3ZL5A

Crystal structure of schistosoma mansoni peroxiredoxin i c48s mutant with one decamer in the asu
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
162
structure length
162
Chain Sequence
LLPNRPAPEFKGQAVINGEFKEICLKDYRGKYVVLFFYPADFTFVSPTEIIAFSDQVEEFNSRNCQVIACSTDSQYSHLAWDNLDRKSGGLGHMKIPLLADRKQEISKAYGVFDEEDGNAFRGLFIIDPNGILRQITINDKPVGRSVDETLRLLDAFQFVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXIREDOXIN I
publication title Switching between the Alternative Structures and Functions of a 2-Cys Peroxiredoxin, by Site-Directed Mutagenesis
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Oxidoreductase
total genus 54
structure length 162
sequence length 162
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2013-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zl5A00
2KHPA 4I6XA 1A23A 2RIIA 2YN1A 4Z7XA 1THXA 10GSA 4KCAA 2H1BA 4XS4B 7GSSA 2V6OA 4HU7A 3KTBA 4K2DA 4ZILA 3A3TA 3HHVA 2M46A 2DC5A 3DD3A 2C0GA 2LS5A 3RAZA 1Z3EA 1GTAA 1EV4A 2YWNA 5E4WA 2VOCA 4OWYA 2C1YA 4ML1A 2VCVA 1LJRA 1FO5A 2AHEA 4OCFA 4HUAA 4HJ2A 5GAPD 2FUG2 4FH8A 1JZWA 3FZ5A 1XW9A 2C3NA 3A2XA 5IOWA 3DVXA 5HFGA 3TJKA 4ECIA 4XS1A 2MMNA 5E59A 3C1RA 1TP9A 1MD3A 2GTUA 3WYWA 3APOA 2GZYA 12GSA 4KDUA 4P3YB 4ZBBA 2IIYA 4CHSA 1K0BA 1PQNA 2L5LA 4PXOA 3UL3A 1B4PA 3PGTA 2E7PA 2H6XA 2CAIA 3ISOA 4NHWA 2L57A 3KZQA 3RHBA 4NHZA 1TK0B 4AJ8A 1KTEA 1SJIA 1YZXA 2HRNA 1SYXA 2C3TA 3FKFA 1PSQA 2GVPA 2X99A 1R26A 1B9XC 4LLRA 3LSZA 1IYHA 2VCXA 5F8BA 5G31A 2OKAA 1XXUA 5IMDA 3CSJA 2GT6A 1VF1A 4K1FA 5D9VA 5ECOB 1X9WB 3ZREA 3Q18A 3CXGA 4GF0A 2V6KA 2CA8A 1ABAA 3ED3A 4KCEA 2JZSA 2VL3A 5INYA 2TIRA 2GDRA 2FCHA 4XRAA 1ZL9A 3HJPA 3IK9A 4XS6A 3KMNA 5D8IA 2C3QA 2ZCTA 4EXJA 4WETA 3FYGA 2MBTA 2XHFA 4XIHA 1X9SB 3UIWA 4N10A 5DAKB 3EWLA 2K9FA 4D73B 4IGJA 1SK1A 1GLPA 3MNGA 2MMOA 2L59A 1GWCA 3IXRA 2H8LA 3UMAA 3EMXA 4AGSA 5ID2A 3WGXA 3EMPA 2YV9A 3F3RA 3TKSC 4KDXA 4MF6A 1A2LA 2KP2A 3S9FA 3QMXA 4RI7A 1B4QA 2EIRA 2BMXA 1K0MA 1A8YA 1USBA 2FY6A 1TXXA 1BQ7A 4QL7A 3SWLA 3GX0A 4MMMA 3Q6OA 3HYPA 5CREA 1XCCA 3ZFBA 2RM5A 1UN2A 4IP6A 2QSIA 5IMFA 5HFKA 1PKWA 2VM2A 4X43A 5J9CA 2P5RA 3UJ1A 4LL4B 4POBA 2OJLA 2VCTA 2LKUA 2TRXA 4V2MA 1ON4A 18GSA 1EZKA 1OAZA 2LEGA 1O6JA 3WD6A 3L9UA 3F6FA 2DMMA 3GIXA 1WWJA 3ZYWA 1B8XA 4TVEA 1URMA 2L6DA 1SJ6A 4MLYA 2MZCA 1V57A 2RLIA 1BYEA 6GSXA 5IMZA 1XW5A 5B6NA 1B48A 1EEJA 1GTUA 4IBPA 3FY7A 5KN1A 3GKXA 5IM9A 3I9V2 4KW6A 3GN3A 3F4RA 2NBSA 4AF2A 2XPEA 1RK4A 4Q5RA 2H71A 1QFNA 9GSSA 3GH6A 2GQLA 3G7JA 1TDIA 3F9UA 1J08A 4MK3A 3GMFA 3KGKA 3KP8A 2REMA 1C72A 1K0DA 3CTGA 4AJ6A 4TN8A 1JZDA 3ZVJD 1GSFA 3Q19A 2CZ2A 3M3MA 2NTOA 3HA9A 5ENUA 1Q4JA 5ECKB 4POLA 4F0BA 1UVZA 4F03A 5KN3A 4ZL7A 3HVSA 2R6KA 3GUSA 2J23A 4TRXA 4DSRA 1QQ2A 4IS0A 3FHKA 3P8WA 3DMLA 4XCSA 4FYBA 3GKNA 5CYYA 3GX8A 4GXZA 2H74A 4K9ZA 3DXBA 2QKEA 1K0CA 1M2AA 4FO5A 4GLTA 3ZIJA 2H70A 4KSOA 3KD0A 1EGOA 1PX7A 3ZMKA 4DSSB 1GP1A 2H1GA 3L9SA 4WKWA 3C73A 5GZZB 1SYRA 4N30A 3TB2A 2O85A 1Z6MA 3PH9A 4DEJA 1YJ6A 4KA0A 3ME8A 5CP1A 4O32A 5AIVA 4ZB9A 4MZBA 5ECSA 3FEUA 4PQ1A 2B5YA 4G2EA 4NXIA 1SENA 4EO3A 5A5KA 3EU4A 3OR5A 3CRUA 4RI6A 1GNEA 4CDOA 4FIWA 4PQHA 1X5EA 1ZZYA 1XVQA 3NZNA 4NPBA 1F37A 2H0GA 2WZ9A 1XWGA 5F05A 2GZZA 2H72A 5FHIA 2LSTA 1YKAA 1HQOA 2C80A 1OKTA 4EC0A 5ABRA 3EE2A 3IE3A 3W8JA 4ZL9A 5ECPB 1S3AA 2YNXA 3EYTA 1S3CA 4IJ3A 1SD8A 3QAVA 2LJRA 4NV5A 3TJBA 2JSZA 3TOTA 1XPVA 3GH9A 2LV3A 4ECCA 1XWKA 3GTUA 2YJ7A 2R3XA 4NMUA 5JWQB 5IPHA 1SKWB 4JEDA 1GNWA 2VLVA 2ZNMA 1R5PA 5DALB 1XW6A 1K0OA 1SD9A 2YV7A 4ISDA 4TXVA 4RQRA 3U6VA 1A0RP 2LJKA 4MZWA 3LXTA 1M2DA 1TRVA 5DCGA 1FW1A 14GSA 1GUHA 2R4VA 4KX4A 1A24A 3G7YA 3KXOA 1MDIA 4IKHA 19GSA 1GH2A 2J9HA 4N0VA 5B6MA 4F0CA 17GSA 1EP7A 4QL9A 2RM6A 4HQSA 4JRRA 2LQQA 5ECRB 3IPZA 2CT6A 3ERFA 5LD0A 4MH3A 1GSQA 1W89A 4OD7A 2I4AA 4XHMA 1OC9A 3IHQA 4BL7A 5EPFA 3A5WA 3ERWA 2WJUA 4ILFA 2TRCP 4TXOB 4K7IA 3KH9A 2DJ2A 4F82A 4LL1B 1X5DA 3DIEA 1S3DA 2MMAA 3HD5A 1PMTA 4JZQA 1BEDA 1SKSB 1HYUA 1OC3A 3O3TA 3C71A 2FA4A 4ZBDA 3G9BA 3TRQA 2LRCA 2WCIA 4QQ7A 2VLUA 4O5RA 5L71A 5CO3A 2LNTA 5H5QA 2RUEA 1SU9A 1F3AA 2GQMA 2HZEB 4BWQA 4KGIA 5DCHA 2YWOA 1FB6A 1VF4A 5J4UA 4TR1A 2H73A 3QFAC 1DUGA 3J7Yb 4OFTA 1XVWA 2C8UA 5A4UA 1W4VA 3LFLA 2GSTA 5ECLB 1TJDA 3GKKA 1ZCPA 2HI7A 2HZFA 5ID2B 5G1KA 2RUFA 1A2MA 4PURA 2GZPA 2GT5A 2JADA 4LA1A 3QAWA 2AUVA 1E2YA 4YAVA 3WGEA 5ECIB 3A2WA 3EURA 1FG4A 5G5FA 5JWOB 3VI7A 1NHYA 4X0XA 2ON7A 1BX9A 4YQMA 2OA7A 1AAZA 4KH7A 4V2LA 4POKA 1GUMA 4I8BA 4ECBA 3FK8A 1ZMAA 3IAM2 2YWMA 3VLNA 4DSQA 1AIUA 2E0QA 1Y6EA 4XS4A 1ST9A 2YANA 2CV4A 3GL3A 5DJMA 5J41A 2CVDA 3ZVJA 1OYJA 1X9MB 1EV9A 1NHOA 2NDOA 1PX6A 3D4TA 3BJ5A 1SKRB 2ZUPA 5JCGA 4PUAA 3E9JB 3GSTA 4MF7A 1CQGA 2F8AA 2VIMA 2WULA 3TJJA 3HCZA 4GSSA 4KB3A 3LGCA 3LJRA 2C0DA 2C0EA 3ME7A 2MMZA 3VFIA 3VPQA 5ECNB 1XZOA 2KLXA 5C00A 3CTFA 4ACSA 1MEKA 1KNGA 2MYGA 3LQ7A 5AGYA 4K0NA 13GSA 2K8VA 1PA3A 3L0HA 2FLSA 1LU4A 2X8GA 11GSA 4KSMA 1EOGA 1U3AA 4L5LA 3N5OA 3ZLPA 1FVKA 4J2FA 3ZL5A 1M9BA 1U6TA 2HSHA 2WS2A 1SK2A 1CQHA 2XC2A 4K7NA 3D6IA 4WF4A 1N8JA 3F4TA 2V41A 5D9XA 4HS1A 3M8NA 2M72A 5IO2A 4HU9A 2K18A 3LWAA 4F9ZA 3MDKA 3QDNA 2F51A 4MPGA 4YAPA 5ECMB 1SL2B 3RBTA 2K8SA 1TW9A 2CVKA 3W6GA 4MZCA 2DJ1A 2YWIA 2FWFA 2GS3A 3HZ4A 2X8HA 2AV4A 3UAPA 2P5QA 3F6DA 4O92A 3US3A 4V2NA 1PRXA 3G7IA 1SJZA 4ULXA 3NIVA 5A4VA 4TKYA 3QFBC 3D22A 2IMDA 3F8UA 4MJEA 3IC4A 1M0UA 5F06A 4HI7A 5IIZA 3KTLA 3H8QA 5DVBA 3GKMA 2JZTA 4D73A 3PINA 4KAEA 4BVYA 3JCML 1K3OA 1Y25A 3KH7A 4IN0A 4IVFA 1T4ZA 2I3YA 3IAS2 1GSUA 2FNOA 4HEA2 4Q5QA 6GSWA 2H6ZA 5IO0A 2PWJA 3FR6A 2VO4A 3TDGA 4MA9A 1PKZA 3ZITA 1HNCA 2H30A 5ECQB 3L4NA 3FZ9A 2VL2A 1T3BA 3GNJA 2DJ3A 1TTZA 3VWUA 2VD0A 2B6MA 1GTBA 4LMWA 3D0ZA 2XBIA 3VWVA 1JHBA 2PU9C 1JLVA 1FVJA 1BJXA 5B7CA 3U5RE 4IW9A 1WJKA 2XBQA 5FWGA 5GAND 2L5OA 1OVNA 2WRTA 2CZ3A 2FD3A 3ZRDA 4EDYA 3K8NA 2VM1A 2JACA 3GTUB 4NV2A 1E6BA 2IWTA 4OMVA 5G30A 5AN1A 4V1Ap 5DQSA 3TKPA 1TK5B 2OBKA 1QMVA 3LORA 3CRTA 1K3LA 3IRAA 2B7KA 2VCQA 5LNKe 2H75A 4GQFA 1XBSA 1VGLA 4I2TA 1HNBA 2VLTA 2LTKA 2EC4A 3QAGA 1WIKA 4L5OA 3LEFA 4Q5NA 3APSA 2BJXA 4EUYA 2DIZA 1DE2A 1VF3A 5IQYA 3C7MA 2H0IA 20GSA 5KEJA 2CX4A 2OE3A 5DJLA 1MTCA 4MABA 4HOJA 2VUPA 2A2SA 2P0GA 4HZ2A 2R2JA 5GSTA 1H4OA 3ZZXA 1V58A 5CNWA 2OADA 2IFQA 3H93A 2VD1A 3TOUA 1TRUA 1XWCA 2KOKA 4EKZA 2IJYA 3CMIA 1M7TA 3TCOA 2IMEA 2FWHA 5HR1A 1OC9B 4BWSA 3UARA 5G1LA 5IMAA 2R37A 2K6VA 1U3IA 2PERA 3QCPA 4L0WA 5CRHA 5HR2A 4HJMA 2JZRA 3E0UA 3PR8A 4G9HA 6GSVA 16GSA 4IELA 4NAXA 1RW1A 3F4SA 2D2ZA 1YDKA 2QGVA 1N2AA 5D9TA 1TU7A 1V2AA 2HLSA 2IMIA 2H6YA 1G0TA 5GSSA 4ID0A 3Q74A 4PX1A 4ZB8A 3QD9A 3UOMA 4FYUA 4MF5A 3F3QA 3MSZA 5HFIA 4CW9A 4XTSA 1ML6A 4YH2A 4MH2A 4WF5A 1PN9A 4DSSA 3CSIA 4TR1B 1TI3A 3D4MA 3ZMLA 1Z7RA 2G2QA 2N5FA 2YPMA 2HRFA 2B7JA 1SL0B 3I6AA 1WP0A 1M2BA 4G10A 4EF0A 1X5CA 1TK8B 3HY2A 3TKRA 1G7EA 1GSDA 3A2VA 2YOIA 3W8SA 1ACVA 2HT9A 2B3SA 3H79A 2GSSA 1DSBA 2F3MA 4TR3A 4ZXGA 4XRDA 4IQAA 4IJIA 3F0IA 3TGZA 5CRWA 1DBYA 1QXHA 5J9BA 1K0NA 2G0FA 1XFLA 4IQ1A 1SL1B 5IMCA 4BVXA 1O81A 1ZOFA 3HJOA 5COHA 2O8VB 1J0FA 3LG6A 3VURA 4YQVA 1OKDA 4OO4A 1J9BA 4ZIJA 3LYPA 2A2RA 2H01A 5HR0A 1AUCA 3KEBA 1AW9A 3HKRA 2HE3A 5IPGA 2CAQA 3H4KA 1EOHA 5F0GA 4MDCA 1JLWA 3EVIA 3MWHA 2OE1A 1F3BA 1G6YA 4RQXA 4K7OA 3GYKA 3KM6A 5EY6A 3IDVA 2F9SA 5DALA 3TUEA 3BCKA 2KP1A 2L4CA 5AISA 6GSSA 4PNFA 1GSEA 3IBHA 5HR3A 5CAXA 1KEBA 1OE7A 3P2AA 4KUNA 4WEYA 4X1UA 2O87A 4RUVA 1A0FA 5H5RA 2WGRA 1TRSA 2VL2C 1MDJA 2O89A 2V1MA 2LUSA 3P7XA 3M1GA 3IOSA 1WPIA 3GSSA 2OBIA 1G7OA 5DQYA 3NOFA 1FAAA 2H19A 4YQUA 4K8MA 2HSYA 3RPPA 1X0RA 4ZB6A 5D9WA 2FHEA 4J56E 2YJHA 2M80A 1ZYQB 4OFMA 5AIXA 3P90A 4N11A 3TJFA 4MP4A 4MCUA 3L9VA 4GTUA 3O6TA 1GTIA 2MBSA 2H66A 2PVQA 4NWYA 4TXOA 1GL8A 1GSYA 4JR6A 2JSYA 1HNAA 3IK7A 1ILOA 1HD2A 2IPAA 1NW2A 1YQ1A 2BTOT 3HDCA 5EL8A 1R4WA 2V2GA 3UVHA 2WDUA 4F2IA 2AAWA 2DLXA 2GLRA 1OC8A 1YY7A 1KBNA 2PPTA 3FRCA 3TKQA 4OCEA 2H1DA 2FWGA 1F6MC 1SK0A 3DWVA 5G5EA 3ZFLA 3GA4A 4EE0A 1V98A 8GSSA 1Z5YE 3HZ8A 1XWBA 4POMA 2PUKC 3O76A 1AQWA 2OACA 4BPYA 2HZEA 1AXDA 3M9KA 4GQCA 5F07A 2R5GA 3H1NA 2JU5A 4TW5A 1PL1A 1THOA 4OFNA 1PL2A 3GRXA 2CVBA 1GLQA 3DGQA 5ECHB 3IA1A 1LBKA 4ML6A 2GQKA 3GV1A 2LJAA 2N5AA 3HVVA 1BAYA 2FWEA 3BOAA 3QR6A 2EIOA 5J3RA 4ZBAA 3TRPA 1T7PB 3HXSA 4N0ZA 3L78A 5CRDA 4WR5A 3WT1A 1FB0A 3D21A 3J7Yk 2PMTA 4TR0A 1O73A 4GSNA 2PGTA 3FW2A 2DMLA 1B9YC 5LCZA 3HJMA 5KN0A 1T4YA 2DJKA 3UEMA 2AJQB 2HFDA 3LXZA 1TI1A 2FA8A 3C1SA 1O8XA 2L6CA 3DEXA 5D73A 4K6XA 4E8HA 1AQVA 2PBJA 4WXTA 1NSWA 1QUWA 2B1LA 5FT3A 1RQMA 1XIYA 3VPTA 3I43A 1YF1A 2C0FA 2B5XA 2E2GA 1NM3A 3FZAA 1WMJA 4J57E 3AY8A 6GSYA 3DKSA 3R2QA 2IMKA 2IMFA 1R7HA 1T00A 1V9WA 1JZOA 1DE1A 3TRXA 3UVTA 1WOUA 2LNSA 1O85A 4PUFC 2ALBA 4KNDA 4IHUA 1XWAA 5HQPA 3GURA 2OE0A 5IOXA 3KP9A 5B8BA 1ZYEA 4IP1A 3ZTLA 5DBQA 1Q98A 2P31A 3QPMA 5JWRB 4HDEA 2HNLA 5DAKA 3FR9A 2X64A 3M0FA 1FOVA 3WT2A 1YEXA 4WR4A 1PGTA 3DVWA 4PGTA 4KE3A 6GSUA 2IFQB 3IR4A 2AYTA 1K0AA 1BG5A 4PQIA 3SBCA 3VWXA 4EVMA 3F63A 4EDZA 1EWXA 2C4JA 3CBUA 1U87A 5ELGA 1ERVA 2Z9SA 2HYXA 3KIJA 3EINA 2NPBA 3RHCA 2VCWA 4MPFA 1EP8A 5H5SA 3I69A 2E2MA 2H0HA 1WRYA 1F2EA 2GGTA 4MJAA 2HXKA 5JCUA 4O7HA 1GSSA 1ZGNA 4FYCA 2H1AA 4H86A 1FHEA 1IYIA 1H75A 3V1WA 3BD2A 1XOAA 2IL3A 2DSAA 1MDKA 3GL5A 2VL9A 3ERGA 3FR3A 4K0GA 4WBRD 6GSTA 4I5QA 1I5GA 2YP6A 1JZRA 1UC7A 4JE1A 4DVCA 2DJJA 2X8CA 2N5BA 1F9MA 3KCMA 4E8EA 4GSTA 2YZHA 3HVXA 5A4WA 3BBYA 2PN8A 5EVOA 4L0UA 4Q5FA 3RPNA 1O7UA 3UBLA 5B8AA 5IMVA 4HZ4A 1YEPA 1VRSD 2EIQA 3WGDA 4ECJA 3CSHA 1R5AA 2I9HA 3DYRA 1V40A 1G6WA 1A8LA 3FZ4A 2IN3A 2YCDA 1AQXA 2F8FA 22GSA 2AB6A 1UA5A 3N9JA 3M9JA 5KN2A 4MJBA 4JU5A 2DJ0A 4OO5A 2JL4A 2A4VA 3TKSA 4V1Ag 1TOFA 2GSRA 1AC1A 5JCWA 1K3YA 2O7KA 3TJGA 1GRXA 2XPDA 4JR4A 3TKSE 1Z9HA 1T8EB 2WB9A 4LMVA 2CQ9A 2CX3A 2WFCA 4WBJA 1Z6NA 2I1UA 3DRNA 4I97A 3MAKA 1QGVA 2ES7A 2GSQA 4G19A 4EL1A 1VF2A 1TU8A 1JFUA 3KMOA 5D96A 3D5JA 5DDLA 1EGRA 2VCZA 2DIYA 3VK9A 1PD21 2NVLA 1ERTA 3UBKA 1YF0A 2DBCA 1ERUA 1M9AA 2PVOC 3KJYA 1U88A 2KUCA 1Z7PA 3GFKA 2FGXA 3CYNA 1YKCA 1ERWA 3APQA 1I9DA 2B1KA 4AJ7A 1GULA 5D93A 3VI5A 3RDWA 3QOUA 2YZUA 4PNGA 1GUKA 4TOPA 5CRGA 5G2ZA 5C04A 3GHAA 2H76A 1MD4A 3E3EA 1A2JA 1T1VA 2LQOA 3VWWA 4BA7A 1M99A 2B5EA 3LYKA 1O8WA 3ZIVA 5J5NA 3IV4A 4L8EA 1QK8A 2L4QA 3BCIA 3EU3A 2QC7A 1TRWA 1OE8A 4HQZA 4MJCA 4GRFA 2LRNA 1EEMA 1WE0A 5ELAA 4ZL8A 1XOBA 4GCIA 2I81A 2LRTA 2ON5A 1TKDB 2VAFA 4KDYA 3EC3A 4I2UA 4JBBA 2V32A 3C8EA 4GWRA 4TR4A
chains in the Genus database with same CATH superfamily
2KHPA 4I6XA 1A23A 2RIIA 2YN1A 4Z7XA 1THXA 10GSA 4KCAA 2H1BA 4XS4B 7GSSA 2V6OA 3IHGA 4HU7A 3KTBA 4K2DA 4ZILA 3A3TA 3HHVA 2M46A 2DC5A 3DD3A 2C0GA 2LS5A 3RAZA 1Z3EA 1GTAA 1EV4A 2YWNA 5E4WA 2VOCA 4OWYA 2C1YA 4ML1A 2VCVA 1LJRA 1FO5A 2AHEA 4OCFA 2QA2A 4HUAA 4HJ2A 5GAPD 2FUG2 4FH8A 1JZWA 3FZ5A 1XW9A 2C3NA 3A2XA 5IOWA 3DVXA 5HFGA 3TJKA 4ECIA 4XS1A 2MMNA 5E59A 3C1RA 1TP9A 1MD3A 2GTUA 3WYWA 3APOA 2GZYA 12GSA 4KDUA 4P3YB 4ZBBA 2IIYA 4CHSA 1K0BA 4PXOA 1PQNA 2L5LA 4K5SA 3UL3A 1B4PA 3PGTA 2E7PA 2H6XA 2CAIA 3ISOA 4FQUA 4NHWA 2L57A 3KZQA 3RHBA 4NHZA 1TK0B 4AJ8A 1KTEA 1SJIA 1YZXA 2HRNA 1SYXA 2C3TA 2QA1A 3FKFA 1PSQA 2GVPA 2X99A 1R26A 1B9XC 4LLRA 3LSZA 1IYHA 2VCXA 5F8BA 5G31A 2OKAA 1XXUA 5IMDA 3CSJA 2GT6A 1VF1A 4K1FA 5D9VA 5ECOB 1X9WB 3ZREA 3FMWA 3Q18A 3CXGA 4GF0A 2V6KA 2CA8A 1ABAA 3ED3A 4KCEA 2JZSA 2VL3A 5INYA 2TIRA 2GDRA 2FCHA 4XRAA 1ZL9A 3HJPA 3IK9A 4XS6A 3KMNA 5D8IA 2C3QA 2ZCTA 4EXJA 4WETA 3FYGA 2MBTA 2XHFA 4XIHA 1X9SB 3UIWA 4N10A 5DAKB 3EWLA 2K9FA 4D73B 4IGJA 1SK1A 1GLPA 3MNGA 2MMOA 2L59A 1GWCA 3IXRA 2H8LA 3UMAA 4YKFA 3EMXA 4AGSA 5ID2A 3WGXA 3EMPA 2YV9A 3F3RA 3TKSC 4KDXA 4MF6A 1A2LA 2KP2A 3S9FA 3QMXA 4RI7A 1B4QA 2EIRA 2BMXA 1K0MA 1A8YA 1USBA 2FY6A 1TXXA 1BQ7A 4QL7A 3SWLA 3GX0A 4MMMA 3A5IA 3Q6OA 3HYPA 5CREA 1XCCA 3ZFBA 2RM5A 1UN2A 4X4JA 4IP6A 2QSIA 5IMFA 5HFKA 1PKWA 2VM2A 4X43A 5J9CA 2P5RA 1PFOA 4LL4B 3UJ1A 4POBA 2OJLA 2VCTA 2LKUA 2TRXA 4V2MA 1ON4A 18GSA 1EZKA 1OAZA 2LEGA 1O6JA 3WD6A 3L9UA 3F6FA 2DMMA 3GIXA 1WWJA 3ZYWA 1B8XA 4TVEA 1URMA 2L6DA 1M3IA 1SJ6A 4MLYA 2MZCA 1V57A 2RLIA 1BYEA 6GSXA 5IMZA 1XW5A 5B6NA 1B48A 1EEJA 1GTUA 4IBPA 3FY7A 5KN1A 3GKXA 5IM9A 3I9V2 4KW6A 3GN3A 3F4RA 2NBSA 4AF2A 2XPEA 2R0PA 1RK4A 4Q5RA 2H71A 1QFNA 9GSSA 3GH6A 2GQLA 3G7JA 1TDIA 3F9UA 1J08A 4MK3A 3GMFA 3KGKA 3KP8A 2REMA 1C72A 1K0DA 3CTGA 4AJ6A 4TN8A 1JZDA 3ZVJD 1GSFA 3Q19A 2CZ2A 3M3MA 2NTOA 3HA9A 5ENUA 1Q4JA 3CQFA 5ECKB 4POLA 4F0BA 1UVZA 4O5UA 4F03A 5KN3A 4ZL7A 3HVSA 2R6KA 3GUSA 2J23A 4TRXA 4DSRA 1QQ2A 4IS0A 3FHKA 3P8WA 3DMLA 4XCSA 4FYBA 3GKNA 5CYYA 3GX8A 4GXZA 2H74A 4K9ZA 2X4AA 3DXBA 2QKEA 1XG8A 1K0CA 1M2AA 4FO5A 4GLTA 3ZIJA 2H70A 4KSOA 3KD0A 1EGOA 1PX7A 3ZMKA 4DSSB 1GP1A 2H1GA 3L9SA 4WKWA 3C73A 5GZZB 1SYRA 4N30A 3TB2A 2O85A 1Z6MA 3PH9A 4DEJA 1YJ6A 4KA0A 3ME8A 5CP1A 4O32A 5AIVA 4ZB9A 4MZBA 5ECSA 3FEUA 4PQ1A 2B5YA 4G2EA 4NXIA 1SENA 4EO3A 5A5KA 3EU4A 3OR5A 3CRUA 4RI6A 1GNEA 4CDOA 4FIWA 4PQHA 4K2XA 1X5EA 1ZZYA 1XVQA 3NZNA 4NPBA 1F37A 2H0GA 4BVXB 2WZ9A 1XWGA 5F05A 2GZZA 2H72A 5FHIA 2LSTA 1YKAA 1HQOA 2C80A 1OKTA 4EC0A 5ABRA 3EE2A 3IE3A 3W8JA 4ZL9A 5ECPB 1S3AA 2YNXA 3EYTA 1S3CA 4IJ3A 1SD8A 3QAVA 2LJRA 4NV5A 3TJBA 2JSZA 3TOTA 1XPVA 3GH9A 2LV3A 4ECCA 1XWKA 3GTUA 2YJ7A 2R3XA 4NMUA 5JWQB 5IPHA 1SKWB 4JEDA 1GNWA 2VLVA 2ZNMA 1R5PA 5DALB 1XW6A 1K0OA 5KOXA 1SD9A 2YV7A 4ISDA 4TXVA 4RQRA 3U6VA 1A0RP 2LJKA 4MZWA 3LXTA 1M2DA 1TRVA 5DCGA 1FW1A 14GSA 1GUHA 2R4VA 4KX4A 1A24A 3G7YA 3KXOA 1MDIA 4IKHA 19GSA 3R3EA 1GH2A 2J9HA 4N0VA 5B6MA 4F0CA 17GSA 1EP7A 4QL9A 2RM6A 4HQSA 4JRRA 2LQQA 5ECRB 3IPZA 2CT6A 3ERFA 5LD0A 4MH3A 1GSQA 1W89A 4OD7A 2I4AA 4XHMA 1OC9A 3IHQA 4BL7A 5EPFA 3A5WA 3ERWA 2WJUA 4ILFA 4USSA 2TRCP 4TXOB 4K7IA 4YKGA 3MYDA 3KH9A 2DJ2A 4A5PA 4F82A 4LL1B 1X5DA 3DIEA 1S3DA 2MMAA 3HD5A 1PMTA 4JZQA 1BEDA 1SKSB 1HYUA 1OC3A 3O3TA 3C71A 2FA4A 4ZBDA 3G9BA 3TRQA 2LRCA 2WCIA 4QQ7A 2VLUA 4O5RA 5L71A 5CO3A 2LNTA 4KF9A 5H5QA 3PPUA 2RUEA 1SU9A 1F3AA 2GQMA 2HZEB 4BWQA 4KGIA 5DCHA 2YWOA 1FB6A 1VF4A 5J4UA 4TR1A 2H73A 3QFAC 1DUGA 3J7Yb 4OFTA 1XVWA 2C8UA 5A4UA 1W4VA 3LFLA 2GSTA 5ECLB 1TJDA 3GKKA 1ZCPA 2HI7A 2HZFA 5ID2B 5G1KA 2RUFA 4BIKA 1A2MA 4PURA 2GZPA 2DKHA 2GT5A 2JADA 4LA1A 3QAWA 2AUVA 1E2YA 4YAVA 3WGEA 5ECIB 3A2WA 3EURA 1FG4A 5G5FA 5JWOB 3VI7A 1NHYA 4X0XA 2ON7A 1BX9A 1PN0A 4YQMA 2OA7A 1AAZA 4KH7A 4V2LA 4POKA 1GUMA 4I8BA 4ECBA 3FK8A 1ZMAA 3IAM2 1ZYNA 2YWMA 3VLNA 4DSQA 1AIUA 2E0QA 1Y6EA 4XS4A 1ST9A 2YANA 2CV4A 3GL3A 5DJMA 5J41A 2CVDA 3ZVJA 1OYJA 1X9MB 1EV9A 1NHOA 2NDOA 1PX6A 3D4TA 3BJ5A 1SKRB 2ZUPA 5JCGA 2A4HA 4PUAA 3E9JB 3GSTA 4MF7A 1CQGA 2F8AA 2VIMA 2WULA 3TJJA 3HCZA 4GSSA 4KB3A 3LGCA 3LJRA 2C0DA 2C0EA 3ME7A 2X49A 2MMZA 3VFIA 3VPQA 5ECNB 1XZOA 2KLXA 5C00A 3CTFA 4ACSA 1MEKA 1KNGA 2MYGA 3LQ7A 5AGYA 4K0NA 13GSA 2K8VA 1PA3A 3L0HA 2FLSA 4Z2TA 1LU4A 2X8GA 11GSA 4KSMA 1EOGA 1U3AA 4L5LA 3N5OA 3ZLPA 1FVKA 4J2FA 3ZL5A 1M9BA 1U6TA 2HSHA 2WS2A 1SK2A 1CQHA 2XC2A 4K7NA 3D6IA 4WF4A 1N8JA 3F4TA 2V41A 5D9XA 4HS1A 3M8NA 2M72A 5IO2A 4HU9A 2K18A 3LWAA 4F9ZA 3MDKA 3QDNA 2F51A 4MPGA 4YAPA 5ECMB 1SL2B 3RBTA 2K8SA 1TW9A 2CVKA 3W6GA 4MZCA 2DJ1A 2YWIA 2FWFA 2GS3A 2R0CA 3HZ4A 2X8HA 2AV4A 3UAPA 2P5QA 3F6DA 4O92A 3US3A 4V2NA 1PRXA 3G7IA 1SJZA 4ULXA 3NIVA 5A4VA 4TKYA 3QFBC 3D22A 2IMDA 3F8UA 4MJEA 3IC4A 1M0UA 5F06A 4HI7A 5IIZA 3KTLA 3H8QA 5DVBA 3GKMA 2JZTA 4D73A 3PINA 4KAEA 4BVYA 3JCML 1K3OA 4K5RA 1Y25A 3KH7A 4IN0A 4IVFA 1T4ZA 2I3YA 3IAS2 1GSUA 2FNOA 4HEA2 4Q5QA 6GSWA 2H6ZA 5IO0A 2PWJA 3FR6A 2VO4A 3TDGA 4MA9A 1PKZA 3ZITA 1HNCA 2H30A 5ECQB 3L4NA 3FZ9A 2VL2A 1T3BA 3GNJA 2DJ3A 1TTZA 3VWUA 2VD0A 2B6MA 1GTBA 4LMWA 3D0ZA 2XBIA 3VWVA 1JHBA 2PU9C 1JLVA 1FVJA 1BJXA 5B7CA 3U5RE 4IW9A 1WJKA 2XBQA 5FWGA 5GAND 2L5OA 1OVNA 2WRTA 2CZ3A 2FD3A 3ZRDA 4EDYA 3K8NA 2VM1A 2JACA 3GTUB 4NV2A 1E6BA 2IWTA 4OMVA 5G30A 5AN1A 4V1Ap 5DQSA 3TKPA 1TK5B 2OBKA 1QMVA 3LORA 3CRTA 1K3LA 3IRAA 2B7KA 2VCQA 5LNKe 2H75A 4GQFA 1XBSA 1VGLA 4I2TA 1HNBA 2VLTA 2A2PA 2LTKA 2EC4A 3QAGA 1WIKA 4L5OA 3LEFA 4Q5NA 3APSA 2BJXA 4EUYA 2DIZA 1DE2A 1VF3A 5IQYA 3C7MA 2H0IA 20GSA 5KEJA 2CX4A 2OE3A 5DJLA 1MTCA 4MABA 4HOJA 2VUPA 4G0KA 2A2SA 2P0GA 4HZ2A 2R2JA 5GSTA 1H4OA 3ZZXA 1V58A 5CNWA 2OADA 2IFQA 3H93A 2VD1A 3TOUA 1TRUA 1XWCA 2KOKA 4EKZA 2IJYA 3CMIA 1M7TA 3TCOA 2IMEA 2FWHA 5HR1A 1M3JA 1OC9B 4BWSA 3UARA 5G1LA 5IMAA 2R37A 4G0LA 2K6VA 1U3IA 2PERA 3QCPA 4L0WA 5CRHA 5HR2A 4CY8A 4HJMA 2JZRA 3E0UA 5BRTA 3PR8A 4G9HA 4ICYA 6GSVA 16GSA 4IELA 4NAXA 1RW1A 3F4SA 2D2ZA 1YDKA 2QGVA 1N2AA 5D9TA 1TU7A 1V2AA 2HLSA 2IMIA 2H6YA 1G0TA 5GSSA 4ID0A 3Q74A 4PX1A 4ZB8A 3QD9A 3UOMA 4FYUA 4MF5A 3F3QA 3MSZA 3MIXA 4G0IA 5HFIA 4CW9A 4XTSA 1ML6A 4YH2A 4MH2A 4WF5A 1PN9A 4DSSA 3CSIA 4TR1B 1TI3A 3D4MA 3ZMLA 1Z7RA 2G2QA 2N5FA 2YPMA 2HRFA 2B7JA 1SL0B 3I6AA 1WP0A 1M2BA 4G10A 4EF0A 1X5CA 1TK8B 5KOWA 3HY2A 3TKRA 1G7EA 1GSDA 3A2VA 2YOIA 3W8SA 1ACVA 2HT9A 2B3SA 3H79A 2GSSA 1DSBA 2F3MA 4TR3A 4ZXGA 4XRDA 4IQAA 4IJIA 3F0IA 3TGZA 5CRWA 1DBYA 1QXHA 5J9BA 1K0NA 2HRKA 2G0FA 1XFLA 3EPTA 4IQ1A 1SL1B 5IMCA 4BVXA 1O81A 1ZOFA 3HJOA 5COHA 2O8VB 1J0FA 3LG6A 3VURA 4YQVA 1OKDA 4OO4A 1J9BA 4ZIJA 3LYPA 2A2RA 2H01A 5HR0A 1AUCA 3KEBA 1AW9A 3HKRA 2HE3A 5IPGA 2CAQA 3H4KA 1EOHA 5F0GA 4MDCA 1JLWA 3EVIA 4MNNA 3MWHA 2OE1A 1F3BA 1G6YA 4RQXA 4K7OA 3GYKA 3KM6A 5EY6A 3IDVA 2F9SA 5DALA 3TUEA 3BCKA 2KP1A 2L4CA 5AISA 6GSSA 1S3RA 4PNFA 1GSEA 4EIQA 3IBHA 5HR3A 5CAXA 1KEBA 3HVNA 1OE7A 3P2AA 4KUNA 4WEYA 4X1UA 2O87A 4RUVA 1A0FA 5H5RA 2WGRA 2R0GA 1TRSA 2VL2C 1MDJA 2O89A 2V1MA 2LUSA 3P7XA 3M1GA 3IOSA 1WPIA 3GSSA 2OBIA 1G7OA 5DQYA 3NOFA 1FAAA 2H19A 4YQUA 4K8MA 2HSYA 3RPPA 1X0RA 4ZB6A 5D9WA 2FHEA 4J56E 2YJHA 2M80A 1ZYQB 4OFMA 5AIXA 3P90A 4N11A 3TJFA 4MP4A 4MCUA 3L9VA 4GTUA 3O6TA 1GTIA 2MBSA 2H66A 2PVQA 4NWYA 4TXOA 1GL8A 1GSYA 4JR6A 3LW9A 2JSYA 1HNAA 3IK7A 1ILOA 1HD2A 2IPAA 1NW2A 1YQ1A 2BTOT 3HDCA 5EL8A 1R4WA 2V2GA 3UVHA 2WDUA 4F2IA 2AAWA 2DLXA 2GLRA 1OC8A 1YY7A 1KBNA 2PPTA 3FRCA 3TKQA 4OCEA 2H1DA 2FWGA 1F6MC 1SK0A 3DWVA 5G5EA 3ZFLA 3GA4A 4EE0A 1V98A 8GSSA 1Z5YE 3HZ8A 1XWBA 4POMA 2PUKC 3O76A 1AQWA 2OACA 4BPYA 2HZEA 1AXDA 1ZYPA 3M9KA 4GQCA 5F07A 2R5GA 3H1NA 2JU5A 4TW5A 1PL1A 1THOA 4OFNA 1PL2A 3GRXA 2CVBA 1GLQA 3DGQA 5ECHB 3IA1A 1LBKA 4ML6A 4BVYB 2GQKA 3GV1A 2LJAA 2N5AA 3HVVA 1BAYA 2FWEA 3BOAA 3QR6A 2EIOA 5J3RA 4ZBAA 2HRAA 3TRPA 1T7PB 3HXSA 4N0ZA 3L78A 5CRDA 4WR5A 3WT1A 1FB0A 3D21A 3J7Yk 2PMTA 4TR0A 1O73A 4GSNA 2PGTA 3FW2A 2DMLA 1B9YC 5LCZA 3HJMA 5KN0A 1T4YA 2DJKA 3UEMA 2AJQB 2HFDA 3LXZA 1TI1A 2FA8A 3C1SA 1O8XA 2L6CA 3DEXA 5D73A 4K6XA 4E8HA 1AQVA 2PBJA 4WXTA 1NSWA 1QUWA 4CY6A 2B1LA 5FT3A 1RQMA 1XIYA 3VPTA 3I43A 1YF1A 2C0FA 2B5XA 2UZ8A 2E2GA 1NM3A 3FZAA 1WMJA 4J57E 3AY8A 6GSYA 3DKSA 3R2QA 2IMKA 2IMFA 1R7HA 1T00A 1V9WA 1JZOA 1DE1A 3TRXA 3UVTA 1WOUA 2LNSA 1O85A 4PUFC 2ALBA 4KNDA 4IHUA 1XWAA 5HQPA 3GURA 2OE0A 5IOXA 3KP9A 5B8BA 1ZYEA 4IP1A 3ZTLA 5DBQA 1Q98A 2P31A 3QPMA 4PTSA 5JWRB 4HDEA 2HNLA 5DAKA 3FR9A 2X64A 3M0FA 1FOVA 3WT2A 1YEXA 4WR4A 1PGTA 3DVWA 4PGTA 4KE3A 6GSUA 2IFQB 3IR4A 2AYTA 1K0AA 1BG5A 4PQIA 3SBCA 3VWXA 4EVMA 3F63A 4EDZA 1EWXA 2C4JA 3CBUA 1U87A 5ELGA 1ERVA 2Z9SA 2HYXA 3KIJA 3EINA 2NPBA 3RHCA 2VCWA 4MPFA 1EP8A 5H5SA 3I69A 2E2MA 2H0HA 1WRYA 1F2EA 2GGTA 4MJAA 2HXKA 5JCUA 4O7HA 1GSSA 1ZGNA 4FYCA 2H1AA 4H86A 1FHEA 1IYIA 1H75A 3V1WA 3BD2A 1XOAA 2IL3A 2DSAA 1MDKA 3GL5A 2VL9A 3ERGA 3FR3A 4K0GA 4WBRD 6GSTA 4I5QA 1I5GA 2YP6A 1JZRA 1UC7A 4JE1A 4DVCA 2DJJA 2X8CA 2N5BA 1F9MA 3KCMA 4E8EA 4GSTA 2DKIA 2YZHA 3HVXA 5A4WA 3BBYA 2PN8A 5EVOA 5BMUA 4L0UA 4Q5FA 3RPNA 1O7UA 3UBLA 5B8AA 5IMVA 4HZ4A 1YEPA 1VRSD 2EIQA 3WGDA 4ECJA 3CSHA 1R5AA 2I9HA 3DYRA 1V40A 1G6WA 1A8LA 3FZ4A 2IN3A 2YCDA 1AQXA 2F8FA 22GSA 2AB6A 1UA5A 3N9JA 3M9JA 5KN2A 4MJBA 4JU5A 2DJ0A 4OO5A 2JL4A 2A4VA 3TKSA 4V1Ag 1TOFA 2GSRA 4BL7B 1AC1A 5JCWA 1K3YA 2O7KA 3TJGA 1GRXA 2XPDA 1FOHA 4JR4A 3TKSE 1Z9HA 1T8EB 2WB9A 4LMVA 2CQ9A 2CX3A 2WFCA 4WBJA 1Z6NA 2I1UA 3DRNA 4I97A 3MAKA 1QGVA 2ES7A 2GSQA 4G19A 4EL1A 1VF2A 1TU8A 1JFUA 4Z2RA 3KMOA 5D96A 3D5JA 5DDLA 1EGRA 2VCZA 2DIYA 3VK9A 1PD21 2NVLA 1ERTA 4Z2UA 3UBKA 1YF0A 2DBCA 1ERUA 1M9AA 2PVOC 3KJYA 1U88A 2KUCA 1Z7PA 3GFKA 2FGXA 3CYNA 1YKCA 1ERWA 3IC8A 3APQA 1I9DA 2B1KA 4AJ7A 1GULA 5D93A 3VI5A 3RDWA 3QOUA 2YZUA 4PNGA 4HSCX 1GUKA 4TOPA 5CRGA 5G2ZA 5C04A 3GHAA 2HSMA 2H76A 1MD4A 3E3EA 1A2JA 1T1VA 2LQOA 3VWWA 4BA7A 1M99A 2B5EA 3LYKA 1O8WA 3ZIVA 5J5NA 3IV4A 4L8EA 1QK8A 4EIPA 2L4QA 3BCIA 4O5QA 3EU3A 2QC7A 1TRWA 4MJCA 1OE8A 4HQZA 4GRFA 2LRNA 1EEMA 1WE0A 5ELAA 4ZL8A 1XOBA 4GCIA 2I81A 2LRTA 2ON5A 1TKDB 2VAFA 4KDYA 3EC3A 4I2UA 4JBBA 2V32A 3C8EA 4GWRA 4TR4A
chains in the Genus database with same CATH topology
2KHPA 4I6XA 1A23A 2RIIA 2YN1A 4Z7XA 1THXA 10GSA 4KCAA 2H1BA 4XS4B 7GSSA 2V6OA 3IHGA 4HU7A 3KTBA 4K2DA 4ZILA 3A3TA 3HHVA 2M46A 2DC5A 3DD3A 2C0GA 2LS5A 3RAZA 1Z3EA 1GTAA 1EV4A 2YWNA 5E4WA 2VOCA 4OWYA 2C1YA 4ML1A 2VCVA 1LJRA 1FO5A 2AHEA 4OCFA 2QA2A 4HUAA 4HJ2A 5GAPD 2FUG2 4FH8A 1JZWA 3FZ5A 1XW9A 2C3NA 3A2XA 5IOWA 3DVXA 5HFGA 3TJKA 4ECIA 4XS1A 2MMNA 5E59A 3C1RA 1TP9A 1MD3A 2GTUA 3WYWA 3APOA 2GZYA 12GSA 4KDUA 4P3YB 4ZBBA 2IIYA 4CHSA 1K0BA 4PXOA 1PQNA 2L5LA 4K5SA 3UL3A 1B4PA 3PGTA 2E7PA 2H6XA 2CAIA 3ISOA 4FQUA 4NHWA 2L57A 3KZQA 3RHBA 4NHZA 1TK0B 4AJ8A 1KTEA 1SJIA 1YZXA 2HRNA 1SYXA 2C3TA 2QA1A 3FKFA 1PSQA 2GVPA 2X99A 1R26A 1B9XC 4LLRA 3LSZA 1IYHA 2VCXA 5F8BA 5G31A 2OKAA 1XXUA 5IMDA 3CSJA 2GT6A 1VF1A 4K1FA 5D9VA 5ECOB 1X9WB 3ZREA 3FMWA 3Q18A 3CXGA 4GF0A 2V6KA 2CA8A 1ABAA 3ED3A 4KCEA 2JZSA 2VL3A 5INYA 2TIRA 2GDRA 2FCHA 4XRAA 1ZL9A 3HJPA 3IK9A 4XS6A 3KMNA 5D8IA 2C3QA 2ZCTA 4EXJA 4WETA 3FYGA 2MBTA 2XHFA 4XIHA 1X9SB 3UIWA 4N10A 5DAKB 3EWLA 2K9FA 4D73B 4IGJA 1SK1A 1GLPA 3MNGA 2MMOA 2L59A 1GWCA 3IXRA 2H8LA 3UMAA 4YKFA 3EMXA 4AGSA 5ID2A 3WGXA 3EMPA 2YV9A 3F3RA 3TKSC 4KDXA 4MF6A 1A2LA 2KP2A 3S9FA 3QMXA 4RI7A 1B4QA 2EIRA 2BMXA 1K0MA 1A8YA 1USBA 2FY6A 1TXXA 1BQ7A 4QL7A 3SWLA 3GX0A 4MMMA 3A5IA 3Q6OA 3HYPA 5CREA 1XCCA 3ZFBA 2RM5A 1UN2A 4X4JA 4IP6A 2QSIA 5IMFA 5HFKA 1PKWA 2VM2A 4X43A 5J9CA 2P5RA 3UJ1A 4LL4B 4POBA 2OJLA 2VCTA 2LKUA 2TRXA 4V2MA 1ON4A 18GSA 1EZKA 1OAZA 2LEGA 1O6JA 3WD6A 3L9UA 3F6FA 2DMMA 3GIXA 1WWJA 3ZYWA 1B8XA 4TVEA 1URMA 2L6DA 1SJ6A 4MLYA 2MZCA 1V57A 2RLIA 1BYEA 6GSXA 5IMZA 1XW5A 5B6NA 1B48A 1EEJA 1GTUA 4IBPA 3FY7A 5KN1A 3GKXA 5IM9A 3I9V2 4KW6A 3GN3A 3F4RA 2NBSA 4AF2A 2XPEA 2R0PA 1RK4A 4Q5RA 2H71A 1QFNA 9GSSA 3GH6A 2GQLA 3G7JA 1TDIA 3F9UA 1J08A 4MK3A 3GMFA 3KGKA 3KP8A 2REMA 1C72A 1K0DA 3CTGA 4AJ6A 4TN8A 1JZDA 3ZVJD 1GSFA 3Q19A 2CZ2A 3M3MA 2NTOA 3HA9A 5ENUA 1Q4JA 5ECKB 4POLA 4F0BA 1UVZA 4O5UA 4F03A 5KN3A 4ZL7A 3HVSA 2R6KA 3GUSA 2J23A 4TRXA 4DSRA 1QQ2A 4IS0A 3FHKA 3P8WA 3DMLA 4XCSA 4FYBA 3GKNA 5CYYA 3GX8A 4GXZA 2H74A 4K9ZA 2X4AA 3DXBA 2QKEA 1K0CA 1M2AA 4FO5A 4GLTA 3ZIJA 2H70A 4KSOA 3KD0A 1EGOA 1PX7A 3ZMKA 4DSSB 1GP1A 2H1GA 3L9SA 4WKWA 3C73A 5GZZB 1SYRA 4N30A 3TB2A 2O85A 1Z6MA 3PH9A 4DEJA 1YJ6A 4KA0A 3ME8A 5CP1A 4O32A 5AIVA 4ZB9A 4MZBA 5ECSA 3FEUA 4PQ1A 2B5YA 4G2EA 4NXIA 1SENA 4EO3A 5A5KA 3EU4A 3OR5A 3CRUA 4RI6A 1GNEA 4CDOA 4FIWA 4PQHA 4K2XA 1X5EA 1ZZYA 1XVQA 3NZNA 4NPBA 1F37A 2H0GA 4BVXB 2WZ9A 1XWGA 5F05A 2GZZA 2H72A 5FHIA 2LSTA 1YKAA 1HQOA 2C80A 1OKTA 4EC0A 5ABRA 3EE2A 3IE3A 3W8JA 4ZL9A 5ECPB 1S3AA 2YNXA 3EYTA 1S3CA 4IJ3A 1SD8A 3QAVA 2LJRA 4NV5A 3TJBA 2JSZA 3TOTA 1XPVA 3GH9A 2LV3A 4ECCA 1XWKA 3GTUA 2YJ7A 2R3XA 4NMUA 5JWQB 5IPHA 1SKWB 4JEDA 1GNWA 2VLVA 2ZNMA 1R5PA 5DALB 1XW6A 1K0OA 5KOXA 1SD9A 2YV7A 4ISDA 4TXVA 4RQRA 3U6VA 1A0RP 2LJKA 4MZWA 3LXTA 1M2DA 1TRVA 5DCGA 1FW1A 14GSA 1GUHA 2R4VA 4KX4A 1A24A 3G7YA 3KXOA 1MDIA 4IKHA 19GSA 3R3EA 1GH2A 2J9HA 4N0VA 5B6MA 4F0CA 17GSA 1EP7A 4QL9A 2RM6A 4HQSA 4JRRA 2LQQA 5ECRB 3IPZA 2CT6A 3ERFA 5LD0A 4MH3A 1GSQA 1W89A 4OD7A 2I4AA 4XHMA 1OC9A 3IHQA 4BL7A 5EPFA 3A5WA 3ERWA 2WJUA 4ILFA 4USSA 2TRCP 4TXOB 4K7IA 4YKGA 3MYDA 3KH9A 2DJ2A 4A5PA 4F82A 4LL1B 1X5DA 3DIEA 1S3DA 2MMAA 3HD5A 1PMTA 4JZQA 1BEDA 1SKSB 1HYUA 1OC3A 3O3TA 3C71A 2FA4A 4ZBDA 3G9BA 3TRQA 2LRCA 2WCIA 4QQ7A 2VLUA 4O5RA 5L71A 5CO3A 2LNTA 4KF9A 5H5QA 3PPUA 2RUEA 1SU9A 1F3AA 2GQMA 2HZEB 4BWQA 4KGIA 5DCHA 2YWOA 1FB6A 1VF4A 5J4UA 4TR1A 2H73A 3QFAC 1DUGA 3J7Yb 4OFTA 1XVWA 2C8UA 5A4UA 1W4VA 3LFLA 2GSTA 5ECLB 1TJDA 3GKKA 1ZCPA 2HI7A 2HZFA 5ID2B 5G1KA 2RUFA 1A2MA 4PURA 2GZPA 2DKHA 2GT5A 2JADA 4LA1A 3QAWA 2AUVA 1E2YA 4YAVA 3WGEA 5ECIB 3A2WA 3EURA 1FG4A 5G5FA 5JWOB 3VI7A 1NHYA 4X0XA 2ON7A 1BX9A 1PN0A 4YQMA 2OA7A 1AAZA 4KH7A 4V2LA 4POKA 1GUMA 4I8BA 4ECBA 3FK8A 1ZMAA 3IAM2 1ZYNA 2YWMA 3VLNA 4DSQA 1AIUA 2E0QA 1Y6EA 4XS4A 1ST9A 2YANA 2CV4A 3GL3A 5DJMA 5J41A 2CVDA 3ZVJA 1OYJA 1X9MB 1EV9A 1NHOA 2NDOA 1PX6A 3D4TA 3BJ5A 1SKRB 2ZUPA 5JCGA 2A4HA 4PUAA 3E9JB 3GSTA 4MF7A 1CQGA 2F8AA 2VIMA 2WULA 3TJJA 3HCZA 4GSSA 4KB3A 3LGCA 3LJRA 2C0DA 2C0EA 3ME7A 2X49A 2MMZA 3VFIA 3VPQA 5ECNB 1XZOA 2KLXA 5C00A 3CTFA 4ACSA 1MEKA 1KNGA 2MYGA 3LQ7A 5AGYA 4K0NA 13GSA 2K8VA 1PA3A 3L0HA 2FLSA 4Z2TA 1LU4A 2X8GA 11GSA 4KSMA 1EOGA 1U3AA 4L5LA 3N5OA 3ZLPA 1FVKA 4J2FA 3ZL5A 1M9BA 1U6TA 2HSHA 2WS2A 1SK2A 1CQHA 2XC2A 4K7NA 3D6IA 4WF4A 1N8JA 3F4TA 2V41A 5D9XA 4HS1A 3M8NA 2M72A 5IO2A 4HU9A 2K18A 3LWAA 4F9ZA 3MDKA 3QDNA 2F51A 4MPGA 4YAPA 5ECMB 1SL2B 3RBTA 2K8SA 1TW9A 2CVKA 3W6GA 4MZCA 2DJ1A 2YWIA 2FWFA 2GS3A 2R0CA 3HZ4A 2X8HA 2AV4A 3UAPA 2P5QA 3F6DA 4O92A 3US3A 4V2NA 1PRXA 3G7IA 1SJZA 4ULXA 3NIVA 5A4VA 4TKYA 3QFBC 3D22A 2IMDA 3F8UA 4MJEA 3IC4A 1M0UA 5F06A 4HI7A 5IIZA 3KTLA 3H8QA 5DVBA 3GKMA 2JZTA 4D73A 3PINA 4KAEA 4BVYA 3JCML 1K3OA 4K5RA 1Y25A 3KH7A 4IN0A 4IVFA 1T4ZA 2I3YA 3IAS2 1GSUA 2FNOA 4HEA2 4Q5QA 6GSWA 2H6ZA 5IO0A 2PWJA 3FR6A 2VO4A 3TDGA 4MA9A 1PKZA 3ZITA 1HNCA 2H30A 5ECQB 3L4NA 3FZ9A 2VL2A 1T3BA 3GNJA 2DJ3A 1TTZA 3VWUA 2VD0A 2B6MA 1GTBA 4LMWA 3D0ZA 2XBIA 3VWVA 1JHBA 2PU9C 1JLVA 1FVJA 1BJXA 5B7CA 3U5RE 4IW9A 1WJKA 2XBQA 5FWGA 5GAND 2L5OA 1OVNA 2WRTA 2CZ3A 2FD3A 3ZRDA 4EDYA 3K8NA 2VM1A 2JACA 3GTUB 4NV2A 1E6BA 2IWTA 4OMVA 5G30A 5AN1A 4V1Ap 5DQSA 3TKPA 1TK5B 2OBKA 1QMVA 3LORA 3CRTA 1K3LA 3IRAA 2B7KA 2VCQA 5LNKe 2H75A 4GQFA 1XBSA 1VGLA 4I2TA 1HNBA 2VLTA 2A2PA 2LTKA 2EC4A 3QAGA 1WIKA 4L5OA 3LEFA 4Q5NA 3APSA 2BJXA 4EUYA 2DIZA 1DE2A 1VF3A 5IQYA 3C7MA 2H0IA 20GSA 5KEJA 2CX4A 2OE3A 5DJLA 1MTCA 4MABA 4HOJA 2VUPA 4G0KA 2A2SA 2P0GA 4HZ2A 2R2JA 5GSTA 1H4OA 3ZZXA 1V58A 5CNWA 2OADA 2IFQA 3H93A 2VD1A 3TOUA 1TRUA 1XWCA 2KOKA 4EKZA 2IJYA 3CMIA 1M7TA 3TCOA 2IMEA 2FWHA 5HR1A 1OC9B 4BWSA 3UARA 5G1LA 5IMAA 2R37A 4G0LA 2K6VA 1U3IA 2PERA 3QCPA 4L0WA 5CRHA 5HR2A 4CY8A 4HJMA 2JZRA 3E0UA 5BRTA 3PR8A 4G9HA 4ICYA 6GSVA 16GSA 4IELA 4NAXA 1RW1A 3F4SA 2D2ZA 1YDKA 2QGVA 1N2AA 5D9TA 1TU7A 1V2AA 2HLSA 2IMIA 2H6YA 1G0TA 5GSSA 4ID0A 3Q74A 4PX1A 4ZB8A 3QD9A 3UOMA 4FYUA 4MF5A 3F3QA 3MSZA 3MIXA 4G0IA 5HFIA 4CW9A 4XTSA 1ML6A 4YH2A 4MH2A 4WF5A 1PN9A 4DSSA 3CSIA 4TR1B 1TI3A 3D4MA 3ZMLA 1Z7RA 2G2QA 2N5FA 2YPMA 2HRFA 2B7JA 1SL0B 3I6AA 1WP0A 1M2BA 4G10A 4EF0A 1X5CA 1TK8B 5KOWA 3HY2A 3TKRA 1G7EA 1GSDA 3A2VA 2YOIA 3W8SA 1ACVA 2HT9A 2B3SA 3H79A 2GSSA 1DSBA 2F3MA 4TR3A 4ZXGA 4XRDA 4IQAA 4IJIA 3F0IA 3TGZA 5CRWA 1DBYA 1QXHA 5J9BA 1K0NA 2HRKA 2G0FA 1XFLA 3EPTA 4IQ1A 1SL1B 5IMCA 4BVXA 1O81A 1ZOFA 3HJOA 5COHA 2O8VB 1J0FA 3LG6A 3VURA 4YQVA 1OKDA 4OO4A 1J9BA 4ZIJA 3LYPA 2A2RA 2H01A 5HR0A 1AUCA 3KEBA 1AW9A 3HKRA 2HE3A 5IPGA 2CAQA 3H4KA 1EOHA 5F0GA 4MDCA 1JLWA 3EVIA 4MNNA 3MWHA 2OE1A 1F3BA 1G6YA 4RQXA 4K7OA 3GYKA 3KM6A 5EY6A 3IDVA 2F9SA 5DALA 3TUEA 3BCKA 2KP1A 2L4CA 5AISA 6GSSA 4PNFA 1GSEA 4EIQA 3IBHA 5HR3A 5CAXA 1KEBA 1OE7A 3P2AA 4KUNA 4WEYA 4X1UA 2O87A 4RUVA 1A0FA 5H5RA 2WGRA 2R0GA 1TRSA 2VL2C 1MDJA 2O89A 2V1MA 2LUSA 3P7XA 3M1GA 3IOSA 1WPIA 3GSSA 2OBIA 1G7OA 5DQYA 3NOFA 1FAAA 2H19A 4YQUA 4K8MA 2HSYA 3RPPA 1X0RA 4ZB6A 5D9WA 2FHEA 4J56E 2YJHA 2M80A 1ZYQB 4OFMA 5AIXA 3P90A 4N11A 3TJFA 4MP4A 4MCUA 3L9VA 4GTUA 3O6TA 1GTIA 2MBSA 2H66A 2PVQA 4NWYA 4TXOA 1GL8A 1GSYA 4JR6A 3LW9A 2JSYA 1HNAA 3IK7A 1ILOA 1HD2A 2IPAA 1NW2A 1YQ1A 2BTOT 3HDCA 5EL8A 1R4WA 2V2GA 3UVHA 2WDUA 4F2IA 2AAWA 2DLXA 2GLRA 1OC8A 1YY7A 1KBNA 2PPTA 3FRCA 3TKQA 4OCEA 2H1DA 2FWGA 1F6MC 1SK0A 3DWVA 5G5EA 3ZFLA 3GA4A 4EE0A 1V98A 8GSSA 1Z5YE 3HZ8A 1XWBA 4POMA 2PUKC 3O76A 1AQWA 2OACA 4BPYA 2HZEA 1AXDA 1ZYPA 3M9KA 4GQCA 5F07A 2R5GA 3H1NA 2JU5A 4TW5A 1PL1A 1THOA 4OFNA 1PL2A 3GRXA 2CVBA 1GLQA 3DGQA 5ECHB 3IA1A 1LBKA 4ML6A 4BVYB 2GQKA 3GV1A 2LJAA 2N5AA 3HVVA 1BAYA 2FWEA 3BOAA 3QR6A 2EIOA 5J3RA 4ZBAA 2HRAA 3TRPA 1T7PB 3HXSA 4N0ZA 3L78A 5CRDA 4WR5A 3WT1A 1FB0A 3D21A 3J7Yk 2PMTA 4TR0A 1O73A 4GSNA 2PGTA 3FW2A 2DMLA 1B9YC 5LCZA 3HJMA 5KN0A 1T4YA 2DJKA 3UEMA 2AJQB 2HFDA 3LXZA 1TI1A 2FA8A 3C1SA 1O8XA 2L6CA 3DEXA 5D73A 4K6XA 4E8HA 1AQVA 2PBJA 4WXTA 1NSWA 1QUWA 4CY6A 2B1LA 5FT3A 1RQMA 1XIYA 3VPTA 3I43A 1YF1A 2C0FA 2B5XA 2UZ8A 2E2GA 1NM3A 3FZAA 1WMJA 4J57E 3AY8A 6GSYA 3DKSA 3R2QA 2IMKA 2IMFA 1R7HA 1T00A 1V9WA 1JZOA 1DE1A 3TRXA 3UVTA 1WOUA 2LNSA 1O85A 4PUFC 2ALBA 4KNDA 4IHUA 1XWAA 5HQPA 3GURA 2OE0A 5IOXA 3KP9A 5B8BA 1ZYEA 4IP1A 3ZTLA 5DBQA 1Q98A 2P31A 3QPMA 4PTSA 5JWRB 4HDEA 2HNLA 5DAKA 3FR9A 2X64A 3M0FA 1FOVA 3WT2A 1YEXA 4WR4A 1PGTA 3DVWA 4PGTA 4KE3A 6GSUA 2IFQB 3IR4A 2AYTA 1K0AA 1BG5A 4PQIA 3SBCA 3VWXA 4EVMA 3F63A 4EDZA 1EWXA 2C4JA 3CBUA 1U87A 5ELGA 1ERVA 2Z9SA 2HYXA 3KIJA 3EINA 2NPBA 3RHCA 2VCWA 4MPFA 1EP8A 5H5SA 3I69A 2E2MA 2H0HA 1WRYA 1F2EA 2GGTA 4MJAA 2HXKA 5JCUA 4O7HA 1GSSA 1ZGNA 4FYCA 2H1AA 4H86A 1FHEA 1IYIA 1H75A 3V1WA 3BD2A 1XOAA 2IL3A 2DSAA 1MDKA 3GL5A 2VL9A 3ERGA 3FR3A 4K0GA 4WBRD 6GSTA 4I5QA 1I5GA 2YP6A 1JZRA 1UC7A 4JE1A 4DVCA 2DJJA 2X8CA 2N5BA 1F9MA 3KCMA 4E8EA 4GSTA 2DKIA 2YZHA 3HVXA 5A4WA 3BBYA 2PN8A 5EVOA 5BMUA 4L0UA 4Q5FA 3RPNA 1O7UA 3UBLA 5B8AA 5IMVA 4HZ4A 1YEPA 1VRSD 2EIQA 3WGDA 4ECJA 3CSHA 1R5AA 2I9HA 3DYRA 1V40A 1G6WA 1A8LA 3FZ4A 2IN3A 2YCDA 1AQXA 2F8FA 22GSA 2AB6A 1UA5A 3N9JA 3M9JA 5KN2A 4MJBA 4JU5A 2DJ0A 4OO5A 2JL4A 2A4VA 3TKSA 4V1Ag 1TOFA 2GSRA 4BL7B 1AC1A 5JCWA 1K3YA 2O7KA 3TJGA 1GRXA 2XPDA 1FOHA 4JR4A 3TKSE 1Z9HA 1T8EB 2WB9A 4LMVA 2CQ9A 2CX3A 2WFCA 4WBJA 1Z6NA 2I1UA 3DRNA 4I97A 3MAKA 1QGVA 2ES7A 2GSQA 4G19A 4EL1A 1VF2A 1TU8A 1JFUA 4Z2RA 3KMOA 5D96A 3D5JA 5DDLA 1EGRA 2VCZA 2DIYA 3VK9A 1PD21 2NVLA 1ERTA 4Z2UA 3UBKA 1YF0A 2DBCA 1ERUA 1M9AA 2PVOC 3KJYA 1U88A 2KUCA 1Z7PA 3GFKA 2FGXA 3CYNA 1YKCA 1ERWA 3IC8A 3APQA 1I9DA 2B1KA 4AJ7A 1GULA 5D93A 3VI5A 3RDWA 3QOUA 2YZUA 4PNGA 1GUKA 4TOPA 5CRGA 5G2ZA 5C04A 3GHAA 2HSMA 2H76A 1MD4A 3E3EA 1A2JA 1T1VA 2LQOA 3VWWA 4BA7A 1M99A 2B5EA 3LYKA 1O8WA 3ZIVA 5J5NA 3IV4A 4L8EA 1QK8A 4EIPA 2L4QA 3BCIA 4O5QA 3EU3A 2QC7A 1TRWA 4MJCA 1OE8A 4HQZA 4GRFA 2LRNA 1EEMA 1WE0A 5ELAA 4ZL8A 1XOBA 4GCIA 2I81A 2LRTA 2ON5A 1TKDB 2VAFA 4KDYA 3EC3A 4I2UA 4JBBA 2V32A 3C8EA 4GWRA 4TR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHP A;  4I6X A;  1A23 A;  2RII A;  2YN1 A;  4Z7X A;  1THX A;  10GS A;  4KCA A;  2H1B A;  4XS4 B;  7GSS A;  2V6O A;  4HU7 A;  3KTB A;  4K2D A;  4ZIL A;  3A3T A;  3HHV A;  2M46 A;  2DC5 A;  3DD3 A;  2C0G A;  2LS5 A;  3RAZ A;  1Z3E A;  1GTA A;  1EV4 A;  2YWN A;  5E4W A;  2VOC A;  4OWY A;  2C1Y A;  4ML1 A;  2VCV A;  1LJR A;  1FO5 A;  2AHE A;  4OCF A;  4HUA A;  4HJ2 A;  5GAP D;  2FUG 2;  4FH8 A;  1JZW A;  3FZ5 A;  1XW9 A;  2C3N A;  3A2X A;  5IOW A;  3DVX A;  5HFG A;  3TJK A;  4ECI A;  4XS1 A;  2MMN A;  5E59 A;  3C1R A;  1TP9 A;  1MD3 A;  2GTU A;  3WYW A;  3APO A;  2GZY A;  12GS A;  4KDU A;  4P3Y B;  4ZBB A;  2IIY A;  4CHS A;  1K0B A;  1PQN A;  2L5L A;  4PXO A;  3UL3 A;  1B4P A;  3PGT A;  2E7P A;  2H6X A;  2CAI A;  3ISO A;  4NHW A;  2L57 A;  3KZQ A;  3RHB A;  4NHZ A;  1TK0 B;  4AJ8 A;  1KTE A;  1SJI A;  1YZX A;  2HRN A;  1SYX A;  2C3T A;  3FKF A;  1PSQ A;  2GVP A;  2X99 A;  1R26 A;  1B9X C;  4LLR A;  3LSZ A;  1IYH A;  2VCX A;  5F8B A;  5G31 A;  2OKA A;  1XXU A;  5IMD A;  3CSJ A;  2GT6 A;  1VF1 A;  4K1F A;  5D9V A;  5ECO B;  1X9W B;  3ZRE A;  3Q18 A;  3CXG A;  4GF0 A;  2V6K A;  2CA8 A;  1ABA A;  3ED3 A;  4KCE A;  2JZS A;  2VL3 A;  5INY A;  2TIR A;  2GDR A;  2FCH A;  4XRA A;  1ZL9 A;  3HJP A;  3IK9 A;  4XS6 A;  3KMN A;  5D8I A;  2C3Q A;  2ZCT A;  4EXJ A;  4WET A;  3FYG A;  2MBT A;  2XHF A;  4XIH A;  1X9S B;  3UIW A;  4N10 A;  5DAK B;  3EWL A;  2K9F A;  4D73 B;  4IGJ A;  1SK1 A;  1GLP A;  3MNG A;  2MMO A;  2L59 A;  1GWC A;  3IXR A;  2H8L A;  3UMA A;  3EMX A;  4AGS A;  5ID2 A;  3WGX A;  3EMP A;  2YV9 A;  3F3R A;  3TKS C;  4KDX A;  4MF6 A;  1A2L A;  2KP2 A;  3S9F A;  3QMX A;  4RI7 A;  1B4Q A;  2EIR A;  2BMX A;  1K0M A;  1A8Y A;  1USB A;  2FY6 A;  1TXX A;  1BQ7 A;  4QL7 A;  3SWL A;  3GX0 A;  4MMM A;  3Q6O A;  3HYP A;  5CRE A;  1XCC A;  3ZFB A;  2RM5 A;  1UN2 A;  4IP6 A;  2QSI A;  5IMF A;  5HFK A;  1PKW A;  2VM2 A;  4X43 A;  5J9C A;  2P5R A;  3UJ1 A;  4LL4 B;  4POB A;  2OJL A;  2VCT A;  2LKU A;  2TRX A;  4V2M A;  1ON4 A;  18GS A;  1EZK A;  1OAZ A;  2LEG A;  1O6J A;  3WD6 A;  3L9U A;  3F6F A;  2DMM A;  3GIX A;  1WWJ A;  3ZYW A;  1B8X A;  4TVE A;  1URM A;  2L6D A;  1SJ6 A;  4MLY A;  2MZC A;  1V57 A;  2RLI A;  1BYE A;  6GSX A;  5IMZ A;  1XW5 A;  5B6N A;  1B48 A;  1EEJ A;  1GTU A;  4IBP A;  3FY7 A;  5KN1 A;  3GKX A;  5IM9 A;  3I9V 2;  4KW6 A;  3GN3 A;  3F4R A;  2NBS A;  4AF2 A;  2XPE A;  1RK4 A;  4Q5R A;  2H71 A;  1QFN A;  9GSS A;  3GH6 A;  2GQL A;  3G7J A;  1TDI A;  3F9U A;  1J08 A;  4MK3 A;  3GMF A;  3KGK A;  3KP8 A;  2REM A;  1C72 A;  1K0D A;  3CTG A;  4AJ6 A;  4TN8 A;  1JZD A;  3ZVJ D;  1GSF A;  3Q19 A;  2CZ2 A;  3M3M A;  2NTO A;  3HA9 A;  5ENU A;  1Q4J A;  5ECK B;  4POL A;  4F0B A;  1UVZ A;  4F03 A;  5KN3 A;  4ZL7 A;  3HVS A;  2R6K A;  3GUS A;  2J23 A;  4TRX A;  4DSR A;  1QQ2 A;  4IS0 A;  3FHK A;  3P8W A;  3DML A;  4XCS A;  4FYB A;  3GKN A;  5CYY A;  3GX8 A;  4GXZ A;  2H74 A;  4K9Z A;  3DXB A;  2QKE A;  1K0C A;  1M2A A;  4FO5 A;  4GLT A;  3ZIJ A;  2H70 A;  4KSO A;  3KD0 A;  1EGO A;  1PX7 A;  3ZMK A;  4DSS B;  1GP1 A;  2H1G A;  3L9S A;  4WKW A;  3C73 A;  5GZZ B;  1SYR A;  4N30 A;  3TB2 A;  2O85 A;  1Z6M A;  3PH9 A;  4DEJ A;  1YJ6 A;  4KA0 A;  3ME8 A;  5CP1 A;  4O32 A;  5AIV A;  4ZB9 A;  4MZB A;  5ECS A;  3FEU A;  4PQ1 A;  2B5Y A;  4G2E A;  4NXI A;  1SEN A;  4EO3 A;  5A5K A;  3EU4 A;  3OR5 A;  3CRU A;  4RI6 A;  1GNE A;  4CDO A;  4FIW A;  4PQH A;  1X5E A;  1ZZY A;  1XVQ A;  3NZN A;  4NPB A;  1F37 A;  2H0G A;  2WZ9 A;  1XWG A;  5F05 A;  2GZZ A;  2H72 A;  5FHI A;  2LST A;  1YKA A;  1HQO A;  2C80 A;  1OKT A;  4EC0 A;  5ABR A;  3EE2 A;  3IE3 A;  3W8J A;  4ZL9 A;  5ECP B;  1S3A A;  2YNX A;  3EYT A;  1S3C A;  4IJ3 A;  1SD8 A;  3QAV A;  2LJR A;  4NV5 A;  3TJB A;  2JSZ A;  3TOT A;  1XPV A;  3GH9 A;  2LV3 A;  4ECC A;  1XWK A;  3GTU A;  2YJ7 A;  2R3X A;  4NMU A;  5JWQ B;  5IPH A;  1SKW B;  4JED A;  1GNW A;  2VLV A;  2ZNM A;  1R5P A;  5DAL B;  1XW6 A;  1K0O A;  1SD9 A;  2YV7 A;  4ISD A;  4TXV A;  4RQR A;  3U6V A;  1A0R P;  2LJK A;  4MZW A;  3LXT A;  1M2D A;  1TRV A;  5DCG A;  1FW1 A;  14GS A;  1GUH A;  2R4V A;  4KX4 A;  1A24 A;  3G7Y A;  3KXO A;  1MDI A;  4IKH A;  19GS A;  1GH2 A;  2J9H A;  4N0V A;  5B6M A;  4F0C A;  17GS A;  1EP7 A;  4QL9 A;  2RM6 A;  4HQS A;  4JRR A;  2LQQ A;  5ECR B;  3IPZ A;  2CT6 A;  3ERF A;  5LD0 A;  4MH3 A;  1GSQ A;  1W89 A;  4OD7 A;  2I4A A;  4XHM A;  1OC9 A;  3IHQ A;  4BL7 A;  5EPF A;  3A5W A;  3ERW A;  2WJU A;  4ILF A;  2TRC P;  4TXO B;  4K7I A;  3KH9 A;  2DJ2 A;  4F82 A;  4LL1 B;  1X5D A;  3DIE A;  1S3D A;  2MMA A;  3HD5 A;  1PMT A;  4JZQ A;  1BED A;  1SKS B;  1HYU A;  1OC3 A;  3O3T A;  3C71 A;  2FA4 A;  4ZBD A;  3G9B A;  3TRQ A;  2LRC A;  2WCI A;  4QQ7 A;  2VLU A;  4O5R A;  5L71 A;  5CO3 A;  2LNT A;  5H5Q A;  2RUE A;  1SU9 A;  1F3A A;  2GQM A;  2HZE B;  4BWQ A;  4KGI A;  5DCH A;  2YWO A;  1FB6 A;  1VF4 A;  5J4U A;  4TR1 A;  2H73 A;  3QFA C;  1DUG A;  3J7Y b;  4OFT A;  1XVW A;  2C8U A;  5A4U A;  1W4V A;  3LFL A;  2GST A;  5ECL B;  1TJD A;  3GKK A;  1ZCP A;  2HI7 A;  2HZF A;  5ID2 B;  5G1K A;  2RUF A;  1A2M A;  4PUR A;  2GZP A;  2GT5 A;  2JAD A;  4LA1 A;  3QAW A;  2AUV A;  1E2Y A;  4YAV A;  3WGE A;  5ECI B;  3A2W A;  3EUR A;  1FG4 A;  5G5F A;  5JWO B;  3VI7 A;  1NHY A;  4X0X A;  2ON7 A;  1BX9 A;  4YQM A;  2OA7 A;  1AAZ A;  4KH7 A;  4V2L A;  4POK A;  1GUM A;  4I8B A;  4ECB A;  3FK8 A;  1ZMA A;  3IAM 2;  2YWM A;  3VLN A;  4DSQ A;  1AIU A;  2E0Q A;  1Y6E A;  4XS4 A;  1ST9 A;  2YAN A;  2CV4 A;  3GL3 A;  5DJM A;  5J41 A;  2CVD A;  3ZVJ A;  1OYJ A;  1X9M B;  1EV9 A;  1NHO A;  2NDO A;  1PX6 A;  3D4T A;  3BJ5 A;  1SKR B;  2ZUP A;  5JCG A;  4PUA A;  3E9J B;  3GST A;  4MF7 A;  1CQG A;  2F8A A;  2VIM A;  2WUL A;  3TJJ A;  3HCZ A;  4GSS A;  4KB3 A;  3LGC A;  3LJR A;  2C0D A;  2C0E A;  3ME7 A;  2MMZ A;  3VFI A;  3VPQ A;  5ECN B;  1XZO A;  2KLX A;  5C00 A;  3CTF A;  4ACS A;  1MEK A;  1KNG A;  2MYG A;  3LQ7 A;  5AGY A;  4K0N A;  13GS A;  2K8V A;  1PA3 A;  3L0H A;  2FLS A;  1LU4 A;  2X8G A;  11GS A;  4KSM A;  1EOG A;  1U3A A;  4L5L A;  3N5O A;  3ZLP A;  1FVK A;  4J2F A;  3ZL5 A;  1M9B A;  1U6T A;  2HSH A;  2WS2 A;  1SK2 A;  1CQH A;  2XC2 A;  4K7N A;  3D6I A;  4WF4 A;  1N8J A;  3F4T A;  2V41 A;  5D9X A;  4HS1 A;  3M8N A;  2M72 A;  5IO2 A;  4HU9 A;  2K18 A;  3LWA A;  4F9Z A;  3MDK A;  3QDN A;  2F51 A;  4MPG A;  4YAP A;  5ECM B;  1SL2 B;  3RBT A;  2K8S A;  1TW9 A;  2CVK A;  3W6G A;  4MZC A;  2DJ1 A;  2YWI A;  2FWF A;  2GS3 A;  3HZ4 A;  2X8H A;  2AV4 A;  3UAP A;  2P5Q A;  3F6D A;  4O92 A;  3US3 A;  4V2N A;  1PRX A;  3G7I A;  1SJZ A;  4ULX A;  3NIV A;  5A4V A;  4TKY A;  3QFB C;  3D22 A;  2IMD A;  3F8U A;  4MJE A;  3IC4 A;  1M0U A;  5F06 A;  4HI7 A;  5IIZ A;  3KTL A;  3H8Q A;  5DVB A;  3GKM A;  2JZT A;  4D73 A;  3PIN A;  4KAE A;  4BVY A;  3JCM L;  1K3O A;  1Y25 A;  3KH7 A;  4IN0 A;  4IVF A;  1T4Z A;  2I3Y A;  3IAS 2;  1GSU A;  2FNO A;  4HEA 2;  4Q5Q A;  6GSW A;  2H6Z A;  5IO0 A;  2PWJ A;  3FR6 A;  2VO4 A;  3TDG A;  4MA9 A;  1PKZ A;  3ZIT A;  1HNC A;  2H30 A;  5ECQ B;  3L4N A;  3FZ9 A;  2VL2 A;  1T3B A;  3GNJ A;  2DJ3 A;  1TTZ A;  3VWU A;  2VD0 A;  2B6M A;  1GTB A;  4LMW A;  3D0Z A;  2XBI A;  3VWV A;  1JHB A;  2PU9 C;  1JLV A;  1FVJ A;  1BJX A;  5B7C A;  3U5R E;  4IW9 A;  1WJK A;  2XBQ A;  5FWG A;  5GAN D;  2L5O A;  1OVN A;  2WRT A;  2CZ3 A;  2FD3 A;  3ZRD A;  4EDY A;  3K8N A;  2VM1 A;  2JAC A;  3GTU B;  4NV2 A;  1E6B A;  2IWT A;  4OMV A;  5G30 A;  5AN1 A;  4V1A p;  5DQS A;  3TKP A;  1TK5 B;  2OBK A;  1QMV A;  3LOR A;  3CRT A;  1K3L A;  3IRA A;  2B7K A;  2VCQ A;  5LNK e;  2H75 A;  4GQF A;  1XBS A;  1VGL A;  4I2T A;  1HNB A;  2VLT A;  2LTK A;  2EC4 A;  3QAG A;  1WIK A;  4L5O A;  3LEF A;  4Q5N A;  3APS A;  2BJX A;  4EUY A;  2DIZ A;  1DE2 A;  1VF3 A;  5IQY A;  3C7M A;  2H0I A;  20GS A;  5KEJ A;  2CX4 A;  2OE3 A;  5DJL A;  1MTC A;  4MAB A;  4HOJ A;  2VUP A;  2A2S A;  2P0G A;  4HZ2 A;  2R2J A;  5GST A;  1H4O A;  3ZZX A;  1V58 A;  5CNW A;  2OAD A;  2IFQ A;  3H93 A;  2VD1 A;  3TOU A;  1TRU A;  1XWC A;  2KOK A;  4EKZ A;  2IJY A;  3CMI A;  1M7T A;  3TCO A;  2IME A;  2FWH A;  5HR1 A;  1OC9 B;  4BWS A;  3UAR A;  5G1L A;  5IMA A;  2R37 A;  2K6V A;  1U3I A;  2PER A;  3QCP A;  4L0W A;  5CRH A;  5HR2 A;  4HJM A;  2JZR A;  3E0U A;  3PR8 A;  4G9H A;  6GSV A;  16GS A;  4IEL A;  4NAX A;  1RW1 A;  3F4S A;  2D2Z A;  1YDK A;  2QGV A;  1N2A A;  5D9T A;  1TU7 A;  1V2A A;  2HLS A;  2IMI A;  2H6Y A;  1G0T A;  5GSS A;  4ID0 A;  3Q74 A;  4PX1 A;  4ZB8 A;  3QD9 A;  3UOM A;  4FYU A;  4MF5 A;  3F3Q A;  3MSZ A;  5HFI A;  4CW9 A;  4XTS A;  1ML6 A;  4YH2 A;  4MH2 A;  4WF5 A;  1PN9 A;  4DSS A;  3CSI A;  4TR1 B;  1TI3 A;  3D4M A;  3ZML A;  1Z7R A;  2G2Q A;  2N5F A;  2YPM A;  2HRF A;  2B7J A;  1SL0 B;  3I6A A;  1WP0 A;  1M2B A;  4G10 A;  4EF0 A;  1X5C A;  1TK8 B;  3HY2 A;  3TKR A;  1G7E A;  1GSD A;  3A2V A;  2YOI A;  3W8S A;  1ACV A;  2HT9 A;  2B3S A;  3H79 A;  2GSS A;  1DSB A;  2F3M A;  4TR3 A;  4ZXG A;  4XRD A;  4IQA A;  4IJI A;  3F0I A;  3TGZ A;  5CRW A;  1DBY A;  1QXH A;  5J9B A;  1K0N A;  2G0F A;  1XFL A;  4IQ1 A;  1SL1 B;  5IMC A;  4BVX A;  1O81 A;  1ZOF A;  3HJO A;  5COH A;  2O8V B;  1J0F A;  3LG6 A;  3VUR A;  4YQV A;  1OKD A;  4OO4 A;  1J9B A;  4ZIJ A;  3LYP A;  2A2R A;  2H01 A;  5HR0 A;  1AUC A;  3KEB A;  1AW9 A;  3HKR A;  2HE3 A;  5IPG A;  2CAQ A;  3H4K A;  1EOH A;  5F0G A;  4MDC A;  1JLW A;  3EVI A;  3MWH A;  2OE1 A;  1F3B A;  1G6Y A;  4RQX A;  4K7O A;  3GYK A;  3KM6 A;  5EY6 A;  3IDV A;  2F9S A;  5DAL A;  3TUE A;  3BCK A;  2KP1 A;  2L4C A;  5AIS A;  6GSS A;  4PNF A;  1GSE A;  3IBH A;  5HR3 A;  5CAX A;  1KEB A;  1OE7 A;  3P2A A;  4KUN A;  4WEY A;  4X1U A;  2O87 A;  4RUV A;  1A0F A;  5H5R A;  2WGR A;  1TRS A;  2VL2 C;  1MDJ A;  2O89 A;  2V1M A;  2LUS A;  3P7X A;  3M1G A;  3IOS A;  1WPI A;  3GSS A;  2OBI A;  1G7O A;  5DQY A;  3NOF A;  1FAA A;  2H19 A;  4YQU A;  4K8M A;  2HSY A;  3RPP A;  1X0R A;  4ZB6 A;  5D9W A;  2FHE A;  4J56 E;  2YJH A;  2M80 A;  1ZYQ B;  4OFM A;  5AIX A;  3P90 A;  4N11 A;  3TJF A;  4MP4 A;  4MCU A;  3L9V A;  4GTU A;  3O6T A;  1GTI A;  2MBS A;  2H66 A;  2PVQ A;  4NWY A;  4TXO A;  1GL8 A;  1GSY A;  4JR6 A;  2JSY A;  1HNA A;  3IK7 A;  1ILO A;  1HD2 A;  2IPA A;  1NW2 A;  1YQ1 A;  2BTO T;  3HDC A;  5EL8 A;  1R4W A;  2V2G A;  3UVH A;  2WDU A;  4F2I A;  2AAW A;  2DLX A;  2GLR A;  1OC8 A;  1YY7 A;  1KBN A;  2PPT A;  3FRC A;  3TKQ A;  4OCE A;  2H1D A;  2FWG A;  1F6M C;  1SK0 A;  3DWV A;  5G5E A;  3ZFL A;  3GA4 A;  4EE0 A;  1V98 A;  8GSS A;  1Z5Y E;  3HZ8 A;  1XWB A;  4POM A;  2PUK C;  3O76 A;  1AQW A;  2OAC A;  4BPY A;  2HZE A;  1AXD A;  3M9K A;  4GQC A;  5F07 A;  2R5G A;  3H1N A;  2JU5 A;  4TW5 A;  1PL1 A;  1THO A;  4OFN A;  1PL2 A;  3GRX A;  2CVB A;  1GLQ A;  3DGQ A;  5ECH B;  3IA1 A;  1LBK A;  4ML6 A;  2GQK A;  3GV1 A;  2LJA A;  2N5A A;  3HVV A;  1BAY A;  2FWE A;  3BOA A;  3QR6 A;  2EIO A;  5J3R A;  4ZBA A;  3TRP A;  1T7P B;  3HXS A;  4N0Z A;  3L78 A;  5CRD A;  4WR5 A;  3WT1 A;  1FB0 A;  3D21 A;  3J7Y k;  2PMT A;  4TR0 A;  1O73 A;  4GSN A;  2PGT A;  3FW2 A;  2DML A;  1B9Y C;  5LCZ A;  3HJM A;  5KN0 A;  1T4Y A;  2DJK A;  3UEM A;  2AJQ B;  2HFD A;  3LXZ A;  1TI1 A;  2FA8 A;  3C1S A;  1O8X A;  2L6C A;  3DEX A;  5D73 A;  4K6X A;  4E8H A;  1AQV A;  2PBJ A;  4WXT A;  1NSW A;  1QUW A;  2B1L A;  5FT3 A;  1RQM A;  1XIY A;  3VPT A;  3I43 A;  1YF1 A;  2C0F A;  2B5X A;  2E2G A;  1NM3 A;  3FZA A;  1WMJ A;  4J57 E;  3AY8 A;  6GSY A;  3DKS A;  3R2Q A;  2IMK A;  2IMF A;  1R7H A;  1T00 A;  1V9W A;  1JZO A;  1DE1 A;  3TRX A;  3UVT A;  1WOU A;  2LNS A;  1O85 A;  4PUF C;  2ALB A;  4KND A;  4IHU A;  1XWA A;  5HQP A;  3GUR A;  2OE0 A;  5IOX A;  3KP9 A;  5B8B A;  1ZYE A;  4IP1 A;  3ZTL A;  5DBQ A;  1Q98 A;  2P31 A;  3QPM A;  5JWR B;  4HDE A;  2HNL A;  5DAK A;  3FR9 A;  2X64 A;  3M0F A;  1FOV A;  3WT2 A;  1YEX A;  4WR4 A;  1PGT A;  3DVW A;  4PGT A;  4KE3 A;  6GSU A;  2IFQ B;  3IR4 A;  2AYT A;  1K0A A;  1BG5 A;  4PQI A;  3SBC A;  3VWX A;  4EVM A;  3F63 A;  4EDZ A;  1EWX A;  2C4J A;  3CBU A;  1U87 A;  5ELG A;  1ERV A;  2Z9S A;  2HYX A;  3KIJ A;  3EIN A;  2NPB A;  3RHC A;  2VCW A;  4MPF A;  1EP8 A;  5H5S A;  3I69 A;  2E2M A;  2H0H A;  1WRY A;  1F2E A;  2GGT A;  4MJA A;  2HXK A;  5JCU A;  4O7H A;  1GSS A;  1ZGN A;  4FYC A;  2H1A A;  4H86 A;  1FHE A;  1IYI A;  1H75 A;  3V1W A;  3BD2 A;  1XOA A;  2IL3 A;  2DSA A;  1MDK A;  3GL5 A;  2VL9 A;  3ERG A;  3FR3 A;  4K0G A;  4WBR D;  6GST A;  4I5Q A;  1I5G A;  2YP6 A;  1JZR A;  1UC7 A;  4JE1 A;  4DVC A;  2DJJ A;  2X8C A;  2N5B A;  1F9M A;  3KCM A;  4E8E A;  4GST A;  2YZH A;  3HVX A;  5A4W A;  3BBY A;  2PN8 A;  5EVO A;  4L0U A;  4Q5F A;  3RPN A;  1O7U A;  3UBL A;  5B8A A;  5IMV A;  4HZ4 A;  1YEP A;  1VRS D;  2EIQ A;  3WGD A;  4ECJ A;  3CSH A;  1R5A A;  2I9H A;  3DYR A;  1V40 A;  1G6W A;  1A8L A;  3FZ4 A;  2IN3 A;  2YCD A;  1AQX A;  2F8F A;  22GS A;  2AB6 A;  1UA5 A;  3N9J A;  3M9J A;  5KN2 A;  4MJB A;  4JU5 A;  2DJ0 A;  4OO5 A;  2JL4 A;  2A4V A;  3TKS A;  4V1A g;  1TOF A;  2GSR A;  1AC1 A;  5JCW A;  1K3Y A;  2O7K A;  3TJG A;  1GRX A;  2XPD A;  4JR4 A;  3TKS E;  1Z9H A;  1T8E B;  2WB9 A;  4LMV A;  2CQ9 A;  2CX3 A;  2WFC A;  4WBJ A;  1Z6N A;  2I1U A;  3DRN A;  4I97 A;  3MAK A;  1QGV A;  2ES7 A;  2GSQ A;  4G19 A;  4EL1 A;  1VF2 A;  1TU8 A;  1JFU A;  3KMO A;  5D96 A;  3D5J A;  5DDL A;  1EGR A;  2VCZ A;  2DIY A;  3VK9 A;  1PD2 1;  2NVL A;  1ERT A;  3UBK A;  1YF0 A;  2DBC A;  1ERU A;  1M9A A;  2PVO C;  3KJY A;  1U88 A;  2KUC A;  1Z7P A;  3GFK A;  2FGX A;  3CYN A;  1YKC A;  1ERW A;  3APQ A;  1I9D A;  2B1K A;  4AJ7 A;  1GUL A;  5D93 A;  3VI5 A;  3RDW A;  3QOU A;  2YZU A;  4PNG A;  1GUK A;  4TOP A;  5CRG A;  5G2Z A;  5C04 A;  3GHA A;  2H76 A;  1MD4 A;  3E3E A;  1A2J A;  1T1V A;  2LQO A;  3VWW A;  4BA7 A;  1M99 A;  2B5E A;  3LYK A;  1O8W A;  3ZIV A;  5J5N A;  3IV4 A;  4L8E A;  1QK8 A;  2L4Q A;  3BCI A;  3EU3 A;  2QC7 A;  1TRW A;  1OE8 A;  4HQZ A;  4MJC A;  4GRF A;  2LRN A;  1EEM A;  1WE0 A;  5ELA A;  4ZL8 A;  1XOB A;  4GCI A;  2I81 A;  2LRT A;  2ON5 A;  1TKD B;  2VAF A;  4KDY A;  3EC3 A;  4I2U A;  4JBB A;  2V32 A;  3C8E A;  4GWR A;  4TR4 A; 
#chains in the Genus database with same CATH topology
 2KHP A;  4I6X A;  1A23 A;  2RII A;  2YN1 A;  4Z7X A;  1THX A;  10GS A;  4KCA A;  2H1B A;  4XS4 B;  7GSS A;  2V6O A;  3IHG A;  4HU7 A;  3KTB A;  4K2D A;  4ZIL A;  3A3T A;  3HHV A;  2M46 A;  2DC5 A;  3DD3 A;  2C0G A;  2LS5 A;  3RAZ A;  1Z3E A;  1GTA A;  1EV4 A;  2YWN A;  5E4W A;  2VOC A;  4OWY A;  2C1Y A;  4ML1 A;  2VCV A;  1LJR A;  1FO5 A;  2AHE A;  4OCF A;  2QA2 A;  4HUA A;  4HJ2 A;  5GAP D;  2FUG 2;  4FH8 A;  1JZW A;  3FZ5 A;  1XW9 A;  2C3N A;  3A2X A;  5IOW A;  3DVX A;  5HFG A;  3TJK A;  4ECI A;  4XS1 A;  2MMN A;  5E59 A;  3C1R A;  1TP9 A;  1MD3 A;  2GTU A;  3WYW A;  3APO A;  2GZY A;  12GS A;  4KDU A;  4P3Y B;  4ZBB A;  2IIY A;  4CHS A;  1K0B A;  4PXO A;  1PQN A;  2L5L A;  4K5S A;  3UL3 A;  1B4P A;  3PGT A;  2E7P A;  2H6X A;  2CAI A;  3ISO A;  4FQU A;  4NHW A;  2L57 A;  3KZQ A;  3RHB A;  4NHZ A;  1TK0 B;  4AJ8 A;  1KTE A;  1SJI A;  1YZX A;  2HRN A;  1SYX A;  2C3T A;  2QA1 A;  3FKF A;  1PSQ A;  2GVP A;  2X99 A;  1R26 A;  1B9X C;  4LLR A;  3LSZ A;  1IYH A;  2VCX A;  5F8B A;  5G31 A;  2OKA A;  1XXU A;  5IMD A;  3CSJ A;  2GT6 A;  1VF1 A;  4K1F A;  5D9V A;  5ECO B;  1X9W B;  3ZRE A;  3FMW A;  3Q18 A;  3CXG A;  4GF0 A;  2V6K A;  2CA8 A;  1ABA A;  3ED3 A;  4KCE A;  2JZS A;  2VL3 A;  5INY A;  2TIR A;  2GDR A;  2FCH A;  4XRA A;  1ZL9 A;  3HJP A;  3IK9 A;  4XS6 A;  3KMN A;  5D8I A;  2C3Q A;  2ZCT A;  4EXJ A;  4WET A;  3FYG A;  2MBT A;  2XHF A;  4XIH A;  1X9S B;  3UIW A;  4N10 A;  5DAK B;  3EWL A;  2K9F A;  4D73 B;  4IGJ A;  1SK1 A;  1GLP A;  3MNG A;  2MMO A;  2L59 A;  1GWC A;  3IXR A;  2H8L A;  3UMA A;  4YKF A;  3EMX A;  4AGS A;  5ID2 A;  3WGX A;  3EMP A;  2YV9 A;  3F3R A;  3TKS C;  4KDX A;  4MF6 A;  1A2L A;  2KP2 A;  3S9F A;  3QMX A;  4RI7 A;  1B4Q A;  2EIR A;  2BMX A;  1K0M A;  1A8Y A;  1USB A;  2FY6 A;  1TXX A;  1BQ7 A;  4QL7 A;  3SWL A;  3GX0 A;  4MMM A;  3A5I A;  3Q6O A;  3HYP A;  5CRE A;  1XCC A;  3ZFB A;  2RM5 A;  1UN2 A;  4X4J A;  4IP6 A;  2QSI A;  5IMF A;  5HFK A;  1PKW A;  2VM2 A;  4X43 A;  5J9C A;  2P5R A;  1PFO A;  4LL4 B;  3UJ1 A;  4POB A;  2OJL A;  2VCT A;  2LKU A;  2TRX A;  4V2M A;  1ON4 A;  18GS A;  1EZK A;  1OAZ A;  2LEG A;  1O6J A;  3WD6 A;  3L9U A;  3F6F A;  2DMM A;  3GIX A;  1WWJ A;  3ZYW A;  1B8X A;  4TVE A;  1URM A;  2L6D A;  1M3I A;  1SJ6 A;  4MLY A;  2MZC A;  1V57 A;  2RLI A;  1BYE A;  6GSX A;  5IMZ A;  1XW5 A;  5B6N A;  1B48 A;  1EEJ A;  1GTU A;  4IBP A;  3FY7 A;  5KN1 A;  3GKX A;  5IM9 A;  3I9V 2;  4KW6 A;  3GN3 A;  3F4R A;  2NBS A;  4AF2 A;  2XPE A;  2R0P A;  1RK4 A;  4Q5R A;  2H71 A;  1QFN A;  9GSS A;  3GH6 A;  2GQL A;  3G7J A;  1TDI A;  3F9U A;  1J08 A;  4MK3 A;  3GMF A;  3KGK A;  3KP8 A;  2REM A;  1C72 A;  1K0D A;  3CTG A;  4AJ6 A;  4TN8 A;  1JZD A;  3ZVJ D;  1GSF A;  3Q19 A;  2CZ2 A;  3M3M A;  2NTO A;  3HA9 A;  5ENU A;  1Q4J A;  3CQF A;  5ECK B;  4POL A;  4F0B A;  1UVZ A;  4O5U A;  4F03 A;  5KN3 A;  4ZL7 A;  3HVS A;  2R6K A;  3GUS A;  2J23 A;  4TRX A;  4DSR A;  1QQ2 A;  4IS0 A;  3FHK A;  3P8W A;  3DML A;  4XCS A;  4FYB A;  3GKN A;  5CYY A;  3GX8 A;  4GXZ A;  2H74 A;  4K9Z A;  2X4A A;  3DXB A;  2QKE A;  1XG8 A;  1K0C A;  1M2A A;  4FO5 A;  4GLT A;  3ZIJ A;  2H70 A;  4KSO A;  3KD0 A;  1EGO A;  1PX7 A;  3ZMK A;  4DSS B;  1GP1 A;  2H1G A;  3L9S A;  4WKW A;  3C73 A;  5GZZ B;  1SYR A;  4N30 A;  3TB2 A;  2O85 A;  1Z6M A;  3PH9 A;  4DEJ A;  1YJ6 A;  4KA0 A;  3ME8 A;  5CP1 A;  4O32 A;  5AIV A;  4ZB9 A;  4MZB A;  5ECS A;  3FEU A;  4PQ1 A;  2B5Y A;  4G2E A;  4NXI A;  1SEN A;  4EO3 A;  5A5K A;  3EU4 A;  3OR5 A;  3CRU A;  4RI6 A;  1GNE A;  4CDO A;  4FIW A;  4PQH A;  4K2X A;  1X5E A;  1ZZY A;  1XVQ A;  3NZN A;  4NPB A;  1F37 A;  2H0G A;  4BVX B;  2WZ9 A;  1XWG A;  5F05 A;  2GZZ A;  2H72 A;  5FHI A;  2LST A;  1YKA A;  1HQO A;  2C80 A;  1OKT A;  4EC0 A;  5ABR A;  3EE2 A;  3IE3 A;  3W8J A;  4ZL9 A;  5ECP B;  1S3A A;  2YNX A;  3EYT A;  1S3C A;  4IJ3 A;  1SD8 A;  3QAV A;  2LJR A;  4NV5 A;  3TJB A;  2JSZ A;  3TOT A;  1XPV A;  3GH9 A;  2LV3 A;  4ECC A;  1XWK A;  3GTU A;  2YJ7 A;  2R3X A;  4NMU A;  5JWQ B;  5IPH A;  1SKW B;  4JED A;  1GNW A;  2VLV A;  2ZNM A;  1R5P A;  5DAL B;  1XW6 A;  1K0O A;  5KOX A;  1SD9 A;  2YV7 A;  4ISD A;  4TXV A;  4RQR A;  3U6V A;  1A0R P;  2LJK A;  4MZW A;  3LXT A;  1M2D A;  1TRV A;  5DCG A;  1FW1 A;  14GS A;  1GUH A;  2R4V A;  4KX4 A;  1A24 A;  3G7Y A;  3KXO A;  1MDI A;  4IKH A;  19GS A;  3R3E A;  1GH2 A;  2J9H A;  4N0V A;  5B6M A;  4F0C A;  17GS A;  1EP7 A;  4QL9 A;  2RM6 A;  4HQS A;  4JRR A;  2LQQ A;  5ECR B;  3IPZ A;  2CT6 A;  3ERF A;  5LD0 A;  4MH3 A;  1GSQ A;  1W89 A;  4OD7 A;  2I4A A;  4XHM A;  1OC9 A;  3IHQ A;  4BL7 A;  5EPF A;  3A5W A;  3ERW A;  2WJU A;  4ILF A;  4USS A;  2TRC P;  4TXO B;  4K7I A;  4YKG A;  3MYD A;  3KH9 A;  2DJ2 A;  4A5P A;  4F82 A;  4LL1 B;  1X5D A;  3DIE A;  1S3D A;  2MMA A;  3HD5 A;  1PMT A;  4JZQ A;  1BED A;  1SKS B;  1HYU A;  1OC3 A;  3O3T A;  3C71 A;  2FA4 A;  4ZBD A;  3G9B A;  3TRQ A;  2LRC A;  2WCI A;  4QQ7 A;  2VLU A;  4O5R A;  5L71 A;  5CO3 A;  2LNT A;  4KF9 A;  5H5Q A;  3PPU A;  2RUE A;  1SU9 A;  1F3A A;  2GQM A;  2HZE B;  4BWQ A;  4KGI A;  5DCH A;  2YWO A;  1FB6 A;  1VF4 A;  5J4U A;  4TR1 A;  2H73 A;  3QFA C;  1DUG A;  3J7Y b;  4OFT A;  1XVW A;  2C8U A;  5A4U A;  1W4V A;  3LFL A;  2GST A;  5ECL B;  1TJD A;  3GKK A;  1ZCP A;  2HI7 A;  2HZF A;  5ID2 B;  5G1K A;  2RUF A;  4BIK A;  1A2M A;  4PUR A;  2GZP A;  2DKH A;  2GT5 A;  2JAD A;  4LA1 A;  3QAW A;  2AUV A;  1E2Y A;  4YAV A;  3WGE A;  5ECI B;  3A2W A;  3EUR A;  1FG4 A;  5G5F A;  5JWO B;  3VI7 A;  1NHY A;  4X0X A;  2ON7 A;  1BX9 A;  1PN0 A;  4YQM A;  2OA7 A;  1AAZ A;  4KH7 A;  4V2L A;  4POK A;  1GUM A;  4I8B A;  4ECB A;  3FK8 A;  1ZMA A;  3IAM 2;  1ZYN A;  2YWM A;  3VLN A;  4DSQ A;  1AIU A;  2E0Q A;  1Y6E A;  4XS4 A;  1ST9 A;  2YAN A;  2CV4 A;  3GL3 A;  5DJM A;  5J41 A;  2CVD A;  3ZVJ A;  1OYJ A;  1X9M B;  1EV9 A;  1NHO A;  2NDO A;  1PX6 A;  3D4T A;  3BJ5 A;  1SKR B;  2ZUP A;  5JCG A;  2A4H A;  4PUA A;  3E9J B;  3GST A;  4MF7 A;  1CQG A;  2F8A A;  2VIM A;  2WUL A;  3TJJ A;  3HCZ A;  4GSS A;  4KB3 A;  3LGC A;  3LJR A;  2C0D A;  2C0E A;  3ME7 A;  2X49 A;  2MMZ A;  3VFI A;  3VPQ A;  5ECN B;  1XZO A;  2KLX A;  5C00 A;  3CTF A;  4ACS A;  1MEK A;  1KNG A;  2MYG A;  3LQ7 A;  5AGY A;  4K0N A;  13GS A;  2K8V A;  1PA3 A;  3L0H A;  2FLS A;  4Z2T A;  1LU4 A;  2X8G A;  11GS A;  4KSM A;  1EOG A;  1U3A A;  4L5L A;  3N5O A;  3ZLP A;  1FVK A;  4J2F A;  3ZL5 A;  1M9B A;  1U6T A;  2HSH A;  2WS2 A;  1SK2 A;  1CQH A;  2XC2 A;  4K7N A;  3D6I A;  4WF4 A;  1N8J A;  3F4T A;  2V41 A;  5D9X A;  4HS1 A;  3M8N A;  2M72 A;  5IO2 A;  4HU9 A;  2K18 A;  3LWA A;  4F9Z A;  3MDK A;  3QDN A;  2F51 A;  4MPG A;  4YAP A;  5ECM B;  1SL2 B;  3RBT A;  2K8S A;  1TW9 A;  2CVK A;  3W6G A;  4MZC A;  2DJ1 A;  2YWI A;  2FWF A;  2GS3 A;  2R0C A;  3HZ4 A;  2X8H A;  2AV4 A;  3UAP A;  2P5Q A;  3F6D A;  4O92 A;  3US3 A;  4V2N A;  1PRX A;  3G7I A;  1SJZ A;  4ULX A;  3NIV A;  5A4V A;  4TKY A;  3QFB C;  3D22 A;  2IMD A;  3F8U A;  4MJE A;  3IC4 A;  1M0U A;  5F06 A;  4HI7 A;  5IIZ A;  3KTL A;  3H8Q A;  5DVB A;  3GKM A;  2JZT A;  4D73 A;  3PIN A;  4KAE A;  4BVY A;  3JCM L;  1K3O A;  4K5R A;  1Y25 A;  3KH7 A;  4IN0 A;  4IVF A;  1T4Z A;  2I3Y A;  3IAS 2;  1GSU A;  2FNO A;  4HEA 2;  4Q5Q A;  6GSW A;  2H6Z A;  5IO0 A;  2PWJ A;  3FR6 A;  2VO4 A;  3TDG A;  4MA9 A;  1PKZ A;  3ZIT A;  1HNC A;  2H30 A;  5ECQ B;  3L4N A;  3FZ9 A;  2VL2 A;  1T3B A;  3GNJ A;  2DJ3 A;  1TTZ A;  3VWU A;  2VD0 A;  2B6M A;  1GTB A;  4LMW A;  3D0Z A;  2XBI A;  3VWV A;  1JHB A;  2PU9 C;  1JLV A;  1FVJ A;  1BJX A;  5B7C A;  3U5R E;  4IW9 A;  1WJK A;  2XBQ A;  5FWG A;  5GAN D;  2L5O A;  1OVN A;  2WRT A;  2CZ3 A;  2FD3 A;  3ZRD A;  4EDY A;  3K8N A;  2VM1 A;  2JAC A;  3GTU B;  4NV2 A;  1E6B A;  2IWT A;  4OMV A;  5G30 A;  5AN1 A;  4V1A p;  5DQS A;  3TKP A;  1TK5 B;  2OBK A;  1QMV A;  3LOR A;  3CRT A;  1K3L A;  3IRA A;  2B7K A;  2VCQ A;  5LNK e;  2H75 A;  4GQF A;  1XBS A;  1VGL A;  4I2T A;  1HNB A;  2VLT A;  2A2P A;  2LTK A;  2EC4 A;  3QAG A;  1WIK A;  4L5O A;  3LEF A;  4Q5N A;  3APS A;  2BJX A;  4EUY A;  2DIZ A;  1DE2 A;  1VF3 A;  5IQY A;  3C7M A;  2H0I A;  20GS A;  5KEJ A;  2CX4 A;  2OE3 A;  5DJL A;  1MTC A;  4MAB A;  4HOJ A;  2VUP A;  4G0K A;  2A2S A;  2P0G A;  4HZ2 A;  2R2J A;  5GST A;  1H4O A;  3ZZX A;  1V58 A;  5CNW A;  2OAD A;  2IFQ A;  3H93 A;  2VD1 A;  3TOU A;  1TRU A;  1XWC A;  2KOK A;  4EKZ A;  2IJY A;  3CMI A;  1M7T A;  3TCO A;  2IME A;  2FWH A;  5HR1 A;  1M3J A;  1OC9 B;  4BWS A;  3UAR A;  5G1L A;  5IMA A;  2R37 A;  4G0L A;  2K6V A;  1U3I A;  2PER A;  3QCP A;  4L0W A;  5CRH A;  5HR2 A;  4CY8 A;  4HJM A;  2JZR A;  3E0U A;  5BRT A;  3PR8 A;  4G9H A;  4ICY A;  6GSV A;  16GS A;  4IEL A;  4NAX A;  1RW1 A;  3F4S A;  2D2Z A;  1YDK A;  2QGV A;  1N2A A;  5D9T A;  1TU7 A;  1V2A A;  2HLS A;  2IMI A;  2H6Y A;  1G0T A;  5GSS A;  4ID0 A;  3Q74 A;  4PX1 A;  4ZB8 A;  3QD9 A;  3UOM A;  4FYU A;  4MF5 A;  3F3Q A;  3MSZ A;  3MIX A;  4G0I A;  5HFI A;  4CW9 A;  4XTS A;  1ML6 A;  4YH2 A;  4MH2 A;  4WF5 A;  1PN9 A;  4DSS A;  3CSI A;  4TR1 B;  1TI3 A;  3D4M A;  3ZML A;  1Z7R A;  2G2Q A;  2N5F A;  2YPM A;  2HRF A;  2B7J A;  1SL0 B;  3I6A A;  1WP0 A;  1M2B A;  4G10 A;  4EF0 A;  1X5C A;  1TK8 B;  5KOW A;  3HY2 A;  3TKR A;  1G7E A;  1GSD A;  3A2V A;  2YOI A;  3W8S A;  1ACV A;  2HT9 A;  2B3S A;  3H79 A;  2GSS A;  1DSB A;  2F3M A;  4TR3 A;  4ZXG A;  4XRD A;  4IQA A;  4IJI A;  3F0I A;  3TGZ A;  5CRW A;  1DBY A;  1QXH A;  5J9B A;  1K0N A;  2HRK A;  2G0F A;  1XFL A;  3EPT A;  4IQ1 A;  1SL1 B;  5IMC A;  4BVX A;  1O81 A;  1ZOF A;  3HJO A;  5COH A;  2O8V B;  1J0F A;  3LG6 A;  3VUR A;  4YQV A;  1OKD A;  4OO4 A;  1J9B A;  4ZIJ A;  3LYP A;  2A2R A;  2H01 A;  5HR0 A;  1AUC A;  3KEB A;  1AW9 A;  3HKR A;  2HE3 A;  5IPG A;  2CAQ A;  3H4K A;  1EOH A;  5F0G A;  4MDC A;  1JLW A;  3EVI A;  4MNN A;  3MWH A;  2OE1 A;  1F3B A;  1G6Y A;  4RQX A;  4K7O A;  3GYK A;  3KM6 A;  5EY6 A;  3IDV A;  2F9S A;  5DAL A;  3TUE A;  3BCK A;  2KP1 A;  2L4C A;  5AIS A;  6GSS A;  1S3R A;  4PNF A;  1GSE A;  4EIQ A;  3IBH A;  5HR3 A;  5CAX A;  1KEB A;  3HVN A;  1OE7 A;  3P2A A;  4KUN A;  4WEY A;  4X1U A;  2O87 A;  4RUV A;  1A0F A;  5H5R A;  2WGR A;  2R0G A;  1TRS A;  2VL2 C;  1MDJ A;  2O89 A;  2V1M A;  2LUS A;  3P7X A;  3M1G A;  3IOS A;  1WPI A;  3GSS A;  2OBI A;  1G7O A;  5DQY A;  3NOF A;  1FAA A;  2H19 A;  4YQU A;  4K8M A;  2HSY A;  3RPP A;  1X0R A;  4ZB6 A;  5D9W A;  2FHE A;  4J56 E;  2YJH A;  2M80 A;  1ZYQ B;  4OFM A;  5AIX A;  3P90 A;  4N11 A;  3TJF A;  4MP4 A;  4MCU A;  3L9V A;  4GTU A;  3O6T A;  1GTI A;  2MBS A;  2H66 A;  2PVQ A;  4NWY A;  4TXO A;  1GL8 A;  1GSY A;  4JR6 A;  3LW9 A;  2JSY A;  1HNA A;  3IK7 A;  1ILO A;  1HD2 A;  2IPA A;  1NW2 A;  1YQ1 A;  2BTO T;  3HDC A;  5EL8 A;  1R4W A;  2V2G A;  3UVH A;  2WDU A;  4F2I A;  2AAW A;  2DLX A;  2GLR A;  1OC8 A;  1YY7 A;  1KBN A;  2PPT A;  3FRC A;  3TKQ A;  4OCE A;  2H1D A;  2FWG A;  1F6M C;  1SK0 A;  3DWV A;  5G5E A;  3ZFL A;  3GA4 A;  4EE0 A;  1V98 A;  8GSS A;  1Z5Y E;  3HZ8 A;  1XWB A;  4POM A;  2PUK C;  3O76 A;  1AQW A;  2OAC A;  4BPY A;  2HZE A;  1AXD A;  1ZYP A;  3M9K A;  4GQC A;  5F07 A;  2R5G A;  3H1N A;  2JU5 A;  4TW5 A;  1PL1 A;  1THO A;  4OFN A;  1PL2 A;  3GRX A;  2CVB A;  1GLQ A;  3DGQ A;  5ECH B;  3IA1 A;  1LBK A;  4ML6 A;  4BVY B;  2GQK A;  3GV1 A;  2LJA A;  2N5A A;  3HVV A;  1BAY A;  2FWE A;  3BOA A;  3QR6 A;  2EIO A;  5J3R A;  4ZBA A;  2HRA A;  3TRP A;  1T7P B;  3HXS A;  4N0Z A;  3L78 A;  5CRD A;  4WR5 A;  3WT1 A;  1FB0 A;  3D21 A;  3J7Y k;  2PMT A;  4TR0 A;  1O73 A;  4GSN A;  2PGT A;  3FW2 A;  2DML A;  1B9Y C;  5LCZ A;  3HJM A;  5KN0 A;  1T4Y A;  2DJK A;  3UEM A;  2AJQ B;  2HFD A;  3LXZ A;  1TI1 A;  2FA8 A;  3C1S A;  1O8X A;  2L6C A;  3DEX A;  5D73 A;  4K6X A;  4E8H A;  1AQV A;  2PBJ A;  4WXT A;  1NSW A;  1QUW A;  4CY6 A;  2B1L A;  5FT3 A;  1RQM A;  1XIY A;  3VPT A;  3I43 A;  1YF1 A;  2C0F A;  2B5X A;  2UZ8 A;  2E2G A;  1NM3 A;  3FZA A;  1WMJ A;  4J57 E;  3AY8 A;  6GSY A;  3DKS A;  3R2Q A;  2IMK A;  2IMF A;  1R7H A;  1T00 A;  1V9W A;  1JZO A;  1DE1 A;  3TRX A;  3UVT A;  1WOU A;  2LNS A;  1O85 A;  4PUF C;  2ALB A;  4KND A;  4IHU A;  1XWA A;  5HQP A;  3GUR A;  2OE0 A;  5IOX A;  3KP9 A;  5B8B A;  1ZYE A;  4IP1 A;  3ZTL A;  5DBQ A;  1Q98 A;  2P31 A;  3QPM A;  4PTS A;  5JWR B;  4HDE A;  2HNL A;  5DAK A;  3FR9 A;  2X64 A;  3M0F A;  1FOV A;  3WT2 A;  1YEX A;  4WR4 A;  1PGT A;  3DVW A;  4PGT A;  4KE3 A;  6GSU A;  2IFQ B;  3IR4 A;  2AYT A;  1K0A A;  1BG5 A;  4PQI A;  3SBC A;  3VWX A;  4EVM A;  3F63 A;  4EDZ A;  1EWX A;  2C4J A;  3CBU A;  1U87 A;  5ELG A;  1ERV A;  2Z9S A;  2HYX A;  3KIJ A;  3EIN A;  2NPB A;  3RHC A;  2VCW A;  4MPF A;  1EP8 A;  5H5S A;  3I69 A;  2E2M A;  2H0H A;  1WRY A;  1F2E A;  2GGT A;  4MJA A;  2HXK A;  5JCU A;  4O7H A;  1GSS A;  1ZGN A;  4FYC A;  2H1A A;  4H86 A;  1FHE A;  1IYI A;  1H75 A;  3V1W A;  3BD2 A;  1XOA A;  2IL3 A;  2DSA A;  1MDK A;  3GL5 A;  2VL9 A;  3ERG A;  3FR3 A;  4K0G A;  4WBR D;  6GST A;  4I5Q A;  1I5G A;  2YP6 A;  1JZR A;  1UC7 A;  4JE1 A;  4DVC A;  2DJJ A;  2X8C A;  2N5B A;  1F9M A;  3KCM A;  4E8E A;  4GST A;  2DKI A;  2YZH A;  3HVX A;  5A4W A;  3BBY A;  2PN8 A;  5EVO A;  5BMU A;  4L0U A;  4Q5F A;  3RPN A;  1O7U A;  3UBL A;  5B8A A;  5IMV A;  4HZ4 A;  1YEP A;  1VRS D;  2EIQ A;  3WGD A;  4ECJ A;  3CSH A;  1R5A A;  2I9H A;  3DYR A;  1V40 A;  1G6W A;  1A8L A;  3FZ4 A;  2IN3 A;  2YCD A;  1AQX A;  2F8F A;  22GS A;  2AB6 A;  1UA5 A;  3N9J A;  3M9J A;  5KN2 A;  4MJB A;  4JU5 A;  2DJ0 A;  4OO5 A;  2JL4 A;  2A4V A;  3TKS A;  4V1A g;  1TOF A;  2GSR A;  4BL7 B;  1AC1 A;  5JCW A;  1K3Y A;  2O7K A;  3TJG A;  1GRX A;  2XPD A;  1FOH A;  4JR4 A;  3TKS E;  1Z9H A;  1T8E B;  2WB9 A;  4LMV A;  2CQ9 A;  2CX3 A;  2WFC A;  4WBJ A;  1Z6N A;  2I1U A;  3DRN A;  4I97 A;  3MAK A;  1QGV A;  2ES7 A;  2GSQ A;  4G19 A;  4EL1 A;  1VF2 A;  1TU8 A;  1JFU A;  4Z2R A;  3KMO A;  5D96 A;  3D5J A;  5DDL A;  1EGR A;  2VCZ A;  2DIY A;  3VK9 A;  1PD2 1;  2NVL A;  1ERT A;  4Z2U A;  3UBK A;  1YF0 A;  2DBC A;  1ERU A;  1M9A A;  2PVO C;  3KJY A;  1U88 A;  2KUC A;  1Z7P A;  3GFK A;  2FGX A;  3CYN A;  1YKC A;  1ERW A;  3IC8 A;  3APQ A;  1I9D A;  2B1K A;  4AJ7 A;  1GUL A;  5D93 A;  3VI5 A;  3RDW A;  3QOU A;  2YZU A;  4PNG A;  4HSC X;  1GUK A;  4TOP A;  5CRG A;  5G2Z A;  5C04 A;  3GHA A;  2HSM A;  2H76 A;  1MD4 A;  3E3E A;  1A2J A;  1T1V A;  2LQO A;  3VWW A;  4BA7 A;  1M99 A;  2B5E A;  3LYK A;  1O8W A;  3ZIV A;  5J5N A;  3IV4 A;  4L8E A;  1QK8 A;  4EIP A;  2L4Q A;  3BCI A;  4O5Q A;  3EU3 A;  2QC7 A;  1TRW A;  4MJC A;  1OE8 A;  4HQZ A;  4GRF A;  2LRN A;  1EEM A;  1WE0 A;  5ELA A;  4ZL8 A;  1XOB A;  4GCI A;  2I81 A;  2LRT A;  2ON5 A;  1TKD B;  2VAF A;  4KDY A;  3EC3 A;  4I2U A;  4JBB A;  2V32 A;  3C8E A;  4GWR A;  4TR4 A; 
#chains in the Genus database with same CATH homology
 2KHP A;  4I6X A;  1A23 A;  2RII A;  2YN1 A;  4Z7X A;  1THX A;  10GS A;  4KCA A;  2H1B A;  4XS4 B;  7GSS A;  2V6O A;  3IHG A;  4HU7 A;  3KTB A;  4K2D A;  4ZIL A;  3A3T A;  3HHV A;  2M46 A;  2DC5 A;  3DD3 A;  2C0G A;  2LS5 A;  3RAZ A;  1Z3E A;  1GTA A;  1EV4 A;  2YWN A;  5E4W A;  2VOC A;  4OWY A;  2C1Y A;  4ML1 A;  2VCV A;  1LJR A;  1FO5 A;  2AHE A;  4OCF A;  2QA2 A;  4HUA A;  4HJ2 A;  5GAP D;  2FUG 2;  4FH8 A;  1JZW A;  3FZ5 A;  1XW9 A;  2C3N A;  3A2X A;  5IOW A;  3DVX A;  5HFG A;  3TJK A;  4ECI A;  4XS1 A;  2MMN A;  5E59 A;  3C1R A;  1TP9 A;  1MD3 A;  2GTU A;  3WYW A;  3APO A;  2GZY A;  12GS A;  4KDU A;  4P3Y B;  4ZBB A;  2IIY A;  4CHS A;  1K0B A;  4PXO A;  1PQN A;  2L5L A;  4K5S A;  3UL3 A;  1B4P A;  3PGT A;  2E7P A;  2H6X A;  2CAI A;  3ISO A;  4FQU A;  4NHW A;  2L57 A;  3KZQ A;  3RHB A;  4NHZ A;  1TK0 B;  4AJ8 A;  1KTE A;  1SJI A;  1YZX A;  2HRN A;  1SYX A;  2C3T A;  2QA1 A;  3FKF A;  1PSQ A;  2GVP A;  2X99 A;  1R26 A;  1B9X C;  4LLR A;  3LSZ A;  1IYH A;  2VCX A;  5F8B A;  5G31 A;  2OKA A;  1XXU A;  5IMD A;  3CSJ A;  2GT6 A;  1VF1 A;  4K1F A;  5D9V A;  5ECO B;  1X9W B;  3ZRE A;  3FMW A;  3Q18 A;  3CXG A;  4GF0 A;  2V6K A;  2CA8 A;  1ABA A;  3ED3 A;  4KCE A;  2JZS A;  2VL3 A;  5INY A;  2TIR A;  2GDR A;  2FCH A;  4XRA A;  1ZL9 A;  3HJP A;  3IK9 A;  4XS6 A;  3KMN A;  5D8I A;  2C3Q A;  2ZCT A;  4EXJ A;  4WET A;  3FYG A;  2MBT A;  2XHF A;  4XIH A;  1X9S B;  3UIW A;  4N10 A;  5DAK B;  3EWL A;  2K9F A;  4D73 B;  4IGJ A;  1SK1 A;  1GLP A;  3MNG A;  2MMO A;  2L59 A;  1GWC A;  3IXR A;  2H8L A;  3UMA A;  4YKF A;  3EMX A;  4AGS A;  5ID2 A;  3WGX A;  3EMP A;  2YV9 A;  3F3R A;  3TKS C;  4KDX A;  4MF6 A;  1A2L A;  2KP2 A;  3S9F A;  3QMX A;  4RI7 A;  1B4Q A;  2EIR A;  2BMX A;  1K0M A;  1A8Y A;  1USB A;  2FY6 A;  1TXX A;  1BQ7 A;  4QL7 A;  3SWL A;  3GX0 A;  4MMM A;  3A5I A;  3Q6O A;  3HYP A;  5CRE A;  1XCC A;  3ZFB A;  2RM5 A;  1UN2 A;  4X4J A;  4IP6 A;  2QSI A;  5IMF A;  5HFK A;  1PKW A;  2VM2 A;  4X43 A;  5J9C A;  2P5R A;  3UJ1 A;  4LL4 B;  4POB A;  2OJL A;  2VCT A;  2LKU A;  2TRX A;  4V2M A;  1ON4 A;  18GS A;  1EZK A;  1OAZ A;  2LEG A;  1O6J A;  3WD6 A;  3L9U A;  3F6F A;  2DMM A;  3GIX A;  1WWJ A;  3ZYW A;  1B8X A;  4TVE A;  1URM A;  2L6D A;  1SJ6 A;  4MLY A;  2MZC A;  1V57 A;  2RLI A;  1BYE A;  6GSX A;  5IMZ A;  1XW5 A;  5B6N A;  1B48 A;  1EEJ A;  1GTU A;  4IBP A;  3FY7 A;  5KN1 A;  3GKX A;  5IM9 A;  3I9V 2;  4KW6 A;  3GN3 A;  3F4R A;  2NBS A;  4AF2 A;  2XPE A;  2R0P A;  1RK4 A;  4Q5R A;  2H71 A;  1QFN A;  9GSS A;  3GH6 A;  2GQL A;  3G7J A;  1TDI A;  3F9U A;  1J08 A;  4MK3 A;  3GMF A;  3KGK A;  3KP8 A;  2REM A;  1C72 A;  1K0D A;  3CTG A;  4AJ6 A;  4TN8 A;  1JZD A;  3ZVJ D;  1GSF A;  3Q19 A;  2CZ2 A;  3M3M A;  2NTO A;  3HA9 A;  5ENU A;  1Q4J A;  5ECK B;  4POL A;  4F0B A;  1UVZ A;  4O5U A;  4F03 A;  5KN3 A;  4ZL7 A;  3HVS A;  2R6K A;  3GUS A;  2J23 A;  4TRX A;  4DSR A;  1QQ2 A;  4IS0 A;  3FHK A;  3P8W A;  3DML A;  4XCS A;  4FYB A;  3GKN A;  5CYY A;  3GX8 A;  4GXZ A;  2H74 A;  4K9Z A;  2X4A A;  3DXB A;  2QKE A;  1K0C A;  1M2A A;  4FO5 A;  4GLT A;  3ZIJ A;  2H70 A;  4KSO A;  3KD0 A;  1EGO A;  1PX7 A;  3ZMK A;  4DSS B;  1GP1 A;  2H1G A;  3L9S A;  4WKW A;  3C73 A;  5GZZ B;  1SYR A;  4N30 A;  3TB2 A;  2O85 A;  1Z6M A;  3PH9 A;  4DEJ A;  1YJ6 A;  4KA0 A;  3ME8 A;  5CP1 A;  4O32 A;  5AIV A;  4ZB9 A;  4MZB A;  5ECS A;  3FEU A;  4PQ1 A;  2B5Y A;  4G2E A;  4NXI A;  1SEN A;  4EO3 A;  5A5K A;  3EU4 A;  3OR5 A;  3CRU A;  4RI6 A;  1GNE A;  4CDO A;  4FIW A;  4PQH A;  4K2X A;  1X5E A;  1ZZY A;  1XVQ A;  3NZN A;  4NPB A;  1F37 A;  2H0G A;  4BVX B;  2WZ9 A;  1XWG A;  5F05 A;  2GZZ A;  2H72 A;  5FHI A;  2LST A;  1YKA A;  1HQO A;  2C80 A;  1OKT A;  4EC0 A;  5ABR A;  3EE2 A;  3IE3 A;  3W8J A;  4ZL9 A;  5ECP B;  1S3A A;  2YNX A;  3EYT A;  1S3C A;  4IJ3 A;  1SD8 A;  3QAV A;  2LJR A;  4NV5 A;  3TJB A;  2JSZ A;  3TOT A;  1XPV A;  3GH9 A;  2LV3 A;  4ECC A;  1XWK A;  3GTU A;  2YJ7 A;  2R3X A;  4NMU A;  5JWQ B;  5IPH A;  1SKW B;  4JED A;  1GNW A;  2VLV A;  2ZNM A;  1R5P A;  5DAL B;  1XW6 A;  1K0O A;  5KOX A;  1SD9 A;  2YV7 A;  4ISD A;  4TXV A;  4RQR A;  3U6V A;  1A0R P;  2LJK A;  4MZW A;  3LXT A;  1M2D A;  1TRV A;  5DCG A;  1FW1 A;  14GS A;  1GUH A;  2R4V A;  4KX4 A;  1A24 A;  3G7Y A;  3KXO A;  1MDI A;  4IKH A;  19GS A;  3R3E A;  1GH2 A;  2J9H A;  4N0V A;  5B6M A;  4F0C A;  17GS A;  1EP7 A;  4QL9 A;  2RM6 A;  4HQS A;  4JRR A;  2LQQ A;  5ECR B;  3IPZ A;  2CT6 A;  3ERF A;  5LD0 A;  4MH3 A;  1GSQ A;  1W89 A;  4OD7 A;  2I4A A;  4XHM A;  1OC9 A;  3IHQ A;  4BL7 A;  5EPF A;  3A5W A;  3ERW A;  2WJU A;  4ILF A;  4USS A;  2TRC P;  4TXO B;  4K7I A;  4YKG A;  3MYD A;  3KH9 A;  2DJ2 A;  4A5P A;  4F82 A;  4LL1 B;  1X5D A;  3DIE A;  1S3D A;  2MMA A;  3HD5 A;  1PMT A;  4JZQ A;  1BED A;  1SKS B;  1HYU A;  1OC3 A;  3O3T A;  3C71 A;  2FA4 A;  4ZBD A;  3G9B A;  3TRQ A;  2LRC A;  2WCI A;  4QQ7 A;  2VLU A;  4O5R A;  5L71 A;  5CO3 A;  2LNT A;  4KF9 A;  5H5Q A;  3PPU A;  2RUE A;  1SU9 A;  1F3A A;  2GQM A;  2HZE B;  4BWQ A;  4KGI A;  5DCH A;  2YWO A;  1FB6 A;  1VF4 A;  5J4U A;  4TR1 A;  2H73 A;  3QFA C;  1DUG A;  3J7Y b;  4OFT A;  1XVW A;  2C8U A;  5A4U A;  1W4V A;  3LFL A;  2GST A;  5ECL B;  1TJD A;  3GKK A;  1ZCP A;  2HI7 A;  2HZF A;  5ID2 B;  5G1K A;  2RUF A;  1A2M A;  4PUR A;  2GZP A;  2DKH A;  2GT5 A;  2JAD A;  4LA1 A;  3QAW A;  2AUV A;  1E2Y A;  4YAV A;  3WGE A;  5ECI B;  3A2W A;  3EUR A;  1FG4 A;  5G5F A;  5JWO B;  3VI7 A;  1NHY A;  4X0X A;  2ON7 A;  1BX9 A;  1PN0 A;  4YQM A;  2OA7 A;  1AAZ A;  4KH7 A;  4V2L A;  4POK A;  1GUM A;  4I8B A;  4ECB A;  3FK8 A;  1ZMA A;  3IAM 2;  1ZYN A;  2YWM A;  3VLN A;  4DSQ A;  1AIU A;  2E0Q A;  1Y6E A;  4XS4 A;  1ST9 A;  2YAN A;  2CV4 A;  3GL3 A;  5DJM A;  5J41 A;  2CVD A;  3ZVJ A;  1OYJ A;  1X9M B;  1EV9 A;  1NHO A;  2NDO A;  1PX6 A;  3D4T A;  3BJ5 A;  1SKR B;  2ZUP A;  5JCG A;  2A4H A;  4PUA A;  3E9J B;  3GST A;  4MF7 A;  1CQG A;  2F8A A;  2VIM A;  2WUL A;  3TJJ A;  3HCZ A;  4GSS A;  4KB3 A;  3LGC A;  3LJR A;  2C0D A;  2C0E A;  3ME7 A;  2X49 A;  2MMZ A;  3VFI A;  3VPQ A;  5ECN B;  1XZO A;  2KLX A;  5C00 A;  3CTF A;  4ACS A;  1MEK A;  1KNG A;  2MYG A;  3LQ7 A;  5AGY A;  4K0N A;  13GS A;  2K8V A;  1PA3 A;  3L0H A;  2FLS A;  4Z2T A;  1LU4 A;  2X8G A;  11GS A;  4KSM A;  1EOG A;  1U3A A;  4L5L A;  3N5O A;  3ZLP A;  1FVK A;  4J2F A;  3ZL5 A;  1M9B A;  1U6T A;  2HSH A;  2WS2 A;  1SK2 A;  1CQH A;  2XC2 A;  4K7N A;  3D6I A;  4WF4 A;  1N8J A;  3F4T A;  2V41 A;  5D9X A;  4HS1 A;  3M8N A;  2M72 A;  5IO2 A;  4HU9 A;  2K18 A;  3LWA A;  4F9Z A;  3MDK A;  3QDN A;  2F51 A;  4MPG A;  4YAP A;  5ECM B;  1SL2 B;  3RBT A;  2K8S A;  1TW9 A;  2CVK A;  3W6G A;  4MZC A;  2DJ1 A;  2YWI A;  2FWF A;  2GS3 A;  2R0C A;  3HZ4 A;  2X8H A;  2AV4 A;  3UAP A;  2P5Q A;  3F6D A;  4O92 A;  3US3 A;  4V2N A;  1PRX A;  3G7I A;  1SJZ A;  4ULX A;  3NIV A;  5A4V A;  4TKY A;  3QFB C;  3D22 A;  2IMD A;  3F8U A;  4MJE A;  3IC4 A;  1M0U A;  5F06 A;  4HI7 A;  5IIZ A;  3KTL A;  3H8Q A;  5DVB A;  3GKM A;  2JZT A;  4D73 A;  3PIN A;  4KAE A;  4BVY A;  3JCM L;  1K3O A;  4K5R A;  1Y25 A;  3KH7 A;  4IN0 A;  4IVF A;  1T4Z A;  2I3Y A;  3IAS 2;  1GSU A;  2FNO A;  4HEA 2;  4Q5Q A;  6GSW A;  2H6Z A;  5IO0 A;  2PWJ A;  3FR6 A;  2VO4 A;  3TDG A;  4MA9 A;  1PKZ A;  3ZIT A;  1HNC A;  2H30 A;  5ECQ B;  3L4N A;  3FZ9 A;  2VL2 A;  1T3B A;  3GNJ A;  2DJ3 A;  1TTZ A;  3VWU A;  2VD0 A;  2B6M A;  1GTB A;  4LMW A;  3D0Z A;  2XBI A;  3VWV A;  1JHB A;  2PU9 C;  1JLV A;  1FVJ A;  1BJX A;  5B7C A;  3U5R E;  4IW9 A;  1WJK A;  2XBQ A;  5FWG A;  5GAN D;  2L5O A;  1OVN A;  2WRT A;  2CZ3 A;  2FD3 A;  3ZRD A;  4EDY A;  3K8N A;  2VM1 A;  2JAC A;  3GTU B;  4NV2 A;  1E6B A;  2IWT A;  4OMV A;  5G30 A;  5AN1 A;  4V1A p;  5DQS A;  3TKP A;  1TK5 B;  2OBK A;  1QMV A;  3LOR A;  3CRT A;  1K3L A;  3IRA A;  2B7K A;  2VCQ A;  5LNK e;  2H75 A;  4GQF A;  1XBS A;  1VGL A;  4I2T A;  1HNB A;  2VLT A;  2A2P A;  2LTK A;  2EC4 A;  3QAG A;  1WIK A;  4L5O A;  3LEF A;  4Q5N A;  3APS A;  2BJX A;  4EUY A;  2DIZ A;  1DE2 A;  1VF3 A;  5IQY A;  3C7M A;  2H0I A;  20GS A;  5KEJ A;  2CX4 A;  2OE3 A;  5DJL A;  1MTC A;  4MAB A;  4HOJ A;  2VUP A;  4G0K A;  2A2S A;  2P0G A;  4HZ2 A;  2R2J A;  5GST A;  1H4O A;  3ZZX A;  1V58 A;  5CNW A;  2OAD A;  2IFQ A;  3H93 A;  2VD1 A;  3TOU A;  1TRU A;  1XWC A;  2KOK A;  4EKZ A;  2IJY A;  3CMI A;  1M7T A;  3TCO A;  2IME A;  2FWH A;  5HR1 A;  1OC9 B;  4BWS A;  3UAR A;  5G1L A;  5IMA A;  2R37 A;  4G0L A;  2K6V A;  1U3I A;  2PER A;  3QCP A;  4L0W A;  5CRH A;  5HR2 A;  4CY8 A;  4HJM A;  2JZR A;  3E0U A;  5BRT A;  3PR8 A;  4G9H A;  4ICY A;  6GSV A;  16GS A;  4IEL A;  4NAX A;  1RW1 A;  3F4S A;  2D2Z A;  1YDK A;  2QGV A;  1N2A A;  5D9T A;  1TU7 A;  1V2A A;  2HLS A;  2IMI A;  2H6Y A;  1G0T A;  5GSS A;  4ID0 A;  3Q74 A;  4PX1 A;  4ZB8 A;  3QD9 A;  3UOM A;  4FYU A;  4MF5 A;  3F3Q A;  3MSZ A;  3MIX A;  4G0I A;  5HFI A;  4CW9 A;  4XTS A;  1ML6 A;  4YH2 A;  4MH2 A;  4WF5 A;  1PN9 A;  4DSS A;  3CSI A;  4TR1 B;  1TI3 A;  3D4M A;  3ZML A;  1Z7R A;  2G2Q A;  2N5F A;  2YPM A;  2HRF A;  2B7J A;  1SL0 B;  3I6A A;  1WP0 A;  1M2B A;  4G10 A;  4EF0 A;  1X5C A;  1TK8 B;  5KOW A;  3HY2 A;  3TKR A;  1G7E A;  1GSD A;  3A2V A;  2YOI A;  3W8S A;  1ACV A;  2HT9 A;  2B3S A;  3H79 A;  2GSS A;  1DSB A;  2F3M A;  4TR3 A;  4ZXG A;  4XRD A;  4IQA A;  4IJI A;  3F0I A;  3TGZ A;  5CRW A;  1DBY A;  1QXH A;  5J9B A;  1K0N A;  2HRK A;  2G0F A;  1XFL A;  3EPT A;  4IQ1 A;  1SL1 B;  5IMC A;  4BVX A;  1O81 A;  1ZOF A;  3HJO A;  5COH A;  2O8V B;  1J0F A;  3LG6 A;  3VUR A;  4YQV A;  1OKD A;  4OO4 A;  1J9B A;  4ZIJ A;  3LYP A;  2A2R A;  2H01 A;  5HR0 A;  1AUC A;  3KEB A;  1AW9 A;  3HKR A;  2HE3 A;  5IPG A;  2CAQ A;  3H4K A;  1EOH A;  5F0G A;  4MDC A;  1JLW A;  3EVI A;  4MNN A;  3MWH A;  2OE1 A;  1F3B A;  1G6Y A;  4RQX A;  4K7O A;  3GYK A;  3KM6 A;  5EY6 A;  3IDV A;  2F9S A;  5DAL A;  3TUE A;  3BCK A;  2KP1 A;  2L4C A;  5AIS A;  6GSS A;  4PNF A;  1GSE A;  4EIQ A;  3IBH A;  5HR3 A;  5CAX A;  1KEB A;  1OE7 A;  3P2A A;  4KUN A;  4WEY A;  4X1U A;  2O87 A;  4RUV A;  1A0F A;  5H5R A;  2WGR A;  2R0G A;  1TRS A;  2VL2 C;  1MDJ A;  2O89 A;  2V1M A;  2LUS A;  3P7X A;  3M1G A;  3IOS A;  1WPI A;  3GSS A;  2OBI A;  1G7O A;  5DQY A;  3NOF A;  1FAA A;  2H19 A;  4YQU A;  4K8M A;  2HSY A;  3RPP A;  1X0R A;  4ZB6 A;  5D9W A;  2FHE A;  4J56 E;  2YJH A;  2M80 A;  1ZYQ B;  4OFM A;  5AIX A;  3P90 A;  4N11 A;  3TJF A;  4MP4 A;  4MCU A;  3L9V A;  4GTU A;  3O6T A;  1GTI A;  2MBS A;  2H66 A;  2PVQ A;  4NWY A;  4TXO A;  1GL8 A;  1GSY A;  4JR6 A;  3LW9 A;  2JSY A;  1HNA A;  3IK7 A;  1ILO A;  1HD2 A;  2IPA A;  1NW2 A;  1YQ1 A;  2BTO T;  3HDC A;  5EL8 A;  1R4W A;  2V2G A;  3UVH A;  2WDU A;  4F2I A;  2AAW A;  2DLX A;  2GLR A;  1OC8 A;  1YY7 A;  1KBN A;  2PPT A;  3FRC A;  3TKQ A;  4OCE A;  2H1D A;  2FWG A;  1F6M C;  1SK0 A;  3DWV A;  5G5E A;  3ZFL A;  3GA4 A;  4EE0 A;  1V98 A;  8GSS A;  1Z5Y E;  3HZ8 A;  1XWB A;  4POM A;  2PUK C;  3O76 A;  1AQW A;  2OAC A;  4BPY A;  2HZE A;  1AXD A;  1ZYP A;  3M9K A;  4GQC A;  5F07 A;  2R5G A;  3H1N A;  2JU5 A;  4TW5 A;  1PL1 A;  1THO A;  4OFN A;  1PL2 A;  3GRX A;  2CVB A;  1GLQ A;  3DGQ A;  5ECH B;  3IA1 A;  1LBK A;  4ML6 A;  4BVY B;  2GQK A;  3GV1 A;  2LJA A;  2N5A A;  3HVV A;  1BAY A;  2FWE A;  3BOA A;  3QR6 A;  2EIO A;  5J3R A;  4ZBA A;  2HRA A;  3TRP A;  1T7P B;  3HXS A;  4N0Z A;  3L78 A;  5CRD A;  4WR5 A;  3WT1 A;  1FB0 A;  3D21 A;  3J7Y k;  2PMT A;  4TR0 A;  1O73 A;  4GSN A;  2PGT A;  3FW2 A;  2DML A;  1B9Y C;  5LCZ A;  3HJM A;  5KN0 A;  1T4Y A;  2DJK A;  3UEM A;  2AJQ B;  2HFD A;  3LXZ A;  1TI1 A;  2FA8 A;  3C1S A;  1O8X A;  2L6C A;  3DEX A;  5D73 A;  4K6X A;  4E8H A;  1AQV A;  2PBJ A;  4WXT A;  1NSW A;  1QUW A;  4CY6 A;  2B1L A;  5FT3 A;  1RQM A;  1XIY A;  3VPT A;  3I43 A;  1YF1 A;  2C0F A;  2B5X A;  2UZ8 A;  2E2G A;  1NM3 A;  3FZA A;  1WMJ A;  4J57 E;  3AY8 A;  6GSY A;  3DKS A;  3R2Q A;  2IMK A;  2IMF A;  1R7H A;  1T00 A;  1V9W A;  1JZO A;  1DE1 A;  3TRX A;  3UVT A;  1WOU A;  2LNS A;  1O85 A;  4PUF C;  2ALB A;  4KND A;  4IHU A;  1XWA A;  5HQP A;  3GUR A;  2OE0 A;  5IOX A;  3KP9 A;  5B8B A;  1ZYE A;  4IP1 A;  3ZTL A;  5DBQ A;  1Q98 A;  2P31 A;  3QPM A;  4PTS A;  5JWR B;  4HDE A;  2HNL A;  5DAK A;  3FR9 A;  2X64 A;  3M0F A;  1FOV A;  3WT2 A;  1YEX A;  4WR4 A;  1PGT A;  3DVW A;  4PGT A;  4KE3 A;  6GSU A;  2IFQ B;  3IR4 A;  2AYT A;  1K0A A;  1BG5 A;  4PQI A;  3SBC A;  3VWX A;  4EVM A;  3F63 A;  4EDZ A;  1EWX A;  2C4J A;  3CBU A;  1U87 A;  5ELG A;  1ERV A;  2Z9S A;  2HYX A;  3KIJ A;  3EIN A;  2NPB A;  3RHC A;  2VCW A;  4MPF A;  1EP8 A;  5H5S A;  3I69 A;  2E2M A;  2H0H A;  1WRY A;  1F2E A;  2GGT A;  4MJA A;  2HXK A;  5JCU A;  4O7H A;  1GSS A;  1ZGN A;  4FYC A;  2H1A A;  4H86 A;  1FHE A;  1IYI A;  1H75 A;  3V1W A;  3BD2 A;  1XOA A;  2IL3 A;  2DSA A;  1MDK A;  3GL5 A;  2VL9 A;  3ERG A;  3FR3 A;  4K0G A;  4WBR D;  6GST A;  4I5Q A;  1I5G A;  2YP6 A;  1JZR A;  1UC7 A;  4JE1 A;  4DVC A;  2DJJ A;  2X8C A;  2N5B A;  1F9M A;  3KCM A;  4E8E A;  4GST A;  2DKI A;  2YZH A;  3HVX A;  5A4W A;  3BBY A;  2PN8 A;  5EVO A;  5BMU A;  4L0U A;  4Q5F A;  3RPN A;  1O7U A;  3UBL A;  5B8A A;  5IMV A;  4HZ4 A;  1YEP A;  1VRS D;  2EIQ A;  3WGD A;  4ECJ A;  3CSH A;  1R5A A;  2I9H A;  3DYR A;  1V40 A;  1G6W A;  1A8L A;  3FZ4 A;  2IN3 A;  2YCD A;  1AQX A;  2F8F A;  22GS A;  2AB6 A;  1UA5 A;  3N9J A;  3M9J A;  5KN2 A;  4MJB A;  4JU5 A;  2DJ0 A;  4OO5 A;  2JL4 A;  2A4V A;  3TKS A;  4V1A g;  1TOF A;  2GSR A;  4BL7 B;  1AC1 A;  5JCW A;  1K3Y A;  2O7K A;  3TJG A;  1GRX A;  2XPD A;  1FOH A;  4JR4 A;  3TKS E;  1Z9H A;  1T8E B;  2WB9 A;  4LMV A;  2CQ9 A;  2CX3 A;  2WFC A;  4WBJ A;  1Z6N A;  2I1U A;  3DRN A;  4I97 A;  3MAK A;  1QGV A;  2ES7 A;  2GSQ A;  4G19 A;  4EL1 A;  1VF2 A;  1TU8 A;  1JFU A;  4Z2R A;  3KMO A;  5D96 A;  3D5J A;  5DDL A;  1EGR A;  2VCZ A;  2DIY A;  3VK9 A;  1PD2 1;  2NVL A;  1ERT A;  4Z2U A;  3UBK A;  1YF0 A;  2DBC A;  1ERU A;  1M9A A;  2PVO C;  3KJY A;  1U88 A;  2KUC A;  1Z7P A;  3GFK A;  2FGX A;  3CYN A;  1YKC A;  1ERW A;  3IC8 A;  3APQ A;  1I9D A;  2B1K A;  4AJ7 A;  1GUL A;  5D93 A;  3VI5 A;  3RDW A;  3QOU A;  2YZU A;  4PNG A;  1GUK A;  4TOP A;  5CRG A;  5G2Z A;  5C04 A;  3GHA A;  2HSM A;  2H76 A;  1MD4 A;  3E3E A;  1A2J A;  1T1V A;  2LQO A;  3VWW A;  4BA7 A;  1M99 A;  2B5E A;  3LYK A;  1O8W A;  3ZIV A;  5J5N A;  3IV4 A;  4L8E A;  1QK8 A;  4EIP A;  2L4Q A;  3BCI A;  4O5Q A;  3EU3 A;  2QC7 A;  1TRW A;  4MJC A;  1OE8 A;  4HQZ A;  4GRF A;  2LRN A;  1EEM A;  1WE0 A;  5ELA A;  4ZL8 A;  1XOB A;  4GCI A;  2I81 A;  2LRT A;  2ON5 A;  1TKD B;  2VAF A;  4KDY A;  3EC3 A;  4I2U A;  4JBB A;  2V32 A;  3C8E A;  4GWR A;  4TR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...