3ZL5A

Crystal structure of schistosoma mansoni peroxiredoxin i c48s mutant with one decamer in the asu
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
162
structure length
162
Chain Sequence
LLPNRPAPEFKGQAVINGEFKEICLKDYRGKYVVLFFYPADFTFVSPTEIIAFSDQVEEFNSRNCQVIACSTDSQYSHLAWDNLDRKSGGLGHMKIPLLADRKQEISKAYGVFDEEDGNAFRGLFIIDPNGILRQITINDKPVGRSVDETLRLLDAFQFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PEROXIREDOXIN I
publication title Switching between the Alternative Structures and Functions of a 2-Cys Peroxiredoxin, by Site-Directed Mutagenesis
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 54
structure length 162
sequence length 162
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zl5A00
2L6CA 1VF2A 3D0ZA 3LG6A 2RM6A 1TOFA 1A0FA 3E9JB 4MJAA 4YH2A 1EP7A 2RUFA 1OC3A 3LGCA 5G5EA 3UL3A 3QR6A 5CRGA 3TKPA 2M72A 2C0DA 2DLXA 2L5LA 3F8UA 2H75A 1OC8A 2C3NA 1Z7RA 2PPTA 1R26A 5CNWA 2GZYA 4ISDA 4K1FA 3SBCA 1BJXA 3VWWA 2B5XA 1EV4A 4YAVA 2DJ0A 1A0RP 2M46A 2PUKC 2GSSA 3KZQA 2P5RA 3KMNA 3ZLPA 1SYRA 3A3TA 5DJMA 3VI7A 3H8QA 1Z9HA 1QUWA 1OVNA 3TUEA 1QFNA 4DEJA 1GWCA 1MDIA 3DIEA 2HI7A 3KCMA 4KDYA 3F4SA 4K6XA 3VPTA 1WRYA 3E3EA 3EE2A 4L5LA 1G6WA 3IXRA 2MMAA 1PX7A 4ZB6A 4GQFA 4XS6A 4MJCA 1T8EB 4OO5A 3GL3A 3ZVJA 4G19A 1YKAA 4TR4A 2O87A 1GL8A 4EVMA 16GSA 4RI7A 2LRCA 1EGOA 2YPMA 1XW5A 4GWRA 3I6AA 1BG5A 3N9JA 1AC1A 5E4WA 5FT3A 1OKTA 1FG4A 2K8VA 3FW2A 4JR4A 4KSOA 5G30A 5HR2A 2MBSA 2MBTA 4RQRA 2VM1A 2FA8A 4F0BA 3IK7A 2H6YA 3I69A 1NHYA 1PL2A 1GNWA 3L78A 4KUNA 3ED3A 5L71A 5G5FA 4X0XA 2VL3A 3MAKA 2BTOT 4EXJA 1X5EA 3MNGA 4NHZA 3UJ1A 2WCIA 4GLTA 4N0ZA 2QGVA 1S3DA 5AGYA 1MD4A 2F9SA 3GTUA 3BCIA 3LYPA 4IGJA 1A23A 4X43A 2CV4A 3H1NA 5KN0A 5CRDA 2DBCA 2VOCA 3ZMKA 3IR4A 2V6KA 2MZCA 4I2TA 4IP1A 5IMCA 2A2RA 4POMA 3GSSA 2LTKA 4CDOA 1QQ2A 3EYTA 4XS1A 1XXUA 5ENUA 5ELGA 5ECPB 2XC2A 1I5GA 1RK4A 4D73B 1I9DA 2I9HA 1GSEA 1TRWA 1X0RA 1ZGNA 5FHIA 2WB9A 2YWMA 2YZUA 4HU7A 1FB6A 3O3TA 3IHQA 4AJ6A 3IOSA 4OWYA 3A2VA 1EEMA 2GS3A 2H6ZA 3CTGA 5F05A 4JBBA 3BD2A 3BBYA 2JACA 3PR8A 3IC4A 2WJUA 3J7Yb 2K8SA 1F3AA 1FVJA 3TJFA 1ML6A 2KHPA 4L0WA 4K8MA 4WF5A 1SK1A 3LEFA 2H76A 4HU9A 6GSXA 1X9MB 2R4VA 4FH8A 4N0VA 4PXOA 1JFUA 1PQNA 1ZCPA 2N5BA 2GZPA 2QC7A 2LQOA 2HRFA 3CXGA 3DRNA 2CAQA 4GCIA 2CVDA 1DE2A 3HKRA 3GX8A 3CYNA 2GQMA 2GT5A 1GTIA 3ZMLA 3VK9A 3GTUB 4ZIJA 2LJAA 3D5JA 2OE0A 5IPGA 5CREA 2CT6A 2EIQA 3RBTA 1M99A 3GV1A 4TRXA 4NMUA 5IO0A 1FW1A 1XOAA 2HT9A 5G1KA 2WGRA 4BA7A 5DJLA 1K0DA 1HD2A 2FCHA 5GAND 3ZTLA 1N2AA 2IMFA 1GSFA 3EINA 3WGEA 2KP1A 9GSSA 4TOPA 3TKRA 4MF5A 1XWGA 2JZTA 1O6JA 3ERWA 2FLSA 3TJKA 2H74A 2K6VA 1C72A 3TJJA 4IJ3A 4TXVA 1SJ6A 2H0HA 10GSA 1A24A 2L4CA 2R37A 2B6MA 2YV7A 4WXTA 3P8WA 2YV9A 1JZRA 3V1WA 1PA3A 5DQSA 1YEXA 1ON4A 2VD1A 1YF0A 3FK8A 1A2JA 1MDKA 2DJJA 1E6BA 4QL7A 1CQGA 5J41A 2XBIA 1UN2A 3EMPA 4IELA 4ILFA 2XBQA 1Y6EA 1HQOA 2DJ2A 4TVEA 2O8VB 5LD0A 1OE7A 1K0BA 4WF4A 3VWXA 2LS5A 2I3YA 3FEUA 1M9BA 3UOMA 3IBHA 2R3XA 3C8EA 1XZOA 1SKSB 2O7KA 1SL2B 3QDNA 4K7IA 3ME8A 1R4WA 2ZUPA 1VF3A 4I97A 3KTLA 1K0CA 4DSRA 4QL9A 1WWJA 4WETA 3EMXA 4XRDA 3DD3A 3CRUA 1G7EA 4EUYA 5DAKB 2F51A 3QAVA 3HYPA 3P90A 2H1BA 1WJKA 4FYUA 6GSUA 2B7JA 2NPBA 4J56E 2J9HA 1SK2A 2CX4A 1K0OA 2O85A 4GTUA 4YQMA 2RUEA 4CHSA 2HZFA 2OBIA 1J08A 2VLVA 1TDIA 1SYXA 4OMVA 3FYGA 4ECCA 5D96A 4EDZA 2YJ7A 1SKRB 1B9XC 2B7KA 2DMLA 1VF4A 3QFAC 3ZYWA 5H5SA 2GGTA 4PUFC 4MF6A 3QOUA 3S9FA 3G9BA 4MMMA 2YZHA 2JU5A 1TP9A 2NBSA 4HJ2A 5B6MA 4N11A 1XOBA 2QSIA 1W89A 2LNTA 2KLXA 2LKUA 3ZFBA 5ECOB 4RUVA 4K0GA 2GLRA 4OFNA 5JWOB 5FWGA 4OFTA 1RQMA 2H6XA 3VI5A 1ILOA 2VLUA 3WGDA 2X8CA 4ACSA 4LLRA 1PKZA 2MMOA 3ISOA 3JCML 1XBSA 2ES7A 3AY8A 6GSTA 2E2MA 4MLYA 3M1GA 3HVVA 3TRXA 4MP4A 2WRTA 6GSWA 4PQHA 3CSIA 3FR6A 2KOKA 2VCXA 4KE3A 1T7PB 3BJ5A 1ZOFA 5CO3A 2H19A 1WPIA 3F4RA 2K18A 1TK8B 2GDRA 1A8YA 3WGXA 4I5QA 2LRTA 3FRCA 1PX6A 1S3CA 2FWGA 2AAWA 2GSTA 3M9KA 5ECQB 4FO5A 1VGLA 2YN1A 4ZILA 5G31A 5LCZA 1SENA 2PMTA 3BCKA 4MJEA 1F37A 5D9TA 4Q5QA 4G9HA 5IMVA 4XCSA 5HFGA 1EOHA 4BWQA 2H01A 3LXZA 19GSA 5B7CA 5AISA 5D93A 1TJDA 1EV9A 2C4JA 1HNAA 5D73A 5J4UA 1PN9A 2GTUA 3IRAA 3UAPA 4MABA 1BEDA 1NW2A 1F3BA 4MPFA 4OCFA 3GURA 1H4OA 2E2GA 2Z9SA 1J9BA 5IOWA 4TN8A 2D2ZA 2GQLA 1XWKA 3HJMA 4OCEA 1GTUA 1H75A 4HUAA 2WS2A 2EIOA 2WULA 3UARA 4D73A 2PU9C 1U87A 3C71A 1R5AA 3UIWA 4ZBDA 5A4WA 4NAXA 4EC0A 2JSZA 1EGRA 5HQPA 5KN2A 5EPFA 1FO5A 2G0FA 2DIZA 2AYTA 3F63A 4HZ4A 3NZNA 4PGTA 2EIRA 2V1MA 2H66A 4P3YB 1Z7PA 1HYUA 4KX4A 3F0IA 3HJOA 3QCPA 1GP1A 4XS4A 2MMZA 3F3RA 3W8JA 1B9YC 5KEJA 5ECKB 1GSSA 4H86A 4RI6A 3VWUA 2VL2C 1U3AA 1DUGA 3FR3A 4K9ZA 3QMXA 3GH9A 1HNCA 1MD3A 1FVKA 1Q98A 3QFBC 3GUSA 3SWLA 3Q6OA 1BQ7A 3TKSA 5DVBA 4PNGA 2V2GA 2PVQA 4O92A 1O73A 2L5OA 2FGXA 2I4AA 3GNJA 4OD7A 3L9VA 3QD9A 3M9JA 2AJQB 4WEYA 2DIYA 1SD9A 2C3TA 2IIYA 1OC9B 2H73A 5DCGA 1M2AA 2LUSA 4LL1B 2FA4A 3IAM2 2OACA 4V1Ap 5AN1A 1BAYA 2IMDA 4HDEA 1ERWA 1G6YA 5H5RA 2IMIA 2H1AA 1ZZYA 5A4VA 5LNKe 5KN3A 2LV3A 4ZL8A 2DMMA 2V6OA 1WP0A 3IV4A 2P5QA 3VPQA 4DSQA 2FWEA 4GF0A 2VL9A 2LJRA 4V1Ag 5DDLA 3HJPA 5JCGA 20GSA 3LQ7A 4WKWA 4HOJA 1KNGA 3HVXA 1O81A 2JL4A 5GZZB 4ECIA 3TDGA 1GTAA 2VCZA 3KIJA 4MZCA 3TJGA 4XS4B 4WBJA 1TTZA 11GSA 3LWAA 1XPVA 4GSSA 5DBQA 3A2XA 2F8FA 2XPEA 2OADA 2FWHA 3HA9A 2CZ2A 4IHUA 2HFDA 1ZMAA 1CQHA 2H8LA 2B1LA 2QKEA 2FNOA 3TB2A 2KUCA 5ABRA 1PGTA 3C7MA 4OFMA 5ECRB 1YJ6A 2H0GA 1AQXA 2X8GA 4JZQA 3DVXA 2H1DA 2GZZA 1DBYA 2ZNMA 3RHCA 2LNSA 3ZRDA 1M7TA 4JR6A 1URMA 1Z6MA 3GKMA 2JADA 2A2SA 1EOGA 2DC5A 2A4VA 3IK9A 5DAKA 2IMKA 4AF2A 1SL1B 3EURA 2MMNA 4K7OA 1JLVA 5ID2A 3O6TA 3DKSA 3APOA 5A4UA 2I81A 1MDJA 3VLNA 3KP8A 3UBLA 4O7HA 5EL8A 2FUG2 6GSYA 2C8UA 4V2NA 4KDXA 2TIRA 2IFQB 3GHAA 5C04A 1YDKA 4BWSA 5G2ZA 4PQ1A 3GH6A 2H1GA 4MF7A 3DWVA 2BMXA 2CX3A 2XPDA 3F6FA 4EE0A 3U5RE 5D9VA 4FIWA 1R5PA 2LEGA 4PX1A 2OKAA 1NSWA 4DVCA 1GUHA 3LORA 4HS1A 3F9UA 3TGZA 3GX0A 4Z7XA 3ZL5A 1GRXA 4GSNA 3G7IA 3KP9A 5DALB 1QK8A 2PGTA 2NVLA 4ZBAA 4F82A 4V2LA 5HR1A 3RAZA 2NTOA 2GQKA 5CRHA 2F8AA 2RLIA 4QQ7A 3F3QA 3KM6A 1V57A 5GSSA 1PD21 3CRTA 1K0NA 2B3SA 3QAGA 4BVXA 2HZEB 3E0UA 2F3MA 4LA1A 3TRPA 1Y25A 3CSHA 3I43A 5IMZA 3ZIJA 2E0QA 4PNFA 3PGTA 2XHFA 1U3IA 1X9SB 1GSYA 2H30A 1QMVA 2H70A 5ECLB 4HQSA 2DJ3A 5ID2B 3HD5A 4HQZA 4KAEA 1EP8A 3GRXA 3HXSA 1SU9A 2N5AA 3M0FA 3UMAA 3VURA 4F0CA 5J9CA 4OO4A 4JE1A 4L0UA 2L4QA 1TKDB 2ON7A 2YNXA 1JZDA 4MK3A 1FOVA 3A2WA 3TRQA 4GSTA 3IAS2 2H72A 1V98A 3ERGA 3IE3A 1K0AA 3EU4A 3NIVA 4KCAA 4LMVA 4E8HA 4TR1B 2AUVA 1K0MA 3TOUA 1XW9A 2C3QA 1ZYQB 3GA4A 1TK5B 4HI7A 2V32A 3D4MA 4EKZA 4MDCA 3DVWA 3PH9A 2L59A 1AQWA 1V2AA 4G10A 17GSA 3P7XA 4MZWA 1DE1A 4POBA 5CYYA 1AXDA 2GT6A 5G1LA 3US3A 2JZRA 4X1UA 2JSYA 5GSTA 4E8EA 4K0NA 1YF1A 3DYRA 4V2MA 2X99A 2IN3A 1SJIA 2HLSA 4ZXGA 5B8BA 1B4QA 1AQVA 1XVQA 2LJKA 1ERUA 1K3YA 1R7HA 2LRNA 3HDCA 2CA8A 1AAZA 5KN1A 2VCTA 5JWRB 4F2IA 22GSA 2WDUA 5ECMB 3EWLA 3EC3A 1KEBA 2HSHA 2RIIA 2OA7A 3I9V2 1JLWA 2OJLA 12GSA 4GQCA 4PUAA 3W6GA 2C0GA 2FWFA 4CW9A 1W4VA 1TRUA 2B5YA 3N5OA 3ZVJD 2VAFA 4ID0A 1MEKA 1RW1A 4IQ1A 3FR9A 4XTSA 3UEMA 4NXIA 4HJMA 5IIZA 3Q18A 1TW9A 2X8HA 3VFIA 4L8EA 4N30A 4WR4A 1TK0B 4KNDA 2DJ1A 1BX9A 3MDKA 3ZFLA 3FY7A 1Q4JA 1FAAA 3FZ4A 2YWNA 1O8XA 3KJYA 1OC9A 2H71A 3KD0A 1X9WB 5CP1A 5IO2A 1FHEA 1K3OA 3ME7A 4YQVA 2OE1A 1AUCA 2CAIA 1B48A 2EC4A 4MZBA 4IW9A 4JEDA 5HFKA 1G0TA 2R5GA 3G7YA 1VRSD 1F2EA 4TXOB 2HRNA 1A8LA 1KBNA 3M3MA 4Q5NA 2AB6A 4DSSB 5AIVA 3GMFA 2CQ9A 2PERA 3DMLA 1TU7A 3UVTA 1XCCA 1LBKA 1GLPA 4KCEA 2ZCTA 2AV4A 4LMWA 4EDYA 2B1KA 3HCZA 2WFCA 4IBPA 3H93A 1ZYEA 2REMA 4J57E 3IA1A 3MSZA 2ALBA 3C1SA 4Q5FA 3EU3A 1T4YA 3LFLA 2FHEA 2N5FA 4MH3A 1WOUA 1BYEA 4EF0A 1AIUA 5ECSA 13GSA 4NV5A 3J7Yk 5B8AA 4ZB8A 2HXKA 4HEA2 4RQXA 2RM5A 3GSTA 1PL1A 1YQ1A 1NM3A 2HYXA 3LSZA 2DJKA 1V9WA 1NHOA 1S3AA 5EY6A 2V41A 3KMOA 4XHMA 5DQYA 1XWBA 3DGQA 2C0FA 1SL0B 1THXA 3KH9A 3L0HA 2OE3A 1OKDA 1JZOA 1TI3A 5JCWA 4TR3A 3H79A 4KGIA 5F8BA 3ZZXA 4TKYA 4TW5A 5C00A 2FY6A 1K3LA 1UA5A 2YP6A 3U6VA 2VLTA 4ML6A 1YZXA 3KXOA 4K2DA 5D8IA 4EO3A 18GSA 3DXBA 5AIXA 5F0GA 1EEJA 1F6MC 4JU5A 4YQUA 4KSMA 5D9XA 5ELAA 2ON5A 1A2LA 2VO4A 3L9UA 1XIYA 1GUMA 5DCHA 3LJRA 3MWHA 2R6KA 4KA0A 4NPBA 3APQA 1U6TA 2IFQA 3K8NA 4WBRD 2C0EA 4GRFA 1TU8A 2CZ3A 3L4NA 2VCVA 5HR0A 3CBUA 4IQAA 1SJZA 3GL5A 6GSVA 1B8XA 2HE3A 2IL3A 1E2YA 4MH2A 2YWIA 3DEXA 1THOA 3IPZA 4N10A 1ERVA 2H0IA 1GNEA 1TXXA 2IJYA 1X5DA 5IQYA 1YY7A 5JWQB 5DALA 1Z5YE 1QXHA 3RHBA 4AJ8A 4XIHA 4TR0A 5J3RA 1MTCA 2GVPA 4BPYA 1DSBA 1OE8A 1GTBA 1LJRA 4NHWA 4F9ZA 3GN3A 2PBJA 3EVIA 2HZEA 5IM9A 2VL2A 1VF1A 1TRSA 2E7PA 3TKSE 4KW6A 2IPAA 2YJHA 1YKCA 2YANA 3APSA 1PSQA 3D21A 3QAWA 3KGKA 1USBA 1F9MA 4KDUA 7GSSA 2GSQA 1GLQA 4NV2A 3GIXA 3NOFA 2LSTA 1OYJA 3VWVA 1J0FA 1M2DA 4NWYA 1YEPA 4IS0A 4ZBBA 3ZIVA 3OR5A 5GAPD 3FZ9A 4MPGA 1EZKA 2NDOA 4ZB9A 1M9AA 2CVBA 3PINA 4ECBA 1KTEA 2FD3A 3KH7A 3TCOA 4IJIA 3Q74A 1B4PA 3TOTA 4MJBA 4TR1A 1LU4A 3RPPA 3D22A 4MCUA 4POLA 3F4TA 4L5OA 1UVZA 4I8BA 3M8NA 3HZ8A 1XWAA 1T00A 2L57A 1SKWB 1IYHA 3LYKA 1V58A 1U88A 3GKNA 2C80A 5D9WA 4BVYA 3CSJA 3BOAA 3FZ5A 1A2MA 1N8JA 1XVWA 5JCUA 1IYIA 3WD6A 3GKXA 4KB3A 5ECHB 4ZL7A 6GSSA 3FKFA 4AGSA 3C73A 4K7NA 3IDVA 1O85A 2AHEA 4Q5RA 3HVSA 3LXTA 1T3BA 2HNLA 2K9FA 2O89A 4IP6A 1PMTA 2C1YA 4WR5A 1QGVA 1O8WA 4O32A 4IN0A 1AW9A 2VUPA 5IMDA 2WZ9A 1G7OA 4GXZA 4POKA 1O7UA 3C1RA 4MA9A 1Z3EA 2L6DA 2J23A 4LL4B 1WMJA 1Z6NA 1XFLA 3KTBA 5EVOA 1UC7A 3TKQA 4G2EA 2YCDA 14GSA 2DSAA 4I6XA 5J5NA 3W8SA 5CAXA 1GH2A 4IVFA 1ACVA 3P2AA 4I2UA 1T4ZA 2OBKA 3CTFA 2BJXA 2I1UA 1GSDA 4IKHA 5J9BA 2MYGA 4J2FA 5F07A 2PWJA 1ST9A 2IMEA 3H4KA 3CMIA 3R2QA 2P31A 1GUKA 1JHBA 1GSQA 4PURA 1GSUA 3UVHA 3GFKA 4FYBA 3ZITA 2VCQA 2CVKA 1T1VA 1WE0A 3QPMA 1TI1A 1OAZA 2P0GA 4JRRA 4KH7A 2M80A 3KEBA 3TJBA 3HZ4A 1PRXA 3O76A 5H5QA 4XRAA 5IMFA 4YAPA 2VIMA 3G7JA 3ZREA 3D6IA 4TXOA 3A5WA 2GSRA 2HSYA 2KP2A 3WT2A 3WT1A 5F06A 1JZWA 3D4TA 3Q19A 4ZL9A 1WIKA 3F6DA 2TRXA 4DSSA 5IMAA 1SD8A 2VM2A 1GULA 1M0UA 3GYKA 4ULXA 4PQIA 1ABAA 2YWOA 1SK0A 2G2QA 5E59A 2PVOC 4O5RA 4AJ7A 1HNBA 2LQQA 1FB0A 2B5EA 5IOXA 2VD0A 4HZ2A 2JZSA 1XW6A 1EWXA 3FZAA 4F03A 5IPHA 3WYWA 3L9SA 5INYA 1PKWA 5HR3A 2R2JA 3FHKA 1ZL9A 3HHVA 5A5KA 2VCWA 4EL1A 2TRCP 3RDWA 5ECIB 3GKKA 2PN8A 1XWCA 1V40A 1X5CA 4BL7A 1ERTA 3HY2A 5ECNB 3TKSC 2IWTA 4FYCA 5CRWA 3UBKA 4ML1A 3ERFA 2X64A 5HFIA 3RPNA 1M2BA 5B6NA 1TRVA 4ECJA 2YOIA 8GSSA 5COHA
chains in the Genus database with same CATH superfamily
2L6CA 1VF2A 3D0ZA 3LG6A 2RM6A 1TOFA 1A0FA 3E9JB 4MJAA 4YH2A 1EP7A 2RUFA 1OC3A 3LGCA 5G5EA 3UL3A 3QR6A 5CRGA 3TKPA 2M72A 2C0DA 2DLXA 2L5LA 3F8UA 2H75A 1OC8A 2C3NA 1Z7RA 2PPTA 4K5SA 1R26A 5CNWA 2GZYA 4ISDA 4K1FA 3SBCA 1BJXA 3VWWA 2B5XA 1EV4A 4YAVA 2DJ0A 1A0RP 2M46A 2PUKC 2GSSA 3KZQA 2P5RA 3KMNA 3ZLPA 1SYRA 3A3TA 5DJMA 3VI7A 3H8QA 1Z9HA 1QUWA 1OVNA 3TUEA 1QFNA 4DEJA 1GWCA 1MDIA 3DIEA 2HI7A 3KCMA 4KDYA 3F4SA 4K6XA 3VPTA 1WRYA 3E3EA 3EE2A 4L5LA 1G6WA 3IXRA 2MMAA 1PX7A 4ZB6A 4GQFA 4XS6A 4MJCA 1T8EB 2QA1A 4OO5A 3GL3A 3ZVJA 4G19A 1YKAA 4TR4A 2O87A 1GL8A 3A5IA 4EVMA 16GSA 4RI7A 2LRCA 1EGOA 2YPMA 1XW5A 4GWRA 3I6AA 1BG5A 3N9JA 1AC1A 5E4WA 5FT3A 1OKTA 1FG4A 2K8VA 3FW2A 4JR4A 4KSOA 5G30A 5HR2A 2MBSA 2MBTA 4RQRA 2VM1A 2FA8A 4F0BA 3IK7A 2H6YA 3I69A 1NHYA 1PL2A 1GNWA 3L78A 4KUNA 3ED3A 5L71A 5G5FA 4X0XA 2VL3A 3MAKA 2BTOT 4EXJA 1X5EA 3MNGA 4NHZA 3UJ1A 2WCIA 4GLTA 4N0ZA 2QGVA 1S3DA 5AGYA 1MD4A 2F9SA 3GTUA 3BCIA 3LYPA 4IGJA 1A23A 4X43A 2CV4A 3H1NA 5KN0A 5CRDA 2DBCA 2VOCA 3ZMKA 3IR4A 2V6KA 2MZCA 4I2TA 4IP1A 5IMCA 2A2RA 4POMA 3GSSA 2LTKA 1FOHA 4CDOA 1QQ2A 3PPUA 3EYTA 4XS1A 1XXUA 5ENUA 5ELGA 5ECPB 2XC2A 1I5GA 1RK4A 1ZYNA 3EPTA 4D73B 1I9DA 2I9HA 5BMUA 1GSEA 1TRWA 1X0RA 1ZGNA 5FHIA 2WB9A 2YWMA 2YZUA 4HU7A 1FB6A 3O3TA 3IHQA 4AJ6A 3IOSA 4OWYA 3A2VA 1EEMA 2GS3A 2H6ZA 3CTGA 5F05A 4JBBA 3BD2A 3BBYA 2JACA 3PR8A 3IC4A 2WJUA 4PTSA 3J7Yb 2K8SA 1F3AA 1FVJA 3TJFA 1ML6A 2KHPA 4L0WA 4K8MA 4WF5A 1SK1A 3LEFA 2H76A 4HU9A 6GSXA 1X9MB 2R4VA 4FH8A 4N0VA 4PXOA 1JFUA 1PQNA 1ZCPA 2N5BA 2GZPA 2QC7A 2LQOA 2HRFA 3CXGA 3DRNA 2CAQA 4GCIA 4G0IA 2CVDA 1DE2A 3HKRA 3GX8A 3CYNA 2GQMA 2GT5A 1GTIA 3ZMLA 3VK9A 3GTUB 4ZIJA 2LJAA 3D5JA 2OE0A 5IPGA 5CREA 2CT6A 2EIQA 3RBTA 1M99A 3GV1A 4TRXA 4NMUA 5IO0A 1FW1A 1XOAA 2HT9A 5G1KA 2WGRA 4BA7A 5DJLA 1K0DA 1HD2A 2FCHA 5GAND 3ZTLA 1N2AA 2IMFA 1GSFA 3EINA 3WGEA 2KP1A 9GSSA 4TOPA 3TKRA 4MF5A 1XWGA 2JZTA 4Z2TA 1O6JA 3ERWA 2FLSA 3TJKA 2H74A 2K6VA 1C72A 3TJJA 4IJ3A 4TXVA 1SJ6A 2H0HA 10GSA 1A24A 2L4CA 2R37A 2B6MA 2YV7A 4WXTA 3P8WA 2YV9A 1JZRA 3V1WA 1PA3A 5DQSA 1YEXA 1ON4A 2VD1A 1YF0A 3FK8A 1A2JA 1MDKA 2DJJA 1E6BA 4QL7A 1CQGA 5J41A 2XBIA 1UN2A 3EMPA 4IELA 4ILFA 2XBQA 1Y6EA 1HQOA 2DJ2A 4TVEA 2O8VB 5LD0A 1OE7A 1K0BA 1M3JA 4WF4A 3VWXA 2LS5A 4Z2RA 2I3YA 3FEUA 1M9BA 3UOMA 3IBHA 2R3XA 3C8EA 1XZOA 1SKSB 2O7KA 1SL2B 3QDNA 4K7IA 4CY6A 3ME8A 1R4WA 2ZUPA 1VF3A 4I97A 3KTLA 1K0CA 4DSRA 4QL9A 1PFOA 1WWJA 4WETA 3EMXA 4Z2UA 4XRDA 3DD3A 3CRUA 1G7EA 4EUYA 4G0KA 5DAKB 2F51A 3QAVA 3HYPA 3P90A 2H1BA 1WJKA 4FYUA 6GSUA 2B7JA 2NPBA 4J56E 2J9HA 1SK2A 2CX4A 1K0OA 2O85A 4GTUA 4YQMA 2RUEA 4CHSA 2HZFA 2OBIA 1J08A 2VLVA 1TDIA 1SYXA 4MNNA 4OMVA 3FYGA 4ECCA 5D96A 4EDZA 2YJ7A 1SKRB 1B9XC 2B7KA 2DMLA 1VF4A 3QFAC 3ZYWA 3MIXA 5H5SA 2DKHA 2GGTA 4PUFC 4MF6A 3QOUA 3S9FA 3G9BA 4MMMA 2YZHA 2JU5A 1TP9A 2NBSA 4HJ2A 5B6MA 4N11A 1XOBA 2QSIA 1W89A 2LNTA 2KLXA 2LKUA 3ZFBA 5ECOB 4RUVA 4K0GA 2GLRA 4OFNA 5JWOB 5FWGA 4OFTA 1RQMA 2H6XA 3VI5A 1ILOA 2VLUA 3WGDA 2X8CA 4ACSA 4LLRA 1PKZA 2MMOA 4BVXB 3ISOA 3JCML 1XBSA 2ES7A 3AY8A 6GSTA 4O5UA 2E2MA 4MLYA 3M1GA 3HVVA 3TRXA 4MP4A 2WRTA 6GSWA 4PQHA 3CSIA 3FR6A 2KOKA 2VCXA 4KE3A 1T7PB 3BJ5A 1ZOFA 5CO3A 2H19A 1WPIA 3F4RA 2K18A 1TK8B 2GDRA 1A8YA 3WGXA 4I5QA 2LRTA 3FRCA 1PX6A 1S3CA 2FWGA 2AAWA 2GSTA 3M9KA 5ECQB 4FO5A 1VGLA 2YN1A 4ZILA 5G31A 5LCZA 1SENA 2PMTA 3CQFA 3BCKA 4MJEA 1F37A 5D9TA 4Q5QA 4G9HA 5IMVA 4XCSA 5HFGA 1EOHA 4BWQA 2H01A 3LXZA 19GSA 4HSCX 5B7CA 5AISA 5D93A 1TJDA 1EV9A 2C4JA 1HNAA 5D73A 5J4UA 1PN9A 2GTUA 3IRAA 3UAPA 4MABA 1BEDA 1NW2A 1F3BA 4MPFA 4OCFA 3GURA 1H4OA 2E2GA 2Z9SA 4EIQA 1J9BA 5IOWA 4TN8A 2D2ZA 4X4JA 2GQLA 1XWKA 3HJMA 4OCEA 1GTUA 1H75A 4HUAA 2WS2A 2EIOA 2WULA 3UARA 4D73A 2PU9C 1U87A 3C71A 1R5AA 3UIWA 4ZBDA 5A4WA 4NAXA 4EC0A 2JSZA 1EGRA 2QA2A 5HQPA 5KN2A 5EPFA 1FO5A 2G0FA 2DIZA 2AYTA 3F63A 4HZ4A 3NZNA 4PGTA 2EIRA 2V1MA 2H66A 4P3YB 1Z7PA 1HYUA 4KX4A 3F0IA 3HJOA 3QCPA 1GP1A 4XS4A 2MMZA 3F3RA 3W8JA 1B9YC 5KEJA 5ECKB 1GSSA 4H86A 4RI6A 3VWUA 2VL2C 1U3AA 1DUGA 3FR3A 4K9ZA 3QMXA 3GH9A 1HNCA 1MD3A 1FVKA 1Q98A 3QFBC 4O5QA 3GUSA 3SWLA 3Q6OA 1BQ7A 3TKSA 5DVBA 4PNGA 2V2GA 2PVQA 4O92A 1O73A 2L5OA 2FGXA 2I4AA 3HVNA 3GNJA 4OD7A 3L9VA 3QD9A 3M9JA 2AJQB 4WEYA 2DIYA 1SD9A 2C3TA 2IIYA 1OC9B 2H73A 1PN0A 5DCGA 1M2AA 2LUSA 4LL1B 2FA4A 3IAM2 2OACA 4V1Ap 5AN1A 1BAYA 2IMDA 4HDEA 1ERWA 1G6YA 5H5RA 2IMIA 2H1AA 1ZZYA 1XG8A 5A4VA 5LNKe 5KN3A 2LV3A 4ZL8A 2DMMA 2V6OA 1WP0A 3IV4A 2P5QA 3VPQA 4DSQA 2FWEA 4GF0A 2VL9A 2LJRA 4V1Ag 5DDLA 3HJPA 5JCGA 20GSA 3LQ7A 4WKWA 4HOJA 1KNGA 3R3EA 3HVXA 1O81A 4K5RA 2JL4A 5GZZB 4ECIA 3TDGA 1GTAA 4YKGA 2VCZA 4K2XA 3KIJA 4MZCA 3TJGA 4XS4B 4WBJA 1TTZA 11GSA 3LWAA 1XPVA 4GSSA 5DBQA 3A2XA 2F8FA 2XPEA 2OADA 3FMWA 2FWHA 3HA9A 2CZ2A 4IHUA 2HFDA 1ZMAA 1CQHA 2H8LA 2B1LA 2QKEA 2FNOA 3TB2A 2KUCA 5ABRA 1PGTA 3C7MA 4OFMA 1YJ6A 5ECRB 2H0GA 1AQXA 2X8GA 4JZQA 3DVXA 2H1DA 2GZZA 1DBYA 2ZNMA 3RHCA 2LNSA 3ZRDA 1M7TA 4JR6A 1URMA 1Z6MA 3GKMA 2JADA 2A2SA 1EOGA 2DC5A 2A4VA 3IK9A 5DAKA 2IMKA 4AF2A 1SL1B 3EURA 2MMNA 4K7OA 1JLVA 5ID2A 3O6TA 3DKSA 3APOA 5A4UA 2I81A 1MDJA 3VLNA 3KP8A 3UBLA 4O7HA 5EL8A 2FUG2 6GSYA 2C8UA 4V2NA 4KDXA 2TIRA 2IFQB 3GHAA 5C04A 1YDKA 4BWSA 5G2ZA 4PQ1A 3GH6A 2H1GA 4MF7A 3DWVA 2BMXA 2CX3A 2XPDA 3F6FA 4EE0A 3U5RE 5D9VA 4FIWA 1R5PA 2LEGA 4PX1A 2OKAA 1NSWA 2UZ8A 4DVCA 1GUHA 3LORA 4HS1A 3F9UA 3TGZA 3GX0A 4Z7XA 3ZL5A 1GRXA 4GSNA 3G7IA 3KP9A 5DALB 1QK8A 2PGTA 2NVLA 4ZBAA 4F82A 4V2LA 5HR1A 3RAZA 2NTOA 2GQKA 5CRHA 2F8AA 2RLIA 4QQ7A 3F3QA 3KM6A 1V57A 5GSSA 1PD21 3CRTA 1K0NA 2B3SA 3QAGA 4BVXA 2HZEB 3E0UA 2F3MA 4LA1A 3TRPA 1Y25A 3CSHA 3I43A 5IMZA 3ZIJA 2E0QA 3MYDA 4PNFA 3PGTA 2XHFA 1U3IA 1X9SB 1GSYA 2H30A 1QMVA 2H70A 5ECLB 4HQSA 2DJ3A 5ID2B 3HD5A 4HQZA 4KAEA 1EP8A 3GRXA 2HRAA 3HXSA 1SU9A 2N5AA 4ICYA 3M0FA 3UMAA 3VURA 4F0CA 5J9CA 4FQUA 4OO4A 4JE1A 4L0UA 2L4QA 2R0CA 1TKDB 2ON7A 2YNXA 1JZDA 4MK3A 1FOVA 3A2WA 3TRQA 4GSTA 3IAS2 2H72A 1V98A 3ERGA 3IE3A 1K0AA 3EU4A 3NIVA 4KCAA 4LMVA 4E8HA 4TR1B 2AUVA 1K0MA 3TOUA 1XW9A 2C3QA 1ZYQB 3GA4A 1TK5B 4HI7A 2V32A 3D4MA 4EKZA 4MDCA 3DVWA 3PH9A 2L59A 1AQWA 1V2AA 4G10A 17GSA 3P7XA 4MZWA 1DE1A 4POBA 4BVYB 5CYYA 1AXDA 2GT6A 5G1LA 3US3A 2JZRA 4X1UA 2JSYA 5GSTA 4E8EA 4K0NA 1YF1A 3DYRA 4V2MA 2X99A 2IN3A 1SJIA 2HLSA 4ZXGA 5B8BA 1B4QA 1AQVA 1XVQA 2LJKA 1ERUA 1K3YA 1R7HA 4USSA 2LRNA 3HDCA 2CA8A 1AAZA 5KN1A 2VCTA 5JWRB 4F2IA 22GSA 2WDUA 5ECMB 2A4HA 3EC3A 3EWLA 1KEBA 2HSHA 2RIIA 2OA7A 3I9V2 1JLWA 2OJLA 12GSA 4GQCA 4PUAA 3W6GA 2C0GA 2FWFA 4CW9A 1W4VA 1TRUA 2B5YA 4KF9A 2A2PA 3N5OA 3ZVJD 2VAFA 4ID0A 1MEKA 1RW1A 4IQ1A 3FR9A 4XTSA 3UEMA 4NXIA 4HJMA 5IIZA 3Q18A 1TW9A 2X8HA 3VFIA 4L8EA 4N30A 4WR4A 1TK0B 4KNDA 2DJ1A 1BX9A 3MDKA 3ZFLA 4BIKA 3FY7A 3LW9A 1Q4JA 1FAAA 3FZ4A 2YWNA 1O8XA 3KJYA 1OC9A 2H71A 3KD0A 1X9WB 5CP1A 5IO2A 1FHEA 1K3OA 3ME7A 4YQVA 2OE1A 1AUCA 2CAIA 1B48A 2EC4A 4MZBA 4IW9A 4JEDA 5HFKA 1G0TA 2R5GA 3G7YA 1VRSD 1F2EA 2X49A 4TXOB 2HRNA 1A8LA 1KBNA 3M3MA 4Q5NA 2AB6A 3IC8A 4DSSB 3GMFA 5AIVA 2CQ9A 2PERA 3DMLA 1TU7A 3UVTA 1XCCA 1LBKA 1GLPA 4KCEA 2ZCTA 2AV4A 4LMWA 4EDYA 2B1KA 3HCZA 2WFCA 4IBPA 3H93A 1ZYEA 2REMA 4J57E 3IA1A 3MSZA 2ALBA 3C1SA 4Q5FA 3EU3A 1T4YA 2HRKA 3LFLA 2FHEA 2N5FA 4MH3A 1WOUA 1BYEA 4BL7B 4EF0A 1AIUA 5ECSA 13GSA 4NV5A 3J7Yk 5B8AA 4ZB8A 2HXKA 4HEA2 4RQXA 2RM5A 3GSTA 1PL1A 1YQ1A 1NM3A 2HYXA 3LSZA 2DJKA 1V9WA 1NHOA 1S3AA 5EY6A 2V41A 3KMOA 4XHMA 5DQYA 1XWBA 3DGQA 2C0FA 1SL0B 1THXA 3KH9A 3L0HA 2OE3A 1OKDA 1JZOA 1TI3A 5JCWA 4TR3A 3H79A 4KGIA 5F8BA 3ZZXA 4TKYA 4TW5A 5C00A 2FY6A 1K3LA 1UA5A 2YP6A 3U6VA 2VLTA 4ML6A 1YZXA 4A5PA 3KXOA 4K2DA 5D8IA 4EO3A 2X4AA 18GSA 3DXBA 5AIXA 5F0GA 1EEJA 1F6MC 4JU5A 4YQUA 4KSMA 4YKFA 5D9XA 5ELAA 2ON5A 1A2LA 2VO4A 3L9UA 1XIYA 1GUMA 5DCHA 3LJRA 3MWHA 2R6KA 4KA0A 4NPBA 3APQA 1U6TA 2IFQA 3K8NA 4WBRD 2C0EA 4GRFA 1TU8A 2CZ3A 3L4NA 2VCVA 5HR0A 2DKIA 3CBUA 4IQAA 1SJZA 3GL5A 6GSVA 1B8XA 2HE3A 2IL3A 1E2YA 4CY8A 4MH2A 2YWIA 3DEXA 1THOA 3IPZA 4EIPA 4N10A 1ERVA 2H0IA 1GNEA 1TXXA 2IJYA 1X5DA 5IQYA 1YY7A 5JWQB 5DALA 1Z5YE 1QXHA 3RHBA 4AJ8A 4G0LA 4XIHA 2HSMA 4TR0A 5J3RA 1MTCA 2GVPA 4BPYA 1DSBA 1OE8A 1GTBA 1LJRA 4NHWA 4F9ZA 3GN3A 2PBJA 3EVIA 2HZEA 5IM9A 2VL2A 1VF1A 1TRSA 2E7PA 3TKSE 4KW6A 2IPAA 2YJHA 1YKCA 2YANA 3APSA 1PSQA 3D21A 3QAWA 3KGKA 1USBA 1F9MA 4KDUA 7GSSA 2GSQA 1GLQA 4NV2A 3GIXA 3NOFA 2LSTA 1OYJA 3VWVA 1J0FA 1M2DA 4NWYA 1YEPA 4IS0A 5KOXA 4ZBBA 3ZIVA 3OR5A 5GAPD 3FZ9A 4MPGA 1EZKA 2NDOA 4ZB9A 1M9AA 2CVBA 3PINA 4ECBA 1KTEA 2FD3A 3KH7A 3TCOA 4IJIA 3Q74A 1B4PA 3TOTA 4MJBA 4TR1A 1LU4A 3RPPA 3D22A 4MCUA 4POLA 1S3RA 3F4TA 4L5OA 1UVZA 4I8BA 3M8NA 3HZ8A 1XWAA 1T00A 2L57A 1SKWB 1IYHA 3LYKA 1V58A 1U88A 3GKNA 2C80A 5D9WA 4BVYA 3CSJA 3BOAA 3FZ5A 1A2MA 1N8JA 1XVWA 5JCUA 1IYIA 3WD6A 3GKXA 4KB3A 5ECHB 4ZL7A 6GSSA 3FKFA 4AGSA 3C73A 4K7NA 3IDVA 5BRTA 1O85A 2R0PA 2AHEA 4Q5RA 3HVSA 3LXTA 1M3IA 1T3BA 2HNLA 2K9FA 2O89A 4IP6A 1PMTA 2C1YA 4WR5A 1QGVA 1O8WA 4O32A 4IN0A 1AW9A 2VUPA 5IMDA 2WZ9A 1G7OA 4GXZA 4POKA 1O7UA 3C1RA 4MA9A 1Z3EA 2L6DA 2J23A 4LL4B 1WMJA 1Z6NA 1XFLA 3KTBA 5EVOA 1UC7A 3TKQA 4G2EA 2YCDA 14GSA 2DSAA 4I6XA 5J5NA 3W8SA 5CAXA 1GH2A 4IVFA 1ACVA 1ZYPA 3P2AA 4I2UA 1T4ZA 2OBKA 3CTFA 2BJXA 2I1UA 1GSDA 4IKHA 5J9BA 2MYGA 4J2FA 5F07A 2PWJA 1ST9A 2IMEA 3H4KA 3CMIA 3R2QA 2P31A 1GUKA 1JHBA 1GSQA 4PURA 1GSUA 3UVHA 3GFKA 4FYBA 3ZITA 2VCQA 2CVKA 1T1VA 1WE0A 3QPMA 1TI1A 1OAZA 2P0GA 4JRRA 4KH7A 2M80A 3KEBA 3TJBA 3HZ4A 1PRXA 3O76A 2R0GA 5H5QA 4XRAA 5IMFA 4YAPA 2VIMA 3G7JA 3ZREA 3D6IA 4TXOA 3A5WA 2GSRA 2HSYA 2KP2A 3IHGA 3WT2A 3WT1A 5F06A 1JZWA 3D4TA 3Q19A 4ZL9A 1WIKA 3F6DA 2TRXA 4DSSA 5IMAA 1SD8A 2VM2A 1GULA 1M0UA 3GYKA 4ULXA 4PQIA 1ABAA 2YWOA 1SK0A 2G2QA 5E59A 2PVOC 4O5RA 4AJ7A 1HNBA 2LQQA 1FB0A 2B5EA 5IOXA 2VD0A 4HZ2A 2JZSA 1XW6A 1EWXA 3FZAA 4F03A 5IPHA 3WYWA 3L9SA 5INYA 1PKWA 5HR3A 2R2JA 3FHKA 1ZL9A 3HHVA 5A5KA 2VCWA 4EL1A 5KOWA 2TRCP 3RDWA 5ECIB 3GKKA 2PN8A 1XWCA 1V40A 1X5CA 4BL7A 1ERTA 3HY2A 5ECNB 3TKSC 2IWTA 4FYCA 5CRWA 3UBKA 4ML1A 3ERFA 2X64A 5HFIA 3RPNA 1M2BA 5B6NA 1TRVA 4ECJA 2YOIA 8GSSA 5COHA
chains in the Genus database with same CATH topology
2L6CA 1VF2A 3D0ZA 3LG6A 2RM6A 1TOFA 1A0FA 3E9JB 4MJAA 4YH2A 1EP7A 2RUFA 1OC3A 3LGCA 5G5EA 3UL3A 3QR6A 5CRGA 3TKPA 2M72A 2C0DA 2DLXA 2L5LA 3F8UA 2H75A 1OC8A 2C3NA 1Z7RA 2PPTA 4K5SA 1R26A 5CNWA 2GZYA 4ISDA 4K1FA 3SBCA 1BJXA 3VWWA 2B5XA 1EV4A 4YAVA 2DJ0A 1A0RP 2M46A 2PUKC 2GSSA 3KZQA 2P5RA 3KMNA 3ZLPA 1SYRA 3A3TA 5DJMA 3VI7A 3H8QA 1Z9HA 1QUWA 1OVNA 3TUEA 1QFNA 4DEJA 1GWCA 1MDIA 3DIEA 2HI7A 3KCMA 4KDYA 3F4SA 4K6XA 3VPTA 1WRYA 3E3EA 3EE2A 4L5LA 1G6WA 3IXRA 2MMAA 1PX7A 4ZB6A 4GQFA 4XS6A 4MJCA 1T8EB 2QA1A 4OO5A 3GL3A 3ZVJA 4G19A 1YKAA 4TR4A 2O87A 1GL8A 3A5IA 4EVMA 16GSA 4RI7A 2LRCA 1EGOA 2YPMA 1XW5A 4GWRA 3I6AA 1BG5A 3N9JA 1AC1A 5E4WA 5FT3A 1OKTA 1FG4A 2K8VA 3FW2A 4JR4A 4KSOA 5G30A 5HR2A 2MBSA 2MBTA 4RQRA 2VM1A 2FA8A 4F0BA 3IK7A 2H6YA 3I69A 1NHYA 1PL2A 1GNWA 3L78A 4KUNA 3ED3A 5L71A 5G5FA 4X0XA 2VL3A 3MAKA 2BTOT 4EXJA 1X5EA 3MNGA 4NHZA 3UJ1A 2WCIA 4GLTA 4N0ZA 2QGVA 1S3DA 5AGYA 1MD4A 2F9SA 3GTUA 3BCIA 3LYPA 4IGJA 1A23A 4X43A 2CV4A 3H1NA 5KN0A 5CRDA 2DBCA 2VOCA 3ZMKA 3IR4A 2V6KA 2MZCA 4I2TA 4IP1A 5IMCA 2A2RA 4POMA 3GSSA 2LTKA 1FOHA 4CDOA 1QQ2A 3PPUA 3EYTA 4XS1A 1XXUA 5ENUA 5ELGA 5ECPB 2XC2A 1I5GA 1RK4A 1ZYNA 3EPTA 4D73B 1I9DA 2I9HA 5BMUA 1GSEA 1TRWA 1X0RA 1ZGNA 5FHIA 2WB9A 2YWMA 2YZUA 4HU7A 1FB6A 3O3TA 3IHQA 4AJ6A 3IOSA 4OWYA 3A2VA 1EEMA 2GS3A 2H6ZA 3CTGA 5F05A 4JBBA 3BD2A 3BBYA 2JACA 3PR8A 3IC4A 2WJUA 4PTSA 3J7Yb 2K8SA 1F3AA 1FVJA 3TJFA 1ML6A 2KHPA 4L0WA 4K8MA 4WF5A 1SK1A 3LEFA 2H76A 4HU9A 6GSXA 1X9MB 2R4VA 4FH8A 4N0VA 4PXOA 1JFUA 1PQNA 1ZCPA 2N5BA 2GZPA 2QC7A 2LQOA 2HRFA 3CXGA 3DRNA 2CAQA 4GCIA 4G0IA 2CVDA 1DE2A 3HKRA 3GX8A 3CYNA 2GQMA 2GT5A 1GTIA 3ZMLA 3VK9A 3GTUB 4ZIJA 2LJAA 3D5JA 2OE0A 5IPGA 5CREA 2CT6A 2EIQA 3RBTA 1M99A 3GV1A 4TRXA 4NMUA 5IO0A 1FW1A 1XOAA 2HT9A 5G1KA 2WGRA 4BA7A 5DJLA 1K0DA 1HD2A 2FCHA 5GAND 3ZTLA 1N2AA 2IMFA 1GSFA 3EINA 3WGEA 2KP1A 9GSSA 4TOPA 3TKRA 4MF5A 1XWGA 2JZTA 4Z2TA 1O6JA 3ERWA 2FLSA 3TJKA 2H74A 2K6VA 1C72A 3TJJA 4IJ3A 4TXVA 1SJ6A 2H0HA 10GSA 1A24A 2L4CA 2R37A 2B6MA 2YV7A 4WXTA 3P8WA 2YV9A 1JZRA 3V1WA 1PA3A 5DQSA 1YEXA 1ON4A 2VD1A 1YF0A 3FK8A 1A2JA 1MDKA 2DJJA 1E6BA 4QL7A 1CQGA 5J41A 2XBIA 1UN2A 3EMPA 4IELA 4ILFA 2XBQA 1Y6EA 1HQOA 2DJ2A 4TVEA 2O8VB 5LD0A 1OE7A 1K0BA 4WF4A 3VWXA 2LS5A 4Z2RA 2I3YA 3FEUA 1M9BA 3UOMA 3IBHA 2R3XA 3C8EA 1XZOA 1SKSB 2O7KA 1SL2B 3QDNA 4K7IA 4CY6A 3ME8A 1R4WA 2ZUPA 1VF3A 4I97A 3KTLA 1K0CA 4DSRA 4QL9A 1WWJA 4WETA 3EMXA 4Z2UA 4XRDA 3DD3A 3CRUA 1G7EA 4EUYA 4G0KA 5DAKB 2F51A 3QAVA 3HYPA 3P90A 2H1BA 1WJKA 4FYUA 6GSUA 2B7JA 2NPBA 4J56E 2J9HA 1SK2A 2CX4A 1K0OA 2O85A 4GTUA 4YQMA 2RUEA 4CHSA 2HZFA 2OBIA 1J08A 2VLVA 1TDIA 1SYXA 4MNNA 4OMVA 3FYGA 4ECCA 5D96A 4EDZA 2YJ7A 1SKRB 1B9XC 2B7KA 2DMLA 1VF4A 3QFAC 3ZYWA 3MIXA 5H5SA 2DKHA 2GGTA 4PUFC 4MF6A 3QOUA 3S9FA 3G9BA 4MMMA 2YZHA 2JU5A 1TP9A 2NBSA 4HJ2A 5B6MA 4N11A 1XOBA 2QSIA 1W89A 2LNTA 2KLXA 2LKUA 3ZFBA 5ECOB 4RUVA 4K0GA 2GLRA 4OFNA 5JWOB 5FWGA 4OFTA 1RQMA 2H6XA 3VI5A 1ILOA 2VLUA 3WGDA 2X8CA 4ACSA 4LLRA 1PKZA 2MMOA 4BVXB 3ISOA 3JCML 1XBSA 2ES7A 3AY8A 6GSTA 4O5UA 2E2MA 4MLYA 3M1GA 3HVVA 3TRXA 4MP4A 2WRTA 6GSWA 4PQHA 3CSIA 3FR6A 2KOKA 2VCXA 4KE3A 1T7PB 3BJ5A 1ZOFA 5CO3A 2H19A 1WPIA 3F4RA 2K18A 1TK8B 2GDRA 1A8YA 3WGXA 4I5QA 2LRTA 3FRCA 1PX6A 1S3CA 2FWGA 2AAWA 2GSTA 3M9KA 5ECQB 4FO5A 1VGLA 2YN1A 4ZILA 5G31A 5LCZA 1SENA 2PMTA 3BCKA 4MJEA 1F37A 5D9TA 4Q5QA 4G9HA 5IMVA 4XCSA 5HFGA 1EOHA 4BWQA 2H01A 3LXZA 19GSA 5B7CA 5AISA 5D93A 1TJDA 1EV9A 2C4JA 1HNAA 5D73A 5J4UA 1PN9A 2GTUA 3IRAA 3UAPA 4MABA 1BEDA 1NW2A 1F3BA 4MPFA 4OCFA 3GURA 1H4OA 2E2GA 2Z9SA 4EIQA 1J9BA 5IOWA 4TN8A 2D2ZA 4X4JA 2GQLA 1XWKA 3HJMA 4OCEA 1GTUA 1H75A 4HUAA 2WS2A 2EIOA 2WULA 3UARA 4D73A 2PU9C 1U87A 3C71A 1R5AA 3UIWA 4ZBDA 5A4WA 4NAXA 4EC0A 2JSZA 1EGRA 2QA2A 5HQPA 5KN2A 5EPFA 1FO5A 2G0FA 2DIZA 2AYTA 3F63A 4HZ4A 3NZNA 4PGTA 2EIRA 2V1MA 2H66A 4P3YB 1Z7PA 1HYUA 4KX4A 3F0IA 3HJOA 3QCPA 1GP1A 4XS4A 2MMZA 3F3RA 3W8JA 1B9YC 5KEJA 5ECKB 1GSSA 4H86A 4RI6A 3VWUA 2VL2C 1U3AA 1DUGA 3FR3A 4K9ZA 3QMXA 3GH9A 1HNCA 1MD3A 1FVKA 1Q98A 3QFBC 4O5QA 3GUSA 3SWLA 3Q6OA 1BQ7A 3TKSA 5DVBA 4PNGA 2V2GA 2PVQA 4O92A 1O73A 2L5OA 2FGXA 2I4AA 3GNJA 4OD7A 3L9VA 3QD9A 3M9JA 2AJQB 4WEYA 2DIYA 1SD9A 2C3TA 2IIYA 1OC9B 2H73A 1PN0A 5DCGA 1M2AA 2LUSA 4LL1B 2FA4A 3IAM2 2OACA 4V1Ap 5AN1A 1BAYA 2IMDA 4HDEA 1ERWA 1G6YA 5H5RA 2IMIA 2H1AA 1ZZYA 5A4VA 5LNKe 5KN3A 2LV3A 4ZL8A 2DMMA 2V6OA 1WP0A 3IV4A 2P5QA 3VPQA 4DSQA 2FWEA 4GF0A 2VL9A 2LJRA 4V1Ag 5DDLA 3HJPA 5JCGA 20GSA 3LQ7A 4WKWA 4HOJA 1KNGA 3R3EA 3HVXA 1O81A 4K5RA 2JL4A 5GZZB 4ECIA 3TDGA 1GTAA 4YKGA 2VCZA 4K2XA 3KIJA 4MZCA 3TJGA 4XS4B 4WBJA 1TTZA 11GSA 3LWAA 1XPVA 4GSSA 5DBQA 3A2XA 2F8FA 2XPEA 2OADA 3FMWA 2FWHA 3HA9A 2CZ2A 4IHUA 2HFDA 1ZMAA 1CQHA 2H8LA 2B1LA 2QKEA 2FNOA 3TB2A 2KUCA 5ABRA 1PGTA 3C7MA 4OFMA 1YJ6A 5ECRB 2H0GA 1AQXA 2X8GA 4JZQA 3DVXA 2H1DA 2GZZA 1DBYA 2ZNMA 3RHCA 2LNSA 3ZRDA 1M7TA 4JR6A 1URMA 1Z6MA 3GKMA 2JADA 2A2SA 1EOGA 2DC5A 2A4VA 3IK9A 5DAKA 2IMKA 4AF2A 1SL1B 3EURA 2MMNA 4K7OA 1JLVA 5ID2A 3O6TA 3DKSA 3APOA 5A4UA 2I81A 1MDJA 3VLNA 3KP8A 3UBLA 4O7HA 5EL8A 2FUG2 6GSYA 2C8UA 4V2NA 4KDXA 2TIRA 2IFQB 3GHAA 5C04A 1YDKA 4BWSA 5G2ZA 4PQ1A 3GH6A 2H1GA 4MF7A 3DWVA 2BMXA 2CX3A 2XPDA 3F6FA 4EE0A 3U5RE 5D9VA 4FIWA 1R5PA 2LEGA 4PX1A 2OKAA 1NSWA 2UZ8A 4DVCA 1GUHA 3LORA 4HS1A 3F9UA 3TGZA 3GX0A 4Z7XA 3ZL5A 1GRXA 4GSNA 3G7IA 3KP9A 5DALB 1QK8A 2PGTA 2NVLA 4ZBAA 4F82A 4V2LA 5HR1A 3RAZA 2NTOA 2GQKA 5CRHA 2F8AA 2RLIA 4QQ7A 3F3QA 3KM6A 1V57A 5GSSA 1PD21 3CRTA 1K0NA 2B3SA 3QAGA 4BVXA 2HZEB 3E0UA 2F3MA 4LA1A 3TRPA 1Y25A 3CSHA 3I43A 5IMZA 3ZIJA 2E0QA 3MYDA 4PNFA 3PGTA 2XHFA 1U3IA 1X9SB 1GSYA 2H30A 1QMVA 2H70A 5ECLB 4HQSA 2DJ3A 5ID2B 3HD5A 4HQZA 4KAEA 1EP8A 3GRXA 2HRAA 3HXSA 1SU9A 2N5AA 4ICYA 3M0FA 3UMAA 3VURA 4F0CA 5J9CA 4FQUA 4OO4A 4JE1A 4L0UA 2L4QA 2R0CA 1TKDB 2ON7A 2YNXA 1JZDA 4MK3A 1FOVA 3A2WA 3TRQA 4GSTA 3IAS2 2H72A 1V98A 3ERGA 3IE3A 1K0AA 3EU4A 3NIVA 4KCAA 4LMVA 4E8HA 4TR1B 2AUVA 1K0MA 3TOUA 1XW9A 2C3QA 1ZYQB 3GA4A 1TK5B 4HI7A 2V32A 3D4MA 4EKZA 4MDCA 3DVWA 3PH9A 2L59A 1AQWA 1V2AA 4G10A 17GSA 3P7XA 4MZWA 1DE1A 4POBA 4BVYB 5CYYA 1AXDA 2GT6A 5G1LA 3US3A 2JZRA 4X1UA 2JSYA 5GSTA 4E8EA 4K0NA 1YF1A 3DYRA 4V2MA 2X99A 2IN3A 1SJIA 2HLSA 4ZXGA 5B8BA 1B4QA 1AQVA 1XVQA 2LJKA 1ERUA 1K3YA 1R7HA 4USSA 2LRNA 3HDCA 2CA8A 1AAZA 5KN1A 2VCTA 5JWRB 4F2IA 22GSA 2WDUA 5ECMB 2A4HA 3EC3A 3EWLA 1KEBA 2HSHA 2RIIA 2OA7A 3I9V2 1JLWA 2OJLA 12GSA 4GQCA 4PUAA 3W6GA 2C0GA 2FWFA 4CW9A 1W4VA 1TRUA 2B5YA 4KF9A 2A2PA 3N5OA 3ZVJD 2VAFA 4ID0A 1MEKA 1RW1A 4IQ1A 3FR9A 4XTSA 3UEMA 4NXIA 4HJMA 5IIZA 3Q18A 1TW9A 2X8HA 3VFIA 4L8EA 4N30A 4WR4A 1TK0B 4KNDA 2DJ1A 1BX9A 3MDKA 3ZFLA 3FY7A 3LW9A 1Q4JA 1FAAA 3FZ4A 2YWNA 1O8XA 3KJYA 1OC9A 2H71A 3KD0A 1X9WB 5CP1A 5IO2A 1FHEA 1K3OA 3ME7A 4YQVA 2OE1A 1AUCA 2CAIA 1B48A 2EC4A 4MZBA 4IW9A 4JEDA 5HFKA 1G0TA 2R5GA 3G7YA 1VRSD 1F2EA 2X49A 4TXOB 2HRNA 1A8LA 1KBNA 3M3MA 4Q5NA 2AB6A 3IC8A 4DSSB 5AIVA 3GMFA 2CQ9A 2PERA 3DMLA 1TU7A 3UVTA 1XCCA 1LBKA 1GLPA 4KCEA 2ZCTA 2AV4A 4LMWA 4EDYA 2B1KA 3HCZA 2WFCA 4IBPA 3H93A 1ZYEA 2REMA 4J57E 3IA1A 3MSZA 2ALBA 3C1SA 4Q5FA 3EU3A 1T4YA 2HRKA 3LFLA 2FHEA 2N5FA 4MH3A 1WOUA 1BYEA 4BL7B 4EF0A 1AIUA 5ECSA 13GSA 4NV5A 3J7Yk 5B8AA 4ZB8A 2HXKA 4HEA2 4RQXA 2RM5A 3GSTA 1PL1A 1YQ1A 1NM3A 2HYXA 3LSZA 2DJKA 1V9WA 1NHOA 1S3AA 5EY6A 2V41A 3KMOA 4XHMA 5DQYA 1XWBA 3DGQA 2C0FA 1SL0B 1THXA 3KH9A 3L0HA 2OE3A 1OKDA 1JZOA 1TI3A 5JCWA 4TR3A 3H79A 4KGIA 5F8BA 3ZZXA 4TKYA 4TW5A 5C00A 2FY6A 1K3LA 1UA5A 2YP6A 3U6VA 2VLTA 4ML6A 1YZXA 4A5PA 3KXOA 4K2DA 5D8IA 4EO3A 2X4AA 18GSA 3DXBA 5AIXA 5F0GA 1EEJA 1F6MC 4JU5A 4YQUA 4KSMA 4YKFA 5D9XA 5ELAA 2ON5A 1A2LA 2VO4A 3L9UA 1XIYA 1GUMA 5DCHA 3LJRA 3MWHA 2R6KA 4KA0A 4NPBA 3APQA 1U6TA 2IFQA 3K8NA 4WBRD 2C0EA 4GRFA 1TU8A 2CZ3A 3L4NA 2VCVA 5HR0A 2DKIA 3CBUA 4IQAA 1SJZA 3GL5A 6GSVA 1B8XA 2HE3A 2IL3A 1E2YA 4CY8A 4MH2A 2YWIA 3DEXA 1THOA 3IPZA 4EIPA 4N10A 1ERVA 2H0IA 1GNEA 1TXXA 2IJYA 1X5DA 5IQYA 1YY7A 5JWQB 5DALA 1Z5YE 1QXHA 3RHBA 4AJ8A 4G0LA 4XIHA 2HSMA 4TR0A 5J3RA 1MTCA 2GVPA 4BPYA 1DSBA 1OE8A 1GTBA 1LJRA 4NHWA 4F9ZA 3GN3A 2PBJA 3EVIA 2HZEA 5IM9A 2VL2A 1VF1A 1TRSA 2E7PA 3TKSE 4KW6A 2IPAA 2YJHA 1YKCA 2YANA 3APSA 1PSQA 3D21A 3QAWA 3KGKA 1USBA 1F9MA 4KDUA 7GSSA 2GSQA 1GLQA 4NV2A 3GIXA 3NOFA 2LSTA 1OYJA 3VWVA 1J0FA 1M2DA 4NWYA 1YEPA 4IS0A 5KOXA 4ZBBA 3ZIVA 3OR5A 5GAPD 3FZ9A 4MPGA 1EZKA 2NDOA 4ZB9A 1M9AA 2CVBA 3PINA 4ECBA 1KTEA 2FD3A 3KH7A 3TCOA 4IJIA 3Q74A 1B4PA 3TOTA 4MJBA 4TR1A 1LU4A 3RPPA 3D22A 4MCUA 4POLA 3F4TA 4L5OA 1UVZA 4I8BA 3M8NA 3HZ8A 1XWAA 1T00A 2L57A 1SKWB 1IYHA 3LYKA 1V58A 1U88A 3GKNA 2C80A 5D9WA 4BVYA 3CSJA 3BOAA 3FZ5A 1A2MA 1N8JA 1XVWA 5JCUA 1IYIA 3WD6A 3GKXA 4KB3A 5ECHB 4ZL7A 6GSSA 3FKFA 4AGSA 3C73A 4K7NA 3IDVA 5BRTA 1O85A 2R0PA 2AHEA 4Q5RA 3HVSA 3LXTA 1T3BA 2HNLA 2K9FA 2O89A 4IP6A 1PMTA 2C1YA 4WR5A 1QGVA 1O8WA 4O32A 4IN0A 1AW9A 2VUPA 5IMDA 2WZ9A 1G7OA 4GXZA 4POKA 1O7UA 3C1RA 4MA9A 1Z3EA 2L6DA 2J23A 4LL4B 1WMJA 1Z6NA 1XFLA 3KTBA 5EVOA 1UC7A 3TKQA 4G2EA 2YCDA 14GSA 2DSAA 4I6XA 5J5NA 3W8SA 5CAXA 1GH2A 4IVFA 1ACVA 1ZYPA 3P2AA 4I2UA 1T4ZA 2OBKA 3CTFA 2BJXA 2I1UA 1GSDA 4IKHA 5J9BA 2MYGA 4J2FA 5F07A 2PWJA 1ST9A 2IMEA 3H4KA 3CMIA 3R2QA 2P31A 1GUKA 1JHBA 1GSQA 4PURA 1GSUA 3UVHA 3GFKA 4FYBA 3ZITA 2VCQA 2CVKA 1T1VA 1WE0A 3QPMA 1TI1A 1OAZA 2P0GA 4JRRA 4KH7A 2M80A 3KEBA 3TJBA 3HZ4A 1PRXA 3O76A 2R0GA 5H5QA 4XRAA 5IMFA 4YAPA 2VIMA 3G7JA 3ZREA 3D6IA 4TXOA 3A5WA 2GSRA 2HSYA 2KP2A 3IHGA 3WT2A 3WT1A 5F06A 1JZWA 3D4TA 3Q19A 4ZL9A 1WIKA 3F6DA 2TRXA 4DSSA 5IMAA 1SD8A 2VM2A 1GULA 1M0UA 3GYKA 4ULXA 4PQIA 1ABAA 2YWOA 1SK0A 2G2QA 5E59A 2PVOC 4O5RA 4AJ7A 1HNBA 2LQQA 1FB0A 2B5EA 5IOXA 2VD0A 4HZ2A 2JZSA 1XW6A 1EWXA 3FZAA 4F03A 5IPHA 3WYWA 3L9SA 5INYA 1PKWA 5HR3A 2R2JA 3FHKA 1ZL9A 3HHVA 5A5KA 2VCWA 4EL1A 5KOWA 2TRCP 3RDWA 5ECIB 3GKKA 2PN8A 1XWCA 1V40A 1X5CA 4BL7A 1ERTA 3HY2A 5ECNB 3TKSC 2IWTA 4FYCA 5CRWA 3UBKA 4ML1A 3ERFA 2X64A 5HFIA 3RPNA 1M2BA 5B6NA 1TRVA 4ECJA 2YOIA 8GSSA 5COHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6C A;  1VF2 A;  3D0Z A;  3LG6 A;  2RM6 A;  1TOF A;  1A0F A;  3E9J B;  4MJA A;  4YH2 A;  1EP7 A;  2RUF A;  1OC3 A;  3LGC A;  5G5E A;  3UL3 A;  3QR6 A;  5CRG A;  3TKP A;  2M72 A;  2C0D A;  2DLX A;  2L5L A;  3F8U A;  2H75 A;  1OC8 A;  2C3N A;  1Z7R A;  2PPT A;  1R26 A;  5CNW A;  2GZY A;  4ISD A;  4K1F A;  3SBC A;  1BJX A;  3VWW A;  2B5X A;  1EV4 A;  4YAV A;  2DJ0 A;  1A0R P;  2M46 A;  2PUK C;  2GSS A;  3KZQ A;  2P5R A;  3KMN A;  3ZLP A;  1SYR A;  3A3T A;  5DJM A;  3VI7 A;  3H8Q A;  1Z9H A;  1QUW A;  1OVN A;  3TUE A;  1QFN A;  4DEJ A;  1GWC A;  1MDI A;  3DIE A;  2HI7 A;  3KCM A;  4KDY A;  3F4S A;  4K6X A;  3VPT A;  1WRY A;  3E3E A;  3EE2 A;  4L5L A;  1G6W A;  3IXR A;  2MMA A;  1PX7 A;  4ZB6 A;  4GQF A;  4XS6 A;  4MJC A;  1T8E B;  4OO5 A;  3GL3 A;  3ZVJ A;  4G19 A;  1YKA A;  4TR4 A;  2O87 A;  1GL8 A;  4EVM A;  16GS A;  4RI7 A;  2LRC A;  1EGO A;  2YPM A;  1XW5 A;  4GWR A;  3I6A A;  1BG5 A;  3N9J A;  1AC1 A;  5E4W A;  5FT3 A;  1OKT A;  1FG4 A;  2K8V A;  3FW2 A;  4JR4 A;  4KSO A;  5G30 A;  5HR2 A;  2MBS A;  2MBT A;  4RQR A;  2VM1 A;  2FA8 A;  4F0B A;  3IK7 A;  2H6Y A;  3I69 A;  1NHY A;  1PL2 A;  1GNW A;  3L78 A;  4KUN A;  3ED3 A;  5L71 A;  5G5F A;  4X0X A;  2VL3 A;  3MAK A;  2BTO T;  4EXJ A;  1X5E A;  3MNG A;  4NHZ A;  3UJ1 A;  2WCI A;  4GLT A;  4N0Z A;  2QGV A;  1S3D A;  5AGY A;  1MD4 A;  2F9S A;  3GTU A;  3BCI A;  3LYP A;  4IGJ A;  1A23 A;  4X43 A;  2CV4 A;  3H1N A;  5KN0 A;  5CRD A;  2DBC A;  2VOC A;  3ZMK A;  3IR4 A;  2V6K A;  2MZC A;  4I2T A;  4IP1 A;  5IMC A;  2A2R A;  4POM A;  3GSS A;  2LTK A;  4CDO A;  1QQ2 A;  3EYT A;  4XS1 A;  1XXU A;  5ENU A;  5ELG A;  5ECP B;  2XC2 A;  1I5G A;  1RK4 A;  4D73 B;  1I9D A;  2I9H A;  1GSE A;  1TRW A;  1X0R A;  1ZGN A;  5FHI A;  2WB9 A;  2YWM A;  2YZU A;  4HU7 A;  1FB6 A;  3O3T A;  3IHQ A;  4AJ6 A;  3IOS A;  4OWY A;  3A2V A;  1EEM A;  2GS3 A;  2H6Z A;  3CTG A;  5F05 A;  4JBB A;  3BD2 A;  3BBY A;  2JAC A;  3PR8 A;  3IC4 A;  2WJU A;  3J7Y b;  2K8S A;  1F3A A;  1FVJ A;  3TJF A;  1ML6 A;  2KHP A;  4L0W A;  4K8M A;  4WF5 A;  1SK1 A;  3LEF A;  2H76 A;  4HU9 A;  6GSX A;  1X9M B;  2R4V A;  4FH8 A;  4N0V A;  4PXO A;  1JFU A;  1PQN A;  1ZCP A;  2N5B A;  2GZP A;  2QC7 A;  2LQO A;  2HRF A;  3CXG A;  3DRN A;  2CAQ A;  4GCI A;  2CVD A;  1DE2 A;  3HKR A;  3GX8 A;  3CYN A;  2GQM A;  2GT5 A;  1GTI A;  3ZML A;  3VK9 A;  3GTU B;  4ZIJ A;  2LJA A;  3D5J A;  2OE0 A;  5IPG A;  5CRE A;  2CT6 A;  2EIQ A;  3RBT A;  1M99 A;  3GV1 A;  4TRX A;  4NMU A;  5IO0 A;  1FW1 A;  1XOA A;  2HT9 A;  5G1K A;  2WGR A;  4BA7 A;  5DJL A;  1K0D A;  1HD2 A;  2FCH A;  5GAN D;  3ZTL A;  1N2A A;  2IMF A;  1GSF A;  3EIN A;  3WGE A;  2KP1 A;  9GSS A;  4TOP A;  3TKR A;  4MF5 A;  1XWG A;  2JZT A;  1O6J A;  3ERW A;  2FLS A;  3TJK A;  2H74 A;  2K6V A;  1C72 A;  3TJJ A;  4IJ3 A;  4TXV A;  1SJ6 A;  2H0H A;  10GS A;  1A24 A;  2L4C A;  2R37 A;  2B6M A;  2YV7 A;  4WXT A;  3P8W A;  2YV9 A;  1JZR A;  3V1W A;  1PA3 A;  5DQS A;  1YEX A;  1ON4 A;  2VD1 A;  1YF0 A;  3FK8 A;  1A2J A;  1MDK A;  2DJJ A;  1E6B A;  4QL7 A;  1CQG A;  5J41 A;  2XBI A;  1UN2 A;  3EMP A;  4IEL A;  4ILF A;  2XBQ A;  1Y6E A;  1HQO A;  2DJ2 A;  4TVE A;  2O8V B;  5LD0 A;  1OE7 A;  1K0B A;  4WF4 A;  3VWX A;  2LS5 A;  2I3Y A;  3FEU A;  1M9B A;  3UOM A;  3IBH A;  2R3X A;  3C8E A;  1XZO A;  1SKS B;  2O7K A;  1SL2 B;  3QDN A;  4K7I A;  3ME8 A;  1R4W A;  2ZUP A;  1VF3 A;  4I97 A;  3KTL A;  1K0C A;  4DSR A;  4QL9 A;  1WWJ A;  4WET A;  3EMX A;  4XRD A;  3DD3 A;  3CRU A;  1G7E A;  4EUY A;  5DAK B;  2F51 A;  3QAV A;  3HYP A;  3P90 A;  2H1B A;  1WJK A;  4FYU A;  6GSU A;  2B7J A;  2NPB A;  4J56 E;  2J9H A;  1SK2 A;  2CX4 A;  1K0O A;  2O85 A;  4GTU A;  4YQM A;  2RUE A;  4CHS A;  2HZF A;  2OBI A;  1J08 A;  2VLV A;  1TDI A;  1SYX A;  4OMV A;  3FYG A;  4ECC A;  5D96 A;  4EDZ A;  2YJ7 A;  1SKR B;  1B9X C;  2B7K A;  2DML A;  1VF4 A;  3QFA C;  3ZYW A;  5H5S A;  2GGT A;  4PUF C;  4MF6 A;  3QOU A;  3S9F A;  3G9B A;  4MMM A;  2YZH A;  2JU5 A;  1TP9 A;  2NBS A;  4HJ2 A;  5B6M A;  4N11 A;  1XOB A;  2QSI A;  1W89 A;  2LNT A;  2KLX A;  2LKU A;  3ZFB A;  5ECO B;  4RUV A;  4K0G A;  2GLR A;  4OFN A;  5JWO B;  5FWG A;  4OFT A;  1RQM A;  2H6X A;  3VI5 A;  1ILO A;  2VLU A;  3WGD A;  2X8C A;  4ACS A;  4LLR A;  1PKZ A;  2MMO A;  3ISO A;  3JCM L;  1XBS A;  2ES7 A;  3AY8 A;  6GST A;  2E2M A;  4MLY A;  3M1G A;  3HVV A;  3TRX A;  4MP4 A;  2WRT A;  6GSW A;  4PQH A;  3CSI A;  3FR6 A;  2KOK A;  2VCX A;  4KE3 A;  1T7P B;  3BJ5 A;  1ZOF A;  5CO3 A;  2H19 A;  1WPI A;  3F4R A;  2K18 A;  1TK8 B;  2GDR A;  1A8Y A;  3WGX A;  4I5Q A;  2LRT A;  3FRC A;  1PX6 A;  1S3C A;  2FWG A;  2AAW A;  2GST A;  3M9K A;  5ECQ B;  4FO5 A;  1VGL A;  2YN1 A;  4ZIL A;  5G31 A;  5LCZ A;  1SEN A;  2PMT A;  3BCK A;  4MJE A;  1F37 A;  5D9T A;  4Q5Q A;  4G9H A;  5IMV A;  4XCS A;  5HFG A;  1EOH A;  4BWQ A;  2H01 A;  3LXZ A;  19GS A;  5B7C A;  5AIS A;  5D93 A;  1TJD A;  1EV9 A;  2C4J A;  1HNA A;  5D73 A;  5J4U A;  1PN9 A;  2GTU A;  3IRA A;  3UAP A;  4MAB A;  1BED A;  1NW2 A;  1F3B A;  4MPF A;  4OCF A;  3GUR A;  1H4O A;  2E2G A;  2Z9S A;  1J9B A;  5IOW A;  4TN8 A;  2D2Z A;  2GQL A;  1XWK A;  3HJM A;  4OCE A;  1GTU A;  1H75 A;  4HUA A;  2WS2 A;  2EIO A;  2WUL A;  3UAR A;  4D73 A;  2PU9 C;  1U87 A;  3C71 A;  1R5A A;  3UIW A;  4ZBD A;  5A4W A;  4NAX A;  4EC0 A;  2JSZ A;  1EGR A;  5HQP A;  5KN2 A;  5EPF A;  1FO5 A;  2G0F A;  2DIZ A;  2AYT A;  3F63 A;  4HZ4 A;  3NZN A;  4PGT A;  2EIR A;  2V1M A;  2H66 A;  4P3Y B;  1Z7P A;  1HYU A;  4KX4 A;  3F0I A;  3HJO A;  3QCP A;  1GP1 A;  4XS4 A;  2MMZ A;  3F3R A;  3W8J A;  1B9Y C;  5KEJ A;  5ECK B;  1GSS A;  4H86 A;  4RI6 A;  3VWU A;  2VL2 C;  1U3A A;  1DUG A;  3FR3 A;  4K9Z A;  3QMX A;  3GH9 A;  1HNC A;  1MD3 A;  1FVK A;  1Q98 A;  3QFB C;  3GUS A;  3SWL A;  3Q6O A;  1BQ7 A;  3TKS A;  5DVB A;  4PNG A;  2V2G A;  2PVQ A;  4O92 A;  1O73 A;  2L5O A;  2FGX A;  2I4A A;  3GNJ A;  4OD7 A;  3L9V A;  3QD9 A;  3M9J A;  2AJQ B;  4WEY A;  2DIY A;  1SD9 A;  2C3T A;  2IIY A;  1OC9 B;  2H73 A;  5DCG A;  1M2A A;  2LUS A;  4LL1 B;  2FA4 A;  3IAM 2;  2OAC A;  4V1A p;  5AN1 A;  1BAY A;  2IMD A;  4HDE A;  1ERW A;  1G6Y A;  5H5R A;  2IMI A;  2H1A A;  1ZZY A;  5A4V A;  5LNK e;  5KN3 A;  2LV3 A;  4ZL8 A;  2DMM A;  2V6O A;  1WP0 A;  3IV4 A;  2P5Q A;  3VPQ A;  4DSQ A;  2FWE A;  4GF0 A;  2VL9 A;  2LJR A;  4V1A g;  5DDL A;  3HJP A;  5JCG A;  20GS A;  3LQ7 A;  4WKW A;  4HOJ A;  1KNG A;  3HVX A;  1O81 A;  2JL4 A;  5GZZ B;  4ECI A;  3TDG A;  1GTA A;  2VCZ A;  3KIJ A;  4MZC A;  3TJG A;  4XS4 B;  4WBJ A;  1TTZ A;  11GS A;  3LWA A;  1XPV A;  4GSS A;  5DBQ A;  3A2X A;  2F8F A;  2XPE A;  2OAD A;  2FWH A;  3HA9 A;  2CZ2 A;  4IHU A;  2HFD A;  1ZMA A;  1CQH A;  2H8L A;  2B1L A;  2QKE A;  2FNO A;  3TB2 A;  2KUC A;  5ABR A;  1PGT A;  3C7M A;  4OFM A;  5ECR B;  1YJ6 A;  2H0G A;  1AQX A;  2X8G A;  4JZQ A;  3DVX A;  2H1D A;  2GZZ A;  1DBY A;  2ZNM A;  3RHC A;  2LNS A;  3ZRD A;  1M7T A;  4JR6 A;  1URM A;  1Z6M A;  3GKM A;  2JAD A;  2A2S A;  1EOG A;  2DC5 A;  2A4V A;  3IK9 A;  5DAK A;  2IMK A;  4AF2 A;  1SL1 B;  3EUR A;  2MMN A;  4K7O A;  1JLV A;  5ID2 A;  3O6T A;  3DKS A;  3APO A;  5A4U A;  2I81 A;  1MDJ A;  3VLN A;  3KP8 A;  3UBL A;  4O7H A;  5EL8 A;  2FUG 2;  6GSY A;  2C8U A;  4V2N A;  4KDX A;  2TIR A;  2IFQ B;  3GHA A;  5C04 A;  1YDK A;  4BWS A;  5G2Z A;  4PQ1 A;  3GH6 A;  2H1G A;  4MF7 A;  3DWV A;  2BMX A;  2CX3 A;  2XPD A;  3F6F A;  4EE0 A;  3U5R E;  5D9V A;  4FIW A;  1R5P A;  2LEG A;  4PX1 A;  2OKA A;  1NSW A;  4DVC A;  1GUH A;  3LOR A;  4HS1 A;  3F9U A;  3TGZ A;  3GX0 A;  4Z7X A;  3ZL5 A;  1GRX A;  4GSN A;  3G7I A;  3KP9 A;  5DAL B;  1QK8 A;  2PGT A;  2NVL A;  4ZBA A;  4F82 A;  4V2L A;  5HR1 A;  3RAZ A;  2NTO A;  2GQK A;  5CRH A;  2F8A A;  2RLI A;  4QQ7 A;  3F3Q A;  3KM6 A;  1V57 A;  5GSS A;  1PD2 1;  3CRT A;  1K0N A;  2B3S A;  3QAG A;  4BVX A;  2HZE B;  3E0U A;  2F3M A;  4LA1 A;  3TRP A;  1Y25 A;  3CSH A;  3I43 A;  5IMZ A;  3ZIJ A;  2E0Q A;  4PNF A;  3PGT A;  2XHF A;  1U3I A;  1X9S B;  1GSY A;  2H30 A;  1QMV A;  2H70 A;  5ECL B;  4HQS A;  2DJ3 A;  5ID2 B;  3HD5 A;  4HQZ A;  4KAE A;  1EP8 A;  3GRX A;  3HXS A;  1SU9 A;  2N5A A;  3M0F A;  3UMA A;  3VUR A;  4F0C A;  5J9C A;  4OO4 A;  4JE1 A;  4L0U A;  2L4Q A;  1TKD B;  2ON7 A;  2YNX A;  1JZD A;  4MK3 A;  1FOV A;  3A2W A;  3TRQ A;  4GST A;  3IAS 2;  2H72 A;  1V98 A;  3ERG A;  3IE3 A;  1K0A A;  3EU4 A;  3NIV A;  4KCA A;  4LMV A;  4E8H A;  4TR1 B;  2AUV A;  1K0M A;  3TOU A;  1XW9 A;  2C3Q A;  1ZYQ B;  3GA4 A;  1TK5 B;  4HI7 A;  2V32 A;  3D4M A;  4EKZ A;  4MDC A;  3DVW A;  3PH9 A;  2L59 A;  1AQW A;  1V2A A;  4G10 A;  17GS A;  3P7X A;  4MZW A;  1DE1 A;  4POB A;  5CYY A;  1AXD A;  2GT6 A;  5G1L A;  3US3 A;  2JZR A;  4X1U A;  2JSY A;  5GST A;  4E8E A;  4K0N A;  1YF1 A;  3DYR A;  4V2M A;  2X99 A;  2IN3 A;  1SJI A;  2HLS A;  4ZXG A;  5B8B A;  1B4Q A;  1AQV A;  1XVQ A;  2LJK A;  1ERU A;  1K3Y A;  1R7H A;  2LRN A;  3HDC A;  2CA8 A;  1AAZ A;  5KN1 A;  2VCT A;  5JWR B;  4F2I A;  22GS A;  2WDU A;  5ECM B;  3EWL A;  3EC3 A;  1KEB A;  2HSH A;  2RII A;  2OA7 A;  3I9V 2;  1JLW A;  2OJL A;  12GS A;  4GQC A;  4PUA A;  3W6G A;  2C0G A;  2FWF A;  4CW9 A;  1W4V A;  1TRU A;  2B5Y A;  3N5O A;  3ZVJ D;  2VAF A;  4ID0 A;  1MEK A;  1RW1 A;  4IQ1 A;  3FR9 A;  4XTS A;  3UEM A;  4NXI A;  4HJM A;  5IIZ A;  3Q18 A;  1TW9 A;  2X8H A;  3VFI A;  4L8E A;  4N30 A;  4WR4 A;  1TK0 B;  4KND A;  2DJ1 A;  1BX9 A;  3MDK A;  3ZFL A;  3FY7 A;  1Q4J A;  1FAA A;  3FZ4 A;  2YWN A;  1O8X A;  3KJY A;  1OC9 A;  2H71 A;  3KD0 A;  1X9W B;  5CP1 A;  5IO2 A;  1FHE A;  1K3O A;  3ME7 A;  4YQV A;  2OE1 A;  1AUC A;  2CAI A;  1B48 A;  2EC4 A;  4MZB A;  4IW9 A;  4JED A;  5HFK A;  1G0T A;  2R5G A;  3G7Y A;  1VRS D;  1F2E A;  4TXO B;  2HRN A;  1A8L A;  1KBN A;  3M3M A;  4Q5N A;  2AB6 A;  4DSS B;  5AIV A;  3GMF A;  2CQ9 A;  2PER A;  3DML A;  1TU7 A;  3UVT A;  1XCC A;  1LBK A;  1GLP A;  4KCE A;  2ZCT A;  2AV4 A;  4LMW A;  4EDY A;  2B1K A;  3HCZ A;  2WFC A;  4IBP A;  3H93 A;  1ZYE A;  2REM A;  4J57 E;  3IA1 A;  3MSZ A;  2ALB A;  3C1S A;  4Q5F A;  3EU3 A;  1T4Y A;  3LFL A;  2FHE A;  2N5F A;  4MH3 A;  1WOU A;  1BYE A;  4EF0 A;  1AIU A;  5ECS A;  13GS A;  4NV5 A;  3J7Y k;  5B8A A;  4ZB8 A;  2HXK A;  4HEA 2;  4RQX A;  2RM5 A;  3GST A;  1PL1 A;  1YQ1 A;  1NM3 A;  2HYX A;  3LSZ A;  2DJK A;  1V9W A;  1NHO A;  1S3A A;  5EY6 A;  2V41 A;  3KMO A;  4XHM A;  5DQY A;  1XWB A;  3DGQ A;  2C0F A;  1SL0 B;  1THX A;  3KH9 A;  3L0H A;  2OE3 A;  1OKD A;  1JZO A;  1TI3 A;  5JCW A;  4TR3 A;  3H79 A;  4KGI A;  5F8B A;  3ZZX A;  4TKY A;  4TW5 A;  5C00 A;  2FY6 A;  1K3L A;  1UA5 A;  2YP6 A;  3U6V A;  2VLT A;  4ML6 A;  1YZX A;  3KXO A;  4K2D A;  5D8I A;  4EO3 A;  18GS A;  3DXB A;  5AIX A;  5F0G A;  1EEJ A;  1F6M C;  4JU5 A;  4YQU A;  4KSM A;  5D9X A;  5ELA A;  2ON5 A;  1A2L A;  2VO4 A;  3L9U A;  1XIY A;  1GUM A;  5DCH A;  3LJR A;  3MWH A;  2R6K A;  4KA0 A;  4NPB A;  3APQ A;  1U6T A;  2IFQ A;  3K8N A;  4WBR D;  2C0E A;  4GRF A;  1TU8 A;  2CZ3 A;  3L4N A;  2VCV A;  5HR0 A;  3CBU A;  4IQA A;  1SJZ A;  3GL5 A;  6GSV A;  1B8X A;  2HE3 A;  2IL3 A;  1E2Y A;  4MH2 A;  2YWI A;  3DEX A;  1THO A;  3IPZ A;  4N10 A;  1ERV A;  2H0I A;  1GNE A;  1TXX A;  2IJY A;  1X5D A;  5IQY A;  1YY7 A;  5JWQ B;  5DAL A;  1Z5Y E;  1QXH A;  3RHB A;  4AJ8 A;  4XIH A;  4TR0 A;  5J3R A;  1MTC A;  2GVP A;  4BPY A;  1DSB A;  1OE8 A;  1GTB A;  1LJR A;  4NHW A;  4F9Z A;  3GN3 A;  2PBJ A;  3EVI A;  2HZE A;  5IM9 A;  2VL2 A;  1VF1 A;  1TRS A;  2E7P A;  3TKS E;  4KW6 A;  2IPA A;  2YJH A;  1YKC A;  2YAN A;  3APS A;  1PSQ A;  3D21 A;  3QAW A;  3KGK A;  1USB A;  1F9M A;  4KDU A;  7GSS A;  2GSQ A;  1GLQ A;  4NV2 A;  3GIX A;  3NOF A;  2LST A;  1OYJ A;  3VWV A;  1J0F A;  1M2D A;  4NWY A;  1YEP A;  4IS0 A;  4ZBB A;  3ZIV A;  3OR5 A;  5GAP D;  3FZ9 A;  4MPG A;  1EZK A;  2NDO A;  4ZB9 A;  1M9A A;  2CVB A;  3PIN A;  4ECB A;  1KTE A;  2FD3 A;  3KH7 A;  3TCO A;  4IJI A;  3Q74 A;  1B4P A;  3TOT A;  4MJB A;  4TR1 A;  1LU4 A;  3RPP A;  3D22 A;  4MCU A;  4POL A;  3F4T A;  4L5O A;  1UVZ A;  4I8B A;  3M8N A;  3HZ8 A;  1XWA A;  1T00 A;  2L57 A;  1SKW B;  1IYH A;  3LYK A;  1V58 A;  1U88 A;  3GKN A;  2C80 A;  5D9W A;  4BVY A;  3CSJ A;  3BOA A;  3FZ5 A;  1A2M A;  1N8J A;  1XVW A;  5JCU A;  1IYI A;  3WD6 A;  3GKX A;  4KB3 A;  5ECH B;  4ZL7 A;  6GSS A;  3FKF A;  4AGS A;  3C73 A;  4K7N A;  3IDV A;  1O85 A;  2AHE A;  4Q5R A;  3HVS A;  3LXT A;  1T3B A;  2HNL A;  2K9F A;  2O89 A;  4IP6 A;  1PMT A;  2C1Y A;  4WR5 A;  1QGV A;  1O8W A;  4O32 A;  4IN0 A;  1AW9 A;  2VUP A;  5IMD A;  2WZ9 A;  1G7O A;  4GXZ A;  4POK A;  1O7U A;  3C1R A;  4MA9 A;  1Z3E A;  2L6D A;  2J23 A;  4LL4 B;  1WMJ A;  1Z6N A;  1XFL A;  3KTB A;  5EVO A;  1UC7 A;  3TKQ A;  4G2E A;  2YCD A;  14GS A;  2DSA A;  4I6X A;  5J5N A;  3W8S A;  5CAX A;  1GH2 A;  4IVF A;  1ACV A;  3P2A A;  4I2U A;  1T4Z A;  2OBK A;  3CTF A;  2BJX A;  2I1U A;  1GSD A;  4IKH A;  5J9B A;  2MYG A;  4J2F A;  5F07 A;  2PWJ A;  1ST9 A;  2IME A;  3H4K A;  3CMI A;  3R2Q A;  2P31 A;  1GUK A;  1JHB A;  1GSQ A;  4PUR A;  1GSU A;  3UVH A;  3GFK A;  4FYB A;  3ZIT A;  2VCQ A;  2CVK A;  1T1V A;  1WE0 A;  3QPM A;  1TI1 A;  1OAZ A;  2P0G A;  4JRR A;  4KH7 A;  2M80 A;  3KEB A;  3TJB A;  3HZ4 A;  1PRX A;  3O76 A;  5H5Q A;  4XRA A;  5IMF A;  4YAP A;  2VIM A;  3G7J A;  3ZRE A;  3D6I A;  4TXO A;  3A5W A;  2GSR A;  2HSY A;  2KP2 A;  3WT2 A;  3WT1 A;  5F06 A;  1JZW A;  3D4T A;  3Q19 A;  4ZL9 A;  1WIK A;  3F6D A;  2TRX A;  4DSS A;  5IMA A;  1SD8 A;  2VM2 A;  1GUL A;  1M0U A;  3GYK A;  4ULX A;  4PQI A;  1ABA A;  2YWO A;  1SK0 A;  2G2Q A;  5E59 A;  2PVO C;  4O5R A;  4AJ7 A;  1HNB A;  2LQQ A;  1FB0 A;  2B5E A;  5IOX A;  2VD0 A;  4HZ2 A;  2JZS A;  1XW6 A;  1EWX A;  3FZA A;  4F03 A;  5IPH A;  3WYW A;  3L9S A;  5INY A;  1PKW A;  5HR3 A;  2R2J A;  3FHK A;  1ZL9 A;  3HHV A;  5A5K A;  2VCW A;  4EL1 A;  2TRC P;  3RDW A;  5ECI B;  3GKK A;  2PN8 A;  1XWC A;  1V40 A;  1X5C A;  4BL7 A;  1ERT A;  3HY2 A;  5ECN B;  3TKS C;  2IWT A;  4FYC A;  5CRW A;  3UBK A;  4ML1 A;  3ERF A;  2X64 A;  5HFI A;  3RPN A;  1M2B A;  5B6N A;  1TRV A;  4ECJ A;  2YOI A;  8GSS A;  5COH A; 
#chains in the Genus database with same CATH topology
 2L6C A;  1VF2 A;  3D0Z A;  3LG6 A;  2RM6 A;  1TOF A;  1A0F A;  3E9J B;  4MJA A;  4YH2 A;  1EP7 A;  2RUF A;  1OC3 A;  3LGC A;  5G5E A;  3UL3 A;  3QR6 A;  5CRG A;  3TKP A;  2M72 A;  2C0D A;  2DLX A;  2L5L A;  3F8U A;  2H75 A;  1OC8 A;  2C3N A;  1Z7R A;  2PPT A;  4K5S A;  1R26 A;  5CNW A;  2GZY A;  4ISD A;  4K1F A;  3SBC A;  1BJX A;  3VWW A;  2B5X A;  1EV4 A;  4YAV A;  2DJ0 A;  1A0R P;  2M46 A;  2PUK C;  2GSS A;  3KZQ A;  2P5R A;  3KMN A;  3ZLP A;  1SYR A;  3A3T A;  5DJM A;  3VI7 A;  3H8Q A;  1Z9H A;  1QUW A;  1OVN A;  3TUE A;  1QFN A;  4DEJ A;  1GWC A;  1MDI A;  3DIE A;  2HI7 A;  3KCM A;  4KDY A;  3F4S A;  4K6X A;  3VPT A;  1WRY A;  3E3E A;  3EE2 A;  4L5L A;  1G6W A;  3IXR A;  2MMA A;  1PX7 A;  4ZB6 A;  4GQF A;  4XS6 A;  4MJC A;  1T8E B;  2QA1 A;  4OO5 A;  3GL3 A;  3ZVJ A;  4G19 A;  1YKA A;  4TR4 A;  2O87 A;  1GL8 A;  3A5I A;  4EVM A;  16GS A;  4RI7 A;  2LRC A;  1EGO A;  2YPM A;  1XW5 A;  4GWR A;  3I6A A;  1BG5 A;  3N9J A;  1AC1 A;  5E4W A;  5FT3 A;  1OKT A;  1FG4 A;  2K8V A;  3FW2 A;  4JR4 A;  4KSO A;  5G30 A;  5HR2 A;  2MBS A;  2MBT A;  4RQR A;  2VM1 A;  2FA8 A;  4F0B A;  3IK7 A;  2H6Y A;  3I69 A;  1NHY A;  1PL2 A;  1GNW A;  3L78 A;  4KUN A;  3ED3 A;  5L71 A;  5G5F A;  4X0X A;  2VL3 A;  3MAK A;  2BTO T;  4EXJ A;  1X5E A;  3MNG A;  4NHZ A;  3UJ1 A;  2WCI A;  4GLT A;  4N0Z A;  2QGV A;  1S3D A;  5AGY A;  1MD4 A;  2F9S A;  3GTU A;  3BCI A;  3LYP A;  4IGJ A;  1A23 A;  4X43 A;  2CV4 A;  3H1N A;  5KN0 A;  5CRD A;  2DBC A;  2VOC A;  3ZMK A;  3IR4 A;  2V6K A;  2MZC A;  4I2T A;  4IP1 A;  5IMC A;  2A2R A;  4POM A;  3GSS A;  2LTK A;  1FOH A;  4CDO A;  1QQ2 A;  3PPU A;  3EYT A;  4XS1 A;  1XXU A;  5ENU A;  5ELG A;  5ECP B;  2XC2 A;  1I5G A;  1RK4 A;  1ZYN A;  3EPT A;  4D73 B;  1I9D A;  2I9H A;  5BMU A;  1GSE A;  1TRW A;  1X0R A;  1ZGN A;  5FHI A;  2WB9 A;  2YWM A;  2YZU A;  4HU7 A;  1FB6 A;  3O3T A;  3IHQ A;  4AJ6 A;  3IOS A;  4OWY A;  3A2V A;  1EEM A;  2GS3 A;  2H6Z A;  3CTG A;  5F05 A;  4JBB A;  3BD2 A;  3BBY A;  2JAC A;  3PR8 A;  3IC4 A;  2WJU A;  4PTS A;  3J7Y b;  2K8S A;  1F3A A;  1FVJ A;  3TJF A;  1ML6 A;  2KHP A;  4L0W A;  4K8M A;  4WF5 A;  1SK1 A;  3LEF A;  2H76 A;  4HU9 A;  6GSX A;  1X9M B;  2R4V A;  4FH8 A;  4N0V A;  4PXO A;  1JFU A;  1PQN A;  1ZCP A;  2N5B A;  2GZP A;  2QC7 A;  2LQO A;  2HRF A;  3CXG A;  3DRN A;  2CAQ A;  4GCI A;  4G0I A;  2CVD A;  1DE2 A;  3HKR A;  3GX8 A;  3CYN A;  2GQM A;  2GT5 A;  1GTI A;  3ZML A;  3VK9 A;  3GTU B;  4ZIJ A;  2LJA A;  3D5J A;  2OE0 A;  5IPG A;  5CRE A;  2CT6 A;  2EIQ A;  3RBT A;  1M99 A;  3GV1 A;  4TRX A;  4NMU A;  5IO0 A;  1FW1 A;  1XOA A;  2HT9 A;  5G1K A;  2WGR A;  4BA7 A;  5DJL A;  1K0D A;  1HD2 A;  2FCH A;  5GAN D;  3ZTL A;  1N2A A;  2IMF A;  1GSF A;  3EIN A;  3WGE A;  2KP1 A;  9GSS A;  4TOP A;  3TKR A;  4MF5 A;  1XWG A;  2JZT A;  4Z2T A;  1O6J A;  3ERW A;  2FLS A;  3TJK A;  2H74 A;  2K6V A;  1C72 A;  3TJJ A;  4IJ3 A;  4TXV A;  1SJ6 A;  2H0H A;  10GS A;  1A24 A;  2L4C A;  2R37 A;  2B6M A;  2YV7 A;  4WXT A;  3P8W A;  2YV9 A;  1JZR A;  3V1W A;  1PA3 A;  5DQS A;  1YEX A;  1ON4 A;  2VD1 A;  1YF0 A;  3FK8 A;  1A2J A;  1MDK A;  2DJJ A;  1E6B A;  4QL7 A;  1CQG A;  5J41 A;  2XBI A;  1UN2 A;  3EMP A;  4IEL A;  4ILF A;  2XBQ A;  1Y6E A;  1HQO A;  2DJ2 A;  4TVE A;  2O8V B;  5LD0 A;  1OE7 A;  1K0B A;  1M3J A;  4WF4 A;  3VWX A;  2LS5 A;  4Z2R A;  2I3Y A;  3FEU A;  1M9B A;  3UOM A;  3IBH A;  2R3X A;  3C8E A;  1XZO A;  1SKS B;  2O7K A;  1SL2 B;  3QDN A;  4K7I A;  4CY6 A;  3ME8 A;  1R4W A;  2ZUP A;  1VF3 A;  4I97 A;  3KTL A;  1K0C A;  4DSR A;  4QL9 A;  1PFO A;  1WWJ A;  4WET A;  3EMX A;  4Z2U A;  4XRD A;  3DD3 A;  3CRU A;  1G7E A;  4EUY A;  4G0K A;  5DAK B;  2F51 A;  3QAV A;  3HYP A;  3P90 A;  2H1B A;  1WJK A;  4FYU A;  6GSU A;  2B7J A;  2NPB A;  4J56 E;  2J9H A;  1SK2 A;  2CX4 A;  1K0O A;  2O85 A;  4GTU A;  4YQM A;  2RUE A;  4CHS A;  2HZF A;  2OBI A;  1J08 A;  2VLV A;  1TDI A;  1SYX A;  4MNN A;  4OMV A;  3FYG A;  4ECC A;  5D96 A;  4EDZ A;  2YJ7 A;  1SKR B;  1B9X C;  2B7K A;  2DML A;  1VF4 A;  3QFA C;  3ZYW A;  3MIX A;  5H5S A;  2DKH A;  2GGT A;  4PUF C;  4MF6 A;  3QOU A;  3S9F A;  3G9B A;  4MMM A;  2YZH A;  2JU5 A;  1TP9 A;  2NBS A;  4HJ2 A;  5B6M A;  4N11 A;  1XOB A;  2QSI A;  1W89 A;  2LNT A;  2KLX A;  2LKU A;  3ZFB A;  5ECO B;  4RUV A;  4K0G A;  2GLR A;  4OFN A;  5JWO B;  5FWG A;  4OFT A;  1RQM A;  2H6X A;  3VI5 A;  1ILO A;  2VLU A;  3WGD A;  2X8C A;  4ACS A;  4LLR A;  1PKZ A;  2MMO A;  4BVX B;  3ISO A;  3JCM L;  1XBS A;  2ES7 A;  3AY8 A;  6GST A;  4O5U A;  2E2M A;  4MLY A;  3M1G A;  3HVV A;  3TRX A;  4MP4 A;  2WRT A;  6GSW A;  4PQH A;  3CSI A;  3FR6 A;  2KOK A;  2VCX A;  4KE3 A;  1T7P B;  3BJ5 A;  1ZOF A;  5CO3 A;  2H19 A;  1WPI A;  3F4R A;  2K18 A;  1TK8 B;  2GDR A;  1A8Y A;  3WGX A;  4I5Q A;  2LRT A;  3FRC A;  1PX6 A;  1S3C A;  2FWG A;  2AAW A;  2GST A;  3M9K A;  5ECQ B;  4FO5 A;  1VGL A;  2YN1 A;  4ZIL A;  5G31 A;  5LCZ A;  1SEN A;  2PMT A;  3CQF A;  3BCK A;  4MJE A;  1F37 A;  5D9T A;  4Q5Q A;  4G9H A;  5IMV A;  4XCS A;  5HFG A;  1EOH A;  4BWQ A;  2H01 A;  3LXZ A;  19GS A;  4HSC X;  5B7C A;  5AIS A;  5D93 A;  1TJD A;  1EV9 A;  2C4J A;  1HNA A;  5D73 A;  5J4U A;  1PN9 A;  2GTU A;  3IRA A;  3UAP A;  4MAB A;  1BED A;  1NW2 A;  1F3B A;  4MPF A;  4OCF A;  3GUR A;  1H4O A;  2E2G A;  2Z9S A;  4EIQ A;  1J9B A;  5IOW A;  4TN8 A;  2D2Z A;  4X4J A;  2GQL A;  1XWK A;  3HJM A;  4OCE A;  1GTU A;  1H75 A;  4HUA A;  2WS2 A;  2EIO A;  2WUL A;  3UAR A;  4D73 A;  2PU9 C;  1U87 A;  3C71 A;  1R5A A;  3UIW A;  4ZBD A;  5A4W A;  4NAX A;  4EC0 A;  2JSZ A;  1EGR A;  2QA2 A;  5HQP A;  5KN2 A;  5EPF A;  1FO5 A;  2G0F A;  2DIZ A;  2AYT A;  3F63 A;  4HZ4 A;  3NZN A;  4PGT A;  2EIR A;  2V1M A;  2H66 A;  4P3Y B;  1Z7P A;  1HYU A;  4KX4 A;  3F0I A;  3HJO A;  3QCP A;  1GP1 A;  4XS4 A;  2MMZ A;  3F3R A;  3W8J A;  1B9Y C;  5KEJ A;  5ECK B;  1GSS A;  4H86 A;  4RI6 A;  3VWU A;  2VL2 C;  1U3A A;  1DUG A;  3FR3 A;  4K9Z A;  3QMX A;  3GH9 A;  1HNC A;  1MD3 A;  1FVK A;  1Q98 A;  3QFB C;  4O5Q A;  3GUS A;  3SWL A;  3Q6O A;  1BQ7 A;  3TKS A;  5DVB A;  4PNG A;  2V2G A;  2PVQ A;  4O92 A;  1O73 A;  2L5O A;  2FGX A;  2I4A A;  3HVN A;  3GNJ A;  4OD7 A;  3L9V A;  3QD9 A;  3M9J A;  2AJQ B;  4WEY A;  2DIY A;  1SD9 A;  2C3T A;  2IIY A;  1OC9 B;  2H73 A;  1PN0 A;  5DCG A;  1M2A A;  2LUS A;  4LL1 B;  2FA4 A;  3IAM 2;  2OAC A;  4V1A p;  5AN1 A;  1BAY A;  2IMD A;  4HDE A;  1ERW A;  1G6Y A;  5H5R A;  2IMI A;  2H1A A;  1ZZY A;  1XG8 A;  5A4V A;  5LNK e;  5KN3 A;  2LV3 A;  4ZL8 A;  2DMM A;  2V6O A;  1WP0 A;  3IV4 A;  2P5Q A;  3VPQ A;  4DSQ A;  2FWE A;  4GF0 A;  2VL9 A;  2LJR A;  4V1A g;  5DDL A;  3HJP A;  5JCG A;  20GS A;  3LQ7 A;  4WKW A;  4HOJ A;  1KNG A;  3R3E A;  3HVX A;  1O81 A;  4K5R A;  2JL4 A;  5GZZ B;  4ECI A;  3TDG A;  1GTA A;  4YKG A;  2VCZ A;  4K2X A;  3KIJ A;  4MZC A;  3TJG A;  4XS4 B;  4WBJ A;  1TTZ A;  11GS A;  3LWA A;  1XPV A;  4GSS A;  5DBQ A;  3A2X A;  2F8F A;  2XPE A;  2OAD A;  3FMW A;  2FWH A;  3HA9 A;  2CZ2 A;  4IHU A;  2HFD A;  1ZMA A;  1CQH A;  2H8L A;  2B1L A;  2QKE A;  2FNO A;  3TB2 A;  2KUC A;  5ABR A;  1PGT A;  3C7M A;  4OFM A;  1YJ6 A;  5ECR B;  2H0G A;  1AQX A;  2X8G A;  4JZQ A;  3DVX A;  2H1D A;  2GZZ A;  1DBY A;  2ZNM A;  3RHC A;  2LNS A;  3ZRD A;  1M7T A;  4JR6 A;  1URM A;  1Z6M A;  3GKM A;  2JAD A;  2A2S A;  1EOG A;  2DC5 A;  2A4V A;  3IK9 A;  5DAK A;  2IMK A;  4AF2 A;  1SL1 B;  3EUR A;  2MMN A;  4K7O A;  1JLV A;  5ID2 A;  3O6T A;  3DKS A;  3APO A;  5A4U A;  2I81 A;  1MDJ A;  3VLN A;  3KP8 A;  3UBL A;  4O7H A;  5EL8 A;  2FUG 2;  6GSY A;  2C8U A;  4V2N A;  4KDX A;  2TIR A;  2IFQ B;  3GHA A;  5C04 A;  1YDK A;  4BWS A;  5G2Z A;  4PQ1 A;  3GH6 A;  2H1G A;  4MF7 A;  3DWV A;  2BMX A;  2CX3 A;  2XPD A;  3F6F A;  4EE0 A;  3U5R E;  5D9V A;  4FIW A;  1R5P A;  2LEG A;  4PX1 A;  2OKA A;  1NSW A;  2UZ8 A;  4DVC A;  1GUH A;  3LOR A;  4HS1 A;  3F9U A;  3TGZ A;  3GX0 A;  4Z7X A;  3ZL5 A;  1GRX A;  4GSN A;  3G7I A;  3KP9 A;  5DAL B;  1QK8 A;  2PGT A;  2NVL A;  4ZBA A;  4F82 A;  4V2L A;  5HR1 A;  3RAZ A;  2NTO A;  2GQK A;  5CRH A;  2F8A A;  2RLI A;  4QQ7 A;  3F3Q A;  3KM6 A;  1V57 A;  5GSS A;  1PD2 1;  3CRT A;  1K0N A;  2B3S A;  3QAG A;  4BVX A;  2HZE B;  3E0U A;  2F3M A;  4LA1 A;  3TRP A;  1Y25 A;  3CSH A;  3I43 A;  5IMZ A;  3ZIJ A;  2E0Q A;  3MYD A;  4PNF A;  3PGT A;  2XHF A;  1U3I A;  1X9S B;  1GSY A;  2H30 A;  1QMV A;  2H70 A;  5ECL B;  4HQS A;  2DJ3 A;  5ID2 B;  3HD5 A;  4HQZ A;  4KAE A;  1EP8 A;  3GRX A;  2HRA A;  3HXS A;  1SU9 A;  2N5A A;  4ICY A;  3M0F A;  3UMA A;  3VUR A;  4F0C A;  5J9C A;  4FQU A;  4OO4 A;  4JE1 A;  4L0U A;  2L4Q A;  2R0C A;  1TKD B;  2ON7 A;  2YNX A;  1JZD A;  4MK3 A;  1FOV A;  3A2W A;  3TRQ A;  4GST A;  3IAS 2;  2H72 A;  1V98 A;  3ERG A;  3IE3 A;  1K0A A;  3EU4 A;  3NIV A;  4KCA A;  4LMV A;  4E8H A;  4TR1 B;  2AUV A;  1K0M A;  3TOU A;  1XW9 A;  2C3Q A;  1ZYQ B;  3GA4 A;  1TK5 B;  4HI7 A;  2V32 A;  3D4M A;  4EKZ A;  4MDC A;  3DVW A;  3PH9 A;  2L59 A;  1AQW A;  1V2A A;  4G10 A;  17GS A;  3P7X A;  4MZW A;  1DE1 A;  4POB A;  4BVY B;  5CYY A;  1AXD A;  2GT6 A;  5G1L A;  3US3 A;  2JZR A;  4X1U A;  2JSY A;  5GST A;  4E8E A;  4K0N A;  1YF1 A;  3DYR A;  4V2M A;  2X99 A;  2IN3 A;  1SJI A;  2HLS A;  4ZXG A;  5B8B A;  1B4Q A;  1AQV A;  1XVQ A;  2LJK A;  1ERU A;  1K3Y A;  1R7H A;  4USS A;  2LRN A;  3HDC A;  2CA8 A;  1AAZ A;  5KN1 A;  2VCT A;  5JWR B;  4F2I A;  22GS A;  2WDU A;  5ECM B;  2A4H A;  3EC3 A;  3EWL A;  1KEB A;  2HSH A;  2RII A;  2OA7 A;  3I9V 2;  1JLW A;  2OJL A;  12GS A;  4GQC A;  4PUA A;  3W6G A;  2C0G A;  2FWF A;  4CW9 A;  1W4V A;  1TRU A;  2B5Y A;  4KF9 A;  2A2P A;  3N5O A;  3ZVJ D;  2VAF A;  4ID0 A;  1MEK A;  1RW1 A;  4IQ1 A;  3FR9 A;  4XTS A;  3UEM A;  4NXI A;  4HJM A;  5IIZ A;  3Q18 A;  1TW9 A;  2X8H A;  3VFI A;  4L8E A;  4N30 A;  4WR4 A;  1TK0 B;  4KND A;  2DJ1 A;  1BX9 A;  3MDK A;  3ZFL A;  4BIK A;  3FY7 A;  3LW9 A;  1Q4J A;  1FAA A;  3FZ4 A;  2YWN A;  1O8X A;  3KJY A;  1OC9 A;  2H71 A;  3KD0 A;  1X9W B;  5CP1 A;  5IO2 A;  1FHE A;  1K3O A;  3ME7 A;  4YQV A;  2OE1 A;  1AUC A;  2CAI A;  1B48 A;  2EC4 A;  4MZB A;  4IW9 A;  4JED A;  5HFK A;  1G0T A;  2R5G A;  3G7Y A;  1VRS D;  1F2E A;  2X49 A;  4TXO B;  2HRN A;  1A8L A;  1KBN A;  3M3M A;  4Q5N A;  2AB6 A;  3IC8 A;  4DSS B;  3GMF A;  5AIV A;  2CQ9 A;  2PER A;  3DML A;  1TU7 A;  3UVT A;  1XCC A;  1LBK A;  1GLP A;  4KCE A;  2ZCT A;  2AV4 A;  4LMW A;  4EDY A;  2B1K A;  3HCZ A;  2WFC A;  4IBP A;  3H93 A;  1ZYE A;  2REM A;  4J57 E;  3IA1 A;  3MSZ A;  2ALB A;  3C1S A;  4Q5F A;  3EU3 A;  1T4Y A;  2HRK A;  3LFL A;  2FHE A;  2N5F A;  4MH3 A;  1WOU A;  1BYE A;  4BL7 B;  4EF0 A;  1AIU A;  5ECS A;  13GS A;  4NV5 A;  3J7Y k;  5B8A A;  4ZB8 A;  2HXK A;  4HEA 2;  4RQX A;  2RM5 A;  3GST A;  1PL1 A;  1YQ1 A;  1NM3 A;  2HYX A;  3LSZ A;  2DJK A;  1V9W A;  1NHO A;  1S3A A;  5EY6 A;  2V41 A;  3KMO A;  4XHM A;  5DQY A;  1XWB A;  3DGQ A;  2C0F A;  1SL0 B;  1THX A;  3KH9 A;  3L0H A;  2OE3 A;  1OKD A;  1JZO A;  1TI3 A;  5JCW A;  4TR3 A;  3H79 A;  4KGI A;  5F8B A;  3ZZX A;  4TKY A;  4TW5 A;  5C00 A;  2FY6 A;  1K3L A;  1UA5 A;  2YP6 A;  3U6V A;  2VLT A;  4ML6 A;  1YZX A;  4A5P A;  3KXO A;  4K2D A;  5D8I A;  4EO3 A;  2X4A A;  18GS A;  3DXB A;  5AIX A;  5F0G A;  1EEJ A;  1F6M C;  4JU5 A;  4YQU A;  4KSM A;  4YKF A;  5D9X A;  5ELA A;  2ON5 A;  1A2L A;  2VO4 A;  3L9U A;  1XIY A;  1GUM A;  5DCH A;  3LJR A;  3MWH A;  2R6K A;  4KA0 A;  4NPB A;  3APQ A;  1U6T A;  2IFQ A;  3K8N A;  4WBR D;  2C0E A;  4GRF A;  1TU8 A;  2CZ3 A;  3L4N A;  2VCV A;  5HR0 A;  2DKI A;  3CBU A;  4IQA A;  1SJZ A;  3GL5 A;  6GSV A;  1B8X A;  2HE3 A;  2IL3 A;  1E2Y A;  4CY8 A;  4MH2 A;  2YWI A;  3DEX A;  1THO A;  3IPZ A;  4EIP A;  4N10 A;  1ERV A;  2H0I A;  1GNE A;  1TXX A;  2IJY A;  1X5D A;  5IQY A;  1YY7 A;  5JWQ B;  5DAL A;  1Z5Y E;  1QXH A;  3RHB A;  4AJ8 A;  4G0L A;  4XIH A;  2HSM A;  4TR0 A;  5J3R A;  1MTC A;  2GVP A;  4BPY A;  1DSB A;  1OE8 A;  1GTB A;  1LJR A;  4NHW A;  4F9Z A;  3GN3 A;  2PBJ A;  3EVI A;  2HZE A;  5IM9 A;  2VL2 A;  1VF1 A;  1TRS A;  2E7P A;  3TKS E;  4KW6 A;  2IPA A;  2YJH A;  1YKC A;  2YAN A;  3APS A;  1PSQ A;  3D21 A;  3QAW A;  3KGK A;  1USB A;  1F9M A;  4KDU A;  7GSS A;  2GSQ A;  1GLQ A;  4NV2 A;  3GIX A;  3NOF A;  2LST A;  1OYJ A;  3VWV A;  1J0F A;  1M2D A;  4NWY A;  1YEP A;  4IS0 A;  5KOX A;  4ZBB A;  3ZIV A;  3OR5 A;  5GAP D;  3FZ9 A;  4MPG A;  1EZK A;  2NDO A;  4ZB9 A;  1M9A A;  2CVB A;  3PIN A;  4ECB A;  1KTE A;  2FD3 A;  3KH7 A;  3TCO A;  4IJI A;  3Q74 A;  1B4P A;  3TOT A;  4MJB A;  4TR1 A;  1LU4 A;  3RPP A;  3D22 A;  4MCU A;  4POL A;  1S3R A;  3F4T A;  4L5O A;  1UVZ A;  4I8B A;  3M8N A;  3HZ8 A;  1XWA A;  1T00 A;  2L57 A;  1SKW B;  1IYH A;  3LYK A;  1V58 A;  1U88 A;  3GKN A;  2C80 A;  5D9W A;  4BVY A;  3CSJ A;  3BOA A;  3FZ5 A;  1A2M A;  1N8J A;  1XVW A;  5JCU A;  1IYI A;  3WD6 A;  3GKX A;  4KB3 A;  5ECH B;  4ZL7 A;  6GSS A;  3FKF A;  4AGS A;  3C73 A;  4K7N A;  3IDV A;  5BRT A;  1O85 A;  2R0P A;  2AHE A;  4Q5R A;  3HVS A;  3LXT A;  1M3I A;  1T3B A;  2HNL A;  2K9F A;  2O89 A;  4IP6 A;  1PMT A;  2C1Y A;  4WR5 A;  1QGV A;  1O8W A;  4O32 A;  4IN0 A;  1AW9 A;  2VUP A;  5IMD A;  2WZ9 A;  1G7O A;  4GXZ A;  4POK A;  1O7U A;  3C1R A;  4MA9 A;  1Z3E A;  2L6D A;  2J23 A;  4LL4 B;  1WMJ A;  1Z6N A;  1XFL A;  3KTB A;  5EVO A;  1UC7 A;  3TKQ A;  4G2E A;  2YCD A;  14GS A;  2DSA A;  4I6X A;  5J5N A;  3W8S A;  5CAX A;  1GH2 A;  4IVF A;  1ACV A;  1ZYP A;  3P2A A;  4I2U A;  1T4Z A;  2OBK A;  3CTF A;  2BJX A;  2I1U A;  1GSD A;  4IKH A;  5J9B A;  2MYG A;  4J2F A;  5F07 A;  2PWJ A;  1ST9 A;  2IME A;  3H4K A;  3CMI A;  3R2Q A;  2P31 A;  1GUK A;  1JHB A;  1GSQ A;  4PUR A;  1GSU A;  3UVH A;  3GFK A;  4FYB A;  3ZIT A;  2VCQ A;  2CVK A;  1T1V A;  1WE0 A;  3QPM A;  1TI1 A;  1OAZ A;  2P0G A;  4JRR A;  4KH7 A;  2M80 A;  3KEB A;  3TJB A;  3HZ4 A;  1PRX A;  3O76 A;  2R0G A;  5H5Q A;  4XRA A;  5IMF A;  4YAP A;  2VIM A;  3G7J A;  3ZRE A;  3D6I A;  4TXO A;  3A5W A;  2GSR A;  2HSY A;  2KP2 A;  3IHG A;  3WT2 A;  3WT1 A;  5F06 A;  1JZW A;  3D4T A;  3Q19 A;  4ZL9 A;  1WIK A;  3F6D A;  2TRX A;  4DSS A;  5IMA A;  1SD8 A;  2VM2 A;  1GUL A;  1M0U A;  3GYK A;  4ULX A;  4PQI A;  1ABA A;  2YWO A;  1SK0 A;  2G2Q A;  5E59 A;  2PVO C;  4O5R A;  4AJ7 A;  1HNB A;  2LQQ A;  1FB0 A;  2B5E A;  5IOX A;  2VD0 A;  4HZ2 A;  2JZS A;  1XW6 A;  1EWX A;  3FZA A;  4F03 A;  5IPH A;  3WYW A;  3L9S A;  5INY A;  1PKW A;  5HR3 A;  2R2J A;  3FHK A;  1ZL9 A;  3HHV A;  5A5K A;  2VCW A;  4EL1 A;  5KOW A;  2TRC P;  3RDW A;  5ECI B;  3GKK A;  2PN8 A;  1XWC A;  1V40 A;  1X5C A;  4BL7 A;  1ERT A;  3HY2 A;  5ECN B;  3TKS C;  2IWT A;  4FYC A;  5CRW A;  3UBK A;  4ML1 A;  3ERF A;  2X64 A;  5HFI A;  3RPN A;  1M2B A;  5B6N A;  1TRV A;  4ECJ A;  2YOI A;  8GSS A;  5COH A; 
#chains in the Genus database with same CATH homology
 2L6C A;  1VF2 A;  3D0Z A;  3LG6 A;  2RM6 A;  1TOF A;  1A0F A;  3E9J B;  4MJA A;  4YH2 A;  1EP7 A;  2RUF A;  1OC3 A;  3LGC A;  5G5E A;  3UL3 A;  3QR6 A;  5CRG A;  3TKP A;  2M72 A;  2C0D A;  2DLX A;  2L5L A;  3F8U A;  2H75 A;  1OC8 A;  2C3N A;  1Z7R A;  2PPT A;  4K5S A;  1R26 A;  5CNW A;  2GZY A;  4ISD A;  4K1F A;  3SBC A;  1BJX A;  3VWW A;  2B5X A;  1EV4 A;  4YAV A;  2DJ0 A;  1A0R P;  2M46 A;  2PUK C;  2GSS A;  3KZQ A;  2P5R A;  3KMN A;  3ZLP A;  1SYR A;  3A3T A;  5DJM A;  3VI7 A;  3H8Q A;  1Z9H A;  1QUW A;  1OVN A;  3TUE A;  1QFN A;  4DEJ A;  1GWC A;  1MDI A;  3DIE A;  2HI7 A;  3KCM A;  4KDY A;  3F4S A;  4K6X A;  3VPT A;  1WRY A;  3E3E A;  3EE2 A;  4L5L A;  1G6W A;  3IXR A;  2MMA A;  1PX7 A;  4ZB6 A;  4GQF A;  4XS6 A;  4MJC A;  1T8E B;  2QA1 A;  4OO5 A;  3GL3 A;  3ZVJ A;  4G19 A;  1YKA A;  4TR4 A;  2O87 A;  1GL8 A;  3A5I A;  4EVM A;  16GS A;  4RI7 A;  2LRC A;  1EGO A;  2YPM A;  1XW5 A;  4GWR A;  3I6A A;  1BG5 A;  3N9J A;  1AC1 A;  5E4W A;  5FT3 A;  1OKT A;  1FG4 A;  2K8V A;  3FW2 A;  4JR4 A;  4KSO A;  5G30 A;  5HR2 A;  2MBS A;  2MBT A;  4RQR A;  2VM1 A;  2FA8 A;  4F0B A;  3IK7 A;  2H6Y A;  3I69 A;  1NHY A;  1PL2 A;  1GNW A;  3L78 A;  4KUN A;  3ED3 A;  5L71 A;  5G5F A;  4X0X A;  2VL3 A;  3MAK A;  2BTO T;  4EXJ A;  1X5E A;  3MNG A;  4NHZ A;  3UJ1 A;  2WCI A;  4GLT A;  4N0Z A;  2QGV A;  1S3D A;  5AGY A;  1MD4 A;  2F9S A;  3GTU A;  3BCI A;  3LYP A;  4IGJ A;  1A23 A;  4X43 A;  2CV4 A;  3H1N A;  5KN0 A;  5CRD A;  2DBC A;  2VOC A;  3ZMK A;  3IR4 A;  2V6K A;  2MZC A;  4I2T A;  4IP1 A;  5IMC A;  2A2R A;  4POM A;  3GSS A;  2LTK A;  1FOH A;  4CDO A;  1QQ2 A;  3PPU A;  3EYT A;  4XS1 A;  1XXU A;  5ENU A;  5ELG A;  5ECP B;  2XC2 A;  1I5G A;  1RK4 A;  1ZYN A;  3EPT A;  4D73 B;  1I9D A;  2I9H A;  5BMU A;  1GSE A;  1TRW A;  1X0R A;  1ZGN A;  5FHI A;  2WB9 A;  2YWM A;  2YZU A;  4HU7 A;  1FB6 A;  3O3T A;  3IHQ A;  4AJ6 A;  3IOS A;  4OWY A;  3A2V A;  1EEM A;  2GS3 A;  2H6Z A;  3CTG A;  5F05 A;  4JBB A;  3BD2 A;  3BBY A;  2JAC A;  3PR8 A;  3IC4 A;  2WJU A;  4PTS A;  3J7Y b;  2K8S A;  1F3A A;  1FVJ A;  3TJF A;  1ML6 A;  2KHP A;  4L0W A;  4K8M A;  4WF5 A;  1SK1 A;  3LEF A;  2H76 A;  4HU9 A;  6GSX A;  1X9M B;  2R4V A;  4FH8 A;  4N0V A;  4PXO A;  1JFU A;  1PQN A;  1ZCP A;  2N5B A;  2GZP A;  2QC7 A;  2LQO A;  2HRF A;  3CXG A;  3DRN A;  2CAQ A;  4GCI A;  4G0I A;  2CVD A;  1DE2 A;  3HKR A;  3GX8 A;  3CYN A;  2GQM A;  2GT5 A;  1GTI A;  3ZML A;  3VK9 A;  3GTU B;  4ZIJ A;  2LJA A;  3D5J A;  2OE0 A;  5IPG A;  5CRE A;  2CT6 A;  2EIQ A;  3RBT A;  1M99 A;  3GV1 A;  4TRX A;  4NMU A;  5IO0 A;  1FW1 A;  1XOA A;  2HT9 A;  5G1K A;  2WGR A;  4BA7 A;  5DJL A;  1K0D A;  1HD2 A;  2FCH A;  5GAN D;  3ZTL A;  1N2A A;  2IMF A;  1GSF A;  3EIN A;  3WGE A;  2KP1 A;  9GSS A;  4TOP A;  3TKR A;  4MF5 A;  1XWG A;  2JZT A;  4Z2T A;  1O6J A;  3ERW A;  2FLS A;  3TJK A;  2H74 A;  2K6V A;  1C72 A;  3TJJ A;  4IJ3 A;  4TXV A;  1SJ6 A;  2H0H A;  10GS A;  1A24 A;  2L4C A;  2R37 A;  2B6M A;  2YV7 A;  4WXT A;  3P8W A;  2YV9 A;  1JZR A;  3V1W A;  1PA3 A;  5DQS A;  1YEX A;  1ON4 A;  2VD1 A;  1YF0 A;  3FK8 A;  1A2J A;  1MDK A;  2DJJ A;  1E6B A;  4QL7 A;  1CQG A;  5J41 A;  2XBI A;  1UN2 A;  3EMP A;  4IEL A;  4ILF A;  2XBQ A;  1Y6E A;  1HQO A;  2DJ2 A;  4TVE A;  2O8V B;  5LD0 A;  1OE7 A;  1K0B A;  4WF4 A;  3VWX A;  2LS5 A;  4Z2R A;  2I3Y A;  3FEU A;  1M9B A;  3UOM A;  3IBH A;  2R3X A;  3C8E A;  1XZO A;  1SKS B;  2O7K A;  1SL2 B;  3QDN A;  4K7I A;  4CY6 A;  3ME8 A;  1R4W A;  2ZUP A;  1VF3 A;  4I97 A;  3KTL A;  1K0C A;  4DSR A;  4QL9 A;  1WWJ A;  4WET A;  3EMX A;  4Z2U A;  4XRD A;  3DD3 A;  3CRU A;  1G7E A;  4EUY A;  4G0K A;  5DAK B;  2F51 A;  3QAV A;  3HYP A;  3P90 A;  2H1B A;  1WJK A;  4FYU A;  6GSU A;  2B7J A;  2NPB A;  4J56 E;  2J9H A;  1SK2 A;  2CX4 A;  1K0O A;  2O85 A;  4GTU A;  4YQM A;  2RUE A;  4CHS A;  2HZF A;  2OBI A;  1J08 A;  2VLV A;  1TDI A;  1SYX A;  4MNN A;  4OMV A;  3FYG A;  4ECC A;  5D96 A;  4EDZ A;  2YJ7 A;  1SKR B;  1B9X C;  2B7K A;  2DML A;  1VF4 A;  3QFA C;  3ZYW A;  3MIX A;  5H5S A;  2DKH A;  2GGT A;  4PUF C;  4MF6 A;  3QOU A;  3S9F A;  3G9B A;  4MMM A;  2YZH A;  2JU5 A;  1TP9 A;  2NBS A;  4HJ2 A;  5B6M A;  4N11 A;  1XOB A;  2QSI A;  1W89 A;  2LNT A;  2KLX A;  2LKU A;  3ZFB A;  5ECO B;  4RUV A;  4K0G A;  2GLR A;  4OFN A;  5JWO B;  5FWG A;  4OFT A;  1RQM A;  2H6X A;  3VI5 A;  1ILO A;  2VLU A;  3WGD A;  2X8C A;  4ACS A;  4LLR A;  1PKZ A;  2MMO A;  4BVX B;  3ISO A;  3JCM L;  1XBS A;  2ES7 A;  3AY8 A;  6GST A;  4O5U A;  2E2M A;  4MLY A;  3M1G A;  3HVV A;  3TRX A;  4MP4 A;  2WRT A;  6GSW A;  4PQH A;  3CSI A;  3FR6 A;  2KOK A;  2VCX A;  4KE3 A;  1T7P B;  3BJ5 A;  1ZOF A;  5CO3 A;  2H19 A;  1WPI A;  3F4R A;  2K18 A;  1TK8 B;  2GDR A;  1A8Y A;  3WGX A;  4I5Q A;  2LRT A;  3FRC A;  1PX6 A;  1S3C A;  2FWG A;  2AAW A;  2GST A;  3M9K A;  5ECQ B;  4FO5 A;  1VGL A;  2YN1 A;  4ZIL A;  5G31 A;  5LCZ A;  1SEN A;  2PMT A;  3BCK A;  4MJE A;  1F37 A;  5D9T A;  4Q5Q A;  4G9H A;  5IMV A;  4XCS A;  5HFG A;  1EOH A;  4BWQ A;  2H01 A;  3LXZ A;  19GS A;  5B7C A;  5AIS A;  5D93 A;  1TJD A;  1EV9 A;  2C4J A;  1HNA A;  5D73 A;  5J4U A;  1PN9 A;  2GTU A;  3IRA A;  3UAP A;  4MAB A;  1BED A;  1NW2 A;  1F3B A;  4MPF A;  4OCF A;  3GUR A;  1H4O A;  2E2G A;  2Z9S A;  4EIQ A;  1J9B A;  5IOW A;  4TN8 A;  2D2Z A;  4X4J A;  2GQL A;  1XWK A;  3HJM A;  4OCE A;  1GTU A;  1H75 A;  4HUA A;  2WS2 A;  2EIO A;  2WUL A;  3UAR A;  4D73 A;  2PU9 C;  1U87 A;  3C71 A;  1R5A A;  3UIW A;  4ZBD A;  5A4W A;  4NAX A;  4EC0 A;  2JSZ A;  1EGR A;  2QA2 A;  5HQP A;  5KN2 A;  5EPF A;  1FO5 A;  2G0F A;  2DIZ A;  2AYT A;  3F63 A;  4HZ4 A;  3NZN A;  4PGT A;  2EIR A;  2V1M A;  2H66 A;  4P3Y B;  1Z7P A;  1HYU A;  4KX4 A;  3F0I A;  3HJO A;  3QCP A;  1GP1 A;  4XS4 A;  2MMZ A;  3F3R A;  3W8J A;  1B9Y C;  5KEJ A;  5ECK B;  1GSS A;  4H86 A;  4RI6 A;  3VWU A;  2VL2 C;  1U3A A;  1DUG A;  3FR3 A;  4K9Z A;  3QMX A;  3GH9 A;  1HNC A;  1MD3 A;  1FVK A;  1Q98 A;  3QFB C;  4O5Q A;  3GUS A;  3SWL A;  3Q6O A;  1BQ7 A;  3TKS A;  5DVB A;  4PNG A;  2V2G A;  2PVQ A;  4O92 A;  1O73 A;  2L5O A;  2FGX A;  2I4A A;  3GNJ A;  4OD7 A;  3L9V A;  3QD9 A;  3M9J A;  2AJQ B;  4WEY A;  2DIY A;  1SD9 A;  2C3T A;  2IIY A;  1OC9 B;  2H73 A;  1PN0 A;  5DCG A;  1M2A A;  2LUS A;  4LL1 B;  2FA4 A;  3IAM 2;  2OAC A;  4V1A p;  5AN1 A;  1BAY A;  2IMD A;  4HDE A;  1ERW A;  1G6Y A;  5H5R A;  2IMI A;  2H1A A;  1ZZY A;  5A4V A;  5LNK e;  5KN3 A;  2LV3 A;  4ZL8 A;  2DMM A;  2V6O A;  1WP0 A;  3IV4 A;  2P5Q A;  3VPQ A;  4DSQ A;  2FWE A;  4GF0 A;  2VL9 A;  2LJR A;  4V1A g;  5DDL A;  3HJP A;  5JCG A;  20GS A;  3LQ7 A;  4WKW A;  4HOJ A;  1KNG A;  3R3E A;  3HVX A;  1O81 A;  4K5R A;  2JL4 A;  5GZZ B;  4ECI A;  3TDG A;  1GTA A;  4YKG A;  2VCZ A;  4K2X A;  3KIJ A;  4MZC A;  3TJG A;  4XS4 B;  4WBJ A;  1TTZ A;  11GS A;  3LWA A;  1XPV A;  4GSS A;  5DBQ A;  3A2X A;  2F8F A;  2XPE A;  2OAD A;  3FMW A;  2FWH A;  3HA9 A;  2CZ2 A;  4IHU A;  2HFD A;  1ZMA A;  1CQH A;  2H8L A;  2B1L A;  2QKE A;  2FNO A;  3TB2 A;  2KUC A;  5ABR A;  1PGT A;  3C7M A;  4OFM A;  1YJ6 A;  5ECR B;  2H0G A;  1AQX A;  2X8G A;  4JZQ A;  3DVX A;  2H1D A;  2GZZ A;  1DBY A;  2ZNM A;  3RHC A;  2LNS A;  3ZRD A;  1M7T A;  4JR6 A;  1URM A;  1Z6M A;  3GKM A;  2JAD A;  2A2S A;  1EOG A;  2DC5 A;  2A4V A;  3IK9 A;  5DAK A;  2IMK A;  4AF2 A;  1SL1 B;  3EUR A;  2MMN A;  4K7O A;  1JLV A;  5ID2 A;  3O6T A;  3DKS A;  3APO A;  5A4U A;  2I81 A;  1MDJ A;  3VLN A;  3KP8 A;  3UBL A;  4O7H A;  5EL8 A;  2FUG 2;  6GSY A;  2C8U A;  4V2N A;  4KDX A;  2TIR A;  2IFQ B;  3GHA A;  5C04 A;  1YDK A;  4BWS A;  5G2Z A;  4PQ1 A;  3GH6 A;  2H1G A;  4MF7 A;  3DWV A;  2BMX A;  2CX3 A;  2XPD A;  3F6F A;  4EE0 A;  3U5R E;  5D9V A;  4FIW A;  1R5P A;  2LEG A;  4PX1 A;  2OKA A;  1NSW A;  2UZ8 A;  4DVC A;  1GUH A;  3LOR A;  4HS1 A;  3F9U A;  3TGZ A;  3GX0 A;  4Z7X A;  3ZL5 A;  1GRX A;  4GSN A;  3G7I A;  3KP9 A;  5DAL B;  1QK8 A;  2PGT A;  2NVL A;  4ZBA A;  4F82 A;  4V2L A;  5HR1 A;  3RAZ A;  2NTO A;  2GQK A;  5CRH A;  2F8A A;  2RLI A;  4QQ7 A;  3F3Q A;  3KM6 A;  1V57 A;  5GSS A;  1PD2 1;  3CRT A;  1K0N A;  2B3S A;  3QAG A;  4BVX A;  2HZE B;  3E0U A;  2F3M A;  4LA1 A;  3TRP A;  1Y25 A;  3CSH A;  3I43 A;  5IMZ A;  3ZIJ A;  2E0Q A;  3MYD A;  4PNF A;  3PGT A;  2XHF A;  1U3I A;  1X9S B;  1GSY A;  2H30 A;  1QMV A;  2H70 A;  5ECL B;  4HQS A;  2DJ3 A;  5ID2 B;  3HD5 A;  4HQZ A;  4KAE A;  1EP8 A;  3GRX A;  2HRA A;  3HXS A;  1SU9 A;  2N5A A;  4ICY A;  3M0F A;  3UMA A;  3VUR A;  4F0C A;  5J9C A;  4FQU A;  4OO4 A;  4JE1 A;  4L0U A;  2L4Q A;  2R0C A;  1TKD B;  2ON7 A;  2YNX A;  1JZD A;  4MK3 A;  1FOV A;  3A2W A;  3TRQ A;  4GST A;  3IAS 2;  2H72 A;  1V98 A;  3ERG A;  3IE3 A;  1K0A A;  3EU4 A;  3NIV A;  4KCA A;  4LMV A;  4E8H A;  4TR1 B;  2AUV A;  1K0M A;  3TOU A;  1XW9 A;  2C3Q A;  1ZYQ B;  3GA4 A;  1TK5 B;  4HI7 A;  2V32 A;  3D4M A;  4EKZ A;  4MDC A;  3DVW A;  3PH9 A;  2L59 A;  1AQW A;  1V2A A;  4G10 A;  17GS A;  3P7X A;  4MZW A;  1DE1 A;  4POB A;  4BVY B;  5CYY A;  1AXD A;  2GT6 A;  5G1L A;  3US3 A;  2JZR A;  4X1U A;  2JSY A;  5GST A;  4E8E A;  4K0N A;  1YF1 A;  3DYR A;  4V2M A;  2X99 A;  2IN3 A;  1SJI A;  2HLS A;  4ZXG A;  5B8B A;  1B4Q A;  1AQV A;  1XVQ A;  2LJK A;  1ERU A;  1K3Y A;  1R7H A;  4USS A;  2LRN A;  3HDC A;  2CA8 A;  1AAZ A;  5KN1 A;  2VCT A;  5JWR B;  4F2I A;  22GS A;  2WDU A;  5ECM B;  2A4H A;  3EC3 A;  3EWL A;  1KEB A;  2HSH A;  2RII A;  2OA7 A;  3I9V 2;  1JLW A;  2OJL A;  12GS A;  4GQC A;  4PUA A;  3W6G A;  2C0G A;  2FWF A;  4CW9 A;  1W4V A;  1TRU A;  2B5Y A;  4KF9 A;  2A2P A;  3N5O A;  3ZVJ D;  2VAF A;  4ID0 A;  1MEK A;  1RW1 A;  4IQ1 A;  3FR9 A;  4XTS A;  3UEM A;  4NXI A;  4HJM A;  5IIZ A;  3Q18 A;  1TW9 A;  2X8H A;  3VFI A;  4L8E A;  4N30 A;  4WR4 A;  1TK0 B;  4KND A;  2DJ1 A;  1BX9 A;  3MDK A;  3ZFL A;  3FY7 A;  3LW9 A;  1Q4J A;  1FAA A;  3FZ4 A;  2YWN A;  1O8X A;  3KJY A;  1OC9 A;  2H71 A;  3KD0 A;  1X9W B;  5CP1 A;  5IO2 A;  1FHE A;  1K3O A;  3ME7 A;  4YQV A;  2OE1 A;  1AUC A;  2CAI A;  1B48 A;  2EC4 A;  4MZB A;  4IW9 A;  4JED A;  5HFK A;  1G0T A;  2R5G A;  3G7Y A;  1VRS D;  1F2E A;  2X49 A;  4TXO B;  2HRN A;  1A8L A;  1KBN A;  3M3M A;  4Q5N A;  2AB6 A;  3IC8 A;  4DSS B;  5AIV A;  3GMF A;  2CQ9 A;  2PER A;  3DML A;  1TU7 A;  3UVT A;  1XCC A;  1LBK A;  1GLP A;  4KCE A;  2ZCT A;  2AV4 A;  4LMW A;  4EDY A;  2B1K A;  3HCZ A;  2WFC A;  4IBP A;  3H93 A;  1ZYE A;  2REM A;  4J57 E;  3IA1 A;  3MSZ A;  2ALB A;  3C1S A;  4Q5F A;  3EU3 A;  1T4Y A;  2HRK A;  3LFL A;  2FHE A;  2N5F A;  4MH3 A;  1WOU A;  1BYE A;  4BL7 B;  4EF0 A;  1AIU A;  5ECS A;  13GS A;  4NV5 A;  3J7Y k;  5B8A A;  4ZB8 A;  2HXK A;  4HEA 2;  4RQX A;  2RM5 A;  3GST A;  1PL1 A;  1YQ1 A;  1NM3 A;  2HYX A;  3LSZ A;  2DJK A;  1V9W A;  1NHO A;  1S3A A;  5EY6 A;  2V41 A;  3KMO A;  4XHM A;  5DQY A;  1XWB A;  3DGQ A;  2C0F A;  1SL0 B;  1THX A;  3KH9 A;  3L0H A;  2OE3 A;  1OKD A;  1JZO A;  1TI3 A;  5JCW A;  4TR3 A;  3H79 A;  4KGI A;  5F8B A;  3ZZX A;  4TKY A;  4TW5 A;  5C00 A;  2FY6 A;  1K3L A;  1UA5 A;  2YP6 A;  3U6V A;  2VLT A;  4ML6 A;  1YZX A;  4A5P A;  3KXO A;  4K2D A;  5D8I A;  4EO3 A;  2X4A A;  18GS A;  3DXB A;  5AIX A;  5F0G A;  1EEJ A;  1F6M C;  4JU5 A;  4YQU A;  4KSM A;  4YKF A;  5D9X A;  5ELA A;  2ON5 A;  1A2L A;  2VO4 A;  3L9U A;  1XIY A;  1GUM A;  5DCH A;  3LJR A;  3MWH A;  2R6K A;  4KA0 A;  4NPB A;  3APQ A;  1U6T A;  2IFQ A;  3K8N A;  4WBR D;  2C0E A;  4GRF A;  1TU8 A;  2CZ3 A;  3L4N A;  2VCV A;  5HR0 A;  2DKI A;  3CBU A;  4IQA A;  1SJZ A;  3GL5 A;  6GSV A;  1B8X A;  2HE3 A;  2IL3 A;  1E2Y A;  4CY8 A;  4MH2 A;  2YWI A;  3DEX A;  1THO A;  3IPZ A;  4EIP A;  4N10 A;  1ERV A;  2H0I A;  1GNE A;  1TXX A;  2IJY A;  1X5D A;  5IQY A;  1YY7 A;  5JWQ B;  5DAL A;  1Z5Y E;  1QXH A;  3RHB A;  4AJ8 A;  4G0L A;  4XIH A;  2HSM A;  4TR0 A;  5J3R A;  1MTC A;  2GVP A;  4BPY A;  1DSB A;  1OE8 A;  1GTB A;  1LJR A;  4NHW A;  4F9Z A;  3GN3 A;  2PBJ A;  3EVI A;  2HZE A;  5IM9 A;  2VL2 A;  1VF1 A;  1TRS A;  2E7P A;  3TKS E;  4KW6 A;  2IPA A;  2YJH A;  1YKC A;  2YAN A;  3APS A;  1PSQ A;  3D21 A;  3QAW A;  3KGK A;  1USB A;  1F9M A;  4KDU A;  7GSS A;  2GSQ A;  1GLQ A;  4NV2 A;  3GIX A;  3NOF A;  2LST A;  1OYJ A;  3VWV A;  1J0F A;  1M2D A;  4NWY A;  1YEP A;  4IS0 A;  5KOX A;  4ZBB A;  3ZIV A;  3OR5 A;  5GAP D;  3FZ9 A;  4MPG A;  1EZK A;  2NDO A;  4ZB9 A;  1M9A A;  2CVB A;  3PIN A;  4ECB A;  1KTE A;  2FD3 A;  3KH7 A;  3TCO A;  4IJI A;  3Q74 A;  1B4P A;  3TOT A;  4MJB A;  4TR1 A;  1LU4 A;  3RPP A;  3D22 A;  4MCU A;  4POL A;  3F4T A;  4L5O A;  1UVZ A;  4I8B A;  3M8N A;  3HZ8 A;  1XWA A;  1T00 A;  2L57 A;  1SKW B;  1IYH A;  3LYK A;  1V58 A;  1U88 A;  3GKN A;  2C80 A;  5D9W A;  4BVY A;  3CSJ A;  3BOA A;  3FZ5 A;  1A2M A;  1N8J A;  1XVW A;  5JCU A;  1IYI A;  3WD6 A;  3GKX A;  4KB3 A;  5ECH B;  4ZL7 A;  6GSS A;  3FKF A;  4AGS A;  3C73 A;  4K7N A;  3IDV A;  5BRT A;  1O85 A;  2R0P A;  2AHE A;  4Q5R A;  3HVS A;  3LXT A;  1T3B A;  2HNL A;  2K9F A;  2O89 A;  4IP6 A;  1PMT A;  2C1Y A;  4WR5 A;  1QGV A;  1O8W A;  4O32 A;  4IN0 A;  1AW9 A;  2VUP A;  5IMD A;  2WZ9 A;  1G7O A;  4GXZ A;  4POK A;  1O7U A;  3C1R A;  4MA9 A;  1Z3E A;  2L6D A;  2J23 A;  4LL4 B;  1WMJ A;  1Z6N A;  1XFL A;  3KTB A;  5EVO A;  1UC7 A;  3TKQ A;  4G2E A;  2YCD A;  14GS A;  2DSA A;  4I6X A;  5J5N A;  3W8S A;  5CAX A;  1GH2 A;  4IVF A;  1ACV A;  1ZYP A;  3P2A A;  4I2U A;  1T4Z A;  2OBK A;  3CTF A;  2BJX A;  2I1U A;  1GSD A;  4IKH A;  5J9B A;  2MYG A;  4J2F A;  5F07 A;  2PWJ A;  1ST9 A;  2IME A;  3H4K A;  3CMI A;  3R2Q A;  2P31 A;  1GUK A;  1JHB A;  1GSQ A;  4PUR A;  1GSU A;  3UVH A;  3GFK A;  4FYB A;  3ZIT A;  2VCQ A;  2CVK A;  1T1V A;  1WE0 A;  3QPM A;  1TI1 A;  1OAZ A;  2P0G A;  4JRR A;  4KH7 A;  2M80 A;  3KEB A;  3TJB A;  3HZ4 A;  1PRX A;  3O76 A;  2R0G A;  5H5Q A;  4XRA A;  5IMF A;  4YAP A;  2VIM A;  3G7J A;  3ZRE A;  3D6I A;  4TXO A;  3A5W A;  2GSR A;  2HSY A;  2KP2 A;  3IHG A;  3WT2 A;  3WT1 A;  5F06 A;  1JZW A;  3D4T A;  3Q19 A;  4ZL9 A;  1WIK A;  3F6D A;  2TRX A;  4DSS A;  5IMA A;  1SD8 A;  2VM2 A;  1GUL A;  1M0U A;  3GYK A;  4ULX A;  4PQI A;  1ABA A;  2YWO A;  1SK0 A;  2G2Q A;  5E59 A;  2PVO C;  4O5R A;  4AJ7 A;  1HNB A;  2LQQ A;  1FB0 A;  2B5E A;  5IOX A;  2VD0 A;  4HZ2 A;  2JZS A;  1XW6 A;  1EWX A;  3FZA A;  4F03 A;  5IPH A;  3WYW A;  3L9S A;  5INY A;  1PKW A;  5HR3 A;  2R2J A;  3FHK A;  1ZL9 A;  3HHV A;  5A5K A;  2VCW A;  4EL1 A;  5KOW A;  2TRC P;  3RDW A;  5ECI B;  3GKK A;  2PN8 A;  1XWC A;  1V40 A;  1X5C A;  4BL7 A;  1ERT A;  3HY2 A;  5ECN B;  3TKS C;  2IWT A;  4FYC A;  5CRW A;  3UBK A;  4ML1 A;  3ERF A;  2X64 A;  5HFI A;  3RPN A;  1M2B A;  5B6N A;  1TRV A;  4ECJ A;  2YOI A;  8GSS A;  5COH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...