2LV3A

Structure-functional characterization of grx domain of mus musculus tgr
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
AREELRRRLRDLIEGNRVMIFSKSYCPHSTRVKELFSSLGVVYNILELDQVDDGASVQEVLTEISNQKTVPNIFVNKVHVGGCDRTFQAHQNGLLQKLLQDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase 3
publication title Structural analysis of glutaredoxin domain of Mus musculus thioredoxin glutathione reductase
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 102
sequence length 102
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2lv3A00
2X64A 2LJRA 4MLYA 4L0UA 5DCGA 3RDWA 1GNEA 1GLPA 3C1RA 4QQ7A 1TK8B 1SYXA 4TR1A 3ZRDA 5KN3A 3NZNA 4PUAA 2KUCA 2DMMA 5ENUA 4IQAA 2WGRA 1EOGA 3HD5A 5IO0A 2B7JA 2VD1A 1SL0B 3D4MA 4TXVA 3TKSC 1GTIA 3TJFA 3E0UA 5CRDA 1O85A 1QK8A 2WCIA 2PU9C 4KW6A 4DSSA 2IFQA 2O87A 3NIVA 2HNLA 1PD21 3TJGA 4PNFA 2K9FA 2DLXA 2GQKA 3QDNA 2VL9A 4HI7A 4WETA 3VI5A 2MYGA 5JCWA 3GKKA 4XIHA 1XWKA 3HJOA 4KB3A 4LMWA 2AUVA 4EL1A 2R2JA 4FIWA 1TKDB 1GTAA 4TW5A 3EU4A 1M7TA 4HU7A 3Q74A 2X99A 3GH6A 5J9BA 2HSYA 1PA3A 2J9HA 2O85A 2YWOA 3CXGA 4J57E 2CVBA 14GSA 4YQUA 3M8NA 4AJ8A 1FB6A 1AIUA 4FYBA 2V41A 4IW9A 1BJXA 5G31A 3C8EA 4OFNA 3D6IA 3UVTA 2DJ1A 3F6FA 1SU9A 1F9MA 3GL3A 2DSAA 4YQMA 3DGQA 1BG5A 3DIEA 2EIOA 2H71A 5IPGA 4BL7A 4O92A 4XRAA 4CHSA 1PKZA 1KEBA 1N2AA 4N30A 5G1KA 4AJ7A 1TP9A 3KP9A 2H1DA 1FVJA 1HNAA 1OYJA 3F6DA 2JZSA 2C0FA 3ME8A 2IMDA 3QPMA 3F9UA 1GSDA 4MDCA 1XW6A 20GSA 5IMFA 3EYTA 1PRXA 2IJYA 3ZLPA 2KP2A 1X5EA 5KN1A 2GZYA 1GNWA 4OMVA 2TRCP 3KMNA 1OE8A 2I81A 1TXXA 3CBUA 3UMAA 1GSFA 3BJ5A 4ISDA 3M9JA 1AC1A 4L5OA 5ECMB 1SJZA 2C8UA 1F37A 4V2LA 4L8EA 4EKZA 3ZFLA 4IS0A 4HU9A 5EY6A 3TUEA 4K7IA 4FH8A 4L0WA 2YWNA 2AYTA 4OFTA 1K3YA 1QXHA 1WJKA 1OC9B 3C71A 2LRNA 1GTBA 5EPFA 5B8AA 1J0FA 2OBIA 5EVOA 3ZVJD 2WZ9A 5LD0A 1X0RA 3VFIA 1K0NA 2C1YA 3ZMKA 1SYRA 1EEMA 1M9AA 2VLUA 3IHQA 2XPDA 1R7HA 1VF1A 1O73A 4ACSA 4ZBDA 2I4AA 4TXOA 2IIYA 4MH3A 1WRYA 3TOUA 2JZTA 1SJIA 1XZOA 5DJMA 4OCEA 4RI7A 5J3RA 2CAIA 2H74A 2KP1A 3GN3A 3RBTA 3IBHA 1XBSA 2L57A 2FWFA 2C80A 1H75A 3DMLA 3ISOA 3F3RA 3P2AA 5ELGA 5ID2A 1XW9A 1XFLA 2LNSA 3TB2A 3LXTA 2DJ2A 1K0DA 1PSQA 1ZGNA 3L0HA 5IMAA 4N0VA 3IV4A 1GUMA 1AUCA 1A2LA 1K0BA 4RQRA 3WYWA 4NWYA 1F3AA 5LCZA 2H0GA 1LU4A 4GSNA 4MP4A 5G2ZA 2LRCA 4JE1A 3QAWA 2LRTA 2D2ZA 2L5LA 3G7YA 2K8VA 4EO3A 1URMA 2R5GA 1OC8A 2ZNMA 4V2NA 5H5RA 1XXUA 3QAGA 1EP8A 4RI6A 4V2MA 1F6MC 1AQVA 2JL4A 1YEPA 2DIYA 2TRXA 1W4VA 3VK9A 1NW2A 2B6MA 1M0UA 1X9SB 5ABRA 3A3TA 4I8BA 2MBSA 2XBQA 1A24A 1USBA 3KEBA 4IGJA 22GSA 4K9ZA 1X9MB 2NDOA 1B4QA 1XWGA 2GQMA 4Z7XA 4BWSA 2RUFA 1YKCA 3ZFBA 3J7Yb 4KSOA 4MA9A 2JU5A 2E2GA 5HFIA 4FYUA 1ZYQB 3W8SA 2FWGA 3QCPA 4LA1A 2GSRA 3TKSE 2B5XA 1V40A 1EZKA 3WGEA 4IQ1A 2YZUA 4CDOA 6GSVA 3KTBA 1GULA 5C04A 1PQNA 1OAZA 2ALBA 4MPFA 5DDLA 1GSUA 5H5SA 3QAVA 2HSHA 3BCKA 1Y6EA 4TKYA 1T4YA 2LJAA 3DWVA 4NAXA 2C3NA 4IJ3A 5CRHA 4TXOB 2NVLA 5IOXA 4N0ZA 2WB9A 1TI1A 2E0QA 2M46A 1GTUA 2GLRA 3FR3A 1A8YA 1U6TA 12GSA 2AB6A 2PGTA 3ERGA 3RPPA 1QQ2A 1J9BA 4LL4B 3GKMA 4NV5A 1ACVA 2L5OA 2OA7A 1BX9A 4HQZA 3L78A 5D96A 1TRUA 4F82A 5D93A 4HEA2 5ECPB 6GSXA 11GSA 2JSYA 4KDYA 3IK9A 3LJRA 5B8BA 1EP7A 1Z5YE 5G5FA 5CRGA 4WEYA 2ES7A 4IHUA 1R5AA 2B5YA 2VCVA 2OJLA 3MAKA 1PL1A 4IJIA 3HY2A 3G7IA 4ZL9A 2CZ3A 3SWLA 1F3BA 2X8CA 1FHEA 3J7Yk 2PWJA 2H73A 4JU5A 3UEMA 2FD3A 4H86A 1EOHA 4HZ2A 4JEDA 1Z7PA 2H01A 1XIYA 3GKNA 2PN8A 2VOCA 5D8IA 2V32A 3A2WA 2CVKA 5HR2A 3IE3A 1T8EB 3LSZA 3RHBA 1MD3A 3LORA 2GSSA 2H70A 3ZIJA 1GL8A 1B48A 3GTUA 4EF0A 4P3YB 3KP8A 2OKAA 2CA8A 1JZOA 1WE0A 4KDUA 2DJKA 1VF4A 3C1SA 3VLNA 5JWOB 4ZB9A 2IMKA 1R26A 2NBSA 2H30A 5CRWA 3FZ4A 5IMZA 2L59A 2H0HA 4N11A 4D73B 5ECNB 1TI3A 4CW9A 1GP1A 5ECLB 5B7CA 1Z3EA 1GSEA 4HS1A 4XS4B 4FYCA 4ZBBA 2MMAA 3N9JA 3L9VA 4F03A 1TTZA 5IO2A 4EDYA 1XWCA 1SD8A 4F9ZA 3GA4A 4JRRA 5AN1A 1GLQA 2CVDA 4KDXA 2YWMA 2IMFA 3E3EA 4AF2A 2H76A 1VGLA 2VL2A 1XPVA 2F51A 5ECKB 1TRSA 3GNJA 4WF5A 3HHVA 1LJRA 1T3BA 3LG6A 3P90A 4KUNA 2YN1A 4PNGA 4IP6A 4MABA 1ZZYA 1GRXA 5AGYA 1AQXA 2H1AA 2H1GA 3U5RE 2IPAA 2MMOA 3IAS2 4MH2A 13GSA 1DE2A 1THXA 4MJCA 2GS3A 3P7XA 3L9SA 3TOTA 2YP6A 1HYUA 3L9UA 3PR8A 6GSWA 5D73A 3HVXA 3VPQA 1G6WA 1G0TA 2ON7A 2YCDA 3GSSA 1ZYEA 5CNWA 5DAKB 3VI7A 2N5AA 1KBNA 1NSWA 4I5QA 2B1KA 1A0FA 3ZZXA 3H8QA 2VM1A 4GQFA 4EXJA 4BVYA 2HRNA 4G2EA 1YQ1A 3KJYA 4TN8A 5KEJA 4WF4A 2B1LA 3OR5A 4OD7A 4OWYA 4F0BA 2XPEA 3IRAA 2HZEB 3KXOA 5F8BA 2LEGA 1OKTA 1S3CA 1ZCPA 4K0NA 3FKFA 4JBBA 3HDCA 3F4RA 4K7NA 2P5QA 3O6TA 5DCHA 1A23A 1HQOA 1ILOA 1O8WA 3KD0A 3R2QA 2FUG2 3SBCA 4HDEA 1I5GA 1BEDA 4YAVA 3D21A 4POKA 1M2AA 2V6KA 4MF6A 2F9SA 5A4UA 5IM9A 3WGDA 1K0OA 3TCOA 4J2FA 2VO4A 5HR1A 2P5RA 3MSZA 2PPTA 4WBJA 5GZZB 4HJMA 5CYYA 2HLSA 4MZCA 4IBPA 3DYRA 5JWRB 1TK5B 5CO3A 2A2SA 1N8JA 4OFMA 3TRXA 10GSA 1NHYA 4TR1B 3QMXA 3ZYWA 4MZBA 1MEKA 4WBRD 4IN0A 4ZXGA 1JLVA 1JHBA 2B3SA 1NHOA 5AIVA 3UJ1A 2WULA 2YJHA 3N5OA 1O6JA 3BOAA 2H8LA 3UBKA 4YAPA 5INYA 17GSA 1GSYA 2REMA 2H1BA 3DVXA 2HT9A 4HQSA 4DSSB 1YY7A 2IFQB 3E9JB 2VL2C 4I97A 1CQGA 2JACA 2O8VB 2HI7A 5EL8A 2RM5A 1A2MA 3CRTA 4POMA 2BJXA 1RQMA 1SL1B 1V9WA 2CAQA 5G5EA 4O5RA 1IYIA 4XCSA 3ME7A 3LYKA 3TKPA 2F8AA 4EDZA 2B5EA 2KHPA 4NMUA 2CV4A 4ZL8A 3WT2A 1TU8A 3UL3A 2YZHA 1O7UA 2QC7A 3HCZA 1E6BA 5HR3A 2WS2A 4XTSA 3LWAA 2TIRA 1AQWA 3EE2A 1FAAA 3WT1A 4EUYA 2LS5A 1SK2A 1WOUA 2FY6A 4AJ6A 3FZ9A 3GMFA 4BWQA 2HZFA 2ON5A 5AISA 5B6MA 2CX4A 2O89A 5CAXA 5DALA 1M99A 3ERFA 3ED3A 3RPNA 5L71A 2FA4A 2YJ7A 3MNGA 1F2EA 3D22A 3VWUA 5G30A 2IN3A 4JZQA 5F05A 3BD2A 2CX3A 4KX4A 5ECSA 4GQCA 1WIKA 1EV9A 1PN9A 3CSHA 2JSZA 1EEJA 5JCUA 4F2IA 3DVWA 1UC7A 3KZQA 2PUKC 4OO5A 3CTGA 4G9HA 1G7OA 1ML6A 1BYEA 1ERUA 2K8SA 4ECJA 3EMPA 2HXKA 4KSMA 1W89A 3F4TA 5D9TA 2V1MA 5B6NA 3GYKA 3EURA 1XOAA 5DVBA 1VF2A 1TW9A 4KAEA 2XHFA 2GDRA 3C7MA 2V2GA 1HNCA 5IQYA 1XW5A 2AV4A 3DRNA 6GSTA 4YQVA 2GGTA 3FZ5A 1PGTA 4XS6A 1BQ7A 2GT6A 4O7HA 2AAWA 3GFKA 4ECIA 3DEXA 1SKRB 2M72A 1YEXA 4V1Ap 3JCML 2A4VA 4N10A 4MF7A 4X0XA 3D4TA 5DQSA 4KGIA 4NHWA 5D9VA 3HJPA 1FO5A 3F4SA 2LV3A 2OE0A 3FW2A 4E8EA 4MZWA 2N5FA 2DJ3A 1JZRA 2QKEA 2DC5A 3EMXA 4BA7A 1XVQA 1U3IA 1R5PA 3GKXA 2R4VA 5JWQB 1YZXA 1SK0A 1FOVA 4GCIA 5ID2B 3M0FA 3S9FA 4PX1A 2LQQA 1X9WB 1V2AA 1T1VA 2RLIA 3NOFA 2RUEA 5F06A 1H4OA 4ZL7A 1TOFA 4TVEA 3GUSA 1GSSA 1S3DA 2IL3A 3G7JA 2GQLA 4TRXA 4XS1A 3MDKA 4NPBA 3CSIA 4TOPA 3QFAC 4WXTA 3HZ8A 2MMNA 5COHA 4ILFA 5CP1A 4XHMA 4BVXA 1S3AA 4GWRA 3A5WA 1PKWA 1NM3A 3FYGA 1MTCA 2H6XA 5IMDA 2GZPA 3IXRA 2LTKA 2VCTA 1J08A 5HFGA 4YH2A 3Q6OA 2YOIA 1DBYA 4X43A 4IELA 2IMIA 4AGSA 3UIWA 2DMLA 2MMZA 1XWBA 2OE1A 1ERWA 3VPTA 3VWXA 2L6CA 3BBYA 3KH7A 3LQ7A 4GTUA 3O76A 4LLRA 5FWGA 3HJMA 2GSTA 3RAZA 5E59A 3ZTLA 3UARA 5A4WA 1U88A 3H4KA 1XVWA 2AHEA 1X5DA 1SKSB 3IDVA 2DJ0A 4K6XA 2X8GA 1XCCA 2RIIA 2WJUA 5A5KA 3FK8A 3EC3A 1ERTA 1ZL9A 1TDIA 2VCZA 2A2RA 3HKRA 3LGCA 4ML6A 2GZZA 2EIQA 1GH2A 4IP1A 3A2XA 1HNBA 1LBKA 1V98A 2C4JA 2FWEA 2P31A 1DE1A 1ZMAA 3CYNA 5GSSA 1FW1A 2EC4A 3IAM2 4GSSA 4J56E 1A2JA 4ID0A 4K0GA 2YANA 3W8JA 2FWHA 2GTUA 4G19A 2KLXA 3GV1A 3W6GA 2HYXA 2H6YA 1JZDA 4RQXA 1A0RP 3ZMLA 1BAYA 2DJJA 5IMVA 1FVKA 5GAND 2XC2A 3BCIA 3ERWA 5GSTA 4TR3A 1QUWA 4HZ4A 4K8MA 1DSBA 1TJDA 1B8XA 1YF1A 3MWHA 3D5JA 3IPZA 2VAFA 1ZOFA 3I69A 1U87A 2CT6A 2VUPA 4ECBA 2IMEA 1ST9A 2FNOA 1AXDA 1OC9A 2C3QA 5ECRB 2C0DA 3IC4A 3PH9A 1PX7A 4HJ2A 2LJKA 2K6VA 3KCMA 3IA1A 3FEUA 2H66A 1OE7A 3FR6A 1TK0B 2YWIA 1DUGA 2Z9SA 5J41A 3GHAA 1EGOA 5D9WA 1U3AA 3EINA 3K8NA 1UN2A 2F8FA 5J4UA 3LFLA 2VCQA 2PBJA 2XBIA 3H79A 3GX8A 2VIMA 1PX6A 2MZCA 4QL9A 1VF3A 3Q19A 3KIJA 2PMTA 1FG4A 4G10A 2QSIA 2NPBA 3U6VA 1XWAA 2KOKA 1C72A 2I3YA 3APQA 5DBQA 3FRCA 3GTUB 3IK7A 1YKAA 3TKQA 1Y25A 2NTOA 1ON4A 2YV9A 3HZ4A 2K18A 2YPMA 3M3MA 4NXIA 3UBLA 3LEFA 3I9V2 4MMMA 2N5BA 4LL1B 4QL7A 1SJ6A 4XRDA 1JFUA 5AIXA 1CQHA 3HA9A 3EWLA 4GLTA 1T00A 1K0AA 5A4VA 5IOWA 4FO5A 1GSQA 3TDGA 5F0GA 1V58A 3DD3A 3IOSA 5ELAA 2MBTA 1MDKA 2FLSA 5DJLA 2LSTA 4KNDA 3ZVJA 2C0EA 4NV2A 3TJKA 1HD2A 5ECIB 2GVPA 4K2DA 2LKUA 4ECCA 3GRXA 3WGXA 4POLA 3Q18A 4LMVA 2DIZA 3UVHA 3GIXA 3GX0A 1TU7A 3KH9A 1WMJA 3CTFA 4TR0A 2OBKA 1E2YA 3VURA 3F63A 1VRSD 19GSA 4MK3A 3HXSA 3RHCA 3V1WA 1SL2B 2WFCA 1MDIA 4PQHA 1K0CA 2CQ9A 5HFKA 4KCEA 2J23A 2HRFA 1G6YA 1AAZA 3H1NA 3APOA 5IMCA 2H75A 4EE0A 2ZUPA 1T4ZA 2V6OA 3HVSA 2L4QA 4MCUA 4TR4A 3TRPA 4OCFA 1T7PB 1YDKA 1TRWA 1XOBA 4EVMA 5KN2A 3QOUA 3CRUA 1PL2A 1M9BA 4KA0A 4E8HA 3CMIA 9GSSA 3APSA 1QGVA 4ULXA 3VWWA 3TGZA 3P8WA 3G9BA 1SENA 2VD0A 3TRQA 4ZB6A 3EU3A 5D9XA 1FB0A 2M80A 4Q5FA 1KTEA 3GL5A 2VLTA 2VM2A 4DSQA 5FHIA 2LUSA 4HOJA 2VCWA 4ML1A 2G2QA 1Z6MA 1ABAA 1GWCA 3FHKA 5J9CA 2EIRA 4GSTA 2WDUA 2WRTA 2X8HA 4MJAA 5G1LA 4BPYA 3ZL5A 4RUVA 3ZITA 3A2VA 3DKSA 2H72A 1YJ6A 1I9DA 1M2BA 2AJQB 4DVCA 3VWVA 1Z9HA 1V57A 1GUHA 3GSTA 3PINA 1ERVA 1Q98A 3QD9A 3WD6A 3O3TA 2JADA 5H5QA 4L5LA 1K3LA 1M2DA 1B9XC 4IKHA 2FGXA 2VCXA 4HUAA 4WR4A 3TJJA 3FY7A 4ZB8A 3F0IA 2R37A 3D0ZA 4O32A 4ZBAA 2RM6A 2P0GA 4WKWA 1O8XA 2YV7A 7GSSA 1IYHA 4KH7A 4PURA 3ZIVA 1K0MA 1G7EA 3L4NA 2BTOT 2C0GA 1Z7RA 3US3A 1SKWB 4F0CA 4MJBA 1KNGA 5IPHA 2BMXA 2E7PA 5LNKe 1X5CA 2C3TA 1A8LA 4ZILA 4V1Ag 5J5NA 2I9HA 4JR4A 4Q5RA 5F07A 2R6KA 4D73A 3H93A 1OVNA 3GURA 4I2TA 2YNXA 3I6AA 4POBA 1OKDA 1O81A 4XS4A 1K3OA 3KM6A 3UAPA 4GF0A 3DXBA 2L4CA 2LNTA 1RK4A 5KN0A 4GXZA 2VLVA 4MF5A 1QFNA 3F8UA 2VL3A 3TKSA 5DQYA 6GSYA 4NHZA 1B9YC 5GAPD 5ECOB 2E2MA 2I1UA 3AY8A 1JZWA 2JZRA 16GSA 5DALB 2CZ2A 5FT3A 2IWTA 4X1UA 2ZCTA 5HR0A 4GRFA 2GT5A 4EC0A 2R3XA 1SD9A 1THOA 2PVOC 2G0FA 3FZAA 1WPIA 4K1FA 3HVVA 3LYPA 5C00A 4PGTA 2F3MA 1AW9A 2PERA 1MD4A 1MDJA 2PVQA 2GSQA 2HFDA 3HYPA 4DSRA 2H0IA 2H6ZA 4PQ1A 1WP0A 2O7KA 4OO4A 4JR6A 2H19A 2OADA 1TRVA 4IVFA 4ZIJA 4MPGA 3KTLA 6GSSA 5DAKA 5E4WA 2QGVA 3TKRA 1EV4A 1SK1A 3LXZA 18GSA 1UVZA 2FHEA 2FCHA 2FA8A 3GH9A 1PMTA 4WR5A 3M9KA 3C73A 1JLWA 2HE3A 2B7KA 3F3QA 4PQIA 1Z6NA 2HZEA 3ZREA 5CREA 4PUFC 6GSUA 3KMOA 3PGTA 3CSJA 4I2UA 3KGKA 4I6XA 1B4PA 8GSSA 3QFBC 4Q5NA 4KE3A 4KCAA 1UA5A 3TJBA 3IR4A 3QR6A 5HQPA 1RW1A 5IIZA 2LQOA 2OACA 1EGRA 3FR9A 2DBCA 1Q4JA 1EWXA 4PXOA 2OE3A 1WWJA 2L6DA 3M1GA 4MJEA 3I43A 5JCGA 1R4WA 1OC3A 4DEJA 4Q5QA 1GUKA 1YF0A 1QMVA 5ECHB 3UOMA 5ECQB 4K7OA 3EVIA
chains in the Genus database with same CATH superfamily
2X64A 2LJRA 4MLYA 4L0UA 5DCGA 3RDWA 1GNEA 1GLPA 3C1RA 4QQ7A 1TK8B 1SYXA 4TR1A 3ZRDA 5KN3A 3NZNA 4PUAA 2KUCA 2DMMA 5ENUA 4IQAA 2WGRA 1EOGA 3HD5A 5IO0A 2B7JA 2VD1A 1SL0B 3D4MA 4TXVA 3TKSC 1GTIA 3TJFA 3E0UA 5CRDA 1O85A 1QK8A 2WCIA 2PU9C 4KW6A 4DSSA 2IFQA 2O87A 3NIVA 2HNLA 1PD21 3TJGA 4PNFA 2K9FA 2DLXA 4BVXB 2GQKA 3QDNA 2VL9A 4HI7A 4WETA 3VI5A 2MYGA 5JCWA 3GKKA 3MYDA 4XIHA 1XWKA 3HJOA 4KB3A 4LMWA 2AUVA 2HRKA 4EL1A 2R2JA 4FIWA 1TKDB 1GTAA 4TW5A 3EU4A 1M7TA 4HU7A 3Q74A 2X99A 3GH6A 5J9BA 2HSYA 1PA3A 2J9HA 2O85A 2YWOA 3CXGA 4J57E 5BMUA 2CVBA 14GSA 4YQUA 3M8NA 4AJ8A 1FB6A 4O5UA 1AIUA 4FYBA 2V41A 4IW9A 1BJXA 5G31A 3C8EA 4OFNA 3D6IA 3UVTA 5KOWA 2DJ1A 3F6FA 1SU9A 1F9MA 3GL3A 2DSAA 4YQMA 3DGQA 1BG5A 3DIEA 2EIOA 2H71A 4YKFA 5IPGA 4BL7A 4O92A 4XRAA 4CHSA 1PKZA 1KEBA 1N2AA 4N30A 5G1KA 4AJ7A 4G0IA 1TP9A 3KP9A 2H1DA 1FVJA 1HNAA 1OYJA 3F6DA 2JZSA 2C0FA 3ME8A 2IMDA 3QPMA 3F9UA 1GSDA 4MDCA 1XW6A 20GSA 5IMFA 3EYTA 1PRXA 2IJYA 3ZLPA 2KP2A 1X5EA 5KN1A 2GZYA 1GNWA 4OMVA 2TRCP 3KMNA 1OE8A 2I81A 1TXXA 3CBUA 3UMAA 1GSFA 3BJ5A 4ISDA 3M9JA 1AC1A 4L5OA 5ECMB 1SJZA 2C8UA 1F37A 4V2LA 4L8EA 4EKZA 3ZFLA 4IS0A 4HU9A 5EY6A 3TUEA 4K7IA 4FH8A 4L0WA 2YWNA 2AYTA 4OFTA 1K3YA 1QXHA 1WJKA 1OC9B 3C71A 2LRNA 1GTBA 2UZ8A 5EPFA 5B8AA 1J0FA 2OBIA 5EVOA 3ZVJD 2WZ9A 5LD0A 1X0RA 3VFIA 1K0NA 2C1YA 3ZMKA 1SYRA 1EEMA 1M9AA 2VLUA 3IHQA 2XPDA 1R7HA 1VF1A 1O73A 4ACSA 4ZBDA 1PN0A 2I4AA 4TXOA 2IIYA 4MH3A 1WRYA 3TOUA 2JZTA 1SJIA 1XZOA 5DJMA 3CQFA 4OCEA 4RI7A 5J3RA 2CAIA 2H74A 2KP1A 3GN3A 3RBTA 3IBHA 1XBSA 2L57A 2FWFA 2C80A 1H75A 3DMLA 3ISOA 3F3RA 3P2AA 5ELGA 5ID2A 1XW9A 1XFLA 2LNSA 3TB2A 3LXTA 2DJ2A 1K0DA 1PSQA 1ZGNA 3L0HA 5IMAA 4N0VA 3IV4A 1GUMA 1AUCA 1A2LA 1K0BA 4RQRA 3WYWA 4NWYA 1F3AA 5LCZA 2H0GA 1LU4A 4GSNA 4MP4A 5G2ZA 2LRCA 4JE1A 3QAWA 2LRTA 2D2ZA 2L5LA 3G7YA 2K8VA 4EO3A 1URMA 2R5GA 1OC8A 2ZNMA 4V2NA 4MNNA 5H5RA 1XXUA 3QAGA 4RI6A 1EP8A 4V2MA 1F6MC 4K2XA 1AQVA 2JL4A 1YEPA 2DIYA 2TRXA 1W4VA 3VK9A 1NW2A 2B6MA 1M0UA 1X9SB 5ABRA 3A3TA 4I8BA 2MBSA 2XBQA 1A24A 1USBA 3KEBA 4IGJA 22GSA 4K9ZA 4EIQA 1X9MB 2NDOA 1B4QA 1XWGA 2GQMA 4Z7XA 4BWSA 2RUFA 1YKCA 3ZFBA 3J7Yb 4KSOA 4MA9A 2JU5A 2E2GA 5HFIA 4FYUA 1ZYQB 3W8SA 2FWGA 3QCPA 4LA1A 2GSRA 3TKSE 2B5XA 1V40A 1EZKA 3WGEA 4IQ1A 2YZUA 4CDOA 6GSVA 3KTBA 1GULA 4G0LA 5C04A 1PQNA 1OAZA 2ALBA 4MPFA 2R0PA 5DDLA 1GSUA 5H5SA 3QAVA 2HSHA 3BCKA 1Y6EA 4TKYA 1T4YA 2LJAA 3DWVA 4NAXA 2C3NA 4IJ3A 5CRHA 4TXOB 2NVLA 5IOXA 4N0ZA 2WB9A 1TI1A 2E0QA 2M46A 1GTUA 2GLRA 3FR3A 2DKHA 1A8YA 1U6TA 12GSA 2AB6A 4ICYA 2PGTA 3ERGA 3RPPA 1QQ2A 1J9BA 4LL4B 3GKMA 4NV5A 1ACVA 2L5OA 2OA7A 1BX9A 4HQZA 3L78A 5D96A 1TRUA 4F82A 5D93A 4HEA2 5ECPB 4K5SA 6GSXA 11GSA 2JSYA 4KDYA 3IK9A 3LJRA 5B8BA 1EP7A 1Z5YE 5G5FA 5CRGA 4WEYA 2ES7A 4IHUA 1R5AA 2B5YA 2VCVA 2OJLA 3MAKA 1PL1A 4IJIA 3HY2A 3G7IA 4ZL9A 2CZ3A 3SWLA 1F3BA 2X8CA 1FHEA 3J7Yk 2PWJA 2H73A 2QA1A 4JU5A 3UEMA 2FD3A 4H86A 4X4JA 1EOHA 4HZ2A 4JEDA 1Z7PA 2H01A 1XIYA 3GKNA 2PN8A 2VOCA 5D8IA 2V32A 4USSA 3A2WA 2CVKA 5HR2A 3IE3A 1T8EB 3LSZA 3RHBA 1MD3A 3LORA 2GSSA 2H70A 3ZIJA 1GL8A 1B48A 3GTUA 4EF0A 4P3YB 3KP8A 2OKAA 2CA8A 1JZOA 1WE0A 4KDUA 2DJKA 1VF4A 3C1SA 3VLNA 5JWOB 4ZB9A 2IMKA 1R26A 4Z2TA 2NBSA 2H30A 5CRWA 3FZ4A 5IMZA 2L59A 2H0HA 4N11A 4D73B 5ECNB 1TI3A 2R0CA 4CW9A 1GP1A 5ECLB 5B7CA 1Z3EA 1GSEA 4HS1A 4XS4B 4FYCA 4ZBBA 3IC8A 3R3EA 2MMAA 3N9JA 3L9VA 4F03A 1TTZA 5IO2A 4EDYA 1XWCA 1SD8A 4F9ZA 3GA4A 4JRRA 5AN1A 1GLQA 2CVDA 4KDXA 2YWMA 2IMFA 3E3EA 4AF2A 2X4AA 2H76A 1VGLA 2VL2A 1XPVA 2F51A 1TRSA 3GNJA 4WF5A 5ECKB 3HHVA 1LJRA 1T3BA 3LG6A 3P90A 4KUNA 2YN1A 4PNGA 4IP6A 4MABA 1ZZYA 1GRXA 5AGYA 1AQXA 2H1AA 2H1GA 3U5RE 2IPAA 2MMOA 3IAS2 4MH2A 13GSA 1DE2A 1THXA 4MJCA 2GS3A 3P7XA 3L9SA 3TOTA 2YP6A 1HYUA 3L9UA 3PR8A 6GSWA 5D73A 3HVXA 3VPQA 1G6WA 1G0TA 2ON7A 2YCDA 3GSSA 1ZYEA 5CNWA 5DAKB 3VI7A 2N5AA 1KBNA 1NSWA 4I5QA 2B1KA 1A0FA 3ZZXA 3H8QA 2VM1A 4GQFA 4EXJA 4BVYA 2HRNA 4G2EA 1YQ1A 3KJYA 4TN8A 5KEJA 4WF4A 2B1LA 3OR5A 4OD7A 4OWYA 4F0BA 2XPEA 4CY6A 3IRAA 2HZEB 3KXOA 5F8BA 2LEGA 1OKTA 1S3CA 1ZCPA 4K0NA 3FKFA 4JBBA 3HDCA 3F4RA 4K7NA 2P5QA 3O6TA 5DCHA 1A23A 1HQOA 1ILOA 1O8WA 3KD0A 2HRAA 3R2QA 2FUG2 3SBCA 4HDEA 1I5GA 1BEDA 4YAVA 3D21A 4POKA 1M2AA 2V6KA 4MF6A 2F9SA 5A4UA 5IM9A 3WGDA 1K0OA 3TCOA 4J2FA 2VO4A 5HR1A 2P5RA 3MSZA 2PPTA 4WBJA 5GZZB 4HJMA 5CYYA 2HLSA 3FMWA 4MZCA 4IBPA 5BRTA 3DYRA 5JWRB 1TK5B 5CO3A 2A2SA 1N8JA 4OFMA 3TRXA 10GSA 1NHYA 4TR1B 3QMXA 4YKGA 3ZYWA 4MZBA 1MEKA 4WBRD 4IN0A 4ZXGA 1JLVA 1JHBA 3PPUA 2B3SA 1NHOA 5AIVA 3UJ1A 2WULA 2YJHA 3N5OA 1O6JA 3BOAA 2H8LA 3UBKA 4YAPA 5INYA 4KF9A 17GSA 1GSYA 2REMA 2H1BA 3DVXA 2HT9A 4HQSA 4DSSB 1YY7A 2IFQB 3E9JB 2VL2C 4I97A 1CQGA 2JACA 2O8VB 2HI7A 5EL8A 2RM5A 1A2MA 3CRTA 4POMA 2BJXA 1RQMA 1SL1B 1V9WA 2CAQA 5G5EA 4O5RA 1IYIA 4XCSA 3ME7A 3LYKA 3TKPA 2F8AA 2HSMA 4EDZA 2B5EA 2KHPA 4NMUA 2CV4A 4ZL8A 3WT2A 1TU8A 3UL3A 2YZHA 1O7UA 2QC7A 3HCZA 1E6BA 5HR3A 2WS2A 4XTSA 2DKIA 3LWAA 2TIRA 1AQWA 3EE2A 1FAAA 3WT1A 4EUYA 2LS5A 3LW9A 1SK2A 1WOUA 2FY6A 4AJ6A 3FZ9A 3GMFA 4BWQA 2HZFA 2ON5A 5AISA 5B6MA 2A4HA 2CX4A 2O89A 5CAXA 5DALA 1M99A 3ERFA 3ED3A 3RPNA 5L71A 2FA4A 2YJ7A 3MNGA 1F2EA 3D22A 3VWUA 5G30A 2IN3A 4JZQA 4BL7B 5F05A 4Z2RA 3BD2A 2CX3A 4KX4A 5ECSA 4GQCA 1WIKA 1EV9A 1PN9A 3CSHA 2JSZA 1EEJA 5JCUA 4F2IA 3DVWA 1UC7A 3KZQA 4K5RA 2PUKC 4OO5A 3CTGA 4G9HA 1G7OA 1ML6A 1BYEA 1ERUA 2K8SA 4ECJA 3EMPA 2HXKA 4KSMA 1W89A 3F4TA 5D9TA 4Z2UA 2V1MA 5B6NA 3EPTA 3EURA 3GYKA 1XOAA 5DVBA 1VF2A 1TW9A 4KAEA 2XHFA 2GDRA 3C7MA 2V2GA 1HNCA 5IQYA 1XW5A 2AV4A 3DRNA 6GSTA 4YQVA 2GGTA 3FZ5A 1PGTA 4XS6A 1BQ7A 2GT6A 4O7HA 2AAWA 3GFKA 4ECIA 3DEXA 1SKRB 2M72A 1YEXA 4V1Ap 3JCML 2A4VA 4N10A 4MF7A 4X0XA 3D4TA 1S3RA 5DQSA 4KGIA 4NHWA 5D9VA 3HJPA 1FO5A 3F4SA 2LV3A 2OE0A 3FW2A 4E8EA 4MZWA 2N5FA 2DJ3A 1M3JA 1JZRA 2QKEA 2DC5A 3EMXA 4BA7A 1XVQA 1U3IA 1R5PA 3GKXA 2R4VA 5JWQB 1YZXA 1SK0A 1FOVA 4GCIA 5ID2B 3M0FA 3S9FA 4PX1A 2R0GA 2LQQA 1X9WB 1V2AA 3HVNA 1T1VA 2RLIA 3NOFA 2RUEA 5F06A 1H4OA 4ZL7A 1TOFA 4TVEA 3GUSA 1GSSA 1S3DA 2IL3A 3G7JA 2GQLA 4TRXA 4XS1A 3MDKA 4NPBA 3CSIA 4TOPA 3QFAC 4WXTA 3HZ8A 2MMNA 5COHA 4ILFA 5CP1A 4XHMA 4BVXA 1S3AA 4GWRA 3A5WA 1PKWA 1NM3A 3FYGA 1MTCA 2H6XA 5IMDA 2GZPA 3IXRA 2LTKA 2VCTA 1J08A 5HFGA 4YH2A 3Q6OA 2YOIA 1DBYA 4X43A 4IELA 2IMIA 4AGSA 3UIWA 2DMLA 2MMZA 1XWBA 2OE1A 1ERWA 3VPTA 3VWXA 2L6CA 3BBYA 3KH7A 3MIXA 3LQ7A 4GTUA 3O76A 4LLRA 5FWGA 3HJMA 2GSTA 3RAZA 5E59A 3ZTLA 3UARA 5A4WA 1U88A 3H4KA 1XVWA 2AHEA 1X5DA 1SKSB 3IDVA 2DJ0A 4K6XA 2X8GA 1XCCA 2RIIA 2WJUA 5A5KA 3FK8A 3EC3A 1ERTA 1ZL9A 1TDIA 2VCZA 2A2RA 3HKRA 3LGCA 4ML6A 2GZZA 2EIQA 4CY8A 1GH2A 4IP1A 3A2XA 1HNBA 1LBKA 1V98A 2C4JA 2FWEA 2P31A 1DE1A 1ZMAA 3CYNA 5GSSA 1FW1A 2EC4A 3IAM2 4GSSA 4J56E 1A2JA 3A5IA 4ID0A 4K0GA 2YANA 3W8JA 2FWHA 2GTUA 4G19A 1ZYPA 2KLXA 3GV1A 3W6GA 2HYXA 2H6YA 1JZDA 4RQXA 1A0RP 3ZMLA 1BAYA 2DJJA 5IMVA 1FVKA 5GAND 2XC2A 3BCIA 3ERWA 5GSTA 4TR3A 1QUWA 4HZ4A 4K8MA 1DSBA 1TJDA 1B8XA 1YF1A 3MWHA 3D5JA 3IPZA 2VAFA 1ZOFA 3I69A 1U87A 2CT6A 2VUPA 4ECBA 4A5PA 2IMEA 1ST9A 2FNOA 1AXDA 1OC9A 2C3QA 5ECRB 2C0DA 3IC4A 4EIPA 3PH9A 1PX7A 4HJ2A 2LJKA 2K6VA 3KCMA 3IA1A 3FEUA 2H66A 1OE7A 3FR6A 1TK0B 2YWIA 1DUGA 2Z9SA 5J41A 3GHAA 1EGOA 5D9WA 1U3AA 3EINA 3K8NA 1UN2A 2F8FA 5J4UA 3LFLA 2VCQA 2PBJA 2XBIA 3H79A 3GX8A 2VIMA 1PX6A 2MZCA 4QL9A 1VF3A 3Q19A 3KIJA 2PMTA 1FG4A 4G10A 2QSIA 2NPBA 3U6VA 1XWAA 2KOKA 1C72A 2I3YA 3APQA 5DBQA 3FRCA 3GTUB 3IK7A 1YKAA 3TKQA 1Y25A 2NTOA 1ON4A 2YV9A 3HZ4A 2K18A 2YPMA 3M3MA 4NXIA 3UBLA 3LEFA 3I9V2 4MMMA 2N5BA 4LL1B 4QL7A 1SJ6A 5KOXA 4XRDA 1JFUA 5AIXA 1CQHA 3HA9A 3EWLA 4GLTA 1T00A 1K0AA 5A4VA 5IOWA 4FO5A 1GSQA 3TDGA 5F0GA 1V58A 3DD3A 3IOSA 1PFOA 5ELAA 2MBTA 1MDKA 2FLSA 5DJLA 2LSTA 4KNDA 3ZVJA 2C0EA 4NV2A 3TJKA 1HD2A 5ECIB 2GVPA 4K2DA 2LKUA 4ECCA 3GRXA 3WGXA 4POLA 3Q18A 4LMVA 4O5QA 2DIZA 1M3IA 3UVHA 3GIXA 3GX0A 1TU7A 3KH9A 1FOHA 1WMJA 3CTFA 4TR0A 2OBKA 1E2YA 3VURA 3F63A 1VRSD 19GSA 4MK3A 3HXSA 3RHCA 3V1WA 1SL2B 2WFCA 1MDIA 4PQHA 1K0CA 2CQ9A 5HFKA 4KCEA 2J23A 2HRFA 1G6YA 1AAZA 3H1NA 3APOA 5IMCA 2H75A 1XG8A 4EE0A 2ZUPA 1T4ZA 2V6OA 3HVSA 2L4QA 4MCUA 4TR4A 3TRPA 4OCFA 1T7PB 1YDKA 1TRWA 1XOBA 4EVMA 2QA2A 5KN2A 3QOUA 3CRUA 1PL2A 1M9BA 4KA0A 4E8HA 3CMIA 9GSSA 3APSA 1QGVA 4ULXA 3VWWA 3TGZA 3P8WA 3G9BA 1SENA 2VD0A 3TRQA 4ZB6A 4BVYB 3EU3A 5D9XA 1FB0A 2M80A 4Q5FA 1KTEA 3GL5A 2VLTA 2VM2A 4DSQA 5FHIA 2LUSA 4HOJA 2VCWA 4ML1A 2G2QA 1Z6MA 1ABAA 1GWCA 3FHKA 5J9CA 2EIRA 4GSTA 2WDUA 2WRTA 2X8HA 4MJAA 5G1LA 4BPYA 3ZL5A 4RUVA 4BIKA 3ZITA 3A2VA 3DKSA 2H72A 1YJ6A 1I9DA 1M2BA 2A2PA 2AJQB 4DVCA 3VWVA 1Z9HA 1V57A 1GUHA 3GSTA 3PINA 1ERVA 1Q98A 3QD9A 3WD6A 3O3TA 2JADA 5H5QA 4L5LA 1K3LA 1M2DA 1B9XC 4IKHA 2FGXA 2VCXA 4HUAA 4WR4A 3TJJA 3FY7A 4ZB8A 3F0IA 2R37A 3D0ZA 4G0KA 3IHGA 4O32A 4ZBAA 2RM6A 2P0GA 4WKWA 1O8XA 2YV7A 7GSSA 1IYHA 4KH7A 4PURA 3ZIVA 1K0MA 1G7EA 3L4NA 2BTOT 2C0GA 1Z7RA 3US3A 1SKWB 4F0CA 4MJBA 1KNGA 5IPHA 2BMXA 2E7PA 5LNKe 1X5CA 2C3TA 1A8LA 4ZILA 4V1Ag 5J5NA 2I9HA 4JR4A 4Q5RA 5F07A 2R6KA 4D73A 2X49A 3H93A 4HSCX 1OVNA 3GURA 4I2TA 2YNXA 3I6AA 4POBA 1OKDA 1O81A 4XS4A 1K3OA 3KM6A 3UAPA 4GF0A 3DXBA 2L4CA 2LNTA 1RK4A 5KN0A 4GXZA 2VLVA 4MF5A 1QFNA 3F8UA 2VL3A 3TKSA 5DQYA 6GSYA 4NHZA 1B9YC 5GAPD 5ECOB 2E2MA 2I1UA 3AY8A 1JZWA 2JZRA 16GSA 5DALB 2CZ2A 5FT3A 2IWTA 4X1UA 2ZCTA 5HR0A 4GRFA 2GT5A 4EC0A 2R3XA 1SD9A 1THOA 2PVOC 2G0FA 3FZAA 1WPIA 1ZYNA 4K1FA 3HVVA 3LYPA 5C00A 4PGTA 2F3MA 1AW9A 2PERA 1MD4A 1MDJA 2PVQA 2GSQA 2HFDA 3HYPA 4DSRA 2H0IA 2H6ZA 4PQ1A 1WP0A 2O7KA 4OO4A 4JR6A 2H19A 2OADA 1TRVA 4IVFA 4ZIJA 4MPGA 3KTLA 6GSSA 5DAKA 5E4WA 2QGVA 3TKRA 1EV4A 1SK1A 3LXZA 18GSA 1UVZA 2FHEA 2FCHA 2FA8A 3GH9A 1PMTA 4WR5A 3M9KA 3C73A 1JLWA 2HE3A 2B7KA 3F3QA 4PQIA 1Z6NA 2HZEA 3ZREA 5CREA 4PUFC 6GSUA 3KMOA 3PGTA 3CSJA 4I2UA 3KGKA 4I6XA 1B4PA 8GSSA 3QFBC 4Q5NA 4KE3A 4KCAA 1UA5A 3TJBA 3IR4A 3QR6A 5HQPA 1RW1A 5IIZA 2LQOA 2OACA 1EGRA 3FR9A 2DBCA 1Q4JA 4FQUA 1EWXA 4PXOA 2OE3A 1WWJA 4PTSA 2L6DA 3M1GA 4MJEA 3I43A 5JCGA 1R4WA 1OC3A 4DEJA 4Q5QA 1GUKA 1YF0A 1QMVA 5ECHB 3UOMA 5ECQB 4K7OA 3EVIA
chains in the Genus database with same CATH topology
2X64A 2LJRA 4MLYA 4L0UA 5DCGA 3RDWA 1GNEA 1GLPA 3C1RA 4QQ7A 1TK8B 1SYXA 4TR1A 3ZRDA 5KN3A 3NZNA 4PUAA 2KUCA 2DMMA 5ENUA 4IQAA 2WGRA 1EOGA 3HD5A 5IO0A 2B7JA 2VD1A 1SL0B 3D4MA 4TXVA 3TKSC 1GTIA 3TJFA 3E0UA 5CRDA 1O85A 1QK8A 2WCIA 2PU9C 4KW6A 4DSSA 2IFQA 2O87A 3NIVA 2HNLA 1PD21 3TJGA 4PNFA 2K9FA 2DLXA 4BVXB 2GQKA 3QDNA 2VL9A 4HI7A 4WETA 3VI5A 2MYGA 5JCWA 3GKKA 3MYDA 4XIHA 1XWKA 3HJOA 4KB3A 4LMWA 2AUVA 2HRKA 4EL1A 2R2JA 4FIWA 1TKDB 1GTAA 4TW5A 3EU4A 1M7TA 4HU7A 3Q74A 2X99A 3GH6A 5J9BA 2HSYA 1PA3A 2J9HA 2O85A 2YWOA 3CXGA 4J57E 5BMUA 2CVBA 14GSA 4YQUA 3M8NA 4AJ8A 1FB6A 4O5UA 1AIUA 4FYBA 2V41A 4IW9A 1BJXA 5G31A 3C8EA 4OFNA 3D6IA 3UVTA 5KOWA 2DJ1A 3F6FA 1SU9A 1F9MA 3GL3A 2DSAA 4YQMA 3DGQA 1BG5A 3DIEA 2EIOA 2H71A 4YKFA 5IPGA 4BL7A 4O92A 4XRAA 4CHSA 1PKZA 1KEBA 1N2AA 4N30A 5G1KA 4AJ7A 4G0IA 1TP9A 3KP9A 2H1DA 1FVJA 1HNAA 1OYJA 3F6DA 2JZSA 2C0FA 3ME8A 2IMDA 3QPMA 3F9UA 1GSDA 4MDCA 1XW6A 20GSA 5IMFA 3EYTA 1PRXA 2IJYA 3ZLPA 2KP2A 1X5EA 5KN1A 2GZYA 1GNWA 4OMVA 2TRCP 3KMNA 1OE8A 2I81A 1TXXA 3CBUA 3UMAA 1GSFA 3BJ5A 4ISDA 3M9JA 1AC1A 4L5OA 5ECMB 1SJZA 2C8UA 1F37A 4V2LA 4L8EA 4EKZA 3ZFLA 4IS0A 4HU9A 5EY6A 3TUEA 4K7IA 4FH8A 4L0WA 2YWNA 2AYTA 4OFTA 1K3YA 1QXHA 1WJKA 1OC9B 3C71A 2LRNA 1GTBA 2UZ8A 5EPFA 5B8AA 1J0FA 2OBIA 5EVOA 3ZVJD 2WZ9A 5LD0A 1X0RA 3VFIA 1K0NA 2C1YA 3ZMKA 1SYRA 1EEMA 1M9AA 2VLUA 3IHQA 2XPDA 1R7HA 1VF1A 1O73A 4ACSA 4ZBDA 1PN0A 2I4AA 4TXOA 2IIYA 4MH3A 1WRYA 3TOUA 2JZTA 1SJIA 1XZOA 5DJMA 4OCEA 4RI7A 5J3RA 2CAIA 2H74A 2KP1A 3GN3A 3RBTA 3IBHA 1XBSA 2L57A 2FWFA 2C80A 1H75A 3DMLA 3ISOA 3F3RA 3P2AA 5ELGA 5ID2A 1XW9A 1XFLA 2LNSA 3TB2A 3LXTA 2DJ2A 1K0DA 1PSQA 1ZGNA 3L0HA 5IMAA 4N0VA 3IV4A 1GUMA 1AUCA 1A2LA 1K0BA 4RQRA 3WYWA 4NWYA 1F3AA 5LCZA 2H0GA 1LU4A 4GSNA 4MP4A 5G2ZA 2LRCA 4JE1A 3QAWA 2LRTA 2D2ZA 2L5LA 3G7YA 2K8VA 4EO3A 1URMA 2R5GA 1OC8A 2ZNMA 4V2NA 4MNNA 5H5RA 1XXUA 3QAGA 4RI6A 1EP8A 4V2MA 1F6MC 4K2XA 1AQVA 2JL4A 1YEPA 2DIYA 2TRXA 1W4VA 3VK9A 1NW2A 2B6MA 1M0UA 1X9SB 5ABRA 3A3TA 4I8BA 2MBSA 2XBQA 1A24A 1USBA 3KEBA 4IGJA 22GSA 4K9ZA 4EIQA 1X9MB 2NDOA 1B4QA 1XWGA 2GQMA 4Z7XA 4BWSA 2RUFA 1YKCA 3ZFBA 3J7Yb 4KSOA 4MA9A 2JU5A 2E2GA 5HFIA 4FYUA 1ZYQB 3W8SA 2FWGA 3QCPA 4LA1A 2GSRA 3TKSE 2B5XA 1V40A 1EZKA 3WGEA 4IQ1A 2YZUA 4CDOA 6GSVA 3KTBA 1GULA 4G0LA 5C04A 1PQNA 1OAZA 2ALBA 4MPFA 2R0PA 5DDLA 1GSUA 5H5SA 3QAVA 2HSHA 3BCKA 1Y6EA 4TKYA 1T4YA 2LJAA 3DWVA 4NAXA 2C3NA 4IJ3A 5CRHA 4TXOB 2NVLA 5IOXA 4N0ZA 2WB9A 1TI1A 2E0QA 2M46A 1GTUA 2GLRA 3FR3A 2DKHA 1A8YA 1U6TA 12GSA 2AB6A 4ICYA 2PGTA 3ERGA 3RPPA 1QQ2A 1J9BA 4LL4B 3GKMA 4NV5A 1ACVA 2L5OA 2OA7A 1BX9A 4HQZA 3L78A 5D96A 1TRUA 4F82A 5D93A 4HEA2 5ECPB 4K5SA 6GSXA 11GSA 2JSYA 4KDYA 3IK9A 3LJRA 5B8BA 1EP7A 1Z5YE 5G5FA 5CRGA 4WEYA 2ES7A 4IHUA 1R5AA 2B5YA 2VCVA 2OJLA 3MAKA 1PL1A 4IJIA 3HY2A 3G7IA 4ZL9A 2CZ3A 3SWLA 1F3BA 2X8CA 1FHEA 3J7Yk 2PWJA 2H73A 2QA1A 4JU5A 3UEMA 2FD3A 4H86A 4X4JA 1EOHA 4HZ2A 4JEDA 1Z7PA 2H01A 1XIYA 3GKNA 2PN8A 2VOCA 5D8IA 2V32A 4USSA 3A2WA 2CVKA 5HR2A 3IE3A 1T8EB 3LSZA 3RHBA 1MD3A 3LORA 2GSSA 2H70A 3ZIJA 1GL8A 1B48A 3GTUA 4EF0A 4P3YB 3KP8A 2OKAA 2CA8A 1JZOA 1WE0A 4KDUA 2DJKA 1VF4A 3C1SA 3VLNA 5JWOB 4ZB9A 2IMKA 1R26A 4Z2TA 2NBSA 2H30A 5CRWA 3FZ4A 5IMZA 2L59A 2H0HA 4N11A 4D73B 5ECNB 1TI3A 2R0CA 4CW9A 1GP1A 5ECLB 5B7CA 1Z3EA 1GSEA 4HS1A 4XS4B 4FYCA 4ZBBA 3IC8A 3R3EA 2MMAA 3N9JA 3L9VA 4F03A 1TTZA 5IO2A 4EDYA 1XWCA 1SD8A 4F9ZA 3GA4A 4JRRA 5AN1A 1GLQA 2CVDA 4KDXA 2YWMA 2IMFA 3E3EA 4AF2A 2X4AA 2H76A 1VGLA 2VL2A 1XPVA 2F51A 1TRSA 3GNJA 4WF5A 5ECKB 3HHVA 1LJRA 1T3BA 3LG6A 3P90A 4KUNA 2YN1A 4PNGA 4IP6A 4MABA 1ZZYA 1GRXA 5AGYA 1AQXA 2H1AA 2H1GA 3U5RE 2IPAA 2MMOA 3IAS2 4MH2A 13GSA 1DE2A 1THXA 4MJCA 2GS3A 3P7XA 3L9SA 3TOTA 2YP6A 1HYUA 3L9UA 3PR8A 6GSWA 5D73A 3HVXA 3VPQA 1G6WA 1G0TA 2ON7A 2YCDA 3GSSA 1ZYEA 5CNWA 5DAKB 3VI7A 2N5AA 1KBNA 1NSWA 4I5QA 2B1KA 1A0FA 3ZZXA 3H8QA 2VM1A 4GQFA 4EXJA 4BVYA 2HRNA 4G2EA 1YQ1A 3KJYA 4TN8A 5KEJA 4WF4A 2B1LA 3OR5A 4OD7A 4OWYA 4F0BA 2XPEA 4CY6A 3IRAA 2HZEB 3KXOA 5F8BA 2LEGA 1OKTA 1S3CA 1ZCPA 4K0NA 3FKFA 4JBBA 3HDCA 3F4RA 4K7NA 2P5QA 3O6TA 5DCHA 1A23A 1HQOA 1ILOA 1O8WA 3KD0A 2HRAA 3R2QA 2FUG2 3SBCA 4HDEA 1I5GA 1BEDA 4YAVA 3D21A 4POKA 1M2AA 2V6KA 4MF6A 2F9SA 5A4UA 5IM9A 3WGDA 1K0OA 3TCOA 4J2FA 2VO4A 5HR1A 2P5RA 3MSZA 2PPTA 4WBJA 5GZZB 4HJMA 5CYYA 2HLSA 3FMWA 4MZCA 4IBPA 5BRTA 3DYRA 5JWRB 1TK5B 5CO3A 2A2SA 1N8JA 4OFMA 3TRXA 10GSA 1NHYA 4TR1B 3QMXA 4YKGA 3ZYWA 4MZBA 1MEKA 4WBRD 4IN0A 4ZXGA 1JLVA 1JHBA 3PPUA 2B3SA 1NHOA 5AIVA 3UJ1A 2WULA 2YJHA 3N5OA 1O6JA 3BOAA 2H8LA 3UBKA 4YAPA 5INYA 4KF9A 17GSA 1GSYA 2REMA 2H1BA 3DVXA 2HT9A 4HQSA 4DSSB 1YY7A 2IFQB 3E9JB 2VL2C 4I97A 1CQGA 2JACA 2O8VB 2HI7A 5EL8A 2RM5A 1A2MA 3CRTA 4POMA 2BJXA 1RQMA 1SL1B 1V9WA 2CAQA 5G5EA 4O5RA 1IYIA 4XCSA 3ME7A 3LYKA 3TKPA 2F8AA 2HSMA 4EDZA 2B5EA 2KHPA 4NMUA 2CV4A 4ZL8A 3WT2A 1TU8A 3UL3A 2YZHA 1O7UA 2QC7A 3HCZA 1E6BA 5HR3A 2WS2A 4XTSA 2DKIA 3LWAA 2TIRA 1AQWA 3EE2A 1FAAA 3WT1A 4EUYA 2LS5A 3LW9A 1SK2A 1WOUA 2FY6A 4AJ6A 3FZ9A 3GMFA 4BWQA 2HZFA 2ON5A 5AISA 5B6MA 2A4HA 2CX4A 2O89A 5CAXA 5DALA 1M99A 3ERFA 3ED3A 3RPNA 5L71A 2FA4A 2YJ7A 3MNGA 1F2EA 3D22A 3VWUA 5G30A 2IN3A 4JZQA 4BL7B 5F05A 4Z2RA 3BD2A 2CX3A 4KX4A 5ECSA 4GQCA 1WIKA 1EV9A 1PN9A 3CSHA 2JSZA 1EEJA 5JCUA 4F2IA 3DVWA 1UC7A 3KZQA 4K5RA 2PUKC 4OO5A 3CTGA 4G9HA 1G7OA 1ML6A 1BYEA 1ERUA 2K8SA 4ECJA 3EMPA 2HXKA 4KSMA 1W89A 3F4TA 5D9TA 4Z2UA 2V1MA 5B6NA 3EPTA 3EURA 3GYKA 1XOAA 5DVBA 1VF2A 1TW9A 4KAEA 2XHFA 2GDRA 3C7MA 2V2GA 1HNCA 5IQYA 1XW5A 2AV4A 3DRNA 6GSTA 4YQVA 2GGTA 3FZ5A 1PGTA 4XS6A 1BQ7A 2GT6A 4O7HA 2AAWA 3GFKA 4ECIA 3DEXA 1SKRB 2M72A 1YEXA 4V1Ap 3JCML 2A4VA 4N10A 4MF7A 4X0XA 3D4TA 5DQSA 4KGIA 4NHWA 5D9VA 3HJPA 1FO5A 3F4SA 2LV3A 2OE0A 3FW2A 4E8EA 4MZWA 2N5FA 2DJ3A 1JZRA 2QKEA 2DC5A 3EMXA 4BA7A 1XVQA 1U3IA 1R5PA 3GKXA 2R4VA 5JWQB 1YZXA 1SK0A 1FOVA 4GCIA 5ID2B 3M0FA 3S9FA 4PX1A 2R0GA 2LQQA 1X9WB 1V2AA 1T1VA 2RLIA 3NOFA 2RUEA 5F06A 1H4OA 4ZL7A 1TOFA 4TVEA 3GUSA 1GSSA 1S3DA 2IL3A 3G7JA 2GQLA 4TRXA 4XS1A 3MDKA 4NPBA 3CSIA 4TOPA 3QFAC 4WXTA 3HZ8A 2MMNA 5COHA 4ILFA 5CP1A 4XHMA 4BVXA 1S3AA 4GWRA 3A5WA 1PKWA 1NM3A 3FYGA 1MTCA 2H6XA 5IMDA 2GZPA 3IXRA 2LTKA 2VCTA 1J08A 5HFGA 4YH2A 3Q6OA 2YOIA 1DBYA 4X43A 4IELA 2IMIA 4AGSA 3UIWA 2DMLA 2MMZA 1XWBA 2OE1A 1ERWA 3VPTA 3VWXA 2L6CA 3BBYA 3KH7A 3MIXA 3LQ7A 4GTUA 3O76A 4LLRA 5FWGA 3HJMA 2GSTA 3RAZA 5E59A 3ZTLA 3UARA 5A4WA 1U88A 3H4KA 1XVWA 2AHEA 1X5DA 1SKSB 3IDVA 2DJ0A 4K6XA 2X8GA 1XCCA 2RIIA 2WJUA 5A5KA 3FK8A 3EC3A 1ERTA 1ZL9A 1TDIA 2VCZA 2A2RA 3HKRA 3LGCA 4ML6A 2GZZA 2EIQA 4CY8A 1GH2A 4IP1A 3A2XA 1HNBA 1LBKA 1V98A 2C4JA 2FWEA 2P31A 1DE1A 1ZMAA 3CYNA 5GSSA 1FW1A 2EC4A 3IAM2 4GSSA 4J56E 1A2JA 3A5IA 4ID0A 4K0GA 2YANA 3W8JA 2FWHA 2GTUA 4G19A 1ZYPA 2KLXA 3GV1A 3W6GA 2HYXA 2H6YA 1JZDA 4RQXA 1A0RP 3ZMLA 1BAYA 2DJJA 5IMVA 1FVKA 5GAND 2XC2A 3BCIA 3ERWA 5GSTA 4TR3A 1QUWA 4HZ4A 4K8MA 1DSBA 1TJDA 1B8XA 1YF1A 3MWHA 3D5JA 3IPZA 2VAFA 1ZOFA 3I69A 1U87A 2CT6A 2VUPA 4ECBA 4A5PA 2IMEA 1ST9A 2FNOA 1AXDA 1OC9A 2C3QA 5ECRB 2C0DA 3IC4A 4EIPA 3PH9A 1PX7A 4HJ2A 2LJKA 2K6VA 3KCMA 3IA1A 3FEUA 2H66A 1OE7A 3FR6A 1TK0B 2YWIA 1DUGA 2Z9SA 5J41A 3GHAA 1EGOA 5D9WA 1U3AA 3EINA 3K8NA 1UN2A 2F8FA 5J4UA 3LFLA 2VCQA 2PBJA 2XBIA 3H79A 3GX8A 2VIMA 1PX6A 2MZCA 4QL9A 1VF3A 3Q19A 3KIJA 2PMTA 1FG4A 4G10A 2QSIA 2NPBA 3U6VA 1XWAA 2KOKA 1C72A 2I3YA 3APQA 5DBQA 3FRCA 3GTUB 3IK7A 1YKAA 3TKQA 1Y25A 2NTOA 1ON4A 2YV9A 3HZ4A 2K18A 2YPMA 3M3MA 4NXIA 3UBLA 3LEFA 3I9V2 4MMMA 2N5BA 4LL1B 4QL7A 1SJ6A 5KOXA 4XRDA 1JFUA 5AIXA 1CQHA 3HA9A 3EWLA 4GLTA 1T00A 1K0AA 5A4VA 5IOWA 4FO5A 1GSQA 3TDGA 5F0GA 1V58A 3DD3A 3IOSA 5ELAA 2MBTA 1MDKA 2FLSA 5DJLA 2LSTA 4KNDA 3ZVJA 2C0EA 4NV2A 3TJKA 1HD2A 5ECIB 2GVPA 4K2DA 2LKUA 4ECCA 3GRXA 3WGXA 4POLA 3Q18A 4LMVA 4O5QA 2DIZA 3UVHA 3GIXA 3GX0A 1TU7A 3KH9A 1FOHA 1WMJA 3CTFA 4TR0A 2OBKA 1E2YA 3VURA 3F63A 1VRSD 19GSA 4MK3A 3HXSA 3RHCA 3V1WA 1SL2B 2WFCA 1MDIA 4PQHA 1K0CA 2CQ9A 5HFKA 4KCEA 2J23A 2HRFA 1G6YA 1AAZA 3H1NA 3APOA 5IMCA 2H75A 4EE0A 2ZUPA 1T4ZA 2V6OA 3HVSA 2L4QA 4MCUA 4TR4A 3TRPA 4OCFA 1T7PB 1YDKA 1TRWA 1XOBA 4EVMA 2QA2A 5KN2A 3QOUA 3CRUA 1PL2A 1M9BA 4KA0A 4E8HA 3CMIA 9GSSA 3APSA 1QGVA 4ULXA 3VWWA 3TGZA 3P8WA 3G9BA 1SENA 2VD0A 3TRQA 4ZB6A 4BVYB 3EU3A 5D9XA 1FB0A 2M80A 4Q5FA 1KTEA 3GL5A 2VLTA 2VM2A 4DSQA 5FHIA 2LUSA 4HOJA 2VCWA 4ML1A 2G2QA 1Z6MA 1ABAA 1GWCA 3FHKA 5J9CA 2EIRA 4GSTA 2WDUA 2WRTA 2X8HA 4MJAA 5G1LA 4BPYA 3ZL5A 4RUVA 3ZITA 3A2VA 3DKSA 2H72A 1YJ6A 1I9DA 1M2BA 2A2PA 2AJQB 4DVCA 3VWVA 1Z9HA 1V57A 1GUHA 3GSTA 3PINA 1ERVA 1Q98A 3QD9A 3WD6A 3O3TA 2JADA 5H5QA 4L5LA 1K3LA 1M2DA 1B9XC 4IKHA 2FGXA 2VCXA 4HUAA 4WR4A 3TJJA 3FY7A 4ZB8A 3F0IA 2R37A 3D0ZA 4G0KA 3IHGA 4O32A 4ZBAA 2RM6A 2P0GA 4WKWA 1O8XA 2YV7A 7GSSA 1IYHA 4KH7A 4PURA 3ZIVA 1K0MA 1G7EA 3L4NA 2BTOT 2C0GA 1Z7RA 3US3A 1SKWB 4F0CA 4MJBA 1KNGA 5IPHA 2BMXA 2E7PA 5LNKe 1X5CA 2C3TA 1A8LA 4ZILA 4V1Ag 5J5NA 2I9HA 4JR4A 4Q5RA 5F07A 2R6KA 4D73A 2X49A 3H93A 1OVNA 3GURA 4I2TA 2YNXA 3I6AA 4POBA 1OKDA 1O81A 4XS4A 1K3OA 3KM6A 3UAPA 4GF0A 3DXBA 2L4CA 2LNTA 1RK4A 5KN0A 4GXZA 2VLVA 4MF5A 1QFNA 3F8UA 2VL3A 3TKSA 5DQYA 6GSYA 4NHZA 1B9YC 5GAPD 5ECOB 2E2MA 2I1UA 3AY8A 1JZWA 2JZRA 16GSA 5DALB 2CZ2A 5FT3A 2IWTA 4X1UA 2ZCTA 5HR0A 4GRFA 2GT5A 4EC0A 2R3XA 1SD9A 1THOA 2PVOC 2G0FA 3FZAA 1WPIA 1ZYNA 4K1FA 3HVVA 3LYPA 5C00A 4PGTA 2F3MA 1AW9A 2PERA 1MD4A 1MDJA 2PVQA 2GSQA 2HFDA 3HYPA 4DSRA 2H0IA 2H6ZA 4PQ1A 1WP0A 2O7KA 4OO4A 4JR6A 2H19A 2OADA 1TRVA 4IVFA 4ZIJA 4MPGA 3KTLA 6GSSA 5DAKA 5E4WA 2QGVA 3TKRA 1EV4A 1SK1A 3LXZA 18GSA 1UVZA 2FHEA 2FCHA 2FA8A 3GH9A 1PMTA 4WR5A 3M9KA 3C73A 1JLWA 2HE3A 2B7KA 3F3QA 4PQIA 1Z6NA 2HZEA 3ZREA 5CREA 4PUFC 6GSUA 3KMOA 3PGTA 3CSJA 4I2UA 3KGKA 4I6XA 1B4PA 8GSSA 3QFBC 4Q5NA 4KE3A 4KCAA 1UA5A 3TJBA 3IR4A 3QR6A 5HQPA 1RW1A 5IIZA 2LQOA 2OACA 1EGRA 3FR9A 2DBCA 1Q4JA 4FQUA 1EWXA 4PXOA 2OE3A 1WWJA 4PTSA 2L6DA 3M1GA 4MJEA 3I43A 5JCGA 1R4WA 1OC3A 4DEJA 4Q5QA 1GUKA 1YF0A 1QMVA 5ECHB 3UOMA 5ECQB 4K7OA 3EVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X64 A;  2LJR A;  4MLY A;  4L0U A;  5DCG A;  3RDW A;  1GNE A;  1GLP A;  3C1R A;  4QQ7 A;  1TK8 B;  1SYX A;  4TR1 A;  3ZRD A;  5KN3 A;  3NZN A;  4PUA A;  2KUC A;  2DMM A;  5ENU A;  4IQA A;  2WGR A;  1EOG A;  3HD5 A;  5IO0 A;  2B7J A;  2VD1 A;  1SL0 B;  3D4M A;  4TXV A;  3TKS C;  1GTI A;  3TJF A;  3E0U A;  5CRD A;  1O85 A;  1QK8 A;  2WCI A;  2PU9 C;  4KW6 A;  4DSS A;  2IFQ A;  2O87 A;  3NIV A;  2HNL A;  1PD2 1;  3TJG A;  4PNF A;  2K9F A;  2DLX A;  2GQK A;  3QDN A;  2VL9 A;  4HI7 A;  4WET A;  3VI5 A;  2MYG A;  5JCW A;  3GKK A;  4XIH A;  1XWK A;  3HJO A;  4KB3 A;  4LMW A;  2AUV A;  4EL1 A;  2R2J A;  4FIW A;  1TKD B;  1GTA A;  4TW5 A;  3EU4 A;  1M7T A;  4HU7 A;  3Q74 A;  2X99 A;  3GH6 A;  5J9B A;  2HSY A;  1PA3 A;  2J9H A;  2O85 A;  2YWO A;  3CXG A;  4J57 E;  2CVB A;  14GS A;  4YQU A;  3M8N A;  4AJ8 A;  1FB6 A;  1AIU A;  4FYB A;  2V41 A;  4IW9 A;  1BJX A;  5G31 A;  3C8E A;  4OFN A;  3D6I A;  3UVT A;  2DJ1 A;  3F6F A;  1SU9 A;  1F9M A;  3GL3 A;  2DSA A;  4YQM A;  3DGQ A;  1BG5 A;  3DIE A;  2EIO A;  2H71 A;  5IPG A;  4BL7 A;  4O92 A;  4XRA A;  4CHS A;  1PKZ A;  1KEB A;  1N2A A;  4N30 A;  5G1K A;  4AJ7 A;  1TP9 A;  3KP9 A;  2H1D A;  1FVJ A;  1HNA A;  1OYJ A;  3F6D A;  2JZS A;  2C0F A;  3ME8 A;  2IMD A;  3QPM A;  3F9U A;  1GSD A;  4MDC A;  1XW6 A;  20GS A;  5IMF A;  3EYT A;  1PRX A;  2IJY A;  3ZLP A;  2KP2 A;  1X5E A;  5KN1 A;  2GZY A;  1GNW A;  4OMV A;  2TRC P;  3KMN A;  1OE8 A;  2I81 A;  1TXX A;  3CBU A;  3UMA A;  1GSF A;  3BJ5 A;  4ISD A;  3M9J A;  1AC1 A;  4L5O A;  5ECM B;  1SJZ A;  2C8U A;  1F37 A;  4V2L A;  4L8E A;  4EKZ A;  3ZFL A;  4IS0 A;  4HU9 A;  5EY6 A;  3TUE A;  4K7I A;  4FH8 A;  4L0W A;  2YWN A;  2AYT A;  4OFT A;  1K3Y A;  1QXH A;  1WJK A;  1OC9 B;  3C71 A;  2LRN A;  1GTB A;  5EPF A;  5B8A A;  1J0F A;  2OBI A;  5EVO A;  3ZVJ D;  2WZ9 A;  5LD0 A;  1X0R A;  3VFI A;  1K0N A;  2C1Y A;  3ZMK A;  1SYR A;  1EEM A;  1M9A A;  2VLU A;  3IHQ A;  2XPD A;  1R7H A;  1VF1 A;  1O73 A;  4ACS A;  4ZBD A;  2I4A A;  4TXO A;  2IIY A;  4MH3 A;  1WRY A;  3TOU A;  2JZT A;  1SJI A;  1XZO A;  5DJM A;  4OCE A;  4RI7 A;  5J3R A;  2CAI A;  2H74 A;  2KP1 A;  3GN3 A;  3RBT A;  3IBH A;  1XBS A;  2L57 A;  2FWF A;  2C80 A;  1H75 A;  3DML A;  3ISO A;  3F3R A;  3P2A A;  5ELG A;  5ID2 A;  1XW9 A;  1XFL A;  2LNS A;  3TB2 A;  3LXT A;  2DJ2 A;  1K0D A;  1PSQ A;  1ZGN A;  3L0H A;  5IMA A;  4N0V A;  3IV4 A;  1GUM A;  1AUC A;  1A2L A;  1K0B A;  4RQR A;  3WYW A;  4NWY A;  1F3A A;  5LCZ A;  2H0G A;  1LU4 A;  4GSN A;  4MP4 A;  5G2Z A;  2LRC A;  4JE1 A;  3QAW A;  2LRT A;  2D2Z A;  2L5L A;  3G7Y A;  2K8V A;  4EO3 A;  1URM A;  2R5G A;  1OC8 A;  2ZNM A;  4V2N A;  5H5R A;  1XXU A;  3QAG A;  1EP8 A;  4RI6 A;  4V2M A;  1F6M C;  1AQV A;  2JL4 A;  1YEP A;  2DIY A;  2TRX A;  1W4V A;  3VK9 A;  1NW2 A;  2B6M A;  1M0U A;  1X9S B;  5ABR A;  3A3T A;  4I8B A;  2MBS A;  2XBQ A;  1A24 A;  1USB A;  3KEB A;  4IGJ A;  22GS A;  4K9Z A;  1X9M B;  2NDO A;  1B4Q A;  1XWG A;  2GQM A;  4Z7X A;  4BWS A;  2RUF A;  1YKC A;  3ZFB A;  3J7Y b;  4KSO A;  4MA9 A;  2JU5 A;  2E2G A;  5HFI A;  4FYU A;  1ZYQ B;  3W8S A;  2FWG A;  3QCP A;  4LA1 A;  2GSR A;  3TKS E;  2B5X A;  1V40 A;  1EZK A;  3WGE A;  4IQ1 A;  2YZU A;  4CDO A;  6GSV A;  3KTB A;  1GUL A;  5C04 A;  1PQN A;  1OAZ A;  2ALB A;  4MPF A;  5DDL A;  1GSU A;  5H5S A;  3QAV A;  2HSH A;  3BCK A;  1Y6E A;  4TKY A;  1T4Y A;  2LJA A;  3DWV A;  4NAX A;  2C3N A;  4IJ3 A;  5CRH A;  4TXO B;  2NVL A;  5IOX A;  4N0Z A;  2WB9 A;  1TI1 A;  2E0Q A;  2M46 A;  1GTU A;  2GLR A;  3FR3 A;  1A8Y A;  1U6T A;  12GS A;  2AB6 A;  2PGT A;  3ERG A;  3RPP A;  1QQ2 A;  1J9B A;  4LL4 B;  3GKM A;  4NV5 A;  1ACV A;  2L5O A;  2OA7 A;  1BX9 A;  4HQZ A;  3L78 A;  5D96 A;  1TRU A;  4F82 A;  5D93 A;  4HEA 2;  5ECP B;  6GSX A;  11GS A;  2JSY A;  4KDY A;  3IK9 A;  3LJR A;  5B8B A;  1EP7 A;  1Z5Y E;  5G5F A;  5CRG A;  4WEY A;  2ES7 A;  4IHU A;  1R5A A;  2B5Y A;  2VCV A;  2OJL A;  3MAK A;  1PL1 A;  4IJI A;  3HY2 A;  3G7I A;  4ZL9 A;  2CZ3 A;  3SWL A;  1F3B A;  2X8C A;  1FHE A;  3J7Y k;  2PWJ A;  2H73 A;  4JU5 A;  3UEM A;  2FD3 A;  4H86 A;  1EOH A;  4HZ2 A;  4JED A;  1Z7P A;  2H01 A;  1XIY A;  3GKN A;  2PN8 A;  2VOC A;  5D8I A;  2V32 A;  3A2W A;  2CVK A;  5HR2 A;  3IE3 A;  1T8E B;  3LSZ A;  3RHB A;  1MD3 A;  3LOR A;  2GSS A;  2H70 A;  3ZIJ A;  1GL8 A;  1B48 A;  3GTU A;  4EF0 A;  4P3Y B;  3KP8 A;  2OKA A;  2CA8 A;  1JZO A;  1WE0 A;  4KDU A;  2DJK A;  1VF4 A;  3C1S A;  3VLN A;  5JWO B;  4ZB9 A;  2IMK A;  1R26 A;  2NBS A;  2H30 A;  5CRW A;  3FZ4 A;  5IMZ A;  2L59 A;  2H0H A;  4N11 A;  4D73 B;  5ECN B;  1TI3 A;  4CW9 A;  1GP1 A;  5ECL B;  5B7C A;  1Z3E A;  1GSE A;  4HS1 A;  4XS4 B;  4FYC A;  4ZBB A;  2MMA A;  3N9J A;  3L9V A;  4F03 A;  1TTZ A;  5IO2 A;  4EDY A;  1XWC A;  1SD8 A;  4F9Z A;  3GA4 A;  4JRR A;  5AN1 A;  1GLQ A;  2CVD A;  4KDX A;  2YWM A;  2IMF A;  3E3E A;  4AF2 A;  2H76 A;  1VGL A;  2VL2 A;  1XPV A;  2F51 A;  5ECK B;  1TRS A;  3GNJ A;  4WF5 A;  3HHV A;  1LJR A;  1T3B A;  3LG6 A;  3P90 A;  4KUN A;  2YN1 A;  4PNG A;  4IP6 A;  4MAB A;  1ZZY A;  1GRX A;  5AGY A;  1AQX A;  2H1A A;  2H1G A;  3U5R E;  2IPA A;  2MMO A;  3IAS 2;  4MH2 A;  13GS A;  1DE2 A;  1THX A;  4MJC A;  2GS3 A;  3P7X A;  3L9S A;  3TOT A;  2YP6 A;  1HYU A;  3L9U A;  3PR8 A;  6GSW A;  5D73 A;  3HVX A;  3VPQ A;  1G6W A;  1G0T A;  2ON7 A;  2YCD A;  3GSS A;  1ZYE A;  5CNW A;  5DAK B;  3VI7 A;  2N5A A;  1KBN A;  1NSW A;  4I5Q A;  2B1K A;  1A0F A;  3ZZX A;  3H8Q A;  2VM1 A;  4GQF A;  4EXJ A;  4BVY A;  2HRN A;  4G2E A;  1YQ1 A;  3KJY A;  4TN8 A;  5KEJ A;  4WF4 A;  2B1L A;  3OR5 A;  4OD7 A;  4OWY A;  4F0B A;  2XPE A;  3IRA A;  2HZE B;  3KXO A;  5F8B A;  2LEG A;  1OKT A;  1S3C A;  1ZCP A;  4K0N A;  3FKF A;  4JBB A;  3HDC A;  3F4R A;  4K7N A;  2P5Q A;  3O6T A;  5DCH A;  1A23 A;  1HQO A;  1ILO A;  1O8W A;  3KD0 A;  3R2Q A;  2FUG 2;  3SBC A;  4HDE A;  1I5G A;  1BED A;  4YAV A;  3D21 A;  4POK A;  1M2A A;  2V6K A;  4MF6 A;  2F9S A;  5A4U A;  5IM9 A;  3WGD A;  1K0O A;  3TCO A;  4J2F A;  2VO4 A;  5HR1 A;  2P5R A;  3MSZ A;  2PPT A;  4WBJ A;  5GZZ B;  4HJM A;  5CYY A;  2HLS A;  4MZC A;  4IBP A;  3DYR A;  5JWR B;  1TK5 B;  5CO3 A;  2A2S A;  1N8J A;  4OFM A;  3TRX A;  10GS A;  1NHY A;  4TR1 B;  3QMX A;  3ZYW A;  4MZB A;  1MEK A;  4WBR D;  4IN0 A;  4ZXG A;  1JLV A;  1JHB A;  2B3S A;  1NHO A;  5AIV A;  3UJ1 A;  2WUL A;  2YJH A;  3N5O A;  1O6J A;  3BOA A;  2H8L A;  3UBK A;  4YAP A;  5INY A;  17GS A;  1GSY A;  2REM A;  2H1B A;  3DVX A;  2HT9 A;  4HQS A;  4DSS B;  1YY7 A;  2IFQ B;  3E9J B;  2VL2 C;  4I97 A;  1CQG A;  2JAC A;  2O8V B;  2HI7 A;  5EL8 A;  2RM5 A;  1A2M A;  3CRT A;  4POM A;  2BJX A;  1RQM A;  1SL1 B;  1V9W A;  2CAQ A;  5G5E A;  4O5R A;  1IYI A;  4XCS A;  3ME7 A;  3LYK A;  3TKP A;  2F8A A;  4EDZ A;  2B5E A;  2KHP A;  4NMU A;  2CV4 A;  4ZL8 A;  3WT2 A;  1TU8 A;  3UL3 A;  2YZH A;  1O7U A;  2QC7 A;  3HCZ A;  1E6B A;  5HR3 A;  2WS2 A;  4XTS A;  3LWA A;  2TIR A;  1AQW A;  3EE2 A;  1FAA A;  3WT1 A;  4EUY A;  2LS5 A;  1SK2 A;  1WOU A;  2FY6 A;  4AJ6 A;  3FZ9 A;  3GMF A;  4BWQ A;  2HZF A;  2ON5 A;  5AIS A;  5B6M A;  2CX4 A;  2O89 A;  5CAX A;  5DAL A;  1M99 A;  3ERF A;  3ED3 A;  3RPN A;  5L71 A;  2FA4 A;  2YJ7 A;  3MNG A;  1F2E A;  3D22 A;  3VWU A;  5G30 A;  2IN3 A;  4JZQ A;  5F05 A;  3BD2 A;  2CX3 A;  4KX4 A;  5ECS A;  4GQC A;  1WIK A;  1EV9 A;  1PN9 A;  3CSH A;  2JSZ A;  1EEJ A;  5JCU A;  4F2I A;  3DVW A;  1UC7 A;  3KZQ A;  2PUK C;  4OO5 A;  3CTG A;  4G9H A;  1G7O A;  1ML6 A;  1BYE A;  1ERU A;  2K8S A;  4ECJ A;  3EMP A;  2HXK A;  4KSM A;  1W89 A;  3F4T A;  5D9T A;  2V1M A;  5B6N A;  3GYK A;  3EUR A;  1XOA A;  5DVB A;  1VF2 A;  1TW9 A;  4KAE A;  2XHF A;  2GDR A;  3C7M A;  2V2G A;  1HNC A;  5IQY A;  1XW5 A;  2AV4 A;  3DRN A;  6GST A;  4YQV A;  2GGT A;  3FZ5 A;  1PGT A;  4XS6 A;  1BQ7 A;  2GT6 A;  4O7H A;  2AAW A;  3GFK A;  4ECI A;  3DEX A;  1SKR B;  2M72 A;  1YEX A;  4V1A p;  3JCM L;  2A4V A;  4N10 A;  4MF7 A;  4X0X A;  3D4T A;  5DQS A;  4KGI A;  4NHW A;  5D9V A;  3HJP A;  1FO5 A;  3F4S A;  2LV3 A;  2OE0 A;  3FW2 A;  4E8E A;  4MZW A;  2N5F A;  2DJ3 A;  1JZR A;  2QKE A;  2DC5 A;  3EMX A;  4BA7 A;  1XVQ A;  1U3I A;  1R5P A;  3GKX A;  2R4V A;  5JWQ B;  1YZX A;  1SK0 A;  1FOV A;  4GCI A;  5ID2 B;  3M0F A;  3S9F A;  4PX1 A;  2LQQ A;  1X9W B;  1V2A A;  1T1V A;  2RLI A;  3NOF A;  2RUE A;  5F06 A;  1H4O A;  4ZL7 A;  1TOF A;  4TVE A;  3GUS A;  1GSS A;  1S3D A;  2IL3 A;  3G7J A;  2GQL A;  4TRX A;  4XS1 A;  3MDK A;  4NPB A;  3CSI A;  4TOP A;  3QFA C;  4WXT A;  3HZ8 A;  2MMN A;  5COH A;  4ILF A;  5CP1 A;  4XHM A;  4BVX A;  1S3A A;  4GWR A;  3A5W A;  1PKW A;  1NM3 A;  3FYG A;  1MTC A;  2H6X A;  5IMD A;  2GZP A;  3IXR A;  2LTK A;  2VCT A;  1J08 A;  5HFG A;  4YH2 A;  3Q6O A;  2YOI A;  1DBY A;  4X43 A;  4IEL A;  2IMI A;  4AGS A;  3UIW A;  2DML A;  2MMZ A;  1XWB A;  2OE1 A;  1ERW A;  3VPT A;  3VWX A;  2L6C A;  3BBY A;  3KH7 A;  3LQ7 A;  4GTU A;  3O76 A;  4LLR A;  5FWG A;  3HJM A;  2GST A;  3RAZ A;  5E59 A;  3ZTL A;  3UAR A;  5A4W A;  1U88 A;  3H4K A;  1XVW A;  2AHE A;  1X5D A;  1SKS B;  3IDV A;  2DJ0 A;  4K6X A;  2X8G A;  1XCC A;  2RII A;  2WJU A;  5A5K A;  3FK8 A;  3EC3 A;  1ERT A;  1ZL9 A;  1TDI A;  2VCZ A;  2A2R A;  3HKR A;  3LGC A;  4ML6 A;  2GZZ A;  2EIQ A;  1GH2 A;  4IP1 A;  3A2X A;  1HNB A;  1LBK A;  1V98 A;  2C4J A;  2FWE A;  2P31 A;  1DE1 A;  1ZMA A;  3CYN A;  5GSS A;  1FW1 A;  2EC4 A;  3IAM 2;  4GSS A;  4J56 E;  1A2J A;  4ID0 A;  4K0G A;  2YAN A;  3W8J A;  2FWH A;  2GTU A;  4G19 A;  2KLX A;  3GV1 A;  3W6G A;  2HYX A;  2H6Y A;  1JZD A;  4RQX A;  1A0R P;  3ZML A;  1BAY A;  2DJJ A;  5IMV A;  1FVK A;  5GAN D;  2XC2 A;  3BCI A;  3ERW A;  5GST A;  4TR3 A;  1QUW A;  4HZ4 A;  4K8M A;  1DSB A;  1TJD A;  1B8X A;  1YF1 A;  3MWH A;  3D5J A;  3IPZ A;  2VAF A;  1ZOF A;  3I69 A;  1U87 A;  2CT6 A;  2VUP A;  4ECB A;  2IME A;  1ST9 A;  2FNO A;  1AXD A;  1OC9 A;  2C3Q A;  5ECR B;  2C0D A;  3IC4 A;  3PH9 A;  1PX7 A;  4HJ2 A;  2LJK A;  2K6V A;  3KCM A;  3IA1 A;  3FEU A;  2H66 A;  1OE7 A;  3FR6 A;  1TK0 B;  2YWI A;  1DUG A;  2Z9S A;  5J41 A;  3GHA A;  1EGO A;  5D9W A;  1U3A A;  3EIN A;  3K8N A;  1UN2 A;  2F8F A;  5J4U A;  3LFL A;  2VCQ A;  2PBJ A;  2XBI A;  3H79 A;  3GX8 A;  2VIM A;  1PX6 A;  2MZC A;  4QL9 A;  1VF3 A;  3Q19 A;  3KIJ A;  2PMT A;  1FG4 A;  4G10 A;  2QSI A;  2NPB A;  3U6V A;  1XWA A;  2KOK A;  1C72 A;  2I3Y A;  3APQ A;  5DBQ A;  3FRC A;  3GTU B;  3IK7 A;  1YKA A;  3TKQ A;  1Y25 A;  2NTO A;  1ON4 A;  2YV9 A;  3HZ4 A;  2K18 A;  2YPM A;  3M3M A;  4NXI A;  3UBL A;  3LEF A;  3I9V 2;  4MMM A;  2N5B A;  4LL1 B;  4QL7 A;  1SJ6 A;  4XRD A;  1JFU A;  5AIX A;  1CQH A;  3HA9 A;  3EWL A;  4GLT A;  1T00 A;  1K0A A;  5A4V A;  5IOW A;  4FO5 A;  1GSQ A;  3TDG A;  5F0G A;  1V58 A;  3DD3 A;  3IOS A;  5ELA A;  2MBT A;  1MDK A;  2FLS A;  5DJL A;  2LST A;  4KND A;  3ZVJ A;  2C0E A;  4NV2 A;  3TJK A;  1HD2 A;  5ECI B;  2GVP A;  4K2D A;  2LKU A;  4ECC A;  3GRX A;  3WGX A;  4POL A;  3Q18 A;  4LMV A;  2DIZ A;  3UVH A;  3GIX A;  3GX0 A;  1TU7 A;  3KH9 A;  1WMJ A;  3CTF A;  4TR0 A;  2OBK A;  1E2Y A;  3VUR A;  3F63 A;  1VRS D;  19GS A;  4MK3 A;  3HXS A;  3RHC A;  3V1W A;  1SL2 B;  2WFC A;  1MDI A;  4PQH A;  1K0C A;  2CQ9 A;  5HFK A;  4KCE A;  2J23 A;  2HRF A;  1G6Y A;  1AAZ A;  3H1N A;  3APO A;  5IMC A;  2H75 A;  4EE0 A;  2ZUP A;  1T4Z A;  2V6O A;  3HVS A;  2L4Q A;  4MCU A;  4TR4 A;  3TRP A;  4OCF A;  1T7P B;  1YDK A;  1TRW A;  1XOB A;  4EVM A;  5KN2 A;  3QOU A;  3CRU A;  1PL2 A;  1M9B A;  4KA0 A;  4E8H A;  3CMI A;  9GSS A;  3APS A;  1QGV A;  4ULX A;  3VWW A;  3TGZ A;  3P8W A;  3G9B A;  1SEN A;  2VD0 A;  3TRQ A;  4ZB6 A;  3EU3 A;  5D9X A;  1FB0 A;  2M80 A;  4Q5F A;  1KTE A;  3GL5 A;  2VLT A;  2VM2 A;  4DSQ A;  5FHI A;  2LUS A;  4HOJ A;  2VCW A;  4ML1 A;  2G2Q A;  1Z6M A;  1ABA A;  1GWC A;  3FHK A;  5J9C A;  2EIR A;  4GST A;  2WDU A;  2WRT A;  2X8H A;  4MJA A;  5G1L A;  4BPY A;  3ZL5 A;  4RUV A;  3ZIT A;  3A2V A;  3DKS A;  2H72 A;  1YJ6 A;  1I9D A;  1M2B A;  2AJQ B;  4DVC A;  3VWV A;  1Z9H A;  1V57 A;  1GUH A;  3GST A;  3PIN A;  1ERV A;  1Q98 A;  3QD9 A;  3WD6 A;  3O3T A;  2JAD A;  5H5Q A;  4L5L A;  1K3L A;  1M2D A;  1B9X C;  4IKH A;  2FGX A;  2VCX A;  4HUA A;  4WR4 A;  3TJJ A;  3FY7 A;  4ZB8 A;  3F0I A;  2R37 A;  3D0Z A;  4O32 A;  4ZBA A;  2RM6 A;  2P0G A;  4WKW A;  1O8X A;  2YV7 A;  7GSS A;  1IYH A;  4KH7 A;  4PUR A;  3ZIV A;  1K0M A;  1G7E A;  3L4N A;  2BTO T;  2C0G A;  1Z7R A;  3US3 A;  1SKW B;  4F0C A;  4MJB A;  1KNG A;  5IPH A;  2BMX A;  2E7P A;  5LNK e;  1X5C A;  2C3T A;  1A8L A;  4ZIL A;  4V1A g;  5J5N A;  2I9H A;  4JR4 A;  4Q5R A;  5F07 A;  2R6K A;  4D73 A;  3H93 A;  1OVN A;  3GUR A;  4I2T A;  2YNX A;  3I6A A;  4POB A;  1OKD A;  1O81 A;  4XS4 A;  1K3O A;  3KM6 A;  3UAP A;  4GF0 A;  3DXB A;  2L4C A;  2LNT A;  1RK4 A;  5KN0 A;  4GXZ A;  2VLV A;  4MF5 A;  1QFN A;  3F8U A;  2VL3 A;  3TKS A;  5DQY A;  6GSY A;  4NHZ A;  1B9Y C;  5GAP D;  5ECO B;  2E2M A;  2I1U A;  3AY8 A;  1JZW A;  2JZR A;  16GS A;  5DAL B;  2CZ2 A;  5FT3 A;  2IWT A;  4X1U A;  2ZCT A;  5HR0 A;  4GRF A;  2GT5 A;  4EC0 A;  2R3X A;  1SD9 A;  1THO A;  2PVO C;  2G0F A;  3FZA A;  1WPI A;  4K1F A;  3HVV A;  3LYP A;  5C00 A;  4PGT A;  2F3M A;  1AW9 A;  2PER A;  1MD4 A;  1MDJ A;  2PVQ A;  2GSQ A;  2HFD A;  3HYP A;  4DSR A;  2H0I A;  2H6Z A;  4PQ1 A;  1WP0 A;  2O7K A;  4OO4 A;  4JR6 A;  2H19 A;  2OAD A;  1TRV A;  4IVF A;  4ZIJ A;  4MPG A;  3KTL A;  6GSS A;  5DAK A;  5E4W A;  2QGV A;  3TKR A;  1EV4 A;  1SK1 A;  3LXZ A;  18GS A;  1UVZ A;  2FHE A;  2FCH A;  2FA8 A;  3GH9 A;  1PMT A;  4WR5 A;  3M9K A;  3C73 A;  1JLW A;  2HE3 A;  2B7K A;  3F3Q A;  4PQI A;  1Z6N A;  2HZE A;  3ZRE A;  5CRE A;  4PUF C;  6GSU A;  3KMO A;  3PGT A;  3CSJ A;  4I2U A;  3KGK A;  4I6X A;  1B4P A;  8GSS A;  3QFB C;  4Q5N A;  4KE3 A;  4KCA A;  1UA5 A;  3TJB A;  3IR4 A;  3QR6 A;  5HQP A;  1RW1 A;  5IIZ A;  2LQO A;  2OAC A;  1EGR A;  3FR9 A;  2DBC A;  1Q4J A;  1EWX A;  4PXO A;  2OE3 A;  1WWJ A;  2L6D A;  3M1G A;  4MJE A;  3I43 A;  5JCG A;  1R4W A;  1OC3 A;  4DEJ A;  4Q5Q A;  1GUK A;  1YF0 A;  1QMV A;  5ECH B;  3UOM A;  5ECQ B;  4K7O A;  3EVI A; 
#chains in the Genus database with same CATH topology
 2X64 A;  2LJR A;  4MLY A;  4L0U A;  5DCG A;  3RDW A;  1GNE A;  1GLP A;  3C1R A;  4QQ7 A;  1TK8 B;  1SYX A;  4TR1 A;  3ZRD A;  5KN3 A;  3NZN A;  4PUA A;  2KUC A;  2DMM A;  5ENU A;  4IQA A;  2WGR A;  1EOG A;  3HD5 A;  5IO0 A;  2B7J A;  2VD1 A;  1SL0 B;  3D4M A;  4TXV A;  3TKS C;  1GTI A;  3TJF A;  3E0U A;  5CRD A;  1O85 A;  1QK8 A;  2WCI A;  2PU9 C;  4KW6 A;  4DSS A;  2IFQ A;  2O87 A;  3NIV A;  2HNL A;  1PD2 1;  3TJG A;  4PNF A;  2K9F A;  2DLX A;  4BVX B;  2GQK A;  3QDN A;  2VL9 A;  4HI7 A;  4WET A;  3VI5 A;  2MYG A;  5JCW A;  3GKK A;  3MYD A;  4XIH A;  1XWK A;  3HJO A;  4KB3 A;  4LMW A;  2AUV A;  2HRK A;  4EL1 A;  2R2J A;  4FIW A;  1TKD B;  1GTA A;  4TW5 A;  3EU4 A;  1M7T A;  4HU7 A;  3Q74 A;  2X99 A;  3GH6 A;  5J9B A;  2HSY A;  1PA3 A;  2J9H A;  2O85 A;  2YWO A;  3CXG A;  4J57 E;  5BMU A;  2CVB A;  14GS A;  4YQU A;  3M8N A;  4AJ8 A;  1FB6 A;  4O5U A;  1AIU A;  4FYB A;  2V41 A;  4IW9 A;  1BJX A;  5G31 A;  3C8E A;  4OFN A;  3D6I A;  3UVT A;  5KOW A;  2DJ1 A;  3F6F A;  1SU9 A;  1F9M A;  3GL3 A;  2DSA A;  4YQM A;  3DGQ A;  1BG5 A;  3DIE A;  2EIO A;  2H71 A;  4YKF A;  5IPG A;  4BL7 A;  4O92 A;  4XRA A;  4CHS A;  1PKZ A;  1KEB A;  1N2A A;  4N30 A;  5G1K A;  4AJ7 A;  4G0I A;  1TP9 A;  3KP9 A;  2H1D A;  1FVJ A;  1HNA A;  1OYJ A;  3F6D A;  2JZS A;  2C0F A;  3ME8 A;  2IMD A;  3QPM A;  3F9U A;  1GSD A;  4MDC A;  1XW6 A;  20GS A;  5IMF A;  3EYT A;  1PRX A;  2IJY A;  3ZLP A;  2KP2 A;  1X5E A;  5KN1 A;  2GZY A;  1GNW A;  4OMV A;  2TRC P;  3KMN A;  1OE8 A;  2I81 A;  1TXX A;  3CBU A;  3UMA A;  1GSF A;  3BJ5 A;  4ISD A;  3M9J A;  1AC1 A;  4L5O A;  5ECM B;  1SJZ A;  2C8U A;  1F37 A;  4V2L A;  4L8E A;  4EKZ A;  3ZFL A;  4IS0 A;  4HU9 A;  5EY6 A;  3TUE A;  4K7I A;  4FH8 A;  4L0W A;  2YWN A;  2AYT A;  4OFT A;  1K3Y A;  1QXH A;  1WJK A;  1OC9 B;  3C71 A;  2LRN A;  1GTB A;  2UZ8 A;  5EPF A;  5B8A A;  1J0F A;  2OBI A;  5EVO A;  3ZVJ D;  2WZ9 A;  5LD0 A;  1X0R A;  3VFI A;  1K0N A;  2C1Y A;  3ZMK A;  1SYR A;  1EEM A;  1M9A A;  2VLU A;  3IHQ A;  2XPD A;  1R7H A;  1VF1 A;  1O73 A;  4ACS A;  4ZBD A;  1PN0 A;  2I4A A;  4TXO A;  2IIY A;  4MH3 A;  1WRY A;  3TOU A;  2JZT A;  1SJI A;  1XZO A;  5DJM A;  3CQF A;  4OCE A;  4RI7 A;  5J3R A;  2CAI A;  2H74 A;  2KP1 A;  3GN3 A;  3RBT A;  3IBH A;  1XBS A;  2L57 A;  2FWF A;  2C80 A;  1H75 A;  3DML A;  3ISO A;  3F3R A;  3P2A A;  5ELG A;  5ID2 A;  1XW9 A;  1XFL A;  2LNS A;  3TB2 A;  3LXT A;  2DJ2 A;  1K0D A;  1PSQ A;  1ZGN A;  3L0H A;  5IMA A;  4N0V A;  3IV4 A;  1GUM A;  1AUC A;  1A2L A;  1K0B A;  4RQR A;  3WYW A;  4NWY A;  1F3A A;  5LCZ A;  2H0G A;  1LU4 A;  4GSN A;  4MP4 A;  5G2Z A;  2LRC A;  4JE1 A;  3QAW A;  2LRT A;  2D2Z A;  2L5L A;  3G7Y A;  2K8V A;  4EO3 A;  1URM A;  2R5G A;  1OC8 A;  2ZNM A;  4V2N A;  4MNN A;  5H5R A;  1XXU A;  3QAG A;  4RI6 A;  1EP8 A;  4V2M A;  1F6M C;  4K2X A;  1AQV A;  2JL4 A;  1YEP A;  2DIY A;  2TRX A;  1W4V A;  3VK9 A;  1NW2 A;  2B6M A;  1M0U A;  1X9S B;  5ABR A;  3A3T A;  4I8B A;  2MBS A;  2XBQ A;  1A24 A;  1USB A;  3KEB A;  4IGJ A;  22GS A;  4K9Z A;  4EIQ A;  1X9M B;  2NDO A;  1B4Q A;  1XWG A;  2GQM A;  4Z7X A;  4BWS A;  2RUF A;  1YKC A;  3ZFB A;  3J7Y b;  4KSO A;  4MA9 A;  2JU5 A;  2E2G A;  5HFI A;  4FYU A;  1ZYQ B;  3W8S A;  2FWG A;  3QCP A;  4LA1 A;  2GSR A;  3TKS E;  2B5X A;  1V40 A;  1EZK A;  3WGE A;  4IQ1 A;  2YZU A;  4CDO A;  6GSV A;  3KTB A;  1GUL A;  4G0L A;  5C04 A;  1PQN A;  1OAZ A;  2ALB A;  4MPF A;  2R0P A;  5DDL A;  1GSU A;  5H5S A;  3QAV A;  2HSH A;  3BCK A;  1Y6E A;  4TKY A;  1T4Y A;  2LJA A;  3DWV A;  4NAX A;  2C3N A;  4IJ3 A;  5CRH A;  4TXO B;  2NVL A;  5IOX A;  4N0Z A;  2WB9 A;  1TI1 A;  2E0Q A;  2M46 A;  1GTU A;  2GLR A;  3FR3 A;  2DKH A;  1A8Y A;  1U6T A;  12GS A;  2AB6 A;  4ICY A;  2PGT A;  3ERG A;  3RPP A;  1QQ2 A;  1J9B A;  4LL4 B;  3GKM A;  4NV5 A;  1ACV A;  2L5O A;  2OA7 A;  1BX9 A;  4HQZ A;  3L78 A;  5D96 A;  1TRU A;  4F82 A;  5D93 A;  4HEA 2;  5ECP B;  4K5S A;  6GSX A;  11GS A;  2JSY A;  4KDY A;  3IK9 A;  3LJR A;  5B8B A;  1EP7 A;  1Z5Y E;  5G5F A;  5CRG A;  4WEY A;  2ES7 A;  4IHU A;  1R5A A;  2B5Y A;  2VCV A;  2OJL A;  3MAK A;  1PL1 A;  4IJI A;  3HY2 A;  3G7I A;  4ZL9 A;  2CZ3 A;  3SWL A;  1F3B A;  2X8C A;  1FHE A;  3J7Y k;  2PWJ A;  2H73 A;  2QA1 A;  4JU5 A;  3UEM A;  2FD3 A;  4H86 A;  4X4J A;  1EOH A;  4HZ2 A;  4JED A;  1Z7P A;  2H01 A;  1XIY A;  3GKN A;  2PN8 A;  2VOC A;  5D8I A;  2V32 A;  4USS A;  3A2W A;  2CVK A;  5HR2 A;  3IE3 A;  1T8E B;  3LSZ A;  3RHB A;  1MD3 A;  3LOR A;  2GSS A;  2H70 A;  3ZIJ A;  1GL8 A;  1B48 A;  3GTU A;  4EF0 A;  4P3Y B;  3KP8 A;  2OKA A;  2CA8 A;  1JZO A;  1WE0 A;  4KDU A;  2DJK A;  1VF4 A;  3C1S A;  3VLN A;  5JWO B;  4ZB9 A;  2IMK A;  1R26 A;  4Z2T A;  2NBS A;  2H30 A;  5CRW A;  3FZ4 A;  5IMZ A;  2L59 A;  2H0H A;  4N11 A;  4D73 B;  5ECN B;  1TI3 A;  2R0C A;  4CW9 A;  1GP1 A;  5ECL B;  5B7C A;  1Z3E A;  1GSE A;  4HS1 A;  4XS4 B;  4FYC A;  4ZBB A;  3IC8 A;  3R3E A;  2MMA A;  3N9J A;  3L9V A;  4F03 A;  1TTZ A;  5IO2 A;  4EDY A;  1XWC A;  1SD8 A;  4F9Z A;  3GA4 A;  4JRR A;  5AN1 A;  1GLQ A;  2CVD A;  4KDX A;  2YWM A;  2IMF A;  3E3E A;  4AF2 A;  2X4A A;  2H76 A;  1VGL A;  2VL2 A;  1XPV A;  2F51 A;  1TRS A;  3GNJ A;  4WF5 A;  5ECK B;  3HHV A;  1LJR A;  1T3B A;  3LG6 A;  3P90 A;  4KUN A;  2YN1 A;  4PNG A;  4IP6 A;  4MAB A;  1ZZY A;  1GRX A;  5AGY A;  1AQX A;  2H1A A;  2H1G A;  3U5R E;  2IPA A;  2MMO A;  3IAS 2;  4MH2 A;  13GS A;  1DE2 A;  1THX A;  4MJC A;  2GS3 A;  3P7X A;  3L9S A;  3TOT A;  2YP6 A;  1HYU A;  3L9U A;  3PR8 A;  6GSW A;  5D73 A;  3HVX A;  3VPQ A;  1G6W A;  1G0T A;  2ON7 A;  2YCD A;  3GSS A;  1ZYE A;  5CNW A;  5DAK B;  3VI7 A;  2N5A A;  1KBN A;  1NSW A;  4I5Q A;  2B1K A;  1A0F A;  3ZZX A;  3H8Q A;  2VM1 A;  4GQF A;  4EXJ A;  4BVY A;  2HRN A;  4G2E A;  1YQ1 A;  3KJY A;  4TN8 A;  5KEJ A;  4WF4 A;  2B1L A;  3OR5 A;  4OD7 A;  4OWY A;  4F0B A;  2XPE A;  4CY6 A;  3IRA A;  2HZE B;  3KXO A;  5F8B A;  2LEG A;  1OKT A;  1S3C A;  1ZCP A;  4K0N A;  3FKF A;  4JBB A;  3HDC A;  3F4R A;  4K7N A;  2P5Q A;  3O6T A;  5DCH A;  1A23 A;  1HQO A;  1ILO A;  1O8W A;  3KD0 A;  2HRA A;  3R2Q A;  2FUG 2;  3SBC A;  4HDE A;  1I5G A;  1BED A;  4YAV A;  3D21 A;  4POK A;  1M2A A;  2V6K A;  4MF6 A;  2F9S A;  5A4U A;  5IM9 A;  3WGD A;  1K0O A;  3TCO A;  4J2F A;  2VO4 A;  5HR1 A;  2P5R A;  3MSZ A;  2PPT A;  4WBJ A;  5GZZ B;  4HJM A;  5CYY A;  2HLS A;  3FMW A;  4MZC A;  4IBP A;  5BRT A;  3DYR A;  5JWR B;  1TK5 B;  5CO3 A;  2A2S A;  1N8J A;  4OFM A;  3TRX A;  10GS A;  1NHY A;  4TR1 B;  3QMX A;  4YKG A;  3ZYW A;  4MZB A;  1MEK A;  4WBR D;  4IN0 A;  4ZXG A;  1JLV A;  1JHB A;  3PPU A;  2B3S A;  1NHO A;  5AIV A;  3UJ1 A;  2WUL A;  2YJH A;  3N5O A;  1O6J A;  3BOA A;  2H8L A;  3UBK A;  4YAP A;  5INY A;  4KF9 A;  17GS A;  1GSY A;  2REM A;  2H1B A;  3DVX A;  2HT9 A;  4HQS A;  4DSS B;  1YY7 A;  2IFQ B;  3E9J B;  2VL2 C;  4I97 A;  1CQG A;  2JAC A;  2O8V B;  2HI7 A;  5EL8 A;  2RM5 A;  1A2M A;  3CRT A;  4POM A;  2BJX A;  1RQM A;  1SL1 B;  1V9W A;  2CAQ A;  5G5E A;  4O5R A;  1IYI A;  4XCS A;  3ME7 A;  3LYK A;  3TKP A;  2F8A A;  2HSM A;  4EDZ A;  2B5E A;  2KHP A;  4NMU A;  2CV4 A;  4ZL8 A;  3WT2 A;  1TU8 A;  3UL3 A;  2YZH A;  1O7U A;  2QC7 A;  3HCZ A;  1E6B A;  5HR3 A;  2WS2 A;  4XTS A;  2DKI A;  3LWA A;  2TIR A;  1AQW A;  3EE2 A;  1FAA A;  3WT1 A;  4EUY A;  2LS5 A;  3LW9 A;  1SK2 A;  1WOU A;  2FY6 A;  4AJ6 A;  3FZ9 A;  3GMF A;  4BWQ A;  2HZF A;  2ON5 A;  5AIS A;  5B6M A;  2A4H A;  2CX4 A;  2O89 A;  5CAX A;  5DAL A;  1M99 A;  3ERF A;  3ED3 A;  3RPN A;  5L71 A;  2FA4 A;  2YJ7 A;  3MNG A;  1F2E A;  3D22 A;  3VWU A;  5G30 A;  2IN3 A;  4JZQ A;  4BL7 B;  5F05 A;  4Z2R A;  3BD2 A;  2CX3 A;  4KX4 A;  5ECS A;  4GQC A;  1WIK A;  1EV9 A;  1PN9 A;  3CSH A;  2JSZ A;  1EEJ A;  5JCU A;  4F2I A;  3DVW A;  1UC7 A;  3KZQ A;  4K5R A;  2PUK C;  4OO5 A;  3CTG A;  4G9H A;  1G7O A;  1ML6 A;  1BYE A;  1ERU A;  2K8S A;  4ECJ A;  3EMP A;  2HXK A;  4KSM A;  1W89 A;  3F4T A;  5D9T A;  4Z2U A;  2V1M A;  5B6N A;  3EPT A;  3EUR A;  3GYK A;  1XOA A;  5DVB A;  1VF2 A;  1TW9 A;  4KAE A;  2XHF A;  2GDR A;  3C7M A;  2V2G A;  1HNC A;  5IQY A;  1XW5 A;  2AV4 A;  3DRN A;  6GST A;  4YQV A;  2GGT A;  3FZ5 A;  1PGT A;  4XS6 A;  1BQ7 A;  2GT6 A;  4O7H A;  2AAW A;  3GFK A;  4ECI A;  3DEX A;  1SKR B;  2M72 A;  1YEX A;  4V1A p;  3JCM L;  2A4V A;  4N10 A;  4MF7 A;  4X0X A;  3D4T A;  1S3R A;  5DQS A;  4KGI A;  4NHW A;  5D9V A;  3HJP A;  1FO5 A;  3F4S A;  2LV3 A;  2OE0 A;  3FW2 A;  4E8E A;  4MZW A;  2N5F A;  2DJ3 A;  1M3J A;  1JZR A;  2QKE A;  2DC5 A;  3EMX A;  4BA7 A;  1XVQ A;  1U3I A;  1R5P A;  3GKX A;  2R4V A;  5JWQ B;  1YZX A;  1SK0 A;  1FOV A;  4GCI A;  5ID2 B;  3M0F A;  3S9F A;  4PX1 A;  2R0G A;  2LQQ A;  1X9W B;  1V2A A;  3HVN A;  1T1V A;  2RLI A;  3NOF A;  2RUE A;  5F06 A;  1H4O A;  4ZL7 A;  1TOF A;  4TVE A;  3GUS A;  1GSS A;  1S3D A;  2IL3 A;  3G7J A;  2GQL A;  4TRX A;  4XS1 A;  3MDK A;  4NPB A;  3CSI A;  4TOP A;  3QFA C;  4WXT A;  3HZ8 A;  2MMN A;  5COH A;  4ILF A;  5CP1 A;  4XHM A;  4BVX A;  1S3A A;  4GWR A;  3A5W A;  1PKW A;  1NM3 A;  3FYG A;  1MTC A;  2H6X A;  5IMD A;  2GZP A;  3IXR A;  2LTK A;  2VCT A;  1J08 A;  5HFG A;  4YH2 A;  3Q6O A;  2YOI A;  1DBY A;  4X43 A;  4IEL A;  2IMI A;  4AGS A;  3UIW A;  2DML A;  2MMZ A;  1XWB A;  2OE1 A;  1ERW A;  3VPT A;  3VWX A;  2L6C A;  3BBY A;  3KH7 A;  3MIX A;  3LQ7 A;  4GTU A;  3O76 A;  4LLR A;  5FWG A;  3HJM A;  2GST A;  3RAZ A;  5E59 A;  3ZTL A;  3UAR A;  5A4W A;  1U88 A;  3H4K A;  1XVW A;  2AHE A;  1X5D A;  1SKS B;  3IDV A;  2DJ0 A;  4K6X A;  2X8G A;  1XCC A;  2RII A;  2WJU A;  5A5K A;  3FK8 A;  3EC3 A;  1ERT A;  1ZL9 A;  1TDI A;  2VCZ A;  2A2R A;  3HKR A;  3LGC A;  4ML6 A;  2GZZ A;  2EIQ A;  4CY8 A;  1GH2 A;  4IP1 A;  3A2X A;  1HNB A;  1LBK A;  1V98 A;  2C4J A;  2FWE A;  2P31 A;  1DE1 A;  1ZMA A;  3CYN A;  5GSS A;  1FW1 A;  2EC4 A;  3IAM 2;  4GSS A;  4J56 E;  1A2J A;  3A5I A;  4ID0 A;  4K0G A;  2YAN A;  3W8J A;  2FWH A;  2GTU A;  4G19 A;  1ZYP A;  2KLX A;  3GV1 A;  3W6G A;  2HYX A;  2H6Y A;  1JZD A;  4RQX A;  1A0R P;  3ZML A;  1BAY A;  2DJJ A;  5IMV A;  1FVK A;  5GAN D;  2XC2 A;  3BCI A;  3ERW A;  5GST A;  4TR3 A;  1QUW A;  4HZ4 A;  4K8M A;  1DSB A;  1TJD A;  1B8X A;  1YF1 A;  3MWH A;  3D5J A;  3IPZ A;  2VAF A;  1ZOF A;  3I69 A;  1U87 A;  2CT6 A;  2VUP A;  4ECB A;  4A5P A;  2IME A;  1ST9 A;  2FNO A;  1AXD A;  1OC9 A;  2C3Q A;  5ECR B;  2C0D A;  3IC4 A;  4EIP A;  3PH9 A;  1PX7 A;  4HJ2 A;  2LJK A;  2K6V A;  3KCM A;  3IA1 A;  3FEU A;  2H66 A;  1OE7 A;  3FR6 A;  1TK0 B;  2YWI A;  1DUG A;  2Z9S A;  5J41 A;  3GHA A;  1EGO A;  5D9W A;  1U3A A;  3EIN A;  3K8N A;  1UN2 A;  2F8F A;  5J4U A;  3LFL A;  2VCQ A;  2PBJ A;  2XBI A;  3H79 A;  3GX8 A;  2VIM A;  1PX6 A;  2MZC A;  4QL9 A;  1VF3 A;  3Q19 A;  3KIJ A;  2PMT A;  1FG4 A;  4G10 A;  2QSI A;  2NPB A;  3U6V A;  1XWA A;  2KOK A;  1C72 A;  2I3Y A;  3APQ A;  5DBQ A;  3FRC A;  3GTU B;  3IK7 A;  1YKA A;  3TKQ A;  1Y25 A;  2NTO A;  1ON4 A;  2YV9 A;  3HZ4 A;  2K18 A;  2YPM A;  3M3M A;  4NXI A;  3UBL A;  3LEF A;  3I9V 2;  4MMM A;  2N5B A;  4LL1 B;  4QL7 A;  1SJ6 A;  5KOX A;  4XRD A;  1JFU A;  5AIX A;  1CQH A;  3HA9 A;  3EWL A;  4GLT A;  1T00 A;  1K0A A;  5A4V A;  5IOW A;  4FO5 A;  1GSQ A;  3TDG A;  5F0G A;  1V58 A;  3DD3 A;  3IOS A;  1PFO A;  5ELA A;  2MBT A;  1MDK A;  2FLS A;  5DJL A;  2LST A;  4KND A;  3ZVJ A;  2C0E A;  4NV2 A;  3TJK A;  1HD2 A;  5ECI B;  2GVP A;  4K2D A;  2LKU A;  4ECC A;  3GRX A;  3WGX A;  4POL A;  3Q18 A;  4LMV A;  4O5Q A;  2DIZ A;  1M3I A;  3UVH A;  3GIX A;  3GX0 A;  1TU7 A;  3KH9 A;  1FOH A;  1WMJ A;  3CTF A;  4TR0 A;  2OBK A;  1E2Y A;  3VUR A;  3F63 A;  1VRS D;  19GS A;  4MK3 A;  3HXS A;  3RHC A;  3V1W A;  1SL2 B;  2WFC A;  1MDI A;  4PQH A;  1K0C A;  2CQ9 A;  5HFK A;  4KCE A;  2J23 A;  2HRF A;  1G6Y A;  1AAZ A;  3H1N A;  3APO A;  5IMC A;  2H75 A;  1XG8 A;  4EE0 A;  2ZUP A;  1T4Z A;  2V6O A;  3HVS A;  2L4Q A;  4MCU A;  4TR4 A;  3TRP A;  4OCF A;  1T7P B;  1YDK A;  1TRW A;  1XOB A;  4EVM A;  2QA2 A;  5KN2 A;  3QOU A;  3CRU A;  1PL2 A;  1M9B A;  4KA0 A;  4E8H A;  3CMI A;  9GSS A;  3APS A;  1QGV A;  4ULX A;  3VWW A;  3TGZ A;  3P8W A;  3G9B A;  1SEN A;  2VD0 A;  3TRQ A;  4ZB6 A;  4BVY B;  3EU3 A;  5D9X A;  1FB0 A;  2M80 A;  4Q5F A;  1KTE A;  3GL5 A;  2VLT A;  2VM2 A;  4DSQ A;  5FHI A;  2LUS A;  4HOJ A;  2VCW A;  4ML1 A;  2G2Q A;  1Z6M A;  1ABA A;  1GWC A;  3FHK A;  5J9C A;  2EIR A;  4GST A;  2WDU A;  2WRT A;  2X8H A;  4MJA A;  5G1L A;  4BPY A;  3ZL5 A;  4RUV A;  4BIK A;  3ZIT A;  3A2V A;  3DKS A;  2H72 A;  1YJ6 A;  1I9D A;  1M2B A;  2A2P A;  2AJQ B;  4DVC A;  3VWV A;  1Z9H A;  1V57 A;  1GUH A;  3GST A;  3PIN A;  1ERV A;  1Q98 A;  3QD9 A;  3WD6 A;  3O3T A;  2JAD A;  5H5Q A;  4L5L A;  1K3L A;  1M2D A;  1B9X C;  4IKH A;  2FGX A;  2VCX A;  4HUA A;  4WR4 A;  3TJJ A;  3FY7 A;  4ZB8 A;  3F0I A;  2R37 A;  3D0Z A;  4G0K A;  3IHG A;  4O32 A;  4ZBA A;  2RM6 A;  2P0G A;  4WKW A;  1O8X A;  2YV7 A;  7GSS A;  1IYH A;  4KH7 A;  4PUR A;  3ZIV A;  1K0M A;  1G7E A;  3L4N A;  2BTO T;  2C0G A;  1Z7R A;  3US3 A;  1SKW B;  4F0C A;  4MJB A;  1KNG A;  5IPH A;  2BMX A;  2E7P A;  5LNK e;  1X5C A;  2C3T A;  1A8L A;  4ZIL A;  4V1A g;  5J5N A;  2I9H A;  4JR4 A;  4Q5R A;  5F07 A;  2R6K A;  4D73 A;  2X49 A;  3H93 A;  4HSC X;  1OVN A;  3GUR A;  4I2T A;  2YNX A;  3I6A A;  4POB A;  1OKD A;  1O81 A;  4XS4 A;  1K3O A;  3KM6 A;  3UAP A;  4GF0 A;  3DXB A;  2L4C A;  2LNT A;  1RK4 A;  5KN0 A;  4GXZ A;  2VLV A;  4MF5 A;  1QFN A;  3F8U A;  2VL3 A;  3TKS A;  5DQY A;  6GSY A;  4NHZ A;  1B9Y C;  5GAP D;  5ECO B;  2E2M A;  2I1U A;  3AY8 A;  1JZW A;  2JZR A;  16GS A;  5DAL B;  2CZ2 A;  5FT3 A;  2IWT A;  4X1U A;  2ZCT A;  5HR0 A;  4GRF A;  2GT5 A;  4EC0 A;  2R3X A;  1SD9 A;  1THO A;  2PVO C;  2G0F A;  3FZA A;  1WPI A;  1ZYN A;  4K1F A;  3HVV A;  3LYP A;  5C00 A;  4PGT A;  2F3M A;  1AW9 A;  2PER A;  1MD4 A;  1MDJ A;  2PVQ A;  2GSQ A;  2HFD A;  3HYP A;  4DSR A;  2H0I A;  2H6Z A;  4PQ1 A;  1WP0 A;  2O7K A;  4OO4 A;  4JR6 A;  2H19 A;  2OAD A;  1TRV A;  4IVF A;  4ZIJ A;  4MPG A;  3KTL A;  6GSS A;  5DAK A;  5E4W A;  2QGV A;  3TKR A;  1EV4 A;  1SK1 A;  3LXZ A;  18GS A;  1UVZ A;  2FHE A;  2FCH A;  2FA8 A;  3GH9 A;  1PMT A;  4WR5 A;  3M9K A;  3C73 A;  1JLW A;  2HE3 A;  2B7K A;  3F3Q A;  4PQI A;  1Z6N A;  2HZE A;  3ZRE A;  5CRE A;  4PUF C;  6GSU A;  3KMO A;  3PGT A;  3CSJ A;  4I2U A;  3KGK A;  4I6X A;  1B4P A;  8GSS A;  3QFB C;  4Q5N A;  4KE3 A;  4KCA A;  1UA5 A;  3TJB A;  3IR4 A;  3QR6 A;  5HQP A;  1RW1 A;  5IIZ A;  2LQO A;  2OAC A;  1EGR A;  3FR9 A;  2DBC A;  1Q4J A;  4FQU A;  1EWX A;  4PXO A;  2OE3 A;  1WWJ A;  4PTS A;  2L6D A;  3M1G A;  4MJE A;  3I43 A;  5JCG A;  1R4W A;  1OC3 A;  4DEJ A;  4Q5Q A;  1GUK A;  1YF0 A;  1QMV A;  5ECH B;  3UOM A;  5ECQ B;  4K7O A;  3EVI A; 
#chains in the Genus database with same CATH homology
 2X64 A;  2LJR A;  4MLY A;  4L0U A;  5DCG A;  3RDW A;  1GNE A;  1GLP A;  3C1R A;  4QQ7 A;  1TK8 B;  1SYX A;  4TR1 A;  3ZRD A;  5KN3 A;  3NZN A;  4PUA A;  2KUC A;  2DMM A;  5ENU A;  4IQA A;  2WGR A;  1EOG A;  3HD5 A;  5IO0 A;  2B7J A;  2VD1 A;  1SL0 B;  3D4M A;  4TXV A;  3TKS C;  1GTI A;  3TJF A;  3E0U A;  5CRD A;  1O85 A;  1QK8 A;  2WCI A;  2PU9 C;  4KW6 A;  4DSS A;  2IFQ A;  2O87 A;  3NIV A;  2HNL A;  1PD2 1;  3TJG A;  4PNF A;  2K9F A;  2DLX A;  4BVX B;  2GQK A;  3QDN A;  2VL9 A;  4HI7 A;  4WET A;  3VI5 A;  2MYG A;  5JCW A;  3GKK A;  3MYD A;  4XIH A;  1XWK A;  3HJO A;  4KB3 A;  4LMW A;  2AUV A;  2HRK A;  4EL1 A;  2R2J A;  4FIW A;  1TKD B;  1GTA A;  4TW5 A;  3EU4 A;  1M7T A;  4HU7 A;  3Q74 A;  2X99 A;  3GH6 A;  5J9B A;  2HSY A;  1PA3 A;  2J9H A;  2O85 A;  2YWO A;  3CXG A;  4J57 E;  5BMU A;  2CVB A;  14GS A;  4YQU A;  3M8N A;  4AJ8 A;  1FB6 A;  4O5U A;  1AIU A;  4FYB A;  2V41 A;  4IW9 A;  1BJX A;  5G31 A;  3C8E A;  4OFN A;  3D6I A;  3UVT A;  5KOW A;  2DJ1 A;  3F6F A;  1SU9 A;  1F9M A;  3GL3 A;  2DSA A;  4YQM A;  3DGQ A;  1BG5 A;  3DIE A;  2EIO A;  2H71 A;  4YKF A;  5IPG A;  4BL7 A;  4O92 A;  4XRA A;  4CHS A;  1PKZ A;  1KEB A;  1N2A A;  4N30 A;  5G1K A;  4AJ7 A;  4G0I A;  1TP9 A;  3KP9 A;  2H1D A;  1FVJ A;  1HNA A;  1OYJ A;  3F6D A;  2JZS A;  2C0F A;  3ME8 A;  2IMD A;  3QPM A;  3F9U A;  1GSD A;  4MDC A;  1XW6 A;  20GS A;  5IMF A;  3EYT A;  1PRX A;  2IJY A;  3ZLP A;  2KP2 A;  1X5E A;  5KN1 A;  2GZY A;  1GNW A;  4OMV A;  2TRC P;  3KMN A;  1OE8 A;  2I81 A;  1TXX A;  3CBU A;  3UMA A;  1GSF A;  3BJ5 A;  4ISD A;  3M9J A;  1AC1 A;  4L5O A;  5ECM B;  1SJZ A;  2C8U A;  1F37 A;  4V2L A;  4L8E A;  4EKZ A;  3ZFL A;  4IS0 A;  4HU9 A;  5EY6 A;  3TUE A;  4K7I A;  4FH8 A;  4L0W A;  2YWN A;  2AYT A;  4OFT A;  1K3Y A;  1QXH A;  1WJK A;  1OC9 B;  3C71 A;  2LRN A;  1GTB A;  2UZ8 A;  5EPF A;  5B8A A;  1J0F A;  2OBI A;  5EVO A;  3ZVJ D;  2WZ9 A;  5LD0 A;  1X0R A;  3VFI A;  1K0N A;  2C1Y A;  3ZMK A;  1SYR A;  1EEM A;  1M9A A;  2VLU A;  3IHQ A;  2XPD A;  1R7H A;  1VF1 A;  1O73 A;  4ACS A;  4ZBD A;  1PN0 A;  2I4A A;  4TXO A;  2IIY A;  4MH3 A;  1WRY A;  3TOU A;  2JZT A;  1SJI A;  1XZO A;  5DJM A;  4OCE A;  4RI7 A;  5J3R A;  2CAI A;  2H74 A;  2KP1 A;  3GN3 A;  3RBT A;  3IBH A;  1XBS A;  2L57 A;  2FWF A;  2C80 A;  1H75 A;  3DML A;  3ISO A;  3F3R A;  3P2A A;  5ELG A;  5ID2 A;  1XW9 A;  1XFL A;  2LNS A;  3TB2 A;  3LXT A;  2DJ2 A;  1K0D A;  1PSQ A;  1ZGN A;  3L0H A;  5IMA A;  4N0V A;  3IV4 A;  1GUM A;  1AUC A;  1A2L A;  1K0B A;  4RQR A;  3WYW A;  4NWY A;  1F3A A;  5LCZ A;  2H0G A;  1LU4 A;  4GSN A;  4MP4 A;  5G2Z A;  2LRC A;  4JE1 A;  3QAW A;  2LRT A;  2D2Z A;  2L5L A;  3G7Y A;  2K8V A;  4EO3 A;  1URM A;  2R5G A;  1OC8 A;  2ZNM A;  4V2N A;  4MNN A;  5H5R A;  1XXU A;  3QAG A;  4RI6 A;  1EP8 A;  4V2M A;  1F6M C;  4K2X A;  1AQV A;  2JL4 A;  1YEP A;  2DIY A;  2TRX A;  1W4V A;  3VK9 A;  1NW2 A;  2B6M A;  1M0U A;  1X9S B;  5ABR A;  3A3T A;  4I8B A;  2MBS A;  2XBQ A;  1A24 A;  1USB A;  3KEB A;  4IGJ A;  22GS A;  4K9Z A;  4EIQ A;  1X9M B;  2NDO A;  1B4Q A;  1XWG A;  2GQM A;  4Z7X A;  4BWS A;  2RUF A;  1YKC A;  3ZFB A;  3J7Y b;  4KSO A;  4MA9 A;  2JU5 A;  2E2G A;  5HFI A;  4FYU A;  1ZYQ B;  3W8S A;  2FWG A;  3QCP A;  4LA1 A;  2GSR A;  3TKS E;  2B5X A;  1V40 A;  1EZK A;  3WGE A;  4IQ1 A;  2YZU A;  4CDO A;  6GSV A;  3KTB A;  1GUL A;  4G0L A;  5C04 A;  1PQN A;  1OAZ A;  2ALB A;  4MPF A;  2R0P A;  5DDL A;  1GSU A;  5H5S A;  3QAV A;  2HSH A;  3BCK A;  1Y6E A;  4TKY A;  1T4Y A;  2LJA A;  3DWV A;  4NAX A;  2C3N A;  4IJ3 A;  5CRH A;  4TXO B;  2NVL A;  5IOX A;  4N0Z A;  2WB9 A;  1TI1 A;  2E0Q A;  2M46 A;  1GTU A;  2GLR A;  3FR3 A;  2DKH A;  1A8Y A;  1U6T A;  12GS A;  2AB6 A;  4ICY A;  2PGT A;  3ERG A;  3RPP A;  1QQ2 A;  1J9B A;  4LL4 B;  3GKM A;  4NV5 A;  1ACV A;  2L5O A;  2OA7 A;  1BX9 A;  4HQZ A;  3L78 A;  5D96 A;  1TRU A;  4F82 A;  5D93 A;  4HEA 2;  5ECP B;  4K5S A;  6GSX A;  11GS A;  2JSY A;  4KDY A;  3IK9 A;  3LJR A;  5B8B A;  1EP7 A;  1Z5Y E;  5G5F A;  5CRG A;  4WEY A;  2ES7 A;  4IHU A;  1R5A A;  2B5Y A;  2VCV A;  2OJL A;  3MAK A;  1PL1 A;  4IJI A;  3HY2 A;  3G7I A;  4ZL9 A;  2CZ3 A;  3SWL A;  1F3B A;  2X8C A;  1FHE A;  3J7Y k;  2PWJ A;  2H73 A;  2QA1 A;  4JU5 A;  3UEM A;  2FD3 A;  4H86 A;  4X4J A;  1EOH A;  4HZ2 A;  4JED A;  1Z7P A;  2H01 A;  1XIY A;  3GKN A;  2PN8 A;  2VOC A;  5D8I A;  2V32 A;  4USS A;  3A2W A;  2CVK A;  5HR2 A;  3IE3 A;  1T8E B;  3LSZ A;  3RHB A;  1MD3 A;  3LOR A;  2GSS A;  2H70 A;  3ZIJ A;  1GL8 A;  1B48 A;  3GTU A;  4EF0 A;  4P3Y B;  3KP8 A;  2OKA A;  2CA8 A;  1JZO A;  1WE0 A;  4KDU A;  2DJK A;  1VF4 A;  3C1S A;  3VLN A;  5JWO B;  4ZB9 A;  2IMK A;  1R26 A;  4Z2T A;  2NBS A;  2H30 A;  5CRW A;  3FZ4 A;  5IMZ A;  2L59 A;  2H0H A;  4N11 A;  4D73 B;  5ECN B;  1TI3 A;  2R0C A;  4CW9 A;  1GP1 A;  5ECL B;  5B7C A;  1Z3E A;  1GSE A;  4HS1 A;  4XS4 B;  4FYC A;  4ZBB A;  3IC8 A;  3R3E A;  2MMA A;  3N9J A;  3L9V A;  4F03 A;  1TTZ A;  5IO2 A;  4EDY A;  1XWC A;  1SD8 A;  4F9Z A;  3GA4 A;  4JRR A;  5AN1 A;  1GLQ A;  2CVD A;  4KDX A;  2YWM A;  2IMF A;  3E3E A;  4AF2 A;  2X4A A;  2H76 A;  1VGL A;  2VL2 A;  1XPV A;  2F51 A;  1TRS A;  3GNJ A;  4WF5 A;  5ECK B;  3HHV A;  1LJR A;  1T3B A;  3LG6 A;  3P90 A;  4KUN A;  2YN1 A;  4PNG A;  4IP6 A;  4MAB A;  1ZZY A;  1GRX A;  5AGY A;  1AQX A;  2H1A A;  2H1G A;  3U5R E;  2IPA A;  2MMO A;  3IAS 2;  4MH2 A;  13GS A;  1DE2 A;  1THX A;  4MJC A;  2GS3 A;  3P7X A;  3L9S A;  3TOT A;  2YP6 A;  1HYU A;  3L9U A;  3PR8 A;  6GSW A;  5D73 A;  3HVX A;  3VPQ A;  1G6W A;  1G0T A;  2ON7 A;  2YCD A;  3GSS A;  1ZYE A;  5CNW A;  5DAK B;  3VI7 A;  2N5A A;  1KBN A;  1NSW A;  4I5Q A;  2B1K A;  1A0F A;  3ZZX A;  3H8Q A;  2VM1 A;  4GQF A;  4EXJ A;  4BVY A;  2HRN A;  4G2E A;  1YQ1 A;  3KJY A;  4TN8 A;  5KEJ A;  4WF4 A;  2B1L A;  3OR5 A;  4OD7 A;  4OWY A;  4F0B A;  2XPE A;  4CY6 A;  3IRA A;  2HZE B;  3KXO A;  5F8B A;  2LEG A;  1OKT A;  1S3C A;  1ZCP A;  4K0N A;  3FKF A;  4JBB A;  3HDC A;  3F4R A;  4K7N A;  2P5Q A;  3O6T A;  5DCH A;  1A23 A;  1HQO A;  1ILO A;  1O8W A;  3KD0 A;  2HRA A;  3R2Q A;  2FUG 2;  3SBC A;  4HDE A;  1I5G A;  1BED A;  4YAV A;  3D21 A;  4POK A;  1M2A A;  2V6K A;  4MF6 A;  2F9S A;  5A4U A;  5IM9 A;  3WGD A;  1K0O A;  3TCO A;  4J2F A;  2VO4 A;  5HR1 A;  2P5R A;  3MSZ A;  2PPT A;  4WBJ A;  5GZZ B;  4HJM A;  5CYY A;  2HLS A;  3FMW A;  4MZC A;  4IBP A;  5BRT A;  3DYR A;  5JWR B;  1TK5 B;  5CO3 A;  2A2S A;  1N8J A;  4OFM A;  3TRX A;  10GS A;  1NHY A;  4TR1 B;  3QMX A;  4YKG A;  3ZYW A;  4MZB A;  1MEK A;  4WBR D;  4IN0 A;  4ZXG A;  1JLV A;  1JHB A;  3PPU A;  2B3S A;  1NHO A;  5AIV A;  3UJ1 A;  2WUL A;  2YJH A;  3N5O A;  1O6J A;  3BOA A;  2H8L A;  3UBK A;  4YAP A;  5INY A;  4KF9 A;  17GS A;  1GSY A;  2REM A;  2H1B A;  3DVX A;  2HT9 A;  4HQS A;  4DSS B;  1YY7 A;  2IFQ B;  3E9J B;  2VL2 C;  4I97 A;  1CQG A;  2JAC A;  2O8V B;  2HI7 A;  5EL8 A;  2RM5 A;  1A2M A;  3CRT A;  4POM A;  2BJX A;  1RQM A;  1SL1 B;  1V9W A;  2CAQ A;  5G5E A;  4O5R A;  1IYI A;  4XCS A;  3ME7 A;  3LYK A;  3TKP A;  2F8A A;  2HSM A;  4EDZ A;  2B5E A;  2KHP A;  4NMU A;  2CV4 A;  4ZL8 A;  3WT2 A;  1TU8 A;  3UL3 A;  2YZH A;  1O7U A;  2QC7 A;  3HCZ A;  1E6B A;  5HR3 A;  2WS2 A;  4XTS A;  2DKI A;  3LWA A;  2TIR A;  1AQW A;  3EE2 A;  1FAA A;  3WT1 A;  4EUY A;  2LS5 A;  3LW9 A;  1SK2 A;  1WOU A;  2FY6 A;  4AJ6 A;  3FZ9 A;  3GMF A;  4BWQ A;  2HZF A;  2ON5 A;  5AIS A;  5B6M A;  2A4H A;  2CX4 A;  2O89 A;  5CAX A;  5DAL A;  1M99 A;  3ERF A;  3ED3 A;  3RPN A;  5L71 A;  2FA4 A;  2YJ7 A;  3MNG A;  1F2E A;  3D22 A;  3VWU A;  5G30 A;  2IN3 A;  4JZQ A;  4BL7 B;  5F05 A;  4Z2R A;  3BD2 A;  2CX3 A;  4KX4 A;  5ECS A;  4GQC A;  1WIK A;  1EV9 A;  1PN9 A;  3CSH A;  2JSZ A;  1EEJ A;  5JCU A;  4F2I A;  3DVW A;  1UC7 A;  3KZQ A;  4K5R A;  2PUK C;  4OO5 A;  3CTG A;  4G9H A;  1G7O A;  1ML6 A;  1BYE A;  1ERU A;  2K8S A;  4ECJ A;  3EMP A;  2HXK A;  4KSM A;  1W89 A;  3F4T A;  5D9T A;  4Z2U A;  2V1M A;  5B6N A;  3EPT A;  3EUR A;  3GYK A;  1XOA A;  5DVB A;  1VF2 A;  1TW9 A;  4KAE A;  2XHF A;  2GDR A;  3C7M A;  2V2G A;  1HNC A;  5IQY A;  1XW5 A;  2AV4 A;  3DRN A;  6GST A;  4YQV A;  2GGT A;  3FZ5 A;  1PGT A;  4XS6 A;  1BQ7 A;  2GT6 A;  4O7H A;  2AAW A;  3GFK A;  4ECI A;  3DEX A;  1SKR B;  2M72 A;  1YEX A;  4V1A p;  3JCM L;  2A4V A;  4N10 A;  4MF7 A;  4X0X A;  3D4T A;  5DQS A;  4KGI A;  4NHW A;  5D9V A;  3HJP A;  1FO5 A;  3F4S A;  2LV3 A;  2OE0 A;  3FW2 A;  4E8E A;  4MZW A;  2N5F A;  2DJ3 A;  1JZR A;  2QKE A;  2DC5 A;  3EMX A;  4BA7 A;  1XVQ A;  1U3I A;  1R5P A;  3GKX A;  2R4V A;  5JWQ B;  1YZX A;  1SK0 A;  1FOV A;  4GCI A;  5ID2 B;  3M0F A;  3S9F A;  4PX1 A;  2R0G A;  2LQQ A;  1X9W B;  1V2A A;  1T1V A;  2RLI A;  3NOF A;  2RUE A;  5F06 A;  1H4O A;  4ZL7 A;  1TOF A;  4TVE A;  3GUS A;  1GSS A;  1S3D A;  2IL3 A;  3G7J A;  2GQL A;  4TRX A;  4XS1 A;  3MDK A;  4NPB A;  3CSI A;  4TOP A;  3QFA C;  4WXT A;  3HZ8 A;  2MMN A;  5COH A;  4ILF A;  5CP1 A;  4XHM A;  4BVX A;  1S3A A;  4GWR A;  3A5W A;  1PKW A;  1NM3 A;  3FYG A;  1MTC A;  2H6X A;  5IMD A;  2GZP A;  3IXR A;  2LTK A;  2VCT A;  1J08 A;  5HFG A;  4YH2 A;  3Q6O A;  2YOI A;  1DBY A;  4X43 A;  4IEL A;  2IMI A;  4AGS A;  3UIW A;  2DML A;  2MMZ A;  1XWB A;  2OE1 A;  1ERW A;  3VPT A;  3VWX A;  2L6C A;  3BBY A;  3KH7 A;  3MIX A;  3LQ7 A;  4GTU A;  3O76 A;  4LLR A;  5FWG A;  3HJM A;  2GST A;  3RAZ A;  5E59 A;  3ZTL A;  3UAR A;  5A4W A;  1U88 A;  3H4K A;  1XVW A;  2AHE A;  1X5D A;  1SKS B;  3IDV A;  2DJ0 A;  4K6X A;  2X8G A;  1XCC A;  2RII A;  2WJU A;  5A5K A;  3FK8 A;  3EC3 A;  1ERT A;  1ZL9 A;  1TDI A;  2VCZ A;  2A2R A;  3HKR A;  3LGC A;  4ML6 A;  2GZZ A;  2EIQ A;  4CY8 A;  1GH2 A;  4IP1 A;  3A2X A;  1HNB A;  1LBK A;  1V98 A;  2C4J A;  2FWE A;  2P31 A;  1DE1 A;  1ZMA A;  3CYN A;  5GSS A;  1FW1 A;  2EC4 A;  3IAM 2;  4GSS A;  4J56 E;  1A2J A;  3A5I A;  4ID0 A;  4K0G A;  2YAN A;  3W8J A;  2FWH A;  2GTU A;  4G19 A;  1ZYP A;  2KLX A;  3GV1 A;  3W6G A;  2HYX A;  2H6Y A;  1JZD A;  4RQX A;  1A0R P;  3ZML A;  1BAY A;  2DJJ A;  5IMV A;  1FVK A;  5GAN D;  2XC2 A;  3BCI A;  3ERW A;  5GST A;  4TR3 A;  1QUW A;  4HZ4 A;  4K8M A;  1DSB A;  1TJD A;  1B8X A;  1YF1 A;  3MWH A;  3D5J A;  3IPZ A;  2VAF A;  1ZOF A;  3I69 A;  1U87 A;  2CT6 A;  2VUP A;  4ECB A;  4A5P A;  2IME A;  1ST9 A;  2FNO A;  1AXD A;  1OC9 A;  2C3Q A;  5ECR B;  2C0D A;  3IC4 A;  4EIP A;  3PH9 A;  1PX7 A;  4HJ2 A;  2LJK A;  2K6V A;  3KCM A;  3IA1 A;  3FEU A;  2H66 A;  1OE7 A;  3FR6 A;  1TK0 B;  2YWI A;  1DUG A;  2Z9S A;  5J41 A;  3GHA A;  1EGO A;  5D9W A;  1U3A A;  3EIN A;  3K8N A;  1UN2 A;  2F8F A;  5J4U A;  3LFL A;  2VCQ A;  2PBJ A;  2XBI A;  3H79 A;  3GX8 A;  2VIM A;  1PX6 A;  2MZC A;  4QL9 A;  1VF3 A;  3Q19 A;  3KIJ A;  2PMT A;  1FG4 A;  4G10 A;  2QSI A;  2NPB A;  3U6V A;  1XWA A;  2KOK A;  1C72 A;  2I3Y A;  3APQ A;  5DBQ A;  3FRC A;  3GTU B;  3IK7 A;  1YKA A;  3TKQ A;  1Y25 A;  2NTO A;  1ON4 A;  2YV9 A;  3HZ4 A;  2K18 A;  2YPM A;  3M3M A;  4NXI A;  3UBL A;  3LEF A;  3I9V 2;  4MMM A;  2N5B A;  4LL1 B;  4QL7 A;  1SJ6 A;  5KOX A;  4XRD A;  1JFU A;  5AIX A;  1CQH A;  3HA9 A;  3EWL A;  4GLT A;  1T00 A;  1K0A A;  5A4V A;  5IOW A;  4FO5 A;  1GSQ A;  3TDG A;  5F0G A;  1V58 A;  3DD3 A;  3IOS A;  5ELA A;  2MBT A;  1MDK A;  2FLS A;  5DJL A;  2LST A;  4KND A;  3ZVJ A;  2C0E A;  4NV2 A;  3TJK A;  1HD2 A;  5ECI B;  2GVP A;  4K2D A;  2LKU A;  4ECC A;  3GRX A;  3WGX A;  4POL A;  3Q18 A;  4LMV A;  4O5Q A;  2DIZ A;  3UVH A;  3GIX A;  3GX0 A;  1TU7 A;  3KH9 A;  1FOH A;  1WMJ A;  3CTF A;  4TR0 A;  2OBK A;  1E2Y A;  3VUR A;  3F63 A;  1VRS D;  19GS A;  4MK3 A;  3HXS A;  3RHC A;  3V1W A;  1SL2 B;  2WFC A;  1MDI A;  4PQH A;  1K0C A;  2CQ9 A;  5HFK A;  4KCE A;  2J23 A;  2HRF A;  1G6Y A;  1AAZ A;  3H1N A;  3APO A;  5IMC A;  2H75 A;  4EE0 A;  2ZUP A;  1T4Z A;  2V6O A;  3HVS A;  2L4Q A;  4MCU A;  4TR4 A;  3TRP A;  4OCF A;  1T7P B;  1YDK A;  1TRW A;  1XOB A;  4EVM A;  2QA2 A;  5KN2 A;  3QOU A;  3CRU A;  1PL2 A;  1M9B A;  4KA0 A;  4E8H A;  3CMI A;  9GSS A;  3APS A;  1QGV A;  4ULX A;  3VWW A;  3TGZ A;  3P8W A;  3G9B A;  1SEN A;  2VD0 A;  3TRQ A;  4ZB6 A;  4BVY B;  3EU3 A;  5D9X A;  1FB0 A;  2M80 A;  4Q5F A;  1KTE A;  3GL5 A;  2VLT A;  2VM2 A;  4DSQ A;  5FHI A;  2LUS A;  4HOJ A;  2VCW A;  4ML1 A;  2G2Q A;  1Z6M A;  1ABA A;  1GWC A;  3FHK A;  5J9C A;  2EIR A;  4GST A;  2WDU A;  2WRT A;  2X8H A;  4MJA A;  5G1L A;  4BPY A;  3ZL5 A;  4RUV A;  3ZIT A;  3A2V A;  3DKS A;  2H72 A;  1YJ6 A;  1I9D A;  1M2B A;  2A2P A;  2AJQ B;  4DVC A;  3VWV A;  1Z9H A;  1V57 A;  1GUH A;  3GST A;  3PIN A;  1ERV A;  1Q98 A;  3QD9 A;  3WD6 A;  3O3T A;  2JAD A;  5H5Q A;  4L5L A;  1K3L A;  1M2D A;  1B9X C;  4IKH A;  2FGX A;  2VCX A;  4HUA A;  4WR4 A;  3TJJ A;  3FY7 A;  4ZB8 A;  3F0I A;  2R37 A;  3D0Z A;  4G0K A;  3IHG A;  4O32 A;  4ZBA A;  2RM6 A;  2P0G A;  4WKW A;  1O8X A;  2YV7 A;  7GSS A;  1IYH A;  4KH7 A;  4PUR A;  3ZIV A;  1K0M A;  1G7E A;  3L4N A;  2BTO T;  2C0G A;  1Z7R A;  3US3 A;  1SKW B;  4F0C A;  4MJB A;  1KNG A;  5IPH A;  2BMX A;  2E7P A;  5LNK e;  1X5C A;  2C3T A;  1A8L A;  4ZIL A;  4V1A g;  5J5N A;  2I9H A;  4JR4 A;  4Q5R A;  5F07 A;  2R6K A;  4D73 A;  2X49 A;  3H93 A;  1OVN A;  3GUR A;  4I2T A;  2YNX A;  3I6A A;  4POB A;  1OKD A;  1O81 A;  4XS4 A;  1K3O A;  3KM6 A;  3UAP A;  4GF0 A;  3DXB A;  2L4C A;  2LNT A;  1RK4 A;  5KN0 A;  4GXZ A;  2VLV A;  4MF5 A;  1QFN A;  3F8U A;  2VL3 A;  3TKS A;  5DQY A;  6GSY A;  4NHZ A;  1B9Y C;  5GAP D;  5ECO B;  2E2M A;  2I1U A;  3AY8 A;  1JZW A;  2JZR A;  16GS A;  5DAL B;  2CZ2 A;  5FT3 A;  2IWT A;  4X1U A;  2ZCT A;  5HR0 A;  4GRF A;  2GT5 A;  4EC0 A;  2R3X A;  1SD9 A;  1THO A;  2PVO C;  2G0F A;  3FZA A;  1WPI A;  1ZYN A;  4K1F A;  3HVV A;  3LYP A;  5C00 A;  4PGT A;  2F3M A;  1AW9 A;  2PER A;  1MD4 A;  1MDJ A;  2PVQ A;  2GSQ A;  2HFD A;  3HYP A;  4DSR A;  2H0I A;  2H6Z A;  4PQ1 A;  1WP0 A;  2O7K A;  4OO4 A;  4JR6 A;  2H19 A;  2OAD A;  1TRV A;  4IVF A;  4ZIJ A;  4MPG A;  3KTL A;  6GSS A;  5DAK A;  5E4W A;  2QGV A;  3TKR A;  1EV4 A;  1SK1 A;  3LXZ A;  18GS A;  1UVZ A;  2FHE A;  2FCH A;  2FA8 A;  3GH9 A;  1PMT A;  4WR5 A;  3M9K A;  3C73 A;  1JLW A;  2HE3 A;  2B7K A;  3F3Q A;  4PQI A;  1Z6N A;  2HZE A;  3ZRE A;  5CRE A;  4PUF C;  6GSU A;  3KMO A;  3PGT A;  3CSJ A;  4I2U A;  3KGK A;  4I6X A;  1B4P A;  8GSS A;  3QFB C;  4Q5N A;  4KE3 A;  4KCA A;  1UA5 A;  3TJB A;  3IR4 A;  3QR6 A;  5HQP A;  1RW1 A;  5IIZ A;  2LQO A;  2OAC A;  1EGR A;  3FR9 A;  2DBC A;  1Q4J A;  4FQU A;  1EWX A;  4PXO A;  2OE3 A;  1WWJ A;  4PTS A;  2L6D A;  3M1G A;  4MJE A;  3I43 A;  5JCG A;  1R4W A;  1OC3 A;  4DEJ A;  4Q5Q A;  1GUK A;  1YF0 A;  1QMV A;  5ECH B;  3UOM A;  5ECQ B;  4K7O A;  3EVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...