1FG4A

Structure of tryparedoxin ii
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
145
structure length
145
Chain Sequence
SGLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPCRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDFPWPNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords TRYPAREDOXIN II
publication title Structures of tryparedoxins revealing interaction with trypanothione.
pubmed doi rcsb
source organism Crithidia fasciculata
total genus 45
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1fg4A00
1URMA 3M8NA 3M3MA 2R37A 2HT9A 3LORA 4ACSA 3ZFBA 2X64A 2BJXA 3LG6A 1PL1A 2GSRA 1FO5A 4POMA 3TKQA 5GAPD 2Z9SA 3CSJA 2I81A 2DLXA 5ABRA 2MMZA 2YV9A 3IK7A 4JBBA 1Y25A 4HQSA 2MBSA 3EMPA 1UC7A 3LYPA 2IMEA 2NTOA 2QGVA 1F3AA 1SK1A 2H74A 1G0TA 2OACA 4OD7A 4ML6A 1WJKA 3M9JA 1T00A 4XTSA 1YZXA 2CVKA 2VCZA 3VWWA 2VCXA 4YQUA 3O6TA 3DXBA 2VD1A 1G6YA 1XW9A 3IPZA 4IJIA 5G5FA 3VLNA 6GSWA 4TKYA 3H1NA 5AIXA 1KBNA 3TRPA 1ZMAA 1PA3A 1OC9B 2HNLA 1Y6EA 1KEBA 1EP8A 1AQXA 5DDLA 4ZB9A 3KH9A 3TJBA 2YZUA 3UVTA 3GX0A 1GP1A 3FZ5A 2HE3A 4AJ7A 3BCIA 4CW9A 3LSZA 3LYKA 4XS6A 1TRSA 1JZDA 1ZYEA 1JLWA 4TR1A 1Z6MA 1S3DA 2QKEA 3QOUA 3TKSA 3TRQA 3VI7A 4TRXA 3APQA 3ZL5A 2GVPA 1ST9A 4ZBBA 1BEDA 5ELAA 5JWRB 3FRCA 3IC4A 2JSYA 4ZL8A 1OAZA 3VWXA 1G6WA 1WIKA 1SYXA 3ZZXA 3HJPA 4WXTA 3TOTA 1UN2A 4EE0A 3FK8A 5AISA 1SD8A 3UMAA 3FYGA 1OYJA 2V2GA 5IMCA 3RAZA 5H5QA 2PU9C 4WKWA 5ID2B 3FKFA 2VL3A 3QR6A 2DMMA 1U3AA 2PMTA 4WEYA 3F63A 2E2GA 4G19A 2CZ2A 2VLVA 3P8WA 4BA7A 1PMTA 1GNWA 5ECOB 2WDUA 3TUEA 2PPTA 2HFDA 4BVYA 3LGCA 1B4QA 1Q98A 5C00A 1TW9A 2OADA 3KGKA 3DGQA 1K0AA 3QAWA 4ECJA 1MTCA 1V58A 4HZ2A 4LA1A 2VCVA 4EDZA 3Q74A 1OC3A 3ZYWA 1Z7RA 3KMNA 4K7IA 3WYWA 5ECMB 2VD0A 3KM6A 3DWVA 1VF2A 5E4WA 3TGZA 3TJJA 2VAFA 3C73A 1M9AA 2OE0A 4K9ZA 2O8VB 4GLTA 5J41A 3QD9A 13GSA 2QSIA 4GQCA 5ELGA 3LJRA 1XWCA 1THXA 5AN1A 3SWLA 2H70A 4O7HA 5CYYA 2HZEA 3HKRA 3UOMA 3QCPA 4HZ4A 3FR9A 3I43A 1THOA 1B9XC 1R5PA 3GFKA 2LEGA 1T8EB 2J23A 3KJYA 4IW9A 1SL0B 1O8XA 3RBTA 2EIRA 5A5KA 4MPGA 5JWOB 4YAPA 5ECIB 3DEXA 3L9VA 1XCCA 3HJOA 2F51A 5L71A 1FW1A 1MEKA 4NWYA 1B48A 1JLVA 4FYBA 1X5EA 3K8NA 4ECIA 2WULA 1SL1B 2RLIA 3GKKA 4EVMA 4DSSA 1KNGA 4NMUA 4RQXA 2FNOA 5JCUA 3TKPA 2M72A 3ZVJD 3NZNA 3G7IA 2WGRA 2F3MA 1T1VA 2B1KA 1YEPA 3LXTA 4WBRD 3ISOA 1EGOA 2V6KA 4ZL7A 4GTUA 1NM3A 5GAND 3N9JA 1U87A 1B8XA 2VOCA 4X43A 2AYTA 1GSEA 3L0HA 3RHCA 1QQ2A 3VFIA 4N11A 4D73A 4ZBDA 3W6GA 1FVKA 2N5FA 1YJ6A 3CMIA 2VCTA 4WBJA 4O92A 1Z3EA 1SK2A 1A8LA 4ECCA 2WCIA 5DVBA 1HQOA 3KTBA 2VLUA 4I5QA 5D8IA 3GL3A 4GRFA 3EVIA 3DMLA 5F07A 1AQWA 4ZB8A 2H1AA 2YNXA 5A4VA 3PGTA 2CVBA 1K0DA 2AHEA 1OC9A 1UVZA 5DCGA 3NOFA 3F9UA 2FUG2 1PKZA 3ZRDA 1ML6A 2L4CA 5KEJA 1PX6A 3G7YA 1OE8A 4TVEA 1I9DA 3L9SA 1A2MA 1TRUA 2L57A 4RI7A 3FR3A 5HFIA 3F6FA 4ISDA 1QK8A 3LEFA 1TK0B 2GZYA 3ZIJA 3EINA 4I8BA 3CTGA 4G10A 2LKUA 1PX7A 1GSQA 2IMIA 3TCOA 2HYXA 4BPYA 1TI1A 4EKZA 2JZRA 2DJ2A 5ECRB 2GQMA 2PVOC 1DSBA 3D6IA 5F06A 5IMZA 4IELA 2H1GA 2ON5A 1DUGA 4XS4A 2P0GA 1Z9HA 1QUWA 1B4PA 2VLTA 2HZEB 5JCWA 5IPGA 4L5OA 4GSTA 2P31A 4OO5A 5CP1A 2LS5A 3D21A 1X0RA 4F03A 1M9BA 3QFAC 4KDXA 6GSYA 3US3A 5HR3A 2DJ1A 4IBPA 3SBCA 3QAVA 4Z7XA 1H4OA 4RQRA 4JZQA 2JADA 2OBIA 4YH2A 4XCSA 3I9V2 2VL2A 3KMOA 4OFMA 4FO5A 2TIRA 2OBKA 4MMMA 5B8AA 4GSSA 3QDNA 2B7JA 1JHBA 1SENA 5KN3A 4DVCA 2K8VA 1TDIA 4GWRA 2VM1A 3TB2A 2OKAA 2FWFA 2AJQB 3RPPA 4KX4A 2RM6A 2VIMA 1EEMA 1GSSA 3CRTA 4LLRA 4H86A 4BWSA 2F8FA 2YWNA 3F3QA 5JCGA 1ZYQB 1W4VA 1XVQA 1WE0A 3DKSA 3D0ZA 1K3YA 4ZL9A 1BQ7A 1TK8B 3KEBA 3RHBA 1GL8A 3FZ4A 3P90A 2D2ZA 5ECNB 1ABAA 5IOXA 4PNFA 2BMXA 2V41A 3GA4A 5HR1A 1O85A 4ZB6A 3GV1A 1GSUA 1B9YC 1MDJA 3IHQA 5GSSA 4KA0A 2FD3A 1EOHA 5EPFA 5HFGA 4HUAA 1ZGNA 3TJFA 4AJ6A 2MMOA 3VPTA 3CSIA 1F2EA 8GSSA 4D73B 2FLSA 4IVFA 1X5DA 1AW9A 2M46A 3D5JA 1O6JA 1U6TA 4PQ1A 2WRTA 1N2AA 4BWQA 3GTUB 2K9FA 1U88A 1GTIA 3F3RA 4XRAA 2NVLA 5D73A 1TK5B 4NPBA 2YOIA 2KUCA 4NAXA 3Q19A 3F4RA 1YKCA 1RQMA 3AY8A 5IMDA 3GN3A 1GLPA 5B6NA 4TR0A 4K2DA 12GSA 3HCZA 3VURA 1R26A 4LMWA 4E8EA 4O32A 1GSYA 1TU7A 4I2TA 2RIIA 4HU9A 3FZAA 2WFCA 2GT6A 4V1Ap 5A4WA 1S3CA 3VWUA 2E2MA 2A4VA 5AGYA 2LQOA 5CNWA 2HRFA 3U6VA 4L0WA 1AUCA 2JZSA 1FB0A 2HSHA 3CYNA 2JL4A 3MSZA 1SD9A 1TP9A 1F6MC 6GSXA 2R6KA 4DSQA 3EC3A 4JRRA 2LNSA 4IS0A 2OE3A 1BAYA 1MDKA 5G1LA 2LSTA 5COHA 5G31A 4MJCA 5ECLB 5CRHA 4GQFA 4XS4B 4XHMA 2L59A 4TR3A 3P2AA 2I4AA 4OMVA 4K6XA 2V1MA 3BCKA 5B7CA 3D22A 2JACA 5D9WA 3VK9A 3HY2A 2DJ3A 6GSTA 4ILFA 5C04A 4GXZA 2K8SA 2ES7A 3Q18A 4MCUA 2PERA 2IN3A 3TJGA 2GT5A 2ZNMA 3A5WA 2R2JA 1K0NA 1W89A 1TKDB 2RM5A 4FYCA 4OFTA 1A8YA 2DIZA 4TXVA 4Q5FA 3QFBC 2IMFA 2GTUA 2P5QA 3H93A 4AGSA 5H5RA 3M9KA 2WB9A 3BBYA 4Q5QA 2VCQA 3ZVJA 2H01A 4PGTA 5G1KA 1A24A 4X1UA 2C4JA 2H0HA 2ON7A 2H66A 1GH2A 4IP6A 2LRCA 4PQHA 2MBTA 4ZILA 1TRWA 1Z5YE 4HOJA 2IL3A 3GKXA 3U5RE 4WF4A 2A2RA 1XFLA 2B5YA 1GSDA 2B7KA 3QAGA 3TKRA 1HNAA 5G2ZA 3ED3A 3EU4A 2AAWA 1V40A 2MMAA 3QMXA 4K0NA 9GSSA 5KN2A 5IM9A 3L4NA 4J57E 2L5LA 3IAM2 1M2AA 2C1YA 4MJEA 5ECQB 2VM2A 1K0OA 3A2XA 2O89A 3F8UA 2JSZA 4MZCA 1YF1A 4LL4B 5DBQA 3O3TA 4OWYA 5J5NA 2TRCP 2KP2A 3DVWA 1XBSA 2O7KA 1HYUA 5DAKB 3IK9A 3IXRA 2JU5A 3GKMA 3TOUA 2CX3A 4MP4A 3J7Yb 3I69A 4KH7A 1JZOA 4I6XA 1ERWA 3KH7A 5IMAA 1ZL9A 1GTAA 4PURA 2KLXA 2R3XA 4F2IA 22GSA 5J9BA 4N0VA 2IMDA 2G2QA 3EYTA 1O81A 3W8SA 4RUVA 1J9BA 4HJ2A 3ZIVA 3IOSA 1WOUA 3DIEA 2N5AA 2IFQB 2F8AA 1OE7A 4KB3A 5CRDA 2FA4A 3F4SA 4NHZA 4CDOA 2GSQA 1XVWA 3EMXA 3VI5A 1WWJA 2X8HA 3WT2A 3HVVA 1ERTA 3E0UA 1HD2A 4HI7A 3QPMA 2LRTA 2YJ7A 3GYKA 2FWEA 1BG5A 5IO0A 2X8GA 1CQGA 2LJAA 1X9SB 2TRXA 20GSA 1O8WA 4BL7A 1ACVA 2C0GA 1M2DA 5DJLA 1RW1A 5F8BA 1GSFA 1R5AA 2YANA 3FZ9A 3L9UA 1N8JA 1XXUA 1KTEA 2C80A 4EO3A 4OCFA 4KUNA 2WJUA 4ECBA 4PUAA 2EC4A 3GTUA 5DQYA 3KTLA 4QQ7A 1F3BA 3LQ7A 1LBKA 2ZCTA 5HFKA 1YEXA 3TDGA 1ON4A 2NBSA 3HDCA 2VO4A 2B1LA 2LNTA 2QC7A 4ID0A 1SKRB 4OO4A 2H72A 1VRSD 4XS1A 4PQIA 2YZHA 3KIJA 2REMA 4K1FA 5CAXA 5J4UA 3PINA 3H8QA 4JE1A 4F9ZA 5AIVA 3G9BA 1JZRA 4K7OA 1G7OA 1SKSB 2PN8A 1U3IA 1X9WB 3GNJA 3GH9A 2CT6A 1XWBA 4WETA 4QL9A 1ZOFA 5FT3A 4V2LA 4N30A 2F9SA 2VCWA 1A0RP 3IBHA 4KCEA 3BJ5A 2H76A 2H1BA 2GQKA 2V32A 3DD3A 1ERUA 3L78A 5B8BA 2WZ9A 1GTUA 1AXDA 5ECSA 4LMVA 1VF4A 1ZZYA 2H73A 2GLRA 5FHIA 4YAVA 4FIWA 3GRXA 3HVXA 1E2YA 2N5BA 6GSVA 1VGLA 1VF3A 3IR4A 3C8EA 2K6VA 2HZFA 1XWGA 1CQHA 3ME8A 1I5GA 4HQZA 3H4KA 4YQMA 2HSYA 5DALB 1YY7A 1ERVA 4K0GA 1V98A 2PGTA 2AUVA 2GZPA 4TXOA 3FR6A 5DQSA 5HR2A 1JFUA 3UARA 2FA8A 1SKWB 3C7MA 3PH9A 2YWIA 2DIYA 2YPMA 1SU9A 1EZKA 1X5CA 4V1Ag 3C1RA 2LV3A 4MLYA 3FW2A 5GSTA 2IWTA 1Z6NA 5B6MA 1QXHA 4XIHA 1QFNA 1EGRA 2B5EA 3WGEA 3EU3A 3GH6A 1A0FA 3UBLA 3UAPA 2YJHA 3A2WA 1TXXA 2C0DA 3RDWA 5G30A 1DE2A 1TJDA 5IIZA 1BYEA 3ZMKA 1J08A 3E9JB 2CQ9A 3UVHA 4TR4A 4L5LA 1UA5A 4FH8A 1EEJA 5EY6A 5LD0A 4KW6A 2CAIA 5EL8A 3LWAA 3ME7A 2GS3A 5E59A 4KGIA 2YCDA 2A2SA 4IGJA 1WPIA 2LRNA 2C0FA 1K0CA 3WD6A 3BOAA 3IRAA 4NXIA 2VL9A 3I6AA 4KSMA 3CBUA 5DAKA 1H75A 4G2EA 5DCHA 4Q5RA 4EC0A 1PKWA 3A3TA 1QGVA 2YWOA 5ENUA 2DMLA 2FHEA 3Q6OA 1OC8A 2VUPA 3HA9A 3ZLPA 2DJ0A 3ZTLA 2RUFA 5IMFA 3TRXA 1SJ6A 2NPBA 1G7EA 4EXJA 5D96A 2XBIA 5LCZA 4NV2A 2C8UA 2DBCA 1XZOA 2LJRA 6GSSA 3R2QA 3WGXA 3H79A 2PBJA 4MJAA 3CSHA 3J7Yk 2CVDA 4MK3A 16GSA 2XC2A 2IFQA 3ZFLA 3HZ4A 4K8MA 2C3TA 2H0IA 1T4YA 4MDCA 3VWVA 2GZZA 3JCML 5F0GA 1XW5A 5D9TA 3MDKA 2IIYA 4ULXA 3TJKA 11GSA 5HQPA 4HS1A 4TOPA 3UIWA 1E6BA 1OKTA 1FAAA 4MZWA 5INYA 2LJKA 4NHWA 4G9HA 4GF0A 4POBA 3ERWA 2XPDA 1MDIA 2GGTA 3ZITA 4ZXGA 1FVJA 17GSA 3DYRA 1V9WA 3KP9A 3F4TA 3V1WA 2XHFA 3M1GA 4WF5A 4HEA2 2RUEA 1XW6A 3O76A 2B6MA 2H1DA 4JEDA 4CHSA 4JU5A 1EV4A 2J9HA 2PUKC 2FWHA 4WR5A 3HXSA 4NV5A 4KDUA 3MWHA 2P5RA 2LQQA 1XOBA 1XOAA 3GX8A 2X99A 2GSTA 1PGTA 3GMFA 1Z7PA 1GLQA 3S9FA 4F0BA 3GIXA 3GHAA 3GUSA 2PVQA 3EWLA 1M2BA 1SK0A 1AQVA 3CXGA 2MMNA 4HJMA 4KNDA 3DVXA 1WMJA 3EE2A 3IE3A 3LFLA 3G7JA 5H5SA 1FHEA 2HXKA 4TXOB 3P7XA 2G0FA 1OKDA 4MA9A 2CV4A 2GSSA 4QL7A 3HD5A 4IN0A 4EDYA 4FYUA 5D9VA 2C3NA 1IYIA 1TRVA 4K7NA 3CTFA 4KDYA 5IQYA 3ERGA 1VF1A 2H75A 3D4MA 2B3SA 4MJBA 5F05A 1X9MB 2I3YA 3MNGA 5LNKe 4TN8A 3F0IA 2R5GA 2DJJA 18GSA 2PWJA 2YWMA 1GWCA 5JWQB 3C1SA 1NW2A 1M0UA 1GUHA 1YKAA 5ECPB 3ZMLA 4MF6A 4IQ1A 1Q4JA 3CRUA 4PXOA 1TU8A 2YP6A 2FWGA 2IPAA 4V2NA 4O5RA 4N10A 5ECHB 2I1UA 2ALBA 4EL1A 2KP1A 3KP8A 1A23A 1NHOA 1GULA 3KXOA 1C72A 1XIYA 4IP1A 1OVNA 1GUKA 2XPEA 5DALA 2WS2A 4HDEA 2ZUPA 4J56E 4TW5A 3WT1A 1R4WA 1V2AA 4MF7A 2V6OA 5IMVA 5ECKB 4MH2A 4ZIJA 3N5OA 4L8EA 1A2LA 2FGXA 1XWAA 2B5XA 1BJXA 2O87A 5D93A 10GSA 2C3QA 1NHYA 5D9XA 3HJMA 1K0MA 2GDRA 2H30A 1A2JA 4ZBAA 3A2VA 5CO3A 1SL2B 3ERFA 4DEJA 1YF0A 2IMKA 2O85A 3F6DA 2DC5A 2H0GA 3D4TA 4JR4A 7GSSA 2OA7A 4POKA 5CRGA 5J3RA 3W8JA 1T3BA 1GRXA 1TI3A 1PQNA 3FEUA 1EP7A 3M0FA 3DRNA 4JR6A 1SYRA 3IAS2 3GURA 2E0QA 4YQVA 2MZCA 4E8HA 2VL2C 2H71A 1XPVA 3RPNA 1V57A 1PSQA 1PD21 3VPQA 1M7TA 3GL5A 4IJ3A 4XRDA 2H6ZA 4EUYA 2MYGA 1FB6A 1TOFA 1DE1A 4TR1B 5G5EA 2YN1A 2K18A 3HZ8A 3GSTA 1BX9A 2OE1A 1ZCPA 5IO2A 4HU7A 2R4VA 5IPHA 3BD2A 3UEMA 3KZQA 4AJ8A 1K3LA 2HI7A 4ML1A 3UL3A 3MAKA 1SJIA 3GSSA 2HRNA 2BTOT 1AAZA 1HNCA 3HHVA 2JZTA 2CX4A 1AC1A 4IQAA 4KE3A 2DJKA 4GSNA 5DJMA 2XBQA 1ILOA 5HR0A 5J9CA 2H6YA 1JZWA 2EIOA 1EWXA 2EIQA 4WR4A 1T7PB 5EVOA 4MF5A 4F0CA 1AIUA 4N0ZA 4OFNA 4X0XA 4EF0A 1S3AA 4IKHA 1DBYA 4MPFA 3KCMA 4BVXA 4MZBA 2AB6A 1T4ZA 4AF2A 1IYHA 2CA8A 4I2UA 2I9HA 2IJYA 1NSWA 2M80A 4Q5NA 4MABA 3FHKA 5CREA 1O7UA 5KN0A 1FOVA 2OJLA 2H8LA 1SJZA 1M99A 5GZZB 1HNBA 3GKNA 1MD3A 2KHPA 2FCHA 2H6XA 4IHUA 4KCAA 5A4UA 1GNEA 1R7HA 2HLSA 4V2MA 4PNGA 1QMVA 1MD4A 2LUSA 1J0FA 4PUFC 1FG4A 4J2FA 4P3YB 1F9MA 2KOKA 3E3EA 5IOWA 1USBA 2AV4A 2FY6A 1GUMA 2X8CA 4POLA 2E7PA 3IDVA 3UBKA 2L4QA 5ID2A 2DSAA 1RK4A 1WP0A 3TKSE 3FY7A 2L5OA 4L0UA 1LJRA 1PN9A 1GTBA 3HVSA 3OR5A 1F37A 1TTZA 3TKSC 5KN1A 2C0EA 4OCEA 3EURA 3NIVA 19GSA 4RI6A 3LXZA 2H19A 4LL1B 1YDKA 2NDOA 3WGDA 3ZREA 5FWGA 1XWKA 2GQLA 1K3OA 3APOA 3KD0A 4DSRA 1YQ1A 3IV4A 2L6CA 2YV7A 2L6DA 1EOGA 1PL2A 1K0BA 1O73A 6GSUA 4F82A 1PRXA 1LU4A 4DSSB 3APSA 1WRYA 4GCIA 2LTKA 2CAQA 14GSA 4KAEA 3UJ1A 2CZ3A 3HYPA 4I97A 3C71A 4PX1A 3PR8A 4MH3A 5CRWA 4KSOA 1EV9A 3IA1A
chains in the Genus database with same CATH superfamily
1URMA 3M8NA 3M3MA 2R37A 2HT9A 3LORA 4ACSA 3ZFBA 2X64A 2BJXA 3LG6A 1PL1A 2GSRA 1FO5A 4POMA 3TKQA 5GAPD 2Z9SA 3CSJA 2I81A 2DLXA 5ABRA 2MMZA 2YV9A 3IK7A 4JBBA 1Y25A 4HQSA 2MBSA 3EMPA 1UC7A 3LYPA 2IMEA 4BIKA 2NTOA 2QGVA 1F3AA 1SK1A 2H74A 1G0TA 2OACA 4OD7A 4ML6A 1WJKA 3M9JA 1T00A 4XTSA 4CY6A 1YZXA 2CVKA 2VCZA 3VWWA 2VCXA 4YQUA 3O6TA 3DXBA 2VD1A 1G6YA 1XW9A 3IPZA 4IJIA 5G5FA 3VLNA 6GSWA 4TKYA 3H1NA 5AIXA 1KBNA 3TRPA 1ZMAA 1PA3A 1OC9B 2HNLA 1Y6EA 1KEBA 1S3RA 1EP8A 1AQXA 5DDLA 4ZB9A 2X49A 3KH9A 3TJBA 2YZUA 3UVTA 3GX0A 1GP1A 3FZ5A 2HE3A 4AJ7A 3BCIA 4CW9A 3LSZA 3LYKA 4XS6A 1TRSA 1JZDA 1ZYEA 1JLWA 4TR1A 1Z6MA 1S3DA 2QKEA 3QOUA 3TKSA 3TRQA 3VI7A 4TRXA 3APQA 3ZL5A 2GVPA 1ST9A 4ZBBA 1BEDA 5ELAA 5JWRB 3FRCA 3IC4A 2JSYA 4ZL8A 1OAZA 3VWXA 1G6WA 1WIKA 1SYXA 3ZZXA 3HJPA 4WXTA 3TOTA 1UN2A 4EE0A 3FK8A 5AISA 1SD8A 3UMAA 3FYGA 1OYJA 2V2GA 5IMCA 3RAZA 5H5QA 2PU9C 4WKWA 5ID2B 3FKFA 2VL3A 3HVNA 3QR6A 2DMMA 1U3AA 2PMTA 4WEYA 3F63A 2E2GA 4G19A 2CZ2A 2VLVA 3P8WA 4BA7A 4KF9A 1PMTA 1GNWA 5ECOB 2WDUA 3TUEA 2PPTA 2HFDA 4BVYA 3LGCA 1B4QA 1Q98A 5C00A 1TW9A 2OADA 3KGKA 3DGQA 1K0AA 3QAWA 4ECJA 1MTCA 1V58A 4HZ2A 4LA1A 2VCVA 4EDZA 3Q74A 1OC3A 3ZYWA 1Z7RA 5BMUA 3KMNA 4K7IA 3WYWA 5ECMB 2VD0A 3KM6A 3DWVA 1VF2A 5E4WA 3TGZA 3TJJA 3IC8A 2VAFA 3C73A 1M9AA 2OE0A 4K9ZA 2O8VB 3MYDA 4GLTA 5J41A 3QD9A 13GSA 2QSIA 4GQCA 5ELGA 3LJRA 1XWCA 1THXA 1M3IA 5AN1A 3SWLA 2H70A 4O7HA 5CYYA 2HZEA 3HKRA 3UOMA 3QCPA 4HZ4A 3FR9A 3I43A 1THOA 1B9XC 1R5PA 3GFKA 2LEGA 1T8EB 2J23A 3KJYA 4IW9A 1SL0B 1O8XA 3MIXA 3RBTA 2EIRA 5A5KA 4MPGA 4A5PA 5JWOB 4YAPA 5ECIB 3DEXA 3L9VA 1PFOA 1XCCA 3HJOA 2F51A 5L71A 1FW1A 1MEKA 4NWYA 1B48A 1JLVA 4FYBA 1X5EA 3K8NA 4ECIA 2WULA 1SL1B 2RLIA 3GKKA 4EVMA 4DSSA 1KNGA 4NMUA 4RQXA 2FNOA 4G0LA 5JCUA 3TKPA 2M72A 3ZVJD 3NZNA 3G7IA 2WGRA 2F3MA 3R3EA 1T1VA 2B1KA 1YEPA 3LXTA 4WBRD 3ISOA 1EGOA 2V6KA 4ZL7A 4GTUA 1NM3A 5GAND 3N9JA 1U87A 1B8XA 2VOCA 4X43A 2AYTA 1GSEA 3L0HA 3RHCA 1QQ2A 3VFIA 4N11A 4D73A 4ZBDA 3W6GA 4PTSA 1FVKA 2N5FA 1YJ6A 3CMIA 2VCTA 4WBJA 4O92A 1Z3EA 1SK2A 1A8LA 4ECCA 2WCIA 5DVBA 1HQOA 3KTBA 2VLUA 4I5QA 3GL3A 4GRFA 5D8IA 3EVIA 3DMLA 1AQWA 5F07A 4ZB8A 2H1AA 2YNXA 5A4VA 3PGTA 2CVBA 1K0DA 2AHEA 1OC9A 1UVZA 5DCGA 3NOFA 3F9UA 2FUG2 1PKZA 3ZRDA 1ML6A 2L4CA 5KEJA 1PX6A 3G7YA 1OE8A 4TVEA 1I9DA 3L9SA 1A2MA 1TRUA 2L57A 4RI7A 3FR3A 5HFIA 3F6FA 4ISDA 1QK8A 3LEFA 1TK0B 2GZYA 3ZIJA 3EINA 4I8BA 3CTGA 4G10A 2LKUA 1PX7A 1GSQA 2IMIA 3TCOA 2HYXA 4BPYA 1TI1A 4EKZA 2JZRA 2DJ2A 5ECRB 2GQMA 2PVOC 1DSBA 3D6IA 5F06A 5IMZA 3IHGA 4IELA 2H1GA 2ON5A 1DUGA 4XS4A 2P0GA 1Z9HA 1QUWA 1B4PA 2VLTA 2HZEB 5JCWA 5IPGA 4L5OA 4GSTA 2P31A 4OO5A 5CP1A 2LS5A 3D21A 1X0RA 4F03A 1M9BA 3QFAC 4KDXA 6GSYA 3US3A 5HR3A 2DJ1A 4IBPA 3SBCA 3QAVA 4Z7XA 1H4OA 4RQRA 4JZQA 2JADA 2OBIA 1ZYNA 4YH2A 4XCSA 3I9V2 2VL2A 3KMOA 4OFMA 4FO5A 2TIRA 2OBKA 2QA2A 4MMMA 5B8AA 4GSSA 3QDNA 2B7JA 1JHBA 1SENA 5KN3A 4DVCA 2K8VA 1TDIA 4GWRA 2VM1A 3TB2A 2OKAA 2FWFA 2AJQB 3RPPA 4KX4A 2RM6A 2VIMA 1EEMA 1GSSA 3CRTA 4LLRA 4H86A 4BWSA 2F8FA 2YWNA 3F3QA 5JCGA 1ZYQB 1W4VA 1XVQA 1WE0A 3DKSA 3D0ZA 1K3YA 4ZL9A 1BQ7A 1TK8B 3KEBA 3RHBA 1GL8A 3FZ4A 3P90A 2D2ZA 5ECNB 1ABAA 5IOXA 4G0KA 4PNFA 2BMXA 2V41A 3GA4A 5HR1A 1O85A 4ZB6A 3GV1A 1GSUA 1B9YC 1MDJA 3IHQA 5GSSA 5KOWA 4KA0A 2FD3A 1EOHA 5EPFA 4YKFA 5HFGA 4HUAA 1ZGNA 3TJFA 4AJ6A 2MMOA 3VPTA 3CSIA 1F2EA 8GSSA 4D73B 2FLSA 4IVFA 1X5DA 1AW9A 2M46A 3D5JA 1O6JA 1U6TA 4PQ1A 2WRTA 1N2AA 4BWQA 3GTUB 2K9FA 1U88A 1GTIA 3F3RA 4XRAA 5BRTA 2NVLA 5D73A 1TK5B 4NPBA 4HSCX 2YOIA 2KUCA 4NAXA 3Q19A 3F4RA 1YKCA 1RQMA 3AY8A 5IMDA 3GN3A 1GLPA 5B6NA 4TR0A 4K2DA 12GSA 3HCZA 4MNNA 3VURA 1R26A 4LMWA 4E8EA 4O32A 1GSYA 3FMWA 1TU7A 4I2TA 2RIIA 4HU9A 3FZAA 2WFCA 2GT6A 4V1Ap 5A4WA 1S3CA 3VWUA 2E2MA 2A4VA 5AGYA 2LQOA 5CNWA 2HRFA 3U6VA 4L0WA 1AUCA 2JZSA 1FB0A 2HSHA 3CYNA 2JL4A 3MSZA 1SD9A 1TP9A 1F6MC 6GSXA 2R6KA 4DSQA 3EC3A 4JRRA 2LNSA 4IS0A 2OE3A 1BAYA 1MDKA 5G1LA 2LSTA 5COHA 5G31A 4MJCA 5ECLB 5CRHA 4GQFA 4XS4B 4XHMA 2L59A 4TR3A 3P2AA 2I4AA 4OMVA 4K6XA 2V1MA 3BCKA 5B7CA 3D22A 2JACA 5D9WA 3VK9A 3HY2A 1ZYPA 2DJ3A 6GSTA 4ILFA 5C04A 4GXZA 2K8SA 2ES7A 3Q18A 4MCUA 2PERA 2IN3A 3TJGA 2GT5A 2ZNMA 3A5WA 2R2JA 1K0NA 1W89A 1TKDB 2RM5A 4FYCA 4OFTA 1A8YA 2DIZA 4TXVA 4Q5FA 3QFBC 2IMFA 1FOHA 2GTUA 2P5QA 3H93A 4AGSA 5H5RA 3M9KA 2WB9A 3BBYA 4Q5QA 2VCQA 3ZVJA 2H01A 4PGTA 5G1KA 1A24A 4X1UA 2C4JA 2H0HA 2ON7A 2H66A 1GH2A 4IP6A 2LRCA 4PQHA 2MBTA 4ZILA 1TRWA 1Z5YE 4HOJA 2IL3A 3GKXA 3U5RE 4WF4A 2A2RA 1XFLA 2B5YA 2HSMA 1GSDA 2B7KA 3QAGA 3TKRA 1HNAA 5G2ZA 3ED3A 3EU4A 2R0CA 2AAWA 1V40A 2MMAA 3QMXA 4K0NA 9GSSA 5KN2A 5IM9A 3L4NA 4J57E 2L5LA 3IAM2 1M2AA 2C1YA 4MJEA 5ECQB 2VM2A 1K0OA 3A2XA 2O89A 3F8UA 2JSZA 4MZCA 1YF1A 4LL4B 5DBQA 3O3TA 4OWYA 5J5NA 2TRCP 2KP2A 3DVWA 1XBSA 2O7KA 1HYUA 5DAKB 3IK9A 3IXRA 2JU5A 3GKMA 3TOUA 2CX3A 4MP4A 3J7Yb 3I69A 4KH7A 1JZOA 4I6XA 1ERWA 3KH7A 5IMAA 1ZL9A 1GTAA 4PURA 2KLXA 2R3XA 4F2IA 22GSA 5J9BA 4N0VA 2IMDA 2G2QA 3EYTA 1O81A 3W8SA 4RUVA 1J9BA 4HJ2A 3ZIVA 3IOSA 2UZ8A 1WOUA 4Z2UA 3DIEA 2N5AA 2IFQB 2F8AA 1OE7A 4KB3A 5CRDA 2FA4A 3F4SA 4NHZA 4CDOA 2GSQA 1XVWA 3EMXA 3VI5A 1WWJA 2X8HA 3WT2A 3HVVA 1XG8A 1ERTA 3E0UA 1HD2A 4HI7A 3QPMA 2LRTA 2YJ7A 3GYKA 2FWEA 1BG5A 4K2XA 5IO0A 2X8GA 1CQGA 2LJAA 1X9SB 2TRXA 20GSA 1O8WA 4BL7A 1ACVA 2C0GA 1M2DA 5DJLA 1RW1A 5F8BA 1GSFA 1R5AA 2YANA 3FZ9A 3L9UA 1N8JA 1PN0A 1XXUA 1KTEA 2C80A 4EO3A 4OCFA 4KUNA 2WJUA 4ECBA 4PUAA 2EC4A 3GTUA 5DQYA 3KTLA 4QQ7A 1F3BA 3LQ7A 1LBKA 2ZCTA 5HFKA 1YEXA 3TDGA 1ON4A 2NBSA 3HDCA 2VO4A 2B1LA 2LNTA 2QC7A 4ID0A 1SKRB 4OO4A 2H72A 1VRSD 4XS1A 4PQIA 2YZHA 3KIJA 2REMA 4K1FA 5CAXA 5J4UA 3PINA 3H8QA 4JE1A 4F9ZA 5AIVA 3G9BA 1JZRA 4K7OA 1G7OA 1SKSB 2PN8A 1U3IA 1X9WB 3GNJA 3GH9A 2CT6A 1XWBA 4WETA 4QL9A 1ZOFA 5FT3A 4V2LA 4N30A 2F9SA 2VCWA 1A0RP 3IBHA 4KCEA 3BJ5A 2H76A 2H1BA 2GQKA 2V32A 3DD3A 1ERUA 3L78A 5B8BA 2WZ9A 1GTUA 1AXDA 5ECSA 4LMVA 1VF4A 1ZZYA 2H73A 2GLRA 5FHIA 4EIPA 4YAVA 4FIWA 2HRAA 3GRXA 3HVXA 1E2YA 2N5BA 6GSVA 1VGLA 1VF3A 3IR4A 3C8EA 2K6VA 2HZFA 1XWGA 1CQHA 3ME8A 1I5GA 4HQZA 3H4KA 4YQMA 2HSYA 5DALB 1YY7A 1ERVA 4K0GA 1V98A 2PGTA 2AUVA 2GZPA 4TXOA 3FR6A 5DQSA 5HR2A 1JFUA 3UARA 2FA8A 1SKWB 3C7MA 3PH9A 2YWIA 2DIYA 2YPMA 1SU9A 1EZKA 1X5CA 4V1Ag 3C1RA 2LV3A 4K5SA 4MLYA 3FW2A 5GSTA 2IWTA 1Z6NA 5B6MA 1QXHA 4XIHA 1QFNA 1EGRA 2B5EA 3WGEA 3EU3A 3GH6A 1A0FA 3UBLA 3UAPA 2YJHA 3A2WA 1TXXA 2C0DA 3RDWA 5G30A 1DE2A 1TJDA 5IIZA 1BYEA 3ZMKA 1J08A 3E9JB 2CQ9A 3UVHA 4TR4A 4L5LA 1UA5A 4FH8A 1EEJA 5EY6A 5LD0A 2DKHA 4KW6A 2CAIA 5EL8A 3LWAA 3ME7A 2GS3A 5E59A 4KGIA 2YCDA 2A2SA 4IGJA 1WPIA 2LRNA 2C0FA 1K0CA 3WD6A 3BOAA 4G0IA 4BL7B 3IRAA 4NXIA 2VL9A 3I6AA 4KSMA 3CBUA 5DAKA 1H75A 4G2EA 5DCHA 4Q5RA 4EC0A 1PKWA 3A3TA 1QGVA 2YWOA 5ENUA 2DMLA 2FHEA 3Q6OA 1OC8A 2VUPA 3HA9A 3ZLPA 2DJ0A 3LW9A 2RUFA 3ZTLA 5IMFA 3TRXA 1SJ6A 2NPBA 1G7EA 4EXJA 5D96A 2XBIA 5LCZA 4NV2A 2C8UA 2DBCA 1XZOA 2LJRA 6GSSA 3R2QA 3WGXA 3H79A 2PBJA 4K5RA 4MJAA 3CSHA 3J7Yk 2CVDA 4MK3A 16GSA 2XC2A 2IFQA 3ZFLA 3HZ4A 4K8MA 2C3TA 2H0IA 2A4HA 1T4YA 4MDCA 3VWVA 2GZZA 3JCML 5F0GA 1XW5A 5D9TA 3MDKA 2IIYA 4ULXA 3TJKA 11GSA 5HQPA 4HS1A 4TOPA 3UIWA 1E6BA 1OKTA 1FAAA 4MZWA 5INYA 2LJKA 4NHWA 4G9HA 4GF0A 4POBA 3ERWA 2XPDA 4BVXB 1MDIA 2GGTA 3ZITA 4ZXGA 1FVJA 17GSA 3DYRA 1V9WA 3KP9A 3F4TA 3V1WA 2XHFA 3M1GA 4WF5A 4HEA2 2RUEA 1XW6A 3O76A 2B6MA 2H1DA 4JEDA 4CHSA 4JU5A 4Z2TA 1EV4A 2J9HA 2PUKC 2FWHA 4WR5A 3HXSA 4NV5A 4KDUA 3MWHA 2P5RA 2LQQA 1XOBA 1XOAA 3GX8A 2X99A 2GSTA 1PGTA 3GMFA 1Z7PA 1GLQA 3S9FA 4F0BA 3GIXA 3GHAA 3GUSA 2PVQA 3EWLA 1M2BA 1SK0A 1AQVA 3CXGA 2MMNA 4HJMA 4KNDA 3DVXA 1WMJA 3EE2A 3IE3A 3LFLA 3G7JA 5H5SA 1FHEA 2HXKA 4TXOB 3P7XA 2G0FA 1OKDA 4MA9A 2CV4A 2GSSA 4QL7A 3HD5A 4IN0A 2QA1A 4EDYA 4FYUA 5D9VA 2C3NA 1IYIA 1TRVA 4K7NA 3CTFA 4KDYA 5IQYA 3ERGA 1VF1A 2H75A 3D4MA 2B3SA 4MJBA 5F05A 1X9MB 2I3YA 3MNGA 4Z2RA 5LNKe 4TN8A 3F0IA 2R5GA 2DJJA 18GSA 2PWJA 2YWMA 1GWCA 5JWQB 3C1SA 1NW2A 1M0UA 1GUHA 1YKAA 5ECPB 3ZMLA 4MF6A 4IQ1A 1Q4JA 3CRUA 4PXOA 1TU8A 2YP6A 2FWGA 2IPAA 4V2NA 4O5RA 4N10A 5ECHB 2I1UA 2ALBA 4EL1A 2KP1A 3EPTA 3KP8A 1A23A 1NHOA 1GULA 3KXOA 1C72A 1XIYA 4IP1A 1OVNA 1GUKA 2XPEA 5DALA 2WS2A 4HDEA 2ZUPA 4J56E 4FQUA 4TW5A 3WT1A 1R4WA 1V2AA 4MF7A 4O5QA 2V6OA 5IMVA 2R0GA 5ECKB 4MH2A 4ZIJA 3N5OA 4L8EA 1A2LA 2FGXA 1XWAA 2B5XA 1BJXA 2O87A 5D93A 10GSA 2C3QA 1NHYA 5D9XA 3HJMA 1K0MA 2GDRA 2H30A 1A2JA 4ZBAA 3A2VA 5CO3A 1M3JA 1SL2B 3ERFA 4DEJA 1YF0A 2IMKA 2O85A 3F6DA 2R0PA 2DC5A 2H0GA 3D4TA 4JR4A 7GSSA 2OA7A 4POKA 5CRGA 5J3RA 3W8JA 1T3BA 1GRXA 1TI3A 1PQNA 3FEUA 1EP7A 3M0FA 3DRNA 4JR6A 1SYRA 3IAS2 3GURA 2E0QA 2A2PA 4YQVA 4X4JA 2MZCA 4E8HA 2VL2C 2H71A 1XPVA 3RPNA 1V57A 1PSQA 1PD21 3VPQA 1M7TA 3GL5A 4IJ3A 4XRDA 2H6ZA 4EUYA 2MYGA 4EIQA 1FB6A 1TOFA 1DE1A 4TR1B 5G5EA 2YN1A 2K18A 3HZ8A 3GSTA 1BX9A 2OE1A 1ZCPA 5IO2A 4HU7A 2R4VA 5IPHA 3BD2A 3UEMA 3KZQA 4AJ8A 1K3LA 2HRKA 2HI7A 4ML1A 3UL3A 3MAKA 1SJIA 3A5IA 3GSSA 2HRNA 4ICYA 2BTOT 2DKIA 4YKGA 1AAZA 1HNCA 3HHVA 2JZTA 2CX4A 1AC1A 4IQAA 4KE3A 2DJKA 4GSNA 5DJMA 2XBQA 1ILOA 5HR0A 5J9CA 2H6YA 3PPUA 1JZWA 2EIOA 1EWXA 2EIQA 4WR4A 1T7PB 5EVOA 4MF5A 4F0CA 1AIUA 4N0ZA 4OFNA 4BVYB 4X0XA 4EF0A 1S3AA 4IKHA 1DBYA 4MPFA 3KCMA 4BVXA 4MZBA 2AB6A 1T4ZA 4AF2A 1IYHA 2CA8A 4I2UA 2I9HA 5KOXA 2IJYA 1NSWA 2M80A 4Q5NA 4MABA 3FHKA 5CREA 1O7UA 5KN0A 1FOVA 2OJLA 4CY8A 2H8LA 1SJZA 1M99A 5GZZB 1HNBA 3GKNA 1MD3A 2KHPA 2FCHA 3CQFA 2H6XA 4IHUA 4KCAA 5A4UA 1GNEA 1R7HA 2HLSA 4V2MA 4PNGA 1QMVA 1MD4A 2LUSA 1J0FA 4PUFC 1FG4A 4J2FA 4P3YB 1F9MA 2KOKA 2X4AA 3E3EA 5IOWA 1USBA 2AV4A 2FY6A 1GUMA 2X8CA 4POLA 2E7PA 3IDVA 3UBKA 2L4QA 5ID2A 2DSAA 1RK4A 1WP0A 3TKSE 4USSA 3FY7A 2L5OA 4L0UA 1LJRA 1PN9A 1GTBA 3HVSA 3OR5A 1F37A 1TTZA 3TKSC 5KN1A 2C0EA 4OCEA 3EURA 3NIVA 19GSA 4RI6A 3LXZA 2H19A 4LL1B 1YDKA 2NDOA 4O5UA 3WGDA 3ZREA 5FWGA 1XWKA 2GQLA 1K3OA 3APOA 3KD0A 4DSRA 1YQ1A 3IV4A 2L6CA 2YV7A 2L6DA 1EOGA 1PL2A 1K0BA 1O73A 6GSUA 4F82A 1PRXA 1LU4A 4DSSB 3APSA 1WRYA 4GCIA 2LTKA 2CAQA 14GSA 4KAEA 3UJ1A 2CZ3A 3HYPA 4I97A 3C71A 4PX1A 3PR8A 4MH3A 5CRWA 4KSOA 1EV9A 3IA1A
chains in the Genus database with same CATH topology
1URMA 3M8NA 3M3MA 2R37A 2HT9A 3LORA 4ACSA 3ZFBA 2X64A 2BJXA 3LG6A 1PL1A 2GSRA 1FO5A 4POMA 3TKQA 5GAPD 2Z9SA 3CSJA 2I81A 2DLXA 5ABRA 2MMZA 2YV9A 3IK7A 4JBBA 1Y25A 4HQSA 2MBSA 3EMPA 1UC7A 3LYPA 2IMEA 2NTOA 2QGVA 1F3AA 1SK1A 2H74A 1G0TA 2OACA 4OD7A 4ML6A 1WJKA 3M9JA 1T00A 4XTSA 4CY6A 1YZXA 2CVKA 2VCZA 3VWWA 2VCXA 4YQUA 3O6TA 3DXBA 2VD1A 1G6YA 1XW9A 3IPZA 4IJIA 5G5FA 3VLNA 6GSWA 4TKYA 3H1NA 5AIXA 1KBNA 3TRPA 1ZMAA 1PA3A 1OC9B 2HNLA 1Y6EA 1KEBA 1EP8A 1AQXA 5DDLA 4ZB9A 2X49A 3KH9A 3TJBA 2YZUA 3UVTA 3GX0A 1GP1A 3FZ5A 2HE3A 4AJ7A 3BCIA 4CW9A 3LSZA 3LYKA 4XS6A 1TRSA 1JZDA 1ZYEA 1JLWA 4TR1A 1Z6MA 1S3DA 2QKEA 3QOUA 3TKSA 3TRQA 3VI7A 4TRXA 3APQA 3ZL5A 2GVPA 1ST9A 4ZBBA 1BEDA 5ELAA 5JWRB 3FRCA 3IC4A 2JSYA 4ZL8A 1OAZA 3VWXA 1G6WA 1WIKA 1SYXA 3ZZXA 3HJPA 4WXTA 3TOTA 1UN2A 4EE0A 3FK8A 5AISA 1SD8A 3UMAA 3FYGA 1OYJA 2V2GA 5IMCA 3RAZA 5H5QA 2PU9C 4WKWA 5ID2B 3FKFA 2VL3A 3QR6A 2DMMA 1U3AA 2PMTA 4WEYA 3F63A 2E2GA 4G19A 2CZ2A 2VLVA 3P8WA 4BA7A 4KF9A 1PMTA 1GNWA 5ECOB 2WDUA 3TUEA 2PPTA 2HFDA 4BVYA 3LGCA 1B4QA 1Q98A 5C00A 1TW9A 2OADA 3KGKA 3DGQA 1K0AA 3QAWA 4ECJA 1MTCA 1V58A 4HZ2A 4LA1A 2VCVA 4EDZA 3Q74A 1OC3A 3ZYWA 1Z7RA 5BMUA 3KMNA 4K7IA 3WYWA 5ECMB 2VD0A 3KM6A 3DWVA 1VF2A 5E4WA 3TGZA 3TJJA 3IC8A 2VAFA 3C73A 1M9AA 2OE0A 4K9ZA 2O8VB 3MYDA 4GLTA 5J41A 3QD9A 13GSA 2QSIA 4GQCA 5ELGA 3LJRA 1XWCA 1THXA 5AN1A 3SWLA 2H70A 4O7HA 5CYYA 2HZEA 3HKRA 3UOMA 3QCPA 4HZ4A 3FR9A 3I43A 1THOA 1B9XC 1R5PA 3GFKA 2LEGA 1T8EB 2J23A 3KJYA 4IW9A 1SL0B 1O8XA 3MIXA 3RBTA 2EIRA 5A5KA 4MPGA 4A5PA 5JWOB 4YAPA 5ECIB 3DEXA 3L9VA 1XCCA 3HJOA 2F51A 5L71A 1FW1A 1MEKA 4NWYA 1B48A 1JLVA 4FYBA 1X5EA 3K8NA 4ECIA 2WULA 1SL1B 2RLIA 3GKKA 4EVMA 4DSSA 1KNGA 4NMUA 4RQXA 2FNOA 4G0LA 5JCUA 3TKPA 2M72A 3ZVJD 3NZNA 3G7IA 2WGRA 2F3MA 3R3EA 1T1VA 2B1KA 1YEPA 3LXTA 4WBRD 3ISOA 1EGOA 2V6KA 4ZL7A 4GTUA 1NM3A 5GAND 3N9JA 1U87A 1B8XA 2VOCA 4X43A 2AYTA 1GSEA 3L0HA 3RHCA 1QQ2A 3VFIA 4N11A 4D73A 4ZBDA 3W6GA 4PTSA 1FVKA 2N5FA 1YJ6A 3CMIA 2VCTA 4WBJA 4O92A 1Z3EA 1SK2A 1A8LA 4ECCA 2WCIA 5DVBA 1HQOA 3KTBA 2VLUA 4I5QA 3GL3A 4GRFA 5D8IA 3EVIA 3DMLA 1AQWA 5F07A 4ZB8A 2H1AA 2YNXA 5A4VA 3PGTA 2CVBA 1K0DA 2AHEA 1OC9A 1UVZA 5DCGA 3NOFA 3F9UA 2FUG2 1PKZA 3ZRDA 1ML6A 2L4CA 5KEJA 1PX6A 3G7YA 1OE8A 4TVEA 1I9DA 3L9SA 1A2MA 1TRUA 2L57A 4RI7A 3FR3A 5HFIA 3F6FA 4ISDA 1QK8A 3LEFA 1TK0B 2GZYA 3ZIJA 3EINA 4I8BA 3CTGA 4G10A 2LKUA 1PX7A 1GSQA 2IMIA 3TCOA 2HYXA 4BPYA 1TI1A 4EKZA 2JZRA 2DJ2A 5ECRB 2GQMA 2PVOC 1DSBA 3D6IA 5F06A 5IMZA 3IHGA 4IELA 2H1GA 2ON5A 1DUGA 4XS4A 2P0GA 1Z9HA 1QUWA 1B4PA 2VLTA 2HZEB 5JCWA 5IPGA 4L5OA 4GSTA 2P31A 4OO5A 5CP1A 2LS5A 3D21A 1X0RA 4F03A 1M9BA 3QFAC 4KDXA 6GSYA 3US3A 5HR3A 2DJ1A 4IBPA 3SBCA 3QAVA 4Z7XA 1H4OA 4RQRA 4JZQA 2JADA 2OBIA 1ZYNA 4YH2A 4XCSA 3I9V2 2VL2A 3KMOA 4OFMA 4FO5A 2TIRA 2OBKA 2QA2A 4MMMA 5B8AA 4GSSA 3QDNA 2B7JA 1JHBA 1SENA 5KN3A 4DVCA 2K8VA 1TDIA 4GWRA 2VM1A 3TB2A 2OKAA 2FWFA 2AJQB 3RPPA 4KX4A 2RM6A 2VIMA 1EEMA 1GSSA 3CRTA 4LLRA 4H86A 4BWSA 2F8FA 2YWNA 3F3QA 5JCGA 1ZYQB 1W4VA 1XVQA 1WE0A 3DKSA 3D0ZA 1K3YA 4ZL9A 1BQ7A 1TK8B 3KEBA 3RHBA 1GL8A 3FZ4A 3P90A 2D2ZA 5ECNB 1ABAA 5IOXA 4G0KA 4PNFA 2BMXA 2V41A 3GA4A 5HR1A 1O85A 4ZB6A 3GV1A 1GSUA 1B9YC 1MDJA 3IHQA 5GSSA 5KOWA 4KA0A 2FD3A 1EOHA 5EPFA 4YKFA 5HFGA 4HUAA 1ZGNA 3TJFA 4AJ6A 2MMOA 3VPTA 3CSIA 1F2EA 8GSSA 4D73B 2FLSA 4IVFA 1X5DA 1AW9A 2M46A 3D5JA 1O6JA 1U6TA 4PQ1A 2WRTA 1N2AA 4BWQA 3GTUB 2K9FA 1U88A 1GTIA 3F3RA 4XRAA 5BRTA 2NVLA 5D73A 1TK5B 4NPBA 2YOIA 2KUCA 4NAXA 3Q19A 3F4RA 1YKCA 1RQMA 3AY8A 5IMDA 3GN3A 1GLPA 5B6NA 4TR0A 4K2DA 12GSA 3HCZA 4MNNA 3VURA 1R26A 4LMWA 4E8EA 4O32A 1GSYA 3FMWA 1TU7A 4I2TA 2RIIA 4HU9A 3FZAA 2WFCA 2GT6A 4V1Ap 5A4WA 1S3CA 3VWUA 2E2MA 2A4VA 5AGYA 2LQOA 5CNWA 2HRFA 3U6VA 4L0WA 1AUCA 2JZSA 1FB0A 2HSHA 3CYNA 2JL4A 3MSZA 1SD9A 1TP9A 1F6MC 6GSXA 2R6KA 4DSQA 3EC3A 4JRRA 2LNSA 4IS0A 2OE3A 1BAYA 1MDKA 5G1LA 2LSTA 5COHA 5G31A 4MJCA 5ECLB 5CRHA 4GQFA 4XS4B 4XHMA 2L59A 4TR3A 3P2AA 2I4AA 4OMVA 4K6XA 2V1MA 3BCKA 5B7CA 3D22A 2JACA 5D9WA 3VK9A 3HY2A 1ZYPA 2DJ3A 6GSTA 4ILFA 5C04A 4GXZA 2K8SA 2ES7A 3Q18A 4MCUA 2PERA 2IN3A 3TJGA 2GT5A 2ZNMA 3A5WA 2R2JA 1K0NA 1W89A 1TKDB 2RM5A 4FYCA 4OFTA 1A8YA 2DIZA 4TXVA 4Q5FA 3QFBC 2IMFA 1FOHA 2GTUA 2P5QA 3H93A 4AGSA 5H5RA 3M9KA 2WB9A 3BBYA 4Q5QA 2VCQA 3ZVJA 2H01A 4PGTA 5G1KA 1A24A 4X1UA 2C4JA 2H0HA 2ON7A 2H66A 1GH2A 4IP6A 2LRCA 4PQHA 2MBTA 4ZILA 1TRWA 1Z5YE 4HOJA 2IL3A 3GKXA 3U5RE 4WF4A 2A2RA 1XFLA 2B5YA 2HSMA 1GSDA 2B7KA 3QAGA 3TKRA 1HNAA 5G2ZA 3ED3A 3EU4A 2R0CA 2AAWA 1V40A 2MMAA 3QMXA 4K0NA 9GSSA 5KN2A 5IM9A 3L4NA 4J57E 2L5LA 3IAM2 1M2AA 2C1YA 4MJEA 5ECQB 2VM2A 1K0OA 3A2XA 2O89A 3F8UA 2JSZA 4MZCA 1YF1A 4LL4B 5DBQA 3O3TA 4OWYA 5J5NA 2TRCP 2KP2A 3DVWA 1XBSA 2O7KA 1HYUA 5DAKB 3IK9A 3IXRA 2JU5A 3GKMA 3TOUA 2CX3A 4MP4A 3J7Yb 3I69A 4KH7A 1JZOA 4I6XA 1ERWA 3KH7A 5IMAA 1ZL9A 1GTAA 4PURA 2KLXA 2R3XA 4F2IA 22GSA 5J9BA 4N0VA 2IMDA 2G2QA 3EYTA 1O81A 3W8SA 4RUVA 1J9BA 4HJ2A 3ZIVA 3IOSA 2UZ8A 1WOUA 4Z2UA 3DIEA 2N5AA 2IFQB 2F8AA 1OE7A 4KB3A 5CRDA 2FA4A 3F4SA 4NHZA 4CDOA 2GSQA 1XVWA 3EMXA 3VI5A 1WWJA 2X8HA 3WT2A 3HVVA 1ERTA 3E0UA 1HD2A 4HI7A 3QPMA 2LRTA 2YJ7A 3GYKA 2FWEA 1BG5A 4K2XA 5IO0A 2X8GA 1CQGA 2LJAA 1X9SB 2TRXA 20GSA 1O8WA 4BL7A 1ACVA 2C0GA 1M2DA 5DJLA 1RW1A 5F8BA 1GSFA 1R5AA 2YANA 3FZ9A 3L9UA 1N8JA 1PN0A 1XXUA 1KTEA 2C80A 4EO3A 4OCFA 4KUNA 2WJUA 4ECBA 4PUAA 2EC4A 3GTUA 5DQYA 3KTLA 4QQ7A 1F3BA 3LQ7A 1LBKA 2ZCTA 5HFKA 1YEXA 3TDGA 1ON4A 2NBSA 3HDCA 2VO4A 2B1LA 2LNTA 2QC7A 4ID0A 1SKRB 4OO4A 2H72A 1VRSD 4XS1A 4PQIA 2YZHA 3KIJA 2REMA 4K1FA 5CAXA 5J4UA 3PINA 3H8QA 4JE1A 4F9ZA 5AIVA 3G9BA 1JZRA 4K7OA 1G7OA 1SKSB 2PN8A 1U3IA 1X9WB 3GNJA 3GH9A 2CT6A 1XWBA 4WETA 4QL9A 1ZOFA 5FT3A 4V2LA 4N30A 2F9SA 2VCWA 1A0RP 3IBHA 4KCEA 3BJ5A 2H76A 2H1BA 2GQKA 2V32A 3DD3A 1ERUA 3L78A 5B8BA 2WZ9A 1GTUA 1AXDA 5ECSA 4LMVA 1VF4A 1ZZYA 2H73A 2GLRA 5FHIA 4EIPA 4YAVA 4FIWA 2HRAA 3GRXA 3HVXA 1E2YA 2N5BA 6GSVA 1VGLA 1VF3A 3IR4A 3C8EA 2K6VA 2HZFA 1XWGA 1CQHA 3ME8A 1I5GA 4HQZA 3H4KA 4YQMA 2HSYA 5DALB 1YY7A 1ERVA 4K0GA 1V98A 2PGTA 2AUVA 2GZPA 4TXOA 3FR6A 5DQSA 5HR2A 1JFUA 3UARA 2FA8A 1SKWB 3C7MA 3PH9A 2YWIA 2DIYA 2YPMA 1SU9A 1EZKA 1X5CA 4V1Ag 3C1RA 2LV3A 4K5SA 4MLYA 3FW2A 5GSTA 2IWTA 1Z6NA 5B6MA 1QXHA 4XIHA 1QFNA 1EGRA 2B5EA 3WGEA 3EU3A 3GH6A 1A0FA 3UBLA 3UAPA 2YJHA 3A2WA 1TXXA 2C0DA 3RDWA 5G30A 1DE2A 1TJDA 5IIZA 1BYEA 3ZMKA 1J08A 3E9JB 2CQ9A 3UVHA 4TR4A 4L5LA 1UA5A 4FH8A 1EEJA 5EY6A 5LD0A 2DKHA 4KW6A 2CAIA 5EL8A 3LWAA 3ME7A 2GS3A 5E59A 4KGIA 2YCDA 2A2SA 4IGJA 1WPIA 2LRNA 2C0FA 1K0CA 3WD6A 3BOAA 4G0IA 4BL7B 3IRAA 4NXIA 2VL9A 3I6AA 4KSMA 3CBUA 5DAKA 1H75A 4G2EA 5DCHA 4Q5RA 4EC0A 1PKWA 3A3TA 1QGVA 2YWOA 5ENUA 2DMLA 2FHEA 3Q6OA 1OC8A 2VUPA 3HA9A 3ZLPA 2DJ0A 3LW9A 2RUFA 3ZTLA 5IMFA 3TRXA 1SJ6A 2NPBA 1G7EA 4EXJA 5D96A 2XBIA 5LCZA 4NV2A 2C8UA 2DBCA 1XZOA 2LJRA 6GSSA 3R2QA 3WGXA 3H79A 2PBJA 4K5RA 4MJAA 3CSHA 3J7Yk 2CVDA 4MK3A 16GSA 2XC2A 2IFQA 3ZFLA 3HZ4A 4K8MA 2C3TA 2H0IA 2A4HA 1T4YA 4MDCA 3VWVA 2GZZA 3JCML 5F0GA 1XW5A 5D9TA 3MDKA 2IIYA 4ULXA 3TJKA 11GSA 5HQPA 4HS1A 4TOPA 3UIWA 1E6BA 1OKTA 1FAAA 4MZWA 5INYA 2LJKA 4NHWA 4G9HA 4GF0A 4POBA 3ERWA 2XPDA 4BVXB 1MDIA 2GGTA 3ZITA 4ZXGA 1FVJA 17GSA 3DYRA 1V9WA 3KP9A 3F4TA 3V1WA 2XHFA 3M1GA 4WF5A 4HEA2 2RUEA 1XW6A 3O76A 2B6MA 2H1DA 4JEDA 4CHSA 4JU5A 4Z2TA 1EV4A 2J9HA 2PUKC 2FWHA 4WR5A 3HXSA 4NV5A 4KDUA 3MWHA 2P5RA 2LQQA 1XOBA 1XOAA 3GX8A 2X99A 2GSTA 1PGTA 3GMFA 1Z7PA 1GLQA 3S9FA 4F0BA 3GIXA 3GHAA 3GUSA 2PVQA 3EWLA 1M2BA 1SK0A 1AQVA 3CXGA 2MMNA 4HJMA 4KNDA 3DVXA 1WMJA 3EE2A 3IE3A 3LFLA 3G7JA 5H5SA 1FHEA 2HXKA 4TXOB 3P7XA 2G0FA 1OKDA 4MA9A 2CV4A 2GSSA 4QL7A 3HD5A 4IN0A 2QA1A 4EDYA 4FYUA 5D9VA 2C3NA 1IYIA 1TRVA 4K7NA 3CTFA 4KDYA 5IQYA 3ERGA 1VF1A 2H75A 3D4MA 2B3SA 4MJBA 5F05A 1X9MB 2I3YA 3MNGA 4Z2RA 5LNKe 4TN8A 3F0IA 2R5GA 2DJJA 18GSA 2PWJA 2YWMA 1GWCA 5JWQB 3C1SA 1NW2A 1M0UA 1GUHA 1YKAA 5ECPB 3ZMLA 4MF6A 4IQ1A 1Q4JA 3CRUA 4PXOA 1TU8A 2YP6A 2FWGA 2IPAA 4V2NA 4O5RA 4N10A 5ECHB 2I1UA 2ALBA 4EL1A 2KP1A 3EPTA 3KP8A 1A23A 1NHOA 1GULA 3KXOA 1C72A 1XIYA 4IP1A 1OVNA 1GUKA 2XPEA 5DALA 2WS2A 4HDEA 2ZUPA 4J56E 4FQUA 4TW5A 3WT1A 1R4WA 1V2AA 4MF7A 4O5QA 2V6OA 5IMVA 2R0GA 5ECKB 4MH2A 4ZIJA 3N5OA 4L8EA 1A2LA 2FGXA 1XWAA 2B5XA 1BJXA 2O87A 5D93A 10GSA 2C3QA 1NHYA 5D9XA 3HJMA 1K0MA 2GDRA 2H30A 1A2JA 4ZBAA 3A2VA 5CO3A 1SL2B 3ERFA 4DEJA 1YF0A 2IMKA 2O85A 3F6DA 2R0PA 2DC5A 2H0GA 3D4TA 4JR4A 7GSSA 2OA7A 4POKA 5CRGA 5J3RA 3W8JA 1T3BA 1GRXA 1TI3A 1PQNA 3FEUA 1EP7A 3M0FA 3DRNA 4JR6A 1SYRA 3IAS2 3GURA 2E0QA 2A2PA 4YQVA 4X4JA 2MZCA 4E8HA 2VL2C 2H71A 1XPVA 3RPNA 1V57A 1PSQA 1PD21 3VPQA 1M7TA 3GL5A 4IJ3A 4XRDA 2H6ZA 4EUYA 2MYGA 4EIQA 1FB6A 1TOFA 1DE1A 4TR1B 5G5EA 2YN1A 2K18A 3HZ8A 3GSTA 1BX9A 2OE1A 1ZCPA 5IO2A 4HU7A 2R4VA 5IPHA 3BD2A 3UEMA 3KZQA 4AJ8A 1K3LA 2HRKA 2HI7A 4ML1A 3UL3A 3MAKA 1SJIA 3A5IA 3GSSA 2HRNA 4ICYA 2BTOT 2DKIA 4YKGA 1AAZA 1HNCA 3HHVA 2JZTA 2CX4A 1AC1A 4IQAA 4KE3A 2DJKA 4GSNA 5DJMA 2XBQA 1ILOA 5HR0A 5J9CA 2H6YA 3PPUA 1JZWA 2EIOA 1EWXA 2EIQA 4WR4A 1T7PB 5EVOA 4MF5A 4F0CA 1AIUA 4N0ZA 4OFNA 4BVYB 4X0XA 4EF0A 1S3AA 4IKHA 1DBYA 4MPFA 3KCMA 4BVXA 4MZBA 2AB6A 1T4ZA 4AF2A 1IYHA 2CA8A 4I2UA 2I9HA 5KOXA 2IJYA 1NSWA 2M80A 4Q5NA 4MABA 3FHKA 5CREA 1O7UA 5KN0A 1FOVA 2OJLA 4CY8A 2H8LA 1SJZA 1M99A 5GZZB 1HNBA 3GKNA 1MD3A 2KHPA 2FCHA 2H6XA 4IHUA 4KCAA 5A4UA 1GNEA 1R7HA 2HLSA 4V2MA 4PNGA 1QMVA 1MD4A 2LUSA 1J0FA 4PUFC 1FG4A 4J2FA 4P3YB 1F9MA 2KOKA 2X4AA 3E3EA 5IOWA 1USBA 2AV4A 2FY6A 1GUMA 2X8CA 4POLA 2E7PA 3IDVA 3UBKA 2L4QA 5ID2A 2DSAA 1RK4A 1WP0A 3TKSE 4USSA 3FY7A 2L5OA 4L0UA 1LJRA 1PN9A 1GTBA 3HVSA 3OR5A 1F37A 1TTZA 3TKSC 5KN1A 2C0EA 4OCEA 3EURA 3NIVA 19GSA 4RI6A 3LXZA 2H19A 4LL1B 1YDKA 2NDOA 4O5UA 3WGDA 3ZREA 5FWGA 1XWKA 2GQLA 1K3OA 3APOA 3KD0A 4DSRA 1YQ1A 3IV4A 2L6CA 2YV7A 2L6DA 1EOGA 1PL2A 1K0BA 1O73A 6GSUA 4F82A 1PRXA 1LU4A 4DSSB 3APSA 1WRYA 4GCIA 2LTKA 2CAQA 14GSA 4KAEA 3UJ1A 2CZ3A 3HYPA 4I97A 3C71A 4PX1A 3PR8A 4MH3A 5CRWA 4KSOA 1EV9A 3IA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1URM A;  3M8N A;  3M3M A;  2R37 A;  2HT9 A;  3LOR A;  4ACS A;  3ZFB A;  2X64 A;  2BJX A;  3LG6 A;  1PL1 A;  2GSR A;  1FO5 A;  4POM A;  3TKQ A;  5GAP D;  2Z9S A;  3CSJ A;  2I81 A;  2DLX A;  5ABR A;  2MMZ A;  2YV9 A;  3IK7 A;  4JBB A;  1Y25 A;  4HQS A;  2MBS A;  3EMP A;  1UC7 A;  3LYP A;  2IME A;  2NTO A;  2QGV A;  1F3A A;  1SK1 A;  2H74 A;  1G0T A;  2OAC A;  4OD7 A;  4ML6 A;  1WJK A;  3M9J A;  1T00 A;  4XTS A;  1YZX A;  2CVK A;  2VCZ A;  3VWW A;  2VCX A;  4YQU A;  3O6T A;  3DXB A;  2VD1 A;  1G6Y A;  1XW9 A;  3IPZ A;  4IJI A;  5G5F A;  3VLN A;  6GSW A;  4TKY A;  3H1N A;  5AIX A;  1KBN A;  3TRP A;  1ZMA A;  1PA3 A;  1OC9 B;  2HNL A;  1Y6E A;  1KEB A;  1EP8 A;  1AQX A;  5DDL A;  4ZB9 A;  3KH9 A;  3TJB A;  2YZU A;  3UVT A;  3GX0 A;  1GP1 A;  3FZ5 A;  2HE3 A;  4AJ7 A;  3BCI A;  4CW9 A;  3LSZ A;  3LYK A;  4XS6 A;  1TRS A;  1JZD A;  1ZYE A;  1JLW A;  4TR1 A;  1Z6M A;  1S3D A;  2QKE A;  3QOU A;  3TKS A;  3TRQ A;  3VI7 A;  4TRX A;  3APQ A;  3ZL5 A;  2GVP A;  1ST9 A;  4ZBB A;  1BED A;  5ELA A;  5JWR B;  3FRC A;  3IC4 A;  2JSY A;  4ZL8 A;  1OAZ A;  3VWX A;  1G6W A;  1WIK A;  1SYX A;  3ZZX A;  3HJP A;  4WXT A;  3TOT A;  1UN2 A;  4EE0 A;  3FK8 A;  5AIS A;  1SD8 A;  3UMA A;  3FYG A;  1OYJ A;  2V2G A;  5IMC A;  3RAZ A;  5H5Q A;  2PU9 C;  4WKW A;  5ID2 B;  3FKF A;  2VL3 A;  3QR6 A;  2DMM A;  1U3A A;  2PMT A;  4WEY A;  3F63 A;  2E2G A;  4G19 A;  2CZ2 A;  2VLV A;  3P8W A;  4BA7 A;  1PMT A;  1GNW A;  5ECO B;  2WDU A;  3TUE A;  2PPT A;  2HFD A;  4BVY A;  3LGC A;  1B4Q A;  1Q98 A;  5C00 A;  1TW9 A;  2OAD A;  3KGK A;  3DGQ A;  1K0A A;  3QAW A;  4ECJ A;  1MTC A;  1V58 A;  4HZ2 A;  4LA1 A;  2VCV A;  4EDZ A;  3Q74 A;  1OC3 A;  3ZYW A;  1Z7R A;  3KMN A;  4K7I A;  3WYW A;  5ECM B;  2VD0 A;  3KM6 A;  3DWV A;  1VF2 A;  5E4W A;  3TGZ A;  3TJJ A;  2VAF A;  3C73 A;  1M9A A;  2OE0 A;  4K9Z A;  2O8V B;  4GLT A;  5J41 A;  3QD9 A;  13GS A;  2QSI A;  4GQC A;  5ELG A;  3LJR A;  1XWC A;  1THX A;  5AN1 A;  3SWL A;  2H70 A;  4O7H A;  5CYY A;  2HZE A;  3HKR A;  3UOM A;  3QCP A;  4HZ4 A;  3FR9 A;  3I43 A;  1THO A;  1B9X C;  1R5P A;  3GFK A;  2LEG A;  1T8E B;  2J23 A;  3KJY A;  4IW9 A;  1SL0 B;  1O8X A;  3RBT A;  2EIR A;  5A5K A;  4MPG A;  5JWO B;  4YAP A;  5ECI B;  3DEX A;  3L9V A;  1XCC A;  3HJO A;  2F51 A;  5L71 A;  1FW1 A;  1MEK A;  4NWY A;  1B48 A;  1JLV A;  4FYB A;  1X5E A;  3K8N A;  4ECI A;  2WUL A;  1SL1 B;  2RLI A;  3GKK A;  4EVM A;  4DSS A;  1KNG A;  4NMU A;  4RQX A;  2FNO A;  5JCU A;  3TKP A;  2M72 A;  3ZVJ D;  3NZN A;  3G7I A;  2WGR A;  2F3M A;  1T1V A;  2B1K A;  1YEP A;  3LXT A;  4WBR D;  3ISO A;  1EGO A;  2V6K A;  4ZL7 A;  4GTU A;  1NM3 A;  5GAN D;  3N9J A;  1U87 A;  1B8X A;  2VOC A;  4X43 A;  2AYT A;  1GSE A;  3L0H A;  3RHC A;  1QQ2 A;  3VFI A;  4N11 A;  4D73 A;  4ZBD A;  3W6G A;  1FVK A;  2N5F A;  1YJ6 A;  3CMI A;  2VCT A;  4WBJ A;  4O92 A;  1Z3E A;  1SK2 A;  1A8L A;  4ECC A;  2WCI A;  5DVB A;  1HQO A;  3KTB A;  2VLU A;  4I5Q A;  5D8I A;  3GL3 A;  4GRF A;  3EVI A;  3DML A;  5F07 A;  1AQW A;  4ZB8 A;  2H1A A;  2YNX A;  5A4V A;  3PGT A;  2CVB A;  1K0D A;  2AHE A;  1OC9 A;  1UVZ A;  5DCG A;  3NOF A;  3F9U A;  2FUG 2;  1PKZ A;  3ZRD A;  1ML6 A;  2L4C A;  5KEJ A;  1PX6 A;  3G7Y A;  1OE8 A;  4TVE A;  1I9D A;  3L9S A;  1A2M A;  1TRU A;  2L57 A;  4RI7 A;  3FR3 A;  5HFI A;  3F6F A;  4ISD A;  1QK8 A;  3LEF A;  1TK0 B;  2GZY A;  3ZIJ A;  3EIN A;  4I8B A;  3CTG A;  4G10 A;  2LKU A;  1PX7 A;  1GSQ A;  2IMI A;  3TCO A;  2HYX A;  4BPY A;  1TI1 A;  4EKZ A;  2JZR A;  2DJ2 A;  5ECR B;  2GQM A;  2PVO C;  1DSB A;  3D6I A;  5F06 A;  5IMZ A;  4IEL A;  2H1G A;  2ON5 A;  1DUG A;  4XS4 A;  2P0G A;  1Z9H A;  1QUW A;  1B4P A;  2VLT A;  2HZE B;  5JCW A;  5IPG A;  4L5O A;  4GST A;  2P31 A;  4OO5 A;  5CP1 A;  2LS5 A;  3D21 A;  1X0R A;  4F03 A;  1M9B A;  3QFA C;  4KDX A;  6GSY A;  3US3 A;  5HR3 A;  2DJ1 A;  4IBP A;  3SBC A;  3QAV A;  4Z7X A;  1H4O A;  4RQR A;  4JZQ A;  2JAD A;  2OBI A;  4YH2 A;  4XCS A;  3I9V 2;  2VL2 A;  3KMO A;  4OFM A;  4FO5 A;  2TIR A;  2OBK A;  4MMM A;  5B8A A;  4GSS A;  3QDN A;  2B7J A;  1JHB A;  1SEN A;  5KN3 A;  4DVC A;  2K8V A;  1TDI A;  4GWR A;  2VM1 A;  3TB2 A;  2OKA A;  2FWF A;  2AJQ B;  3RPP A;  4KX4 A;  2RM6 A;  2VIM A;  1EEM A;  1GSS A;  3CRT A;  4LLR A;  4H86 A;  4BWS A;  2F8F A;  2YWN A;  3F3Q A;  5JCG A;  1ZYQ B;  1W4V A;  1XVQ A;  1WE0 A;  3DKS A;  3D0Z A;  1K3Y A;  4ZL9 A;  1BQ7 A;  1TK8 B;  3KEB A;  3RHB A;  1GL8 A;  3FZ4 A;  3P90 A;  2D2Z A;  5ECN B;  1ABA A;  5IOX A;  4PNF A;  2BMX A;  2V41 A;  3GA4 A;  5HR1 A;  1O85 A;  4ZB6 A;  3GV1 A;  1GSU A;  1B9Y C;  1MDJ A;  3IHQ A;  5GSS A;  4KA0 A;  2FD3 A;  1EOH A;  5EPF A;  5HFG A;  4HUA A;  1ZGN A;  3TJF A;  4AJ6 A;  2MMO A;  3VPT A;  3CSI A;  1F2E A;  8GSS A;  4D73 B;  2FLS A;  4IVF A;  1X5D A;  1AW9 A;  2M46 A;  3D5J A;  1O6J A;  1U6T A;  4PQ1 A;  2WRT A;  1N2A A;  4BWQ A;  3GTU B;  2K9F A;  1U88 A;  1GTI A;  3F3R A;  4XRA A;  2NVL A;  5D73 A;  1TK5 B;  4NPB A;  2YOI A;  2KUC A;  4NAX A;  3Q19 A;  3F4R A;  1YKC A;  1RQM A;  3AY8 A;  5IMD A;  3GN3 A;  1GLP A;  5B6N A;  4TR0 A;  4K2D A;  12GS A;  3HCZ A;  3VUR A;  1R26 A;  4LMW A;  4E8E A;  4O32 A;  1GSY A;  1TU7 A;  4I2T A;  2RII A;  4HU9 A;  3FZA A;  2WFC A;  2GT6 A;  4V1A p;  5A4W A;  1S3C A;  3VWU A;  2E2M A;  2A4V A;  5AGY A;  2LQO A;  5CNW A;  2HRF A;  3U6V A;  4L0W A;  1AUC A;  2JZS A;  1FB0 A;  2HSH A;  3CYN A;  2JL4 A;  3MSZ A;  1SD9 A;  1TP9 A;  1F6M C;  6GSX A;  2R6K A;  4DSQ A;  3EC3 A;  4JRR A;  2LNS A;  4IS0 A;  2OE3 A;  1BAY A;  1MDK A;  5G1L A;  2LST A;  5COH A;  5G31 A;  4MJC A;  5ECL B;  5CRH A;  4GQF A;  4XS4 B;  4XHM A;  2L59 A;  4TR3 A;  3P2A A;  2I4A A;  4OMV A;  4K6X A;  2V1M A;  3BCK A;  5B7C A;  3D22 A;  2JAC A;  5D9W A;  3VK9 A;  3HY2 A;  2DJ3 A;  6GST A;  4ILF A;  5C04 A;  4GXZ A;  2K8S A;  2ES7 A;  3Q18 A;  4MCU A;  2PER A;  2IN3 A;  3TJG A;  2GT5 A;  2ZNM A;  3A5W A;  2R2J A;  1K0N A;  1W89 A;  1TKD B;  2RM5 A;  4FYC A;  4OFT A;  1A8Y A;  2DIZ A;  4TXV A;  4Q5F A;  3QFB C;  2IMF A;  2GTU A;  2P5Q A;  3H93 A;  4AGS A;  5H5R A;  3M9K A;  2WB9 A;  3BBY A;  4Q5Q A;  2VCQ A;  3ZVJ A;  2H01 A;  4PGT A;  5G1K A;  1A24 A;  4X1U A;  2C4J A;  2H0H A;  2ON7 A;  2H66 A;  1GH2 A;  4IP6 A;  2LRC A;  4PQH A;  2MBT A;  4ZIL A;  1TRW A;  1Z5Y E;  4HOJ A;  2IL3 A;  3GKX A;  3U5R E;  4WF4 A;  2A2R A;  1XFL A;  2B5Y A;  1GSD A;  2B7K A;  3QAG A;  3TKR A;  1HNA A;  5G2Z A;  3ED3 A;  3EU4 A;  2AAW A;  1V40 A;  2MMA A;  3QMX A;  4K0N A;  9GSS A;  5KN2 A;  5IM9 A;  3L4N A;  4J57 E;  2L5L A;  3IAM 2;  1M2A A;  2C1Y A;  4MJE A;  5ECQ B;  2VM2 A;  1K0O A;  3A2X A;  2O89 A;  3F8U A;  2JSZ A;  4MZC A;  1YF1 A;  4LL4 B;  5DBQ A;  3O3T A;  4OWY A;  5J5N A;  2TRC P;  2KP2 A;  3DVW A;  1XBS A;  2O7K A;  1HYU A;  5DAK B;  3IK9 A;  3IXR A;  2JU5 A;  3GKM A;  3TOU A;  2CX3 A;  4MP4 A;  3J7Y b;  3I69 A;  4KH7 A;  1JZO A;  4I6X A;  1ERW A;  3KH7 A;  5IMA A;  1ZL9 A;  1GTA A;  4PUR A;  2KLX A;  2R3X A;  4F2I A;  22GS A;  5J9B A;  4N0V A;  2IMD A;  2G2Q A;  3EYT A;  1O81 A;  3W8S A;  4RUV A;  1J9B A;  4HJ2 A;  3ZIV A;  3IOS A;  1WOU A;  3DIE A;  2N5A A;  2IFQ B;  2F8A A;  1OE7 A;  4KB3 A;  5CRD A;  2FA4 A;  3F4S A;  4NHZ A;  4CDO A;  2GSQ A;  1XVW A;  3EMX A;  3VI5 A;  1WWJ A;  2X8H A;  3WT2 A;  3HVV A;  1ERT A;  3E0U A;  1HD2 A;  4HI7 A;  3QPM A;  2LRT A;  2YJ7 A;  3GYK A;  2FWE A;  1BG5 A;  5IO0 A;  2X8G A;  1CQG A;  2LJA A;  1X9S B;  2TRX A;  20GS A;  1O8W A;  4BL7 A;  1ACV A;  2C0G A;  1M2D A;  5DJL A;  1RW1 A;  5F8B A;  1GSF A;  1R5A A;  2YAN A;  3FZ9 A;  3L9U A;  1N8J A;  1XXU A;  1KTE A;  2C80 A;  4EO3 A;  4OCF A;  4KUN A;  2WJU A;  4ECB A;  4PUA A;  2EC4 A;  3GTU A;  5DQY A;  3KTL A;  4QQ7 A;  1F3B A;  3LQ7 A;  1LBK A;  2ZCT A;  5HFK A;  1YEX A;  3TDG A;  1ON4 A;  2NBS A;  3HDC A;  2VO4 A;  2B1L A;  2LNT A;  2QC7 A;  4ID0 A;  1SKR B;  4OO4 A;  2H72 A;  1VRS D;  4XS1 A;  4PQI A;  2YZH A;  3KIJ A;  2REM A;  4K1F A;  5CAX A;  5J4U A;  3PIN A;  3H8Q A;  4JE1 A;  4F9Z A;  5AIV A;  3G9B A;  1JZR A;  4K7O A;  1G7O A;  1SKS B;  2PN8 A;  1U3I A;  1X9W B;  3GNJ A;  3GH9 A;  2CT6 A;  1XWB A;  4WET A;  4QL9 A;  1ZOF A;  5FT3 A;  4V2L A;  4N30 A;  2F9S A;  2VCW A;  1A0R P;  3IBH A;  4KCE A;  3BJ5 A;  2H76 A;  2H1B A;  2GQK A;  2V32 A;  3DD3 A;  1ERU A;  3L78 A;  5B8B A;  2WZ9 A;  1GTU A;  1AXD A;  5ECS A;  4LMV A;  1VF4 A;  1ZZY A;  2H73 A;  2GLR A;  5FHI A;  4YAV A;  4FIW A;  3GRX A;  3HVX A;  1E2Y A;  2N5B A;  6GSV A;  1VGL A;  1VF3 A;  3IR4 A;  3C8E A;  2K6V A;  2HZF A;  1XWG A;  1CQH A;  3ME8 A;  1I5G A;  4HQZ A;  3H4K A;  4YQM A;  2HSY A;  5DAL B;  1YY7 A;  1ERV A;  4K0G A;  1V98 A;  2PGT A;  2AUV A;  2GZP A;  4TXO A;  3FR6 A;  5DQS A;  5HR2 A;  1JFU A;  3UAR A;  2FA8 A;  1SKW B;  3C7M A;  3PH9 A;  2YWI A;  2DIY A;  2YPM A;  1SU9 A;  1EZK A;  1X5C A;  4V1A g;  3C1R A;  2LV3 A;  4MLY A;  3FW2 A;  5GST A;  2IWT A;  1Z6N A;  5B6M A;  1QXH A;  4XIH A;  1QFN A;  1EGR A;  2B5E A;  3WGE A;  3EU3 A;  3GH6 A;  1A0F A;  3UBL A;  3UAP A;  2YJH A;  3A2W A;  1TXX A;  2C0D A;  3RDW A;  5G30 A;  1DE2 A;  1TJD A;  5IIZ A;  1BYE A;  3ZMK A;  1J08 A;  3E9J B;  2CQ9 A;  3UVH A;  4TR4 A;  4L5L A;  1UA5 A;  4FH8 A;  1EEJ A;  5EY6 A;  5LD0 A;  4KW6 A;  2CAI A;  5EL8 A;  3LWA A;  3ME7 A;  2GS3 A;  5E59 A;  4KGI A;  2YCD A;  2A2S A;  4IGJ A;  1WPI A;  2LRN A;  2C0F A;  1K0C A;  3WD6 A;  3BOA A;  3IRA A;  4NXI A;  2VL9 A;  3I6A A;  4KSM A;  3CBU A;  5DAK A;  1H75 A;  4G2E A;  5DCH A;  4Q5R A;  4EC0 A;  1PKW A;  3A3T A;  1QGV A;  2YWO A;  5ENU A;  2DML A;  2FHE A;  3Q6O A;  1OC8 A;  2VUP A;  3HA9 A;  3ZLP A;  2DJ0 A;  3ZTL A;  2RUF A;  5IMF A;  3TRX A;  1SJ6 A;  2NPB A;  1G7E A;  4EXJ A;  5D96 A;  2XBI A;  5LCZ A;  4NV2 A;  2C8U A;  2DBC A;  1XZO A;  2LJR A;  6GSS A;  3R2Q A;  3WGX A;  3H79 A;  2PBJ A;  4MJA A;  3CSH A;  3J7Y k;  2CVD A;  4MK3 A;  16GS A;  2XC2 A;  2IFQ A;  3ZFL A;  3HZ4 A;  4K8M A;  2C3T A;  2H0I A;  1T4Y A;  4MDC A;  3VWV A;  2GZZ A;  3JCM L;  5F0G A;  1XW5 A;  5D9T A;  3MDK A;  2IIY A;  4ULX A;  3TJK A;  11GS A;  5HQP A;  4HS1 A;  4TOP A;  3UIW A;  1E6B A;  1OKT A;  1FAA A;  4MZW A;  5INY A;  2LJK A;  4NHW A;  4G9H A;  4GF0 A;  4POB A;  3ERW A;  2XPD A;  1MDI A;  2GGT A;  3ZIT A;  4ZXG A;  1FVJ A;  17GS A;  3DYR A;  1V9W A;  3KP9 A;  3F4T A;  3V1W A;  2XHF A;  3M1G A;  4WF5 A;  4HEA 2;  2RUE A;  1XW6 A;  3O76 A;  2B6M A;  2H1D A;  4JED A;  4CHS A;  4JU5 A;  1EV4 A;  2J9H A;  2PUK C;  2FWH A;  4WR5 A;  3HXS A;  4NV5 A;  4KDU A;  3MWH A;  2P5R A;  2LQQ A;  1XOB A;  1XOA A;  3GX8 A;  2X99 A;  2GST A;  1PGT A;  3GMF A;  1Z7P A;  1GLQ A;  3S9F A;  4F0B A;  3GIX A;  3GHA A;  3GUS A;  2PVQ A;  3EWL A;  1M2B A;  1SK0 A;  1AQV A;  3CXG A;  2MMN A;  4HJM A;  4KND A;  3DVX A;  1WMJ A;  3EE2 A;  3IE3 A;  3LFL A;  3G7J A;  5H5S A;  1FHE A;  2HXK A;  4TXO B;  3P7X A;  2G0F A;  1OKD A;  4MA9 A;  2CV4 A;  2GSS A;  4QL7 A;  3HD5 A;  4IN0 A;  4EDY A;  4FYU A;  5D9V A;  2C3N A;  1IYI A;  1TRV A;  4K7N A;  3CTF A;  4KDY A;  5IQY A;  3ERG A;  1VF1 A;  2H75 A;  3D4M A;  2B3S A;  4MJB A;  5F05 A;  1X9M B;  2I3Y A;  3MNG A;  5LNK e;  4TN8 A;  3F0I A;  2R5G A;  2DJJ A;  18GS A;  2PWJ A;  2YWM A;  1GWC A;  5JWQ B;  3C1S A;  1NW2 A;  1M0U A;  1GUH A;  1YKA A;  5ECP B;  3ZML A;  4MF6 A;  4IQ1 A;  1Q4J A;  3CRU A;  4PXO A;  1TU8 A;  2YP6 A;  2FWG A;  2IPA A;  4V2N A;  4O5R A;  4N10 A;  5ECH B;  2I1U A;  2ALB A;  4EL1 A;  2KP1 A;  3KP8 A;  1A23 A;  1NHO A;  1GUL A;  3KXO A;  1C72 A;  1XIY A;  4IP1 A;  1OVN A;  1GUK A;  2XPE A;  5DAL A;  2WS2 A;  4HDE A;  2ZUP A;  4J56 E;  4TW5 A;  3WT1 A;  1R4W A;  1V2A A;  4MF7 A;  2V6O A;  5IMV A;  5ECK B;  4MH2 A;  4ZIJ A;  3N5O A;  4L8E A;  1A2L A;  2FGX A;  1XWA A;  2B5X A;  1BJX A;  2O87 A;  5D93 A;  10GS A;  2C3Q A;  1NHY A;  5D9X A;  3HJM A;  1K0M A;  2GDR A;  2H30 A;  1A2J A;  4ZBA A;  3A2V A;  5CO3 A;  1SL2 B;  3ERF A;  4DEJ A;  1YF0 A;  2IMK A;  2O85 A;  3F6D A;  2DC5 A;  2H0G A;  3D4T A;  4JR4 A;  7GSS A;  2OA7 A;  4POK A;  5CRG A;  5J3R A;  3W8J A;  1T3B A;  1GRX A;  1TI3 A;  1PQN A;  3FEU A;  1EP7 A;  3M0F A;  3DRN A;  4JR6 A;  1SYR A;  3IAS 2;  3GUR A;  2E0Q A;  4YQV A;  2MZC A;  4E8H A;  2VL2 C;  2H71 A;  1XPV A;  3RPN A;  1V57 A;  1PSQ A;  1PD2 1;  3VPQ A;  1M7T A;  3GL5 A;  4IJ3 A;  4XRD A;  2H6Z A;  4EUY A;  2MYG A;  1FB6 A;  1TOF A;  1DE1 A;  4TR1 B;  5G5E A;  2YN1 A;  2K18 A;  3HZ8 A;  3GST A;  1BX9 A;  2OE1 A;  1ZCP A;  5IO2 A;  4HU7 A;  2R4V A;  5IPH A;  3BD2 A;  3UEM A;  3KZQ A;  4AJ8 A;  1K3L A;  2HI7 A;  4ML1 A;  3UL3 A;  3MAK A;  1SJI A;  3GSS A;  2HRN A;  2BTO T;  1AAZ A;  1HNC A;  3HHV A;  2JZT A;  2CX4 A;  1AC1 A;  4IQA A;  4KE3 A;  2DJK A;  4GSN A;  5DJM A;  2XBQ A;  1ILO A;  5HR0 A;  5J9C A;  2H6Y A;  1JZW A;  2EIO A;  1EWX A;  2EIQ A;  4WR4 A;  1T7P B;  5EVO A;  4MF5 A;  4F0C A;  1AIU A;  4N0Z A;  4OFN A;  4X0X A;  4EF0 A;  1S3A A;  4IKH A;  1DBY A;  4MPF A;  3KCM A;  4BVX A;  4MZB A;  2AB6 A;  1T4Z A;  4AF2 A;  1IYH A;  2CA8 A;  4I2U A;  2I9H A;  2IJY A;  1NSW A;  2M80 A;  4Q5N A;  4MAB A;  3FHK A;  5CRE A;  1O7U A;  5KN0 A;  1FOV A;  2OJL A;  2H8L A;  1SJZ A;  1M99 A;  5GZZ B;  1HNB A;  3GKN A;  1MD3 A;  2KHP A;  2FCH A;  2H6X A;  4IHU A;  4KCA A;  5A4U A;  1GNE A;  1R7H A;  2HLS A;  4V2M A;  4PNG A;  1QMV A;  1MD4 A;  2LUS A;  1J0F A;  4PUF C;  1FG4 A;  4J2F A;  4P3Y B;  1F9M A;  2KOK A;  3E3E A;  5IOW A;  1USB A;  2AV4 A;  2FY6 A;  1GUM A;  2X8C A;  4POL A;  2E7P A;  3IDV A;  3UBK A;  2L4Q A;  5ID2 A;  2DSA A;  1RK4 A;  1WP0 A;  3TKS E;  3FY7 A;  2L5O A;  4L0U A;  1LJR A;  1PN9 A;  1GTB A;  3HVS A;  3OR5 A;  1F37 A;  1TTZ A;  3TKS C;  5KN1 A;  2C0E A;  4OCE A;  3EUR A;  3NIV A;  19GS A;  4RI6 A;  3LXZ A;  2H19 A;  4LL1 B;  1YDK A;  2NDO A;  3WGD A;  3ZRE A;  5FWG A;  1XWK A;  2GQL A;  1K3O A;  3APO A;  3KD0 A;  4DSR A;  1YQ1 A;  3IV4 A;  2L6C A;  2YV7 A;  2L6D A;  1EOG A;  1PL2 A;  1K0B A;  1O73 A;  6GSU A;  4F82 A;  1PRX A;  1LU4 A;  4DSS B;  3APS A;  1WRY A;  4GCI A;  2LTK A;  2CAQ A;  14GS A;  4KAE A;  3UJ1 A;  2CZ3 A;  3HYP A;  4I97 A;  3C71 A;  4PX1 A;  3PR8 A;  4MH3 A;  5CRW A;  4KSO A;  1EV9 A;  3IA1 A; 
#chains in the Genus database with same CATH topology
 1URM A;  3M8N A;  3M3M A;  2R37 A;  2HT9 A;  3LOR A;  4ACS A;  3ZFB A;  2X64 A;  2BJX A;  3LG6 A;  1PL1 A;  2GSR A;  1FO5 A;  4POM A;  3TKQ A;  5GAP D;  2Z9S A;  3CSJ A;  2I81 A;  2DLX A;  5ABR A;  2MMZ A;  2YV9 A;  3IK7 A;  4JBB A;  1Y25 A;  4HQS A;  2MBS A;  3EMP A;  1UC7 A;  3LYP A;  2IME A;  4BIK A;  2NTO A;  2QGV A;  1F3A A;  1SK1 A;  2H74 A;  1G0T A;  2OAC A;  4OD7 A;  4ML6 A;  1WJK A;  3M9J A;  1T00 A;  4XTS A;  4CY6 A;  1YZX A;  2CVK A;  2VCZ A;  3VWW A;  2VCX A;  4YQU A;  3O6T A;  3DXB A;  2VD1 A;  1G6Y A;  1XW9 A;  3IPZ A;  4IJI A;  5G5F A;  3VLN A;  6GSW A;  4TKY A;  3H1N A;  5AIX A;  1KBN A;  3TRP A;  1ZMA A;  1PA3 A;  1OC9 B;  2HNL A;  1Y6E A;  1KEB A;  1S3R A;  1EP8 A;  1AQX A;  5DDL A;  4ZB9 A;  2X49 A;  3KH9 A;  3TJB A;  2YZU A;  3UVT A;  3GX0 A;  1GP1 A;  3FZ5 A;  2HE3 A;  4AJ7 A;  3BCI A;  4CW9 A;  3LSZ A;  3LYK A;  4XS6 A;  1TRS A;  1JZD A;  1ZYE A;  1JLW A;  4TR1 A;  1Z6M A;  1S3D A;  2QKE A;  3QOU A;  3TKS A;  3TRQ A;  3VI7 A;  4TRX A;  3APQ A;  3ZL5 A;  2GVP A;  1ST9 A;  4ZBB A;  1BED A;  5ELA A;  5JWR B;  3FRC A;  3IC4 A;  2JSY A;  4ZL8 A;  1OAZ A;  3VWX A;  1G6W A;  1WIK A;  1SYX A;  3ZZX A;  3HJP A;  4WXT A;  3TOT A;  1UN2 A;  4EE0 A;  3FK8 A;  5AIS A;  1SD8 A;  3UMA A;  3FYG A;  1OYJ A;  2V2G A;  5IMC A;  3RAZ A;  5H5Q A;  2PU9 C;  4WKW A;  5ID2 B;  3FKF A;  2VL3 A;  3HVN A;  3QR6 A;  2DMM A;  1U3A A;  2PMT A;  4WEY A;  3F63 A;  2E2G A;  4G19 A;  2CZ2 A;  2VLV A;  3P8W A;  4BA7 A;  4KF9 A;  1PMT A;  1GNW A;  5ECO B;  2WDU A;  3TUE A;  2PPT A;  2HFD A;  4BVY A;  3LGC A;  1B4Q A;  1Q98 A;  5C00 A;  1TW9 A;  2OAD A;  3KGK A;  3DGQ A;  1K0A A;  3QAW A;  4ECJ A;  1MTC A;  1V58 A;  4HZ2 A;  4LA1 A;  2VCV A;  4EDZ A;  3Q74 A;  1OC3 A;  3ZYW A;  1Z7R A;  5BMU A;  3KMN A;  4K7I A;  3WYW A;  5ECM B;  2VD0 A;  3KM6 A;  3DWV A;  1VF2 A;  5E4W A;  3TGZ A;  3TJJ A;  3IC8 A;  2VAF A;  3C73 A;  1M9A A;  2OE0 A;  4K9Z A;  2O8V B;  3MYD A;  4GLT A;  5J41 A;  3QD9 A;  13GS A;  2QSI A;  4GQC A;  5ELG A;  3LJR A;  1XWC A;  1THX A;  1M3I A;  5AN1 A;  3SWL A;  2H70 A;  4O7H A;  5CYY A;  2HZE A;  3HKR A;  3UOM A;  3QCP A;  4HZ4 A;  3FR9 A;  3I43 A;  1THO A;  1B9X C;  1R5P A;  3GFK A;  2LEG A;  1T8E B;  2J23 A;  3KJY A;  4IW9 A;  1SL0 B;  1O8X A;  3MIX A;  3RBT A;  2EIR A;  5A5K A;  4MPG A;  4A5P A;  5JWO B;  4YAP A;  5ECI B;  3DEX A;  3L9V A;  1PFO A;  1XCC A;  3HJO A;  2F51 A;  5L71 A;  1FW1 A;  1MEK A;  4NWY A;  1B48 A;  1JLV A;  4FYB A;  1X5E A;  3K8N A;  4ECI A;  2WUL A;  1SL1 B;  2RLI A;  3GKK A;  4EVM A;  4DSS A;  1KNG A;  4NMU A;  4RQX A;  2FNO A;  4G0L A;  5JCU A;  3TKP A;  2M72 A;  3ZVJ D;  3NZN A;  3G7I A;  2WGR A;  2F3M A;  3R3E A;  1T1V A;  2B1K A;  1YEP A;  3LXT A;  4WBR D;  3ISO A;  1EGO A;  2V6K A;  4ZL7 A;  4GTU A;  1NM3 A;  5GAN D;  3N9J A;  1U87 A;  1B8X A;  2VOC A;  4X43 A;  2AYT A;  1GSE A;  3L0H A;  3RHC A;  1QQ2 A;  3VFI A;  4N11 A;  4D73 A;  4ZBD A;  3W6G A;  4PTS A;  1FVK A;  2N5F A;  1YJ6 A;  3CMI A;  2VCT A;  4WBJ A;  4O92 A;  1Z3E A;  1SK2 A;  1A8L A;  4ECC A;  2WCI A;  5DVB A;  1HQO A;  3KTB A;  2VLU A;  4I5Q A;  3GL3 A;  4GRF A;  5D8I A;  3EVI A;  3DML A;  1AQW A;  5F07 A;  4ZB8 A;  2H1A A;  2YNX A;  5A4V A;  3PGT A;  2CVB A;  1K0D A;  2AHE A;  1OC9 A;  1UVZ A;  5DCG A;  3NOF A;  3F9U A;  2FUG 2;  1PKZ A;  3ZRD A;  1ML6 A;  2L4C A;  5KEJ A;  1PX6 A;  3G7Y A;  1OE8 A;  4TVE A;  1I9D A;  3L9S A;  1A2M A;  1TRU A;  2L57 A;  4RI7 A;  3FR3 A;  5HFI A;  3F6F A;  4ISD A;  1QK8 A;  3LEF A;  1TK0 B;  2GZY A;  3ZIJ A;  3EIN A;  4I8B A;  3CTG A;  4G10 A;  2LKU A;  1PX7 A;  1GSQ A;  2IMI A;  3TCO A;  2HYX A;  4BPY A;  1TI1 A;  4EKZ A;  2JZR A;  2DJ2 A;  5ECR B;  2GQM A;  2PVO C;  1DSB A;  3D6I A;  5F06 A;  5IMZ A;  3IHG A;  4IEL A;  2H1G A;  2ON5 A;  1DUG A;  4XS4 A;  2P0G A;  1Z9H A;  1QUW A;  1B4P A;  2VLT A;  2HZE B;  5JCW A;  5IPG A;  4L5O A;  4GST A;  2P31 A;  4OO5 A;  5CP1 A;  2LS5 A;  3D21 A;  1X0R A;  4F03 A;  1M9B A;  3QFA C;  4KDX A;  6GSY A;  3US3 A;  5HR3 A;  2DJ1 A;  4IBP A;  3SBC A;  3QAV A;  4Z7X A;  1H4O A;  4RQR A;  4JZQ A;  2JAD A;  2OBI A;  1ZYN A;  4YH2 A;  4XCS A;  3I9V 2;  2VL2 A;  3KMO A;  4OFM A;  4FO5 A;  2TIR A;  2OBK A;  2QA2 A;  4MMM A;  5B8A A;  4GSS A;  3QDN A;  2B7J A;  1JHB A;  1SEN A;  5KN3 A;  4DVC A;  2K8V A;  1TDI A;  4GWR A;  2VM1 A;  3TB2 A;  2OKA A;  2FWF A;  2AJQ B;  3RPP A;  4KX4 A;  2RM6 A;  2VIM A;  1EEM A;  1GSS A;  3CRT A;  4LLR A;  4H86 A;  4BWS A;  2F8F A;  2YWN A;  3F3Q A;  5JCG A;  1ZYQ B;  1W4V A;  1XVQ A;  1WE0 A;  3DKS A;  3D0Z A;  1K3Y A;  4ZL9 A;  1BQ7 A;  1TK8 B;  3KEB A;  3RHB A;  1GL8 A;  3FZ4 A;  3P90 A;  2D2Z A;  5ECN B;  1ABA A;  5IOX A;  4G0K A;  4PNF A;  2BMX A;  2V41 A;  3GA4 A;  5HR1 A;  1O85 A;  4ZB6 A;  3GV1 A;  1GSU A;  1B9Y C;  1MDJ A;  3IHQ A;  5GSS A;  5KOW A;  4KA0 A;  2FD3 A;  1EOH A;  5EPF A;  4YKF A;  5HFG A;  4HUA A;  1ZGN A;  3TJF A;  4AJ6 A;  2MMO A;  3VPT A;  3CSI A;  1F2E A;  8GSS A;  4D73 B;  2FLS A;  4IVF A;  1X5D A;  1AW9 A;  2M46 A;  3D5J A;  1O6J A;  1U6T A;  4PQ1 A;  2WRT A;  1N2A A;  4BWQ A;  3GTU B;  2K9F A;  1U88 A;  1GTI A;  3F3R A;  4XRA A;  5BRT A;  2NVL A;  5D73 A;  1TK5 B;  4NPB A;  4HSC X;  2YOI A;  2KUC A;  4NAX A;  3Q19 A;  3F4R A;  1YKC A;  1RQM A;  3AY8 A;  5IMD A;  3GN3 A;  1GLP A;  5B6N A;  4TR0 A;  4K2D A;  12GS A;  3HCZ A;  4MNN A;  3VUR A;  1R26 A;  4LMW A;  4E8E A;  4O32 A;  1GSY A;  3FMW A;  1TU7 A;  4I2T A;  2RII A;  4HU9 A;  3FZA A;  2WFC A;  2GT6 A;  4V1A p;  5A4W A;  1S3C A;  3VWU A;  2E2M A;  2A4V A;  5AGY A;  2LQO A;  5CNW A;  2HRF A;  3U6V A;  4L0W A;  1AUC A;  2JZS A;  1FB0 A;  2HSH A;  3CYN A;  2JL4 A;  3MSZ A;  1SD9 A;  1TP9 A;  1F6M C;  6GSX A;  2R6K A;  4DSQ A;  3EC3 A;  4JRR A;  2LNS A;  4IS0 A;  2OE3 A;  1BAY A;  1MDK A;  5G1L A;  2LST A;  5COH A;  5G31 A;  4MJC A;  5ECL B;  5CRH A;  4GQF A;  4XS4 B;  4XHM A;  2L59 A;  4TR3 A;  3P2A A;  2I4A A;  4OMV A;  4K6X A;  2V1M A;  3BCK A;  5B7C A;  3D22 A;  2JAC A;  5D9W A;  3VK9 A;  3HY2 A;  1ZYP A;  2DJ3 A;  6GST A;  4ILF A;  5C04 A;  4GXZ A;  2K8S A;  2ES7 A;  3Q18 A;  4MCU A;  2PER A;  2IN3 A;  3TJG A;  2GT5 A;  2ZNM A;  3A5W A;  2R2J A;  1K0N A;  1W89 A;  1TKD B;  2RM5 A;  4FYC A;  4OFT A;  1A8Y A;  2DIZ A;  4TXV A;  4Q5F A;  3QFB C;  2IMF A;  1FOH A;  2GTU A;  2P5Q A;  3H93 A;  4AGS A;  5H5R A;  3M9K A;  2WB9 A;  3BBY A;  4Q5Q A;  2VCQ A;  3ZVJ A;  2H01 A;  4PGT A;  5G1K A;  1A24 A;  4X1U A;  2C4J A;  2H0H A;  2ON7 A;  2H66 A;  1GH2 A;  4IP6 A;  2LRC A;  4PQH A;  2MBT A;  4ZIL A;  1TRW A;  1Z5Y E;  4HOJ A;  2IL3 A;  3GKX A;  3U5R E;  4WF4 A;  2A2R A;  1XFL A;  2B5Y A;  2HSM A;  1GSD A;  2B7K A;  3QAG A;  3TKR A;  1HNA A;  5G2Z A;  3ED3 A;  3EU4 A;  2R0C A;  2AAW A;  1V40 A;  2MMA A;  3QMX A;  4K0N A;  9GSS A;  5KN2 A;  5IM9 A;  3L4N A;  4J57 E;  2L5L A;  3IAM 2;  1M2A A;  2C1Y A;  4MJE A;  5ECQ B;  2VM2 A;  1K0O A;  3A2X A;  2O89 A;  3F8U A;  2JSZ A;  4MZC A;  1YF1 A;  4LL4 B;  5DBQ A;  3O3T A;  4OWY A;  5J5N A;  2TRC P;  2KP2 A;  3DVW A;  1XBS A;  2O7K A;  1HYU A;  5DAK B;  3IK9 A;  3IXR A;  2JU5 A;  3GKM A;  3TOU A;  2CX3 A;  4MP4 A;  3J7Y b;  3I69 A;  4KH7 A;  1JZO A;  4I6X A;  1ERW A;  3KH7 A;  5IMA A;  1ZL9 A;  1GTA A;  4PUR A;  2KLX A;  2R3X A;  4F2I A;  22GS A;  5J9B A;  4N0V A;  2IMD A;  2G2Q A;  3EYT A;  1O81 A;  3W8S A;  4RUV A;  1J9B A;  4HJ2 A;  3ZIV A;  3IOS A;  2UZ8 A;  1WOU A;  4Z2U A;  3DIE A;  2N5A A;  2IFQ B;  2F8A A;  1OE7 A;  4KB3 A;  5CRD A;  2FA4 A;  3F4S A;  4NHZ A;  4CDO A;  2GSQ A;  1XVW A;  3EMX A;  3VI5 A;  1WWJ A;  2X8H A;  3WT2 A;  3HVV A;  1XG8 A;  1ERT A;  3E0U A;  1HD2 A;  4HI7 A;  3QPM A;  2LRT A;  2YJ7 A;  3GYK A;  2FWE A;  1BG5 A;  4K2X A;  5IO0 A;  2X8G A;  1CQG A;  2LJA A;  1X9S B;  2TRX A;  20GS A;  1O8W A;  4BL7 A;  1ACV A;  2C0G A;  1M2D A;  5DJL A;  1RW1 A;  5F8B A;  1GSF A;  1R5A A;  2YAN A;  3FZ9 A;  3L9U A;  1N8J A;  1PN0 A;  1XXU A;  1KTE A;  2C80 A;  4EO3 A;  4OCF A;  4KUN A;  2WJU A;  4ECB A;  4PUA A;  2EC4 A;  3GTU A;  5DQY A;  3KTL A;  4QQ7 A;  1F3B A;  3LQ7 A;  1LBK A;  2ZCT A;  5HFK A;  1YEX A;  3TDG A;  1ON4 A;  2NBS A;  3HDC A;  2VO4 A;  2B1L A;  2LNT A;  2QC7 A;  4ID0 A;  1SKR B;  4OO4 A;  2H72 A;  1VRS D;  4XS1 A;  4PQI A;  2YZH A;  3KIJ A;  2REM A;  4K1F A;  5CAX A;  5J4U A;  3PIN A;  3H8Q A;  4JE1 A;  4F9Z A;  5AIV A;  3G9B A;  1JZR A;  4K7O A;  1G7O A;  1SKS B;  2PN8 A;  1U3I A;  1X9W B;  3GNJ A;  3GH9 A;  2CT6 A;  1XWB A;  4WET A;  4QL9 A;  1ZOF A;  5FT3 A;  4V2L A;  4N30 A;  2F9S A;  2VCW A;  1A0R P;  3IBH A;  4KCE A;  3BJ5 A;  2H76 A;  2H1B A;  2GQK A;  2V32 A;  3DD3 A;  1ERU A;  3L78 A;  5B8B A;  2WZ9 A;  1GTU A;  1AXD A;  5ECS A;  4LMV A;  1VF4 A;  1ZZY A;  2H73 A;  2GLR A;  5FHI A;  4EIP A;  4YAV A;  4FIW A;  2HRA A;  3GRX A;  3HVX A;  1E2Y A;  2N5B A;  6GSV A;  1VGL A;  1VF3 A;  3IR4 A;  3C8E A;  2K6V A;  2HZF A;  1XWG A;  1CQH A;  3ME8 A;  1I5G A;  4HQZ A;  3H4K A;  4YQM A;  2HSY A;  5DAL B;  1YY7 A;  1ERV A;  4K0G A;  1V98 A;  2PGT A;  2AUV A;  2GZP A;  4TXO A;  3FR6 A;  5DQS A;  5HR2 A;  1JFU A;  3UAR A;  2FA8 A;  1SKW B;  3C7M A;  3PH9 A;  2YWI A;  2DIY A;  2YPM A;  1SU9 A;  1EZK A;  1X5C A;  4V1A g;  3C1R A;  2LV3 A;  4K5S A;  4MLY A;  3FW2 A;  5GST A;  2IWT A;  1Z6N A;  5B6M A;  1QXH A;  4XIH A;  1QFN A;  1EGR A;  2B5E A;  3WGE A;  3EU3 A;  3GH6 A;  1A0F A;  3UBL A;  3UAP A;  2YJH A;  3A2W A;  1TXX A;  2C0D A;  3RDW A;  5G30 A;  1DE2 A;  1TJD A;  5IIZ A;  1BYE A;  3ZMK A;  1J08 A;  3E9J B;  2CQ9 A;  3UVH A;  4TR4 A;  4L5L A;  1UA5 A;  4FH8 A;  1EEJ A;  5EY6 A;  5LD0 A;  2DKH A;  4KW6 A;  2CAI A;  5EL8 A;  3LWA A;  3ME7 A;  2GS3 A;  5E59 A;  4KGI A;  2YCD A;  2A2S A;  4IGJ A;  1WPI A;  2LRN A;  2C0F A;  1K0C A;  3WD6 A;  3BOA A;  4G0I A;  4BL7 B;  3IRA A;  4NXI A;  2VL9 A;  3I6A A;  4KSM A;  3CBU A;  5DAK A;  1H75 A;  4G2E A;  5DCH A;  4Q5R A;  4EC0 A;  1PKW A;  3A3T A;  1QGV A;  2YWO A;  5ENU A;  2DML A;  2FHE A;  3Q6O A;  1OC8 A;  2VUP A;  3HA9 A;  3ZLP A;  2DJ0 A;  3LW9 A;  2RUF A;  3ZTL A;  5IMF A;  3TRX A;  1SJ6 A;  2NPB A;  1G7E A;  4EXJ A;  5D96 A;  2XBI A;  5LCZ A;  4NV2 A;  2C8U A;  2DBC A;  1XZO A;  2LJR A;  6GSS A;  3R2Q A;  3WGX A;  3H79 A;  2PBJ A;  4K5R A;  4MJA A;  3CSH A;  3J7Y k;  2CVD A;  4MK3 A;  16GS A;  2XC2 A;  2IFQ A;  3ZFL A;  3HZ4 A;  4K8M A;  2C3T A;  2H0I A;  2A4H A;  1T4Y A;  4MDC A;  3VWV A;  2GZZ A;  3JCM L;  5F0G A;  1XW5 A;  5D9T A;  3MDK A;  2IIY A;  4ULX A;  3TJK A;  11GS A;  5HQP A;  4HS1 A;  4TOP A;  3UIW A;  1E6B A;  1OKT A;  1FAA A;  4MZW A;  5INY A;  2LJK A;  4NHW A;  4G9H A;  4GF0 A;  4POB A;  3ERW A;  2XPD A;  4BVX B;  1MDI A;  2GGT A;  3ZIT A;  4ZXG A;  1FVJ A;  17GS A;  3DYR A;  1V9W A;  3KP9 A;  3F4T A;  3V1W A;  2XHF A;  3M1G A;  4WF5 A;  4HEA 2;  2RUE A;  1XW6 A;  3O76 A;  2B6M A;  2H1D A;  4JED A;  4CHS A;  4JU5 A;  4Z2T A;  1EV4 A;  2J9H A;  2PUK C;  2FWH A;  4WR5 A;  3HXS A;  4NV5 A;  4KDU A;  3MWH A;  2P5R A;  2LQQ A;  1XOB A;  1XOA A;  3GX8 A;  2X99 A;  2GST A;  1PGT A;  3GMF A;  1Z7P A;  1GLQ A;  3S9F A;  4F0B A;  3GIX A;  3GHA A;  3GUS A;  2PVQ A;  3EWL A;  1M2B A;  1SK0 A;  1AQV A;  3CXG A;  2MMN A;  4HJM A;  4KND A;  3DVX A;  1WMJ A;  3EE2 A;  3IE3 A;  3LFL A;  3G7J A;  5H5S A;  1FHE A;  2HXK A;  4TXO B;  3P7X A;  2G0F A;  1OKD A;  4MA9 A;  2CV4 A;  2GSS A;  4QL7 A;  3HD5 A;  4IN0 A;  2QA1 A;  4EDY A;  4FYU A;  5D9V A;  2C3N A;  1IYI A;  1TRV A;  4K7N A;  3CTF A;  4KDY A;  5IQY A;  3ERG A;  1VF1 A;  2H75 A;  3D4M A;  2B3S A;  4MJB A;  5F05 A;  1X9M B;  2I3Y A;  3MNG A;  4Z2R A;  5LNK e;  4TN8 A;  3F0I A;  2R5G A;  2DJJ A;  18GS A;  2PWJ A;  2YWM A;  1GWC A;  5JWQ B;  3C1S A;  1NW2 A;  1M0U A;  1GUH A;  1YKA A;  5ECP B;  3ZML A;  4MF6 A;  4IQ1 A;  1Q4J A;  3CRU A;  4PXO A;  1TU8 A;  2YP6 A;  2FWG A;  2IPA A;  4V2N A;  4O5R A;  4N10 A;  5ECH B;  2I1U A;  2ALB A;  4EL1 A;  2KP1 A;  3EPT A;  3KP8 A;  1A23 A;  1NHO A;  1GUL A;  3KXO A;  1C72 A;  1XIY A;  4IP1 A;  1OVN A;  1GUK A;  2XPE A;  5DAL A;  2WS2 A;  4HDE A;  2ZUP A;  4J56 E;  4FQU A;  4TW5 A;  3WT1 A;  1R4W A;  1V2A A;  4MF7 A;  4O5Q A;  2V6O A;  5IMV A;  2R0G A;  5ECK B;  4MH2 A;  4ZIJ A;  3N5O A;  4L8E A;  1A2L A;  2FGX A;  1XWA A;  2B5X A;  1BJX A;  2O87 A;  5D93 A;  10GS A;  2C3Q A;  1NHY A;  5D9X A;  3HJM A;  1K0M A;  2GDR A;  2H30 A;  1A2J A;  4ZBA A;  3A2V A;  5CO3 A;  1M3J A;  1SL2 B;  3ERF A;  4DEJ A;  1YF0 A;  2IMK A;  2O85 A;  3F6D A;  2R0P A;  2DC5 A;  2H0G A;  3D4T A;  4JR4 A;  7GSS A;  2OA7 A;  4POK A;  5CRG A;  5J3R A;  3W8J A;  1T3B A;  1GRX A;  1TI3 A;  1PQN A;  3FEU A;  1EP7 A;  3M0F A;  3DRN A;  4JR6 A;  1SYR A;  3IAS 2;  3GUR A;  2E0Q A;  2A2P A;  4YQV A;  4X4J A;  2MZC A;  4E8H A;  2VL2 C;  2H71 A;  1XPV A;  3RPN A;  1V57 A;  1PSQ A;  1PD2 1;  3VPQ A;  1M7T A;  3GL5 A;  4IJ3 A;  4XRD A;  2H6Z A;  4EUY A;  2MYG A;  4EIQ A;  1FB6 A;  1TOF A;  1DE1 A;  4TR1 B;  5G5E A;  2YN1 A;  2K18 A;  3HZ8 A;  3GST A;  1BX9 A;  2OE1 A;  1ZCP A;  5IO2 A;  4HU7 A;  2R4V A;  5IPH A;  3BD2 A;  3UEM A;  3KZQ A;  4AJ8 A;  1K3L A;  2HRK A;  2HI7 A;  4ML1 A;  3UL3 A;  3MAK A;  1SJI A;  3A5I A;  3GSS A;  2HRN A;  4ICY A;  2BTO T;  2DKI A;  4YKG A;  1AAZ A;  1HNC A;  3HHV A;  2JZT A;  2CX4 A;  1AC1 A;  4IQA A;  4KE3 A;  2DJK A;  4GSN A;  5DJM A;  2XBQ A;  1ILO A;  5HR0 A;  5J9C A;  2H6Y A;  3PPU A;  1JZW A;  2EIO A;  1EWX A;  2EIQ A;  4WR4 A;  1T7P B;  5EVO A;  4MF5 A;  4F0C A;  1AIU A;  4N0Z A;  4OFN A;  4BVY B;  4X0X A;  4EF0 A;  1S3A A;  4IKH A;  1DBY A;  4MPF A;  3KCM A;  4BVX A;  4MZB A;  2AB6 A;  1T4Z A;  4AF2 A;  1IYH A;  2CA8 A;  4I2U A;  2I9H A;  5KOX A;  2IJY A;  1NSW A;  2M80 A;  4Q5N A;  4MAB A;  3FHK A;  5CRE A;  1O7U A;  5KN0 A;  1FOV A;  2OJL A;  4CY8 A;  2H8L A;  1SJZ A;  1M99 A;  5GZZ B;  1HNB A;  3GKN A;  1MD3 A;  2KHP A;  2FCH A;  3CQF A;  2H6X A;  4IHU A;  4KCA A;  5A4U A;  1GNE A;  1R7H A;  2HLS A;  4V2M A;  4PNG A;  1QMV A;  1MD4 A;  2LUS A;  1J0F A;  4PUF C;  1FG4 A;  4J2F A;  4P3Y B;  1F9M A;  2KOK A;  2X4A A;  3E3E A;  5IOW A;  1USB A;  2AV4 A;  2FY6 A;  1GUM A;  2X8C A;  4POL A;  2E7P A;  3IDV A;  3UBK A;  2L4Q A;  5ID2 A;  2DSA A;  1RK4 A;  1WP0 A;  3TKS E;  4USS A;  3FY7 A;  2L5O A;  4L0U A;  1LJR A;  1PN9 A;  1GTB A;  3HVS A;  3OR5 A;  1F37 A;  1TTZ A;  3TKS C;  5KN1 A;  2C0E A;  4OCE A;  3EUR A;  3NIV A;  19GS A;  4RI6 A;  3LXZ A;  2H19 A;  4LL1 B;  1YDK A;  2NDO A;  4O5U A;  3WGD A;  3ZRE A;  5FWG A;  1XWK A;  2GQL A;  1K3O A;  3APO A;  3KD0 A;  4DSR A;  1YQ1 A;  3IV4 A;  2L6C A;  2YV7 A;  2L6D A;  1EOG A;  1PL2 A;  1K0B A;  1O73 A;  6GSU A;  4F82 A;  1PRX A;  1LU4 A;  4DSS B;  3APS A;  1WRY A;  4GCI A;  2LTK A;  2CAQ A;  14GS A;  4KAE A;  3UJ1 A;  2CZ3 A;  3HYP A;  4I97 A;  3C71 A;  4PX1 A;  3PR8 A;  4MH3 A;  5CRW A;  4KSO A;  1EV9 A;  3IA1 A; 
#chains in the Genus database with same CATH homology
 1URM A;  3M8N A;  3M3M A;  2R37 A;  2HT9 A;  3LOR A;  4ACS A;  3ZFB A;  2X64 A;  2BJX A;  3LG6 A;  1PL1 A;  2GSR A;  1FO5 A;  4POM A;  3TKQ A;  5GAP D;  2Z9S A;  3CSJ A;  2I81 A;  2DLX A;  5ABR A;  2MMZ A;  2YV9 A;  3IK7 A;  4JBB A;  1Y25 A;  4HQS A;  2MBS A;  3EMP A;  1UC7 A;  3LYP A;  2IME A;  2NTO A;  2QGV A;  1F3A A;  1SK1 A;  2H74 A;  1G0T A;  2OAC A;  4OD7 A;  4ML6 A;  1WJK A;  3M9J A;  1T00 A;  4XTS A;  4CY6 A;  1YZX A;  2CVK A;  2VCZ A;  3VWW A;  2VCX A;  4YQU A;  3O6T A;  3DXB A;  2VD1 A;  1G6Y A;  1XW9 A;  3IPZ A;  4IJI A;  5G5F A;  3VLN A;  6GSW A;  4TKY A;  3H1N A;  5AIX A;  1KBN A;  3TRP A;  1ZMA A;  1PA3 A;  1OC9 B;  2HNL A;  1Y6E A;  1KEB A;  1EP8 A;  1AQX A;  5DDL A;  4ZB9 A;  2X49 A;  3KH9 A;  3TJB A;  2YZU A;  3UVT A;  3GX0 A;  1GP1 A;  3FZ5 A;  2HE3 A;  4AJ7 A;  3BCI A;  4CW9 A;  3LSZ A;  3LYK A;  4XS6 A;  1TRS A;  1JZD A;  1ZYE A;  1JLW A;  4TR1 A;  1Z6M A;  1S3D A;  2QKE A;  3QOU A;  3TKS A;  3TRQ A;  3VI7 A;  4TRX A;  3APQ A;  3ZL5 A;  2GVP A;  1ST9 A;  4ZBB A;  1BED A;  5ELA A;  5JWR B;  3FRC A;  3IC4 A;  2JSY A;  4ZL8 A;  1OAZ A;  3VWX A;  1G6W A;  1WIK A;  1SYX A;  3ZZX A;  3HJP A;  4WXT A;  3TOT A;  1UN2 A;  4EE0 A;  3FK8 A;  5AIS A;  1SD8 A;  3UMA A;  3FYG A;  1OYJ A;  2V2G A;  5IMC A;  3RAZ A;  5H5Q A;  2PU9 C;  4WKW A;  5ID2 B;  3FKF A;  2VL3 A;  3QR6 A;  2DMM A;  1U3A A;  2PMT A;  4WEY A;  3F63 A;  2E2G A;  4G19 A;  2CZ2 A;  2VLV A;  3P8W A;  4BA7 A;  4KF9 A;  1PMT A;  1GNW A;  5ECO B;  2WDU A;  3TUE A;  2PPT A;  2HFD A;  4BVY A;  3LGC A;  1B4Q A;  1Q98 A;  5C00 A;  1TW9 A;  2OAD A;  3KGK A;  3DGQ A;  1K0A A;  3QAW A;  4ECJ A;  1MTC A;  1V58 A;  4HZ2 A;  4LA1 A;  2VCV A;  4EDZ A;  3Q74 A;  1OC3 A;  3ZYW A;  1Z7R A;  5BMU A;  3KMN A;  4K7I A;  3WYW A;  5ECM B;  2VD0 A;  3KM6 A;  3DWV A;  1VF2 A;  5E4W A;  3TGZ A;  3TJJ A;  3IC8 A;  2VAF A;  3C73 A;  1M9A A;  2OE0 A;  4K9Z A;  2O8V B;  3MYD A;  4GLT A;  5J41 A;  3QD9 A;  13GS A;  2QSI A;  4GQC A;  5ELG A;  3LJR A;  1XWC A;  1THX A;  5AN1 A;  3SWL A;  2H70 A;  4O7H A;  5CYY A;  2HZE A;  3HKR A;  3UOM A;  3QCP A;  4HZ4 A;  3FR9 A;  3I43 A;  1THO A;  1B9X C;  1R5P A;  3GFK A;  2LEG A;  1T8E B;  2J23 A;  3KJY A;  4IW9 A;  1SL0 B;  1O8X A;  3MIX A;  3RBT A;  2EIR A;  5A5K A;  4MPG A;  4A5P A;  5JWO B;  4YAP A;  5ECI B;  3DEX A;  3L9V A;  1XCC A;  3HJO A;  2F51 A;  5L71 A;  1FW1 A;  1MEK A;  4NWY A;  1B48 A;  1JLV A;  4FYB A;  1X5E A;  3K8N A;  4ECI A;  2WUL A;  1SL1 B;  2RLI A;  3GKK A;  4EVM A;  4DSS A;  1KNG A;  4NMU A;  4RQX A;  2FNO A;  4G0L A;  5JCU A;  3TKP A;  2M72 A;  3ZVJ D;  3NZN A;  3G7I A;  2WGR A;  2F3M A;  3R3E A;  1T1V A;  2B1K A;  1YEP A;  3LXT A;  4WBR D;  3ISO A;  1EGO A;  2V6K A;  4ZL7 A;  4GTU A;  1NM3 A;  5GAN D;  3N9J A;  1U87 A;  1B8X A;  2VOC A;  4X43 A;  2AYT A;  1GSE A;  3L0H A;  3RHC A;  1QQ2 A;  3VFI A;  4N11 A;  4D73 A;  4ZBD A;  3W6G A;  4PTS A;  1FVK A;  2N5F A;  1YJ6 A;  3CMI A;  2VCT A;  4WBJ A;  4O92 A;  1Z3E A;  1SK2 A;  1A8L A;  4ECC A;  2WCI A;  5DVB A;  1HQO A;  3KTB A;  2VLU A;  4I5Q A;  3GL3 A;  4GRF A;  5D8I A;  3EVI A;  3DML A;  1AQW A;  5F07 A;  4ZB8 A;  2H1A A;  2YNX A;  5A4V A;  3PGT A;  2CVB A;  1K0D A;  2AHE A;  1OC9 A;  1UVZ A;  5DCG A;  3NOF A;  3F9U A;  2FUG 2;  1PKZ A;  3ZRD A;  1ML6 A;  2L4C A;  5KEJ A;  1PX6 A;  3G7Y A;  1OE8 A;  4TVE A;  1I9D A;  3L9S A;  1A2M A;  1TRU A;  2L57 A;  4RI7 A;  3FR3 A;  5HFI A;  3F6F A;  4ISD A;  1QK8 A;  3LEF A;  1TK0 B;  2GZY A;  3ZIJ A;  3EIN A;  4I8B A;  3CTG A;  4G10 A;  2LKU A;  1PX7 A;  1GSQ A;  2IMI A;  3TCO A;  2HYX A;  4BPY A;  1TI1 A;  4EKZ A;  2JZR A;  2DJ2 A;  5ECR B;  2GQM A;  2PVO C;  1DSB A;  3D6I A;  5F06 A;  5IMZ A;  3IHG A;  4IEL A;  2H1G A;  2ON5 A;  1DUG A;  4XS4 A;  2P0G A;  1Z9H A;  1QUW A;  1B4P A;  2VLT A;  2HZE B;  5JCW A;  5IPG A;  4L5O A;  4GST A;  2P31 A;  4OO5 A;  5CP1 A;  2LS5 A;  3D21 A;  1X0R A;  4F03 A;  1M9B A;  3QFA C;  4KDX A;  6GSY A;  3US3 A;  5HR3 A;  2DJ1 A;  4IBP A;  3SBC A;  3QAV A;  4Z7X A;  1H4O A;  4RQR A;  4JZQ A;  2JAD A;  2OBI A;  1ZYN A;  4YH2 A;  4XCS A;  3I9V 2;  2VL2 A;  3KMO A;  4OFM A;  4FO5 A;  2TIR A;  2OBK A;  2QA2 A;  4MMM A;  5B8A A;  4GSS A;  3QDN A;  2B7J A;  1JHB A;  1SEN A;  5KN3 A;  4DVC A;  2K8V A;  1TDI A;  4GWR A;  2VM1 A;  3TB2 A;  2OKA A;  2FWF A;  2AJQ B;  3RPP A;  4KX4 A;  2RM6 A;  2VIM A;  1EEM A;  1GSS A;  3CRT A;  4LLR A;  4H86 A;  4BWS A;  2F8F A;  2YWN A;  3F3Q A;  5JCG A;  1ZYQ B;  1W4V A;  1XVQ A;  1WE0 A;  3DKS A;  3D0Z A;  1K3Y A;  4ZL9 A;  1BQ7 A;  1TK8 B;  3KEB A;  3RHB A;  1GL8 A;  3FZ4 A;  3P90 A;  2D2Z A;  5ECN B;  1ABA A;  5IOX A;  4G0K A;  4PNF A;  2BMX A;  2V41 A;  3GA4 A;  5HR1 A;  1O85 A;  4ZB6 A;  3GV1 A;  1GSU A;  1B9Y C;  1MDJ A;  3IHQ A;  5GSS A;  5KOW A;  4KA0 A;  2FD3 A;  1EOH A;  5EPF A;  4YKF A;  5HFG A;  4HUA A;  1ZGN A;  3TJF A;  4AJ6 A;  2MMO A;  3VPT A;  3CSI A;  1F2E A;  8GSS A;  4D73 B;  2FLS A;  4IVF A;  1X5D A;  1AW9 A;  2M46 A;  3D5J A;  1O6J A;  1U6T A;  4PQ1 A;  2WRT A;  1N2A A;  4BWQ A;  3GTU B;  2K9F A;  1U88 A;  1GTI A;  3F3R A;  4XRA A;  5BRT A;  2NVL A;  5D73 A;  1TK5 B;  4NPB A;  2YOI A;  2KUC A;  4NAX A;  3Q19 A;  3F4R A;  1YKC A;  1RQM A;  3AY8 A;  5IMD A;  3GN3 A;  1GLP A;  5B6N A;  4TR0 A;  4K2D A;  12GS A;  3HCZ A;  4MNN A;  3VUR A;  1R26 A;  4LMW A;  4E8E A;  4O32 A;  1GSY A;  3FMW A;  1TU7 A;  4I2T A;  2RII A;  4HU9 A;  3FZA A;  2WFC A;  2GT6 A;  4V1A p;  5A4W A;  1S3C A;  3VWU A;  2E2M A;  2A4V A;  5AGY A;  2LQO A;  5CNW A;  2HRF A;  3U6V A;  4L0W A;  1AUC A;  2JZS A;  1FB0 A;  2HSH A;  3CYN A;  2JL4 A;  3MSZ A;  1SD9 A;  1TP9 A;  1F6M C;  6GSX A;  2R6K A;  4DSQ A;  3EC3 A;  4JRR A;  2LNS A;  4IS0 A;  2OE3 A;  1BAY A;  1MDK A;  5G1L A;  2LST A;  5COH A;  5G31 A;  4MJC A;  5ECL B;  5CRH A;  4GQF A;  4XS4 B;  4XHM A;  2L59 A;  4TR3 A;  3P2A A;  2I4A A;  4OMV A;  4K6X A;  2V1M A;  3BCK A;  5B7C A;  3D22 A;  2JAC A;  5D9W A;  3VK9 A;  3HY2 A;  1ZYP A;  2DJ3 A;  6GST A;  4ILF A;  5C04 A;  4GXZ A;  2K8S A;  2ES7 A;  3Q18 A;  4MCU A;  2PER A;  2IN3 A;  3TJG A;  2GT5 A;  2ZNM A;  3A5W A;  2R2J A;  1K0N A;  1W89 A;  1TKD B;  2RM5 A;  4FYC A;  4OFT A;  1A8Y A;  2DIZ A;  4TXV A;  4Q5F A;  3QFB C;  2IMF A;  1FOH A;  2GTU A;  2P5Q A;  3H93 A;  4AGS A;  5H5R A;  3M9K A;  2WB9 A;  3BBY A;  4Q5Q A;  2VCQ A;  3ZVJ A;  2H01 A;  4PGT A;  5G1K A;  1A24 A;  4X1U A;  2C4J A;  2H0H A;  2ON7 A;  2H66 A;  1GH2 A;  4IP6 A;  2LRC A;  4PQH A;  2MBT A;  4ZIL A;  1TRW A;  1Z5Y E;  4HOJ A;  2IL3 A;  3GKX A;  3U5R E;  4WF4 A;  2A2R A;  1XFL A;  2B5Y A;  2HSM A;  1GSD A;  2B7K A;  3QAG A;  3TKR A;  1HNA A;  5G2Z A;  3ED3 A;  3EU4 A;  2R0C A;  2AAW A;  1V40 A;  2MMA A;  3QMX A;  4K0N A;  9GSS A;  5KN2 A;  5IM9 A;  3L4N A;  4J57 E;  2L5L A;  3IAM 2;  1M2A A;  2C1Y A;  4MJE A;  5ECQ B;  2VM2 A;  1K0O A;  3A2X A;  2O89 A;  3F8U A;  2JSZ A;  4MZC A;  1YF1 A;  4LL4 B;  5DBQ A;  3O3T A;  4OWY A;  5J5N A;  2TRC P;  2KP2 A;  3DVW A;  1XBS A;  2O7K A;  1HYU A;  5DAK B;  3IK9 A;  3IXR A;  2JU5 A;  3GKM A;  3TOU A;  2CX3 A;  4MP4 A;  3J7Y b;  3I69 A;  4KH7 A;  1JZO A;  4I6X A;  1ERW A;  3KH7 A;  5IMA A;  1ZL9 A;  1GTA A;  4PUR A;  2KLX A;  2R3X A;  4F2I A;  22GS A;  5J9B A;  4N0V A;  2IMD A;  2G2Q A;  3EYT A;  1O81 A;  3W8S A;  4RUV A;  1J9B A;  4HJ2 A;  3ZIV A;  3IOS A;  2UZ8 A;  1WOU A;  4Z2U A;  3DIE A;  2N5A A;  2IFQ B;  2F8A A;  1OE7 A;  4KB3 A;  5CRD A;  2FA4 A;  3F4S A;  4NHZ A;  4CDO A;  2GSQ A;  1XVW A;  3EMX A;  3VI5 A;  1WWJ A;  2X8H A;  3WT2 A;  3HVV A;  1ERT A;  3E0U A;  1HD2 A;  4HI7 A;  3QPM A;  2LRT A;  2YJ7 A;  3GYK A;  2FWE A;  1BG5 A;  4K2X A;  5IO0 A;  2X8G A;  1CQG A;  2LJA A;  1X9S B;  2TRX A;  20GS A;  1O8W A;  4BL7 A;  1ACV A;  2C0G A;  1M2D A;  5DJL A;  1RW1 A;  5F8B A;  1GSF A;  1R5A A;  2YAN A;  3FZ9 A;  3L9U A;  1N8J A;  1PN0 A;  1XXU A;  1KTE A;  2C80 A;  4EO3 A;  4OCF A;  4KUN A;  2WJU A;  4ECB A;  4PUA A;  2EC4 A;  3GTU A;  5DQY A;  3KTL A;  4QQ7 A;  1F3B A;  3LQ7 A;  1LBK A;  2ZCT A;  5HFK A;  1YEX A;  3TDG A;  1ON4 A;  2NBS A;  3HDC A;  2VO4 A;  2B1L A;  2LNT A;  2QC7 A;  4ID0 A;  1SKR B;  4OO4 A;  2H72 A;  1VRS D;  4XS1 A;  4PQI A;  2YZH A;  3KIJ A;  2REM A;  4K1F A;  5CAX A;  5J4U A;  3PIN A;  3H8Q A;  4JE1 A;  4F9Z A;  5AIV A;  3G9B A;  1JZR A;  4K7O A;  1G7O A;  1SKS B;  2PN8 A;  1U3I A;  1X9W B;  3GNJ A;  3GH9 A;  2CT6 A;  1XWB A;  4WET A;  4QL9 A;  1ZOF A;  5FT3 A;  4V2L A;  4N30 A;  2F9S A;  2VCW A;  1A0R P;  3IBH A;  4KCE A;  3BJ5 A;  2H76 A;  2H1B A;  2GQK A;  2V32 A;  3DD3 A;  1ERU A;  3L78 A;  5B8B A;  2WZ9 A;  1GTU A;  1AXD A;  5ECS A;  4LMV A;  1VF4 A;  1ZZY A;  2H73 A;  2GLR A;  5FHI A;  4EIP A;  4YAV A;  4FIW A;  2HRA A;  3GRX A;  3HVX A;  1E2Y A;  2N5B A;  6GSV A;  1VGL A;  1VF3 A;  3IR4 A;  3C8E A;  2K6V A;  2HZF A;  1XWG A;  1CQH A;  3ME8 A;  1I5G A;  4HQZ A;  3H4K A;  4YQM A;  2HSY A;  5DAL B;  1YY7 A;  1ERV A;  4K0G A;  1V98 A;  2PGT A;  2AUV A;  2GZP A;  4TXO A;  3FR6 A;  5DQS A;  5HR2 A;  1JFU A;  3UAR A;  2FA8 A;  1SKW B;  3C7M A;  3PH9 A;  2YWI A;  2DIY A;  2YPM A;  1SU9 A;  1EZK A;  1X5C A;  4V1A g;  3C1R A;  2LV3 A;  4K5S A;  4MLY A;  3FW2 A;  5GST A;  2IWT A;  1Z6N A;  5B6M A;  1QXH A;  4XIH A;  1QFN A;  1EGR A;  2B5E A;  3WGE A;  3EU3 A;  3GH6 A;  1A0F A;  3UBL A;  3UAP A;  2YJH A;  3A2W A;  1TXX A;  2C0D A;  3RDW A;  5G30 A;  1DE2 A;  1TJD A;  5IIZ A;  1BYE A;  3ZMK A;  1J08 A;  3E9J B;  2CQ9 A;  3UVH A;  4TR4 A;  4L5L A;  1UA5 A;  4FH8 A;  1EEJ A;  5EY6 A;  5LD0 A;  2DKH A;  4KW6 A;  2CAI A;  5EL8 A;  3LWA A;  3ME7 A;  2GS3 A;  5E59 A;  4KGI A;  2YCD A;  2A2S A;  4IGJ A;  1WPI A;  2LRN A;  2C0F A;  1K0C A;  3WD6 A;  3BOA A;  4G0I A;  4BL7 B;  3IRA A;  4NXI A;  2VL9 A;  3I6A A;  4KSM A;  3CBU A;  5DAK A;  1H75 A;  4G2E A;  5DCH A;  4Q5R A;  4EC0 A;  1PKW A;  3A3T A;  1QGV A;  2YWO A;  5ENU A;  2DML A;  2FHE A;  3Q6O A;  1OC8 A;  2VUP A;  3HA9 A;  3ZLP A;  2DJ0 A;  3LW9 A;  2RUF A;  3ZTL A;  5IMF A;  3TRX A;  1SJ6 A;  2NPB A;  1G7E A;  4EXJ A;  5D96 A;  2XBI A;  5LCZ A;  4NV2 A;  2C8U A;  2DBC A;  1XZO A;  2LJR A;  6GSS A;  3R2Q A;  3WGX A;  3H79 A;  2PBJ A;  4K5R A;  4MJA A;  3CSH A;  3J7Y k;  2CVD A;  4MK3 A;  16GS A;  2XC2 A;  2IFQ A;  3ZFL A;  3HZ4 A;  4K8M A;  2C3T A;  2H0I A;  2A4H A;  1T4Y A;  4MDC A;  3VWV A;  2GZZ A;  3JCM L;  5F0G A;  1XW5 A;  5D9T A;  3MDK A;  2IIY A;  4ULX A;  3TJK A;  11GS A;  5HQP A;  4HS1 A;  4TOP A;  3UIW A;  1E6B A;  1OKT A;  1FAA A;  4MZW A;  5INY A;  2LJK A;  4NHW A;  4G9H A;  4GF0 A;  4POB A;  3ERW A;  2XPD A;  4BVX B;  1MDI A;  2GGT A;  3ZIT A;  4ZXG A;  1FVJ A;  17GS A;  3DYR A;  1V9W A;  3KP9 A;  3F4T A;  3V1W A;  2XHF A;  3M1G A;  4WF5 A;  4HEA 2;  2RUE A;  1XW6 A;  3O76 A;  2B6M A;  2H1D A;  4JED A;  4CHS A;  4JU5 A;  4Z2T A;  1EV4 A;  2J9H A;  2PUK C;  2FWH A;  4WR5 A;  3HXS A;  4NV5 A;  4KDU A;  3MWH A;  2P5R A;  2LQQ A;  1XOB A;  1XOA A;  3GX8 A;  2X99 A;  2GST A;  1PGT A;  3GMF A;  1Z7P A;  1GLQ A;  3S9F A;  4F0B A;  3GIX A;  3GHA A;  3GUS A;  2PVQ A;  3EWL A;  1M2B A;  1SK0 A;  1AQV A;  3CXG A;  2MMN A;  4HJM A;  4KND A;  3DVX A;  1WMJ A;  3EE2 A;  3IE3 A;  3LFL A;  3G7J A;  5H5S A;  1FHE A;  2HXK A;  4TXO B;  3P7X A;  2G0F A;  1OKD A;  4MA9 A;  2CV4 A;  2GSS A;  4QL7 A;  3HD5 A;  4IN0 A;  2QA1 A;  4EDY A;  4FYU A;  5D9V A;  2C3N A;  1IYI A;  1TRV A;  4K7N A;  3CTF A;  4KDY A;  5IQY A;  3ERG A;  1VF1 A;  2H75 A;  3D4M A;  2B3S A;  4MJB A;  5F05 A;  1X9M B;  2I3Y A;  3MNG A;  4Z2R A;  5LNK e;  4TN8 A;  3F0I A;  2R5G A;  2DJJ A;  18GS A;  2PWJ A;  2YWM A;  1GWC A;  5JWQ B;  3C1S A;  1NW2 A;  1M0U A;  1GUH A;  1YKA A;  5ECP B;  3ZML A;  4MF6 A;  4IQ1 A;  1Q4J A;  3CRU A;  4PXO A;  1TU8 A;  2YP6 A;  2FWG A;  2IPA A;  4V2N A;  4O5R A;  4N10 A;  5ECH B;  2I1U A;  2ALB A;  4EL1 A;  2KP1 A;  3EPT A;  3KP8 A;  1A23 A;  1NHO A;  1GUL A;  3KXO A;  1C72 A;  1XIY A;  4IP1 A;  1OVN A;  1GUK A;  2XPE A;  5DAL A;  2WS2 A;  4HDE A;  2ZUP A;  4J56 E;  4FQU A;  4TW5 A;  3WT1 A;  1R4W A;  1V2A A;  4MF7 A;  4O5Q A;  2V6O A;  5IMV A;  2R0G A;  5ECK B;  4MH2 A;  4ZIJ A;  3N5O A;  4L8E A;  1A2L A;  2FGX A;  1XWA A;  2B5X A;  1BJX A;  2O87 A;  5D93 A;  10GS A;  2C3Q A;  1NHY A;  5D9X A;  3HJM A;  1K0M A;  2GDR A;  2H30 A;  1A2J A;  4ZBA A;  3A2V A;  5CO3 A;  1SL2 B;  3ERF A;  4DEJ A;  1YF0 A;  2IMK A;  2O85 A;  3F6D A;  2R0P A;  2DC5 A;  2H0G A;  3D4T A;  4JR4 A;  7GSS A;  2OA7 A;  4POK A;  5CRG A;  5J3R A;  3W8J A;  1T3B A;  1GRX A;  1TI3 A;  1PQN A;  3FEU A;  1EP7 A;  3M0F A;  3DRN A;  4JR6 A;  1SYR A;  3IAS 2;  3GUR A;  2E0Q A;  2A2P A;  4YQV A;  4X4J A;  2MZC A;  4E8H A;  2VL2 C;  2H71 A;  1XPV A;  3RPN A;  1V57 A;  1PSQ A;  1PD2 1;  3VPQ A;  1M7T A;  3GL5 A;  4IJ3 A;  4XRD A;  2H6Z A;  4EUY A;  2MYG A;  4EIQ A;  1FB6 A;  1TOF A;  1DE1 A;  4TR1 B;  5G5E A;  2YN1 A;  2K18 A;  3HZ8 A;  3GST A;  1BX9 A;  2OE1 A;  1ZCP A;  5IO2 A;  4HU7 A;  2R4V A;  5IPH A;  3BD2 A;  3UEM A;  3KZQ A;  4AJ8 A;  1K3L A;  2HRK A;  2HI7 A;  4ML1 A;  3UL3 A;  3MAK A;  1SJI A;  3A5I A;  3GSS A;  2HRN A;  4ICY A;  2BTO T;  2DKI A;  4YKG A;  1AAZ A;  1HNC A;  3HHV A;  2JZT A;  2CX4 A;  1AC1 A;  4IQA A;  4KE3 A;  2DJK A;  4GSN A;  5DJM A;  2XBQ A;  1ILO A;  5HR0 A;  5J9C A;  2H6Y A;  3PPU A;  1JZW A;  2EIO A;  1EWX A;  2EIQ A;  4WR4 A;  1T7P B;  5EVO A;  4MF5 A;  4F0C A;  1AIU A;  4N0Z A;  4OFN A;  4BVY B;  4X0X A;  4EF0 A;  1S3A A;  4IKH A;  1DBY A;  4MPF A;  3KCM A;  4BVX A;  4MZB A;  2AB6 A;  1T4Z A;  4AF2 A;  1IYH A;  2CA8 A;  4I2U A;  2I9H A;  5KOX A;  2IJY A;  1NSW A;  2M80 A;  4Q5N A;  4MAB A;  3FHK A;  5CRE A;  1O7U A;  5KN0 A;  1FOV A;  2OJL A;  4CY8 A;  2H8L A;  1SJZ A;  1M99 A;  5GZZ B;  1HNB A;  3GKN A;  1MD3 A;  2KHP A;  2FCH A;  2H6X A;  4IHU A;  4KCA A;  5A4U A;  1GNE A;  1R7H A;  2HLS A;  4V2M A;  4PNG A;  1QMV A;  1MD4 A;  2LUS A;  1J0F A;  4PUF C;  1FG4 A;  4J2F A;  4P3Y B;  1F9M A;  2KOK A;  2X4A A;  3E3E A;  5IOW A;  1USB A;  2AV4 A;  2FY6 A;  1GUM A;  2X8C A;  4POL A;  2E7P A;  3IDV A;  3UBK A;  2L4Q A;  5ID2 A;  2DSA A;  1RK4 A;  1WP0 A;  3TKS E;  4USS A;  3FY7 A;  2L5O A;  4L0U A;  1LJR A;  1PN9 A;  1GTB A;  3HVS A;  3OR5 A;  1F37 A;  1TTZ A;  3TKS C;  5KN1 A;  2C0E A;  4OCE A;  3EUR A;  3NIV A;  19GS A;  4RI6 A;  3LXZ A;  2H19 A;  4LL1 B;  1YDK A;  2NDO A;  4O5U A;  3WGD A;  3ZRE A;  5FWG A;  1XWK A;  2GQL A;  1K3O A;  3APO A;  3KD0 A;  4DSR A;  1YQ1 A;  3IV4 A;  2L6C A;  2YV7 A;  2L6D A;  1EOG A;  1PL2 A;  1K0B A;  1O73 A;  6GSU A;  4F82 A;  1PRX A;  1LU4 A;  4DSS B;  3APS A;  1WRY A;  4GCI A;  2LTK A;  2CAQ A;  14GS A;  4KAE A;  3UJ1 A;  2CZ3 A;  3HYP A;  4I97 A;  3C71 A;  4PX1 A;  3PR8 A;  4MH3 A;  5CRW A;  4KSO A;  1EV9 A;  3IA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...