 5CO3A 3IV4A 4XHMA 1VRSD 1F9MA 5IO0A 4BVXA 4GCIA 2VLUA 3GKKA 3IBHA 3VWVA 1GWCA 5J5NA 4HJ2A 1YF1A 3CTFA 4X0XA 4J57E 1FHEA 1TRWA 1A8YA 3A3TA 3R2QA 2PN8A 2H1BA 1BYEA 2ZCTA 4KSOA 1YJ6A 1N2AA 2VCWA 1ON4A 9GSSA 5IM9A 1HYUA 2CAIA 2GZPA 4I97A 5CP1A 4AGSA 4JR6A 4QQ7A 5J3RA 3D21A 5ECOB 2N5BA 1RK4A 2A4VA 2RM5A 2FNOA 1SD8A 1H4OA 1TRUA 4MJAA 2LQOA 3HJOA 1FVKA 5C00A 4YQMA 1XWAA 1GP1A 3D22A 3KMOA 2JADA 2RM6A 4EUYA 2VL3A 1ZYQB 4O32A 2O89A 2PUKC 1JZWA 4F0CA 1G6YA 1M2DA 2E7PA 2PBJA 1WJKA 1FW1A 2PVQA 3TOUA 1MD4A 1EEMA 2HLSA 4MJBA 3E9JB 2GQLA 3GYKA 1PRXA 4RUVA 1GUMA 2EC4A 19GSA 1OE7A 2EIOA 1GSFA 2GTUA 4OFNA 1ERUA 3BOAA 2C80A 20GSA 3UOMA 3ED3A 5F06A 2H6YA 2YANA 5AISA 5KN3A 5B6NA 4N10A 2LS5A 3LGCA 1YQ1A 1VGLA 1XW9A 2DJKA 5F05A 2CV4A 5LCZA 4ZBAA 4MJCA 2B3SA 1DBYA 3VK9A 2B5YA 3W6GA 5CRWA 1NHOA 4PX1A 13GSA 3TKQA 2H70A 4TR0A 4L5LA 3VURA 4IP6A 1GTIA 3DGQA 4IW9A 1QFNA 4IHUA 3TDGA 2HI7A 4EVMA 3VPQA 3HHVA 7GSSA 1SYXA 5EL8A 2ZUPA 4G2EA 3LXZA 4TR4A 2MBSA 11GSA 4MJEA 1PD21 3ME8A 1SENA 1ZZYA 4NMUA 2G2QA 3WGXA 4J56E 2RUEA 3KTLA 4ZIJA 1NW2A 1J9BA 1R5PA 3S9FA 4ID0A 3QAWA 1XZOA 5IPHA 3VPTA 4PNGA 5A5KA 2YCDA 5AN1A 2IFQA 4GXZA 3IK7A 4JU5A 2IFQB 1G7OA 2C3TA 3HVVA 2C0GA 1YEXA 2C3QA 2H71A 1WPIA 5CRHA 4G19A 1WP0A 3F8UA 3WGDA 2JSZA 4G9HA 2AUVA 4NV2A 4FH8A 4ACSA 2HSYA 3FZ5A 1A2LA 4N30A 4IELA 2B5XA 5KN2A 3A2WA 3DIEA 4WR5A 2BTOT 4OMVA 3SWLA 1ZYEA 2XBIA 2QC7A 4KNDA 4Q5NA 22GSA 2PWJA 5IIZA 5HFGA 3FK8A 4HOJA 4I6XA 1OC3A 4ECJA 2ZNMA 3HJPA 3M9JA 2L6DA 1TK5B 3G7JA 2V2GA 3IOSA 4V1Ap 4PQIA 3FY7A 2HZFA 2ON5A 4PUFC 4F03A 4TVEA 3CMIA 4ML6A 4PQHA 4RQXA 4ZL8A 4XRAA 1SL2B 5JCWA 1PSQA 4LMVA 1EV9A 4XS6A 2M72A 1YEPA 2I81A 4KCEA 3D0ZA 5ECIB 4XCSA 1IYIA 5IPGA 2H1GA 5IQYA 2IIYA 3KP8A 4KDYA 2VCVA 4MF7A 3KD0A 4LL4B 1XPVA 2VUPA 4LMWA 1RQMA 4MA9A 3F4TA 4PNFA 1TP9A 4GF0A 4HJMA 4NWYA 1R26A 5ECSA 2J9HA 2H30A 2H1AA 5IMFA 5HR3A 4BPYA 5ENUA 2LV3A 2LKUA 5B8BA 1AQWA 3IE3A 1T3BA 3BJ5A 1V40A 4AJ6A 2C0DA 3KH7A 5G1KA 4MABA 1B48A 1UVZA 2FGXA 1QK8A 4ZBBA 1AC1A 1K0CA 1XOBA 3GURA 3F4RA 1AIUA 2OE1A 3UL3A 3ZL5A 3GKXA 1XCCA 2VLTA 5CYYA 1OYJA 2FLSA 4POLA 1MDJA 1UN2A 3TB2A 2CA8A 2AHEA 2GZZA 3VLNA 2MMZA 5D73A 3KGKA 5DJMA 3JCML 3TOTA 2BJXA 2E0QA 3FEUA 3LORA 1EOGA 1XVWA 1WRYA 3A2VA 1QQ2A 1SJ6A 2YJ7A 1ZMAA 1JLWA 5IOXA 1SYRA 4WEYA 1GH2A 2YWNA 3TGZA 1ACVA 2N5FA 4WKWA 1EV4A 1M99A 1W4VA 2HFDA 3I43A 5COHA 3ZTLA 3IR4A 2HYXA 4RI6A 1A23A 4D73A 2H74A 4D73B 4TRXA 4OWYA 1T00A 5ELAA 1K3OA 3KEBA 3FZAA 3HA9A 3RBTA 3EU3A 5JWQB 2VOCA 2WCIA 1QMVA 3F9UA 3FYGA 4ZBDA 3D4TA 2CX3A 2Z9SA 2A2RA 2H0IA 1O8XA 3I69A 4K2DA 2K6VA 1UA5A 2L57A 4Q5QA 4DSSA 4CDOA 4DSSB 4OFTA 2LNSA 4IGJA 2H1DA 4MZCA 4F82A 4OD7A 5GSSA 1XVQA 4L8EA 2NVLA 3GX8A 2CX4A 1ABAA 3EE2A 3HVXA 2GS3A 1OKDA 1YF0A 4GSTA 2LQQA 2GDRA 1S3DA 1O6JA 1PX6A 5G31A 3F6DA 2IMIA 1OKTA 4BWSA 5DJLA 4AF2A 3VWXA 1SJZA 1NSWA 5EY6A 4MH2A 3IA1A 3VI5A 1I5GA 2EIQA 4JZQA 4HUAA 1TOFA 1MEKA 2H66A 3F3QA 3GKMA 3KH9A 1M0UA 3G9BA 5E4WA 2OJLA 4ZB8A 2FA4A 2B5EA 1WWJA 1LU4A 4JBBA 3E0UA 3APOA 3GFKA 2AYTA 1Z6NA 4RQRA 1CQHA 1K0MA 2VO4A 3CTGA 1Z7RA 2PVOC 4K8MA 2MYGA 1A24A 2HXKA 3Q18A 3QFAC 1Y25A 1TRSA 2GGTA 1GSEA 5CAXA 2FWGA 2JU5A 1JHBA 3LG6A 5ID2A 1GNEA 5A4UA 1O7UA 12GSA 1V98A 2YWIA 1TKDB 2YOIA 4OO4A 1B9YC 2K9FA 1Y6EA 1GRXA 2VCQA 4NPBA 4NHZA 1EP7A 1Z6MA 1TW9A 1THOA 3V1WA 3GA4A 2WFCA 4GWRA 3RHBA 1Q4JA 2LJRA 4MF6A 2O85A 3GV1A 3D4MA 3PGTA 1IYHA 1MD3A 3KP9A 1VF3A 3ZMLA 1PL2A 2KHPA 5CREA 3A2XA 4IQAA 1FB6A 4E8HA 1NM3A 2B1LA 5EVOA 3GN3A 3IXRA 2GVPA 3C1RA 5IMCA 2KUCA 3N9JA 4YAVA 3WT2A 4WF5A 2X8CA 4NAXA 3LEFA 2CVBA 2JZSA 2MMOA 3ZREA 1V2AA 3WT1A 2H6ZA 1A0RP 4ZB9A 1BQ7A 3ME7A 2FA8A 2FCHA 4LA1A 1M2AA 2GLRA 2MBTA 3GRXA 4BVYA 1BAYA 5CNWA 2C1YA 1DUGA 3TRPA 4K0NA 1T7PB 3MSZA 4G10A 2WRTA 3VI7A 1VF4A 1G7EA 4L0WA 4V2MA 4TW5A 3L78A 3C8EA 4LL1B 2CZ3A 4O7HA 2B6MA 2YPMA 3TRXA 1USBA 1LBKA 2P31A 3RDWA 3ERWA 4HU9A 5LNKe 1CQGA 3GL3A 3ZVJA 3IRAA 1C72A 1Z5YE 2YV9A 2XHFA 2WULA 2R4VA 4I2UA 2R5GA 3ZYWA 2LEGA 2LTKA 2NTOA 2RLIA 2X8HA 4KUNA 2JSYA 1B9XC 4H86A 5F8BA 4OFMA 2P0GA 2X99A 4MP4A 4N11A 2DIYA 3HD5A 4ZILA 5G5FA 2XBQA 1MTCA 4HZ2A 3KXOA 3I6AA 5L71A 4NXIA 4V2LA 4EXJA 5AIVA 5LD0A 1M9BA 2AB6A 3P2AA 2OE0A 5JWRB 3E3EA 3EYTA 2H8LA 3K8NA 5D96A 3LXTA 2IL3A 1URMA 2NDOA 3H8QA 1MDKA 4JR4A 5ECHB 1EP8A 1BX9A 18GSA 3ZZXA 3UVHA 2CZ2A 4O92A 4WBRD 3ERFA 4QL9A 6GSXA 4MF5A 1ZGNA 2OA7A 3ZFBA 2DJ3A 3ISOA 2K18A 3NIVA 1K3LA 1TI1A 4V1Ag 3L9SA 2OBIA 3C1SA 2GQKA 1X0RA 4IBPA 1SD9A 3HY2A 2R3XA 3ZLPA 4TXOA 2YJHA 2O7KA 5CRDA 4TXOB 2M46A 2DC5A 3IC4A 3BCIA 5FWGA 2FUG2 1O73A 4EKZA 1FB0A 1SL0B 1GNWA 5IMZA 3H1NA 2GT6A 3LYKA 4IJIA 2HRNA 1GTUA 5G30A 1J08A 5KN1A 3EMXA 1JFUA 2LSTA 4L5OA 1XWBA 2F8FA 4PQ1A 5EPFA 4IQ1A 5ECKB 1A2JA 2FY6A 4JE1A 2AV4A 3DD3A 3MWHA 2DLXA 1OC9A 2IMEA 1OC9B 2MMAA 5CRGA 3CSJA 4K9ZA 1X5EA 1XIYA 4O5RA 1AW9A 4EDYA 5B7CA 4GRFA 2LJKA 2FD3A 2GSRA 3M0FA 4HQZA 1VF2A 4Z7XA 4I8BA 1K0AA 3GSTA 2BMXA 2L59A 3RPPA 3F6FA 4YAPA 1GUHA 5J9CA 5DQSA 2DMMA 3H93A 3GHAA 3GIXA 5HFIA 1SKWB 3D6IA 4X43A 3TJKA 2VL2C 4BWQA 3FW2A 2R6KA 2CVDA 3GKNA 2LUSA 3FZ9A 4KW6A 1O8WA 2WS2A 3APSA 1O85A 2H76A 1GSQA 2IWTA 3IDVA 1GTAA 4I2TA 4NV5A 1SK2A 3DRNA 4CHSA 2GSTA 4KB3A 1TDIA 3HXSA 3U6VA 2V6KA 4IJ3A 5IMAA 1XWCA 3KM6A 4WR4A 2GQMA 1M2BA 1T4YA 4MK3A 3PINA 4EO3A 3HZ8A 2PPTA 5INYA 3TKSE 3PH9A 4I5QA 5G1LA 1F2EA 2FHEA 3MNGA 5D8IA 2O8VB 4FYBA 4WF4A 1BG5A 1MDIA 3LYPA 2MZCA 2R2JA 2REMA 4KAEA 1I9DA 1FVJA 2YN1A 2VAFA 5HR2A 4N0ZA 3RHCA 2H72A 3W8SA 1GLPA 1UC7A 5D9VA 1F37A 2PGTA 1K0DA 4MH3A 3TJBA 5H5RA 1U87A 2WJUA 2IMKA 2TRXA 3CYNA 2IMFA 1F3AA 5GSTA 2O87A 3IK9A 2GT5A 1SK1A 1KBNA 1PX7A 3J7Yb 1EWXA 2L6CA 5HFKA 2YWOA 1X5CA 4BL7A 4ULXA 5HR1A 1XW5A 6GSYA 1S3CA 4POBA 3J7Yk 4CW9A 1JLVA 3KIJA 3DWVA 3IHQA 1GSDA 4FIWA 2E2MA 3UJ1A 1X9SB 4GSNA 1GSYA 2LRCA 2FWHA 3LJRA 5DCHA 4KGIA 3GTUA 2JL4A 3GTUB 3HKRA 2L4QA 1E2YA 3CBUA 3HJMA 2TRCP 2L4CA 4TXVA 1WMJA 2K8SA 1TU7A 5AGYA 1TXXA 5KEJA 4MZWA 1ZOFA 4LLRA 2FWFA 2V6OA 4POMA 1U6TA 1YDKA 3DVXA 1R7HA 4AJ8A 1DE1A 5G2ZA 1HD2A 5A4VA 3GSSA 4Q5FA 3AY8A 4KX4A 3UIWA 2QSIA 4J2FA 2AJQB 2C0FA 1ZCPA 3M3MA 3CRUA 1BEDA 2HE3A 5ECLB 3IAS2 5ID2B 4OCEA 1JZOA 3PR8A 3TCOA 4HEA2 3EWLA 5ECRB 2FWEA 3C73A 1M7TA 1U3IA 1PGTA 4MZBA 3DYRA 4GSSA 5DDLA 1WIKA 3P90A 1J0FA 3FRCA 6GSVA 3ZMKA 1WOUA 4XIHA 3CSHA 4EE0A 4N0VA 3NZNA 4X1UA 4E8EA 3O6TA 3GUSA 4XTSA 4AJ7A 1OC8A 3ERGA 3O3TA 2CQ9A 5IMDA 3UVTA 1K0OA 1T4ZA 2DSAA 4KCAA 1KNGA 2H6XA 2TIRA 2VM2A 4K1FA 3BD2A 5B8AA 1XXUA 2VL9A 3LWAA 4XRDA 1B4QA 3TKRA 4XS4A 2L5LA 1AQVA 4XS1A 4XS4B 5DAKA 2F3MA 2E2GA 5DAKB 5B6MA 4ZXGA 3MDKA 2MMNA 3KJYA 3LQ7A 4YH2A 10GSA 2YWMA 1G6WA 3EC3A 4GQCA 1G0TA 2KLXA 2VM1A 3QD9A 1LJRA 6GSWA 5ECMB 4PUAA 4WXTA 4TN8A 3Q74A 3QAVA 2H19A 2YNXA 1AAZA 1TRVA 2JZRA 2VCXA 4KH7A 1KEBA 1OAZA 3DXBA 1X9MB 2ES7A 3GL5A 2OKAA 4JRRA 1SKSB 1N8JA 3FR9A 4ECBA 3EURA 3VWUA 1SK0A 3P8WA 3QPMA 2DMLA 3DKSA 1HNCA 3QDNA 4FYCA 3P7XA 2F51A 2CAQA 3TJFA 4BA7A 4NHWA 4YQVA 1XOAA 4TR3A 3L4NA 5H5SA 3EMPA 3QFBC 1V57A 2CVKA 4P3YB 3GH9A 2WZ9A 1T8EB 2YZHA 4IVFA 2X64A 4IKHA 3U5RE 2NBSA 3ZRDA 2OBKA 1ERVA 4GQFA 4ECIA 2GSQA 3EU4A 2PMTA 3VFIA 3A5WA 2IN3A 2WGRA 1TJDA 4V2NA 3DVWA 2JZTA 5J9BA 1X5DA 3H79A 2KP2A 3FR6A 2VL2A 4OO5A 2LRNA 4EDZA 3GX0A 3FR3A 4IN0A 2B7KA 3D5JA 2JACA 2H0GA 2C4JA 4DSQA 4TKYA 3UBLA 5F07A 4ZB6A 3F4SA 5J4UA 4KDUA 1GL8A 1FG4A 2H73A 3HVSA 4F9ZA 1HNAA 2DJ2A 2X8GA 5DQYA 3F0IA 1U3AA 1PQNA 4KE3A 1SU9A 4IP1A 2EIRA 1Z7PA 1M9AA 3QAGA 4FYUA 3L0HA 1ERTA 4IS0A 2R37A 2F8AA 3UAPA 2IMDA 4HU7A 1YZXA 5DBQA 4MLYA 1QXHA 3OR5A 3ZIVA 2F9SA 3KTBA 5GAPD 1QUWA 3LSZA 1XW6A 3TKSA 1ML6A 2A2SA 1OVNA 4F0BA 5KN0A 4MMMA 1AQXA 1K0NA 5DVBA 5D9WA 3M9KA 6GSTA 4HQSA 4K0GA 3M8NA 1ERWA 4PGTA 2AAWA 1V58A 1EOHA 4HS1A 1GSUA 4MCUA 2HT9A 5A4WA 2N5AA 4WETA 2CT6A 2PU9C 2WDUA 3UMAA 3BBYA 1PN9A 3FZ4A 2L5OA 3H4KA 3WGEA 5ECPB 3UARA 3MAKA 2OE3A 2XPDA 4KA0A 3EINA 1JZRA 2RIIA 3WD6A 1F3BA 3QOUA 1R4WA 1K3YA 2VCTA 3C71A 3L9VA 3WYWA 1PKWA 3KZQA 1FAAA 5H5QA 2V1MA 2P5QA 5ECQB 4Q5RA 3GH6A 1Z3EA 2HRFA 3HZ4A 4MPFA 1OE8A 5JWOB 1YY7A 3DEXA 3F63A 3UBKA 4HZ4A 1FO5A 1TI3A 1EZKA 3BCKA 4MDCA 5FT3A 3Q19A 2ALBA 2P5RA 2KOKA 4FO5A 1Q98A 2V41A 1JZDA 2QGVA 1XWGA 2DJ1A 1THXA 4POKA 3CXGA 2HNLA 1H75A 2WB9A 3W8JA 4DEJA 4KDXA 2DJ0A 6GSSA 4WBJA 3UEMA 2KP1A 3F3RA 4PXOA 2I4AA 1KTEA 1SKRB 2YP6A 6GSUA 14GSA 4ZL9A 4ML1A 5DCGA 1TU8A 2G0FA 3TUEA 3N5OA 5GZZB 2VCZA 2VLVA 4EF0A 3GMFA 2J23A 5D93A 3HYPA 2H75A 1U88A 2ON7A 3TJJA 3O76A 4RI7A 4OCFA 2VIMA 3QMXA 1R5AA 2GSSA 3QR6A 1T1VA 1PA3A 2C0EA 4KSMA 3TRQA 3ZIJA 5IO2A 5D9TA 1K0BA 3G7YA 2D2ZA 5C04A 4ECCA 3FHKA 3SBCA 3TKSC 1EEJA 4DVCA 5F0GA 1HNBA 2M80A 1B4PA 1TK8B 1S3AA 3US3A 2DJJA 1GLQA 1PL1A 3HCZA 3QCPA 3HDCA 4GLTA 3APQA 1DE2A 4MPGA 2IPAA 1HQOA 3ZFLA 1SJIA 4DSRA 4ISDA 2C8UA 2YZUA 1QGVA 2DBCA 2DIZA 2V32A 3GNJA 2VD0A 2B7JA 1XWKA 1BJXA 4QL7A 1FOVA 2PERA 5HQPA 4GTUA 4YQUA 5ELGA 4PURA 1RW1A 2HSHA 2XC2A 1DSBA 1O81A 1ZL9A 3RAZA 3LFLA 4EC0A 5HR0A 3KCMA 1ILOA 5DALA 3I9V2 5DALB 4ZL7A 5J41A 4K6XA 5ABRA 2QKEA 5AIXA 1Z9HA 1TK0B 1EGRA 2LRTA 2I3YA 4L0UA 3TKPA 2OACA 2YV7A 1EGOA 1E6BA 3G7IA 2IJYA 2H0HA 4TOPA 1ST9A 1W89A 3FKFA 2GZYA 5IMVA 1A8LA 4F2IA 1X9WB 1GULA 1V9WA 3RPNA 3TJGA 5IOWA 2XPEA 1GTBA 1XFLA
chains in the Genus database with same CATH superfamily
1B8XA 1F6MC 3Q6OA 5E59A 3LW9A 2C3NA 3IPZA 2HZEA 2LJAA 2HZEB 5JCGA 16GSA 4HDEA 3CSIA 3KMNA 5G5EA 1AXDA 1GUKA 4K7IA 4ILFA 1SL1B 5ECNB 2K8VA 3L9UA 2B1KA 2I9HA 3IAM2 3ZVJD 2OADA 1AUCA 3VWWA 3C7MA 1PKZA 3CRTA 3DMLA 1YKAA 1NHYA 3NOFA 5FHIA 5D9XA 1XBSA 3M1GA 17GSA 1PMTA 5JCUA 1GSSA 3EVIA 1VF1A 1WE0A 2H01A 1A0FA 4EL1A 4K7OA 2I1UA 4JEDA 4K7NA 1TTZA 1A2MA 3ZITA 5GAND 1YKCA 8GSSA 2VD1A 2LNTA 4TR1A 4TR1B 2RUFA 4YKFA 4HI7A 2NPBA 5CO3A 3IV4A 4XHMA 1VRSD 1F9MA 5IO0A 4BVXA 4GCIA 2VLUA 3GKKA 3IBHA 4K5SA 3VWVA 1GWCA 5J5NA 4HJ2A 1YF1A 3CTFA 4X0XA 4J57E 1FHEA 1FOHA 1TRWA 1A8YA 3A3TA 3R2QA 2PN8A 2H1BA 1BYEA 2ZCTA 4KSOA 1YJ6A 1N2AA 2VCWA 1ON4A 9GSSA 5IM9A 1HYUA 2CAIA 2GZPA 4I97A 5CP1A 4AGSA 4JR6A 4QQ7A 5J3RA 3D21A 5ECOB 2N5BA 1RK4A 2A4VA 2RM5A 2FNOA 1SD8A 1H4OA 1TRUA 4MJAA 2LQOA 3HJOA 1FVKA 5C00A 4YQMA 1XWAA 1GP1A 3D22A 3KMOA 2JADA 2RM6A 4EUYA 2VL3A 1ZYQB 4O32A 2O89A 2PUKC 1JZWA 4F0CA 1G6YA 1M2DA 2E7PA 2PBJA 4X4JA 2R0CA 4ICYA 1WJKA 1FW1A 2PVQA 3TOUA 1MD4A 1EEMA 2HLSA 4MJBA 3E9JB 2GQLA 3GYKA 1PRXA 2X4AA 4RUVA 1GUMA 2EC4A 19GSA 1OE7A 2EIOA 1GSFA 2GTUA 4OFNA 1ERUA 3BOAA 2C80A 20GSA 3UOMA 3ED3A 5F06A 2H6YA 2YANA 5AISA 5KN3A 5B6NA 4N10A 4K2XA 2LS5A 3LGCA 1YQ1A 1XG8A 1VGLA 1XW9A 2DJKA 5F05A 2CV4A 5LCZA 4ZBAA 4MJCA 2B3SA 1DBYA 3VK9A 2B5YA 3W6GA 5CRWA 1NHOA 4PX1A 13GSA 3TKQA 2H70A 4TR0A 4L5LA 3VURA 4IP6A 3MIXA 1GTIA 3DGQA 4IW9A 1QFNA 4IHUA 3TDGA 2HI7A 4HSCX 4EVMA 3VPQA 3HHVA 7GSSA 1SYXA 5EL8A 2ZUPA 4G2EA 3LXZA 4TR4A 2MBSA 11GSA 4Z2UA 4MJEA 1PD21 5KOXA 4MNNA 3ME8A 1SENA 1ZZYA 4NMUA 2G2QA 3WGXA 4J56E 2RUEA 3KTLA 4ZIJA 1NW2A 1J9BA 1R5PA 3S9FA 4ID0A 3QAWA 1XZOA 5IPHA 3VPTA 4PNGA 5A5KA 2YCDA 5AN1A 2IFQA 4GXZA 3IK7A 4JU5A 2IFQB 1G7OA 2C3TA 3HVVA 2C0GA 1YEXA 2C3QA 2H71A 1WPIA 5CRHA 4G19A 1WP0A 3F8UA 3WGDA 2JSZA 4G9HA 2AUVA 4NV2A 4FH8A 4ACSA 2HSYA 3FZ5A 1A2LA 4N30A 4IELA 2B5XA 5KN2A 3A2WA 3DIEA 4WR5A 2BTOT 1S3RA 4OMVA 3SWLA 1ZYEA 2XBIA 2QC7A 4KNDA 4Q5NA 22GSA 2PWJA 5IIZA 5HFGA 3FK8A 4HOJA 4I6XA 1OC3A 4ECJA 2ZNMA 3HJPA 3M9JA 2L6DA 1TK5B 3G7JA 2V2GA 3IOSA 4V1Ap 4PQIA 3EPTA 3FY7A 2HZFA 2ON5A 4PUFC 2UZ8A 4F03A 4TVEA 3CMIA 4ML6A 4PQHA 4RQXA 4ZL8A 4XRAA 1SL2B 5JCWA 1PSQA 4LMVA 1EV9A 4XS6A 2M72A 1YEPA 2I81A 4KCEA 3D0ZA 5ECIB 4XCSA 1IYIA 5IPGA 2H1GA 3HVNA 5IQYA 2IIYA 3KP8A 4KDYA 2VCVA 4MF7A 3KD0A 4BIKA 4LL4B 1XPVA 2VUPA 4LMWA 1RQMA 4MA9A 3F4TA 4PNFA 1TP9A 4GF0A 4HJMA 4NWYA 1R26A 5ECSA 2J9HA 1ZYNA 2H30A 2H1AA 5IMFA 5HR3A 2A2PA 4BPYA 5ENUA 2LV3A 2LKUA 5B8BA 1AQWA 3IE3A 1T3BA 3BJ5A 1V40A 4AJ6A 2C0DA 3KH7A 5G1KA 4MABA 1B48A 1UVZA 2FGXA 1QK8A 4ZBBA 4O5QA 1AC1A 1K0CA 1XOBA 4USSA 3GURA 3F4RA 1AIUA 2OE1A 3UL3A 3ZL5A 3GKXA 1XCCA 2VLTA 5CYYA 1OYJA 2FLSA 4POLA 1MDJA 1UN2A 3TB2A 2CA8A 2AHEA 2GZZA 3VLNA 2MMZA 5D73A 3KGKA 5DJMA 3JCML 3TOTA 2BJXA 2E0QA 3FEUA 3LORA 1EOGA 1XVWA 1WRYA 3A2VA 1QQ2A 1SJ6A 2YJ7A 1ZMAA 1JLWA 5IOXA 1SYRA 4WEYA 1GH2A 2YWNA 3TGZA 1ACVA 2N5FA 4WKWA 1EV4A 1M99A 1W4VA 2HFDA 3I43A 5COHA 3ZTLA 3IR4A 2HYXA 4RI6A 1A23A 4D73A 2H74A 4D73B 4TRXA 4OWYA 1T00A 5ELAA 1K3OA 3KEBA 3FZAA 3HA9A 3RBTA 3EU3A 5JWQB 2VOCA 2WCIA 1QMVA 3F9UA 3FYGA 4ZBDA 3D4TA 2CX3A 2Z9SA 2A2RA 2H0IA 1O8XA 3I69A 4K2DA 2K6VA 1UA5A 2L57A 4Q5QA 4DSSA 4CDOA 4DSSB 4OFTA 2LNSA 4IGJA 2H1DA 4MZCA 4F82A 4OD7A 1PN0A 5GSSA 1XVQA 4L8EA 2NVLA 3GX8A 2CX4A 1ABAA 3EE2A 3HVXA 2GS3A 1OKDA 1YF0A 4GSTA 2LQQA 2GDRA 1S3DA 1O6JA 1PX6A 5G31A 3F6DA 2IMIA 1OKTA 4BWSA 3R3EA 5DJLA 4AF2A 3VWXA 1SJZA 1NSWA 4MH2A 3IA1A 5EY6A 3VI5A 1I5GA 2EIQA 4JZQA 4HUAA 1TOFA 1MEKA 2H66A 3F3QA 3GKMA 3KH9A 1M0UA 3G9BA 5E4WA 2OJLA 4ZB8A 2FA4A 2B5EA 1WWJA 1LU4A 4JBBA 3E0UA 3APOA 3GFKA 4CY8A 2AYTA 1Z6NA 4RQRA 1CQHA 1K0MA 2VO4A 3CTGA 1Z7RA 2PVOC 4K8MA 2MYGA 1A24A 2HXKA 3Q18A 3QFAC 1Y25A 1TRSA 2GGTA 1GSEA 5CAXA 2FWGA 2JU5A 1JHBA 3LG6A 5ID2A 1GNEA 5A4UA 1O7UA 12GSA 1V98A 2YWIA 1TKDB 2YOIA 4OO4A 1B9YC 2K9FA 4BVXB 1Y6EA 1GRXA 2VCQA 4NPBA 4NHZA 1EP7A 1Z6MA 1TW9A 1THOA 3V1WA 3GA4A 2WFCA 4GWRA 3RHBA 1Q4JA 2LJRA 4MF6A 2O85A 3GV1A 3D4MA 3PGTA 1IYHA 1MD3A 3KP9A 1VF3A 3ZMLA 1PL2A 2KHPA 5CREA 3A2XA 4IQAA 1FB6A 4E8HA 1NM3A 2B1LA 2HRKA 5EVOA 3GN3A 3IXRA 2GVPA 3C1RA 5IMCA 2KUCA 3N9JA 4YAVA 3WT2A 4WF5A 2X8CA 4NAXA 3LEFA 2CVBA 2JZSA 2MMOA 3ZREA 1V2AA 4G0LA 3WT1A 2H6ZA 1A0RP 4ZB9A 1BQ7A 3ME7A 2FA8A 2FCHA 4LA1A 1M2AA 2GLRA 2HSMA 2MBTA 3GRXA 4BVYA 2A4HA 4BVYB 1BAYA 5CNWA 2C1YA 1DUGA 3TRPA 4K0NA 1T7PB 3MSZA 4G10A 2WRTA 3VI7A 1VF4A 1G7EA 4L0WA 4V2MA 4TW5A 3L78A 3C8EA 4LL1B 2CZ3A 4O7HA 2B6MA 2YPMA 3TRXA 1USBA 1LBKA 2X49A 2P31A 3RDWA 3ERWA 4HU9A 5LNKe 1CQGA 3GL3A 3ZVJA 3IRAA 1C72A 1Z5YE 3IC8A 2YV9A 2XHFA 2WULA 2R4VA 4I2UA 2R5GA 3ZYWA 2LEGA 2HRAA 2LTKA 2NTOA 3PPUA 2RLIA 2X8HA 4KUNA 2JSYA 1B9XC 4H86A 5F8BA 4OFMA 2P0GA 2X99A 4MP4A 4N11A 2DIYA 3HD5A 4ZILA 5G5FA 2XBQA 1MTCA 4HZ2A 3KXOA 3I6AA 5L71A 4NXIA 4V2LA 4EXJA 5AIVA 5LD0A 1M9BA 2AB6A 3P2AA 2OE0A 5JWRB 3E3EA 3EYTA 2H8LA 3K8NA 5D96A 3LXTA 2IL3A 1URMA 2NDOA 3H8QA 1MDKA 4JR4A 5ECHB 1EP8A 1BX9A 18GSA 3ZZXA 3UVHA 2CZ2A 4O92A 4WBRD 2R0PA 3ERFA 3IHGA 4QL9A 6GSXA 4MF5A 1ZGNA 2OA7A 3ZFBA 2DJ3A 3ISOA 2K18A 3NIVA 1K3LA 1TI1A 4V1Ag 3L9SA 2OBIA 3C1SA 2GQKA 1X0RA 4IBPA 1SD9A 3HY2A 2R3XA 3ZLPA 4TXOA 2YJHA 2O7KA 5CRDA 4TXOB 2M46A 2DC5A 3IC4A 3BCIA 5FWGA 2FUG2 1O73A 4EKZA 1FB0A 1SL0B 1GNWA 5IMZA 3H1NA 2GT6A 3LYKA 4IJIA 2HRNA 1GTUA 5G30A 4Z2TA 1J08A 4G0IA 5KN1A 3EMXA 1JFUA 2LSTA 4L5OA 1XWBA 2F8FA 4PQ1A 5EPFA 4IQ1A 5ECKB 1A2JA 2FY6A 4JE1A 2AV4A 3DD3A 3MWHA 2DLXA 1OC9A 2IMEA 1OC9B 2MMAA 5CRGA 3CSJA 4K9ZA 1X5EA 1XIYA 4O5RA 1AW9A 4EDYA 5B7CA 4GRFA 2LJKA 2FD3A 2GSRA 3M0FA 4HQZA 1VF2A 4Z7XA 4I8BA 1K0AA 3GSTA 2BMXA 2L59A 3RPPA 2DKHA 3F6FA 4YAPA 1GUHA 5J9CA 5DQSA 2DMMA 4CY6A 3H93A 3GHAA 3GIXA 5HFIA 1SKWB 5KOWA 3D6IA 4X43A 3TJKA 2VL2C 4BWQA 3FW2A 2R6KA 2CVDA 3GKNA 2R0GA 2LUSA 3FZ9A 4KW6A 1O8WA 2WS2A 3APSA 1O85A 2H76A 1GSQA 2IWTA 3IDVA 1GTAA 4I2TA 4Z2RA 4NV5A 1SK2A 3DRNA 4CHSA 2GSTA 4KB3A 1TDIA 3HXSA 3U6VA 2V6KA 4IJ3A 5IMAA 1XWCA 3KM6A 4WR4A 2GQMA 4FQUA 1M2BA 1T4YA 4MK3A 3PINA 4EO3A 3HZ8A 2PPTA 5INYA 3TKSE 3PH9A 4I5QA 5G1LA 1F2EA 2FHEA 3MNGA 5D8IA 2O8VB 4FYBA 4WF4A 1BG5A 1MDIA 3LYPA 2MZCA 2R2JA 2REMA 4KAEA 1I9DA 1FVJA 2YN1A 2VAFA 5HR2A 4N0ZA 3RHCA 2H72A 3W8SA 1GLPA 1UC7A 5D9VA 1F37A 2PGTA 1K0DA 1M3JA 4MH3A 3TJBA 5H5RA 1U87A 2WJUA 2IMKA 2TRXA 3CYNA 2IMFA 1F3AA 5GSTA 2O87A 3IK9A 2GT5A 1SK1A 1KBNA 1PX7A 3J7Yb 1EWXA 4EIQA 2L6CA 5HFKA 2YWOA 1X5CA 4BL7A 1M3IA 4ULXA 5HR1A 4BL7B 1XW5A 6GSYA 1S3CA 4POBA 3J7Yk 4CW9A 1JLVA 3KIJA 3DWVA 3IHQA 1GSDA 4FIWA 2E2MA 3UJ1A 1X9SB 4GSNA 1GSYA 2LRCA 2FWHA 3LJRA 5DCHA 4KGIA 4G0KA 3GTUA 2JL4A 3GTUB 3HKRA 2L4QA 1E2YA 3CBUA 3HJMA 2TRCP 2L4CA 4TXVA 1WMJA 2K8SA 1TU7A 5AGYA 1TXXA 5KEJA 4MZWA 1ZOFA 4LLRA 2FWFA 2V6OA 4POMA 1U6TA 1YDKA 3DVXA 1PFOA 1R7HA 4AJ8A 1DE1A 5G2ZA 1HD2A 5A4VA 5BMUA 3GSSA 4Q5FA 3AY8A 4KX4A 3UIWA 2QSIA 4J2FA 2AJQB 2C0FA 1ZCPA 3A5IA 3M3MA 3CRUA 1BEDA 2HE3A 5ECLB 3IAS2 5ID2B 4OCEA 1JZOA 3PR8A 3TCOA 4A5PA 4HEA2 3EWLA 5ECRB 2FWEA 3C73A 1M7TA 1U3IA 1PGTA 4MZBA 3DYRA 4GSSA 5DDLA 1WIKA 3P90A 1J0FA 3FRCA 6GSVA 3ZMKA 1WOUA 4XIHA 3CSHA 4EE0A 4N0VA 3NZNA 4X1UA 4E8EA 3O6TA 3GUSA 4XTSA 4AJ7A 1OC8A 3ERGA 3O3TA 2QA1A 2CQ9A 5IMDA 3UVTA 1K0OA 1T4ZA 2DSAA 4KCAA 1KNGA 2H6XA 2TIRA 2VM2A 4K1FA 3BD2A 5B8AA 1XXUA 2VL9A 3LWAA 4XRDA 1B4QA 3TKRA 4XS4A 2L5LA 1AQVA 3FMWA 4XS1A 4XS4B 5DAKA 2F3MA 2E2GA 5DAKB 5B6MA 4ZXGA 3MDKA 2MMNA 3KJYA 3LQ7A 4KF9A 4YH2A 10GSA 2YWMA 1G6WA 3EC3A 4GQCA 1G0TA 2KLXA 2VM1A 3QD9A 1LJRA 6GSWA 5ECMB 4PUAA 4WXTA 4TN8A 3Q74A 3QAVA 2H19A 2YNXA 1AAZA 1TRVA 2JZRA 2VCXA 4KH7A 1KEBA 1OAZA 3DXBA 1X9MB 2ES7A 3GL5A 2OKAA 4JRRA 1SKSB 1N8JA 3FR9A 4ECBA 3EURA 3VWUA 1SK0A 3P8WA 3QPMA 2DMLA 3DKSA 1HNCA 3QDNA 4FYCA 3P7XA 2F51A 2CAQA 3TJFA 4BA7A 4NHWA 4YQVA 1ZYPA 1XOAA 4TR3A 3L4NA 5H5SA 3EMPA 3QFBC 1V57A 2CVKA 4P3YB 3GH9A 2WZ9A 1T8EB 2YZHA 4IVFA 2X64A 4IKHA 3U5RE 2NBSA 3ZRDA 2OBKA 1ERVA 4GQFA 4ECIA 2GSQA 3EU4A 2PMTA 3VFIA 3A5WA 2IN3A 2WGRA 1TJDA 4V2NA 3DVWA 2JZTA 5J9BA 1X5DA 3H79A 2KP2A 3FR6A 2VL2A 4OO5A 2LRNA 4EDZA 3GX0A 3FR3A 4IN0A 2B7KA 3D5JA 2JACA 2H0GA 2C4JA 4DSQA 4TKYA 3UBLA 5F07A 4ZB6A 3F4SA 5J4UA 4KDUA 1GL8A 1FG4A 2H73A 3HVSA 4F9ZA 1HNAA 2DJ2A 2X8GA 5DQYA 3F0IA 1U3AA 1PQNA 4KE3A 1SU9A 4IP1A 2EIRA 1Z7PA 1M9AA 3QAGA 4FYUA 4PTSA 3L0HA 1ERTA 4IS0A 2R37A 2F8AA 3UAPA 2IMDA 4HU7A 1YZXA 5DBQA 4MLYA 1QXHA 3OR5A 4K5RA 3ZIVA 2F9SA 3KTBA 5GAPD 1QUWA 3LSZA 1XW6A 3TKSA 1ML6A 2A2SA 1OVNA 4F0BA 5KN0A 4MMMA 1AQXA 1K0NA 5DVBA 5D9WA 3M9KA 6GSTA 4HQSA 4K0GA 3M8NA 1ERWA 4PGTA 2AAWA 1V58A 1EOHA 4HS1A 1GSUA 4MCUA 2HT9A 5A4WA 2N5AA 4WETA 2CT6A 2PU9C 2WDUA 3UMAA 3BBYA 1PN9A 3FZ4A 2L5OA 3H4KA 3WGEA 5ECPB 3UARA 3MAKA 2OE3A 2XPDA 4KA0A 3EINA 1JZRA 2RIIA 3WD6A 1F3BA 3QOUA 1R4WA 1K3YA 2VCTA 3C71A 3L9VA 3WYWA 1PKWA 3KZQA 1FAAA 5H5QA 2V1MA 2P5QA 5ECQB 4Q5RA 3GH6A 1Z3EA 2HRFA 3HZ4A 4MPFA 1OE8A 5JWOB 1YY7A 3DEXA 3F63A 3UBKA 4HZ4A 1FO5A 1TI3A 1EZKA 3BCKA 4MDCA 5FT3A 3Q19A 2ALBA 2P5RA 4EIPA 2KOKA 4O5UA 4FO5A 1Q98A 2V41A 1JZDA 2QGVA 1XWGA 2DJ1A 1THXA 4POKA 3CXGA 2HNLA 5BRTA 1H75A 2WB9A 3W8JA 4DEJA 4KDXA 2DJ0A 6GSSA 4WBJA 3UEMA 2KP1A 3F3RA 4PXOA 2I4AA 1KTEA 1SKRB 2YP6A 6GSUA 14GSA 4ZL9A 4ML1A 5DCGA 1TU8A 2G0FA 3TUEA 3N5OA 4YKGA 5GZZB 2VCZA 2VLVA 4EF0A 3GMFA 2J23A 5D93A 3HYPA 2H75A 1U88A 2ON7A 3TJJA 3O76A 4RI7A 4OCFA 2QA2A 2VIMA 2DKIA 3QMXA 1R5AA 2GSSA 3QR6A 1T1VA 1PA3A 2C0EA 4KSMA 3TRQA 3ZIJA 5IO2A 5D9TA 1K0BA 3G7YA 2D2ZA 5C04A 4ECCA 3FHKA 3SBCA 3TKSC 1EEJA 4DVCA 5F0GA 1HNBA 2M80A 1B4PA 1TK8B 1S3AA 3US3A 2DJJA 1GLQA 1PL1A 3HCZA 3QCPA 3HDCA 4GLTA 3CQFA 3APQA 1DE2A 4MPGA 2IPAA 1HQOA 3ZFLA 1SJIA 4DSRA 4ISDA 2C8UA 2YZUA 1QGVA 2DBCA 2DIZA 2V32A 3GNJA 2VD0A 2B7JA 1XWKA 1BJXA 4QL7A 1FOVA 2PERA 5HQPA 4GTUA 4YQUA 5ELGA 4PURA 1RW1A 2HSHA 2XC2A 1DSBA 1O81A 1ZL9A 3RAZA 3LFLA 4EC0A 5HR0A 3KCMA 1ILOA 5DALA 3I9V2 5DALB 4ZL7A 5J41A 4K6XA 5ABRA 2QKEA 5AIXA 1Z9HA 1TK0B 1EGRA 2LRTA 2I3YA 4L0UA 3MYDA 3TKPA 2OACA 2YV7A 1EGOA 1E6BA 3G7IA 2IJYA 2H0HA 4TOPA 1ST9A 1W89A 3FKFA 2GZYA 5IMVA 1A8LA 4F2IA 1X9WB 1GULA 1V9WA 3RPNA 3TJGA 5IOWA 2XPEA 1GTBA 1XFLA
chains in the Genus database with same CATH topology
1B8XA 1F6MC 3Q6OA 5E59A 3LW9A 2C3NA 3IPZA 2HZEA 2LJAA 2HZEB 5JCGA 16GSA 4HDEA 3CSIA 3KMNA 5G5EA 1AXDA 1GUKA 4K7IA 4ILFA 1SL1B 5ECNB 2K8VA 3L9UA 2B1KA 2I9HA 3IAM2 3ZVJD 2OADA 1AUCA 3VWWA 3C7MA 1PKZA 3CRTA 3DMLA 1YKAA 1NHYA 3NOFA 5FHIA 5D9XA 1XBSA 3M1GA 17GSA 1PMTA 5JCUA 1GSSA 3EVIA 1VF1A 1WE0A 2H01A 1A0FA 4EL1A 4K7OA 2I1UA 4JEDA 4K7NA 1TTZA 1A2MA 3ZITA 5GAND 1YKCA 8GSSA 2VD1A 2LNTA 4TR1A 4TR1B 2RUFA 4YKFA 4HI7A 2NPBA 5CO3A 3IV4A 4XHMA 1VRSD 1F9MA 5IO0A 4BVXA 4GCIA 2VLUA 3GKKA 3IBHA 4K5SA 3VWVA 1GWCA 5J5NA 4HJ2A 1YF1A 3CTFA 4X0XA 4J57E 1FHEA 1FOHA 1TRWA 1A8YA 3A3TA 3R2QA 2PN8A 2H1BA 1BYEA 2ZCTA 4KSOA 1YJ6A 1N2AA 2VCWA 1ON4A 9GSSA 5IM9A 1HYUA 2CAIA 2GZPA 4I97A 5CP1A 4AGSA 4JR6A 4QQ7A 5J3RA 3D21A 5ECOB 2N5BA 1RK4A 2A4VA 2RM5A 2FNOA 1SD8A 1H4OA 1TRUA 4MJAA 2LQOA 3HJOA 1FVKA 5C00A 4YQMA 1XWAA 1GP1A 3D22A 3KMOA 2JADA 2RM6A 4EUYA 2VL3A 1ZYQB 4O32A 2O89A 2PUKC 1JZWA 4F0CA 1G6YA 1M2DA 2E7PA 2PBJA 4X4JA 2R0CA 4ICYA 1WJKA 1FW1A 2PVQA 3TOUA 1MD4A 1EEMA 2HLSA 4MJBA 3E9JB 2GQLA 3GYKA 1PRXA 2X4AA 4RUVA 1GUMA 2EC4A 19GSA 1OE7A 2EIOA 1GSFA 2GTUA 4OFNA 1ERUA 3BOAA 2C80A 20GSA 3UOMA 3ED3A 5F06A 2H6YA 2YANA 5AISA 5KN3A 5B6NA 4N10A 4K2XA 2LS5A 3LGCA 1YQ1A 1VGLA 1XW9A 2DJKA 5F05A 2CV4A 5LCZA 4ZBAA 4MJCA 2B3SA 1DBYA 3VK9A 2B5YA 3W6GA 5CRWA 1NHOA 4PX1A 13GSA 3TKQA 2H70A 4TR0A 4L5LA 3VURA 4IP6A 3MIXA 1GTIA 3DGQA 4IW9A 1QFNA 4IHUA 3TDGA 2HI7A 4EVMA 3VPQA 3HHVA 7GSSA 1SYXA 5EL8A 2ZUPA 4G2EA 3LXZA 4TR4A 2MBSA 11GSA 4Z2UA 4MJEA 1PD21 5KOXA 4MNNA 3ME8A 1SENA 1ZZYA 4NMUA 2G2QA 3WGXA 4J56E 2RUEA 3KTLA 4ZIJA 1NW2A 1J9BA 1R5PA 3S9FA 4ID0A 3QAWA 1XZOA 5IPHA 3VPTA 4PNGA 5A5KA 2YCDA 5AN1A 2IFQA 4GXZA 3IK7A 4JU5A 2IFQB 1G7OA 2C3TA 3HVVA 2C0GA 1YEXA 2C3QA 2H71A 1WPIA 5CRHA 4G19A 1WP0A 3F8UA 3WGDA 2JSZA 4G9HA 2AUVA 4NV2A 4FH8A 4ACSA 2HSYA 3FZ5A 1A2LA 4N30A 4IELA 2B5XA 5KN2A 3A2WA 3DIEA 4WR5A 2BTOT 4OMVA 3SWLA 1ZYEA 2XBIA 2QC7A 4KNDA 4Q5NA 22GSA 2PWJA 5IIZA 5HFGA 3FK8A 4HOJA 4I6XA 1OC3A 4ECJA 2ZNMA 3HJPA 3M9JA 2L6DA 1TK5B 3G7JA 2V2GA 3IOSA 4V1Ap 4PQIA 3EPTA 3FY7A 2HZFA 2ON5A 4PUFC 2UZ8A 4F03A 4TVEA 3CMIA 4ML6A 4PQHA 4RQXA 4ZL8A 4XRAA 1SL2B 5JCWA 1PSQA 4LMVA 1EV9A 4XS6A 2M72A 1YEPA 2I81A 4KCEA 3D0ZA 5ECIB 4XCSA 1IYIA 5IPGA 2H1GA 5IQYA 2IIYA 3KP8A 4KDYA 2VCVA 4MF7A 3KD0A 4LL4B 1XPVA 2VUPA 4LMWA 1RQMA 4MA9A 3F4TA 4PNFA 1TP9A 4GF0A 4HJMA 4NWYA 1R26A 5ECSA 2J9HA 1ZYNA 2H30A 2H1AA 5IMFA 5HR3A 2A2PA 4BPYA 5ENUA 2LV3A 2LKUA 5B8BA 1AQWA 3IE3A 1T3BA 3BJ5A 1V40A 4AJ6A 2C0DA 3KH7A 5G1KA 4MABA 1B48A 1UVZA 2FGXA 1QK8A 4ZBBA 4O5QA 1AC1A 1K0CA 1XOBA 4USSA 3GURA 3F4RA 1AIUA 2OE1A 3UL3A 3ZL5A 3GKXA 1XCCA 2VLTA 5CYYA 1OYJA 2FLSA 4POLA 1MDJA 1UN2A 3TB2A 2CA8A 2AHEA 2GZZA 3VLNA 2MMZA 5D73A 3KGKA 5DJMA 3JCML 3TOTA 2BJXA 2E0QA 3FEUA 3LORA 1EOGA 1XVWA 1WRYA 3A2VA 1QQ2A 1SJ6A 2YJ7A 1ZMAA 1JLWA 5IOXA 1SYRA 4WEYA 1GH2A 2YWNA 3TGZA 1ACVA 2N5FA 4WKWA 1EV4A 1M99A 1W4VA 2HFDA 3I43A 5COHA 3ZTLA 3IR4A 2HYXA 4RI6A 1A23A 4D73A 2H74A 4D73B 4TRXA 4OWYA 1T00A 5ELAA 1K3OA 3KEBA 3FZAA 3HA9A 3RBTA 3EU3A 5JWQB 2VOCA 2WCIA 1QMVA 3F9UA 3FYGA 4ZBDA 3D4TA 2CX3A 2Z9SA 2A2RA 2H0IA 1O8XA 3I69A 4K2DA 2K6VA 1UA5A 2L57A 4Q5QA 4DSSA 4CDOA 4DSSB 4OFTA 2LNSA 4IGJA 2H1DA 4MZCA 4F82A 4OD7A 1PN0A 5GSSA 1XVQA 4L8EA 2NVLA 3GX8A 2CX4A 1ABAA 3EE2A 3HVXA 2GS3A 1OKDA 1YF0A 4GSTA 2LQQA 2GDRA 1S3DA 1O6JA 1PX6A 5G31A 3F6DA 2IMIA 1OKTA 4BWSA 3R3EA 5DJLA 4AF2A 3VWXA 1SJZA 1NSWA 4MH2A 3IA1A 5EY6A 3VI5A 1I5GA 2EIQA 4JZQA 4HUAA 1TOFA 1MEKA 2H66A 3F3QA 3GKMA 3KH9A 1M0UA 3G9BA 5E4WA 2OJLA 4ZB8A 2FA4A 2B5EA 1WWJA 1LU4A 4JBBA 3E0UA 3APOA 3GFKA 4CY8A 2AYTA 1Z6NA 4RQRA 1CQHA 1K0MA 2VO4A 3CTGA 1Z7RA 2PVOC 4K8MA 2MYGA 1A24A 2HXKA 3Q18A 3QFAC 1Y25A 1TRSA 2GGTA 1GSEA 5CAXA 2FWGA 2JU5A 1JHBA 3LG6A 5ID2A 1GNEA 5A4UA 1O7UA 12GSA 1V98A 2YWIA 1TKDB 2YOIA 4OO4A 1B9YC 2K9FA 4BVXB 1Y6EA 1GRXA 2VCQA 4NPBA 4NHZA 1EP7A 1Z6MA 1TW9A 1THOA 3V1WA 3GA4A 2WFCA 4GWRA 3RHBA 1Q4JA 2LJRA 4MF6A 2O85A 3GV1A 3D4MA 3PGTA 1IYHA 1MD3A 3KP9A 1VF3A 3ZMLA 1PL2A 2KHPA 5CREA 3A2XA 4IQAA 1FB6A 4E8HA 1NM3A 2B1LA 2HRKA 5EVOA 3GN3A 3IXRA 2GVPA 3C1RA 5IMCA 2KUCA 3N9JA 4YAVA 3WT2A 4WF5A 2X8CA 4NAXA 3LEFA 2CVBA 2JZSA 2MMOA 3ZREA 1V2AA 4G0LA 3WT1A 2H6ZA 1A0RP 4ZB9A 1BQ7A 3ME7A 2FA8A 2FCHA 4LA1A 1M2AA 2GLRA 2HSMA 2MBTA 3GRXA 4BVYA 2A4HA 4BVYB 1BAYA 5CNWA 2C1YA 1DUGA 3TRPA 4K0NA 1T7PB 3MSZA 4G10A 2WRTA 3VI7A 1VF4A 1G7EA 4L0WA 4V2MA 4TW5A 3L78A 3C8EA 4LL1B 2CZ3A 4O7HA 2B6MA 2YPMA 3TRXA 1USBA 1LBKA 2X49A 2P31A 3RDWA 3ERWA 4HU9A 5LNKe 1CQGA 3GL3A 3ZVJA 3IRAA 1C72A 1Z5YE 3IC8A 2YV9A 2XHFA 2WULA 2R4VA 4I2UA 2R5GA 3ZYWA 2LEGA 2HRAA 2LTKA 2NTOA 3PPUA 2RLIA 2X8HA 4KUNA 2JSYA 1B9XC 4H86A 5F8BA 4OFMA 2P0GA 2X99A 4MP4A 4N11A 2DIYA 3HD5A 4ZILA 5G5FA 2XBQA 1MTCA 4HZ2A 3KXOA 3I6AA 5L71A 4NXIA 4V2LA 4EXJA 5AIVA 5LD0A 1M9BA 2AB6A 3P2AA 2OE0A 5JWRB 3E3EA 3EYTA 2H8LA 3K8NA 5D96A 3LXTA 2IL3A 1URMA 2NDOA 3H8QA 1MDKA 4JR4A 5ECHB 1EP8A 1BX9A 18GSA 3ZZXA 3UVHA 2CZ2A 4O92A 4WBRD 2R0PA 3ERFA 3IHGA 4QL9A 6GSXA 4MF5A 1ZGNA 2OA7A 3ZFBA 2DJ3A 3ISOA 2K18A 3NIVA 1K3LA 1TI1A 4V1Ag 3L9SA 2OBIA 3C1SA 2GQKA 1X0RA 4IBPA 1SD9A 3HY2A 2R3XA 3ZLPA 4TXOA 2YJHA 2O7KA 5CRDA 4TXOB 2M46A 2DC5A 3IC4A 3BCIA 5FWGA 2FUG2 1O73A 4EKZA 1FB0A 1SL0B 1GNWA 5IMZA 3H1NA 2GT6A 3LYKA 4IJIA 2HRNA 1GTUA 5G30A 4Z2TA 1J08A 4G0IA 5KN1A 3EMXA 1JFUA 2LSTA 4L5OA 1XWBA 2F8FA 4PQ1A 5EPFA 4IQ1A 5ECKB 1A2JA 2FY6A 4JE1A 2AV4A 3DD3A 3MWHA 2DLXA 1OC9A 2IMEA 1OC9B 2MMAA 5CRGA 3CSJA 4K9ZA 1X5EA 1XIYA 4O5RA 1AW9A 4EDYA 5B7CA 4GRFA 2LJKA 2FD3A 2GSRA 3M0FA 4HQZA 1VF2A 4Z7XA 4I8BA 1K0AA 3GSTA 2BMXA 2L59A 3RPPA 2DKHA 3F6FA 4YAPA 1GUHA 5J9CA 5DQSA 2DMMA 4CY6A 3H93A 3GHAA 3GIXA 5HFIA 1SKWB 5KOWA 3D6IA 4X43A 3TJKA 2VL2C 4BWQA 3FW2A 2R6KA 2CVDA 3GKNA 2R0GA 2LUSA 3FZ9A 4KW6A 1O8WA 2WS2A 3APSA 1O85A 2H76A 1GSQA 2IWTA 3IDVA 1GTAA 4I2TA 4Z2RA 4NV5A 1SK2A 3DRNA 4CHSA 2GSTA 4KB3A 1TDIA 3HXSA 3U6VA 2V6KA 4IJ3A 5IMAA 1XWCA 3KM6A 4WR4A 2GQMA 4FQUA 1M2BA 1T4YA 4MK3A 3PINA 4EO3A 3HZ8A 2PPTA 5INYA 3TKSE 3PH9A 4I5QA 5G1LA 1F2EA 2FHEA 3MNGA 5D8IA 2O8VB 4FYBA 4WF4A 1BG5A 1MDIA 3LYPA 2MZCA 2R2JA 2REMA 4KAEA 1I9DA 1FVJA 2YN1A 2VAFA 5HR2A 4N0ZA 3RHCA 2H72A 3W8SA 1GLPA 1UC7A 5D9VA 1F37A 2PGTA 1K0DA 4MH3A 3TJBA 5H5RA 1U87A 2WJUA 2IMKA 2TRXA 3CYNA 2IMFA 1F3AA 5GSTA 2O87A 3IK9A 2GT5A 1SK1A 1KBNA 1PX7A 3J7Yb 1EWXA 4EIQA 2L6CA 5HFKA 2YWOA 1X5CA 4BL7A 4ULXA 5HR1A 4BL7B 1XW5A 6GSYA 1S3CA 4POBA 3J7Yk 4CW9A 1JLVA 3KIJA 3DWVA 3IHQA 1GSDA 4FIWA 2E2MA 3UJ1A 1X9SB 4GSNA 1GSYA 2LRCA 2FWHA 3LJRA 5DCHA 4KGIA 4G0KA 3GTUA 2JL4A 3GTUB 3HKRA 2L4QA 1E2YA 3CBUA 3HJMA 2TRCP 2L4CA 4TXVA 1WMJA 2K8SA 1TU7A 5AGYA 1TXXA 5KEJA 4MZWA 1ZOFA 4LLRA 2FWFA 2V6OA 4POMA 1U6TA 1YDKA 3DVXA 1R7HA 4AJ8A 1DE1A 5G2ZA 1HD2A 5A4VA 5BMUA 3GSSA 4Q5FA 3AY8A 4KX4A 3UIWA 2QSIA 4J2FA 2AJQB 2C0FA 1ZCPA 3A5IA 3M3MA 3CRUA 1BEDA 2HE3A 5ECLB 3IAS2 5ID2B 4OCEA 1JZOA 3PR8A 3TCOA 4A5PA 4HEA2 3EWLA 5ECRB 2FWEA 3C73A 1M7TA 1U3IA 1PGTA 4MZBA 3DYRA 4GSSA 5DDLA 1WIKA 3P90A 1J0FA 3FRCA 6GSVA 3ZMKA 1WOUA 4XIHA 3CSHA 4EE0A 4N0VA 3NZNA 4X1UA 4E8EA 3O6TA 3GUSA 4XTSA 4AJ7A 1OC8A 3ERGA 3O3TA 2QA1A 2CQ9A 5IMDA 3UVTA 1K0OA 1T4ZA 2DSAA 4KCAA 1KNGA 2H6XA 2TIRA 2VM2A 4K1FA 3BD2A 5B8AA 1XXUA 2VL9A 3LWAA 4XRDA 1B4QA 3TKRA 4XS4A 2L5LA 1AQVA 3FMWA 4XS1A 4XS4B 5DAKA 2F3MA 2E2GA 5DAKB 5B6MA 4ZXGA 3MDKA 2MMNA 3KJYA 3LQ7A 4KF9A 4YH2A 10GSA 2YWMA 1G6WA 3EC3A 4GQCA 1G0TA 2KLXA 2VM1A 3QD9A 1LJRA 6GSWA 5ECMB 4PUAA 4WXTA 4TN8A 3Q74A 3QAVA 2H19A 2YNXA 1AAZA 1TRVA 2JZRA 2VCXA 4KH7A 1KEBA 1OAZA 3DXBA 1X9MB 2ES7A 3GL5A 2OKAA 4JRRA 1SKSB 1N8JA 3FR9A 4ECBA 3EURA 3VWUA 1SK0A 3P8WA 3QPMA 2DMLA 3DKSA 1HNCA 3QDNA 4FYCA 3P7XA 2F51A 2CAQA 3TJFA 4BA7A 4NHWA 4YQVA 1ZYPA 1XOAA 4TR3A 3L4NA 5H5SA 3EMPA 3QFBC 1V57A 2CVKA 4P3YB 3GH9A 2WZ9A 1T8EB 2YZHA 4IVFA 2X64A 4IKHA 3U5RE 2NBSA 3ZRDA 2OBKA 1ERVA 4GQFA 4ECIA 2GSQA 3EU4A 2PMTA 3VFIA 3A5WA 2IN3A 2WGRA 1TJDA 4V2NA 3DVWA 2JZTA 5J9BA 1X5DA 3H79A 2KP2A 3FR6A 2VL2A 4OO5A 2LRNA 4EDZA 3GX0A 3FR3A 4IN0A 2B7KA 3D5JA 2JACA 2H0GA 2C4JA 4DSQA 4TKYA 3UBLA 5F07A 4ZB6A 3F4SA 5J4UA 4KDUA 1GL8A 1FG4A 2H73A 3HVSA 4F9ZA 1HNAA 2DJ2A 2X8GA 5DQYA 3F0IA 1U3AA 1PQNA 4KE3A 1SU9A 4IP1A 2EIRA 1Z7PA 1M9AA 3QAGA 4FYUA 4PTSA 3L0HA 1ERTA 4IS0A 2R37A 2F8AA 3UAPA 2IMDA 4HU7A 1YZXA 5DBQA 4MLYA 1QXHA 3OR5A 4K5RA 3ZIVA 2F9SA 3KTBA 5GAPD 1QUWA 3LSZA 1XW6A 3TKSA 1ML6A 2A2SA 1OVNA 4F0BA 5KN0A 4MMMA 1AQXA 1K0NA 5DVBA 5D9WA 3M9KA 6GSTA 4HQSA 4K0GA 3M8NA 1ERWA 4PGTA 2AAWA 1V58A 1EOHA 4HS1A 1GSUA 4MCUA 2HT9A 5A4WA 2N5AA 4WETA 2CT6A 2PU9C 2WDUA 3UMAA 3BBYA 1PN9A 3FZ4A 2L5OA 3H4KA 3WGEA 5ECPB 3UARA 3MAKA 2OE3A 2XPDA 4KA0A 3EINA 1JZRA 2RIIA 3WD6A 1F3BA 3QOUA 1R4WA 1K3YA 2VCTA 3C71A 3L9VA 3WYWA 1PKWA 3KZQA 1FAAA 5H5QA 2V1MA 2P5QA 5ECQB 4Q5RA 3GH6A 1Z3EA 2HRFA 3HZ4A 4MPFA 1OE8A 5JWOB 1YY7A 3DEXA 3F63A 3UBKA 4HZ4A 1FO5A 1TI3A 1EZKA 3BCKA 4MDCA 5FT3A 3Q19A 2ALBA 2P5RA 4EIPA 2KOKA 4O5UA 4FO5A 1Q98A 2V41A 1JZDA 2QGVA 1XWGA 2DJ1A 1THXA 4POKA 3CXGA 2HNLA 5BRTA 1H75A 2WB9A 3W8JA 4DEJA 4KDXA 2DJ0A 6GSSA 4WBJA 3UEMA 2KP1A 3F3RA 4PXOA 2I4AA 1KTEA 1SKRB 2YP6A 6GSUA 14GSA 4ZL9A 4ML1A 5DCGA 1TU8A 2G0FA 3TUEA 3N5OA 4YKGA 5GZZB 2VCZA 2VLVA 4EF0A 3GMFA 2J23A 5D93A 3HYPA 2H75A 1U88A 2ON7A 3TJJA 3O76A 4RI7A 4OCFA 2QA2A 2VIMA 2DKIA 3QMXA 1R5AA 2GSSA 3QR6A 1T1VA 1PA3A 2C0EA 4KSMA 3TRQA 3ZIJA 5IO2A 5D9TA 1K0BA 3G7YA 2D2ZA 5C04A 4ECCA 3FHKA 3SBCA 3TKSC 1EEJA 4DVCA 5F0GA 1HNBA 2M80A 1B4PA 1TK8B 1S3AA 3US3A 2DJJA 1GLQA 1PL1A 3HCZA 3QCPA 3HDCA 4GLTA 3APQA 1DE2A 4MPGA 2IPAA 1HQOA 3ZFLA 1SJIA 4DSRA 4ISDA 2C8UA 2YZUA 1QGVA 2DBCA 2DIZA 2V32A 3GNJA 2VD0A 2B7JA 1XWKA 1BJXA 4QL7A 1FOVA 2PERA 5HQPA 4GTUA 4YQUA 5ELGA 4PURA 1RW1A 2HSHA 2XC2A 1DSBA 1O81A 1ZL9A 3RAZA 3LFLA 4EC0A 5HR0A 3KCMA 1ILOA 5DALA 3I9V2 5DALB 4ZL7A 5J41A 4K6XA 5ABRA 2QKEA 5AIXA 1Z9HA 1TK0B 1EGRA 2LRTA 2I3YA 4L0UA 3MYDA 3TKPA 2OACA 2YV7A 1EGOA 1E6BA 3G7IA 2IJYA 2H0HA 4TOPA 1ST9A 1W89A 3FKFA 2GZYA 5IMVA 1A8LA 4F2IA 1X9WB 1GULA 1V9WA 3RPNA 3TJGA 5IOWA 2XPEA 1GTBA 1XFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B8X A;  1F6M C;  3Q6O A;  5E59 A;  2C3N A;  3IPZ A;  2HZE A;  2LJA A;  2HZE B;  5JCG A;  16GS A;  4HDE A;  3CSI A;  3KMN A;  5G5E A;  1AXD A;  1GUK A;  4K7I A;  4ILF A;  1SL1 B;  5ECN B;  2K8V A;  3L9U A;  2B1K A;  2I9H A;  3IAM 2;  3ZVJ D;  2OAD A;  1AUC A;  3VWW A;  3C7M A;  1PKZ A;  3CRT A;  3DML A;  1YKA A;  1NHY A;  3NOF A;  5FHI A;  5D9X A;  1XBS A;  3M1G A;  17GS A;  1PMT A;  5JCU A;  1GSS A;  3EVI A;  1VF1 A;  1WE0 A;  2H01 A;  1A0F A;  4EL1 A;  4K7O A;  2I1U A;  4JED A;  4K7N A;  1TTZ A;  1A2M A;  3ZIT A;  5GAN D;  1YKC A;  8GSS A;  2VD1 A;  2LNT A;  4TR1 A;  4TR1 B;  2RUF A;  4HI7 A;  2NPB A;  5CO3 A;  3IV4 A;  4XHM A;  1VRS D;  1F9M A;  5IO0 A;  4BVX A;  4GCI A;  2VLU A;  3GKK A;  3IBH A;  3VWV A;  1GWC A;  5J5N A;  4HJ2 A;  1YF1 A;  3CTF A;  4X0X A;  4J57 E;  1FHE A;  1TRW A;  1A8Y A;  3A3T A;  3R2Q A;  2PN8 A;  2H1B A;  1BYE A;  2ZCT A;  4KSO A;  1YJ6 A;  1N2A A;  2VCW A;  1ON4 A;  9GSS A;  5IM9 A;  1HYU A;  2CAI A;  2GZP A;  4I97 A;  5CP1 A;  4AGS A;  4JR6 A;  4QQ7 A;  5J3R A;  3D21 A;  5ECO B;  2N5B A;  1RK4 A;  2A4V A;  2RM5 A;  2FNO A;  1SD8 A;  1H4O A;  1TRU A;  4MJA A;  2LQO A;  3HJO A;  1FVK A;  5C00 A;  4YQM A;  1XWA A;  1GP1 A;  3D22 A;  3KMO A;  2JAD A;  2RM6 A;  4EUY A;  2VL3 A;  1ZYQ B;  4O32 A;  2O89 A;  2PUK C;  1JZW A;  4F0C A;  1G6Y A;  1M2D A;  2E7P A;  2PBJ A;  1WJK A;  1FW1 A;  2PVQ A;  3TOU A;  1MD4 A;  1EEM A;  2HLS A;  4MJB A;  3E9J B;  2GQL A;  3GYK A;  1PRX A;  4RUV A;  1GUM A;  2EC4 A;  19GS A;  1OE7 A;  2EIO A;  1GSF A;  2GTU A;  4OFN A;  1ERU A;  3BOA A;  2C80 A;  20GS A;  3UOM A;  3ED3 A;  5F06 A;  2H6Y A;  2YAN A;  5AIS A;  5KN3 A;  5B6N A;  4N10 A;  2LS5 A;  3LGC A;  1YQ1 A;  1VGL A;  1XW9 A;  2DJK A;  5F05 A;  2CV4 A;  5LCZ A;  4ZBA A;  4MJC A;  2B3S A;  1DBY A;  3VK9 A;  2B5Y A;  3W6G A;  5CRW A;  1NHO A;  4PX1 A;  13GS A;  3TKQ A;  2H70 A;  4TR0 A;  4L5L A;  3VUR A;  4IP6 A;  1GTI A;  3DGQ A;  4IW9 A;  1QFN A;  4IHU A;  3TDG A;  2HI7 A;  4EVM A;  3VPQ A;  3HHV A;  7GSS A;  1SYX A;  5EL8 A;  2ZUP A;  4G2E A;  3LXZ A;  4TR4 A;  2MBS A;  11GS A;  4MJE A;  1PD2 1;  3ME8 A;  1SEN A;  1ZZY A;  4NMU A;  2G2Q A;  3WGX A;  4J56 E;  2RUE A;  3KTL A;  4ZIJ A;  1NW2 A;  1J9B A;  1R5P A;  3S9F A;  4ID0 A;  3QAW A;  1XZO A;  5IPH A;  3VPT A;  4PNG A;  5A5K A;  2YCD A;  5AN1 A;  2IFQ A;  4GXZ A;  3IK7 A;  4JU5 A;  2IFQ B;  1G7O A;  2C3T A;  3HVV A;  2C0G A;  1YEX A;  2C3Q A;  2H71 A;  1WPI A;  5CRH A;  4G19 A;  1WP0 A;  3F8U A;  3WGD A;  2JSZ A;  4G9H A;  2AUV A;  4NV2 A;  4FH8 A;  4ACS A;  2HSY A;  3FZ5 A;  1A2L A;  4N30 A;  4IEL A;  2B5X A;  5KN2 A;  3A2W A;  3DIE A;  4WR5 A;  2BTO T;  4OMV A;  3SWL A;  1ZYE A;  2XBI A;  2QC7 A;  4KND A;  4Q5N A;  22GS A;  2PWJ A;  5IIZ A;  5HFG A;  3FK8 A;  4HOJ A;  4I6X A;  1OC3 A;  4ECJ A;  2ZNM A;  3HJP A;  3M9J A;  2L6D A;  1TK5 B;  3G7J A;  2V2G A;  3IOS A;  4V1A p;  4PQI A;  3FY7 A;  2HZF A;  2ON5 A;  4PUF C;  4F03 A;  4TVE A;  3CMI A;  4ML6 A;  4PQH A;  4RQX A;  4ZL8 A;  4XRA A;  1SL2 B;  5JCW A;  1PSQ A;  4LMV A;  1EV9 A;  4XS6 A;  2M72 A;  1YEP A;  2I81 A;  4KCE A;  3D0Z A;  5ECI B;  4XCS A;  1IYI A;  5IPG A;  2H1G A;  5IQY A;  2IIY A;  3KP8 A;  4KDY A;  2VCV A;  4MF7 A;  3KD0 A;  4LL4 B;  1XPV A;  2VUP A;  4LMW A;  1RQM A;  4MA9 A;  3F4T A;  4PNF A;  1TP9 A;  4GF0 A;  4HJM A;  4NWY A;  1R26 A;  5ECS A;  2J9H A;  2H30 A;  2H1A A;  5IMF A;  5HR3 A;  4BPY A;  5ENU A;  2LV3 A;  2LKU A;  5B8B A;  1AQW A;  3IE3 A;  1T3B A;  3BJ5 A;  1V40 A;  4AJ6 A;  2C0D A;  3KH7 A;  5G1K A;  4MAB A;  1B48 A;  1UVZ A;  2FGX A;  1QK8 A;  4ZBB A;  1AC1 A;  1K0C A;  1XOB A;  3GUR A;  3F4R A;  1AIU A;  2OE1 A;  3UL3 A;  3ZL5 A;  3GKX A;  1XCC A;  2VLT A;  5CYY A;  1OYJ A;  2FLS A;  4POL A;  1MDJ A;  1UN2 A;  3TB2 A;  2CA8 A;  2AHE A;  2GZZ A;  3VLN A;  2MMZ A;  5D73 A;  3KGK A;  5DJM A;  3JCM L;  3TOT A;  2BJX A;  2E0Q A;  3FEU A;  3LOR A;  1EOG A;  1XVW A;  1WRY A;  3A2V A;  1QQ2 A;  1SJ6 A;  2YJ7 A;  1ZMA A;  1JLW A;  5IOX A;  1SYR A;  4WEY A;  1GH2 A;  2YWN A;  3TGZ A;  1ACV A;  2N5F A;  4WKW A;  1EV4 A;  1M99 A;  1W4V A;  2HFD A;  3I43 A;  5COH A;  3ZTL A;  3IR4 A;  2HYX A;  4RI6 A;  1A23 A;  4D73 A;  2H74 A;  4D73 B;  4TRX A;  4OWY A;  1T00 A;  5ELA A;  1K3O A;  3KEB A;  3FZA A;  3HA9 A;  3RBT A;  3EU3 A;  5JWQ B;  2VOC A;  2WCI A;  1QMV A;  3F9U A;  3FYG A;  4ZBD A;  3D4T A;  2CX3 A;  2Z9S A;  2A2R A;  2H0I A;  1O8X A;  3I69 A;  4K2D A;  2K6V A;  1UA5 A;  2L57 A;  4Q5Q A;  4DSS A;  4CDO A;  4DSS B;  4OFT A;  2LNS A;  4IGJ A;  2H1D A;  4MZC A;  4F82 A;  4OD7 A;  5GSS A;  1XVQ A;  4L8E A;  2NVL A;  3GX8 A;  2CX4 A;  1ABA A;  3EE2 A;  3HVX A;  2GS3 A;  1OKD A;  1YF0 A;  4GST A;  2LQQ A;  2GDR A;  1S3D A;  1O6J A;  1PX6 A;  5G31 A;  3F6D A;  2IMI A;  1OKT A;  4BWS A;  5DJL A;  4AF2 A;  3VWX A;  1SJZ A;  1NSW A;  5EY6 A;  4MH2 A;  3IA1 A;  3VI5 A;  1I5G A;  2EIQ A;  4JZQ A;  4HUA A;  1TOF A;  1MEK A;  2H66 A;  3F3Q A;  3GKM A;  3KH9 A;  1M0U A;  3G9B A;  5E4W A;  2OJL A;  4ZB8 A;  2FA4 A;  2B5E A;  1WWJ A;  1LU4 A;  4JBB A;  3E0U A;  3APO A;  3GFK A;  2AYT A;  1Z6N A;  4RQR A;  1CQH A;  1K0M A;  2VO4 A;  3CTG A;  1Z7R A;  2PVO C;  4K8M A;  2MYG A;  1A24 A;  2HXK A;  3Q18 A;  3QFA C;  1Y25 A;  1TRS A;  2GGT A;  1GSE A;  5CAX A;  2FWG A;  2JU5 A;  1JHB A;  3LG6 A;  5ID2 A;  1GNE A;  5A4U A;  1O7U A;  12GS A;  1V98 A;  2YWI A;  1TKD B;  2YOI A;  4OO4 A;  1B9Y C;  2K9F A;  1Y6E A;  1GRX A;  2VCQ A;  4NPB A;  4NHZ A;  1EP7 A;  1Z6M A;  1TW9 A;  1THO A;  3V1W A;  3GA4 A;  2WFC A;  4GWR A;  3RHB A;  1Q4J A;  2LJR A;  4MF6 A;  2O85 A;  3GV1 A;  3D4M A;  3PGT A;  1IYH A;  1MD3 A;  3KP9 A;  1VF3 A;  3ZML A;  1PL2 A;  2KHP A;  5CRE A;  3A2X A;  4IQA A;  1FB6 A;  4E8H A;  1NM3 A;  2B1L A;  5EVO A;  3GN3 A;  3IXR A;  2GVP A;  3C1R A;  5IMC A;  2KUC A;  3N9J A;  4YAV A;  3WT2 A;  4WF5 A;  2X8C A;  4NAX A;  3LEF A;  2CVB A;  2JZS A;  2MMO A;  3ZRE A;  1V2A A;  3WT1 A;  2H6Z A;  1A0R P;  4ZB9 A;  1BQ7 A;  3ME7 A;  2FA8 A;  2FCH A;  4LA1 A;  1M2A A;  2GLR A;  2MBT A;  3GRX A;  4BVY A;  1BAY A;  5CNW A;  2C1Y A;  1DUG A;  3TRP A;  4K0N A;  1T7P B;  3MSZ A;  4G10 A;  2WRT A;  3VI7 A;  1VF4 A;  1G7E A;  4L0W A;  4V2M A;  4TW5 A;  3L78 A;  3C8E A;  4LL1 B;  2CZ3 A;  4O7H A;  2B6M A;  2YPM A;  3TRX A;  1USB A;  1LBK A;  2P31 A;  3RDW A;  3ERW A;  4HU9 A;  5LNK e;  1CQG A;  3GL3 A;  3ZVJ A;  3IRA A;  1C72 A;  1Z5Y E;  2YV9 A;  2XHF A;  2WUL A;  2R4V A;  4I2U A;  2R5G A;  3ZYW A;  2LEG A;  2LTK A;  2NTO A;  2RLI A;  2X8H A;  4KUN A;  2JSY A;  1B9X C;  4H86 A;  5F8B A;  4OFM A;  2P0G A;  2X99 A;  4MP4 A;  4N11 A;  2DIY A;  3HD5 A;  4ZIL A;  5G5F A;  2XBQ A;  1MTC A;  4HZ2 A;  3KXO A;  3I6A A;  5L71 A;  4NXI A;  4V2L A;  4EXJ A;  5AIV A;  5LD0 A;  1M9B A;  2AB6 A;  3P2A A;  2OE0 A;  5JWR B;  3E3E A;  3EYT A;  2H8L A;  3K8N A;  5D96 A;  3LXT A;  2IL3 A;  1URM A;  2NDO A;  3H8Q A;  1MDK A;  4JR4 A;  5ECH B;  1EP8 A;  1BX9 A;  18GS A;  3ZZX A;  3UVH A;  2CZ2 A;  4O92 A;  4WBR D;  3ERF A;  4QL9 A;  6GSX A;  4MF5 A;  1ZGN A;  2OA7 A;  3ZFB A;  2DJ3 A;  3ISO A;  2K18 A;  3NIV A;  1K3L A;  1TI1 A;  4V1A g;  3L9S A;  2OBI A;  3C1S A;  2GQK A;  1X0R A;  4IBP A;  1SD9 A;  3HY2 A;  2R3X A;  3ZLP A;  4TXO A;  2YJH A;  2O7K A;  5CRD A;  4TXO B;  2M46 A;  2DC5 A;  3IC4 A;  3BCI A;  5FWG A;  2FUG 2;  1O73 A;  4EKZ A;  1FB0 A;  1SL0 B;  1GNW A;  5IMZ A;  3H1N A;  2GT6 A;  3LYK A;  4IJI A;  2HRN A;  1GTU A;  5G30 A;  1J08 A;  5KN1 A;  3EMX A;  1JFU A;  2LST A;  4L5O A;  1XWB A;  2F8F A;  4PQ1 A;  5EPF A;  4IQ1 A;  5ECK B;  1A2J A;  2FY6 A;  4JE1 A;  2AV4 A;  3DD3 A;  3MWH A;  2DLX A;  1OC9 A;  2IME A;  1OC9 B;  2MMA A;  5CRG A;  3CSJ A;  4K9Z A;  1X5E A;  1XIY A;  4O5R A;  1AW9 A;  4EDY A;  5B7C A;  4GRF A;  2LJK A;  2FD3 A;  2GSR A;  3M0F A;  4HQZ A;  1VF2 A;  4Z7X A;  4I8B A;  1K0A A;  3GST A;  2BMX A;  2L59 A;  3RPP A;  3F6F A;  4YAP A;  1GUH A;  5J9C A;  5DQS A;  2DMM A;  3H93 A;  3GHA A;  3GIX A;  5HFI A;  1SKW B;  3D6I A;  4X43 A;  3TJK A;  2VL2 C;  4BWQ A;  3FW2 A;  2R6K A;  2CVD A;  3GKN A;  2LUS A;  3FZ9 A;  4KW6 A;  1O8W A;  2WS2 A;  3APS A;  1O85 A;  2H76 A;  1GSQ A;  2IWT A;  3IDV A;  1GTA A;  4I2T A;  4NV5 A;  1SK2 A;  3DRN A;  4CHS A;  2GST A;  4KB3 A;  1TDI A;  3HXS A;  3U6V A;  2V6K A;  4IJ3 A;  5IMA A;  1XWC A;  3KM6 A;  4WR4 A;  2GQM A;  1M2B A;  1T4Y A;  4MK3 A;  3PIN A;  4EO3 A;  3HZ8 A;  2PPT A;  5INY A;  3TKS E;  3PH9 A;  4I5Q A;  5G1L A;  1F2E A;  2FHE A;  3MNG A;  5D8I A;  2O8V B;  4FYB A;  4WF4 A;  1BG5 A;  1MDI A;  3LYP A;  2MZC A;  2R2J A;  2REM A;  4KAE A;  1I9D A;  1FVJ A;  2YN1 A;  2VAF A;  5HR2 A;  4N0Z A;  3RHC A;  2H72 A;  3W8S A;  1GLP A;  1UC7 A;  5D9V A;  1F37 A;  2PGT A;  1K0D A;  4MH3 A;  3TJB A;  5H5R A;  1U87 A;  2WJU A;  2IMK A;  2TRX A;  3CYN A;  2IMF A;  1F3A A;  5GST A;  2O87 A;  3IK9 A;  2GT5 A;  1SK1 A;  1KBN A;  1PX7 A;  3J7Y b;  1EWX A;  2L6C A;  5HFK A;  2YWO A;  1X5C A;  4BL7 A;  4ULX A;  5HR1 A;  1XW5 A;  6GSY A;  1S3C A;  4POB A;  3J7Y k;  4CW9 A;  1JLV A;  3KIJ A;  3DWV A;  3IHQ A;  1GSD A;  4FIW A;  2E2M A;  3UJ1 A;  1X9S B;  4GSN A;  1GSY A;  2LRC A;  2FWH A;  3LJR A;  5DCH A;  4KGI A;  3GTU A;  2JL4 A;  3GTU B;  3HKR A;  2L4Q A;  1E2Y A;  3CBU A;  3HJM A;  2TRC P;  2L4C A;  4TXV A;  1WMJ A;  2K8S A;  1TU7 A;  5AGY A;  1TXX A;  5KEJ A;  4MZW A;  1ZOF A;  4LLR A;  2FWF A;  2V6O A;  4POM A;  1U6T A;  1YDK A;  3DVX A;  1R7H A;  4AJ8 A;  1DE1 A;  5G2Z A;  1HD2 A;  5A4V A;  3GSS A;  4Q5F A;  3AY8 A;  4KX4 A;  3UIW A;  2QSI A;  4J2F A;  2AJQ B;  2C0F A;  1ZCP A;  3M3M A;  3CRU A;  1BED A;  2HE3 A;  5ECL B;  3IAS 2;  5ID2 B;  4OCE A;  1JZO A;  3PR8 A;  3TCO A;  4HEA 2;  3EWL A;  5ECR B;  2FWE A;  3C73 A;  1M7T A;  1U3I A;  1PGT A;  4MZB A;  3DYR A;  4GSS A;  5DDL A;  1WIK A;  3P90 A;  1J0F A;  3FRC A;  6GSV A;  3ZMK A;  1WOU A;  4XIH A;  3CSH A;  4EE0 A;  4N0V A;  3NZN A;  4X1U A;  4E8E A;  3O6T A;  3GUS A;  4XTS A;  4AJ7 A;  1OC8 A;  3ERG A;  3O3T A;  2CQ9 A;  5IMD A;  3UVT A;  1K0O A;  1T4Z A;  2DSA A;  4KCA A;  1KNG A;  2H6X A;  2TIR A;  2VM2 A;  4K1F A;  3BD2 A;  5B8A A;  1XXU A;  2VL9 A;  3LWA A;  4XRD A;  1B4Q A;  3TKR A;  4XS4 A;  2L5L A;  1AQV A;  4XS1 A;  4XS4 B;  5DAK A;  2F3M A;  2E2G A;  5DAK B;  5B6M A;  4ZXG A;  3MDK A;  2MMN A;  3KJY A;  3LQ7 A;  4YH2 A;  10GS A;  2YWM A;  1G6W A;  3EC3 A;  4GQC A;  1G0T A;  2KLX A;  2VM1 A;  3QD9 A;  1LJR A;  6GSW A;  5ECM B;  4PUA A;  4WXT A;  4TN8 A;  3Q74 A;  3QAV A;  2H19 A;  2YNX A;  1AAZ A;  1TRV A;  2JZR A;  2VCX A;  4KH7 A;  1KEB A;  1OAZ A;  3DXB A;  1X9M B;  2ES7 A;  3GL5 A;  2OKA A;  4JRR A;  1SKS B;  1N8J A;  3FR9 A;  4ECB A;  3EUR A;  3VWU A;  1SK0 A;  3P8W A;  3QPM A;  2DML A;  3DKS A;  1HNC A;  3QDN A;  4FYC A;  3P7X A;  2F51 A;  2CAQ A;  3TJF A;  4BA7 A;  4NHW A;  4YQV A;  1XOA A;  4TR3 A;  3L4N A;  5H5S A;  3EMP A;  3QFB C;  1V57 A;  2CVK A;  4P3Y B;  3GH9 A;  2WZ9 A;  1T8E B;  2YZH A;  4IVF A;  2X64 A;  4IKH A;  3U5R E;  2NBS A;  3ZRD A;  2OBK A;  1ERV A;  4GQF A;  4ECI A;  2GSQ A;  3EU4 A;  2PMT A;  3VFI A;  3A5W A;  2IN3 A;  2WGR A;  1TJD A;  4V2N A;  3DVW A;  2JZT A;  5J9B A;  1X5D A;  3H79 A;  2KP2 A;  3FR6 A;  2VL2 A;  4OO5 A;  2LRN A;  4EDZ A;  3GX0 A;  3FR3 A;  4IN0 A;  2B7K A;  3D5J A;  2JAC A;  2H0G A;  2C4J A;  4DSQ A;  4TKY A;  3UBL A;  5F07 A;  4ZB6 A;  3F4S A;  5J4U A;  4KDU A;  1GL8 A;  1FG4 A;  2H73 A;  3HVS A;  4F9Z A;  1HNA A;  2DJ2 A;  2X8G A;  5DQY A;  3F0I A;  1U3A A;  1PQN A;  4KE3 A;  1SU9 A;  4IP1 A;  2EIR A;  1Z7P A;  1M9A A;  3QAG A;  4FYU A;  3L0H A;  1ERT A;  4IS0 A;  2R37 A;  2F8A A;  3UAP A;  2IMD A;  4HU7 A;  1YZX A;  5DBQ A;  4MLY A;  1QXH A;  3OR5 A;  3ZIV A;  2F9S A;  3KTB A;  5GAP D;  1QUW A;  3LSZ A;  1XW6 A;  3TKS A;  1ML6 A;  2A2S A;  1OVN A;  4F0B A;  5KN0 A;  4MMM A;  1AQX A;  1K0N A;  5DVB A;  5D9W A;  3M9K A;  6GST A;  4HQS A;  4K0G A;  3M8N A;  1ERW A;  4PGT A;  2AAW A;  1V58 A;  1EOH A;  4HS1 A;  1GSU A;  4MCU A;  2HT9 A;  5A4W A;  2N5A A;  4WET A;  2CT6 A;  2PU9 C;  2WDU A;  3UMA A;  3BBY A;  1PN9 A;  3FZ4 A;  2L5O A;  3H4K A;  3WGE A;  5ECP B;  3UAR A;  3MAK A;  2OE3 A;  2XPD A;  4KA0 A;  3EIN A;  1JZR A;  2RII A;  3WD6 A;  1F3B A;  3QOU A;  1R4W A;  1K3Y A;  2VCT A;  3C71 A;  3L9V A;  3WYW A;  1PKW A;  3KZQ A;  1FAA A;  5H5Q A;  2V1M A;  2P5Q A;  5ECQ B;  4Q5R A;  3GH6 A;  1Z3E A;  2HRF A;  3HZ4 A;  4MPF A;  1OE8 A;  5JWO B;  1YY7 A;  3DEX A;  3F63 A;  3UBK A;  4HZ4 A;  1FO5 A;  1TI3 A;  1EZK A;  3BCK A;  4MDC A;  5FT3 A;  3Q19 A;  2ALB A;  2P5R A;  2KOK A;  4FO5 A;  1Q98 A;  2V41 A;  1JZD A;  2QGV A;  1XWG A;  2DJ1 A;  1THX A;  4POK A;  3CXG A;  2HNL A;  1H75 A;  2WB9 A;  3W8J A;  4DEJ A;  4KDX A;  2DJ0 A;  6GSS A;  4WBJ A;  3UEM A;  2KP1 A;  3F3R A;  4PXO A;  2I4A A;  1KTE A;  1SKR B;  2YP6 A;  6GSU A;  14GS A;  4ZL9 A;  4ML1 A;  5DCG A;  1TU8 A;  2G0F A;  3TUE A;  3N5O A;  5GZZ B;  2VCZ A;  2VLV A;  4EF0 A;  3GMF A;  2J23 A;  5D93 A;  3HYP A;  2H75 A;  1U88 A;  2ON7 A;  3TJJ A;  3O76 A;  4RI7 A;  4OCF A;  2VIM A;  3QMX A;  1R5A A;  2GSS A;  3QR6 A;  1T1V A;  1PA3 A;  2C0E A;  4KSM A;  3TRQ A;  3ZIJ A;  5IO2 A;  5D9T A;  1K0B A;  3G7Y A;  2D2Z A;  5C04 A;  4ECC A;  3FHK A;  3SBC A;  3TKS C;  1EEJ A;  4DVC A;  5F0G A;  1HNB A;  2M80 A;  1B4P A;  1TK8 B;  1S3A A;  3US3 A;  2DJJ A;  1GLQ A;  1PL1 A;  3HCZ A;  3QCP A;  3HDC A;  4GLT A;  3APQ A;  1DE2 A;  4MPG A;  2IPA A;  1HQO A;  3ZFL A;  1SJI A;  4DSR A;  4ISD A;  2C8U A;  2YZU A;  1QGV A;  2DBC A;  2DIZ A;  2V32 A;  3GNJ A;  2VD0 A;  2B7J A;  1XWK A;  1BJX A;  4QL7 A;  1FOV A;  2PER A;  5HQP A;  4GTU A;  4YQU A;  5ELG A;  4PUR A;  1RW1 A;  2HSH A;  2XC2 A;  1DSB A;  1O81 A;  1ZL9 A;  3RAZ A;  3LFL A;  4EC0 A;  5HR0 A;  3KCM A;  1ILO A;  5DAL A;  3I9V 2;  5DAL B;  4ZL7 A;  5J41 A;  4K6X A;  5ABR A;  2QKE A;  5AIX A;  1Z9H A;  1TK0 B;  1EGR A;  2LRT A;  2I3Y A;  4L0U A;  3TKP A;  2OAC A;  2YV7 A;  1EGO A;  1E6B A;  3G7I A;  2IJY A;  2H0H A;  4TOP A;  1ST9 A;  1W89 A;  3FKF A;  2GZY A;  5IMV A;  1A8L A;  4F2I A;  1X9W B;  1GUL A;  1V9W A;  3RPN A;  3TJG A;  5IOW A;  2XPE A;  1GTB A;  1XFL A; 
#chains in the Genus database with same CATH topology
 1B8X A;  1F6M C;  3Q6O A;  5E59 A;  3LW9 A;  2C3N A;  3IPZ A;  2HZE A;  2LJA A;  2HZE B;  5JCG A;  16GS A;  4HDE A;  3CSI A;  3KMN A;  5G5E A;  1AXD A;  1GUK A;  4K7I A;  4ILF A;  1SL1 B;  5ECN B;  2K8V A;  3L9U A;  2B1K A;  2I9H A;  3IAM 2;  3ZVJ D;  2OAD A;  1AUC A;  3VWW A;  3C7M A;  1PKZ A;  3CRT A;  3DML A;  1YKA A;  1NHY A;  3NOF A;  5FHI A;  5D9X A;  1XBS A;  3M1G A;  17GS A;  1PMT A;  5JCU A;  1GSS A;  3EVI A;  1VF1 A;  1WE0 A;  2H01 A;  1A0F A;  4EL1 A;  4K7O A;  2I1U A;  4JED A;  4K7N A;  1TTZ A;  1A2M A;  3ZIT A;  5GAN D;  1YKC A;  8GSS A;  2VD1 A;  2LNT A;  4TR1 A;  4TR1 B;  2RUF A;  4YKF A;  4HI7 A;  2NPB A;  5CO3 A;  3IV4 A;  4XHM A;  1VRS D;  1F9M A;  5IO0 A;  4BVX A;  4GCI A;  2VLU A;  3GKK A;  3IBH A;  4K5S A;  3VWV A;  1GWC A;  5J5N A;  4HJ2 A;  1YF1 A;  3CTF A;  4X0X A;  4J57 E;  1FHE A;  1FOH A;  1TRW A;  1A8Y A;  3A3T A;  3R2Q A;  2PN8 A;  2H1B A;  1BYE A;  2ZCT A;  4KSO A;  1YJ6 A;  1N2A A;  2VCW A;  1ON4 A;  9GSS A;  5IM9 A;  1HYU A;  2CAI A;  2GZP A;  4I97 A;  5CP1 A;  4AGS A;  4JR6 A;  4QQ7 A;  5J3R A;  3D21 A;  5ECO B;  2N5B A;  1RK4 A;  2A4V A;  2RM5 A;  2FNO A;  1SD8 A;  1H4O A;  1TRU A;  4MJA A;  2LQO A;  3HJO A;  1FVK A;  5C00 A;  4YQM A;  1XWA A;  1GP1 A;  3D22 A;  3KMO A;  2JAD A;  2RM6 A;  4EUY A;  2VL3 A;  1ZYQ B;  4O32 A;  2O89 A;  2PUK C;  1JZW A;  4F0C A;  1G6Y A;  1M2D A;  2E7P A;  2PBJ A;  4X4J A;  2R0C A;  4ICY A;  1WJK A;  1FW1 A;  2PVQ A;  3TOU A;  1MD4 A;  1EEM A;  2HLS A;  4MJB A;  3E9J B;  2GQL A;  3GYK A;  1PRX A;  2X4A A;  4RUV A;  1GUM A;  2EC4 A;  19GS A;  1OE7 A;  2EIO A;  1GSF A;  2GTU A;  4OFN A;  1ERU A;  3BOA A;  2C80 A;  20GS A;  3UOM A;  3ED3 A;  5F06 A;  2H6Y A;  2YAN A;  5AIS A;  5KN3 A;  5B6N A;  4N10 A;  4K2X A;  2LS5 A;  3LGC A;  1YQ1 A;  1XG8 A;  1VGL A;  1XW9 A;  2DJK A;  5F05 A;  2CV4 A;  5LCZ A;  4ZBA A;  4MJC A;  2B3S A;  1DBY A;  3VK9 A;  2B5Y A;  3W6G A;  5CRW A;  1NHO A;  4PX1 A;  13GS A;  3TKQ A;  2H70 A;  4TR0 A;  4L5L A;  3VUR A;  4IP6 A;  3MIX A;  1GTI A;  3DGQ A;  4IW9 A;  1QFN A;  4IHU A;  3TDG A;  2HI7 A;  4HSC X;  4EVM A;  3VPQ A;  3HHV A;  7GSS A;  1SYX A;  5EL8 A;  2ZUP A;  4G2E A;  3LXZ A;  4TR4 A;  2MBS A;  11GS A;  4Z2U A;  4MJE A;  1PD2 1;  5KOX A;  4MNN A;  3ME8 A;  1SEN A;  1ZZY A;  4NMU A;  2G2Q A;  3WGX A;  4J56 E;  2RUE A;  3KTL A;  4ZIJ A;  1NW2 A;  1J9B A;  1R5P A;  3S9F A;  4ID0 A;  3QAW A;  1XZO A;  5IPH A;  3VPT A;  4PNG A;  5A5K A;  2YCD A;  5AN1 A;  2IFQ A;  4GXZ A;  3IK7 A;  4JU5 A;  2IFQ B;  1G7O A;  2C3T A;  3HVV A;  2C0G A;  1YEX A;  2C3Q A;  2H71 A;  1WPI A;  5CRH A;  4G19 A;  1WP0 A;  3F8U A;  3WGD A;  2JSZ A;  4G9H A;  2AUV A;  4NV2 A;  4FH8 A;  4ACS A;  2HSY A;  3FZ5 A;  1A2L A;  4N30 A;  4IEL A;  2B5X A;  5KN2 A;  3A2W A;  3DIE A;  4WR5 A;  2BTO T;  1S3R A;  4OMV A;  3SWL A;  1ZYE A;  2XBI A;  2QC7 A;  4KND A;  4Q5N A;  22GS A;  2PWJ A;  5IIZ A;  5HFG A;  3FK8 A;  4HOJ A;  4I6X A;  1OC3 A;  4ECJ A;  2ZNM A;  3HJP A;  3M9J A;  2L6D A;  1TK5 B;  3G7J A;  2V2G A;  3IOS A;  4V1A p;  4PQI A;  3EPT A;  3FY7 A;  2HZF A;  2ON5 A;  4PUF C;  2UZ8 A;  4F03 A;  4TVE A;  3CMI A;  4ML6 A;  4PQH A;  4RQX A;  4ZL8 A;  4XRA A;  1SL2 B;  5JCW A;  1PSQ A;  4LMV A;  1EV9 A;  4XS6 A;  2M72 A;  1YEP A;  2I81 A;  4KCE A;  3D0Z A;  5ECI B;  4XCS A;  1IYI A;  5IPG A;  2H1G A;  3HVN A;  5IQY A;  2IIY A;  3KP8 A;  4KDY A;  2VCV A;  4MF7 A;  3KD0 A;  4BIK A;  4LL4 B;  1XPV A;  2VUP A;  4LMW A;  1RQM A;  4MA9 A;  3F4T A;  4PNF A;  1TP9 A;  4GF0 A;  4HJM A;  4NWY A;  1R26 A;  5ECS A;  2J9H A;  1ZYN A;  2H30 A;  2H1A A;  5IMF A;  5HR3 A;  2A2P A;  4BPY A;  5ENU A;  2LV3 A;  2LKU A;  5B8B A;  1AQW A;  3IE3 A;  1T3B A;  3BJ5 A;  1V40 A;  4AJ6 A;  2C0D A;  3KH7 A;  5G1K A;  4MAB A;  1B48 A;  1UVZ A;  2FGX A;  1QK8 A;  4ZBB A;  4O5Q A;  1AC1 A;  1K0C A;  1XOB A;  4USS A;  3GUR A;  3F4R A;  1AIU A;  2OE1 A;  3UL3 A;  3ZL5 A;  3GKX A;  1XCC A;  2VLT A;  5CYY A;  1OYJ A;  2FLS A;  4POL A;  1MDJ A;  1UN2 A;  3TB2 A;  2CA8 A;  2AHE A;  2GZZ A;  3VLN A;  2MMZ A;  5D73 A;  3KGK A;  5DJM A;  3JCM L;  3TOT A;  2BJX A;  2E0Q A;  3FEU A;  3LOR A;  1EOG A;  1XVW A;  1WRY A;  3A2V A;  1QQ2 A;  1SJ6 A;  2YJ7 A;  1ZMA A;  1JLW A;  5IOX A;  1SYR A;  4WEY A;  1GH2 A;  2YWN A;  3TGZ A;  1ACV A;  2N5F A;  4WKW A;  1EV4 A;  1M99 A;  1W4V A;  2HFD A;  3I43 A;  5COH A;  3ZTL A;  3IR4 A;  2HYX A;  4RI6 A;  1A23 A;  4D73 A;  2H74 A;  4D73 B;  4TRX A;  4OWY A;  1T00 A;  5ELA A;  1K3O A;  3KEB A;  3FZA A;  3HA9 A;  3RBT A;  3EU3 A;  5JWQ B;  2VOC A;  2WCI A;  1QMV A;  3F9U A;  3FYG A;  4ZBD A;  3D4T A;  2CX3 A;  2Z9S A;  2A2R A;  2H0I A;  1O8X A;  3I69 A;  4K2D A;  2K6V A;  1UA5 A;  2L57 A;  4Q5Q A;  4DSS A;  4CDO A;  4DSS B;  4OFT A;  2LNS A;  4IGJ A;  2H1D A;  4MZC A;  4F82 A;  4OD7 A;  1PN0 A;  5GSS A;  1XVQ A;  4L8E A;  2NVL A;  3GX8 A;  2CX4 A;  1ABA A;  3EE2 A;  3HVX A;  2GS3 A;  1OKD A;  1YF0 A;  4GST A;  2LQQ A;  2GDR A;  1S3D A;  1O6J A;  1PX6 A;  5G31 A;  3F6D A;  2IMI A;  1OKT A;  4BWS A;  3R3E A;  5DJL A;  4AF2 A;  3VWX A;  1SJZ A;  1NSW A;  4MH2 A;  3IA1 A;  5EY6 A;  3VI5 A;  1I5G A;  2EIQ A;  4JZQ A;  4HUA A;  1TOF A;  1MEK A;  2H66 A;  3F3Q A;  3GKM A;  3KH9 A;  1M0U A;  3G9B A;  5E4W A;  2OJL A;  4ZB8 A;  2FA4 A;  2B5E A;  1WWJ A;  1LU4 A;  4JBB A;  3E0U A;  3APO A;  3GFK A;  4CY8 A;  2AYT A;  1Z6N A;  4RQR A;  1CQH A;  1K0M A;  2VO4 A;  3CTG A;  1Z7R A;  2PVO C;  4K8M A;  2MYG A;  1A24 A;  2HXK A;  3Q18 A;  3QFA C;  1Y25 A;  1TRS A;  2GGT A;  1GSE A;  5CAX A;  2FWG A;  2JU5 A;  1JHB A;  3LG6 A;  5ID2 A;  1GNE A;  5A4U A;  1O7U A;  12GS A;  1V98 A;  2YWI A;  1TKD B;  2YOI A;  4OO4 A;  1B9Y C;  2K9F A;  4BVX B;  1Y6E A;  1GRX A;  2VCQ A;  4NPB A;  4NHZ A;  1EP7 A;  1Z6M A;  1TW9 A;  1THO A;  3V1W A;  3GA4 A;  2WFC A;  4GWR A;  3RHB A;  1Q4J A;  2LJR A;  4MF6 A;  2O85 A;  3GV1 A;  3D4M A;  3PGT A;  1IYH A;  1MD3 A;  3KP9 A;  1VF3 A;  3ZML A;  1PL2 A;  2KHP A;  5CRE A;  3A2X A;  4IQA A;  1FB6 A;  4E8H A;  1NM3 A;  2B1L A;  2HRK A;  5EVO A;  3GN3 A;  3IXR A;  2GVP A;  3C1R A;  5IMC A;  2KUC A;  3N9J A;  4YAV A;  3WT2 A;  4WF5 A;  2X8C A;  4NAX A;  3LEF A;  2CVB A;  2JZS A;  2MMO A;  3ZRE A;  1V2A A;  4G0L A;  3WT1 A;  2H6Z A;  1A0R P;  4ZB9 A;  1BQ7 A;  3ME7 A;  2FA8 A;  2FCH A;  4LA1 A;  1M2A A;  2GLR A;  2HSM A;  2MBT A;  3GRX A;  4BVY A;  2A4H A;  4BVY B;  1BAY A;  5CNW A;  2C1Y A;  1DUG A;  3TRP A;  4K0N A;  1T7P B;  3MSZ A;  4G10 A;  2WRT A;  3VI7 A;  1VF4 A;  1G7E A;  4L0W A;  4V2M A;  4TW5 A;  3L78 A;  3C8E A;  4LL1 B;  2CZ3 A;  4O7H A;  2B6M A;  2YPM A;  3TRX A;  1USB A;  1LBK A;  2X49 A;  2P31 A;  3RDW A;  3ERW A;  4HU9 A;  5LNK e;  1CQG A;  3GL3 A;  3ZVJ A;  3IRA A;  1C72 A;  1Z5Y E;  3IC8 A;  2YV9 A;  2XHF A;  2WUL A;  2R4V A;  4I2U A;  2R5G A;  3ZYW A;  2LEG A;  2HRA A;  2LTK A;  2NTO A;  3PPU A;  2RLI A;  2X8H A;  4KUN A;  2JSY A;  1B9X C;  4H86 A;  5F8B A;  4OFM A;  2P0G A;  2X99 A;  4MP4 A;  4N11 A;  2DIY A;  3HD5 A;  4ZIL A;  5G5F A;  2XBQ A;  1MTC A;  4HZ2 A;  3KXO A;  3I6A A;  5L71 A;  4NXI A;  4V2L A;  4EXJ A;  5AIV A;  5LD0 A;  1M9B A;  2AB6 A;  3P2A A;  2OE0 A;  5JWR B;  3E3E A;  3EYT A;  2H8L A;  3K8N A;  5D96 A;  3LXT A;  2IL3 A;  1URM A;  2NDO A;  3H8Q A;  1MDK A;  4JR4 A;  5ECH B;  1EP8 A;  1BX9 A;  18GS A;  3ZZX A;  3UVH A;  2CZ2 A;  4O92 A;  4WBR D;  2R0P A;  3ERF A;  3IHG A;  4QL9 A;  6GSX A;  4MF5 A;  1ZGN A;  2OA7 A;  3ZFB A;  2DJ3 A;  3ISO A;  2K18 A;  3NIV A;  1K3L A;  1TI1 A;  4V1A g;  3L9S A;  2OBI A;  3C1S A;  2GQK A;  1X0R A;  4IBP A;  1SD9 A;  3HY2 A;  2R3X A;  3ZLP A;  4TXO A;  2YJH A;  2O7K A;  5CRD A;  4TXO B;  2M46 A;  2DC5 A;  3IC4 A;  3BCI A;  5FWG A;  2FUG 2;  1O73 A;  4EKZ A;  1FB0 A;  1SL0 B;  1GNW A;  5IMZ A;  3H1N A;  2GT6 A;  3LYK A;  4IJI A;  2HRN A;  1GTU A;  5G30 A;  4Z2T A;  1J08 A;  4G0I A;  5KN1 A;  3EMX A;  1JFU A;  2LST A;  4L5O A;  1XWB A;  2F8F A;  4PQ1 A;  5EPF A;  4IQ1 A;  5ECK B;  1A2J A;  2FY6 A;  4JE1 A;  2AV4 A;  3DD3 A;  3MWH A;  2DLX A;  1OC9 A;  2IME A;  1OC9 B;  2MMA A;  5CRG A;  3CSJ A;  4K9Z A;  1X5E A;  1XIY A;  4O5R A;  1AW9 A;  4EDY A;  5B7C A;  4GRF A;  2LJK A;  2FD3 A;  2GSR A;  3M0F A;  4HQZ A;  1VF2 A;  4Z7X A;  4I8B A;  1K0A A;  3GST A;  2BMX A;  2L59 A;  3RPP A;  2DKH A;  3F6F A;  4YAP A;  1GUH A;  5J9C A;  5DQS A;  2DMM A;  4CY6 A;  3H93 A;  3GHA A;  3GIX A;  5HFI A;  1SKW B;  5KOW A;  3D6I A;  4X43 A;  3TJK A;  2VL2 C;  4BWQ A;  3FW2 A;  2R6K A;  2CVD A;  3GKN A;  2R0G A;  2LUS A;  3FZ9 A;  4KW6 A;  1O8W A;  2WS2 A;  3APS A;  1O85 A;  2H76 A;  1GSQ A;  2IWT A;  3IDV A;  1GTA A;  4I2T A;  4Z2R A;  4NV5 A;  1SK2 A;  3DRN A;  4CHS A;  2GST A;  4KB3 A;  1TDI A;  3HXS A;  3U6V A;  2V6K A;  4IJ3 A;  5IMA A;  1XWC A;  3KM6 A;  4WR4 A;  2GQM A;  4FQU A;  1M2B A;  1T4Y A;  4MK3 A;  3PIN A;  4EO3 A;  3HZ8 A;  2PPT A;  5INY A;  3TKS E;  3PH9 A;  4I5Q A;  5G1L A;  1F2E A;  2FHE A;  3MNG A;  5D8I A;  2O8V B;  4FYB A;  4WF4 A;  1BG5 A;  1MDI A;  3LYP A;  2MZC A;  2R2J A;  2REM A;  4KAE A;  1I9D A;  1FVJ A;  2YN1 A;  2VAF A;  5HR2 A;  4N0Z A;  3RHC A;  2H72 A;  3W8S A;  1GLP A;  1UC7 A;  5D9V A;  1F37 A;  2PGT A;  1K0D A;  1M3J A;  4MH3 A;  3TJB A;  5H5R A;  1U87 A;  2WJU A;  2IMK A;  2TRX A;  3CYN A;  2IMF A;  1F3A A;  5GST A;  2O87 A;  3IK9 A;  2GT5 A;  1SK1 A;  1KBN A;  1PX7 A;  3J7Y b;  1EWX A;  4EIQ A;  2L6C A;  5HFK A;  2YWO A;  1X5C A;  4BL7 A;  1M3I A;  4ULX A;  5HR1 A;  4BL7 B;  1XW5 A;  6GSY A;  1S3C A;  4POB A;  3J7Y k;  4CW9 A;  1JLV A;  3KIJ A;  3DWV A;  3IHQ A;  1GSD A;  4FIW A;  2E2M A;  3UJ1 A;  1X9S B;  4GSN A;  1GSY A;  2LRC A;  2FWH A;  3LJR A;  5DCH A;  4KGI A;  4G0K A;  3GTU A;  2JL4 A;  3GTU B;  3HKR A;  2L4Q A;  1E2Y A;  3CBU A;  3HJM A;  2TRC P;  2L4C A;  4TXV A;  1WMJ A;  2K8S A;  1TU7 A;  5AGY A;  1TXX A;  5KEJ A;  4MZW A;  1ZOF A;  4LLR A;  2FWF A;  2V6O A;  4POM A;  1U6T A;  1YDK A;  3DVX A;  1PFO A;  1R7H A;  4AJ8 A;  1DE1 A;  5G2Z A;  1HD2 A;  5A4V A;  5BMU A;  3GSS A;  4Q5F A;  3AY8 A;  4KX4 A;  3UIW A;  2QSI A;  4J2F A;  2AJQ B;  2C0F A;  1ZCP A;  3A5I A;  3M3M A;  3CRU A;  1BED A;  2HE3 A;  5ECL B;  3IAS 2;  5ID2 B;  4OCE A;  1JZO A;  3PR8 A;  3TCO A;  4A5P A;  4HEA 2;  3EWL A;  5ECR B;  2FWE A;  3C73 A;  1M7T A;  1U3I A;  1PGT A;  4MZB A;  3DYR A;  4GSS A;  5DDL A;  1WIK A;  3P90 A;  1J0F A;  3FRC A;  6GSV A;  3ZMK A;  1WOU A;  4XIH A;  3CSH A;  4EE0 A;  4N0V A;  3NZN A;  4X1U A;  4E8E A;  3O6T A;  3GUS A;  4XTS A;  4AJ7 A;  1OC8 A;  3ERG A;  3O3T A;  2QA1 A;  2CQ9 A;  5IMD A;  3UVT A;  1K0O A;  1T4Z A;  2DSA A;  4KCA A;  1KNG A;  2H6X A;  2TIR A;  2VM2 A;  4K1F A;  3BD2 A;  5B8A A;  1XXU A;  2VL9 A;  3LWA A;  4XRD A;  1B4Q A;  3TKR A;  4XS4 A;  2L5L A;  1AQV A;  3FMW A;  4XS1 A;  4XS4 B;  5DAK A;  2F3M A;  2E2G A;  5DAK B;  5B6M A;  4ZXG A;  3MDK A;  2MMN A;  3KJY A;  3LQ7 A;  4KF9 A;  4YH2 A;  10GS A;  2YWM A;  1G6W A;  3EC3 A;  4GQC A;  1G0T A;  2KLX A;  2VM1 A;  3QD9 A;  1LJR A;  6GSW A;  5ECM B;  4PUA A;  4WXT A;  4TN8 A;  3Q74 A;  3QAV A;  2H19 A;  2YNX A;  1AAZ A;  1TRV A;  2JZR A;  2VCX A;  4KH7 A;  1KEB A;  1OAZ A;  3DXB A;  1X9M B;  2ES7 A;  3GL5 A;  2OKA A;  4JRR A;  1SKS B;  1N8J A;  3FR9 A;  4ECB A;  3EUR A;  3VWU A;  1SK0 A;  3P8W A;  3QPM A;  2DML A;  3DKS A;  1HNC A;  3QDN A;  4FYC A;  3P7X A;  2F51 A;  2CAQ A;  3TJF A;  4BA7 A;  4NHW A;  4YQV A;  1ZYP A;  1XOA A;  4TR3 A;  3L4N A;  5H5S A;  3EMP A;  3QFB C;  1V57 A;  2CVK A;  4P3Y B;  3GH9 A;  2WZ9 A;  1T8E B;  2YZH A;  4IVF A;  2X64 A;  4IKH A;  3U5R E;  2NBS A;  3ZRD A;  2OBK A;  1ERV A;  4GQF A;  4ECI A;  2GSQ A;  3EU4 A;  2PMT A;  3VFI A;  3A5W A;  2IN3 A;  2WGR A;  1TJD A;  4V2N A;  3DVW A;  2JZT A;  5J9B A;  1X5D A;  3H79 A;  2KP2 A;  3FR6 A;  2VL2 A;  4OO5 A;  2LRN A;  4EDZ A;  3GX0 A;  3FR3 A;  4IN0 A;  2B7K A;  3D5J A;  2JAC A;  2H0G A;  2C4J A;  4DSQ A;  4TKY A;  3UBL A;  5F07 A;  4ZB6 A;  3F4S A;  5J4U A;  4KDU A;  1GL8 A;  1FG4 A;  2H73 A;  3HVS A;  4F9Z A;  1HNA A;  2DJ2 A;  2X8G A;  5DQY A;  3F0I A;  1U3A A;  1PQN A;  4KE3 A;  1SU9 A;  4IP1 A;  2EIR A;  1Z7P A;  1M9A A;  3QAG A;  4FYU A;  4PTS A;  3L0H A;  1ERT A;  4IS0 A;  2R37 A;  2F8A A;  3UAP A;  2IMD A;  4HU7 A;  1YZX A;  5DBQ A;  4MLY A;  1QXH A;  3OR5 A;  4K5R A;  3ZIV A;  2F9S A;  3KTB A;  5GAP D;  1QUW A;  3LSZ A;  1XW6 A;  3TKS A;  1ML6 A;  2A2S A;  1OVN A;  4F0B A;  5KN0 A;  4MMM A;  1AQX A;  1K0N A;  5DVB A;  5D9W A;  3M9K A;  6GST A;  4HQS A;  4K0G A;  3M8N A;  1ERW A;  4PGT A;  2AAW A;  1V58 A;  1EOH A;  4HS1 A;  1GSU A;  4MCU A;  2HT9 A;  5A4W A;  2N5A A;  4WET A;  2CT6 A;  2PU9 C;  2WDU A;  3UMA A;  3BBY A;  1PN9 A;  3FZ4 A;  2L5O A;  3H4K A;  3WGE A;  5ECP B;  3UAR A;  3MAK A;  2OE3 A;  2XPD A;  4KA0 A;  3EIN A;  1JZR A;  2RII A;  3WD6 A;  1F3B A;  3QOU A;  1R4W A;  1K3Y A;  2VCT A;  3C71 A;  3L9V A;  3WYW A;  1PKW A;  3KZQ A;  1FAA A;  5H5Q A;  2V1M A;  2P5Q A;  5ECQ B;  4Q5R A;  3GH6 A;  1Z3E A;  2HRF A;  3HZ4 A;  4MPF A;  1OE8 A;  5JWO B;  1YY7 A;  3DEX A;  3F63 A;  3UBK A;  4HZ4 A;  1FO5 A;  1TI3 A;  1EZK A;  3BCK A;  4MDC A;  5FT3 A;  3Q19 A;  2ALB A;  2P5R A;  4EIP A;  2KOK A;  4O5U A;  4FO5 A;  1Q98 A;  2V41 A;  1JZD A;  2QGV A;  1XWG A;  2DJ1 A;  1THX A;  4POK A;  3CXG A;  2HNL A;  5BRT A;  1H75 A;  2WB9 A;  3W8J A;  4DEJ A;  4KDX A;  2DJ0 A;  6GSS A;  4WBJ A;  3UEM A;  2KP1 A;  3F3R A;  4PXO A;  2I4A A;  1KTE A;  1SKR B;  2YP6 A;  6GSU A;  14GS A;  4ZL9 A;  4ML1 A;  5DCG A;  1TU8 A;  2G0F A;  3TUE A;  3N5O A;  4YKG A;  5GZZ B;  2VCZ A;  2VLV A;  4EF0 A;  3GMF A;  2J23 A;  5D93 A;  3HYP A;  2H75 A;  1U88 A;  2ON7 A;  3TJJ A;  3O76 A;  4RI7 A;  4OCF A;  2QA2 A;  2VIM A;  2DKI A;  3QMX A;  1R5A A;  2GSS A;  3QR6 A;  1T1V A;  1PA3 A;  2C0E A;  4KSM A;  3TRQ A;  3ZIJ A;  5IO2 A;  5D9T A;  1K0B A;  3G7Y A;  2D2Z A;  5C04 A;  4ECC A;  3FHK A;  3SBC A;  3TKS C;  1EEJ A;  4DVC A;  5F0G A;  1HNB A;  2M80 A;  1B4P A;  1TK8 B;  1S3A A;  3US3 A;  2DJJ A;  1GLQ A;  1PL1 A;  3HCZ A;  3QCP A;  3HDC A;  4GLT A;  3CQF A;  3APQ A;  1DE2 A;  4MPG A;  2IPA A;  1HQO A;  3ZFL A;  1SJI A;  4DSR A;  4ISD A;  2C8U A;  2YZU A;  1QGV A;  2DBC A;  2DIZ A;  2V32 A;  3GNJ A;  2VD0 A;  2B7J A;  1XWK A;  1BJX A;  4QL7 A;  1FOV A;  2PER A;  5HQP A;  4GTU A;  4YQU A;  5ELG A;  4PUR A;  1RW1 A;  2HSH A;  2XC2 A;  1DSB A;  1O81 A;  1ZL9 A;  3RAZ A;  3LFL A;  4EC0 A;  5HR0 A;  3KCM A;  1ILO A;  5DAL A;  3I9V 2;  5DAL B;  4ZL7 A;  5J41 A;  4K6X A;  5ABR A;  2QKE A;  5AIX A;  1Z9H A;  1TK0 B;  1EGR A;  2LRT A;  2I3Y A;  4L0U A;  3MYD A;  3TKP A;  2OAC A;  2YV7 A;  1EGO A;  1E6B A;  3G7I A;  2IJY A;  2H0H A;  4TOP A;  1ST9 A;  1W89 A;  3FKF A;  2GZY A;  5IMV A;  1A8L A;  4F2I A;  1X9W B;  1GUL A;  1V9W A;  3RPN A;  3TJG A;  5IOW A;  2XPE A;  1GTB A;  1XFL A; 
#chains in the Genus database with same CATH homology
 1B8X A;  1F6M C;  3Q6O A;  5E59 A;  3LW9 A;  2C3N A;  3IPZ A;  2HZE A;  2LJA A;  2HZE B;  5JCG A;  16GS A;  4HDE A;  3CSI A;  3KMN A;  5G5E A;  1AXD A;  1GUK A;  4K7I A;  4ILF A;  1SL1 B;  5ECN B;  2K8V A;  3L9U A;  2B1K A;  2I9H A;  3IAM 2;  3ZVJ D;  2OAD A;  1AUC A;  3VWW A;  3C7M A;  1PKZ A;  3CRT A;  3DML A;  1YKA A;  1NHY A;  3NOF A;  5FHI A;  5D9X A;  1XBS A;  3M1G A;  17GS A;  1PMT A;  5JCU A;  1GSS A;  3EVI A;  1VF1 A;  1WE0 A;  2H01 A;  1A0F A;  4EL1 A;  4K7O A;  2I1U A;  4JED A;  4K7N A;  1TTZ A;  1A2M A;  3ZIT A;  5GAN D;  1YKC A;  8GSS A;  2VD1 A;  2LNT A;  4TR1 A;  4TR1 B;  2RUF A;  4YKF A;  4HI7 A;  2NPB A;  5CO3 A;  3IV4 A;  4XHM A;  1VRS D;  1F9M A;  5IO0 A;  4BVX A;  4GCI A;  2VLU A;  3GKK A;  3IBH A;  4K5S A;  3VWV A;  1GWC A;  5J5N A;  4HJ2 A;  1YF1 A;  3CTF A;  4X0X A;  4J57 E;  1FHE A;  1FOH A;  1TRW A;  1A8Y A;  3A3T A;  3R2Q A;  2PN8 A;  2H1B A;  1BYE A;  2ZCT A;  4KSO A;  1YJ6 A;  1N2A A;  2VCW A;  1ON4 A;  9GSS A;  5IM9 A;  1HYU A;  2CAI A;  2GZP A;  4I97 A;  5CP1 A;  4AGS A;  4JR6 A;  4QQ7 A;  5J3R A;  3D21 A;  5ECO B;  2N5B A;  1RK4 A;  2A4V A;  2RM5 A;  2FNO A;  1SD8 A;  1H4O A;  1TRU A;  4MJA A;  2LQO A;  3HJO A;  1FVK A;  5C00 A;  4YQM A;  1XWA A;  1GP1 A;  3D22 A;  3KMO A;  2JAD A;  2RM6 A;  4EUY A;  2VL3 A;  1ZYQ B;  4O32 A;  2O89 A;  2PUK C;  1JZW A;  4F0C A;  1G6Y A;  1M2D A;  2E7P A;  2PBJ A;  4X4J A;  2R0C A;  4ICY A;  1WJK A;  1FW1 A;  2PVQ A;  3TOU A;  1MD4 A;  1EEM A;  2HLS A;  4MJB A;  3E9J B;  2GQL A;  3GYK A;  1PRX A;  2X4A A;  4RUV A;  1GUM A;  2EC4 A;  19GS A;  1OE7 A;  2EIO A;  1GSF A;  2GTU A;  4OFN A;  1ERU A;  3BOA A;  2C80 A;  20GS A;  3UOM A;  3ED3 A;  5F06 A;  2H6Y A;  2YAN A;  5AIS A;  5KN3 A;  5B6N A;  4N10 A;  4K2X A;  2LS5 A;  3LGC A;  1YQ1 A;  1VGL A;  1XW9 A;  2DJK A;  5F05 A;  2CV4 A;  5LCZ A;  4ZBA A;  4MJC A;  2B3S A;  1DBY A;  3VK9 A;  2B5Y A;  3W6G A;  5CRW A;  1NHO A;  4PX1 A;  13GS A;  3TKQ A;  2H70 A;  4TR0 A;  4L5L A;  3VUR A;  4IP6 A;  3MIX A;  1GTI A;  3DGQ A;  4IW9 A;  1QFN A;  4IHU A;  3TDG A;  2HI7 A;  4EVM A;  3VPQ A;  3HHV A;  7GSS A;  1SYX A;  5EL8 A;  2ZUP A;  4G2E A;  3LXZ A;  4TR4 A;  2MBS A;  11GS A;  4Z2U A;  4MJE A;  1PD2 1;  5KOX A;  4MNN A;  3ME8 A;  1SEN A;  1ZZY A;  4NMU A;  2G2Q A;  3WGX A;  4J56 E;  2RUE A;  3KTL A;  4ZIJ A;  1NW2 A;  1J9B A;  1R5P A;  3S9F A;  4ID0 A;  3QAW A;  1XZO A;  5IPH A;  3VPT A;  4PNG A;  5A5K A;  2YCD A;  5AN1 A;  2IFQ A;  4GXZ A;  3IK7 A;  4JU5 A;  2IFQ B;  1G7O A;  2C3T A;  3HVV A;  2C0G A;  1YEX A;  2C3Q A;  2H71 A;  1WPI A;  5CRH A;  4G19 A;  1WP0 A;  3F8U A;  3WGD A;  2JSZ A;  4G9H A;  2AUV A;  4NV2 A;  4FH8 A;  4ACS A;  2HSY A;  3FZ5 A;  1A2L A;  4N30 A;  4IEL A;  2B5X A;  5KN2 A;  3A2W A;  3DIE A;  4WR5 A;  2BTO T;  4OMV A;  3SWL A;  1ZYE A;  2XBI A;  2QC7 A;  4KND A;  4Q5N A;  22GS A;  2PWJ A;  5IIZ A;  5HFG A;  3FK8 A;  4HOJ A;  4I6X A;  1OC3 A;  4ECJ A;  2ZNM A;  3HJP A;  3M9J A;  2L6D A;  1TK5 B;  3G7J A;  2V2G A;  3IOS A;  4V1A p;  4PQI A;  3EPT A;  3FY7 A;  2HZF A;  2ON5 A;  4PUF C;  2UZ8 A;  4F03 A;  4TVE A;  3CMI A;  4ML6 A;  4PQH A;  4RQX A;  4ZL8 A;  4XRA A;  1SL2 B;  5JCW A;  1PSQ A;  4LMV A;  1EV9 A;  4XS6 A;  2M72 A;  1YEP A;  2I81 A;  4KCE A;  3D0Z A;  5ECI B;  4XCS A;  1IYI A;  5IPG A;  2H1G A;  5IQY A;  2IIY A;  3KP8 A;  4KDY A;  2VCV A;  4MF7 A;  3KD0 A;  4LL4 B;  1XPV A;  2VUP A;  4LMW A;  1RQM A;  4MA9 A;  3F4T A;  4PNF A;  1TP9 A;  4GF0 A;  4HJM A;  4NWY A;  1R26 A;  5ECS A;  2J9H A;  1ZYN A;  2H30 A;  2H1A A;  5IMF A;  5HR3 A;  2A2P A;  4BPY A;  5ENU A;  2LV3 A;  2LKU A;  5B8B A;  1AQW A;  3IE3 A;  1T3B A;  3BJ5 A;  1V40 A;  4AJ6 A;  2C0D A;  3KH7 A;  5G1K A;  4MAB A;  1B48 A;  1UVZ A;  2FGX A;  1QK8 A;  4ZBB A;  4O5Q A;  1AC1 A;  1K0C A;  1XOB A;  4USS A;  3GUR A;  3F4R A;  1AIU A;  2OE1 A;  3UL3 A;  3ZL5 A;  3GKX A;  1XCC A;  2VLT A;  5CYY A;  1OYJ A;  2FLS A;  4POL A;  1MDJ A;  1UN2 A;  3TB2 A;  2CA8 A;  2AHE A;  2GZZ A;  3VLN A;  2MMZ A;  5D73 A;  3KGK A;  5DJM A;  3JCM L;  3TOT A;  2BJX A;  2E0Q A;  3FEU A;  3LOR A;  1EOG A;  1XVW A;  1WRY A;  3A2V A;  1QQ2 A;  1SJ6 A;  2YJ7 A;  1ZMA A;  1JLW A;  5IOX A;  1SYR A;  4WEY A;  1GH2 A;  2YWN A;  3TGZ A;  1ACV A;  2N5F A;  4WKW A;  1EV4 A;  1M99 A;  1W4V A;  2HFD A;  3I43 A;  5COH A;  3ZTL A;  3IR4 A;  2HYX A;  4RI6 A;  1A23 A;  4D73 A;  2H74 A;  4D73 B;  4TRX A;  4OWY A;  1T00 A;  5ELA A;  1K3O A;  3KEB A;  3FZA A;  3HA9 A;  3RBT A;  3EU3 A;  5JWQ B;  2VOC A;  2WCI A;  1QMV A;  3F9U A;  3FYG A;  4ZBD A;  3D4T A;  2CX3 A;  2Z9S A;  2A2R A;  2H0I A;  1O8X A;  3I69 A;  4K2D A;  2K6V A;  1UA5 A;  2L57 A;  4Q5Q A;  4DSS A;  4CDO A;  4DSS B;  4OFT A;  2LNS A;  4IGJ A;  2H1D A;  4MZC A;  4F82 A;  4OD7 A;  1PN0 A;  5GSS A;  1XVQ A;  4L8E A;  2NVL A;  3GX8 A;  2CX4 A;  1ABA A;  3EE2 A;  3HVX A;  2GS3 A;  1OKD A;  1YF0 A;  4GST A;  2LQQ A;  2GDR A;  1S3D A;  1O6J A;  1PX6 A;  5G31 A;  3F6D A;  2IMI A;  1OKT A;  4BWS A;  3R3E A;  5DJL A;  4AF2 A;  3VWX A;  1SJZ A;  1NSW A;  4MH2 A;  3IA1 A;  5EY6 A;  3VI5 A;  1I5G A;  2EIQ A;  4JZQ A;  4HUA A;  1TOF A;  1MEK A;  2H66 A;  3F3Q A;  3GKM A;  3KH9 A;  1M0U A;  3G9B A;  5E4W A;  2OJL A;  4ZB8 A;  2FA4 A;  2B5E A;  1WWJ A;  1LU4 A;  4JBB A;  3E0U A;  3APO A;  3GFK A;  4CY8 A;  2AYT A;  1Z6N A;  4RQR A;  1CQH A;  1K0M A;  2VO4 A;  3CTG A;  1Z7R A;  2PVO C;  4K8M A;  2MYG A;  1A24 A;  2HXK A;  3Q18 A;  3QFA C;  1Y25 A;  1TRS A;  2GGT A;  1GSE A;  5CAX A;  2FWG A;  2JU5 A;  1JHB A;  3LG6 A;  5ID2 A;  1GNE A;  5A4U A;  1O7U A;  12GS A;  1V98 A;  2YWI A;  1TKD B;  2YOI A;  4OO4 A;  1B9Y C;  2K9F A;  4BVX B;  1Y6E A;  1GRX A;  2VCQ A;  4NPB A;  4NHZ A;  1EP7 A;  1Z6M A;  1TW9 A;  1THO A;  3V1W A;  3GA4 A;  2WFC A;  4GWR A;  3RHB A;  1Q4J A;  2LJR A;  4MF6 A;  2O85 A;  3GV1 A;  3D4M A;  3PGT A;  1IYH A;  1MD3 A;  3KP9 A;  1VF3 A;  3ZML A;  1PL2 A;  2KHP A;  5CRE A;  3A2X A;  4IQA A;  1FB6 A;  4E8H A;  1NM3 A;  2B1L A;  2HRK A;  5EVO A;  3GN3 A;  3IXR A;  2GVP A;  3C1R A;  5IMC A;  2KUC A;  3N9J A;  4YAV A;  3WT2 A;  4WF5 A;  2X8C A;  4NAX A;  3LEF A;  2CVB A;  2JZS A;  2MMO A;  3ZRE A;  1V2A A;  4G0L A;  3WT1 A;  2H6Z A;  1A0R P;  4ZB9 A;  1BQ7 A;  3ME7 A;  2FA8 A;  2FCH A;  4LA1 A;  1M2A A;  2GLR A;  2HSM A;  2MBT A;  3GRX A;  4BVY A;  2A4H A;  4BVY B;  1BAY A;  5CNW A;  2C1Y A;  1DUG A;  3TRP A;  4K0N A;  1T7P B;  3MSZ A;  4G10 A;  2WRT A;  3VI7 A;  1VF4 A;  1G7E A;  4L0W A;  4V2M A;  4TW5 A;  3L78 A;  3C8E A;  4LL1 B;  2CZ3 A;  4O7H A;  2B6M A;  2YPM A;  3TRX A;  1USB A;  1LBK A;  2X49 A;  2P31 A;  3RDW A;  3ERW A;  4HU9 A;  5LNK e;  1CQG A;  3GL3 A;  3ZVJ A;  3IRA A;  1C72 A;  1Z5Y E;  3IC8 A;  2YV9 A;  2XHF A;  2WUL A;  2R4V A;  4I2U A;  2R5G A;  3ZYW A;  2LEG A;  2HRA A;  2LTK A;  2NTO A;  3PPU A;  2RLI A;  2X8H A;  4KUN A;  2JSY A;  1B9X C;  4H86 A;  5F8B A;  4OFM A;  2P0G A;  2X99 A;  4MP4 A;  4N11 A;  2DIY A;  3HD5 A;  4ZIL A;  5G5F A;  2XBQ A;  1MTC A;  4HZ2 A;  3KXO A;  3I6A A;  5L71 A;  4NXI A;  4V2L A;  4EXJ A;  5AIV A;  5LD0 A;  1M9B A;  2AB6 A;  3P2A A;  2OE0 A;  5JWR B;  3E3E A;  3EYT A;  2H8L A;  3K8N A;  5D96 A;  3LXT A;  2IL3 A;  1URM A;  2NDO A;  3H8Q A;  1MDK A;  4JR4 A;  5ECH B;  1EP8 A;  1BX9 A;  18GS A;  3ZZX A;  3UVH A;  2CZ2 A;  4O92 A;  4WBR D;  2R0P A;  3ERF A;  3IHG A;  4QL9 A;  6GSX A;  4MF5 A;  1ZGN A;  2OA7 A;  3ZFB A;  2DJ3 A;  3ISO A;  2K18 A;  3NIV A;  1K3L A;  1TI1 A;  4V1A g;  3L9S A;  2OBI A;  3C1S A;  2GQK A;  1X0R A;  4IBP A;  1SD9 A;  3HY2 A;  2R3X A;  3ZLP A;  4TXO A;  2YJH A;  2O7K A;  5CRD A;  4TXO B;  2M46 A;  2DC5 A;  3IC4 A;  3BCI A;  5FWG A;  2FUG 2;  1O73 A;  4EKZ A;  1FB0 A;  1SL0 B;  1GNW A;  5IMZ A;  3H1N A;  2GT6 A;  3LYK A;  4IJI A;  2HRN A;  1GTU A;  5G30 A;  4Z2T A;  1J08 A;  4G0I A;  5KN1 A;  3EMX A;  1JFU A;  2LST A;  4L5O A;  1XWB A;  2F8F A;  4PQ1 A;  5EPF A;  4IQ1 A;  5ECK B;  1A2J A;  2FY6 A;  4JE1 A;  2AV4 A;  3DD3 A;  3MWH A;  2DLX A;  1OC9 A;  2IME A;  1OC9 B;  2MMA A;  5CRG A;  3CSJ A;  4K9Z A;  1X5E A;  1XIY A;  4O5R A;  1AW9 A;  4EDY A;  5B7C A;  4GRF A;  2LJK A;  2FD3 A;  2GSR A;  3M0F A;  4HQZ A;  1VF2 A;  4Z7X A;  4I8B A;  1K0A A;  3GST A;  2BMX A;  2L59 A;  3RPP A;  2DKH A;  3F6F A;  4YAP A;  1GUH A;  5J9C A;  5DQS A;  2DMM A;  4CY6 A;  3H93 A;  3GHA A;  3GIX A;  5HFI A;  1SKW B;  5KOW A;  3D6I A;  4X43 A;  3TJK A;  2VL2 C;  4BWQ A;  3FW2 A;  2R6K A;  2CVD A;  3GKN A;  2R0G A;  2LUS A;  3FZ9 A;  4KW6 A;  1O8W A;  2WS2 A;  3APS A;  1O85 A;  2H76 A;  1GSQ A;  2IWT A;  3IDV A;  1GTA A;  4I2T A;  4Z2R A;  4NV5 A;  1SK2 A;  3DRN A;  4CHS A;  2GST A;  4KB3 A;  1TDI A;  3HXS A;  3U6V A;  2V6K A;  4IJ3 A;  5IMA A;  1XWC A;  3KM6 A;  4WR4 A;  2GQM A;  4FQU A;  1M2B A;  1T4Y A;  4MK3 A;  3PIN A;  4EO3 A;  3HZ8 A;  2PPT A;  5INY A;  3TKS E;  3PH9 A;  4I5Q A;  5G1L A;  1F2E A;  2FHE A;  3MNG A;  5D8I A;  2O8V B;  4FYB A;  4WF4 A;  1BG5 A;  1MDI A;  3LYP A;  2MZC A;  2R2J A;  2REM A;  4KAE A;  1I9D A;  1FVJ A;  2YN1 A;  2VAF A;  5HR2 A;  4N0Z A;  3RHC A;  2H72 A;  3W8S A;  1GLP A;  1UC7 A;  5D9V A;  1F37 A;  2PGT A;  1K0D A;  4MH3 A;  3TJB A;  5H5R A;  1U87 A;  2WJU A;  2IMK A;  2TRX A;  3CYN A;  2IMF A;  1F3A A;  5GST A;  2O87 A;  3IK9 A;  2GT5 A;  1SK1 A;  1KBN A;  1PX7 A;  3J7Y b;  1EWX A;  4EIQ A;  2L6C A;  5HFK A;  2YWO A;  1X5C A;  4BL7 A;  4ULX A;  5HR1 A;  4BL7 B;  1XW5 A;  6GSY A;  1S3C A;  4POB A;  3J7Y k;  4CW9 A;  1JLV A;  3KIJ A;  3DWV A;  3IHQ A;  1GSD A;  4FIW A;  2E2M A;  3UJ1 A;  1X9S B;  4GSN A;  1GSY A;  2LRC A;  2FWH A;  3LJR A;  5DCH A;  4KGI A;  4G0K A;  3GTU A;  2JL4 A;  3GTU B;  3HKR A;  2L4Q A;  1E2Y A;  3CBU A;  3HJM A;  2TRC P;  2L4C A;  4TXV A;  1WMJ A;  2K8S A;  1TU7 A;  5AGY A;  1TXX A;  5KEJ A;  4MZW A;  1ZOF A;  4LLR A;  2FWF A;  2V6O A;  4POM A;  1U6T A;  1YDK A;  3DVX A;  1R7H A;  4AJ8 A;  1DE1 A;  5G2Z A;  1HD2 A;  5A4V A;  5BMU A;  3GSS A;  4Q5F A;  3AY8 A;  4KX4 A;  3UIW A;  2QSI A;  4J2F A;  2AJQ B;  2C0F A;  1ZCP A;  3A5I A;  3M3M A;  3CRU A;  1BED A;  2HE3 A;  5ECL B;  3IAS 2;  5ID2 B;  4OCE A;  1JZO A;  3PR8 A;  3TCO A;  4A5P A;  4HEA 2;  3EWL A;  5ECR B;  2FWE A;  3C73 A;  1M7T A;  1U3I A;  1PGT A;  4MZB A;  3DYR A;  4GSS A;  5DDL A;  1WIK A;  3P90 A;  1J0F A;  3FRC A;  6GSV A;  3ZMK A;  1WOU A;  4XIH A;  3CSH A;  4EE0 A;  4N0V A;  3NZN A;  4X1U A;  4E8E A;  3O6T A;  3GUS A;  4XTS A;  4AJ7 A;  1OC8 A;  3ERG A;  3O3T A;  2QA1 A;  2CQ9 A;  5IMD A;  3UVT A;  1K0O A;  1T4Z A;  2DSA A;  4KCA A;  1KNG A;  2H6X A;  2TIR A;  2VM2 A;  4K1F A;  3BD2 A;  5B8A A;  1XXU A;  2VL9 A;  3LWA A;  4XRD A;  1B4Q A;  3TKR A;  4XS4 A;  2L5L A;  1AQV A;  3FMW A;  4XS1 A;  4XS4 B;  5DAK A;  2F3M A;  2E2G A;  5DAK B;  5B6M A;  4ZXG A;  3MDK A;  2MMN A;  3KJY A;  3LQ7 A;  4KF9 A;  4YH2 A;  10GS A;  2YWM A;  1G6W A;  3EC3 A;  4GQC A;  1G0T A;  2KLX A;  2VM1 A;  3QD9 A;  1LJR A;  6GSW A;  5ECM B;  4PUA A;  4WXT A;  4TN8 A;  3Q74 A;  3QAV A;  2H19 A;  2YNX A;  1AAZ A;  1TRV A;  2JZR A;  2VCX A;  4KH7 A;  1KEB A;  1OAZ A;  3DXB A;  1X9M B;  2ES7 A;  3GL5 A;  2OKA A;  4JRR A;  1SKS B;  1N8J A;  3FR9 A;  4ECB A;  3EUR A;  3VWU A;  1SK0 A;  3P8W A;  3QPM A;  2DML A;  3DKS A;  1HNC A;  3QDN A;  4FYC A;  3P7X A;  2F51 A;  2CAQ A;  3TJF A;  4BA7 A;  4NHW A;  4YQV A;  1ZYP A;  1XOA A;  4TR3 A;  3L4N A;  5H5S A;  3EMP A;  3QFB C;  1V57 A;  2CVK A;  4P3Y B;  3GH9 A;  2WZ9 A;  1T8E B;  2YZH A;  4IVF A;  2X64 A;  4IKH A;  3U5R E;  2NBS A;  3ZRD A;  2OBK A;  1ERV A;  4GQF A;  4ECI A;  2GSQ A;  3EU4 A;  2PMT A;  3VFI A;  3A5W A;  2IN3 A;  2WGR A;  1TJD A;  4V2N A;  3DVW A;  2JZT A;  5J9B A;  1X5D A;  3H79 A;  2KP2 A;  3FR6 A;  2VL2 A;  4OO5 A;  2LRN A;  4EDZ A;  3GX0 A;  3FR3 A;  4IN0 A;  2B7K A;  3D5J A;  2JAC A;  2H0G A;  2C4J A;  4DSQ A;  4TKY A;  3UBL A;  5F07 A;  4ZB6 A;  3F4S A;  5J4U A;  4KDU A;  1GL8 A;  1FG4 A;  2H73 A;  3HVS A;  4F9Z A;  1HNA A;  2DJ2 A;  2X8G A;  5DQY A;  3F0I A;  1U3A A;  1PQN A;  4KE3 A;  1SU9 A;  4IP1 A;  2EIR A;  1Z7P A;  1M9A A;  3QAG A;  4FYU A;  4PTS A;  3L0H A;  1ERT A;  4IS0 A;  2R37 A;  2F8A A;  3UAP A;  2IMD A;  4HU7 A;  1YZX A;  5DBQ A;  4MLY A;  1QXH A;  3OR5 A;  4K5R A;  3ZIV A;  2F9S A;  3KTB A;  5GAP D;  1QUW A;  3LSZ A;  1XW6 A;  3TKS A;  1ML6 A;  2A2S A;  1OVN A;  4F0B A;  5KN0 A;  4MMM A;  1AQX A;  1K0N A;  5DVB A;  5D9W A;  3M9K A;  6GST A;  4HQS A;  4K0G A;  3M8N A;  1ERW A;  4PGT A;  2AAW A;  1V58 A;  1EOH A;  4HS1 A;  1GSU A;  4MCU A;  2HT9 A;  5A4W A;  2N5A A;  4WET A;  2CT6 A;  2PU9 C;  2WDU A;  3UMA A;  3BBY A;  1PN9 A;  3FZ4 A;  2L5O A;  3H4K A;  3WGE A;  5ECP B;  3UAR A;  3MAK A;  2OE3 A;  2XPD A;  4KA0 A;  3EIN A;  1JZR A;  2RII A;  3WD6 A;  1F3B A;  3QOU A;  1R4W A;  1K3Y A;  2VCT A;  3C71 A;  3L9V A;  3WYW A;  1PKW A;  3KZQ A;  1FAA A;  5H5Q A;  2V1M A;  2P5Q A;  5ECQ B;  4Q5R A;  3GH6 A;  1Z3E A;  2HRF A;  3HZ4 A;  4MPF A;  1OE8 A;  5JWO B;  1YY7 A;  3DEX A;  3F63 A;  3UBK A;  4HZ4 A;  1FO5 A;  1TI3 A;  1EZK A;  3BCK A;  4MDC A;  5FT3 A;  3Q19 A;  2ALB A;  2P5R A;  4EIP A;  2KOK A;  4O5U A;  4FO5 A;  1Q98 A;  2V41 A;  1JZD A;  2QGV A;  1XWG A;  2DJ1 A;  1THX A;  4POK A;  3CXG A;  2HNL A;  5BRT A;  1H75 A;  2WB9 A;  3W8J A;  4DEJ A;  4KDX A;  2DJ0 A;  6GSS A;  4WBJ A;  3UEM A;  2KP1 A;  3F3R A;  4PXO A;  2I4A A;  1KTE A;  1SKR B;  2YP6 A;  6GSU A;  14GS A;  4ZL9 A;  4ML1 A;  5DCG A;  1TU8 A;  2G0F A;  3TUE A;  3N5O A;  4YKG A;  5GZZ B;  2VCZ A;  2VLV A;  4EF0 A;  3GMF A;  2J23 A;  5D93 A;  3HYP A;  2H75 A;  1U88 A;  2ON7 A;  3TJJ A;  3O76 A;  4RI7 A;  4OCF A;  2QA2 A;  2VIM A;  2DKI A;  3QMX A;  1R5A A;  2GSS A;  3QR6 A;  1T1V A;  1PA3 A;  2C0E A;  4KSM A;  3TRQ A;  3ZIJ A;  5IO2 A;  5D9T A;  1K0B A;  3G7Y A;  2D2Z A;  5C04 A;  4ECC A;  3FHK A;  3SBC A;  3TKS C;  1EEJ A;  4DVC A;  5F0G A;  1HNB A;  2M80 A;  1B4P A;  1TK8 B;  1S3A A;  3US3 A;  2DJJ A;  1GLQ A;  1PL1 A;  3HCZ A;  3QCP A;  3HDC A;  4GLT A;  3APQ A;  1DE2 A;  4MPG A;  2IPA A;  1HQO A;  3ZFL A;  1SJI A;  4DSR A;  4ISD A;  2C8U A;  2YZU A;  1QGV A;  2DBC A;  2DIZ A;  2V32 A;  3GNJ A;  2VD0 A;  2B7J A;  1XWK A;  1BJX A;  4QL7 A;  1FOV A;  2PER A;  5HQP A;  4GTU A;  4YQU A;  5ELG A;  4PUR A;  1RW1 A;  2HSH A;  2XC2 A;  1DSB A;  1O81 A;  1ZL9 A;  3RAZ A;  3LFL A;  4EC0 A;  5HR0 A;  3KCM A;  1ILO A;  5DAL A;  3I9V 2;  5DAL B;  4ZL7 A;  5J41 A;  4K6X A;  5ABR A;  2QKE A;  5AIX A;  1Z9H A;  1TK0 B;  1EGR A;  2LRT A;  2I3Y A;  4L0U A;  3MYD A;  3TKP A;  2OAC A;  2YV7 A;  1EGO A;  1E6B A;  3G7I A;  2IJY A;  2H0H A;  4TOP A;  1ST9 A;  1W89 A;  3FKF A;  2GZY A;  5IMV A;  1A8L A;  4F2I A;  1X9W B;  1GUL A;  1V9W A;  3RPN A;  3TJG A;  5IOW A;  2XPE A;  1GTB A;  1XFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...