1FG4A

Structure of tryparedoxin ii
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
145
structure length
145
Chain Sequence
SGLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPCRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDFPWPNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPAREDOXIN II
publication title Structures of tryparedoxins revealing interaction with trypanothione.
pubmed doi rcsb
source organism Crithidia fasciculata
molecule tags Electron transport
total genus 45
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1fg4A00
2H30A 1U88A 2WGRA 4LLRA 1YQ1A 1SK1A 4GTUA 3FR3A 2FWFA 2XHFA 4GQFA 3QR6A 1TP9A 2O89A 3ED3A 1ML6A 4YAPA 1KTEA 1OVNA 1FHEA 4TW5A 1UVZA 2H19A 4ZB6A 1AAZA 1GTIA 4EC0A 1XWBA 1SK2A 1JZOA 4O32A 3DMLA 5F8BA 2H76A 2D2ZA 2AHEA 1RW1A 2IN3A 4TXVA 4V2NA 3QFAC 2LTKA 4HUAA 3FRCA 4L0WA 4NPBA 1ERUA 1B9YC 3UIWA 5A4WA 1EGOA 2CA8A 3G9BA 5J9CA 3DVWA 1TTZA 4GLTA 5EY6A 5HQPA 2RUFA 1TOFA 4WBJA 2K6VA 2OBKA 2V6KA 1Q4JA 3DGQA 3GNJA 1V9WA 2C3QA 1FOVA 5G5FA 1H75A 5AN1A 3Q74A 3F9UA 2RLIA 3KP9A 3HXSA 3G7YA 2FLSA 4F2IA 2C4JA 1GSEA 2BJXA 2E0QA 2H0HA 3KZQA 1BYEA 1YY7A 1VRSD 3ERWA 5B8BA 3RHBA 5ECRB 4KE3A 1EZKA 3RAZA 3TB2A 2MMZA 1VGLA 1I9DA 1GWCA 2ZCTA 1GUKA 4EXJA 2Z9SA 2GSRA 2LQQA 1GNWA 3ZREA 3C8EA 3L9SA 3P8WA 3LORA 3H79A 3IOSA 3CSIA 4ZB8A 3CRTA 2PN8A 1JZWA 2QKEA 2YZUA 4NV2A 5ID2B 4HOJA 5AIVA 1RQMA 1UC7A 4ZXGA 1GL8A 4XS4B 1K0AA 3QCPA 4OFNA 2ZUPA 3F4RA 4QL9A 2XC2A 1GUMA 1G7EA 3DWVA 1PRXA 1FW1A 3FKFA 1XVQA 11GSA 3IK9A 4MCUA 5INYA 4FIWA 1M99A 4RI6A 1YDKA 3WYWA 4I2UA 3TRXA 1XWGA 5GAND 2OJLA 3HKRA 2K8VA 1SD8A 4AJ8A 2TRXA 1I5GA 2R5GA 4EO3A 1OE7A 2FUG2 2JADA 4PUFC 3GIXA 2YP6A 5HFGA 5LNKe 3EE2A 4NHWA 1XWAA 2L59A 1AXDA 3H93A 4G10A 2VL9A 4I5QA 1TI3A 2KUCA 4F03A 1B9XC 4DVCA 2REMA 4E8HA 2X99A 3KH9A 1XW6A 3KP8A 2ES7A 3HDCA 5GSSA 2C0GA 3BD2A 2X8GA 3L9VA 4ULXA 2C3NA 3GL3A 1O85A 4JBBA 3TRPA 2IMIA 4TR1B 2N5BA 4Q5NA 1ZL9A 2JACA 2MYGA 3IA1A 4JZQA 2VD0A 1YEPA 2FCHA 3CSHA 5G31A 3G7JA 2EIQA 3EWLA 1K0OA 3V1WA 4WR5A 1HNAA 3UVTA 2H0IA 1Z9HA 1PGTA 2P0GA 3P90A 5J41A 1ILOA 1PL1A 1TXXA 1PSQA 3P7XA 2DJJA 1XCCA 5IMCA 5D8IA 5ECOB 2GLRA 5CO3A 3CXGA 4K6XA 2KP1A 1SU9A 5IOWA 1DSBA 3ZIVA 4HJ2A 4WETA 4EL1A 4IS0A 3CYNA 2G0FA 3UL3A 3LJRA 3BBYA 2DJ1A 2GVPA 4D73B 2VLUA 5H5RA 5LD0A 3VI7A 1XFLA 1ZYQB 1FVJA 3ERFA 4MF7A 5COHA 4P3YB 2C80A 2FGXA 4O7HA 2H1AA 1H4OA 1QMVA 1O7UA 2ON7A 3QMXA 5G30A 3ZYWA 3RHCA 2A2SA 2C1YA 5CREA 1X0RA 3DVXA 4N0VA 4J57E 5D93A 3UBKA 4K2DA 2NDOA 1N8JA 1JLVA 3VURA 2LJAA 4GCIA 4RUVA 2IL3A 5KN0A 4MZBA 5B8AA 2FA8A 2MMNA 3VPTA 4ISDA 2R3XA 2LQOA 2GQMA 4KX4A 5D9WA 18GSA 1OKDA 4XRAA 4Q5QA 1TRWA 2B5XA 3VK9A 1X9WB 3QPMA 5FT3A 2JSYA 2RM5A 2O7KA 2E2MA 5IMAA 1YEXA 2CVDA 2LUSA 4OWYA 3ZIJA 4XS6A 3HJPA 3LQ7A 3FK8A 1O73A 4ACSA 4MABA 6GSYA 5JCWA 5KN1A 3IPZA 4K7OA 3TJJA 2MMAA 2PWJA 5G1KA 4MH3A 3GKMA 5L71A 3TOTA 2DJKA 5LCZA 2M72A 4JEDA 5DQSA 1PX7A 1QGVA 1U3IA 3G7IA 3IV4A 4Q5FA 2VLVA 3E0UA 4MJBA 2PGTA 5C00A 3I9V2 4ZL9A 3L78A 5DALA 4GF0A 3GYKA 4OCFA 1A23A 5ECQB 1C72A 2YWMA 3ISOA 1EV9A 2NTOA 4XIHA 4GSSA 2H6ZA 3M1GA 4NMUA 5ID2A 3VWVA 4KUNA 1EEMA 4OFMA 20GSA 2GS3A 4XS4A 4TRXA 3AY8A 1MEKA 2CV4A 3KTLA 2EIRA 1TW9A 4XRDA 1XBSA 2NBSA 5JCUA 3KTBA 4I97A 1THXA 1XIYA 4BWQA 4K1FA 5HR1A 3WT2A 2VD1A 3GKKA 1UN2A 1A2MA 5H5QA 3ZLPA 3IRAA 4DSSB 4WF5A 4CHSA 2LJKA 1AIUA 1GTBA 5HR2A 3TCOA 3LSZA 2IFQB 4OFTA 5IPHA 1MTCA 3ZZXA 2YCDA 1B4PA 3U5RE 3IC4A 3CTFA 4ZIJA 4WEYA 3F6FA 1PKZA 4IKHA 4KDUA 1KEBA 1U87A 1R5PA 1A8YA 5CRWA 3GFKA 1M0UA 3FZ5A 1BAYA 3KMNA 1SL1B 2H6YA 4TR4A 1T3BA 2L6DA 3FHKA 2IMEA 1XOBA 3DYRA 3MSZA 4TR1A 2HZFA 4HDEA 1YJ6A 1XOAA 5ELAA 1TRSA 5D9TA 2YV7A 4HQSA 1TU8A 4N30A 5G1LA 4IQ1A 1S3DA 3LFLA 3FR9A 2M80A 1O8WA 3UARA 2TRCP 2L57A 3OR5A 1CQGA 4L8EA 3GKNA 4FYUA 3KEBA 1G6YA 4YH2A 3WGEA 3M9JA 2IJYA 1W4VA 5IMFA 5EPFA 4KCAA 3W8SA 3BCKA 2O8VB 1F37A 5B6NA 1AC1A 5C04A 3FEUA 1B48A 4D73A 4KH7A 2L5LA 4YQVA 1ZGNA 2LNSA 5FHIA 1WRYA 2KLXA 1K0BA 2WJUA 1OC8A 4ZBBA 2XBIA 3BOAA 2V41A 4OD7A 3ZFLA 2VCQA 3RBTA 5DVBA 5D9XA 1G0TA 2DJ3A 2VL3A 4FH8A 2GGTA 4IP6A 2H01A 1BEDA 3A2XA 5ECKB 1R5AA 5ECIB 3F3RA 3C1SA 2VOCA 6GSVA 2BTOT 4K8MA 1SJIA 1PKWA 4MZCA 1SL2B 4N10A 2EC4A 2H8LA 4CDOA 3FZ9A 2E7PA 2E2GA 1Z6MA 3IBHA 5H5SA 2K18A 3LYKA 3KH7A 4MMMA 2FY6A 3TKRA 3RPNA 4NV5A 3RDWA 2LSTA 2I9HA 2HZEB 2JSZA 5D73A 3MAKA 5F06A 1R7HA 1TI1A 6GSXA 2R37A 2LKUA 3CTGA 1GSSA 2WULA 2CQ9A 2OE3A 2O87A 3FW2A 4HU7A 1V58A 4KNDA 2I4AA 3TJGA 2H73A 1GTUA 2CVBA 4X43A 4PQIA 1Z7PA 5AISA 4PGTA 3TKPA 5CP1A 4PXOA 4PNFA 3I6AA 5ABRA 14GSA 4OMVA 2CT6A 2HXKA 1V2AA 3GKXA 2HRFA 4I8BA 4YQUA 3ZVJA 3SWLA 1LJRA 1TJDA 1B8XA 6GSUA 3EMPA 2F8AA 1DE2A 4QL7A 2QSIA 4K0GA 2VAFA 2OE1A 1BQ7A 3GV1A 2LRCA 2H72A 1PD21 5CYYA 3R2QA 4MA9A 2B1KA 3FR6A 3C7MA 2LRNA 5JWRB 2H74A 4DSSA 1JHBA 4JR4A 1WE0A 4ZL7A 4KAEA 4DSQA 2H75A 2B3SA 4KGIA 4IJIA 3WGDA 1KNGA 3GRXA 8GSSA 4MP4A 2C0EA 4PX1A 4N0ZA 4K0NA 3HJOA 2GDRA 2RM6A 3DD3A 2VCXA 1U6TA 2JZSA 4PQ1A 3FZAA 4Q5RA 1KBNA 3Q19A 5A4UA 4ECCA 3VWWA 3APQA 1ACVA 3L9UA 2RIIA 4IHUA 2QC7A 3IK7A 2HRNA 3QAGA 2WFCA 3HVXA 3PR8A 2TIRA 4TKYA 4KSOA 4O92A 2V32A 3DRNA 5HFIA 1S3CA 5IQYA 3UJ1A 2WRTA 5G2ZA 2IIYA 1EV4A 1FVKA 4F9ZA 2F9SA 1NHOA 3BCIA 4GSTA 3IXRA 1GLPA 5EVOA 5ECSA 1SJZA 4DSRA 2GT5A 2PU9C 3GX8A 1NW2A 3LXZA 4MLYA 3E9JB 2HSYA 3F6DA 2VO4A 3KM6A 3GURA 3TOUA 1Z7RA 3LGCA 2F51A 4ZB9A 5J9BA 4HS1A 3E3EA 1QFNA 3HZ8A 1XXUA 1XVWA 3CBUA 3J7Yb 1F3AA 2VCWA 1DBYA 1DE1A 2ZNMA 1Z3EA 5F05A 2WS2A 3UBLA 3UAPA 1O8XA 2K8SA 4GXZA 4GRFA 1OC9B 3TKQA 5DAKB 4LMVA 3ZMLA 5D9VA 2X8HA 1YF1A 2DBCA 1TK5B 1MDIA 4LMWA 3F4TA 1VF2A 4POLA 3ZFBA 4MH2A 4TXOB 1EEJA 1LU4A 2YZHA 2PPTA 4AJ7A 4G2EA 1SKWB 3JCML 3D22A 4GQCA 4ZBAA 4HI7A 1Q98A 3UEMA 3TKSC 5KEJA 1OE8A 3HZ4A 1K0MA 2MZCA 1GSUA 3PGTA 4KSMA 1DUGA 2FNOA 1T1VA 2H1BA 1T4ZA 3M9KA 3DIEA 1K0CA 3W8JA 2GZZA 3A5WA 4XS1A 1PMTA 2HZEA 2X64A 1HNBA 1AW9A 1Y25A 4WF4A 2K9FA 2KOKA 3LYPA 4KDYA 5IM9A 1X9MB 4EUYA 1WPIA 1EOHA 4MDCA 5F07A 2I81A 2GQKA 3GSTA 2P5QA 3PINA 4KB3A 1S3AA 5HR3A 1GLQA 5DJLA 3IR4A 1TRUA 5DCHA 3LWAA 1NHYA 3TJBA 2J9HA 4MZWA 3WD6A 2LEGA 3GMFA 1YZXA 2L5OA 2OBIA 2DLXA 1JZRA 1XWKA 5J5NA 3EYTA 3MWHA 2VCZA 2GZPA 5IIZA 3FZ4A 4IW9A 5B6MA 3VPQA 4MF6A 1A0RP 1FB0A 1SKRB 5EL8A 4ECJA 1E6BA 1VF4A 1IYHA 3J7Yk 4JE1A 2I1UA 5FWGA 2R4VA 3D5JA 6GSTA 1F3BA 1UA5A 1USBA 3ME8A 1VF3A 5DDLA 1F6MC 1QQ2A 5DBQA 5IMDA 1Z6NA 1V98A 4ML1A 1TDIA 3TGZA 1T4YA 3TUEA 3QAWA 19GSA 3VLNA 4POKA 2H6XA 3QFBC 2AV4A 2JZTA 1MD4A 2CAIA 16GSA 3ZL5A 1Y6EA 4WXTA 1T00A 1F2EA 5JCGA 4TN8A 1GRXA 5CRDA 2R6KA 1GSYA 1QUWA 3KIJA 4BA7A 5IMZA 4ML6A 2JZRA 3EC3A 1ERTA 1EP7A 4WR4A 3US3A 2DSAA 2VM2A 4I2TA 4HJMA 2LRTA 1R4WA 1QK8A 4OCEA 2HSHA 3D21A 2MBSA 3HYPA 3IAM2 1ZYEA 2PVOC 3ERGA 3O6TA 3K8NA 4EKZA 3HCZA 1YF0A 4L0UA 2GQLA 1THOA 2P31A 1A8LA 3UOMA 2OE0A 3WT1A 2FWGA 1N2AA 2WB9A 4TR0A 2YWOA 4ID0A 2HE3A 4JU5A 4V2MA 3EU3A 3GUSA 3CSJA 2NVLA 3W6GA 3GH6A 3KMOA 4WBRD 1O6JA 3GHAA 4ECIA 1M2AA 2LNTA 1SKSB 4V2LA 5KN3A 1A2LA 2L4QA 2PVQA 2MMOA 1TU7A 1AUCA 5ECLB 2DIZA 1OAZA 2YPMA 4FYCA 4BVXA 1OC9A 4LA1A 5DAKA 2C3TA 1PL2A 2OA7A 2VCTA 2B5YA 3ME7A 2AUVA 1YKAA 2GZYA 3MNGA 1TRVA 2B5EA 4TXOA 5IO2A 4EVMA 3HVSA 2NPBA 5D96A 4POMA 1SYRA 2GT6A 4RI7A 4IGJA 2DMLA 2KP2A 4NHZA 1GSFA 2B6MA 3IHQA 3A2VA 17GSA 1XWCA 2VM1A 3D6IA 4J2FA 4G9HA 1OYJA 3IAS2 3ZVJD 2N5FA 3H1NA 3NOFA 1ZOFA 1Z5YE 2YWIA 3HD5A 1CQHA 3S9FA 1GSDA 2HI7A 3GA4A 2CVKA 2H66A 3NZNA 4Z7XA 4BWSA 4NAXA 2L6CA 5JWOB 3EVIA 1MDKA 2X8CA 3HA9A 2FD3A 4O5RA 2EIOA 3QD9A 5ECPB 2GSQA 2OACA 2DIYA 1XW9A 1SYXA 2C0DA 3VWXA 1IYIA 9GSSA 1M2DA 2GTUA 3SBCA 1WJKA 4F0BA 2VUPA 13GSA 2A2RA 1W89A 1MDJA 2FWEA 1X5CA 7GSSA 2DJ2A 2H1DA 2YNXA 3APSA 5ECHB 2J23A 4YQMA 1E2YA 4TR3A 4DEJA 5G5EA 3EINA 3KXOA 3BJ5A 1K3LA 4IN0A 4AJ6A 3HVVA 4J56E 4CW9A 4MJAA 2VL2C 1JFUA 1SENA 4HU9A 1FG4A 5CRHA 4RQXA 1NSWA 4MK3A 1OC3A 5DALB 1SL0B 1ZZYA 3Q18A 4L5OA 4MJEA 3EURA 1ST9A 3P2AA 2HFDA 2H0GA 4OO4A 4GSNA 3TJKA 4MPFA 3LG6A 3TKSE 1T7PB 3LEFA 2FWHA 2IFQA 2DJ0A 2LJRA 1K0NA 4EDZA 1G6WA 4LL4B 1J0FA 1SD9A 5A4VA 4V1Ap 1ON4A 1A0FA 3O3TA 4QQ7A 3TKSA 6GSSA 1WMJA 3F3QA 4F82A 4G19A 4TOPA 2YN1A 4EE0A 4HQZA 3ZTLA 4AF2A 2OADA 4WKWA 2F8FA 5IPGA 2F3MA 1EOGA 4IP1A 4FYBA 3HHVA 5A5KA 1OKTA 3H4KA 4XHMA 1M9AA 2CAQA 1EWXA 2V6OA 3A3TA 1GTAA 1M2BA 1G7OA 3I43A 3KJYA 4FO5A 2A4VA 5HR0A 5ECNB 3GTUB 4HEA2 4RQRA 1FO5A 1XPVA 1AQWA 1YKCA 3C1RA 1XZOA 2VCVA 3CRUA 1WP0A 1EGRA 2IMKA 5KN2A 5IO0A 2G2QA 1ABAA 4IJ3A 4ZILA 5CNWA 10GSA 2IPAA 2AJQB 4K7NA 4JRRA 4ILFA 5IMVA 2HLSA 1GSQA 3DXBA 1K0DA 1GH2A 1RK4A 2JU5A 3NIVA 3ZITA 1PX6A 1BJXA 1F9MA 5J4UA 1M7TA 1WOUA 3APOA 4K9ZA 2DMMA 1PQNA 3WGXA 2C8UA 1JLWA 4EF0A 4KA0A 4X0XA 2YJHA 4L5LA 1O81A 5F0GA 3F63A 4JR6A 1A24A 3C73A 1ERVA 4PURA 4LL1B 4MJCA 4NWYA 4N11A 3ZMKA 3LXTA 4XTSA 3DKSA 1GNEA 3TJFA 5HFKA 3H8QA 1WWJA 2CZ2A 2WCIA 1QXHA 3IDVA 3L0HA 2HT9A 1FB6A 1LBKA 1HYUA 5ELGA 4OO5A 1J08A 3UMAA 3QAVA 3FYGA 5DQYA 2LS5A 2WZ9A 4K7IA 4GWRA 1WIKA 2CX4A 2MBTA 3RPPA 3F8UA 4IQAA 2N5AA 3O76A 4MF5A 1ZCPA 4HZ2A 5J3RA 2CZ3A 1BX9A 5GSTA 1X5DA 2IMDA 4BPYA 2LV3A 2WDUA 4IELA 1V57A 3Q6OA 2O85A 2C0FA 3VWUA 2IWTA 3ZRDA 1FAAA 2DC5A 1T8EB 5IOXA 5AGYA 2FA4A 6GSWA 5E4WA 2VIMA 3M3MA 3C71A 2R2JA 3HJMA 1SJ6A 2V2GA 2AB6A 2PBJA 1HNCA 5GAPD 2IMFA 1J9BA 2GSSA 2H71A 4ZBDA 1URMA 3D4MA 5GZZB 2AAWA 22GSA 2HNLA 4XCSA 2YJ7A 1NM3A 4HZ4A 3GH9A 4KDXA 4IBPA 4ZL8A 1TKDB 1TK0B 1HQOA 4I6XA 3F4SA 4PNGA 2ALBA 3A2WA 3KD0A 1ERWA 2H1GA 2PERA 3VFIA 4KW6A 2XPEA 3TRQA 3D4TA 4MPGA 3HY2A 1M9BA 5ECMB 4V1Ag 3TDGA 2P5RA 2I3YA 4ECBA 2BMXA 5ENUA 2V1MA 4BL7A 3QOUA 2YWNA 3FY7A 2YANA 4NXIA 2PUKC 2M46A 1X5EA 3VI5A 2PMTA 1PA3A 1VF1A 3DEXA 2YV9A 3D0ZA 1EP8A 1K3YA 1B4QA 5CAXA 3EMXA 3KCMA 4AGSA 2CX3A 4YAVA 3CMIA 1TK8B 2GSTA 3N9JA 2YOIA 2JL4A 3L4NA 5JWQB 4H86A 1AQVA 3GL5A 1AQXA 1PN9A 2L4CA 3M0FA 2XPDA 2KHPA 4EDYA 3GTUA 3PH9A 4BVYA 1GP1A 3UVHA 2RUEA 3QDNA 2H70A 5DCGA 4IVFA 4PUAA 2QGVA 1JZDA 1BG5A 3KGKA 2HYXA 1XW5A 3MDKA 2XBQA 2OKAA 1X9SB 1U3AA 1K3OA 1GULA 4X1UA 3EU4A 3I69A 3U6VA 4PQHA 1MD3A 1V40A 4POBA 2B7JA 2FHEA 5B7CA 4KCEA 4E8EA 5CRGA 1GUHA 3N5OA 1R26A 1ZMAA 3F0IA 1HD2A 2B1LA 1A2JA 5DJMA 3IE3A 2VLTA 1SK0A 4TVEA 3GN3A 3GX0A 2AYTA 5AIXA 2B7KA 3M8NA 2VL2A 5E59A 2ON5A 4F0CA 12GSA 3GSSA
chains in the Genus database with same CATH superfamily
2H30A 1U88A 2WGRA 4LLRA 1YQ1A 1SK1A 4GTUA 3FR3A 2FWFA 2XHFA 4GQFA 3QR6A 1TP9A 2O89A 3ED3A 1ML6A 4YAPA 1KTEA 1OVNA 1FHEA 4TW5A 1UVZA 2H19A 3MIXA 4ZB6A 1AAZA 1GTIA 4EC0A 1XWBA 1SK2A 4K5SA 1JZOA 4O32A 3DMLA 5F8BA 2H76A 2D2ZA 2AHEA 1RW1A 2IN3A 4TXVA 4V2NA 3QFAC 2LTKA 1ZYPA 4HUAA 3FRCA 4L0WA 4NPBA 1ERUA 1B9YC 3UIWA 5A4WA 1EGOA 2CA8A 3G9BA 5J9CA 3DVWA 1TTZA 4GLTA 5EY6A 5HQPA 2RUFA 1TOFA 4WBJA 2K6VA 2OBKA 2V6KA 1Q4JA 3DGQA 3GNJA 1V9WA 3LW9A 2C3QA 1FOVA 5G5FA 1H75A 5AN1A 3Q74A 3F9UA 2RLIA 3KP9A 3HXSA 3G7YA 2FLSA 4F2IA 2C4JA 1GSEA 2BJXA 2E0QA 2H0HA 3KZQA 1BYEA 1YY7A 1VRSD 3ERWA 5B8BA 3RHBA 5ECRB 4KE3A 1EZKA 2R0PA 3RAZA 3TB2A 2MMZA 1VGLA 1I9DA 1GWCA 2ZCTA 1GUKA 4EXJA 3MYDA 2Z9SA 3IC8A 2GSRA 5BMUA 2LQQA 1GNWA 3ZREA 3C8EA 3L9SA 3P8WA 3LORA 3H79A 3IOSA 3CSIA 4ZB8A 3CRTA 2PN8A 1JZWA 2QKEA 2YZUA 4NV2A 5ID2B 4HOJA 5AIVA 1RQMA 1UC7A 4ZXGA 1GL8A 4XS4B 1K0AA 3QCPA 4OFNA 2ZUPA 3F4RA 4QL9A 2XC2A 1GUMA 1G7EA 3DWVA 1PRXA 1FW1A 3FKFA 1XVQA 3FMWA 11GSA 3IK9A 4MCUA 5INYA 4FIWA 1M99A 4RI6A 1YDKA 3WYWA 4I2UA 3TRXA 1XWGA 5GAND 2OJLA 3HKRA 2K8VA 1SD8A 4AJ8A 2TRXA 1I5GA 2R5GA 4EO3A 1OE7A 2FUG2 2JADA 4PUFC 3GIXA 2YP6A 5HFGA 5LNKe 3EE2A 4NHWA 1XWAA 2L59A 1AXDA 3H93A 4G10A 2VL9A 4I5QA 1TI3A 2KUCA 4F03A 1B9XC 4DVCA 2REMA 4E8HA 2X99A 3KH9A 1XW6A 3KP8A 2ES7A 3HDCA 5GSSA 2C0GA 3BD2A 2X8GA 3L9VA 4ULXA 2C3NA 3GL3A 1O85A 4JBBA 3TRPA 2IMIA 4TR1B 2N5BA 4Q5NA 1ZL9A 2JACA 2MYGA 3IA1A 4JZQA 2VD0A 1YEPA 1PN0A 2FCHA 3CSHA 5G31A 3G7JA 2EIQA 3EWLA 1K0OA 3V1WA 4WR5A 1HNAA 3UVTA 2H0IA 1Z9HA 1PGTA 2P0GA 3P90A 5J41A 1ILOA 1PL1A 1TXXA 1PSQA 3P7XA 2DJJA 1XCCA 5IMCA 5D8IA 5ECOB 2GLRA 5CO3A 3CXGA 4K6XA 2KP1A 1SU9A 5IOWA 1DSBA 3ZIVA 4HJ2A 4WETA 4EL1A 4IS0A 3CYNA 2G0FA 3UL3A 3LJRA 3BBYA 2DJ1A 2GVPA 4D73B 2VLUA 5H5RA 5LD0A 3VI7A 1XFLA 1ZYQB 1FVJA 3ERFA 4MF7A 5COHA 4P3YB 2C80A 2FGXA 4O7HA 2H1AA 1H4OA 1QMVA 2A4HA 1O7UA 2ON7A 3QMXA 5G30A 3ZYWA 3RHCA 2A2SA 2C1YA 5CREA 1X0RA 3DVXA 4N0VA 4J57E 5D93A 3UBKA 4K2DA 2NDOA 1N8JA 1JLVA 4G0IA 3VURA 2LJAA 4GCIA 4RUVA 2IL3A 5KN0A 4MZBA 5B8AA 2FA8A 2MMNA 3VPTA 4ISDA 2R3XA 2LQOA 2GQMA 4KX4A 5D9WA 18GSA 1OKDA 4XRAA 4Q5QA 1TRWA 2B5XA 3VK9A 1X9WB 3QPMA 5FT3A 2JSYA 3A5IA 2RM5A 2O7KA 2E2MA 5IMAA 1YEXA 2CVDA 2LUSA 4OWYA 3ZIJA 4XS6A 3HJPA 3LQ7A 3FK8A 1O73A 4ACSA 4ICYA 4MABA 6GSYA 5JCWA 5KN1A 3IPZA 4K7OA 3TJJA 2MMAA 2PWJA 5G1KA 4MH3A 3GKMA 5L71A 4FQUA 3TOTA 2DJKA 5LCZA 2M72A 4JEDA 4G0KA 5DQSA 1PX7A 1QGVA 1U3IA 3G7IA 3IV4A 4Q5FA 2VLVA 3E0UA 4MJBA 2PGTA 5C00A 3I9V2 4ZL9A 3L78A 5DALA 4GF0A 3GYKA 4OCFA 1A23A 5ECQB 1C72A 2YWMA 3ISOA 1EV9A 2NTOA 4XIHA 3HVNA 4GSSA 2H6ZA 3M1GA 4NMUA 5ID2A 3VWVA 4KUNA 1EEMA 4OFMA 20GSA 2HSMA 2QA1A 2GS3A 4XS4A 4TRXA 3AY8A 1MEKA 2CV4A 3KTLA 2EIRA 1TW9A 4XRDA 1XBSA 2NBSA 5JCUA 2X4AA 3KTBA 4I97A 1THXA 1M3JA 1XIYA 4BWQA 4K1FA 5HR1A 4YKGA 3WT2A 2VD1A 3GKKA 1UN2A 1A2MA 5H5QA 3ZLPA 3IRAA 4DSSB 4WF5A 4CHSA 2LJKA 1AIUA 1GTBA 5HR2A 3TCOA 3LSZA 2IFQB 4OFTA 5IPHA 1MTCA 3ZZXA 2YCDA 1B4PA 3U5RE 3IC4A 3CTFA 4ZIJA 4WEYA 3F6FA 1PKZA 4IKHA 4KDUA 1KEBA 1U87A 1R5PA 1A8YA 4X4JA 5CRWA 3GFKA 1M0UA 3FZ5A 1BAYA 3KMNA 1SL1B 2H6YA 4TR4A 1T3BA 4A5PA 2L6DA 3FHKA 2IMEA 1XOBA 3DYRA 3MSZA 4TR1A 2HZFA 4HDEA 1YJ6A 1XOAA 5ELAA 1TRSA 5D9TA 2YV7A 4HQSA 1TU8A 4N30A 5G1LA 4IQ1A 1S3DA 3LFLA 3FR9A 2M80A 1O8WA 3UARA 2TRCP 2L57A 3OR5A 3EPTA 1CQGA 4L8EA 3GKNA 4FYUA 3KEBA 1G6YA 4YH2A 3WGEA 3M9JA 2IJYA 1W4VA 5IMFA 5EPFA 4KCAA 3W8SA 3BCKA 2O8VB 1F37A 5B6NA 1AC1A 5C04A 3FEUA 1B48A 4D73A 4KH7A 2L5LA 4YQVA 1ZGNA 2LNSA 5FHIA 1WRYA 2KLXA 1K0BA 2WJUA 1OC8A 4ZBBA 2XBIA 3BOAA 2V41A 4OD7A 3ZFLA 2VCQA 3RBTA 5DVBA 5D9XA 1G0TA 2DJ3A 2VL3A 4FH8A 2GGTA 4IP6A 2H01A 1BEDA 3A2XA 5ECKB 1R5AA 5ECIB 3F3RA 3C1SA 2VOCA 6GSVA 2BTOT 4K8MA 1SJIA 1PKWA 4HSCX 4MZCA 1SL2B 4N10A 2EC4A 2H8LA 4CDOA 3FZ9A 2E7PA 2E2GA 1Z6MA 3IBHA 5H5SA 2K18A 3LYKA 2R0GA 3KH7A 4MMMA 2FY6A 4CY6A 3TKRA 3RPNA 4NV5A 3RDWA 2LSTA 2I9HA 2HZEB 4BIKA 4MNNA 2JSZA 5D73A 4PTSA 3MAKA 5F06A 1R7HA 1TI1A 6GSXA 2R37A 2LKUA 3CTGA 1GSSA 2WULA 2CQ9A 2OE3A 2O87A 3FW2A 4HU7A 1V58A 4KNDA 2I4AA 3TJGA 2H73A 1GTUA 2CVBA 4X43A 4PQIA 1Z7PA 5AISA 4PGTA 3TKPA 5CP1A 4PXOA 5BRTA 4PNFA 3I6AA 5ABRA 14GSA 4OMVA 2CT6A 2HXKA 1V2AA 3GKXA 2HRFA 4I8BA 4YQUA 3ZVJA 3SWLA 1LJRA 1TJDA 1B8XA 6GSUA 3EMPA 2F8AA 1DE2A 4QL7A 2QSIA 4K0GA 2VAFA 2OE1A 1BQ7A 3GV1A 2LRCA 2H72A 4USSA 1PD21 5CYYA 3R2QA 4MA9A 2B1KA 3FR6A 3C7MA 2LRNA 5JWRB 2H74A 4DSSA 1JHBA 4JR4A 1WE0A 4ZL7A 4KAEA 4DSQA 2H75A 2B3SA 4KGIA 4IJIA 3WGDA 1FOHA 1KNGA 3GRXA 8GSSA 4MP4A 2C0EA 4PX1A 4N0ZA 4K0NA 3HJOA 2GDRA 2RM6A 3DD3A 2VCXA 1U6TA 2JZSA 4PQ1A 3FZAA 4Q5RA 1KBNA 1PFOA 3Q19A 5A4UA 4ECCA 3VWWA 3APQA 1ACVA 3L9UA 2RIIA 4IHUA 2QC7A 3IK7A 2HRNA 3QAGA 2WFCA 3HVXA 3PR8A 2TIRA 1M3IA 4TKYA 4KSOA 4O92A 2V32A 3DRNA 5HFIA 1S3CA 5IQYA 3UJ1A 2WRTA 5G2ZA 2IIYA 1EV4A 1FVKA 4F9ZA 2F9SA 1NHOA 3BCIA 4GSTA 3IXRA 1GLPA 5EVOA 5ECSA 1SJZA 4DSRA 2GT5A 2PU9C 3GX8A 1NW2A 3LXZA 4MLYA 3E9JB 2HSYA 3F6DA 2VO4A 3KM6A 3GURA 3TOUA 1Z7RA 3LGCA 2F51A 4ZB9A 5J9BA 4HS1A 3E3EA 1QFNA 1XG8A 3HZ8A 1XXUA 1XVWA 3CBUA 3J7Yb 1F3AA 2VCWA 1DBYA 1DE1A 2ZNMA 1Z3EA 5F05A 3PPUA 2WS2A 3UBLA 3UAPA 1O8XA 2K8SA 4BVXB 4GXZA 4GRFA 1OC9B 3TKQA 5DAKB 4LMVA 3ZMLA 5D9VA 2X8HA 1YF1A 2DBCA 1TK5B 1MDIA 4LMWA 3F4TA 1VF2A 4POLA 3ZFBA 4MH2A 4TXOB 1EEJA 1LU4A 2YZHA 2PPTA 4AJ7A 4G2EA 1SKWB 3JCML 3D22A 4GQCA 4ZBAA 4HI7A 1Q98A 3UEMA 3TKSC 5KEJA 1OE8A 3HZ4A 1K0MA 2MZCA 1GSUA 3PGTA 4KSMA 1DUGA 2FNOA 1T1VA 2H1BA 4EIQA 1T4ZA 3M9KA 3DIEA 1K0CA 3W8JA 2GZZA 3A5WA 4XS1A 1PMTA 2HZEA 2X64A 1HNBA 1AW9A 1Y25A 4WF4A 2K9FA 2KOKA 3LYPA 4KDYA 5IM9A 5KOWA 1X9MB 4EUYA 1WPIA 1EOHA 4MDCA 5F07A 2I81A 2GQKA 3GSTA 2P5QA 3PINA 4KB3A 1S3AA 5HR3A 1GLQA 5DJLA 4O5UA 3IR4A 1TRUA 5DCHA 3LWAA 1NHYA 3TJBA 2J9HA 4MZWA 3WD6A 2LEGA 3GMFA 1YZXA 4KF9A 2L5OA 2OBIA 2DLXA 1JZRA 2DKHA 1XWKA 5J5NA 3EYTA 3MWHA 2VCZA 2GZPA 5IIZA 3FZ4A 4IW9A 5B6MA 3VPQA 4MF6A 1A0RP 1FB0A 1SKRB 5EL8A 4ECJA 1E6BA 1VF4A 1IYHA 3J7Yk 4JE1A 2I1UA 5FWGA 2R4VA 3D5JA 6GSTA 1F3BA 1UA5A 3R3EA 1USBA 3ME8A 1VF3A 5DDLA 4YKFA 1F6MC 1QQ2A 5DBQA 5IMDA 1Z6NA 1V98A 4ML1A 1TDIA 3TGZA 1T4YA 3TUEA 3QAWA 19GSA 3VLNA 4POKA 2H6XA 3QFBC 2AV4A 2JZTA 1MD4A 2CAIA 16GSA 3ZL5A 1Y6EA 4WXTA 1T00A 1F2EA 5JCGA 4TN8A 4CY8A 1GRXA 5CRDA 2R6KA 1GSYA 1QUWA 3KIJA 4BA7A 5IMZA 4ML6A 2JZRA 3EC3A 1ERTA 1EP7A 4WR4A 3US3A 2DSAA 2VM2A 4I2TA 4HJMA 2LRTA 1R4WA 1QK8A 4OCEA 2HSHA 3D21A 2MBSA 3HYPA 3IAM2 1ZYEA 2PVOC 3ERGA 3O6TA 3K8NA 4EKZA 3HCZA 1YF0A 4L0UA 2GQLA 1THOA 2P31A 1A8LA 3UOMA 2OE0A 3WT1A 2FWGA 1N2AA 2WB9A 4TR0A 2YWOA 4ID0A 2HE3A 4JU5A 4V2MA 3EU3A 3GUSA 3CSJA 2NVLA 3W6GA 3GH6A 3KMOA 2UZ8A 4WBRD 1O6JA 3GHAA 4ECIA 1M2AA 2LNTA 1SKSB 4V2LA 5KN3A 1A2LA 2L4QA 2PVQA 2MMOA 1TU7A 1AUCA 5ECLB 2DIZA 1OAZA 2YPMA 4FYCA 4BVXA 1OC9A 4LA1A 5DAKA 2C3TA 1PL2A 2OA7A 2VCTA 2B5YA 3ME7A 2AUVA 1YKAA 2GZYA 3MNGA 1TRVA 2B5EA 4TXOA 5IO2A 4EVMA 3HVSA 2NPBA 5D96A 4POMA 1SYRA 2GT6A 4RI7A 4IGJA 2DMLA 2KP2A 2DKIA 4NHZA 1GSFA 2B6MA 3IHQA 3A2VA 17GSA 1XWCA 2VM1A 3D6IA 4J2FA 4G9HA 1OYJA 3IAS2 3ZVJD 2N5FA 3H1NA 3NOFA 1ZOFA 1Z5YE 2YWIA 3HD5A 1CQHA 3S9FA 1GSDA 2HI7A 3GA4A 2CVKA 2H66A 3NZNA 4Z7XA 4BWSA 4NAXA 2L6CA 5JWOB 3EVIA 4EIPA 1MDKA 2X8CA 3HA9A 2FD3A 4O5RA 2EIOA 3QD9A 5ECPB 2GSQA 2OACA 2DIYA 1XW9A 1SYXA 2C0DA 3VWXA 1IYIA 9GSSA 1M2DA 2GTUA 3SBCA 1WJKA 4F0BA 2VUPA 13GSA 2A2RA 1W89A 1MDJA 2FWEA 2A2PA 1X5CA 7GSSA 2HRAA 2DJ2A 2H1DA 2YNXA 3APSA 5ECHB 2J23A 4YQMA 1E2YA 4TR3A 4DEJA 5G5EA 3EINA 3KXOA 3BJ5A 1K3LA 4IN0A 4AJ6A 3HVVA 4J56E 4Z2UA 4CW9A 4MJAA 2VL2C 1JFUA 1SENA 4HU9A 1FG4A 5CRHA 4RQXA 1NSWA 4MK3A 1OC3A 1S3RA 5DALB 1SL0B 1ZZYA 1ZYNA 3Q18A 4L5OA 4MJEA 3EURA 1ST9A 3P2AA 2HFDA 2H0GA 4OO4A 4GSNA 3TJKA 4MPFA 3LG6A 3TKSE 1T7PB 3LEFA 2FWHA 2IFQA 2DJ0A 2LJRA 1K0NA 4EDZA 1G6WA 4LL4B 1J0FA 1SD9A 4BL7B 5A4VA 4V1Ap 1ON4A 1A0FA 3O3TA 4QQ7A 3TKSA 6GSSA 1WMJA 3F3QA 3CQFA 4F82A 4G19A 4TOPA 2YN1A 4EE0A 4HQZA 3ZTLA 4AF2A 2OADA 4WKWA 2F8FA 5IPGA 2F3MA 1EOGA 4IP1A 4FYBA 4Z2RA 3HHVA 5A5KA 1OKTA 3H4KA 4XHMA 1M9AA 2CAQA 1EWXA 2V6OA 3A3TA 1GTAA 1M2BA 1G7OA 3I43A 3KJYA 4FO5A 2A4VA 5HR0A 5ECNB 3GTUB 4HEA2 4RQRA 1FO5A 1XPVA 1AQWA 1YKCA 3C1RA 1XZOA 4BVYB 2VCVA 3CRUA 1WP0A 1EGRA 2IMKA 5KN2A 5IO0A 2G2QA 1ABAA 4IJ3A 4ZILA 5CNWA 10GSA 2IPAA 2AJQB 4K7NA 4JRRA 4ILFA 5IMVA 2HLSA 1GSQA 3DXBA 1K0DA 1GH2A 1RK4A 2JU5A 3NIVA 3ZITA 1PX6A 4K2XA 1BJXA 1F9MA 5J4UA 1M7TA 1WOUA 3APOA 4K9ZA 2DMMA 1PQNA 3WGXA 2C8UA 1JLWA 4EF0A 4KA0A 4X0XA 2YJHA 4L5LA 1O81A 5F0GA 3F63A 4JR6A 1A24A 3C73A 1ERVA 4PURA 4LL1B 4MJCA 4NWYA 4N11A 3ZMKA 3LXTA 4XTSA 3DKSA 1GNEA 3TJFA 2R0CA 5HFKA 3H8QA 1WWJA 2CZ2A 2WCIA 1QXHA 3IDVA 3L0HA 2HT9A 1FB6A 1LBKA 1HYUA 5ELGA 4G0LA 4OO5A 1J08A 3UMAA 2X49A 3QAVA 3FYGA 5DQYA 2LS5A 2WZ9A 4K7IA 4GWRA 1WIKA 2CX4A 2MBTA 3RPPA 3F8UA 4IQAA 2N5AA 3O76A 4MF5A 1ZCPA 4HZ2A 5J3RA 2CZ3A 1BX9A 5GSTA 1X5DA 2IMDA 4BPYA 2LV3A 2WDUA 4IELA 1V57A 3Q6OA 2O85A 2C0FA 3VWUA 2IWTA 3ZRDA 1FAAA 2DC5A 1T8EB 5IOXA 5AGYA 2FA4A 6GSWA 5E4WA 2VIMA 3M3MA 3C71A 2R2JA 3HJMA 1SJ6A 5KOXA 2V2GA 2AB6A 2PBJA 1HNCA 5GAPD 2IMFA 1J9BA 2GSSA 2H71A 4ZBDA 1URMA 3D4MA 5GZZB 2AAWA 22GSA 2HNLA 4XCSA 2YJ7A 1NM3A 4HZ4A 3GH9A 4KDXA 4IBPA 4ZL8A 1TKDB 1TK0B 1HQOA 4I6XA 3F4SA 4PNGA 2HRKA 2ALBA 3A2WA 3KD0A 1ERWA 2H1GA 2PERA 3VFIA 4KW6A 2XPEA 3TRQA 3D4TA 4MPGA 3HY2A 1M9BA 4O5QA 4V1Ag 5ECMB 3TDGA 2P5RA 2I3YA 4ECBA 2BMXA 5ENUA 2V1MA 4BL7A 3QOUA 2YWNA 3FY7A 2YANA 2QA2A 4NXIA 2PUKC 2M46A 1X5EA 3VI5A 2PMTA 1PA3A 1VF1A 3DEXA 2YV9A 4K5RA 3D0ZA 1EP8A 1K3YA 1B4QA 5CAXA 3EMXA 3KCMA 4AGSA 2CX3A 4YAVA 3CMIA 1TK8B 2GSTA 3N9JA 2YOIA 2JL4A 3L4NA 5JWQB 4H86A 1AQVA 3GL5A 1AQXA 1PN9A 2L4CA 3M0FA 2XPDA 2KHPA 4EDYA 3GTUA 3PH9A 4BVYA 1GP1A 3UVHA 2RUEA 3QDNA 2H70A 5DCGA 4IVFA 4PUAA 2QGVA 1JZDA 1BG5A 3KGKA 2HYXA 1XW5A 3MDKA 2XBQA 2OKAA 1X9SB 1U3AA 1K3OA 1GULA 4X1UA 3EU4A 4Z2TA 3I69A 3U6VA 4PQHA 1MD3A 1V40A 4POBA 2B7JA 2FHEA 5B7CA 4KCEA 4E8EA 5CRGA 1GUHA 3N5OA 1R26A 1ZMAA 3F0IA 1HD2A 2B1LA 1A2JA 5DJMA 3IE3A 2VLTA 1SK0A 4TVEA 3GN3A 3GX0A 2AYTA 5AIXA 2B7KA 3IHGA 3M8NA 2VL2A 5E59A 2ON5A 4F0CA 12GSA 3GSSA
chains in the Genus database with same CATH topology
2H30A 1U88A 2WGRA 4LLRA 1YQ1A 1SK1A 4GTUA 3FR3A 2FWFA 2XHFA 4GQFA 3QR6A 1TP9A 2O89A 3ED3A 1ML6A 4YAPA 1KTEA 1OVNA 1FHEA 4TW5A 1UVZA 2H19A 3MIXA 4ZB6A 1AAZA 1GTIA 4EC0A 1XWBA 1SK2A 4K5SA 1JZOA 4O32A 3DMLA 5F8BA 2H76A 2D2ZA 2AHEA 1RW1A 2IN3A 4TXVA 4V2NA 3QFAC 2LTKA 1ZYPA 4HUAA 3FRCA 4L0WA 4NPBA 1ERUA 1B9YC 3UIWA 5A4WA 1EGOA 2CA8A 3G9BA 5J9CA 3DVWA 1TTZA 4GLTA 5EY6A 5HQPA 2RUFA 1TOFA 4WBJA 2K6VA 2OBKA 2V6KA 1Q4JA 3DGQA 3GNJA 1V9WA 3LW9A 2C3QA 1FOVA 5G5FA 1H75A 5AN1A 3Q74A 3F9UA 2RLIA 3KP9A 3HXSA 3G7YA 2FLSA 4F2IA 2C4JA 1GSEA 2BJXA 2E0QA 2H0HA 3KZQA 1BYEA 1YY7A 1VRSD 3ERWA 5B8BA 3RHBA 5ECRB 4KE3A 1EZKA 2R0PA 3RAZA 3TB2A 2MMZA 1VGLA 1I9DA 1GWCA 2ZCTA 1GUKA 4EXJA 3MYDA 2Z9SA 3IC8A 2GSRA 5BMUA 2LQQA 1GNWA 3ZREA 3C8EA 3L9SA 3P8WA 3LORA 3H79A 3IOSA 3CSIA 4ZB8A 3CRTA 2PN8A 1JZWA 2QKEA 2YZUA 4NV2A 5ID2B 4HOJA 5AIVA 1RQMA 1UC7A 4ZXGA 1GL8A 4XS4B 1K0AA 3QCPA 4OFNA 2ZUPA 3F4RA 4QL9A 2XC2A 1GUMA 1G7EA 3DWVA 1PRXA 1FW1A 3FKFA 1XVQA 3FMWA 11GSA 3IK9A 4MCUA 5INYA 4FIWA 1M99A 4RI6A 1YDKA 3WYWA 4I2UA 3TRXA 1XWGA 5GAND 2OJLA 3HKRA 2K8VA 1SD8A 4AJ8A 2TRXA 1I5GA 2R5GA 4EO3A 1OE7A 2FUG2 2JADA 4PUFC 3GIXA 2YP6A 5HFGA 5LNKe 3EE2A 4NHWA 1XWAA 2L59A 1AXDA 3H93A 4G10A 2VL9A 4I5QA 1TI3A 2KUCA 4F03A 1B9XC 4DVCA 2REMA 4E8HA 2X99A 3KH9A 1XW6A 3KP8A 2ES7A 3HDCA 5GSSA 2C0GA 3BD2A 2X8GA 3L9VA 4ULXA 2C3NA 3GL3A 1O85A 4JBBA 3TRPA 2IMIA 4TR1B 2N5BA 4Q5NA 1ZL9A 2JACA 2MYGA 3IA1A 4JZQA 2VD0A 1YEPA 1PN0A 2FCHA 3CSHA 5G31A 3G7JA 2EIQA 3EWLA 1K0OA 3V1WA 4WR5A 1HNAA 3UVTA 2H0IA 1Z9HA 1PGTA 2P0GA 3P90A 5J41A 1ILOA 1PL1A 1TXXA 1PSQA 3P7XA 2DJJA 1XCCA 5IMCA 5D8IA 5ECOB 2GLRA 5CO3A 3CXGA 4K6XA 2KP1A 1SU9A 5IOWA 1DSBA 3ZIVA 4HJ2A 4WETA 4EL1A 4IS0A 3CYNA 2G0FA 3UL3A 3LJRA 3BBYA 2DJ1A 2GVPA 4D73B 2VLUA 5H5RA 5LD0A 3VI7A 1XFLA 1ZYQB 1FVJA 3ERFA 4MF7A 5COHA 4P3YB 2C80A 2FGXA 4O7HA 2H1AA 1H4OA 1QMVA 2A4HA 1O7UA 2ON7A 3QMXA 5G30A 3ZYWA 3RHCA 2A2SA 2C1YA 5CREA 1X0RA 3DVXA 4N0VA 4J57E 5D93A 3UBKA 4K2DA 2NDOA 1N8JA 1JLVA 4G0IA 3VURA 2LJAA 4GCIA 4RUVA 2IL3A 5KN0A 4MZBA 5B8AA 2FA8A 2MMNA 3VPTA 4ISDA 2R3XA 2LQOA 2GQMA 4KX4A 5D9WA 18GSA 1OKDA 4XRAA 4Q5QA 1TRWA 2B5XA 3VK9A 1X9WB 3QPMA 5FT3A 2JSYA 3A5IA 2RM5A 2O7KA 2E2MA 5IMAA 1YEXA 2CVDA 2LUSA 4OWYA 3ZIJA 4XS6A 3HJPA 3LQ7A 3FK8A 1O73A 4ACSA 4ICYA 4MABA 6GSYA 5JCWA 5KN1A 3IPZA 4K7OA 3TJJA 2MMAA 2PWJA 5G1KA 4MH3A 3GKMA 5L71A 4FQUA 3TOTA 2DJKA 5LCZA 2M72A 4JEDA 4G0KA 5DQSA 1PX7A 1QGVA 1U3IA 3G7IA 3IV4A 4Q5FA 2VLVA 3E0UA 4MJBA 2PGTA 5C00A 3I9V2 4ZL9A 3L78A 5DALA 4GF0A 3GYKA 4OCFA 1A23A 5ECQB 1C72A 2YWMA 3ISOA 1EV9A 2NTOA 4XIHA 4GSSA 2H6ZA 3M1GA 4NMUA 5ID2A 3VWVA 4KUNA 1EEMA 4OFMA 20GSA 2HSMA 2QA1A 2GS3A 4XS4A 4TRXA 3AY8A 1MEKA 2CV4A 3KTLA 2EIRA 1TW9A 4XRDA 1XBSA 2NBSA 5JCUA 2X4AA 3KTBA 4I97A 1THXA 1XIYA 4BWQA 4K1FA 5HR1A 4YKGA 3WT2A 2VD1A 3GKKA 1UN2A 1A2MA 5H5QA 3ZLPA 3IRAA 4DSSB 4WF5A 4CHSA 2LJKA 1AIUA 1GTBA 5HR2A 3TCOA 3LSZA 2IFQB 4OFTA 5IPHA 1MTCA 3ZZXA 2YCDA 1B4PA 3U5RE 3IC4A 3CTFA 4ZIJA 4WEYA 3F6FA 1PKZA 4IKHA 4KDUA 1KEBA 1U87A 1R5PA 1A8YA 4X4JA 5CRWA 3GFKA 1M0UA 3FZ5A 1BAYA 3KMNA 1SL1B 2H6YA 4TR4A 1T3BA 4A5PA 2L6DA 3FHKA 2IMEA 1XOBA 3DYRA 3MSZA 4TR1A 2HZFA 4HDEA 1YJ6A 1XOAA 5ELAA 1TRSA 5D9TA 2YV7A 4HQSA 1TU8A 4N30A 5G1LA 4IQ1A 1S3DA 3LFLA 3FR9A 2M80A 1O8WA 3UARA 2TRCP 2L57A 3OR5A 3EPTA 1CQGA 4L8EA 3GKNA 4FYUA 3KEBA 1G6YA 4YH2A 3WGEA 3M9JA 2IJYA 1W4VA 5IMFA 5EPFA 4KCAA 3W8SA 3BCKA 2O8VB 1F37A 5B6NA 1AC1A 5C04A 3FEUA 1B48A 4D73A 4KH7A 2L5LA 4YQVA 1ZGNA 2LNSA 5FHIA 1WRYA 2KLXA 1K0BA 2WJUA 1OC8A 4ZBBA 2XBIA 3BOAA 2V41A 4OD7A 3ZFLA 2VCQA 3RBTA 5DVBA 5D9XA 1G0TA 2DJ3A 2VL3A 4FH8A 2GGTA 4IP6A 2H01A 1BEDA 3A2XA 5ECKB 1R5AA 5ECIB 3F3RA 3C1SA 2VOCA 6GSVA 2BTOT 4K8MA 1SJIA 1PKWA 4MZCA 1SL2B 4N10A 2EC4A 2H8LA 4CDOA 3FZ9A 2E7PA 2E2GA 1Z6MA 3IBHA 5H5SA 2K18A 3LYKA 2R0GA 3KH7A 4MMMA 2FY6A 4CY6A 3TKRA 3RPNA 4NV5A 3RDWA 2LSTA 2I9HA 2HZEB 4MNNA 5D73A 2JSZA 4PTSA 3MAKA 5F06A 1R7HA 1TI1A 6GSXA 2R37A 2LKUA 3CTGA 1GSSA 2WULA 2CQ9A 2OE3A 2O87A 3FW2A 4HU7A 1V58A 4KNDA 2I4AA 3TJGA 2H73A 1GTUA 2CVBA 4X43A 4PQIA 1Z7PA 5AISA 4PGTA 3TKPA 5CP1A 4PXOA 5BRTA 4PNFA 3I6AA 5ABRA 14GSA 4OMVA 2CT6A 2HXKA 1V2AA 3GKXA 2HRFA 4I8BA 4YQUA 3ZVJA 3SWLA 1LJRA 1TJDA 1B8XA 6GSUA 3EMPA 2F8AA 1DE2A 4QL7A 2QSIA 4K0GA 2VAFA 2OE1A 1BQ7A 3GV1A 2LRCA 2H72A 4USSA 1PD21 5CYYA 3R2QA 4MA9A 2B1KA 3FR6A 3C7MA 2LRNA 5JWRB 2H74A 4DSSA 1JHBA 4JR4A 1WE0A 4ZL7A 4KAEA 4DSQA 2H75A 2B3SA 4KGIA 4IJIA 3WGDA 1FOHA 1KNGA 3GRXA 8GSSA 4MP4A 2C0EA 4PX1A 4N0ZA 4K0NA 3HJOA 2GDRA 2RM6A 3DD3A 2VCXA 1U6TA 2JZSA 4PQ1A 3FZAA 4Q5RA 1KBNA 3Q19A 5A4UA 4ECCA 3VWWA 3APQA 1ACVA 3L9UA 2RIIA 4IHUA 2QC7A 3IK7A 2HRNA 3QAGA 2WFCA 3HVXA 3PR8A 2TIRA 4TKYA 4KSOA 4O92A 2V32A 3DRNA 5HFIA 1S3CA 5IQYA 3UJ1A 2WRTA 5G2ZA 2IIYA 1EV4A 1FVKA 4F9ZA 2F9SA 1NHOA 3BCIA 4GSTA 3IXRA 1GLPA 5EVOA 5ECSA 1SJZA 4DSRA 2GT5A 2PU9C 3GX8A 1NW2A 3LXZA 4MLYA 3E9JB 2HSYA 3F6DA 2VO4A 3KM6A 3GURA 3TOUA 1Z7RA 3LGCA 2F51A 4ZB9A 5J9BA 4HS1A 3E3EA 1QFNA 3HZ8A 1XXUA 1XVWA 3CBUA 3J7Yb 1F3AA 2VCWA 1DBYA 1DE1A 2ZNMA 1Z3EA 5F05A 3PPUA 2WS2A 3UBLA 3UAPA 1O8XA 2K8SA 4BVXB 4GXZA 4GRFA 1OC9B 3TKQA 5DAKB 4LMVA 3ZMLA 5D9VA 2X8HA 1YF1A 2DBCA 1TK5B 1MDIA 4LMWA 3F4TA 1VF2A 4POLA 3ZFBA 4MH2A 4TXOB 1EEJA 1LU4A 2YZHA 2PPTA 4AJ7A 4G2EA 1SKWB 3JCML 3D22A 4GQCA 4ZBAA 4HI7A 1Q98A 3UEMA 3TKSC 5KEJA 1OE8A 3HZ4A 1K0MA 2MZCA 1GSUA 3PGTA 4KSMA 1DUGA 2FNOA 1T1VA 2H1BA 4EIQA 1T4ZA 3M9KA 3DIEA 1K0CA 3W8JA 2GZZA 3A5WA 4XS1A 1PMTA 2HZEA 2X64A 1HNBA 1AW9A 1Y25A 4WF4A 2K9FA 2KOKA 3LYPA 4KDYA 5IM9A 5KOWA 1X9MB 4EUYA 1WPIA 1EOHA 4MDCA 5F07A 2I81A 2GQKA 3GSTA 2P5QA 3PINA 4KB3A 1S3AA 5HR3A 1GLQA 5DJLA 4O5UA 3IR4A 1TRUA 5DCHA 3LWAA 1NHYA 3TJBA 2J9HA 4MZWA 3WD6A 2LEGA 3GMFA 1YZXA 4KF9A 2L5OA 2OBIA 2DLXA 1JZRA 2DKHA 1XWKA 5J5NA 3EYTA 3MWHA 2VCZA 2GZPA 5IIZA 3FZ4A 4IW9A 5B6MA 3VPQA 4MF6A 1A0RP 1FB0A 1SKRB 5EL8A 4ECJA 1E6BA 1VF4A 1IYHA 3J7Yk 4JE1A 2I1UA 5FWGA 2R4VA 3D5JA 6GSTA 1F3BA 1UA5A 3R3EA 1USBA 3ME8A 1VF3A 5DDLA 4YKFA 1F6MC 1QQ2A 5DBQA 5IMDA 1Z6NA 1V98A 4ML1A 1TDIA 3TGZA 1T4YA 3TUEA 3QAWA 19GSA 3VLNA 4POKA 2H6XA 3QFBC 2AV4A 2JZTA 1MD4A 2CAIA 16GSA 3ZL5A 1Y6EA 4WXTA 1T00A 1F2EA 5JCGA 4TN8A 4CY8A 1GRXA 5CRDA 2R6KA 1GSYA 1QUWA 3KIJA 4BA7A 5IMZA 4ML6A 2JZRA 3EC3A 1ERTA 1EP7A 4WR4A 3US3A 2DSAA 2VM2A 4I2TA 4HJMA 2LRTA 1R4WA 1QK8A 4OCEA 2HSHA 3D21A 2MBSA 3HYPA 3IAM2 1ZYEA 2PVOC 3ERGA 3O6TA 3K8NA 4EKZA 3HCZA 1YF0A 4L0UA 2GQLA 1THOA 2P31A 1A8LA 3UOMA 2OE0A 3WT1A 2FWGA 1N2AA 2WB9A 4TR0A 2YWOA 4ID0A 2HE3A 4JU5A 4V2MA 3EU3A 3GUSA 3CSJA 2NVLA 3W6GA 3GH6A 3KMOA 2UZ8A 4WBRD 1O6JA 3GHAA 4ECIA 1M2AA 2LNTA 1SKSB 4V2LA 5KN3A 1A2LA 2L4QA 2PVQA 2MMOA 1TU7A 1AUCA 5ECLB 2DIZA 1OAZA 2YPMA 4FYCA 4BVXA 1OC9A 4LA1A 5DAKA 2C3TA 1PL2A 2OA7A 2VCTA 2B5YA 3ME7A 2AUVA 1YKAA 2GZYA 3MNGA 1TRVA 2B5EA 4TXOA 5IO2A 4EVMA 3HVSA 2NPBA 5D96A 4POMA 1SYRA 2GT6A 4RI7A 4IGJA 2DMLA 2KP2A 2DKIA 4NHZA 1GSFA 2B6MA 3IHQA 3A2VA 17GSA 1XWCA 2VM1A 3D6IA 4J2FA 4G9HA 1OYJA 3IAS2 3ZVJD 2N5FA 3H1NA 3NOFA 1ZOFA 1Z5YE 2YWIA 3HD5A 1CQHA 3S9FA 1GSDA 2HI7A 3GA4A 2CVKA 2H66A 3NZNA 4Z7XA 4BWSA 4NAXA 2L6CA 5JWOB 3EVIA 4EIPA 1MDKA 2X8CA 3HA9A 2FD3A 4O5RA 2EIOA 3QD9A 5ECPB 2GSQA 2OACA 2DIYA 1XW9A 1SYXA 2C0DA 3VWXA 1IYIA 9GSSA 1M2DA 2GTUA 3SBCA 1WJKA 4F0BA 2VUPA 13GSA 2A2RA 1W89A 1MDJA 2FWEA 2A2PA 1X5CA 7GSSA 2HRAA 2DJ2A 2H1DA 2YNXA 3APSA 5ECHB 2J23A 4YQMA 1E2YA 4TR3A 4DEJA 5G5EA 3EINA 3KXOA 3BJ5A 1K3LA 4IN0A 4AJ6A 3HVVA 4J56E 4Z2UA 4CW9A 4MJAA 2VL2C 1JFUA 1SENA 4HU9A 1FG4A 5CRHA 4RQXA 1NSWA 4MK3A 1OC3A 5DALB 1SL0B 1ZZYA 1ZYNA 3Q18A 4L5OA 4MJEA 3EURA 1ST9A 3P2AA 2HFDA 2H0GA 4OO4A 4GSNA 3TJKA 4MPFA 3LG6A 3TKSE 1T7PB 3LEFA 2FWHA 2IFQA 2DJ0A 2LJRA 1K0NA 4EDZA 1G6WA 4LL4B 1J0FA 1SD9A 4BL7B 5A4VA 4V1Ap 1ON4A 1A0FA 3O3TA 4QQ7A 3TKSA 6GSSA 1WMJA 3F3QA 4F82A 4G19A 4TOPA 2YN1A 4EE0A 4HQZA 3ZTLA 4AF2A 2OADA 4WKWA 2F8FA 5IPGA 2F3MA 1EOGA 4IP1A 4FYBA 4Z2RA 3HHVA 5A5KA 1OKTA 3H4KA 4XHMA 1M9AA 2CAQA 1EWXA 2V6OA 3A3TA 1GTAA 1M2BA 1G7OA 3I43A 3KJYA 4FO5A 2A4VA 5HR0A 5ECNB 3GTUB 4HEA2 4RQRA 1FO5A 1XPVA 1AQWA 1YKCA 3C1RA 1XZOA 4BVYB 2VCVA 3CRUA 1WP0A 1EGRA 2IMKA 5KN2A 5IO0A 2G2QA 1ABAA 4IJ3A 4ZILA 5CNWA 10GSA 2IPAA 2AJQB 4K7NA 4JRRA 4ILFA 5IMVA 2HLSA 1GSQA 3DXBA 1K0DA 1GH2A 1RK4A 2JU5A 3NIVA 3ZITA 1PX6A 4K2XA 1BJXA 1F9MA 5J4UA 1M7TA 1WOUA 3APOA 4K9ZA 2DMMA 1PQNA 3WGXA 2C8UA 1JLWA 4EF0A 4KA0A 4X0XA 2YJHA 4L5LA 1O81A 5F0GA 3F63A 4JR6A 1A24A 3C73A 1ERVA 4PURA 4LL1B 4MJCA 4NWYA 4N11A 3ZMKA 3LXTA 4XTSA 3DKSA 1GNEA 3TJFA 2R0CA 5HFKA 3H8QA 1WWJA 2CZ2A 2WCIA 1QXHA 3IDVA 3L0HA 2HT9A 1FB6A 1LBKA 1HYUA 5ELGA 4G0LA 4OO5A 1J08A 3UMAA 2X49A 3QAVA 3FYGA 5DQYA 2LS5A 2WZ9A 4K7IA 4GWRA 1WIKA 2CX4A 2MBTA 3RPPA 3F8UA 4IQAA 2N5AA 3O76A 4MF5A 1ZCPA 4HZ2A 5J3RA 2CZ3A 1BX9A 5GSTA 1X5DA 2IMDA 4BPYA 2LV3A 2WDUA 4IELA 1V57A 3Q6OA 2O85A 2C0FA 3VWUA 2IWTA 3ZRDA 1FAAA 2DC5A 1T8EB 5IOXA 5AGYA 2FA4A 6GSWA 5E4WA 2VIMA 3M3MA 3C71A 2R2JA 3HJMA 1SJ6A 5KOXA 2V2GA 2AB6A 2PBJA 1HNCA 5GAPD 2IMFA 1J9BA 2GSSA 2H71A 4ZBDA 1URMA 3D4MA 5GZZB 2AAWA 22GSA 2HNLA 4XCSA 2YJ7A 1NM3A 4HZ4A 3GH9A 4KDXA 4IBPA 4ZL8A 1TKDB 1TK0B 1HQOA 4I6XA 3F4SA 4PNGA 2HRKA 2ALBA 3A2WA 3KD0A 1ERWA 2H1GA 2PERA 3VFIA 4KW6A 2XPEA 3TRQA 3D4TA 4MPGA 3HY2A 1M9BA 4O5QA 4V1Ag 5ECMB 3TDGA 2P5RA 2I3YA 4ECBA 2BMXA 5ENUA 2V1MA 4BL7A 3QOUA 2YWNA 3FY7A 2YANA 2QA2A 4NXIA 2PUKC 2M46A 1X5EA 3VI5A 2PMTA 1PA3A 1VF1A 3DEXA 2YV9A 4K5RA 3D0ZA 1EP8A 1K3YA 1B4QA 5CAXA 3EMXA 3KCMA 4AGSA 2CX3A 4YAVA 3CMIA 1TK8B 2GSTA 3N9JA 2YOIA 2JL4A 3L4NA 5JWQB 4H86A 1AQVA 3GL5A 1AQXA 1PN9A 2L4CA 3M0FA 2XPDA 2KHPA 4EDYA 3GTUA 3PH9A 4BVYA 1GP1A 3UVHA 2RUEA 3QDNA 2H70A 5DCGA 4IVFA 4PUAA 2QGVA 1JZDA 1BG5A 3KGKA 2HYXA 1XW5A 3MDKA 2XBQA 2OKAA 1X9SB 1U3AA 1K3OA 1GULA 4X1UA 3EU4A 4Z2TA 3I69A 3U6VA 4PQHA 1MD3A 1V40A 4POBA 2B7JA 2FHEA 5B7CA 4KCEA 4E8EA 5CRGA 1GUHA 3N5OA 1R26A 1ZMAA 3F0IA 1HD2A 2B1LA 1A2JA 5DJMA 3IE3A 2VLTA 1SK0A 4TVEA 3GN3A 3GX0A 2AYTA 5AIXA 2B7KA 3IHGA 3M8NA 2VL2A 5E59A 2ON5A 4F0CA 12GSA 3GSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H30 A;  1U88 A;  2WGR A;  4LLR A;  1YQ1 A;  1SK1 A;  4GTU A;  3FR3 A;  2FWF A;  2XHF A;  4GQF A;  3QR6 A;  1TP9 A;  2O89 A;  3ED3 A;  1ML6 A;  4YAP A;  1KTE A;  1OVN A;  1FHE A;  4TW5 A;  1UVZ A;  2H19 A;  4ZB6 A;  1AAZ A;  1GTI A;  4EC0 A;  1XWB A;  1SK2 A;  1JZO A;  4O32 A;  3DML A;  5F8B A;  2H76 A;  2D2Z A;  2AHE A;  1RW1 A;  2IN3 A;  4TXV A;  4V2N A;  3QFA C;  2LTK A;  4HUA A;  3FRC A;  4L0W A;  4NPB A;  1ERU A;  1B9Y C;  3UIW A;  5A4W A;  1EGO A;  2CA8 A;  3G9B A;  5J9C A;  3DVW A;  1TTZ A;  4GLT A;  5EY6 A;  5HQP A;  2RUF A;  1TOF A;  4WBJ A;  2K6V A;  2OBK A;  2V6K A;  1Q4J A;  3DGQ A;  3GNJ A;  1V9W A;  2C3Q A;  1FOV A;  5G5F A;  1H75 A;  5AN1 A;  3Q74 A;  3F9U A;  2RLI A;  3KP9 A;  3HXS A;  3G7Y A;  2FLS A;  4F2I A;  2C4J A;  1GSE A;  2BJX A;  2E0Q A;  2H0H A;  3KZQ A;  1BYE A;  1YY7 A;  1VRS D;  3ERW A;  5B8B A;  3RHB A;  5ECR B;  4KE3 A;  1EZK A;  3RAZ A;  3TB2 A;  2MMZ A;  1VGL A;  1I9D A;  1GWC A;  2ZCT A;  1GUK A;  4EXJ A;  2Z9S A;  2GSR A;  2LQQ A;  1GNW A;  3ZRE A;  3C8E A;  3L9S A;  3P8W A;  3LOR A;  3H79 A;  3IOS A;  3CSI A;  4ZB8 A;  3CRT A;  2PN8 A;  1JZW A;  2QKE A;  2YZU A;  4NV2 A;  5ID2 B;  4HOJ A;  5AIV A;  1RQM A;  1UC7 A;  4ZXG A;  1GL8 A;  4XS4 B;  1K0A A;  3QCP A;  4OFN A;  2ZUP A;  3F4R A;  4QL9 A;  2XC2 A;  1GUM A;  1G7E A;  3DWV A;  1PRX A;  1FW1 A;  3FKF A;  1XVQ A;  11GS A;  3IK9 A;  4MCU A;  5INY A;  4FIW A;  1M99 A;  4RI6 A;  1YDK A;  3WYW A;  4I2U A;  3TRX A;  1XWG A;  5GAN D;  2OJL A;  3HKR A;  2K8V A;  1SD8 A;  4AJ8 A;  2TRX A;  1I5G A;  2R5G A;  4EO3 A;  1OE7 A;  2FUG 2;  2JAD A;  4PUF C;  3GIX A;  2YP6 A;  5HFG A;  5LNK e;  3EE2 A;  4NHW A;  1XWA A;  2L59 A;  1AXD A;  3H93 A;  4G10 A;  2VL9 A;  4I5Q A;  1TI3 A;  2KUC A;  4F03 A;  1B9X C;  4DVC A;  2REM A;  4E8H A;  2X99 A;  3KH9 A;  1XW6 A;  3KP8 A;  2ES7 A;  3HDC A;  5GSS A;  2C0G A;  3BD2 A;  2X8G A;  3L9V A;  4ULX A;  2C3N A;  3GL3 A;  1O85 A;  4JBB A;  3TRP A;  2IMI A;  4TR1 B;  2N5B A;  4Q5N A;  1ZL9 A;  2JAC A;  2MYG A;  3IA1 A;  4JZQ A;  2VD0 A;  1YEP A;  2FCH A;  3CSH A;  5G31 A;  3G7J A;  2EIQ A;  3EWL A;  1K0O A;  3V1W A;  4WR5 A;  1HNA A;  3UVT A;  2H0I A;  1Z9H A;  1PGT A;  2P0G A;  3P90 A;  5J41 A;  1ILO A;  1PL1 A;  1TXX A;  1PSQ A;  3P7X A;  2DJJ A;  1XCC A;  5IMC A;  5D8I A;  5ECO B;  2GLR A;  5CO3 A;  3CXG A;  4K6X A;  2KP1 A;  1SU9 A;  5IOW A;  1DSB A;  3ZIV A;  4HJ2 A;  4WET A;  4EL1 A;  4IS0 A;  3CYN A;  2G0F A;  3UL3 A;  3LJR A;  3BBY A;  2DJ1 A;  2GVP A;  4D73 B;  2VLU A;  5H5R A;  5LD0 A;  3VI7 A;  1XFL A;  1ZYQ B;  1FVJ A;  3ERF A;  4MF7 A;  5COH A;  4P3Y B;  2C80 A;  2FGX A;  4O7H A;  2H1A A;  1H4O A;  1QMV A;  1O7U A;  2ON7 A;  3QMX A;  5G30 A;  3ZYW A;  3RHC A;  2A2S A;  2C1Y A;  5CRE A;  1X0R A;  3DVX A;  4N0V A;  4J57 E;  5D93 A;  3UBK A;  4K2D A;  2NDO A;  1N8J A;  1JLV A;  3VUR A;  2LJA A;  4GCI A;  4RUV A;  2IL3 A;  5KN0 A;  4MZB A;  5B8A A;  2FA8 A;  2MMN A;  3VPT A;  4ISD A;  2R3X A;  2LQO A;  2GQM A;  4KX4 A;  5D9W A;  18GS A;  1OKD A;  4XRA A;  4Q5Q A;  1TRW A;  2B5X A;  3VK9 A;  1X9W B;  3QPM A;  5FT3 A;  2JSY A;  2RM5 A;  2O7K A;  2E2M A;  5IMA A;  1YEX A;  2CVD A;  2LUS A;  4OWY A;  3ZIJ A;  4XS6 A;  3HJP A;  3LQ7 A;  3FK8 A;  1O73 A;  4ACS A;  4MAB A;  6GSY A;  5JCW A;  5KN1 A;  3IPZ A;  4K7O A;  3TJJ A;  2MMA A;  2PWJ A;  5G1K A;  4MH3 A;  3GKM A;  5L71 A;  3TOT A;  2DJK A;  5LCZ A;  2M72 A;  4JED A;  5DQS A;  1PX7 A;  1QGV A;  1U3I A;  3G7I A;  3IV4 A;  4Q5F A;  2VLV A;  3E0U A;  4MJB A;  2PGT A;  5C00 A;  3I9V 2;  4ZL9 A;  3L78 A;  5DAL A;  4GF0 A;  3GYK A;  4OCF A;  1A23 A;  5ECQ B;  1C72 A;  2YWM A;  3ISO A;  1EV9 A;  2NTO A;  4XIH A;  4GSS A;  2H6Z A;  3M1G A;  4NMU A;  5ID2 A;  3VWV A;  4KUN A;  1EEM A;  4OFM A;  20GS A;  2GS3 A;  4XS4 A;  4TRX A;  3AY8 A;  1MEK A;  2CV4 A;  3KTL A;  2EIR A;  1TW9 A;  4XRD A;  1XBS A;  2NBS A;  5JCU A;  3KTB A;  4I97 A;  1THX A;  1XIY A;  4BWQ A;  4K1F A;  5HR1 A;  3WT2 A;  2VD1 A;  3GKK A;  1UN2 A;  1A2M A;  5H5Q A;  3ZLP A;  3IRA A;  4DSS B;  4WF5 A;  4CHS A;  2LJK A;  1AIU A;  1GTB A;  5HR2 A;  3TCO A;  3LSZ A;  2IFQ B;  4OFT A;  5IPH A;  1MTC A;  3ZZX A;  2YCD A;  1B4P A;  3U5R E;  3IC4 A;  3CTF A;  4ZIJ A;  4WEY A;  3F6F A;  1PKZ A;  4IKH A;  4KDU A;  1KEB A;  1U87 A;  1R5P A;  1A8Y A;  5CRW A;  3GFK A;  1M0U A;  3FZ5 A;  1BAY A;  3KMN A;  1SL1 B;  2H6Y A;  4TR4 A;  1T3B A;  2L6D A;  3FHK A;  2IME A;  1XOB A;  3DYR A;  3MSZ A;  4TR1 A;  2HZF A;  4HDE A;  1YJ6 A;  1XOA A;  5ELA A;  1TRS A;  5D9T A;  2YV7 A;  4HQS A;  1TU8 A;  4N30 A;  5G1L A;  4IQ1 A;  1S3D A;  3LFL A;  3FR9 A;  2M80 A;  1O8W A;  3UAR A;  2TRC P;  2L57 A;  3OR5 A;  1CQG A;  4L8E A;  3GKN A;  4FYU A;  3KEB A;  1G6Y A;  4YH2 A;  3WGE A;  3M9J A;  2IJY A;  1W4V A;  5IMF A;  5EPF A;  4KCA A;  3W8S A;  3BCK A;  2O8V B;  1F37 A;  5B6N A;  1AC1 A;  5C04 A;  3FEU A;  1B48 A;  4D73 A;  4KH7 A;  2L5L A;  4YQV A;  1ZGN A;  2LNS A;  5FHI A;  1WRY A;  2KLX A;  1K0B A;  2WJU A;  1OC8 A;  4ZBB A;  2XBI A;  3BOA A;  2V41 A;  4OD7 A;  3ZFL A;  2VCQ A;  3RBT A;  5DVB A;  5D9X A;  1G0T A;  2DJ3 A;  2VL3 A;  4FH8 A;  2GGT A;  4IP6 A;  2H01 A;  1BED A;  3A2X A;  5ECK B;  1R5A A;  5ECI B;  3F3R A;  3C1S A;  2VOC A;  6GSV A;  2BTO T;  4K8M A;  1SJI A;  1PKW A;  4MZC A;  1SL2 B;  4N10 A;  2EC4 A;  2H8L A;  4CDO A;  3FZ9 A;  2E7P A;  2E2G A;  1Z6M A;  3IBH A;  5H5S A;  2K18 A;  3LYK A;  3KH7 A;  4MMM A;  2FY6 A;  3TKR A;  3RPN A;  4NV5 A;  3RDW A;  2LST A;  2I9H A;  2HZE B;  2JSZ A;  5D73 A;  3MAK A;  5F06 A;  1R7H A;  1TI1 A;  6GSX A;  2R37 A;  2LKU A;  3CTG A;  1GSS A;  2WUL A;  2CQ9 A;  2OE3 A;  2O87 A;  3FW2 A;  4HU7 A;  1V58 A;  4KND A;  2I4A A;  3TJG A;  2H73 A;  1GTU A;  2CVB A;  4X43 A;  4PQI A;  1Z7P A;  5AIS A;  4PGT A;  3TKP A;  5CP1 A;  4PXO A;  4PNF A;  3I6A A;  5ABR A;  14GS A;  4OMV A;  2CT6 A;  2HXK A;  1V2A A;  3GKX A;  2HRF A;  4I8B A;  4YQU A;  3ZVJ A;  3SWL A;  1LJR A;  1TJD A;  1B8X A;  6GSU A;  3EMP A;  2F8A A;  1DE2 A;  4QL7 A;  2QSI A;  4K0G A;  2VAF A;  2OE1 A;  1BQ7 A;  3GV1 A;  2LRC A;  2H72 A;  1PD2 1;  5CYY A;  3R2Q A;  4MA9 A;  2B1K A;  3FR6 A;  3C7M A;  2LRN A;  5JWR B;  2H74 A;  4DSS A;  1JHB A;  4JR4 A;  1WE0 A;  4ZL7 A;  4KAE A;  4DSQ A;  2H75 A;  2B3S A;  4KGI A;  4IJI A;  3WGD A;  1KNG A;  3GRX A;  8GSS A;  4MP4 A;  2C0E A;  4PX1 A;  4N0Z A;  4K0N A;  3HJO A;  2GDR A;  2RM6 A;  3DD3 A;  2VCX A;  1U6T A;  2JZS A;  4PQ1 A;  3FZA A;  4Q5R A;  1KBN A;  3Q19 A;  5A4U A;  4ECC A;  3VWW A;  3APQ A;  1ACV A;  3L9U A;  2RII A;  4IHU A;  2QC7 A;  3IK7 A;  2HRN A;  3QAG A;  2WFC A;  3HVX A;  3PR8 A;  2TIR A;  4TKY A;  4KSO A;  4O92 A;  2V32 A;  3DRN A;  5HFI A;  1S3C A;  5IQY A;  3UJ1 A;  2WRT A;  5G2Z A;  2IIY A;  1EV4 A;  1FVK A;  4F9Z A;  2F9S A;  1NHO A;  3BCI A;  4GST A;  3IXR A;  1GLP A;  5EVO A;  5ECS A;  1SJZ A;  4DSR A;  2GT5 A;  2PU9 C;  3GX8 A;  1NW2 A;  3LXZ A;  4MLY A;  3E9J B;  2HSY A;  3F6D A;  2VO4 A;  3KM6 A;  3GUR A;  3TOU A;  1Z7R A;  3LGC A;  2F51 A;  4ZB9 A;  5J9B A;  4HS1 A;  3E3E A;  1QFN A;  3HZ8 A;  1XXU A;  1XVW A;  3CBU A;  3J7Y b;  1F3A A;  2VCW A;  1DBY A;  1DE1 A;  2ZNM A;  1Z3E A;  5F05 A;  2WS2 A;  3UBL A;  3UAP A;  1O8X A;  2K8S A;  4GXZ A;  4GRF A;  1OC9 B;  3TKQ A;  5DAK B;  4LMV A;  3ZML A;  5D9V A;  2X8H A;  1YF1 A;  2DBC A;  1TK5 B;  1MDI A;  4LMW A;  3F4T A;  1VF2 A;  4POL A;  3ZFB A;  4MH2 A;  4TXO B;  1EEJ A;  1LU4 A;  2YZH A;  2PPT A;  4AJ7 A;  4G2E A;  1SKW B;  3JCM L;  3D22 A;  4GQC A;  4ZBA A;  4HI7 A;  1Q98 A;  3UEM A;  3TKS C;  5KEJ A;  1OE8 A;  3HZ4 A;  1K0M A;  2MZC A;  1GSU A;  3PGT A;  4KSM A;  1DUG A;  2FNO A;  1T1V A;  2H1B A;  1T4Z A;  3M9K A;  3DIE A;  1K0C A;  3W8J A;  2GZZ A;  3A5W A;  4XS1 A;  1PMT A;  2HZE A;  2X64 A;  1HNB A;  1AW9 A;  1Y25 A;  4WF4 A;  2K9F A;  2KOK A;  3LYP A;  4KDY A;  5IM9 A;  1X9M B;  4EUY A;  1WPI A;  1EOH A;  4MDC A;  5F07 A;  2I81 A;  2GQK A;  3GST A;  2P5Q A;  3PIN A;  4KB3 A;  1S3A A;  5HR3 A;  1GLQ A;  5DJL A;  3IR4 A;  1TRU A;  5DCH A;  3LWA A;  1NHY A;  3TJB A;  2J9H A;  4MZW A;  3WD6 A;  2LEG A;  3GMF A;  1YZX A;  2L5O A;  2OBI A;  2DLX A;  1JZR A;  1XWK A;  5J5N A;  3EYT A;  3MWH A;  2VCZ A;  2GZP A;  5IIZ A;  3FZ4 A;  4IW9 A;  5B6M A;  3VPQ A;  4MF6 A;  1A0R P;  1FB0 A;  1SKR B;  5EL8 A;  4ECJ A;  1E6B A;  1VF4 A;  1IYH A;  3J7Y k;  4JE1 A;  2I1U A;  5FWG A;  2R4V A;  3D5J A;  6GST A;  1F3B A;  1UA5 A;  1USB A;  3ME8 A;  1VF3 A;  5DDL A;  1F6M C;  1QQ2 A;  5DBQ A;  5IMD A;  1Z6N A;  1V98 A;  4ML1 A;  1TDI A;  3TGZ A;  1T4Y A;  3TUE A;  3QAW A;  19GS A;  3VLN A;  4POK A;  2H6X A;  3QFB C;  2AV4 A;  2JZT A;  1MD4 A;  2CAI A;  16GS A;  3ZL5 A;  1Y6E A;  4WXT A;  1T00 A;  1F2E A;  5JCG A;  4TN8 A;  1GRX A;  5CRD A;  2R6K A;  1GSY A;  1QUW A;  3KIJ A;  4BA7 A;  5IMZ A;  4ML6 A;  2JZR A;  3EC3 A;  1ERT A;  1EP7 A;  4WR4 A;  3US3 A;  2DSA A;  2VM2 A;  4I2T A;  4HJM A;  2LRT A;  1R4W A;  1QK8 A;  4OCE A;  2HSH A;  3D21 A;  2MBS A;  3HYP A;  3IAM 2;  1ZYE A;  2PVO C;  3ERG A;  3O6T A;  3K8N A;  4EKZ A;  3HCZ A;  1YF0 A;  4L0U A;  2GQL A;  1THO A;  2P31 A;  1A8L A;  3UOM A;  2OE0 A;  3WT1 A;  2FWG A;  1N2A A;  2WB9 A;  4TR0 A;  2YWO A;  4ID0 A;  2HE3 A;  4JU5 A;  4V2M A;  3EU3 A;  3GUS A;  3CSJ A;  2NVL A;  3W6G A;  3GH6 A;  3KMO A;  4WBR D;  1O6J A;  3GHA A;  4ECI A;  1M2A A;  2LNT A;  1SKS B;  4V2L A;  5KN3 A;  1A2L A;  2L4Q A;  2PVQ A;  2MMO A;  1TU7 A;  1AUC A;  5ECL B;  2DIZ A;  1OAZ A;  2YPM A;  4FYC A;  4BVX A;  1OC9 A;  4LA1 A;  5DAK A;  2C3T A;  1PL2 A;  2OA7 A;  2VCT A;  2B5Y A;  3ME7 A;  2AUV A;  1YKA A;  2GZY A;  3MNG A;  1TRV A;  2B5E A;  4TXO A;  5IO2 A;  4EVM A;  3HVS A;  2NPB A;  5D96 A;  4POM A;  1SYR A;  2GT6 A;  4RI7 A;  4IGJ A;  2DML A;  2KP2 A;  4NHZ A;  1GSF A;  2B6M A;  3IHQ A;  3A2V A;  17GS A;  1XWC A;  2VM1 A;  3D6I A;  4J2F A;  4G9H A;  1OYJ A;  3IAS 2;  3ZVJ D;  2N5F A;  3H1N A;  3NOF A;  1ZOF A;  1Z5Y E;  2YWI A;  3HD5 A;  1CQH A;  3S9F A;  1GSD A;  2HI7 A;  3GA4 A;  2CVK A;  2H66 A;  3NZN A;  4Z7X A;  4BWS A;  4NAX A;  2L6C A;  5JWO B;  3EVI A;  1MDK A;  2X8C A;  3HA9 A;  2FD3 A;  4O5R A;  2EIO A;  3QD9 A;  5ECP B;  2GSQ A;  2OAC A;  2DIY A;  1XW9 A;  1SYX A;  2C0D A;  3VWX A;  1IYI A;  9GSS A;  1M2D A;  2GTU A;  3SBC A;  1WJK A;  4F0B A;  2VUP A;  13GS A;  2A2R A;  1W89 A;  1MDJ A;  2FWE A;  1X5C A;  7GSS A;  2DJ2 A;  2H1D A;  2YNX A;  3APS A;  5ECH B;  2J23 A;  4YQM A;  1E2Y A;  4TR3 A;  4DEJ A;  5G5E A;  3EIN A;  3KXO A;  3BJ5 A;  1K3L A;  4IN0 A;  4AJ6 A;  3HVV A;  4J56 E;  4CW9 A;  4MJA A;  2VL2 C;  1JFU A;  1SEN A;  4HU9 A;  1FG4 A;  5CRH A;  4RQX A;  1NSW A;  4MK3 A;  1OC3 A;  5DAL B;  1SL0 B;  1ZZY A;  3Q18 A;  4L5O A;  4MJE A;  3EUR A;  1ST9 A;  3P2A A;  2HFD A;  2H0G A;  4OO4 A;  4GSN A;  3TJK A;  4MPF A;  3LG6 A;  3TKS E;  1T7P B;  3LEF A;  2FWH A;  2IFQ A;  2DJ0 A;  2LJR A;  1K0N A;  4EDZ A;  1G6W A;  4LL4 B;  1J0F A;  1SD9 A;  5A4V A;  4V1A p;  1ON4 A;  1A0F A;  3O3T A;  4QQ7 A;  3TKS A;  6GSS A;  1WMJ A;  3F3Q A;  4F82 A;  4G19 A;  4TOP A;  2YN1 A;  4EE0 A;  4HQZ A;  3ZTL A;  4AF2 A;  2OAD A;  4WKW A;  2F8F A;  5IPG A;  2F3M A;  1EOG A;  4IP1 A;  4FYB A;  3HHV A;  5A5K A;  1OKT A;  3H4K A;  4XHM A;  1M9A A;  2CAQ A;  1EWX A;  2V6O A;  3A3T A;  1GTA A;  1M2B A;  1G7O A;  3I43 A;  3KJY A;  4FO5 A;  2A4V A;  5HR0 A;  5ECN B;  3GTU B;  4HEA 2;  4RQR A;  1FO5 A;  1XPV A;  1AQW A;  1YKC A;  3C1R A;  1XZO A;  2VCV A;  3CRU A;  1WP0 A;  1EGR A;  2IMK A;  5KN2 A;  5IO0 A;  2G2Q A;  1ABA A;  4IJ3 A;  4ZIL A;  5CNW A;  10GS A;  2IPA A;  2AJQ B;  4K7N A;  4JRR A;  4ILF A;  5IMV A;  2HLS A;  1GSQ A;  3DXB A;  1K0D A;  1GH2 A;  1RK4 A;  2JU5 A;  3NIV A;  3ZIT A;  1PX6 A;  1BJX A;  1F9M A;  5J4U A;  1M7T A;  1WOU A;  3APO A;  4K9Z A;  2DMM A;  1PQN A;  3WGX A;  2C8U A;  1JLW A;  4EF0 A;  4KA0 A;  4X0X A;  2YJH A;  4L5L A;  1O81 A;  5F0G A;  3F63 A;  4JR6 A;  1A24 A;  3C73 A;  1ERV A;  4PUR A;  4LL1 B;  4MJC A;  4NWY A;  4N11 A;  3ZMK A;  3LXT A;  4XTS A;  3DKS A;  1GNE A;  3TJF A;  5HFK A;  3H8Q A;  1WWJ A;  2CZ2 A;  2WCI A;  1QXH A;  3IDV A;  3L0H A;  2HT9 A;  1FB6 A;  1LBK A;  1HYU A;  5ELG A;  4OO5 A;  1J08 A;  3UMA A;  3QAV A;  3FYG A;  5DQY A;  2LS5 A;  2WZ9 A;  4K7I A;  4GWR A;  1WIK A;  2CX4 A;  2MBT A;  3RPP A;  3F8U A;  4IQA A;  2N5A A;  3O76 A;  4MF5 A;  1ZCP A;  4HZ2 A;  5J3R A;  2CZ3 A;  1BX9 A;  5GST A;  1X5D A;  2IMD A;  4BPY A;  2LV3 A;  2WDU A;  4IEL A;  1V57 A;  3Q6O A;  2O85 A;  2C0F A;  3VWU A;  2IWT A;  3ZRD A;  1FAA A;  2DC5 A;  1T8E B;  5IOX A;  5AGY A;  2FA4 A;  6GSW A;  5E4W A;  2VIM A;  3M3M A;  3C71 A;  2R2J A;  3HJM A;  1SJ6 A;  2V2G A;  2AB6 A;  2PBJ A;  1HNC A;  5GAP D;  2IMF A;  1J9B A;  2GSS A;  2H71 A;  4ZBD A;  1URM A;  3D4M A;  5GZZ B;  2AAW A;  22GS A;  2HNL A;  4XCS A;  2YJ7 A;  1NM3 A;  4HZ4 A;  3GH9 A;  4KDX A;  4IBP A;  4ZL8 A;  1TKD B;  1TK0 B;  1HQO A;  4I6X A;  3F4S A;  4PNG A;  2ALB A;  3A2W A;  3KD0 A;  1ERW A;  2H1G A;  2PER A;  3VFI A;  4KW6 A;  2XPE A;  3TRQ A;  3D4T A;  4MPG A;  3HY2 A;  1M9B A;  5ECM B;  4V1A g;  3TDG A;  2P5R A;  2I3Y A;  4ECB A;  2BMX A;  5ENU A;  2V1M A;  4BL7 A;  3QOU A;  2YWN A;  3FY7 A;  2YAN A;  4NXI A;  2PUK C;  2M46 A;  1X5E A;  3VI5 A;  2PMT A;  1PA3 A;  1VF1 A;  3DEX A;  2YV9 A;  3D0Z A;  1EP8 A;  1K3Y A;  1B4Q A;  5CAX A;  3EMX A;  3KCM A;  4AGS A;  2CX3 A;  4YAV A;  3CMI A;  1TK8 B;  2GST A;  3N9J A;  2YOI A;  2JL4 A;  3L4N A;  5JWQ B;  4H86 A;  1AQV A;  3GL5 A;  1AQX A;  1PN9 A;  2L4C A;  3M0F A;  2XPD A;  2KHP A;  4EDY A;  3GTU A;  3PH9 A;  4BVY A;  1GP1 A;  3UVH A;  2RUE A;  3QDN A;  2H70 A;  5DCG A;  4IVF A;  4PUA A;  2QGV A;  1JZD A;  1BG5 A;  3KGK A;  2HYX A;  1XW5 A;  3MDK A;  2XBQ A;  2OKA A;  1X9S B;  1U3A A;  1K3O A;  1GUL A;  4X1U A;  3EU4 A;  3I69 A;  3U6V A;  4PQH A;  1MD3 A;  1V40 A;  4POB A;  2B7J A;  2FHE A;  5B7C A;  4KCE A;  4E8E A;  5CRG A;  1GUH A;  3N5O A;  1R26 A;  1ZMA A;  3F0I A;  1HD2 A;  2B1L A;  1A2J A;  5DJM A;  3IE3 A;  2VLT A;  1SK0 A;  4TVE A;  3GN3 A;  3GX0 A;  2AYT A;  5AIX A;  2B7K A;  3M8N A;  2VL2 A;  5E59 A;  2ON5 A;  4F0C A;  12GS A;  3GSS A; 
#chains in the Genus database with same CATH topology
 2H30 A;  1U88 A;  2WGR A;  4LLR A;  1YQ1 A;  1SK1 A;  4GTU A;  3FR3 A;  2FWF A;  2XHF A;  4GQF A;  3QR6 A;  1TP9 A;  2O89 A;  3ED3 A;  1ML6 A;  4YAP A;  1KTE A;  1OVN A;  1FHE A;  4TW5 A;  1UVZ A;  2H19 A;  3MIX A;  4ZB6 A;  1AAZ A;  1GTI A;  4EC0 A;  1XWB A;  1SK2 A;  4K5S A;  1JZO A;  4O32 A;  3DML A;  5F8B A;  2H76 A;  2D2Z A;  2AHE A;  1RW1 A;  2IN3 A;  4TXV A;  4V2N A;  3QFA C;  2LTK A;  1ZYP A;  4HUA A;  3FRC A;  4L0W A;  4NPB A;  1ERU A;  1B9Y C;  3UIW A;  5A4W A;  1EGO A;  2CA8 A;  3G9B A;  5J9C A;  3DVW A;  1TTZ A;  4GLT A;  5EY6 A;  5HQP A;  2RUF A;  1TOF A;  4WBJ A;  2K6V A;  2OBK A;  2V6K A;  1Q4J A;  3DGQ A;  3GNJ A;  1V9W A;  3LW9 A;  2C3Q A;  1FOV A;  5G5F A;  1H75 A;  5AN1 A;  3Q74 A;  3F9U A;  2RLI A;  3KP9 A;  3HXS A;  3G7Y A;  2FLS A;  4F2I A;  2C4J A;  1GSE A;  2BJX A;  2E0Q A;  2H0H A;  3KZQ A;  1BYE A;  1YY7 A;  1VRS D;  3ERW A;  5B8B A;  3RHB A;  5ECR B;  4KE3 A;  1EZK A;  2R0P A;  3RAZ A;  3TB2 A;  2MMZ A;  1VGL A;  1I9D A;  1GWC A;  2ZCT A;  1GUK A;  4EXJ A;  3MYD A;  2Z9S A;  3IC8 A;  2GSR A;  5BMU A;  2LQQ A;  1GNW A;  3ZRE A;  3C8E A;  3L9S A;  3P8W A;  3LOR A;  3H79 A;  3IOS A;  3CSI A;  4ZB8 A;  3CRT A;  2PN8 A;  1JZW A;  2QKE A;  2YZU A;  4NV2 A;  5ID2 B;  4HOJ A;  5AIV A;  1RQM A;  1UC7 A;  4ZXG A;  1GL8 A;  4XS4 B;  1K0A A;  3QCP A;  4OFN A;  2ZUP A;  3F4R A;  4QL9 A;  2XC2 A;  1GUM A;  1G7E A;  3DWV A;  1PRX A;  1FW1 A;  3FKF A;  1XVQ A;  3FMW A;  11GS A;  3IK9 A;  4MCU A;  5INY A;  4FIW A;  1M99 A;  4RI6 A;  1YDK A;  3WYW A;  4I2U A;  3TRX A;  1XWG A;  5GAN D;  2OJL A;  3HKR A;  2K8V A;  1SD8 A;  4AJ8 A;  2TRX A;  1I5G A;  2R5G A;  4EO3 A;  1OE7 A;  2FUG 2;  2JAD A;  4PUF C;  3GIX A;  2YP6 A;  5HFG A;  5LNK e;  3EE2 A;  4NHW A;  1XWA A;  2L59 A;  1AXD A;  3H93 A;  4G10 A;  2VL9 A;  4I5Q A;  1TI3 A;  2KUC A;  4F03 A;  1B9X C;  4DVC A;  2REM A;  4E8H A;  2X99 A;  3KH9 A;  1XW6 A;  3KP8 A;  2ES7 A;  3HDC A;  5GSS A;  2C0G A;  3BD2 A;  2X8G A;  3L9V A;  4ULX A;  2C3N A;  3GL3 A;  1O85 A;  4JBB A;  3TRP A;  2IMI A;  4TR1 B;  2N5B A;  4Q5N A;  1ZL9 A;  2JAC A;  2MYG A;  3IA1 A;  4JZQ A;  2VD0 A;  1YEP A;  1PN0 A;  2FCH A;  3CSH A;  5G31 A;  3G7J A;  2EIQ A;  3EWL A;  1K0O A;  3V1W A;  4WR5 A;  1HNA A;  3UVT A;  2H0I A;  1Z9H A;  1PGT A;  2P0G A;  3P90 A;  5J41 A;  1ILO A;  1PL1 A;  1TXX A;  1PSQ A;  3P7X A;  2DJJ A;  1XCC A;  5IMC A;  5D8I A;  5ECO B;  2GLR A;  5CO3 A;  3CXG A;  4K6X A;  2KP1 A;  1SU9 A;  5IOW A;  1DSB A;  3ZIV A;  4HJ2 A;  4WET A;  4EL1 A;  4IS0 A;  3CYN A;  2G0F A;  3UL3 A;  3LJR A;  3BBY A;  2DJ1 A;  2GVP A;  4D73 B;  2VLU A;  5H5R A;  5LD0 A;  3VI7 A;  1XFL A;  1ZYQ B;  1FVJ A;  3ERF A;  4MF7 A;  5COH A;  4P3Y B;  2C80 A;  2FGX A;  4O7H A;  2H1A A;  1H4O A;  1QMV A;  2A4H A;  1O7U A;  2ON7 A;  3QMX A;  5G30 A;  3ZYW A;  3RHC A;  2A2S A;  2C1Y A;  5CRE A;  1X0R A;  3DVX A;  4N0V A;  4J57 E;  5D93 A;  3UBK A;  4K2D A;  2NDO A;  1N8J A;  1JLV A;  4G0I A;  3VUR A;  2LJA A;  4GCI A;  4RUV A;  2IL3 A;  5KN0 A;  4MZB A;  5B8A A;  2FA8 A;  2MMN A;  3VPT A;  4ISD A;  2R3X A;  2LQO A;  2GQM A;  4KX4 A;  5D9W A;  18GS A;  1OKD A;  4XRA A;  4Q5Q A;  1TRW A;  2B5X A;  3VK9 A;  1X9W B;  3QPM A;  5FT3 A;  2JSY A;  3A5I A;  2RM5 A;  2O7K A;  2E2M A;  5IMA A;  1YEX A;  2CVD A;  2LUS A;  4OWY A;  3ZIJ A;  4XS6 A;  3HJP A;  3LQ7 A;  3FK8 A;  1O73 A;  4ACS A;  4ICY A;  4MAB A;  6GSY A;  5JCW A;  5KN1 A;  3IPZ A;  4K7O A;  3TJJ A;  2MMA A;  2PWJ A;  5G1K A;  4MH3 A;  3GKM A;  5L71 A;  4FQU A;  3TOT A;  2DJK A;  5LCZ A;  2M72 A;  4JED A;  4G0K A;  5DQS A;  1PX7 A;  1QGV A;  1U3I A;  3G7I A;  3IV4 A;  4Q5F A;  2VLV A;  3E0U A;  4MJB A;  2PGT A;  5C00 A;  3I9V 2;  4ZL9 A;  3L78 A;  5DAL A;  4GF0 A;  3GYK A;  4OCF A;  1A23 A;  5ECQ B;  1C72 A;  2YWM A;  3ISO A;  1EV9 A;  2NTO A;  4XIH A;  3HVN A;  4GSS A;  2H6Z A;  3M1G A;  4NMU A;  5ID2 A;  3VWV A;  4KUN A;  1EEM A;  4OFM A;  20GS A;  2HSM A;  2QA1 A;  2GS3 A;  4XS4 A;  4TRX A;  3AY8 A;  1MEK A;  2CV4 A;  3KTL A;  2EIR A;  1TW9 A;  4XRD A;  1XBS A;  2NBS A;  5JCU A;  2X4A A;  3KTB A;  4I97 A;  1THX A;  1M3J A;  1XIY A;  4BWQ A;  4K1F A;  5HR1 A;  4YKG A;  3WT2 A;  2VD1 A;  3GKK A;  1UN2 A;  1A2M A;  5H5Q A;  3ZLP A;  3IRA A;  4DSS B;  4WF5 A;  4CHS A;  2LJK A;  1AIU A;  1GTB A;  5HR2 A;  3TCO A;  3LSZ A;  2IFQ B;  4OFT A;  5IPH A;  1MTC A;  3ZZX A;  2YCD A;  1B4P A;  3U5R E;  3IC4 A;  3CTF A;  4ZIJ A;  4WEY A;  3F6F A;  1PKZ A;  4IKH A;  4KDU A;  1KEB A;  1U87 A;  1R5P A;  1A8Y A;  4X4J A;  5CRW A;  3GFK A;  1M0U A;  3FZ5 A;  1BAY A;  3KMN A;  1SL1 B;  2H6Y A;  4TR4 A;  1T3B A;  4A5P A;  2L6D A;  3FHK A;  2IME A;  1XOB A;  3DYR A;  3MSZ A;  4TR1 A;  2HZF A;  4HDE A;  1YJ6 A;  1XOA A;  5ELA A;  1TRS A;  5D9T A;  2YV7 A;  4HQS A;  1TU8 A;  4N30 A;  5G1L A;  4IQ1 A;  1S3D A;  3LFL A;  3FR9 A;  2M80 A;  1O8W A;  3UAR A;  2TRC P;  2L57 A;  3OR5 A;  3EPT A;  1CQG A;  4L8E A;  3GKN A;  4FYU A;  3KEB A;  1G6Y A;  4YH2 A;  3WGE A;  3M9J A;  2IJY A;  1W4V A;  5IMF A;  5EPF A;  4KCA A;  3W8S A;  3BCK A;  2O8V B;  1F37 A;  5B6N A;  1AC1 A;  5C04 A;  3FEU A;  1B48 A;  4D73 A;  4KH7 A;  2L5L A;  4YQV A;  1ZGN A;  2LNS A;  5FHI A;  1WRY A;  2KLX A;  1K0B A;  2WJU A;  1OC8 A;  4ZBB A;  2XBI A;  3BOA A;  2V41 A;  4OD7 A;  3ZFL A;  2VCQ A;  3RBT A;  5DVB A;  5D9X A;  1G0T A;  2DJ3 A;  2VL3 A;  4FH8 A;  2GGT A;  4IP6 A;  2H01 A;  1BED A;  3A2X A;  5ECK B;  1R5A A;  5ECI B;  3F3R A;  3C1S A;  2VOC A;  6GSV A;  2BTO T;  4K8M A;  1SJI A;  1PKW A;  4HSC X;  4MZC A;  1SL2 B;  4N10 A;  2EC4 A;  2H8L A;  4CDO A;  3FZ9 A;  2E7P A;  2E2G A;  1Z6M A;  3IBH A;  5H5S A;  2K18 A;  3LYK A;  2R0G A;  3KH7 A;  4MMM A;  2FY6 A;  4CY6 A;  3TKR A;  3RPN A;  4NV5 A;  3RDW A;  2LST A;  2I9H A;  2HZE B;  4BIK A;  4MNN A;  2JSZ A;  5D73 A;  4PTS A;  3MAK A;  5F06 A;  1R7H A;  1TI1 A;  6GSX A;  2R37 A;  2LKU A;  3CTG A;  1GSS A;  2WUL A;  2CQ9 A;  2OE3 A;  2O87 A;  3FW2 A;  4HU7 A;  1V58 A;  4KND A;  2I4A A;  3TJG A;  2H73 A;  1GTU A;  2CVB A;  4X43 A;  4PQI A;  1Z7P A;  5AIS A;  4PGT A;  3TKP A;  5CP1 A;  4PXO A;  5BRT A;  4PNF A;  3I6A A;  5ABR A;  14GS A;  4OMV A;  2CT6 A;  2HXK A;  1V2A A;  3GKX A;  2HRF A;  4I8B A;  4YQU A;  3ZVJ A;  3SWL A;  1LJR A;  1TJD A;  1B8X A;  6GSU A;  3EMP A;  2F8A A;  1DE2 A;  4QL7 A;  2QSI A;  4K0G A;  2VAF A;  2OE1 A;  1BQ7 A;  3GV1 A;  2LRC A;  2H72 A;  4USS A;  1PD2 1;  5CYY A;  3R2Q A;  4MA9 A;  2B1K A;  3FR6 A;  3C7M A;  2LRN A;  5JWR B;  2H74 A;  4DSS A;  1JHB A;  4JR4 A;  1WE0 A;  4ZL7 A;  4KAE A;  4DSQ A;  2H75 A;  2B3S A;  4KGI A;  4IJI A;  3WGD A;  1FOH A;  1KNG A;  3GRX A;  8GSS A;  4MP4 A;  2C0E A;  4PX1 A;  4N0Z A;  4K0N A;  3HJO A;  2GDR A;  2RM6 A;  3DD3 A;  2VCX A;  1U6T A;  2JZS A;  4PQ1 A;  3FZA A;  4Q5R A;  1KBN A;  1PFO A;  3Q19 A;  5A4U A;  4ECC A;  3VWW A;  3APQ A;  1ACV A;  3L9U A;  2RII A;  4IHU A;  2QC7 A;  3IK7 A;  2HRN A;  3QAG A;  2WFC A;  3HVX A;  3PR8 A;  2TIR A;  1M3I A;  4TKY A;  4KSO A;  4O92 A;  2V32 A;  3DRN A;  5HFI A;  1S3C A;  5IQY A;  3UJ1 A;  2WRT A;  5G2Z A;  2IIY A;  1EV4 A;  1FVK A;  4F9Z A;  2F9S A;  1NHO A;  3BCI A;  4GST A;  3IXR A;  1GLP A;  5EVO A;  5ECS A;  1SJZ A;  4DSR A;  2GT5 A;  2PU9 C;  3GX8 A;  1NW2 A;  3LXZ A;  4MLY A;  3E9J B;  2HSY A;  3F6D A;  2VO4 A;  3KM6 A;  3GUR A;  3TOU A;  1Z7R A;  3LGC A;  2F51 A;  4ZB9 A;  5J9B A;  4HS1 A;  3E3E A;  1QFN A;  1XG8 A;  3HZ8 A;  1XXU A;  1XVW A;  3CBU A;  3J7Y b;  1F3A A;  2VCW A;  1DBY A;  1DE1 A;  2ZNM A;  1Z3E A;  5F05 A;  3PPU A;  2WS2 A;  3UBL A;  3UAP A;  1O8X A;  2K8S A;  4BVX B;  4GXZ A;  4GRF A;  1OC9 B;  3TKQ A;  5DAK B;  4LMV A;  3ZML A;  5D9V A;  2X8H A;  1YF1 A;  2DBC A;  1TK5 B;  1MDI A;  4LMW A;  3F4T A;  1VF2 A;  4POL A;  3ZFB A;  4MH2 A;  4TXO B;  1EEJ A;  1LU4 A;  2YZH A;  2PPT A;  4AJ7 A;  4G2E A;  1SKW B;  3JCM L;  3D22 A;  4GQC A;  4ZBA A;  4HI7 A;  1Q98 A;  3UEM A;  3TKS C;  5KEJ A;  1OE8 A;  3HZ4 A;  1K0M A;  2MZC A;  1GSU A;  3PGT A;  4KSM A;  1DUG A;  2FNO A;  1T1V A;  2H1B A;  4EIQ A;  1T4Z A;  3M9K A;  3DIE A;  1K0C A;  3W8J A;  2GZZ A;  3A5W A;  4XS1 A;  1PMT A;  2HZE A;  2X64 A;  1HNB A;  1AW9 A;  1Y25 A;  4WF4 A;  2K9F A;  2KOK A;  3LYP A;  4KDY A;  5IM9 A;  5KOW A;  1X9M B;  4EUY A;  1WPI A;  1EOH A;  4MDC A;  5F07 A;  2I81 A;  2GQK A;  3GST A;  2P5Q A;  3PIN A;  4KB3 A;  1S3A A;  5HR3 A;  1GLQ A;  5DJL A;  4O5U A;  3IR4 A;  1TRU A;  5DCH A;  3LWA A;  1NHY A;  3TJB A;  2J9H A;  4MZW A;  3WD6 A;  2LEG A;  3GMF A;  1YZX A;  4KF9 A;  2L5O A;  2OBI A;  2DLX A;  1JZR A;  2DKH A;  1XWK A;  5J5N A;  3EYT A;  3MWH A;  2VCZ A;  2GZP A;  5IIZ A;  3FZ4 A;  4IW9 A;  5B6M A;  3VPQ A;  4MF6 A;  1A0R P;  1FB0 A;  1SKR B;  5EL8 A;  4ECJ A;  1E6B A;  1VF4 A;  1IYH A;  3J7Y k;  4JE1 A;  2I1U A;  5FWG A;  2R4V A;  3D5J A;  6GST A;  1F3B A;  1UA5 A;  3R3E A;  1USB A;  3ME8 A;  1VF3 A;  5DDL A;  4YKF A;  1F6M C;  1QQ2 A;  5DBQ A;  5IMD A;  1Z6N A;  1V98 A;  4ML1 A;  1TDI A;  3TGZ A;  1T4Y A;  3TUE A;  3QAW A;  19GS A;  3VLN A;  4POK A;  2H6X A;  3QFB C;  2AV4 A;  2JZT A;  1MD4 A;  2CAI A;  16GS A;  3ZL5 A;  1Y6E A;  4WXT A;  1T00 A;  1F2E A;  5JCG A;  4TN8 A;  4CY8 A;  1GRX A;  5CRD A;  2R6K A;  1GSY A;  1QUW A;  3KIJ A;  4BA7 A;  5IMZ A;  4ML6 A;  2JZR A;  3EC3 A;  1ERT A;  1EP7 A;  4WR4 A;  3US3 A;  2DSA A;  2VM2 A;  4I2T A;  4HJM A;  2LRT A;  1R4W A;  1QK8 A;  4OCE A;  2HSH A;  3D21 A;  2MBS A;  3HYP A;  3IAM 2;  1ZYE A;  2PVO C;  3ERG A;  3O6T A;  3K8N A;  4EKZ A;  3HCZ A;  1YF0 A;  4L0U A;  2GQL A;  1THO A;  2P31 A;  1A8L A;  3UOM A;  2OE0 A;  3WT1 A;  2FWG A;  1N2A A;  2WB9 A;  4TR0 A;  2YWO A;  4ID0 A;  2HE3 A;  4JU5 A;  4V2M A;  3EU3 A;  3GUS A;  3CSJ A;  2NVL A;  3W6G A;  3GH6 A;  3KMO A;  2UZ8 A;  4WBR D;  1O6J A;  3GHA A;  4ECI A;  1M2A A;  2LNT A;  1SKS B;  4V2L A;  5KN3 A;  1A2L A;  2L4Q A;  2PVQ A;  2MMO A;  1TU7 A;  1AUC A;  5ECL B;  2DIZ A;  1OAZ A;  2YPM A;  4FYC A;  4BVX A;  1OC9 A;  4LA1 A;  5DAK A;  2C3T A;  1PL2 A;  2OA7 A;  2VCT A;  2B5Y A;  3ME7 A;  2AUV A;  1YKA A;  2GZY A;  3MNG A;  1TRV A;  2B5E A;  4TXO A;  5IO2 A;  4EVM A;  3HVS A;  2NPB A;  5D96 A;  4POM A;  1SYR A;  2GT6 A;  4RI7 A;  4IGJ A;  2DML A;  2KP2 A;  2DKI A;  4NHZ A;  1GSF A;  2B6M A;  3IHQ A;  3A2V A;  17GS A;  1XWC A;  2VM1 A;  3D6I A;  4J2F A;  4G9H A;  1OYJ A;  3IAS 2;  3ZVJ D;  2N5F A;  3H1N A;  3NOF A;  1ZOF A;  1Z5Y E;  2YWI A;  3HD5 A;  1CQH A;  3S9F A;  1GSD A;  2HI7 A;  3GA4 A;  2CVK A;  2H66 A;  3NZN A;  4Z7X A;  4BWS A;  4NAX A;  2L6C A;  5JWO B;  3EVI A;  4EIP A;  1MDK A;  2X8C A;  3HA9 A;  2FD3 A;  4O5R A;  2EIO A;  3QD9 A;  5ECP B;  2GSQ A;  2OAC A;  2DIY A;  1XW9 A;  1SYX A;  2C0D A;  3VWX A;  1IYI A;  9GSS A;  1M2D A;  2GTU A;  3SBC A;  1WJK A;  4F0B A;  2VUP A;  13GS A;  2A2R A;  1W89 A;  1MDJ A;  2FWE A;  2A2P A;  1X5C A;  7GSS A;  2HRA A;  2DJ2 A;  2H1D A;  2YNX A;  3APS A;  5ECH B;  2J23 A;  4YQM A;  1E2Y A;  4TR3 A;  4DEJ A;  5G5E A;  3EIN A;  3KXO A;  3BJ5 A;  1K3L A;  4IN0 A;  4AJ6 A;  3HVV A;  4J56 E;  4Z2U A;  4CW9 A;  4MJA A;  2VL2 C;  1JFU A;  1SEN A;  4HU9 A;  1FG4 A;  5CRH A;  4RQX A;  1NSW A;  4MK3 A;  1OC3 A;  1S3R A;  5DAL B;  1SL0 B;  1ZZY A;  1ZYN A;  3Q18 A;  4L5O A;  4MJE A;  3EUR A;  1ST9 A;  3P2A A;  2HFD A;  2H0G A;  4OO4 A;  4GSN A;  3TJK A;  4MPF A;  3LG6 A;  3TKS E;  1T7P B;  3LEF A;  2FWH A;  2IFQ A;  2DJ0 A;  2LJR A;  1K0N A;  4EDZ A;  1G6W A;  4LL4 B;  1J0F A;  1SD9 A;  4BL7 B;  5A4V A;  4V1A p;  1ON4 A;  1A0F A;  3O3T A;  4QQ7 A;  3TKS A;  6GSS A;  1WMJ A;  3F3Q A;  3CQF A;  4F82 A;  4G19 A;  4TOP A;  2YN1 A;  4EE0 A;  4HQZ A;  3ZTL A;  4AF2 A;  2OAD A;  4WKW A;  2F8F A;  5IPG A;  2F3M A;  1EOG A;  4IP1 A;  4FYB A;  4Z2R A;  3HHV A;  5A5K A;  1OKT A;  3H4K A;  4XHM A;  1M9A A;  2CAQ A;  1EWX A;  2V6O A;  3A3T A;  1GTA A;  1M2B A;  1G7O A;  3I43 A;  3KJY A;  4FO5 A;  2A4V A;  5HR0 A;  5ECN B;  3GTU B;  4HEA 2;  4RQR A;  1FO5 A;  1XPV A;  1AQW A;  1YKC A;  3C1R A;  1XZO A;  4BVY B;  2VCV A;  3CRU A;  1WP0 A;  1EGR A;  2IMK A;  5KN2 A;  5IO0 A;  2G2Q A;  1ABA A;  4IJ3 A;  4ZIL A;  5CNW A;  10GS A;  2IPA A;  2AJQ B;  4K7N A;  4JRR A;  4ILF A;  5IMV A;  2HLS A;  1GSQ A;  3DXB A;  1K0D A;  1GH2 A;  1RK4 A;  2JU5 A;  3NIV A;  3ZIT A;  1PX6 A;  4K2X A;  1BJX A;  1F9M A;  5J4U A;  1M7T A;  1WOU A;  3APO A;  4K9Z A;  2DMM A;  1PQN A;  3WGX A;  2C8U A;  1JLW A;  4EF0 A;  4KA0 A;  4X0X A;  2YJH A;  4L5L A;  1O81 A;  5F0G A;  3F63 A;  4JR6 A;  1A24 A;  3C73 A;  1ERV A;  4PUR A;  4LL1 B;  4MJC A;  4NWY A;  4N11 A;  3ZMK A;  3LXT A;  4XTS A;  3DKS A;  1GNE A;  3TJF A;  2R0C A;  5HFK A;  3H8Q A;  1WWJ A;  2CZ2 A;  2WCI A;  1QXH A;  3IDV A;  3L0H A;  2HT9 A;  1FB6 A;  1LBK A;  1HYU A;  5ELG A;  4G0L A;  4OO5 A;  1J08 A;  3UMA A;  2X49 A;  3QAV A;  3FYG A;  5DQY A;  2LS5 A;  2WZ9 A;  4K7I A;  4GWR A;  1WIK A;  2CX4 A;  2MBT A;  3RPP A;  3F8U A;  4IQA A;  2N5A A;  3O76 A;  4MF5 A;  1ZCP A;  4HZ2 A;  5J3R A;  2CZ3 A;  1BX9 A;  5GST A;  1X5D A;  2IMD A;  4BPY A;  2LV3 A;  2WDU A;  4IEL A;  1V57 A;  3Q6O A;  2O85 A;  2C0F A;  3VWU A;  2IWT A;  3ZRD A;  1FAA A;  2DC5 A;  1T8E B;  5IOX A;  5AGY A;  2FA4 A;  6GSW A;  5E4W A;  2VIM A;  3M3M A;  3C71 A;  2R2J A;  3HJM A;  1SJ6 A;  5KOX A;  2V2G A;  2AB6 A;  2PBJ A;  1HNC A;  5GAP D;  2IMF A;  1J9B A;  2GSS A;  2H71 A;  4ZBD A;  1URM A;  3D4M A;  5GZZ B;  2AAW A;  22GS A;  2HNL A;  4XCS A;  2YJ7 A;  1NM3 A;  4HZ4 A;  3GH9 A;  4KDX A;  4IBP A;  4ZL8 A;  1TKD B;  1TK0 B;  1HQO A;  4I6X A;  3F4S A;  4PNG A;  2HRK A;  2ALB A;  3A2W A;  3KD0 A;  1ERW A;  2H1G A;  2PER A;  3VFI A;  4KW6 A;  2XPE A;  3TRQ A;  3D4T A;  4MPG A;  3HY2 A;  1M9B A;  4O5Q A;  4V1A g;  5ECM B;  3TDG A;  2P5R A;  2I3Y A;  4ECB A;  2BMX A;  5ENU A;  2V1M A;  4BL7 A;  3QOU A;  2YWN A;  3FY7 A;  2YAN A;  2QA2 A;  4NXI A;  2PUK C;  2M46 A;  1X5E A;  3VI5 A;  2PMT A;  1PA3 A;  1VF1 A;  3DEX A;  2YV9 A;  4K5R A;  3D0Z A;  1EP8 A;  1K3Y A;  1B4Q A;  5CAX A;  3EMX A;  3KCM A;  4AGS A;  2CX3 A;  4YAV A;  3CMI A;  1TK8 B;  2GST A;  3N9J A;  2YOI A;  2JL4 A;  3L4N A;  5JWQ B;  4H86 A;  1AQV A;  3GL5 A;  1AQX A;  1PN9 A;  2L4C A;  3M0F A;  2XPD A;  2KHP A;  4EDY A;  3GTU A;  3PH9 A;  4BVY A;  1GP1 A;  3UVH A;  2RUE A;  3QDN A;  2H70 A;  5DCG A;  4IVF A;  4PUA A;  2QGV A;  1JZD A;  1BG5 A;  3KGK A;  2HYX A;  1XW5 A;  3MDK A;  2XBQ A;  2OKA A;  1X9S B;  1U3A A;  1K3O A;  1GUL A;  4X1U A;  3EU4 A;  4Z2T A;  3I69 A;  3U6V A;  4PQH A;  1MD3 A;  1V40 A;  4POB A;  2B7J A;  2FHE A;  5B7C A;  4KCE A;  4E8E A;  5CRG A;  1GUH A;  3N5O A;  1R26 A;  1ZMA A;  3F0I A;  1HD2 A;  2B1L A;  1A2J A;  5DJM A;  3IE3 A;  2VLT A;  1SK0 A;  4TVE A;  3GN3 A;  3GX0 A;  2AYT A;  5AIX A;  2B7K A;  3IHG A;  3M8N A;  2VL2 A;  5E59 A;  2ON5 A;  4F0C A;  12GS A;  3GSS A; 
#chains in the Genus database with same CATH homology
 2H30 A;  1U88 A;  2WGR A;  4LLR A;  1YQ1 A;  1SK1 A;  4GTU A;  3FR3 A;  2FWF A;  2XHF A;  4GQF A;  3QR6 A;  1TP9 A;  2O89 A;  3ED3 A;  1ML6 A;  4YAP A;  1KTE A;  1OVN A;  1FHE A;  4TW5 A;  1UVZ A;  2H19 A;  3MIX A;  4ZB6 A;  1AAZ A;  1GTI A;  4EC0 A;  1XWB A;  1SK2 A;  4K5S A;  1JZO A;  4O32 A;  3DML A;  5F8B A;  2H76 A;  2D2Z A;  2AHE A;  1RW1 A;  2IN3 A;  4TXV A;  4V2N A;  3QFA C;  2LTK A;  1ZYP A;  4HUA A;  3FRC A;  4L0W A;  4NPB A;  1ERU A;  1B9Y C;  3UIW A;  5A4W A;  1EGO A;  2CA8 A;  3G9B A;  5J9C A;  3DVW A;  1TTZ A;  4GLT A;  5EY6 A;  5HQP A;  2RUF A;  1TOF A;  4WBJ A;  2K6V A;  2OBK A;  2V6K A;  1Q4J A;  3DGQ A;  3GNJ A;  1V9W A;  3LW9 A;  2C3Q A;  1FOV A;  5G5F A;  1H75 A;  5AN1 A;  3Q74 A;  3F9U A;  2RLI A;  3KP9 A;  3HXS A;  3G7Y A;  2FLS A;  4F2I A;  2C4J A;  1GSE A;  2BJX A;  2E0Q A;  2H0H A;  3KZQ A;  1BYE A;  1YY7 A;  1VRS D;  3ERW A;  5B8B A;  3RHB A;  5ECR B;  4KE3 A;  1EZK A;  2R0P A;  3RAZ A;  3TB2 A;  2MMZ A;  1VGL A;  1I9D A;  1GWC A;  2ZCT A;  1GUK A;  4EXJ A;  3MYD A;  2Z9S A;  3IC8 A;  2GSR A;  5BMU A;  2LQQ A;  1GNW A;  3ZRE A;  3C8E A;  3L9S A;  3P8W A;  3LOR A;  3H79 A;  3IOS A;  3CSI A;  4ZB8 A;  3CRT A;  2PN8 A;  1JZW A;  2QKE A;  2YZU A;  4NV2 A;  5ID2 B;  4HOJ A;  5AIV A;  1RQM A;  1UC7 A;  4ZXG A;  1GL8 A;  4XS4 B;  1K0A A;  3QCP A;  4OFN A;  2ZUP A;  3F4R A;  4QL9 A;  2XC2 A;  1GUM A;  1G7E A;  3DWV A;  1PRX A;  1FW1 A;  3FKF A;  1XVQ A;  3FMW A;  11GS A;  3IK9 A;  4MCU A;  5INY A;  4FIW A;  1M99 A;  4RI6 A;  1YDK A;  3WYW A;  4I2U A;  3TRX A;  1XWG A;  5GAN D;  2OJL A;  3HKR A;  2K8V A;  1SD8 A;  4AJ8 A;  2TRX A;  1I5G A;  2R5G A;  4EO3 A;  1OE7 A;  2FUG 2;  2JAD A;  4PUF C;  3GIX A;  2YP6 A;  5HFG A;  5LNK e;  3EE2 A;  4NHW A;  1XWA A;  2L59 A;  1AXD A;  3H93 A;  4G10 A;  2VL9 A;  4I5Q A;  1TI3 A;  2KUC A;  4F03 A;  1B9X C;  4DVC A;  2REM A;  4E8H A;  2X99 A;  3KH9 A;  1XW6 A;  3KP8 A;  2ES7 A;  3HDC A;  5GSS A;  2C0G A;  3BD2 A;  2X8G A;  3L9V A;  4ULX A;  2C3N A;  3GL3 A;  1O85 A;  4JBB A;  3TRP A;  2IMI A;  4TR1 B;  2N5B A;  4Q5N A;  1ZL9 A;  2JAC A;  2MYG A;  3IA1 A;  4JZQ A;  2VD0 A;  1YEP A;  1PN0 A;  2FCH A;  3CSH A;  5G31 A;  3G7J A;  2EIQ A;  3EWL A;  1K0O A;  3V1W A;  4WR5 A;  1HNA A;  3UVT A;  2H0I A;  1Z9H A;  1PGT A;  2P0G A;  3P90 A;  5J41 A;  1ILO A;  1PL1 A;  1TXX A;  1PSQ A;  3P7X A;  2DJJ A;  1XCC A;  5IMC A;  5D8I A;  5ECO B;  2GLR A;  5CO3 A;  3CXG A;  4K6X A;  2KP1 A;  1SU9 A;  5IOW A;  1DSB A;  3ZIV A;  4HJ2 A;  4WET A;  4EL1 A;  4IS0 A;  3CYN A;  2G0F A;  3UL3 A;  3LJR A;  3BBY A;  2DJ1 A;  2GVP A;  4D73 B;  2VLU A;  5H5R A;  5LD0 A;  3VI7 A;  1XFL A;  1ZYQ B;  1FVJ A;  3ERF A;  4MF7 A;  5COH A;  4P3Y B;  2C80 A;  2FGX A;  4O7H A;  2H1A A;  1H4O A;  1QMV A;  2A4H A;  1O7U A;  2ON7 A;  3QMX A;  5G30 A;  3ZYW A;  3RHC A;  2A2S A;  2C1Y A;  5CRE A;  1X0R A;  3DVX A;  4N0V A;  4J57 E;  5D93 A;  3UBK A;  4K2D A;  2NDO A;  1N8J A;  1JLV A;  4G0I A;  3VUR A;  2LJA A;  4GCI A;  4RUV A;  2IL3 A;  5KN0 A;  4MZB A;  5B8A A;  2FA8 A;  2MMN A;  3VPT A;  4ISD A;  2R3X A;  2LQO A;  2GQM A;  4KX4 A;  5D9W A;  18GS A;  1OKD A;  4XRA A;  4Q5Q A;  1TRW A;  2B5X A;  3VK9 A;  1X9W B;  3QPM A;  5FT3 A;  2JSY A;  3A5I A;  2RM5 A;  2O7K A;  2E2M A;  5IMA A;  1YEX A;  2CVD A;  2LUS A;  4OWY A;  3ZIJ A;  4XS6 A;  3HJP A;  3LQ7 A;  3FK8 A;  1O73 A;  4ACS A;  4ICY A;  4MAB A;  6GSY A;  5JCW A;  5KN1 A;  3IPZ A;  4K7O A;  3TJJ A;  2MMA A;  2PWJ A;  5G1K A;  4MH3 A;  3GKM A;  5L71 A;  4FQU A;  3TOT A;  2DJK A;  5LCZ A;  2M72 A;  4JED A;  4G0K A;  5DQS A;  1PX7 A;  1QGV A;  1U3I A;  3G7I A;  3IV4 A;  4Q5F A;  2VLV A;  3E0U A;  4MJB A;  2PGT A;  5C00 A;  3I9V 2;  4ZL9 A;  3L78 A;  5DAL A;  4GF0 A;  3GYK A;  4OCF A;  1A23 A;  5ECQ B;  1C72 A;  2YWM A;  3ISO A;  1EV9 A;  2NTO A;  4XIH A;  4GSS A;  2H6Z A;  3M1G A;  4NMU A;  5ID2 A;  3VWV A;  4KUN A;  1EEM A;  4OFM A;  20GS A;  2HSM A;  2QA1 A;  2GS3 A;  4XS4 A;  4TRX A;  3AY8 A;  1MEK A;  2CV4 A;  3KTL A;  2EIR A;  1TW9 A;  4XRD A;  1XBS A;  2NBS A;  5JCU A;  2X4A A;  3KTB A;  4I97 A;  1THX A;  1XIY A;  4BWQ A;  4K1F A;  5HR1 A;  4YKG A;  3WT2 A;  2VD1 A;  3GKK A;  1UN2 A;  1A2M A;  5H5Q A;  3ZLP A;  3IRA A;  4DSS B;  4WF5 A;  4CHS A;  2LJK A;  1AIU A;  1GTB A;  5HR2 A;  3TCO A;  3LSZ A;  2IFQ B;  4OFT A;  5IPH A;  1MTC A;  3ZZX A;  2YCD A;  1B4P A;  3U5R E;  3IC4 A;  3CTF A;  4ZIJ A;  4WEY A;  3F6F A;  1PKZ A;  4IKH A;  4KDU A;  1KEB A;  1U87 A;  1R5P A;  1A8Y A;  4X4J A;  5CRW A;  3GFK A;  1M0U A;  3FZ5 A;  1BAY A;  3KMN A;  1SL1 B;  2H6Y A;  4TR4 A;  1T3B A;  4A5P A;  2L6D A;  3FHK A;  2IME A;  1XOB A;  3DYR A;  3MSZ A;  4TR1 A;  2HZF A;  4HDE A;  1YJ6 A;  1XOA A;  5ELA A;  1TRS A;  5D9T A;  2YV7 A;  4HQS A;  1TU8 A;  4N30 A;  5G1L A;  4IQ1 A;  1S3D A;  3LFL A;  3FR9 A;  2M80 A;  1O8W A;  3UAR A;  2TRC P;  2L57 A;  3OR5 A;  3EPT A;  1CQG A;  4L8E A;  3GKN A;  4FYU A;  3KEB A;  1G6Y A;  4YH2 A;  3WGE A;  3M9J A;  2IJY A;  1W4V A;  5IMF A;  5EPF A;  4KCA A;  3W8S A;  3BCK A;  2O8V B;  1F37 A;  5B6N A;  1AC1 A;  5C04 A;  3FEU A;  1B48 A;  4D73 A;  4KH7 A;  2L5L A;  4YQV A;  1ZGN A;  2LNS A;  5FHI A;  1WRY A;  2KLX A;  1K0B A;  2WJU A;  1OC8 A;  4ZBB A;  2XBI A;  3BOA A;  2V41 A;  4OD7 A;  3ZFL A;  2VCQ A;  3RBT A;  5DVB A;  5D9X A;  1G0T A;  2DJ3 A;  2VL3 A;  4FH8 A;  2GGT A;  4IP6 A;  2H01 A;  1BED A;  3A2X A;  5ECK B;  1R5A A;  5ECI B;  3F3R A;  3C1S A;  2VOC A;  6GSV A;  2BTO T;  4K8M A;  1SJI A;  1PKW A;  4MZC A;  1SL2 B;  4N10 A;  2EC4 A;  2H8L A;  4CDO A;  3FZ9 A;  2E7P A;  2E2G A;  1Z6M A;  3IBH A;  5H5S A;  2K18 A;  3LYK A;  2R0G A;  3KH7 A;  4MMM A;  2FY6 A;  4CY6 A;  3TKR A;  3RPN A;  4NV5 A;  3RDW A;  2LST A;  2I9H A;  2HZE B;  4MNN A;  5D73 A;  2JSZ A;  4PTS A;  3MAK A;  5F06 A;  1R7H A;  1TI1 A;  6GSX A;  2R37 A;  2LKU A;  3CTG A;  1GSS A;  2WUL A;  2CQ9 A;  2OE3 A;  2O87 A;  3FW2 A;  4HU7 A;  1V58 A;  4KND A;  2I4A A;  3TJG A;  2H73 A;  1GTU A;  2CVB A;  4X43 A;  4PQI A;  1Z7P A;  5AIS A;  4PGT A;  3TKP A;  5CP1 A;  4PXO A;  5BRT A;  4PNF A;  3I6A A;  5ABR A;  14GS A;  4OMV A;  2CT6 A;  2HXK A;  1V2A A;  3GKX A;  2HRF A;  4I8B A;  4YQU A;  3ZVJ A;  3SWL A;  1LJR A;  1TJD A;  1B8X A;  6GSU A;  3EMP A;  2F8A A;  1DE2 A;  4QL7 A;  2QSI A;  4K0G A;  2VAF A;  2OE1 A;  1BQ7 A;  3GV1 A;  2LRC A;  2H72 A;  4USS A;  1PD2 1;  5CYY A;  3R2Q A;  4MA9 A;  2B1K A;  3FR6 A;  3C7M A;  2LRN A;  5JWR B;  2H74 A;  4DSS A;  1JHB A;  4JR4 A;  1WE0 A;  4ZL7 A;  4KAE A;  4DSQ A;  2H75 A;  2B3S A;  4KGI A;  4IJI A;  3WGD A;  1FOH A;  1KNG A;  3GRX A;  8GSS A;  4MP4 A;  2C0E A;  4PX1 A;  4N0Z A;  4K0N A;  3HJO A;  2GDR A;  2RM6 A;  3DD3 A;  2VCX A;  1U6T A;  2JZS A;  4PQ1 A;  3FZA A;  4Q5R A;  1KBN A;  3Q19 A;  5A4U A;  4ECC A;  3VWW A;  3APQ A;  1ACV A;  3L9U A;  2RII A;  4IHU A;  2QC7 A;  3IK7 A;  2HRN A;  3QAG A;  2WFC A;  3HVX A;  3PR8 A;  2TIR A;  4TKY A;  4KSO A;  4O92 A;  2V32 A;  3DRN A;  5HFI A;  1S3C A;  5IQY A;  3UJ1 A;  2WRT A;  5G2Z A;  2IIY A;  1EV4 A;  1FVK A;  4F9Z A;  2F9S A;  1NHO A;  3BCI A;  4GST A;  3IXR A;  1GLP A;  5EVO A;  5ECS A;  1SJZ A;  4DSR A;  2GT5 A;  2PU9 C;  3GX8 A;  1NW2 A;  3LXZ A;  4MLY A;  3E9J B;  2HSY A;  3F6D A;  2VO4 A;  3KM6 A;  3GUR A;  3TOU A;  1Z7R A;  3LGC A;  2F51 A;  4ZB9 A;  5J9B A;  4HS1 A;  3E3E A;  1QFN A;  3HZ8 A;  1XXU A;  1XVW A;  3CBU A;  3J7Y b;  1F3A A;  2VCW A;  1DBY A;  1DE1 A;  2ZNM A;  1Z3E A;  5F05 A;  3PPU A;  2WS2 A;  3UBL A;  3UAP A;  1O8X A;  2K8S A;  4BVX B;  4GXZ A;  4GRF A;  1OC9 B;  3TKQ A;  5DAK B;  4LMV A;  3ZML A;  5D9V A;  2X8H A;  1YF1 A;  2DBC A;  1TK5 B;  1MDI A;  4LMW A;  3F4T A;  1VF2 A;  4POL A;  3ZFB A;  4MH2 A;  4TXO B;  1EEJ A;  1LU4 A;  2YZH A;  2PPT A;  4AJ7 A;  4G2E A;  1SKW B;  3JCM L;  3D22 A;  4GQC A;  4ZBA A;  4HI7 A;  1Q98 A;  3UEM A;  3TKS C;  5KEJ A;  1OE8 A;  3HZ4 A;  1K0M A;  2MZC A;  1GSU A;  3PGT A;  4KSM A;  1DUG A;  2FNO A;  1T1V A;  2H1B A;  4EIQ A;  1T4Z A;  3M9K A;  3DIE A;  1K0C A;  3W8J A;  2GZZ A;  3A5W A;  4XS1 A;  1PMT A;  2HZE A;  2X64 A;  1HNB A;  1AW9 A;  1Y25 A;  4WF4 A;  2K9F A;  2KOK A;  3LYP A;  4KDY A;  5IM9 A;  5KOW A;  1X9M B;  4EUY A;  1WPI A;  1EOH A;  4MDC A;  5F07 A;  2I81 A;  2GQK A;  3GST A;  2P5Q A;  3PIN A;  4KB3 A;  1S3A A;  5HR3 A;  1GLQ A;  5DJL A;  4O5U A;  3IR4 A;  1TRU A;  5DCH A;  3LWA A;  1NHY A;  3TJB A;  2J9H A;  4MZW A;  3WD6 A;  2LEG A;  3GMF A;  1YZX A;  4KF9 A;  2L5O A;  2OBI A;  2DLX A;  1JZR A;  2DKH A;  1XWK A;  5J5N A;  3EYT A;  3MWH A;  2VCZ A;  2GZP A;  5IIZ A;  3FZ4 A;  4IW9 A;  5B6M A;  3VPQ A;  4MF6 A;  1A0R P;  1FB0 A;  1SKR B;  5EL8 A;  4ECJ A;  1E6B A;  1VF4 A;  1IYH A;  3J7Y k;  4JE1 A;  2I1U A;  5FWG A;  2R4V A;  3D5J A;  6GST A;  1F3B A;  1UA5 A;  3R3E A;  1USB A;  3ME8 A;  1VF3 A;  5DDL A;  4YKF A;  1F6M C;  1QQ2 A;  5DBQ A;  5IMD A;  1Z6N A;  1V98 A;  4ML1 A;  1TDI A;  3TGZ A;  1T4Y A;  3TUE A;  3QAW A;  19GS A;  3VLN A;  4POK A;  2H6X A;  3QFB C;  2AV4 A;  2JZT A;  1MD4 A;  2CAI A;  16GS A;  3ZL5 A;  1Y6E A;  4WXT A;  1T00 A;  1F2E A;  5JCG A;  4TN8 A;  4CY8 A;  1GRX A;  5CRD A;  2R6K A;  1GSY A;  1QUW A;  3KIJ A;  4BA7 A;  5IMZ A;  4ML6 A;  2JZR A;  3EC3 A;  1ERT A;  1EP7 A;  4WR4 A;  3US3 A;  2DSA A;  2VM2 A;  4I2T A;  4HJM A;  2LRT A;  1R4W A;  1QK8 A;  4OCE A;  2HSH A;  3D21 A;  2MBS A;  3HYP A;  3IAM 2;  1ZYE A;  2PVO C;  3ERG A;  3O6T A;  3K8N A;  4EKZ A;  3HCZ A;  1YF0 A;  4L0U A;  2GQL A;  1THO A;  2P31 A;  1A8L A;  3UOM A;  2OE0 A;  3WT1 A;  2FWG A;  1N2A A;  2WB9 A;  4TR0 A;  2YWO A;  4ID0 A;  2HE3 A;  4JU5 A;  4V2M A;  3EU3 A;  3GUS A;  3CSJ A;  2NVL A;  3W6G A;  3GH6 A;  3KMO A;  2UZ8 A;  4WBR D;  1O6J A;  3GHA A;  4ECI A;  1M2A A;  2LNT A;  1SKS B;  4V2L A;  5KN3 A;  1A2L A;  2L4Q A;  2PVQ A;  2MMO A;  1TU7 A;  1AUC A;  5ECL B;  2DIZ A;  1OAZ A;  2YPM A;  4FYC A;  4BVX A;  1OC9 A;  4LA1 A;  5DAK A;  2C3T A;  1PL2 A;  2OA7 A;  2VCT A;  2B5Y A;  3ME7 A;  2AUV A;  1YKA A;  2GZY A;  3MNG A;  1TRV A;  2B5E A;  4TXO A;  5IO2 A;  4EVM A;  3HVS A;  2NPB A;  5D96 A;  4POM A;  1SYR A;  2GT6 A;  4RI7 A;  4IGJ A;  2DML A;  2KP2 A;  2DKI A;  4NHZ A;  1GSF A;  2B6M A;  3IHQ A;  3A2V A;  17GS A;  1XWC A;  2VM1 A;  3D6I A;  4J2F A;  4G9H A;  1OYJ A;  3IAS 2;  3ZVJ D;  2N5F A;  3H1N A;  3NOF A;  1ZOF A;  1Z5Y E;  2YWI A;  3HD5 A;  1CQH A;  3S9F A;  1GSD A;  2HI7 A;  3GA4 A;  2CVK A;  2H66 A;  3NZN A;  4Z7X A;  4BWS A;  4NAX A;  2L6C A;  5JWO B;  3EVI A;  4EIP A;  1MDK A;  2X8C A;  3HA9 A;  2FD3 A;  4O5R A;  2EIO A;  3QD9 A;  5ECP B;  2GSQ A;  2OAC A;  2DIY A;  1XW9 A;  1SYX A;  2C0D A;  3VWX A;  1IYI A;  9GSS A;  1M2D A;  2GTU A;  3SBC A;  1WJK A;  4F0B A;  2VUP A;  13GS A;  2A2R A;  1W89 A;  1MDJ A;  2FWE A;  2A2P A;  1X5C A;  7GSS A;  2HRA A;  2DJ2 A;  2H1D A;  2YNX A;  3APS A;  5ECH B;  2J23 A;  4YQM A;  1E2Y A;  4TR3 A;  4DEJ A;  5G5E A;  3EIN A;  3KXO A;  3BJ5 A;  1K3L A;  4IN0 A;  4AJ6 A;  3HVV A;  4J56 E;  4Z2U A;  4CW9 A;  4MJA A;  2VL2 C;  1JFU A;  1SEN A;  4HU9 A;  1FG4 A;  5CRH A;  4RQX A;  1NSW A;  4MK3 A;  1OC3 A;  5DAL B;  1SL0 B;  1ZZY A;  1ZYN A;  3Q18 A;  4L5O A;  4MJE A;  3EUR A;  1ST9 A;  3P2A A;  2HFD A;  2H0G A;  4OO4 A;  4GSN A;  3TJK A;  4MPF A;  3LG6 A;  3TKS E;  1T7P B;  3LEF A;  2FWH A;  2IFQ A;  2DJ0 A;  2LJR A;  1K0N A;  4EDZ A;  1G6W A;  4LL4 B;  1J0F A;  1SD9 A;  4BL7 B;  5A4V A;  4V1A p;  1ON4 A;  1A0F A;  3O3T A;  4QQ7 A;  3TKS A;  6GSS A;  1WMJ A;  3F3Q A;  4F82 A;  4G19 A;  4TOP A;  2YN1 A;  4EE0 A;  4HQZ A;  3ZTL A;  4AF2 A;  2OAD A;  4WKW A;  2F8F A;  5IPG A;  2F3M A;  1EOG A;  4IP1 A;  4FYB A;  4Z2R A;  3HHV A;  5A5K A;  1OKT A;  3H4K A;  4XHM A;  1M9A A;  2CAQ A;  1EWX A;  2V6O A;  3A3T A;  1GTA A;  1M2B A;  1G7O A;  3I43 A;  3KJY A;  4FO5 A;  2A4V A;  5HR0 A;  5ECN B;  3GTU B;  4HEA 2;  4RQR A;  1FO5 A;  1XPV A;  1AQW A;  1YKC A;  3C1R A;  1XZO A;  4BVY B;  2VCV A;  3CRU A;  1WP0 A;  1EGR A;  2IMK A;  5KN2 A;  5IO0 A;  2G2Q A;  1ABA A;  4IJ3 A;  4ZIL A;  5CNW A;  10GS A;  2IPA A;  2AJQ B;  4K7N A;  4JRR A;  4ILF A;  5IMV A;  2HLS A;  1GSQ A;  3DXB A;  1K0D A;  1GH2 A;  1RK4 A;  2JU5 A;  3NIV A;  3ZIT A;  1PX6 A;  4K2X A;  1BJX A;  1F9M A;  5J4U A;  1M7T A;  1WOU A;  3APO A;  4K9Z A;  2DMM A;  1PQN A;  3WGX A;  2C8U A;  1JLW A;  4EF0 A;  4KA0 A;  4X0X A;  2YJH A;  4L5L A;  1O81 A;  5F0G A;  3F63 A;  4JR6 A;  1A24 A;  3C73 A;  1ERV A;  4PUR A;  4LL1 B;  4MJC A;  4NWY A;  4N11 A;  3ZMK A;  3LXT A;  4XTS A;  3DKS A;  1GNE A;  3TJF A;  2R0C A;  5HFK A;  3H8Q A;  1WWJ A;  2CZ2 A;  2WCI A;  1QXH A;  3IDV A;  3L0H A;  2HT9 A;  1FB6 A;  1LBK A;  1HYU A;  5ELG A;  4G0L A;  4OO5 A;  1J08 A;  3UMA A;  2X49 A;  3QAV A;  3FYG A;  5DQY A;  2LS5 A;  2WZ9 A;  4K7I A;  4GWR A;  1WIK A;  2CX4 A;  2MBT A;  3RPP A;  3F8U A;  4IQA A;  2N5A A;  3O76 A;  4MF5 A;  1ZCP A;  4HZ2 A;  5J3R A;  2CZ3 A;  1BX9 A;  5GST A;  1X5D A;  2IMD A;  4BPY A;  2LV3 A;  2WDU A;  4IEL A;  1V57 A;  3Q6O A;  2O85 A;  2C0F A;  3VWU A;  2IWT A;  3ZRD A;  1FAA A;  2DC5 A;  1T8E B;  5IOX A;  5AGY A;  2FA4 A;  6GSW A;  5E4W A;  2VIM A;  3M3M A;  3C71 A;  2R2J A;  3HJM A;  1SJ6 A;  5KOX A;  2V2G A;  2AB6 A;  2PBJ A;  1HNC A;  5GAP D;  2IMF A;  1J9B A;  2GSS A;  2H71 A;  4ZBD A;  1URM A;  3D4M A;  5GZZ B;  2AAW A;  22GS A;  2HNL A;  4XCS A;  2YJ7 A;  1NM3 A;  4HZ4 A;  3GH9 A;  4KDX A;  4IBP A;  4ZL8 A;  1TKD B;  1TK0 B;  1HQO A;  4I6X A;  3F4S A;  4PNG A;  2HRK A;  2ALB A;  3A2W A;  3KD0 A;  1ERW A;  2H1G A;  2PER A;  3VFI A;  4KW6 A;  2XPE A;  3TRQ A;  3D4T A;  4MPG A;  3HY2 A;  1M9B A;  4O5Q A;  4V1A g;  5ECM B;  3TDG A;  2P5R A;  2I3Y A;  4ECB A;  2BMX A;  5ENU A;  2V1M A;  4BL7 A;  3QOU A;  2YWN A;  3FY7 A;  2YAN A;  2QA2 A;  4NXI A;  2PUK C;  2M46 A;  1X5E A;  3VI5 A;  2PMT A;  1PA3 A;  1VF1 A;  3DEX A;  2YV9 A;  4K5R A;  3D0Z A;  1EP8 A;  1K3Y A;  1B4Q A;  5CAX A;  3EMX A;  3KCM A;  4AGS A;  2CX3 A;  4YAV A;  3CMI A;  1TK8 B;  2GST A;  3N9J A;  2YOI A;  2JL4 A;  3L4N A;  5JWQ B;  4H86 A;  1AQV A;  3GL5 A;  1AQX A;  1PN9 A;  2L4C A;  3M0F A;  2XPD A;  2KHP A;  4EDY A;  3GTU A;  3PH9 A;  4BVY A;  1GP1 A;  3UVH A;  2RUE A;  3QDN A;  2H70 A;  5DCG A;  4IVF A;  4PUA A;  2QGV A;  1JZD A;  1BG5 A;  3KGK A;  2HYX A;  1XW5 A;  3MDK A;  2XBQ A;  2OKA A;  1X9S B;  1U3A A;  1K3O A;  1GUL A;  4X1U A;  3EU4 A;  4Z2T A;  3I69 A;  3U6V A;  4PQH A;  1MD3 A;  1V40 A;  4POB A;  2B7J A;  2FHE A;  5B7C A;  4KCE A;  4E8E A;  5CRG A;  1GUH A;  3N5O A;  1R26 A;  1ZMA A;  3F0I A;  1HD2 A;  2B1L A;  1A2J A;  5DJM A;  3IE3 A;  2VLT A;  1SK0 A;  4TVE A;  3GN3 A;  3GX0 A;  2AYT A;  5AIX A;  2B7K A;  3IHG A;  3M8N A;  2VL2 A;  5E59 A;  2ON5 A;  4F0C A;  12GS A;  3GSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...