1A0RP

Heterotrimeric complex of phosducin/transducin beta-gamma
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
218
structure length
188
Chain Sequence
FEGQASHTGPKGVINDWRKFKLESEFSRKMSVQEYELIHKDKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELESGEQFLETIEKEQKITTIVVHIYEDGIKGCDALNSSLICLAAEYPMVKFCKIKASNTGAGDRFSSDVLPTLLVYKGGELLSNFISVTEQLAEEFFTGDVESFLNEYGLLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (transducer/transduction)
molecule keywords TRANSDUCIN (BETA SUBUNIT)
publication title Phosducin induces a structural change in transducin beta gamma.
pubmed doi rcsb
total genus 56
structure length 188
sequence length 218
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF02114 Phosducin Phosducin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.168.10 Mainly Alpha Orthogonal Bundle Phosducin; domain 2 Phosducin, domain 2 1a0rP02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a0rP01
3W6GA 5G2ZA 4TR4A 1GUMA 3H8QA 5JWRB 2NBSA 2B5YA 1EV9A 1ERWA 2OE0A 3FW2A 4V2NA 5ECLB 5J9BA 1SJZA 2RM6A 2IFQA 3EE2A 3HDCA 5D73A 4YQUA 3HZ8A 4KAEA 2HYXA 4KB3A 5IPHA 2FHEA 1PA3A 2E2MA 2E7PA 2LJAA 5ECPB 4ZXGA 1NHYA 3UBLA 4N0ZA 3UARA 1USBA 5F8BA 1K0AA 4LMWA 4O32A 1SJIA 4TOPA 3IBHA 3CSIA 2GLRA 2YCDA 1XW5A 2P0GA 2FCHA 1NHOA 1OC9B 1X9WB 1YEPA 5ECOB 2QSIA 1HNCA 2A2RA 2H76A 5DJMA 2FWEA 3H93A 2YJHA 2V1MA 4O5RA 1B4PA 1T8EB 3J7Yk 3EYTA 3ERWA 3TRQA 3CRUA 3F4TA 2GQMA 2RIIA 5DJLA 2DSAA 3GHAA 2LUSA 2D2ZA 4I5QA 5AIVA 4TN8A 2EIQA 4OO4A 3V1WA 5ABRA 5IMAA 2LS5A 3ISOA 3GFKA 3A5WA 4FYBA 1ML6A 5ECNB 4RI7A 4F9ZA 1ERVA 1WE0A 4N0VA 2FY6A 5KN0A 2PN8A 3VLNA 3MDKA 5DQYA 2F51A 1YQ1A 2ALBA 1XWKA 3QPMA 2PUKC 5D8IA 3UEMA 1G6WA 1AAZA 2GSSA 5CRHA 5J5NA 3ZVJA 2XC2A 1GSFA 4MPGA 4OCFA 3EVIA 2AV4A 3KCMA 3RPPA 3UVHA 1TRWA 2VO4A 2H1BA 2V6KA 2L6CA 2L59A 3I69A 2GS3A 2O8VB 2QKEA 4PQIA 2YZHA 2F3MA 3IR4A 2LQQA 1NM3A 1F3BA 3Q74A 1YEXA 1FO5A 1S3AA 3CMIA 1XFLA 3ZITA 5CRGA 1JZOA 2HRNA 3TRXA 3TKSC 2M72A 3FZAA 3U5RE 3TJJA 3G7JA 2CVDA 5G30A 1B4QA 3FKFA 5EVOA 2EIRA 2CAIA 1TJDA 3TOTA 2FA8A 3RHBA 3C8EA 3VWUA 2WDUA 4XHMA 1JLWA 4YAPA 4EXJA 1OC9A 5CAXA 1ERUA 4L5LA 5B7CA 1O73A 1ERTA 2GQKA 4HEA2 2YOIA 4G19A 1XWBA 3GA4A 1WPIA 2MMZA 3A2XA 4WF5A 3BD2A 2R2JA 2M46A 1BYEA 1THOA 1OKTA 3HYPA 5L71A 5D96A 1VF2A 2C0DA 5C00A 5B8AA 1ZCPA 4DSQA 3HCZA 3CSJA 2MBTA 1KNGA 1W89A 2J9HA 1SL2B 1YKAA 4ACSA 1KTEA 5JWOB 2HE3A 3GURA 1U3AA 2CX3A 1PL2A 9GSSA 1FAAA 1TI1A 4WR4A 3ZRDA 2AJQB 5G5FA 4EC0A 1AQXA 1GTAA 1WMJA 2DJJA 2MMAA 1K0OA 4IJIA 2CA8A 3TKQA 4YQMA 3RHCA 3TKSE 4MPFA 3IK7A 4IS0A 2CAQA 3APOA 3F4SA 2LJKA 4HU9A 1F6MC 5DCGA 3M8NA 2OA7A 4Q5QA 3L9SA 2LQOA 2ES7A 1O7UA 1BX9A 2V32A 2F8FA 5B8BA 2GSQA 3E9JB 1BEDA 1WP0A 3C1SA 4ZBAA 2FLSA 4NAXA 3UMAA 1T1VA 1SKSB 2H01A 3VPTA 1PL1A 4PUFC 4KNDA 4ZB6A 1R26A 1BG5A 4O7HA 2BMXA 2VCXA 4KUNA 3P8WA 3EMXA 1EZKA 1X5DA 3CYNA 2EC4A 3EMPA 1U88A 1S3CA 5B6MA 1VGLA 4HQZA 2DJKA 5EY6A 5GSSA 2VLUA 4JZQA 4NHWA 4P3YB 1TKDB 5ECQB 4F82A 1BAYA 1SU9A 3TKRA 14GSA 1Q4JA 3TDGA 3L9UA 1HYUA 2LRCA 5A5KA 1PRXA 2AYTA 3ED3A 2DMLA 1TK0B 3HZ4A 3KEBA 4IW9A 1SYXA 3C71A 1V57A 1ZGNA 2H0GA 1TRVA 2I4AA 3IA1A 2PBJA 1KBNA 1U3IA 4BL7A 1MDIA 2VLVA 4IP6A 4WBRD 3NZNA 1H4OA 1R4WA 2CX4A 2PMTA 5IM9A 5CRDA 3GL3A 4WF4A 1R5AA 4PXOA 2L5OA 5IMFA 4JR4A 1U6TA 5E59A 4POLA 2JSZA 1SKRB 1Q98A 2I1UA 4POBA 1M2DA 5GAPD 3ZFLA 1R7HA 4ECBA 3TKPA 1MDKA 2E2GA 4EVMA 4QQ7A 7GSSA 1ACVA 2FGXA 1A8YA 3FR3A 2XPDA 2JACA 2DC5A 4FH8A 3RBTA 1DE2A 1SK1A 2MZCA 2GSRA 4NWYA 1FVKA 4FYCA 3SWLA 3UIWA 4TR0A 2X99A 1T7PB 1N8JA 2C3TA 1XBSA 2ON7A 1AXDA 1JZDA 2ZNMA 1MTCA 3IHQA 2F8AA 3APSA 3GN3A 4PGTA 2J23A 4ECJA 1A24A 1THXA 4IQ1A 3GKMA 1YZXA 3UAPA 4JR6A 4I97A 1V40A 4NV2A 2A4VA 3MSZA 5ELAA 1UA5A 2LSTA 4MDCA 2H8LA 3QDNA 1M9AA 3HD5A 5ECRB 3VK9A 6GSUA 3WGEA 5AIXA 1Y25A 2VCZA 3ZL5A 2O87A 4ZL8A 3ZZXA 3TGZA 2PPTA 2YZUA 4N10A 2WCIA 1A0FA 2HI7A 4BWSA 2L4CA 1SYRA 2G2QA 5C04A 1E2YA 4L0UA 1CQGA 5DVBA 4K1FA 2X8GA 5INYA 2BTOT 4MABA 1WJKA 3A3TA 2R6KA 3GV1A 4GSTA 1AC1A 5CREA 4X1UA 2N5BA 1TU8A 2YV9A 1YF1A 3F3RA 4KDYA 1FB0A 3HVXA 6GSXA 5H5QA 3TUEA 1XVWA 3LQ7A 3IAM2 19GSA 2AAWA 3ZIVA 2HXKA 2R4VA 1TRSA 4K0GA 1K0BA 5COHA 5DAKB 1K0NA 4BVYA 1BJXA 2FD3A 6GSTA 2CQ9A 4XIHA 2VM1A 5LD0A 3KIJA 1V9WA 3GUSA 3GSSA 5EPFA 2EIOA 3FR9A 17GSA 3BCIA 2H74A 1GSDA 3FZ5A 3N9JA 3LORA 4K2DA 4XS1A 2C0FA 1YJ6A 3DYRA 1WIKA 2LRNA 4PUAA 2VLTA 3ERGA 5IO0A 2CT6A 3KTLA 2PVQA 1CQHA 1ZYEA 2H1GA 2LTKA 4OCEA 2IIYA 2H72A 1PX7A 1PGTA 18GSA 4HOJA 2X8CA 20GSA 3LYKA 1Z5YE 2VL2C 2BJXA 3DD3A 3QFBC 2XBQA 4IP1A 1HD2A 4OWYA 4IBPA 1PSQA 4OO5A 3QAWA 4F0CA 5IMCA 2YWOA 4GCIA 22GSA 2FWGA 1YF0A 1K0CA 1AW9A 3CRTA 1PX6A 2B5XA 4AJ6A 16GSA 2X64A 1K0MA 3KMNA 5H5RA 2HRFA 3JCML 4AJ7A 4ZILA 5G1LA 4POKA 3VI5A 3WYWA 1V2AA 4KA0A 1R5PA 4ZL7A 3ZFBA 4GF0A 1GP1A 2C0GA 5LCZA 2WRTA 1X9MB 4EDZA 12GSA 2KOKA 3GMFA 2GQLA 4MZCA 4H86A 1M2BA 1K3LA 1A2MA 2DIYA 4WETA 1EEMA 4TRXA 4XRDA 5AGYA 2PVOC 3BCKA 5ECIB 2KUCA 2GDRA 3LXZA 2LEGA 3ZYWA 4MCUA 4KCEA 3H4KA 1O8XA 3H1NA 1J08A 4EF0A 1J9BA 3GNJA 4LL1B 4TR1B 2A2SA 4ULXA 1EV4A 5DAKA 4FYUA 2H1AA 1ABAA 3C7MA 1FOVA 2ZCTA 1LU4A 3APQA 3IXRA 4HQSA 3SBCA 5J41A 4ZB9A 4BVXA 2YWIA 4Z7XA 4NHZA 4IVFA 3I43A 4ILFA 4K8MA 2PWJA 4IQAA 1MD3A 4GLTA 4DSRA 3ZIJA 3IDVA 1E6BA 2I3YA 3HY2A 4GSSA 4KSOA 4OFTA 3W8SA 1ON4A 4LL4B 1MD4A 1PMTA 4KDUA 3G7YA 2NVLA 4TVEA 3EINA 1AUCA 1PKWA 1VF4A 5ECSA 1IYHA 2CZ3A 2MBSA 2JADA 2HZFA 2ON5A 1QMVA 5D9TA 1GNWA 3VWXA 1F9MA 2RUFA 4X0XA 2V6OA 1XXUA 4HU7A 3D0ZA 3DGQA 3VPQA 1EGRA 2WGRA 3GX0A 1T4ZA 4EUYA 1XWAA 4EKZA 1URMA 1X5CA 4WBJA 2CVKA 3MAKA 3IAS2 3CBUA 1ZL9A 2KP1A 2DJ0A 13GSA 3D21A 1A8LA 5FT3A 1EP8A 1WRYA 4L5OA 3LYPA 4MJAA 1RW1A 4ML6A 6GSWA 2CV4A 2FA4A 4F0BA 1F3AA 1GWCA 3DVWA 3OR5A 1X5EA 3GRXA 4NPBA 3CTFA 4AF2A 3DKSA 4HZ2A 2HSHA 1PKZA 4WXTA 1NSWA 1UN2A 1XWCA 1TOFA 1AIUA 2LJRA 4CHSA 4HDEA 4ZBDA 3K8NA 3D22A 11GSA 4GXZA 2TRXA 3EURA 3IV4A 4K6XA 1EOGA 3ZLPA 4TR1A 5DBQA 4F2IA 3GYKA 4K7IA 2ZUPA 5CRWA 1I9DA 3D6IA 1T00A 1YDKA 2IMIA 8GSSA 1OC3A 5AISA 4HJMA 4G2EA 1TRUA 1SL1B 2GSTA 1V58A 1GTIA 5E4WA 1A2JA 3MWHA 5D93A 1GL8A 3KMOA 2O89A 4MJBA 1WWJA 1PN9A 2DJ3A 5IMVA 2V41A 3M3MA 10GSA 4K0NA 1XW6A 5DALB 4V1Ag 4YH2A 2IMKA 5IOWA 2YWNA 4CDOA 1IYIA 3D5JA 4KDXA 1GUKA 2IWTA 1FHEA 3I6AA 4I6XA 5G31A 2LKUA 4XS4B 1DE1A 3LGCA 3R2QA 5B6NA 1MDJA 2OACA 3EC3A 5D9XA 2RM5A 4IN0A 5ECKB 2FUG2 5HR0A 4KW6A 2PGTA 3EU4A 1XOAA 4L0WA 3F6FA 2VOCA 2OBKA 1B8XA 5JCUA 1F37A 4ZL9A 3KH9A 1XCCA 3KZQA 3S9FA 1M2AA 1SK0A 3M1GA 2JL4A 3D4TA 2VM2A 2B1KA 3VFIA 3HA9A 1QXHA 1GLQA 1OC8A 6GSVA 2DJ1A 1TW9A 1GSSA 2DJ2A 2MYGA 1YY7A 2C80A 2B5EA 4HZ4A 3ZVJD 1EGOA 1RQMA 4K7NA 5F0GA 3I9V2 3FRCA 3HJMA 1G6YA 2PERA 4RQRA 4G10A 4X43A 2VCTA 4XS6A 2V2GA 3FYGA 1MEKA 1TTZA 1HQOA 1K3YA 5J3RA 4V1Ap 3ZREA 2I9HA 4O92A 5GZZB 4XCSA 2M80A 3TOUA 2GTUA 3GSTA 4J2FA 3ZMLA 2OKAA 4DSSB 3QAVA 3FZ4A 3IRAA 3DVXA 3UL3A 3DIEA 3EWLA 2YV7A 4TXOB 3TJBA 2GVPA 2X8HA 1F2EA 4MJEA 1SL0B 4LA1A 1C72A 3KGKA 1GRXA 1J0FA 3M9KA 1TP9A 2L6DA 4YAVA 5HFIA 3E0UA 3NIVA 3IPZA 1XOBA 4ECCA 3WT1A 1SJ6A 3QD9A 3HXSA 4DEJA 2XHFA 2YNXA 2L57A 1GTBA 2MMOA 4IGJA 3N5OA 1T4YA 4IKHA 2HLSA 2H6XA 4MJCA 3PH9A 5DALA 2CZ2A 1PQNA 2KLXA 3FEUA 2GT6A 2FNOA 5HFGA 1SK2A 4IJ3A 3KTBA 2IL3A 2JZTA 5CP1A 1GNEA 3LXTA 3P7XA 2DIZA 4FO5A 3KXOA 4XS4A 1O85A 2N5AA 3P2AA 2L5LA 3GTUB 4DVCA 1QUWA 2LV3A 4Q5FA 4V2MA 4K7OA 3QR6A 4EL1A 1M0UA 1X0RA 4HS1A 4NV5A 4PNGA 1XVQA 1TI3A 3G9BA 5IOXA 2K18A 3Q18A 2GZPA 4ZIJA 4E8HA 5IPGA 1OE8A 5F07A 1OAZA 5KN3A 3C73A 3KD0A 2YP6A 1WOUA 1AQWA 2VL2A 2AB6A 2JU5A 5IMDA 2KHPA 2RUEA 1HNAA 4ECIA 1DBYA 1EEJA 4GQCA 2HNLA 4E8EA 1B9XC 2TIRA 1KEBA 1BQ7A 3GL5A 4BPYA 1K3OA 4CW9A 1Z9HA 2H1DA 4GRFA 5F06A 4MZWA 5HR2A 5IO2A 2VL3A 3GH9A 2K8VA 4V2LA 4DSSA 3DWVA 1SENA 5KN1A 5A4WA 3E3EA 1XIYA 3LFLA 1XW9A 2H30A 2VD1A 2B6MA 3GKXA 4MP4A 5G5EA 1JZRA 5HQPA 4TXOA 5DQSA 3DXBA 2JZRA 3VI7A 3VWWA 3F9UA 3A2VA 4RUVA 1FVJA 4YQVA 4F03A 2DMMA 3BOAA 3WT2A 2IJYA 4LMVA 2XPEA 3HHVA 5ENUA 4MLYA 5D9WA 4QL9A 1VF1A 2VD0A 1Z7PA 2YPMA 3M9JA 5KN2A 4J56E 5EL8A 3CSHA 3Q19A 4I2TA 5DDLA 3LWAA 1GSUA 3HJPA 3QOUA 3EU3A 4OFMA 3TB2A 1A23A 4MMMA 1Z6MA 4GSNA 4AJ8A 5F05A 3TCOA 2C0EA 3GKNA 2K8SA 1I5GA 4XTSA 4WR5A 4JU5A 2WULA 1ZMAA 2VCQA 3QAGA 3CXGA 3Q6OA 5HR3A 2C3QA 1G7EA 3TJKA 3GTUA 1EP7A 2N5FA 1B48A 3O3TA 2REMA 2RLIA 3IK9A 2H6YA 3TKSA 2LRTA 3TRPA 3UJ1A 2GT5A 2WS2A 2H75A 3GX8A 1FW1A 2B3SA 2B7JA 4GQFA 1GULA 3ZMKA 2F9SA 5J4UA 5AN1A 2WZ9A 4ML1A 4I8BA 5ECMB 2DBCA 3LEFA 4TXVA 2GZYA 3IC4A 2HZEB 2IMDA 4N30A 3RAZA 3AY8A 6GSYA 5FHIA 1NW2A 4PQHA 1OYJA 4L8EA 3L4NA 4NMUA 3UBKA 1FG4A 4OFNA 1EWXA 1M7TA 3GKKA 2L4QA 2QGVA 3NOFA 2LNSA 1X9SB 3F4RA 4K9ZA 3L9VA 3KM6A 3ERFA 1GLPA 4KCAA 5JCWA 2IPAA 3WGXA 2R5GA 1ZOFA 3TJGA 2OJLA 1OKDA 5H5SA 1JHBA 2VCVA 2VL9A 1RK4A 3QFAC 1H75A 1ZZYA 3J7Yb 1YKCA 4D73B 6GSSA 3QMXA 2B1LA 1DUGA 1A2LA 4WEYA 3VWVA 2H0IA 2P31A 5JWQB 3P90A 1TK8B 2PU9C 2WJUA 1GSYA 3U6VA 4J57E 3BBYA 3TJFA 4NXIA 3GH6A 1SD8A 2P5RA 5IMZA 5LNKe 3IOSA 2C3NA 3PINA 5ECHB 2O7KA 2G0FA 2H19A 3FY7A 5ELGA 1TXXA 2YWMA 1W4VA 3W8JA 1O6JA 4BWQA 2GGTA 3QCPA 4KX4A 2DLXA 4MH2A 2C8UA 5HFKA 4PNFA 3O6TA 3KP9A 3LSZA 4KE3A 4TW5A 3BJ5A 4RI6A 1PD21 2R3XA 5HR1A 4PX1A 3G7IA 2R37A 3KP8A 1ZYQB 2C4JA 2IMEA 4MF7A 1G0TA 3F0IA 3F3QA 3F6DA 2FWFA 4POMA 2FWHA 4TKYA 1HNBA 2H73A 1VF3A 5A4VA 4I2UA 5ID2B 2H71A 3WD6A 1OVNA 2Z9SA 2OADA 3L0HA 1A0RP 2HZEA 1O81A 3MNGA 1XPVA 1SKWB 4JBBA 5GAND 2OE1A 3HKRA 1XWGA 1U87A 2HSYA 4JEDA 1ILOA 2YANA 2HT9A 2GZZA 3C1RA 4HJ2A 3ZTLA 1GUHA 2YJ7A 2O85A 1JLVA 2YN1A 1TDIA 1Z7RA 4EO3A 3L78A 2H6ZA 3FK8A 1XZOA 2JSYA 2P5QA 1FB6A 3FZ9A 2AHEA 3DRNA 3M0FA 4OD7A 1GH2A 1O8WA 1V98A 5DCHA 2JZSA 2E0QA 3HVSA 4GWRA 1Y6EA 3KJYA 4IELA 4OMVA 1K0DA 5CYYA 4D73A 3O76A 1TK5B 1B9YC 2AUVA 4FIWA 2IMFA 4Q5NA 1JFUA 4HI7A 2OE3A 5CO3A 2H70A 5KEJA 2C1YA 2IFQB 2IN3A 3RDWA 3F8UA 4EDYA 1QFNA 4GTUA 3WGDA 3H79A 4G9HA 2KP2A 4KH7A 1GTUA 4QL7A 1TU7A 2H66A 1UC7A 2NPBA 2NDOA 5A4UA 4MF6A 1VRSD 3DEXA 1QQ2A 4KSMA 2MMNA 1GSQA 3HVVA 3DMLA 1Z3EA 3ME7A 3FHKA 1AQVA 2LNTA 4TR3A 1T3BA 1LJRA 4ZBBA 3UVTA 3VURA 5CNWA 4EE0A 5JCGA 3US3A 4MA9A 2XBIA 4MK3A 3GIXA 1S3DA 3FR6A 1M9BA 5FWGA 1QGVA 1GSEA 3LG6A 1Z6NA 3RPNA 4MZBA 1SD9A 4KGIA 4BA7A 4N11A 3ME8A 2WB9A 2NTOA 2K9FA 5ID2A 2HFDA 3IE3A 2B7KA 4ID0A 4WKWA 2CVBA 4XRAA 2VAFA 1QK8A 3D4MA 1ST9A 1M99A 4MH3A 4Q5RA 3HJOA 5D9VA 1DSBA 4ZB8A 3CTGA 2TRCP 2K6VA 3A2WA 5IQYA 3LJRA 2VUPA 5G1KA 5J9CA 2I81A 3PGTA 1EOHA 3KH7A 1G7OA 1LBKA 4MF5A 2VIMA 4ISDA 4JRRA 5GSTA 1OE7A 3UOMA 2OBIA 1UVZA 2H0HA 3PR8A 4IHUA 5IIZA 4PQ1A 4PURA 2VCWA 3F63A 2QC7A 1N2AA 1JZWA 4JE1A 2WFCA 4HUAA 4LLRA 4RQXA 4AGSA
chains in the Genus database with same CATH superfamily
3W6GA 5G2ZA 4TR4A 1GUMA 3H8QA 5JWRB 2NBSA 2B5YA 1EV9A 1ERWA 2OE0A 3FW2A 4V2NA 5ECLB 5J9BA 1SJZA 2RM6A 2IFQA 3EE2A 3HDCA 5D73A 4YQUA 3HZ8A 4KAEA 2HYXA 4KB3A 5IPHA 2FHEA 1PA3A 2E2MA 2E7PA 2LJAA 5ECPB 4ZXGA 1NHYA 3UBLA 4N0ZA 3UARA 1USBA 5F8BA 1K0AA 4LMWA 4O32A 1SJIA 4TOPA 3IBHA 3CSIA 2GLRA 2YCDA 5FLXI 1XW5A 2P0GA 2FCHA 1NHOA 1OC9B 1X9WB 1YEPA 2R0PA 5ECOB 2QSIA 1HNCA 2A2RA 2H76A 5DJMA 2FWEA 3H93A 2YJHA 3IHGA 2V1MA 4O5RA 1B4PA 1T8EB 3J7Yk 3EYTA 3ERWA 3TRQA 3CRUA 3F4TA 2GQMA 2RIIA 5DJLA 2DSAA 3GHAA 2LUSA 2D2ZA 4X4JA 4I5QA 5AIVA 4TN8A 2EIQA 4OO4A 3V1WA 5ABRA 5IMAA 2LS5A 3ISOA 3GFKA 3A5WA 4FYBA 1ML6A 5ECNB 4RI7A 4Z2UA 4F9ZA 1ERVA 1XG8A 1WE0A 4N0VA 2FY6A 5KN0A 2PN8A 3VLNA 3MDKA 5DQYA 2F51A 1YQ1A 2ALBA 1XWKA 3QPMA 2PUKC 5D8IA 3UEMA 1G6WA 1AAZA 2GSSA 5CRHA 5J5NA 3ZVJA 4YKFA 2XC2A 1GSFA 4MPGA 4KF9A 4OCFA 3EVIA 2AV4A 3KCMA 3RPPA 4YKGA 3UVHA 1TRWA 2VO4A 2H1BA 2V6KA 2L6CA 2L59A 3I69A 2GS3A 2O8VB 2QKEA 4PQIA 2YZHA 2F3MA 3IR4A 2LQQA 1NM3A 1F3BA 3Q74A 1YEXA 1FO5A 1S3AA 3CMIA 1XFLA 3ZITA 5CRGA 1JZOA 2HRNA 3TRXA 3TKSC 2M72A 3FZAA 3U5RE 3TJJA 3G7JA 2CVDA 5G30A 1B4QA 3FKFA 5EVOA 2EIRA 2CAIA 1TJDA 3TOTA 2FA8A 3RHBA 4A5PA 3C8EA 3VWUA 2WDUA 4XHMA 1JLWA 4YAPA 5BRTA 4EXJA 1OC9A 5CAXA 1ERUA 4L5LA 5B7CA 1O73A 1ERTA 2GQKA 4HEA2 4BL7B 2YOIA 4G19A 1XWBA 3GA4A 1WPIA 2MMZA 3A2XA 4WF5A 3BD2A 2R2JA 2M46A 1BYEA 1THOA 2UZ8A 4G0KA 2A4HA 1OKTA 3HYPA 5L71A 5D96A 1VF2A 2C0DA 5C00A 5B8AA 1ZCPA 4DSQA 3HCZA 3CSJA 2MBTA 1KNGA 1W89A 2J9HA 1SL2B 1YKAA 4ACSA 1KTEA 5JWOB 2HE3A 3GURA 1U3AA 2CX3A 1PL2A 9GSSA 1FAAA 1TI1A 4WR4A 3ZRDA 2AJQB 5G5FA 4EC0A 1AQXA 1GTAA 1WMJA 2DJJA 2MMAA 1K0OA 4IJIA 2CA8A 3TKQA 4YQMA 1M3IA 3RHCA 3TKSE 4MPFA 3IK7A 4IS0A 2CAQA 3APOA 3F4SA 2LJKA 4HU9A 2R0GA 1F6MC 5DCGA 3M8NA 2OA7A 4Q5QA 3L9SA 2LQOA 2ES7A 1O7UA 1BX9A 2V32A 2F8FA 5B8BA 2GSQA 3E9JB 1BEDA 1WP0A 3C1SA 4ZBAA 2FLSA 4NAXA 3UMAA 1T1VA 1SKSB 2H01A 3VPTA 1PL1A 4PUFC 4KNDA 4ZB6A 1R26A 1BG5A 4O7HA 2BMXA 2VCXA 4KUNA 3P8WA 3EMXA 1EZKA 1X5DA 3CYNA 2EC4A 3EMPA 1U88A 1S3CA 4K5RA 5B6MA 1VGLA 4HQZA 2DJKA 5EY6A 5GSSA 2VLUA 4PTSA 4JZQA 4NHWA 4P3YB 1TKDB 5ECQB 4F82A 1BAYA 1SU9A 3TKRA 14GSA 1Q4JA 3TDGA 3L9UA 1HYUA 2LRCA 5A5KA 1PRXA 2AYTA 3ED3A 2DMLA 1TK0B 3HZ4A 3KEBA 4IW9A 1SYXA 3C71A 1V57A 1ZGNA 2H0GA 1TRVA 2I4AA 3IA1A 2PBJA 1KBNA 1U3IA 3A5IA 4BL7A 1MDIA 2VLVA 4IP6A 4WBRD 3NZNA 1H4OA 1R4WA 2CX4A 2PMTA 5IM9A 5CRDA 3GL3A 4WF4A 1R5AA 4PXOA 2L5OA 5IMFA 4JR4A 1U6TA 5E59A 5KOWA 4POLA 2JSZA 1SKRB 1Q98A 2I1UA 4POBA 1M2DA 5GAPD 3ZFLA 1R7HA 4ECBA 3TKPA 1MDKA 2E2GA 4EVMA 3MIXA 4QQ7A 7GSSA 1ACVA 2FGXA 1A8YA 3FR3A 4EIPA 2XPDA 2JACA 2DC5A 4FH8A 3RBTA 1DE2A 1SK1A 2MZCA 2GSRA 4NWYA 1FVKA 4FYCA 3SWLA 3UIWA 4K5SA 4TR0A 2X99A 1T7PB 1N8JA 2C3TA 1XBSA 2ON7A 1AXDA 1JZDA 2ZNMA 1MTCA 3IHQA 2F8AA 3APSA 3GN3A 4PGTA 2J23A 4ECJA 1A24A 1THXA 4IQ1A 3GKMA 1YZXA 3UAPA 4JR6A 4I97A 1V40A 4NV2A 3IC8A 2A4VA 3MSZA 5ELAA 1UA5A 2LSTA 4MDCA 2H8LA 3QDNA 1M9AA 3HD5A 5ECRB 3VK9A 6GSUA 3WGEA 5AIXA 1Y25A 2VCZA 3ZL5A 2O87A 4ZL8A 3ZZXA 3TGZA 1ZYPA 2PPTA 2YZUA 4N10A 2WCIA 1A0FA 5IT9I 2HI7A 4BWSA 2L4CA 1SYRA 2G2QA 5C04A 1E2YA 4L0UA 1CQGA 5DVBA 4K1FA 2X8GA 5INYA 2BTOT 4MABA 1WJKA 3A3TA 2R6KA 3GV1A 4GSTA 1AC1A 5CREA 4X1UA 2N5BA 1TU8A 2YV9A 1YF1A 3F3RA 4KDYA 1FB0A 3HVXA 6GSXA 5H5QA 3TUEA 1XVWA 3LQ7A 3IAM2 19GSA 2AAWA 3ZIVA 2HXKA 2R4VA 1TRSA 4K0GA 1K0BA 4Z2TA 5COHA 1PN0A 5DAKB 1K0NA 4BVYA 1BJXA 2FD3A 6GSTA 2CQ9A 4XIHA 3R3EA 2VM1A 4BVXB 5LD0A 3KIJA 1V9WA 3GUSA 3GSSA 5EPFA 2EIOA 3FR9A 17GSA 3BCIA 2H74A 1GSDA 5KOXA 3FZ5A 3N9JA 3LORA 4K2DA 4XS1A 2C0FA 4O5QA 1YJ6A 1PFOA 3DYRA 1WIKA 2LRNA 4PUAA 2VLTA 3ERGA 5IO0A 2CT6A 3KTLA 2HRKA 2PVQA 1CQHA 1ZYEA 2H1GA 2LTKA 4OCEA 2IIYA 2H72A 1PX7A 1PGTA 18GSA 4HOJA 2X8CA 20GSA 3LYKA 1Z5YE 2VL2C 2BJXA 3DD3A 3QFBC 2XBQA 4IP1A 1HD2A 4OWYA 4IBPA 1PSQA 4OO5A 3QAWA 4F0CA 5IMCA 2YWOA 4GCIA 22GSA 2FWGA 1YF0A 1K0CA 1AW9A 3CRTA 1PX6A 2B5XA 4AJ6A 16GSA 2X64A 1K0MA 3KMNA 5H5RA 2X4AA 2HRFA 3JCML 4AJ7A 4ZILA 5G1LA 4POKA 3VI5A 3WYWA 1V2AA 4KA0A 1R5PA 4ZL7A 3ZFBA 4GF0A 1GP1A 2C0GA 5LCZA 2WRTA 1X9MB 4EDZA 12GSA 2KOKA 3GMFA 2GQLA 4MZCA 4H86A 1M2BA 1K3LA 1A2MA 2DIYA 4WETA 1EEMA 4TRXA 4XRDA 5AGYA 2PVOC 3BCKA 5ECIB 2KUCA 2GDRA 3LXZA 2LEGA 3ZYWA 4MCUA 4KCEA 3H4KA 1O8XA 3H1NA 1J08A 4EF0A 1J9BA 3GNJA 5BMUA 4LL1B 4TR1B 2A2SA 4ULXA 1EV4A 5DAKA 4FYUA 2H1AA 1ABAA 3C7MA 1FOVA 2ZCTA 1LU4A 3APQA 3IXRA 4G0IA 4HQSA 3SBCA 5J41A 4ZB9A 4BVXA 2YWIA 4Z7XA 4NHZA 4IVFA 3I43A 4ILFA 4K8MA 2PWJA 4IQAA 1MD3A 4GLTA 4DSRA 3ZIJA 3IDVA 4MNNA 1E6BA 2I3YA 3HY2A 4GSSA 4KSOA 4OFTA 3W8SA 1ON4A 4LL4B 1MD4A 1PMTA 4KDUA 3G7YA 2NVLA 4TVEA 3EINA 1AUCA 1PKWA 1VF4A 5ECSA 1IYHA 2CZ3A 2MBSA 2JADA 2HZFA 2ON5A 1QMVA 5D9TA 1GNWA 3VWXA 1F9MA 2RUFA 4X0XA 2V6OA 1XXUA 4HU7A 3D0ZA 3DGQA 3VPQA 1EGRA 2WGRA 3GX0A 1T4ZA 4EUYA 1XWAA 4EKZA 1URMA 1X5CA 4WBJA 2CVKA 3MAKA 3IAS2 3CBUA 1ZL9A 2KP1A 2DJ0A 13GSA 3D21A 4USSA 1A8LA 5FT3A 1EP8A 1WRYA 4BIKA 4L5OA 3LYPA 4MJAA 1RW1A 4ML6A 6GSWA 2CV4A 3MYDA 2FA4A 4F0BA 1F3AA 1GWCA 3DVWA 3OR5A 1X5EA 3GRXA 4NPBA 3CTFA 4AF2A 3DKSA 4HZ2A 1M3JA 2HSHA 1PKZA 4WXTA 1NSWA 1UN2A 1XWCA 1TOFA 1AIUA 2LJRA 4CHSA 4HDEA 4ZBDA 3K8NA 3D22A 11GSA 4GXZA 2TRXA 3EURA 3IV4A 4K6XA 1EOGA 3ZLPA 2QA2A 4TR1A 5DBQA 4F2IA 3GYKA 4K7IA 2ZUPA 5CRWA 1I9DA 3D6IA 1T00A 1YDKA 2IMIA 8GSSA 1OC3A 5AISA 4HJMA 1S3RA 4G2EA 1TRUA 1SL1B 2GSTA 1V58A 3LW9A 2QA1A 1GTIA 5E4WA 1A2JA 3MWHA 5D93A 1GL8A 3KMOA 2O89A 4MJBA 4CY6A 1WWJA 1PN9A 2DJ3A 5IMVA 2V41A 3M3MA 10GSA 4K0NA 1XW6A 5DALB 4V1Ag 4YH2A 2IMKA 5IOWA 2YWNA 4CDOA 1IYIA 3D5JA 4KDXA 1GUKA 2IWTA 1FHEA 3I6AA 4I6XA 5G31A 2LKUA 4XS4B 1DE1A 3LGCA 3R2QA 5B6NA 1MDJA 2OACA 3EC3A 5D9XA 2RM5A 4IN0A 4BVYB 5ECKB 2FUG2 5HR0A 4KW6A 2PGTA 3EU4A 1XOAA 4L0WA 3F6FA 2VOCA 2OBKA 1B8XA 5JCUA 2HSMA 1F37A 4ZL9A 3KH9A 1XCCA 3KZQA 3S9FA 1M2AA 1SK0A 3M1GA 2JL4A 3D4TA 3J80I 2VM2A 2B1KA 3VFIA 3HA9A 1QXHA 1GLQA 1OC8A 6GSVA 2DJ1A 1TW9A 1GSSA 2DJ2A 3EPTA 2MYGA 1YY7A 2C80A 2B5EA 4HZ4A 3ZVJD 1EGOA 1RQMA 4K7NA 5F0GA 3I9V2 3FRCA 3HJMA 1G6YA 2PERA 4RQRA 4G10A 4X43A 2VCTA 4XS6A 2V2GA 3FYGA 1MEKA 1TTZA 1HQOA 1K3YA 5J3RA 4V1Ap 3ZREA 2I9HA 4O92A 5GZZB 4XCSA 2M80A 3TOUA 2GTUA 3GSTA 4J2FA 3ZMLA 2OKAA 4DSSB 3QAVA 3FZ4A 3IRAA 3DVXA 3UL3A 3DIEA 3EWLA 2YV7A 4TXOB 3TJBA 2GVPA 2X8HA 1F2EA 4MJEA 1SL0B 4LA1A 1C72A 3KGKA 1GRXA 1J0FA 3M9KA 1TP9A 2L6DA 4YAVA 5HFIA 3E0UA 3NIVA 3IPZA 1XOBA 4ECCA 3WT1A 1SJ6A 3QD9A 3HXSA 4DEJA 2XHFA 2YNXA 2L57A 1GTBA 2MMOA 4IGJA 3N5OA 1T4YA 4IKHA 2HLSA 2H6XA 4MJCA 3PH9A 5DALA 2CZ2A 1PQNA 2KLXA 2HRAA 2GT6A 3FEUA 2FNOA 5HFGA 1SK2A 4IJ3A 3KTBA 2IL3A 2JZTA 5CP1A 1GNEA 3LXTA 3P7XA 2DIZA 4FO5A 3KXOA 4XS4A 1O85A 2N5AA 3P2AA 2L5LA 3GTUB 4DVCA 1QUWA 2LV3A 4Q5FA 4V2MA 4K7OA 3CQFA 3QR6A 4EL1A 1M0UA 1X0RA 4HS1A 4NV5A 4PNGA 1XVQA 1TI3A 3G9BA 5IOXA 2K18A 3Q18A 2GZPA 4ZIJA 4E8HA 5IPGA 1OE8A 5F07A 1OAZA 5KN3A 3C73A 3KD0A 2YP6A 1WOUA 1AQWA 2VL2A 2AB6A 2JU5A 5IMDA 2KHPA 2RUEA 3PPUA 1HNAA 4ECIA 1DBYA 1EEJA 4GQCA 2HNLA 4E8EA 1B9XC 2TIRA 1KEBA 1BQ7A 3GL5A 4BPYA 1K3OA 4CW9A 1Z9HA 4G0LA 2H1DA 4GRFA 5F06A 4MZWA 5HR2A 5IO2A 2VL3A 3GH9A 2K8VA 4V2LA 4DSSA 3DWVA 1SENA 5KN1A 5A4WA 3E3EA 1XIYA 3LFLA 1XW9A 2H30A 2VD1A 2B6MA 3GKXA 4MP4A 5G5EA 1JZRA 5HQPA 4TXOA 5DQSA 3DXBA 2JZRA 3VI7A 3VWWA 3F9UA 3A2VA 4RUVA 1FVJA 4YQVA 4F03A 3HVNA 2DMMA 3BOAA 3WT2A 2IJYA 4LMVA 2XPEA 3HHVA 5ENUA 4MLYA 5D9WA 4QL9A 1VF1A 5A2QI 2VD0A 1Z7PA 2YPMA 3M9JA 5KN2A 4J56E 3CSHA 5EL8A 3Q19A 4I2TA 5DDLA 3LWAA 1GSUA 3HJPA 3QOUA 3EU3A 4OFMA 3TB2A 1A23A 4MMMA 1Z6MA 4GSNA 4AJ8A 5F05A 3TCOA 2C0EA 3GKNA 2K8SA 1I5GA 4XTSA 4WR5A 4JU5A 2WULA 1FOHA 1ZMAA 2VCQA 3QAGA 3CXGA 3Q6OA 5HR3A 2C3QA 1G7EA 3TJKA 3GTUA 1EP7A 2N5FA 1B48A 3O3TA 2REMA 2RLIA 3IK9A 2H6YA 3TKSA 2LRTA 3TRPA 3UJ1A 2GT5A 2WS2A 2H75A 3GX8A 1FW1A 2B3SA 2B7JA 2A2PA 4GQFA 1GULA 3ZMKA 2F9SA 5J4UA 5AN1A 2WZ9A 4ML1A 4I8BA 5ECMB 2DBCA 3LEFA 4TXVA 2GZYA 3IC4A 2HZEB 2IMDA 4N30A 3RAZA 3AY8A 2DKIA 2R0CA 6GSYA 5FHIA 4K2XA 1NW2A 4PQHA 1OYJA 4L8EA 3L4NA 4NMUA 3UBKA 1FG4A 4OFNA 1EWXA 1M7TA 3GKKA 2L4QA 4CY8A 2QGVA 3NOFA 2LNSA 1X9SB 3F4RA 4K9ZA 3L9VA 3KM6A 3ERFA 1GLPA 4KCAA 5JCWA 2IPAA 3WGXA 2R5GA 1ZOFA 3JAMI 3TJGA 2OJLA 1OKDA 5H5SA 1JHBA 2VCVA 2VL9A 1RK4A 3QFAC 1H75A 1ZZYA 3J7Yb 1YKCA 4D73B 6GSSA 3QMXA 2B1LA 1DUGA 1A2LA 4WEYA 3VWVA 2X49A 2H0IA 2P31A 5JWQB 3P90A 1TK8B 2PU9C 2WJUA 1GSYA 3U6VA 4J57E 3BBYA 3TJFA 4NXIA 3GH6A 1SD8A 2P5RA 5IMZA 5LNKe 3IOSA 2C3NA 3PINA 5ECHB 2O7KA 2G0FA 5LL6V 2H19A 3FY7A 4Z2RA 5ELGA 1TXXA 2YWMA 1W4VA 4HSCX 3W8JA 1O6JA 4BWQA 2GGTA 3QCPA 4KX4A 2DLXA 4MH2A 2C8UA 5HFKA 4PNFA 3O6TA 3KP9A 3LSZA 4KE3A 4TW5A 3BJ5A 4RI6A 1PD21 2R3XA 5HR1A 4PX1A 3G7IA 2R37A 3KP8A 1ZYQB 2C4JA 2IMEA 4MF7A 1G0TA 3F0IA 3F3QA 3F6DA 2FWFA 4POMA 2FWHA 4TKYA 1HNBA 2H73A 1VF3A 5A4VA 4I2UA 5ID2B 2H71A 3WD6A 1OVNA 4O5UA 2Z9SA 2OADA 3L0HA 1A0RP 2HZEA 1O81A 3MNGA 1XPVA 1SKWB 4JBBA 5GAND 2OE1A 3HKRA 1XWGA 1U87A 2HSYA 4JEDA 1ILOA 2YANA 2HT9A 2GZZA 3C1RA 4HJ2A 3ZTLA 1GUHA 2YJ7A 4ICYA 2O85A 1JLVA 2YN1A 1TDIA 1Z7RA 4FQUA 4EO3A 3L78A 2H6ZA 2DKHA 3FK8A 1XZOA 2JSYA 2P5QA 1FB6A 3FZ9A 2AHEA 3DRNA 3M0FA 4OD7A 1GH2A 1O8WA 1V98A 5DCHA 2JZSA 2E0QA 3HVSA 4GWRA 1Y6EA 3KJYA 4IELA 4OMVA 1K0DA 5CYYA 4D73A 3O76A 1TK5B 1B9YC 2AUVA 3FMWA 4FIWA 2IMFA 4Q5NA 1JFUA 4HI7A 2OE3A 5CO3A 2H70A 5KEJA 2C1YA 2IFQB 2IN3A 3RDWA 3F8UA 4EDYA 1QFNA 4GTUA 3WGDA 3H79A 4G9HA 2KP2A 4KH7A 1GTUA 4QL7A 1TU7A 2H66A 1UC7A 2NPBA 2NDOA 5A4UA 4MF6A 1VRSD 3DEXA 1QQ2A 4KSMA 2MMNA 1GSQA 3J81I 3HVVA 3DMLA 1Z3EA 3ME7A 4EIQA 3FHKA 1AQVA 2LNTA 4TR3A 1T3BA 1LJRA 4ZBBA 3UVTA 3VURA 5CNWA 4EE0A 5JCGA 3US3A 4MA9A 2XBIA 4MK3A 3GIXA 1S3DA 3FR6A 1M9BA 5FWGA 1QGVA 1GSEA 3LG6A 1Z6NA 3RPNA 4MZBA 1SD9A 4KGIA 4BA7A 4N11A 3ME8A 2WB9A 2NTOA 2K9FA 5ID2A 2HFDA 3IE3A 2B7KA 4ID0A 4WKWA 2CVBA 4XRAA 2VAFA 1QK8A 3D4MA 1ST9A 1M99A 4MH3A 4Q5RA 3HJOA 5D9VA 1DSBA 4ZB8A 3CTGA 2TRCP 2K6VA 3A2WA 5IQYA 3LJRA 2VUPA 5G1KA 5J9CA 2I81A 3PGTA 1EOHA 1ZYNA 3KH7A 1G7OA 1LBKA 4MF5A 2VIMA 4ISDA 4JRRA 5GSTA 1OE7A 3UOMA 2OBIA 1UVZA 2H0HA 3PR8A 4IHUA 5IIZA 4PQ1A 4PURA 2VCWA 3F63A 2QC7A 1N2AA 1JZWA 4JE1A 2WFCA 4HUAA 4LLRA 4RQXA 4AGSA
chains in the Genus database with same CATH topology
3W6GA 5G2ZA 4TR4A 1GUMA 3H8QA 5JWRB 2NBSA 2B5YA 1EV9A 1ERWA 2OE0A 3FW2A 4V2NA 5ECLB 5J9BA 1SJZA 2RM6A 2IFQA 3EE2A 3HDCA 5D73A 4YQUA 3HZ8A 4KAEA 2HYXA 4KB3A 5IPHA 2FHEA 1PA3A 2E2MA 2E7PA 2LJAA 5ECPB 4ZXGA 1NHYA 3UBLA 4N0ZA 3UARA 1USBA 5F8BA 1K0AA 4LMWA 4O32A 1SJIA 4TOPA 3IBHA 3CSIA 2GLRA 2YCDA 1XW5A 2P0GA 2FCHA 1NHOA 1OC9B 1X9WB 1YEPA 2R0PA 5ECOB 2QSIA 1HNCA 2A2RA 2H76A 5DJMA 2FWEA 3H93A 2YJHA 3IHGA 2V1MA 4O5RA 1B4PA 1T8EB 3J7Yk 3EYTA 3ERWA 3TRQA 3CRUA 3F4TA 2GQMA 2RIIA 5DJLA 2DSAA 3GHAA 2LUSA 2D2ZA 4X4JA 4I5QA 5AIVA 4TN8A 2EIQA 4OO4A 3V1WA 5ABRA 5IMAA 2LS5A 3ISOA 3GFKA 3A5WA 4FYBA 1ML6A 5ECNB 4RI7A 4Z2UA 4F9ZA 1ERVA 1WE0A 4N0VA 2FY6A 5KN0A 2PN8A 3VLNA 3MDKA 5DQYA 2F51A 1YQ1A 2ALBA 1XWKA 3QPMA 2PUKC 5D8IA 3UEMA 1G6WA 1AAZA 2GSSA 5CRHA 5J5NA 3ZVJA 4YKFA 2XC2A 1GSFA 4MPGA 4KF9A 4OCFA 3EVIA 2AV4A 3KCMA 3RPPA 4YKGA 3UVHA 1TRWA 2VO4A 2H1BA 2V6KA 2L6CA 2L59A 3I69A 2GS3A 2O8VB 2QKEA 4PQIA 2YZHA 2F3MA 3IR4A 2LQQA 1NM3A 1F3BA 3Q74A 1YEXA 1FO5A 1S3AA 3CMIA 1XFLA 3ZITA 5CRGA 1JZOA 2HRNA 3TRXA 3TKSC 2M72A 3FZAA 3U5RE 3TJJA 3G7JA 2CVDA 5G30A 1B4QA 3FKFA 5EVOA 2EIRA 2CAIA 1TJDA 3TOTA 2FA8A 3RHBA 4A5PA 3C8EA 3VWUA 2WDUA 4XHMA 1JLWA 4YAPA 5BRTA 4EXJA 1OC9A 5CAXA 1ERUA 4L5LA 5B7CA 1O73A 1ERTA 2GQKA 4HEA2 4BL7B 2YOIA 4G19A 1XWBA 3GA4A 1WPIA 2MMZA 3A2XA 4WF5A 3BD2A 2R2JA 2M46A 1BYEA 1THOA 2UZ8A 4G0KA 2A4HA 1OKTA 3HYPA 5L71A 5D96A 1VF2A 2C0DA 5C00A 5B8AA 1ZCPA 4DSQA 3HCZA 3CSJA 2MBTA 1KNGA 1W89A 2J9HA 1SL2B 1YKAA 4ACSA 1KTEA 5JWOB 2HE3A 3GURA 1U3AA 2CX3A 1PL2A 9GSSA 1FAAA 1TI1A 4WR4A 3ZRDA 2AJQB 5G5FA 4EC0A 1AQXA 1GTAA 1WMJA 2DJJA 2MMAA 1K0OA 4IJIA 2CA8A 3TKQA 4YQMA 3RHCA 3TKSE 4MPFA 3IK7A 4IS0A 2CAQA 3APOA 3F4SA 2LJKA 4HU9A 2R0GA 1F6MC 5DCGA 3M8NA 2OA7A 4Q5QA 3L9SA 2LQOA 2ES7A 1O7UA 1BX9A 2V32A 2F8FA 5B8BA 2GSQA 3E9JB 1BEDA 1WP0A 3C1SA 4ZBAA 2FLSA 4NAXA 3UMAA 1T1VA 1SKSB 2H01A 3VPTA 1PL1A 4PUFC 4KNDA 4ZB6A 1R26A 1BG5A 4O7HA 2BMXA 2VCXA 4KUNA 3P8WA 3EMXA 1EZKA 1X5DA 3CYNA 2EC4A 3EMPA 1U88A 1S3CA 4K5RA 5B6MA 1VGLA 4HQZA 2DJKA 5EY6A 5GSSA 2VLUA 4PTSA 4JZQA 4NHWA 4P3YB 1TKDB 5ECQB 4F82A 1BAYA 1SU9A 3TKRA 14GSA 1Q4JA 3TDGA 3L9UA 1HYUA 2LRCA 5A5KA 1PRXA 2AYTA 3ED3A 2DMLA 1TK0B 3HZ4A 3KEBA 4IW9A 1SYXA 3C71A 1V57A 1ZGNA 2H0GA 1TRVA 2I4AA 3IA1A 2PBJA 1KBNA 1U3IA 3A5IA 4BL7A 1MDIA 2VLVA 4IP6A 4WBRD 3NZNA 1H4OA 1R4WA 2CX4A 2PMTA 5IM9A 5CRDA 3GL3A 4WF4A 1R5AA 4PXOA 2L5OA 5IMFA 4JR4A 1U6TA 5E59A 5KOWA 4POLA 2JSZA 1SKRB 1Q98A 2I1UA 4POBA 1M2DA 5GAPD 3ZFLA 1R7HA 4ECBA 3TKPA 1MDKA 2E2GA 4EVMA 3MIXA 4QQ7A 7GSSA 1ACVA 2FGXA 1A8YA 3FR3A 4EIPA 2XPDA 2JACA 2DC5A 4FH8A 3RBTA 1DE2A 1SK1A 2MZCA 2GSRA 4NWYA 1FVKA 4FYCA 3SWLA 3UIWA 4K5SA 4TR0A 2X99A 1T7PB 1N8JA 2C3TA 1XBSA 2ON7A 1AXDA 1JZDA 2ZNMA 1MTCA 3IHQA 2F8AA 3APSA 3GN3A 4PGTA 2J23A 4ECJA 1A24A 1THXA 4IQ1A 3GKMA 1YZXA 3UAPA 4JR6A 4I97A 1V40A 4NV2A 3IC8A 2A4VA 3MSZA 5ELAA 1UA5A 2LSTA 4MDCA 2H8LA 3QDNA 1M9AA 3HD5A 5ECRB 3VK9A 6GSUA 3WGEA 5AIXA 1Y25A 2VCZA 3ZL5A 2O87A 4ZL8A 3ZZXA 3TGZA 1ZYPA 2PPTA 2YZUA 4N10A 2WCIA 1A0FA 2HI7A 4BWSA 2L4CA 1SYRA 2G2QA 5C04A 1E2YA 4L0UA 1CQGA 5DVBA 4K1FA 2X8GA 5INYA 2BTOT 4MABA 1WJKA 3A3TA 2R6KA 3GV1A 4GSTA 1AC1A 5CREA 4X1UA 2N5BA 1TU8A 2YV9A 1YF1A 3F3RA 4KDYA 1FB0A 3HVXA 6GSXA 5H5QA 3TUEA 1XVWA 3LQ7A 3IAM2 19GSA 2AAWA 3ZIVA 2HXKA 2R4VA 1TRSA 4K0GA 1K0BA 4Z2TA 5COHA 1PN0A 5DAKB 1K0NA 4BVYA 1BJXA 2FD3A 6GSTA 2CQ9A 4XIHA 3R3EA 2VM1A 4BVXB 5LD0A 3KIJA 1V9WA 3GUSA 3GSSA 5EPFA 2EIOA 3FR9A 17GSA 3BCIA 2H74A 1GSDA 5KOXA 3FZ5A 3N9JA 3LORA 4K2DA 4XS1A 2C0FA 4O5QA 1YJ6A 3DYRA 1WIKA 2LRNA 4PUAA 2VLTA 3ERGA 5IO0A 2CT6A 3KTLA 2HRKA 2PVQA 1CQHA 1ZYEA 2H1GA 2LTKA 4OCEA 2IIYA 2H72A 1PX7A 1PGTA 18GSA 4HOJA 2X8CA 20GSA 3LYKA 1Z5YE 2VL2C 2BJXA 3DD3A 3QFBC 2XBQA 4IP1A 1HD2A 4OWYA 4IBPA 1PSQA 4OO5A 3QAWA 4F0CA 5IMCA 2YWOA 4GCIA 22GSA 2FWGA 1YF0A 1K0CA 1AW9A 3CRTA 1PX6A 2B5XA 4AJ6A 16GSA 2X64A 1K0MA 3KMNA 5H5RA 2X4AA 2HRFA 3JCML 4AJ7A 4ZILA 5G1LA 4POKA 3VI5A 3WYWA 1V2AA 4KA0A 1R5PA 4ZL7A 3ZFBA 4GF0A 1GP1A 2C0GA 5LCZA 2WRTA 1X9MB 4EDZA 12GSA 2KOKA 3GMFA 2GQLA 4MZCA 4H86A 1M2BA 1K3LA 1A2MA 2DIYA 4WETA 1EEMA 4TRXA 4XRDA 5AGYA 2PVOC 3BCKA 5ECIB 2KUCA 2GDRA 3LXZA 2LEGA 3ZYWA 4MCUA 4KCEA 3H4KA 1O8XA 3H1NA 1J08A 4EF0A 1J9BA 3GNJA 5BMUA 4LL1B 4TR1B 2A2SA 4ULXA 1EV4A 5DAKA 4FYUA 2H1AA 1ABAA 3C7MA 1FOVA 2ZCTA 1LU4A 3APQA 3IXRA 4G0IA 4HQSA 3SBCA 5J41A 4ZB9A 4BVXA 2YWIA 4Z7XA 4NHZA 4IVFA 3I43A 4ILFA 4K8MA 2PWJA 4IQAA 1MD3A 4GLTA 4DSRA 3ZIJA 3IDVA 4MNNA 1E6BA 2I3YA 3HY2A 4GSSA 4KSOA 4OFTA 3W8SA 1ON4A 4LL4B 1MD4A 1PMTA 4KDUA 3G7YA 2NVLA 4TVEA 3EINA 1AUCA 1PKWA 1VF4A 5ECSA 1IYHA 2CZ3A 2MBSA 2JADA 2HZFA 2ON5A 1QMVA 5D9TA 1GNWA 3VWXA 1F9MA 2RUFA 4X0XA 2V6OA 1XXUA 4HU7A 3D0ZA 3DGQA 3VPQA 1EGRA 2WGRA 3GX0A 1T4ZA 4EUYA 1XWAA 4EKZA 1URMA 1X5CA 4WBJA 2CVKA 3MAKA 3IAS2 3CBUA 1ZL9A 2KP1A 2DJ0A 13GSA 3D21A 4USSA 1A8LA 5FT3A 1EP8A 1WRYA 4L5OA 3LYPA 4MJAA 1RW1A 4ML6A 6GSWA 2CV4A 3MYDA 2FA4A 4F0BA 1F3AA 1GWCA 3DVWA 3OR5A 1X5EA 3GRXA 4NPBA 3CTFA 4AF2A 3DKSA 4HZ2A 2HSHA 1PKZA 4WXTA 1NSWA 1UN2A 1XWCA 1TOFA 1AIUA 2LJRA 4CHSA 4HDEA 4ZBDA 3K8NA 3D22A 11GSA 4GXZA 2TRXA 3EURA 3IV4A 4K6XA 1EOGA 3ZLPA 2QA2A 4TR1A 5DBQA 4F2IA 3GYKA 4K7IA 2ZUPA 5CRWA 1I9DA 3D6IA 1T00A 1YDKA 2IMIA 8GSSA 1OC3A 5AISA 4HJMA 4G2EA 1TRUA 1SL1B 2GSTA 1V58A 3LW9A 2QA1A 1GTIA 5E4WA 1A2JA 3MWHA 5D93A 1GL8A 3KMOA 2O89A 4MJBA 4CY6A 1WWJA 1PN9A 2DJ3A 5IMVA 2V41A 3M3MA 10GSA 4K0NA 1XW6A 5DALB 4V1Ag 4YH2A 2IMKA 5IOWA 2YWNA 4CDOA 1IYIA 3D5JA 4KDXA 1GUKA 2IWTA 1FHEA 3I6AA 4I6XA 5G31A 2LKUA 4XS4B 1DE1A 3LGCA 3R2QA 5B6NA 1MDJA 2OACA 3EC3A 5D9XA 2RM5A 4IN0A 4BVYB 5ECKB 2FUG2 5HR0A 4KW6A 2PGTA 3EU4A 1XOAA 4L0WA 3F6FA 2VOCA 2OBKA 1B8XA 5JCUA 2HSMA 1F37A 4ZL9A 3KH9A 1XCCA 3KZQA 3S9FA 1M2AA 1SK0A 3M1GA 2JL4A 3D4TA 2VM2A 2B1KA 3VFIA 3HA9A 1QXHA 1GLQA 1OC8A 6GSVA 2DJ1A 1TW9A 1GSSA 2DJ2A 3EPTA 2MYGA 1YY7A 2C80A 2B5EA 4HZ4A 3ZVJD 1EGOA 1RQMA 4K7NA 5F0GA 3I9V2 3FRCA 3HJMA 1G6YA 2PERA 4RQRA 4G10A 4X43A 2VCTA 4XS6A 2V2GA 3FYGA 1MEKA 1TTZA 1HQOA 1K3YA 5J3RA 4V1Ap 3ZREA 2I9HA 4O92A 5GZZB 4XCSA 2M80A 3TOUA 2GTUA 3GSTA 4J2FA 3ZMLA 2OKAA 4DSSB 3QAVA 3FZ4A 3IRAA 3DVXA 3UL3A 3DIEA 3EWLA 2YV7A 4TXOB 3TJBA 2GVPA 2X8HA 1F2EA 4MJEA 1SL0B 4LA1A 1C72A 3KGKA 1GRXA 1J0FA 3M9KA 1TP9A 2L6DA 4YAVA 5HFIA 3E0UA 3NIVA 3IPZA 1XOBA 4ECCA 3WT1A 1SJ6A 3QD9A 3HXSA 4DEJA 2XHFA 2YNXA 2L57A 1GTBA 2MMOA 4IGJA 3N5OA 1T4YA 4IKHA 2HLSA 2H6XA 4MJCA 3PH9A 5DALA 2CZ2A 1PQNA 2KLXA 2HRAA 2GT6A 3FEUA 2FNOA 5HFGA 1SK2A 4IJ3A 3KTBA 2IL3A 2JZTA 5CP1A 1GNEA 3LXTA 3P7XA 2DIZA 4FO5A 3KXOA 4XS4A 1O85A 2N5AA 3P2AA 2L5LA 3GTUB 4DVCA 1QUWA 2LV3A 4Q5FA 4V2MA 4K7OA 3QR6A 4EL1A 1M0UA 1X0RA 4HS1A 4NV5A 4PNGA 1XVQA 1TI3A 3G9BA 5IOXA 2K18A 3Q18A 2GZPA 4ZIJA 4E8HA 5IPGA 1OE8A 5F07A 1OAZA 5KN3A 3C73A 3KD0A 2YP6A 1WOUA 1AQWA 2VL2A 2AB6A 2JU5A 5IMDA 2KHPA 2RUEA 3PPUA 1HNAA 4ECIA 1DBYA 1EEJA 4GQCA 2HNLA 4E8EA 1B9XC 2TIRA 1KEBA 1BQ7A 3GL5A 4BPYA 1K3OA 4CW9A 1Z9HA 4G0LA 2H1DA 4GRFA 5F06A 4MZWA 5HR2A 5IO2A 2VL3A 3GH9A 2K8VA 4V2LA 4DSSA 3DWVA 1SENA 5KN1A 5A4WA 3E3EA 1XIYA 3LFLA 1XW9A 2H30A 2VD1A 2B6MA 3GKXA 4MP4A 5G5EA 1JZRA 5HQPA 4TXOA 5DQSA 3DXBA 2JZRA 3VI7A 3VWWA 3F9UA 3A2VA 4RUVA 1FVJA 4YQVA 4F03A 2DMMA 3BOAA 3WT2A 2IJYA 4LMVA 2XPEA 3HHVA 5ENUA 4MLYA 5D9WA 4QL9A 1VF1A 2VD0A 1Z7PA 2YPMA 3M9JA 5KN2A 4J56E 3CSHA 5EL8A 3Q19A 4I2TA 5DDLA 3LWAA 1GSUA 3HJPA 3QOUA 3EU3A 4OFMA 3TB2A 1A23A 4MMMA 1Z6MA 4GSNA 4AJ8A 5F05A 3TCOA 2C0EA 3GKNA 2K8SA 1I5GA 4XTSA 4WR5A 4JU5A 2WULA 1FOHA 1ZMAA 2VCQA 3QAGA 3CXGA 3Q6OA 5HR3A 2C3QA 1G7EA 3TJKA 3GTUA 1EP7A 2N5FA 1B48A 3O3TA 2REMA 2RLIA 3IK9A 2H6YA 3TKSA 2LRTA 3TRPA 3UJ1A 2GT5A 2WS2A 2H75A 3GX8A 1FW1A 2B3SA 2B7JA 2A2PA 4GQFA 1GULA 3ZMKA 2F9SA 5J4UA 5AN1A 2WZ9A 4ML1A 4I8BA 5ECMB 2DBCA 3LEFA 4TXVA 2GZYA 3IC4A 2HZEB 2IMDA 4N30A 3RAZA 3AY8A 2DKIA 2R0CA 6GSYA 5FHIA 4K2XA 1NW2A 4PQHA 1OYJA 4L8EA 3L4NA 4NMUA 3UBKA 1FG4A 4OFNA 1EWXA 1M7TA 3GKKA 2L4QA 4CY8A 2QGVA 3NOFA 2LNSA 1X9SB 3F4RA 4K9ZA 3L9VA 3KM6A 3ERFA 1GLPA 4KCAA 5JCWA 2IPAA 3WGXA 2R5GA 1ZOFA 3TJGA 2OJLA 1OKDA 5H5SA 1JHBA 2VCVA 2VL9A 1RK4A 3QFAC 1H75A 1ZZYA 3J7Yb 1YKCA 4D73B 6GSSA 3QMXA 2B1LA 1DUGA 1A2LA 4WEYA 3VWVA 2X49A 2H0IA 2P31A 5JWQB 3P90A 1TK8B 2PU9C 2WJUA 1GSYA 3U6VA 4J57E 3BBYA 3TJFA 4NXIA 3GH6A 1SD8A 2P5RA 5IMZA 5LNKe 3IOSA 2C3NA 3PINA 5ECHB 2O7KA 2G0FA 2H19A 3FY7A 4Z2RA 5ELGA 1TXXA 2YWMA 1W4VA 3W8JA 1O6JA 4BWQA 2GGTA 3QCPA 4KX4A 2DLXA 4MH2A 2C8UA 5HFKA 4PNFA 3O6TA 3KP9A 3LSZA 4KE3A 4TW5A 3BJ5A 4RI6A 1PD21 2R3XA 5HR1A 4PX1A 3G7IA 2R37A 3KP8A 1ZYQB 2C4JA 2IMEA 4MF7A 1G0TA 3F0IA 3F3QA 3F6DA 2FWFA 4POMA 2FWHA 4TKYA 1HNBA 2H73A 1VF3A 5A4VA 4I2UA 5ID2B 2H71A 3WD6A 1OVNA 4O5UA 2Z9SA 2OADA 3L0HA 1A0RP 2HZEA 1O81A 3MNGA 1XPVA 1SKWB 4JBBA 5GAND 2OE1A 3HKRA 1XWGA 1U87A 2HSYA 4JEDA 1ILOA 2YANA 2HT9A 2GZZA 3C1RA 4HJ2A 3ZTLA 1GUHA 2YJ7A 4ICYA 2O85A 1JLVA 2YN1A 1TDIA 1Z7RA 4FQUA 4EO3A 3L78A 2H6ZA 2DKHA 3FK8A 1XZOA 2JSYA 2P5QA 1FB6A 3FZ9A 2AHEA 3DRNA 3M0FA 4OD7A 1GH2A 1O8WA 1V98A 5DCHA 2JZSA 2E0QA 3HVSA 4GWRA 1Y6EA 3KJYA 4IELA 4OMVA 1K0DA 5CYYA 4D73A 3O76A 1TK5B 1B9YC 2AUVA 3FMWA 4FIWA 2IMFA 4Q5NA 1JFUA 4HI7A 2OE3A 5CO3A 2H70A 5KEJA 2C1YA 2IFQB 2IN3A 3RDWA 3F8UA 4EDYA 1QFNA 4GTUA 3WGDA 3H79A 4G9HA 2KP2A 4KH7A 1GTUA 4QL7A 1TU7A 2H66A 1UC7A 2NPBA 2NDOA 5A4UA 4MF6A 1VRSD 3DEXA 1QQ2A 4KSMA 2MMNA 1GSQA 3HVVA 3DMLA 1Z3EA 3ME7A 4EIQA 3FHKA 1AQVA 2LNTA 4TR3A 1T3BA 1LJRA 4ZBBA 3UVTA 3VURA 5CNWA 4EE0A 5JCGA 3US3A 4MA9A 2XBIA 4MK3A 3GIXA 1S3DA 3FR6A 1M9BA 5FWGA 1QGVA 1GSEA 3LG6A 1Z6NA 3RPNA 4MZBA 1SD9A 4KGIA 4BA7A 4N11A 3ME8A 2WB9A 2NTOA 2K9FA 5ID2A 2HFDA 3IE3A 2B7KA 4ID0A 4WKWA 2CVBA 4XRAA 2VAFA 1QK8A 3D4MA 1ST9A 1M99A 4MH3A 4Q5RA 3HJOA 5D9VA 1DSBA 4ZB8A 3CTGA 2TRCP 2K6VA 3A2WA 5IQYA 3LJRA 2VUPA 5G1KA 5J9CA 2I81A 3PGTA 1EOHA 1ZYNA 3KH7A 1G7OA 1LBKA 4MF5A 2VIMA 4ISDA 4JRRA 5GSTA 1OE7A 3UOMA 2OBIA 1UVZA 2H0HA 3PR8A 4IHUA 5IIZA 4PQ1A 4PURA 2VCWA 3F63A 2QC7A 1N2AA 1JZWA 4JE1A 2WFCA 4HUAA 4LLRA 4RQXA 4AGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W6G A;  5G2Z A;  4TR4 A;  1GUM A;  3H8Q A;  5JWR B;  2NBS A;  2B5Y A;  1EV9 A;  1ERW A;  2OE0 A;  3FW2 A;  4V2N A;  5ECL B;  5J9B A;  1SJZ A;  2RM6 A;  2IFQ A;  3EE2 A;  3HDC A;  5D73 A;  4YQU A;  3HZ8 A;  4KAE A;  2HYX A;  4KB3 A;  5IPH A;  2FHE A;  1PA3 A;  2E2M A;  2E7P A;  2LJA A;  5ECP B;  4ZXG A;  1NHY A;  3UBL A;  4N0Z A;  3UAR A;  1USB A;  5F8B A;  1K0A A;  4LMW A;  4O32 A;  1SJI A;  4TOP A;  3IBH A;  3CSI A;  2GLR A;  2YCD A;  1XW5 A;  2P0G A;  2FCH A;  1NHO A;  1OC9 B;  1X9W B;  1YEP A;  5ECO B;  2QSI A;  1HNC A;  2A2R A;  2H76 A;  5DJM A;  2FWE A;  3H93 A;  2YJH A;  2V1M A;  4O5R A;  1B4P A;  1T8E B;  3J7Y k;  3EYT A;  3ERW A;  3TRQ A;  3CRU A;  3F4T A;  2GQM A;  2RII A;  5DJL A;  2DSA A;  3GHA A;  2LUS A;  2D2Z A;  4I5Q A;  5AIV A;  4TN8 A;  2EIQ A;  4OO4 A;  3V1W A;  5ABR A;  5IMA A;  2LS5 A;  3ISO A;  3GFK A;  3A5W A;  4FYB A;  1ML6 A;  5ECN B;  4RI7 A;  4F9Z A;  1ERV A;  1WE0 A;  4N0V A;  2FY6 A;  5KN0 A;  2PN8 A;  3VLN A;  3MDK A;  5DQY A;  2F51 A;  1YQ1 A;  2ALB A;  1XWK A;  3QPM A;  2PUK C;  5D8I A;  3UEM A;  1G6W A;  1AAZ A;  2GSS A;  5CRH A;  5J5N A;  3ZVJ A;  2XC2 A;  1GSF A;  4MPG A;  4OCF A;  3EVI A;  2AV4 A;  3KCM A;  3RPP A;  3UVH A;  1TRW A;  2VO4 A;  2H1B A;  2V6K A;  2L6C A;  2L59 A;  3I69 A;  2GS3 A;  2O8V B;  2QKE A;  4PQI A;  2YZH A;  2F3M A;  3IR4 A;  2LQQ A;  1NM3 A;  1F3B A;  3Q74 A;  1YEX A;  1FO5 A;  1S3A A;  3CMI A;  1XFL A;  3ZIT A;  5CRG A;  1JZO A;  2HRN A;  3TRX A;  3TKS C;  2M72 A;  3FZA A;  3U5R E;  3TJJ A;  3G7J A;  2CVD A;  5G30 A;  1B4Q A;  3FKF A;  5EVO A;  2EIR A;  2CAI A;  1TJD A;  3TOT A;  2FA8 A;  3RHB A;  3C8E A;  3VWU A;  2WDU A;  4XHM A;  1JLW A;  4YAP A;  4EXJ A;  1OC9 A;  5CAX A;  1ERU A;  4L5L A;  5B7C A;  1O73 A;  1ERT A;  2GQK A;  4HEA 2;  2YOI A;  4G19 A;  1XWB A;  3GA4 A;  1WPI A;  2MMZ A;  3A2X A;  4WF5 A;  3BD2 A;  2R2J A;  2M46 A;  1BYE A;  1THO A;  1OKT A;  3HYP A;  5L71 A;  5D96 A;  1VF2 A;  2C0D A;  5C00 A;  5B8A A;  1ZCP A;  4DSQ A;  3HCZ A;  3CSJ A;  2MBT A;  1KNG A;  1W89 A;  2J9H A;  1SL2 B;  1YKA A;  4ACS A;  1KTE A;  5JWO B;  2HE3 A;  3GUR A;  1U3A A;  2CX3 A;  1PL2 A;  9GSS A;  1FAA A;  1TI1 A;  4WR4 A;  3ZRD A;  2AJQ B;  5G5F A;  4EC0 A;  1AQX A;  1GTA A;  1WMJ A;  2DJJ A;  2MMA A;  1K0O A;  4IJI A;  2CA8 A;  3TKQ A;  4YQM A;  3RHC A;  3TKS E;  4MPF A;  3IK7 A;  4IS0 A;  2CAQ A;  3APO A;  3F4S A;  2LJK A;  4HU9 A;  1F6M C;  5DCG A;  3M8N A;  2OA7 A;  4Q5Q A;  3L9S A;  2LQO A;  2ES7 A;  1O7U A;  1BX9 A;  2V32 A;  2F8F A;  5B8B A;  2GSQ A;  3E9J B;  1BED A;  1WP0 A;  3C1S A;  4ZBA A;  2FLS A;  4NAX A;  3UMA A;  1T1V A;  1SKS B;  2H01 A;  3VPT A;  1PL1 A;  4PUF C;  4KND A;  4ZB6 A;  1R26 A;  1BG5 A;  4O7H A;  2BMX A;  2VCX A;  4KUN A;  3P8W A;  3EMX A;  1EZK A;  1X5D A;  3CYN A;  2EC4 A;  3EMP A;  1U88 A;  1S3C A;  5B6M A;  1VGL A;  4HQZ A;  2DJK A;  5EY6 A;  5GSS A;  2VLU A;  4JZQ A;  4NHW A;  4P3Y B;  1TKD B;  5ECQ B;  4F82 A;  1BAY A;  1SU9 A;  3TKR A;  14GS A;  1Q4J A;  3TDG A;  3L9U A;  1HYU A;  2LRC A;  5A5K A;  1PRX A;  2AYT A;  3ED3 A;  2DML A;  1TK0 B;  3HZ4 A;  3KEB A;  4IW9 A;  1SYX A;  3C71 A;  1V57 A;  1ZGN A;  2H0G A;  1TRV A;  2I4A A;  3IA1 A;  2PBJ A;  1KBN A;  1U3I A;  4BL7 A;  1MDI A;  2VLV A;  4IP6 A;  4WBR D;  3NZN A;  1H4O A;  1R4W A;  2CX4 A;  2PMT A;  5IM9 A;  5CRD A;  3GL3 A;  4WF4 A;  1R5A A;  4PXO A;  2L5O A;  5IMF A;  4JR4 A;  1U6T A;  5E59 A;  4POL A;  2JSZ A;  1SKR B;  1Q98 A;  2I1U A;  4POB A;  1M2D A;  5GAP D;  3ZFL A;  1R7H A;  4ECB A;  3TKP A;  1MDK A;  2E2G A;  4EVM A;  4QQ7 A;  7GSS A;  1ACV A;  2FGX A;  1A8Y A;  3FR3 A;  2XPD A;  2JAC A;  2DC5 A;  4FH8 A;  3RBT A;  1DE2 A;  1SK1 A;  2MZC A;  2GSR A;  4NWY A;  1FVK A;  4FYC A;  3SWL A;  3UIW A;  4TR0 A;  2X99 A;  1T7P B;  1N8J A;  2C3T A;  1XBS A;  2ON7 A;  1AXD A;  1JZD A;  2ZNM A;  1MTC A;  3IHQ A;  2F8A A;  3APS A;  3GN3 A;  4PGT A;  2J23 A;  4ECJ A;  1A24 A;  1THX A;  4IQ1 A;  3GKM A;  1YZX A;  3UAP A;  4JR6 A;  4I97 A;  1V40 A;  4NV2 A;  2A4V A;  3MSZ A;  5ELA A;  1UA5 A;  2LST A;  4MDC A;  2H8L A;  3QDN A;  1M9A A;  3HD5 A;  5ECR B;  3VK9 A;  6GSU A;  3WGE A;  5AIX A;  1Y25 A;  2VCZ A;  3ZL5 A;  2O87 A;  4ZL8 A;  3ZZX A;  3TGZ A;  2PPT A;  2YZU A;  4N10 A;  2WCI A;  1A0F A;  2HI7 A;  4BWS A;  2L4C A;  1SYR A;  2G2Q A;  5C04 A;  1E2Y A;  4L0U A;  1CQG A;  5DVB A;  4K1F A;  2X8G A;  5INY A;  2BTO T;  4MAB A;  1WJK A;  3A3T A;  2R6K A;  3GV1 A;  4GST A;  1AC1 A;  5CRE A;  4X1U A;  2N5B A;  1TU8 A;  2YV9 A;  1YF1 A;  3F3R A;  4KDY A;  1FB0 A;  3HVX A;  6GSX A;  5H5Q A;  3TUE A;  1XVW A;  3LQ7 A;  3IAM 2;  19GS A;  2AAW A;  3ZIV A;  2HXK A;  2R4V A;  1TRS A;  4K0G A;  1K0B A;  5COH A;  5DAK B;  1K0N A;  4BVY A;  1BJX A;  2FD3 A;  6GST A;  2CQ9 A;  4XIH A;  2VM1 A;  5LD0 A;  3KIJ A;  1V9W A;  3GUS A;  3GSS A;  5EPF A;  2EIO A;  3FR9 A;  17GS A;  3BCI A;  2H74 A;  1GSD A;  3FZ5 A;  3N9J A;  3LOR A;  4K2D A;  4XS1 A;  2C0F A;  1YJ6 A;  3DYR A;  1WIK A;  2LRN A;  4PUA A;  2VLT A;  3ERG A;  5IO0 A;  2CT6 A;  3KTL A;  2PVQ A;  1CQH A;  1ZYE A;  2H1G A;  2LTK A;  4OCE A;  2IIY A;  2H72 A;  1PX7 A;  1PGT A;  18GS A;  4HOJ A;  2X8C A;  20GS A;  3LYK A;  1Z5Y E;  2VL2 C;  2BJX A;  3DD3 A;  3QFB C;  2XBQ A;  4IP1 A;  1HD2 A;  4OWY A;  4IBP A;  1PSQ A;  4OO5 A;  3QAW A;  4F0C A;  5IMC A;  2YWO A;  4GCI A;  22GS A;  2FWG A;  1YF0 A;  1K0C A;  1AW9 A;  3CRT A;  1PX6 A;  2B5X A;  4AJ6 A;  16GS A;  2X64 A;  1K0M A;  3KMN A;  5H5R A;  2HRF A;  3JCM L;  4AJ7 A;  4ZIL A;  5G1L A;  4POK A;  3VI5 A;  3WYW A;  1V2A A;  4KA0 A;  1R5P A;  4ZL7 A;  3ZFB A;  4GF0 A;  1GP1 A;  2C0G A;  5LCZ A;  2WRT A;  1X9M B;  4EDZ A;  12GS A;  2KOK A;  3GMF A;  2GQL A;  4MZC A;  4H86 A;  1M2B A;  1K3L A;  1A2M A;  2DIY A;  4WET A;  1EEM A;  4TRX A;  4XRD A;  5AGY A;  2PVO C;  3BCK A;  5ECI B;  2KUC A;  2GDR A;  3LXZ A;  2LEG A;  3ZYW A;  4MCU A;  4KCE A;  3H4K A;  1O8X A;  3H1N A;  1J08 A;  4EF0 A;  1J9B A;  3GNJ A;  4LL1 B;  4TR1 B;  2A2S A;  4ULX A;  1EV4 A;  5DAK A;  4FYU A;  2H1A A;  1ABA A;  3C7M A;  1FOV A;  2ZCT A;  1LU4 A;  3APQ A;  3IXR A;  4HQS A;  3SBC A;  5J41 A;  4ZB9 A;  4BVX A;  2YWI A;  4Z7X A;  4NHZ A;  4IVF A;  3I43 A;  4ILF A;  4K8M A;  2PWJ A;  4IQA A;  1MD3 A;  4GLT A;  4DSR A;  3ZIJ A;  3IDV A;  1E6B A;  2I3Y A;  3HY2 A;  4GSS A;  4KSO A;  4OFT A;  3W8S A;  1ON4 A;  4LL4 B;  1MD4 A;  1PMT A;  4KDU A;  3G7Y A;  2NVL A;  4TVE A;  3EIN A;  1AUC A;  1PKW A;  1VF4 A;  5ECS A;  1IYH A;  2CZ3 A;  2MBS A;  2JAD A;  2HZF A;  2ON5 A;  1QMV A;  5D9T A;  1GNW A;  3VWX A;  1F9M A;  2RUF A;  4X0X A;  2V6O A;  1XXU A;  4HU7 A;  3D0Z A;  3DGQ A;  3VPQ A;  1EGR A;  2WGR A;  3GX0 A;  1T4Z A;  4EUY A;  1XWA A;  4EKZ A;  1URM A;  1X5C A;  4WBJ A;  2CVK A;  3MAK A;  3IAS 2;  3CBU A;  1ZL9 A;  2KP1 A;  2DJ0 A;  13GS A;  3D21 A;  1A8L A;  5FT3 A;  1EP8 A;  1WRY A;  4L5O A;  3LYP A;  4MJA A;  1RW1 A;  4ML6 A;  6GSW A;  2CV4 A;  2FA4 A;  4F0B A;  1F3A A;  1GWC A;  3DVW A;  3OR5 A;  1X5E A;  3GRX A;  4NPB A;  3CTF A;  4AF2 A;  3DKS A;  4HZ2 A;  2HSH A;  1PKZ A;  4WXT A;  1NSW A;  1UN2 A;  1XWC A;  1TOF A;  1AIU A;  2LJR A;  4CHS A;  4HDE A;  4ZBD A;  3K8N A;  3D22 A;  11GS A;  4GXZ A;  2TRX A;  3EUR A;  3IV4 A;  4K6X A;  1EOG A;  3ZLP A;  4TR1 A;  5DBQ A;  4F2I A;  3GYK A;  4K7I A;  2ZUP A;  5CRW A;  1I9D A;  3D6I A;  1T00 A;  1YDK A;  2IMI A;  8GSS A;  1OC3 A;  5AIS A;  4HJM A;  4G2E A;  1TRU A;  1SL1 B;  2GST A;  1V58 A;  1GTI A;  5E4W A;  1A2J A;  3MWH A;  5D93 A;  1GL8 A;  3KMO A;  2O89 A;  4MJB A;  1WWJ A;  1PN9 A;  2DJ3 A;  5IMV A;  2V41 A;  3M3M A;  10GS A;  4K0N A;  1XW6 A;  5DAL B;  4V1A g;  4YH2 A;  2IMK A;  5IOW A;  2YWN A;  4CDO A;  1IYI A;  3D5J A;  4KDX A;  1GUK A;  2IWT A;  1FHE A;  3I6A A;  4I6X A;  5G31 A;  2LKU A;  4XS4 B;  1DE1 A;  3LGC A;  3R2Q A;  5B6N A;  1MDJ A;  2OAC A;  3EC3 A;  5D9X A;  2RM5 A;  4IN0 A;  5ECK B;  2FUG 2;  5HR0 A;  4KW6 A;  2PGT A;  3EU4 A;  1XOA A;  4L0W A;  3F6F A;  2VOC A;  2OBK A;  1B8X A;  5JCU A;  1F37 A;  4ZL9 A;  3KH9 A;  1XCC A;  3KZQ A;  3S9F A;  1M2A A;  1SK0 A;  3M1G A;  2JL4 A;  3D4T A;  2VM2 A;  2B1K A;  3VFI A;  3HA9 A;  1QXH A;  1GLQ A;  1OC8 A;  6GSV A;  2DJ1 A;  1TW9 A;  1GSS A;  2DJ2 A;  2MYG A;  1YY7 A;  2C80 A;  2B5E A;  4HZ4 A;  3ZVJ D;  1EGO A;  1RQM A;  4K7N A;  5F0G A;  3I9V 2;  3FRC A;  3HJM A;  1G6Y A;  2PER A;  4RQR A;  4G10 A;  4X43 A;  2VCT A;  4XS6 A;  2V2G A;  3FYG A;  1MEK A;  1TTZ A;  1HQO A;  1K3Y A;  5J3R A;  4V1A p;  3ZRE A;  2I9H A;  4O92 A;  5GZZ B;  4XCS A;  2M80 A;  3TOU A;  2GTU A;  3GST A;  4J2F A;  3ZML A;  2OKA A;  4DSS B;  3QAV A;  3FZ4 A;  3IRA A;  3DVX A;  3UL3 A;  3DIE A;  3EWL A;  2YV7 A;  4TXO B;  3TJB A;  2GVP A;  2X8H A;  1F2E A;  4MJE A;  1SL0 B;  4LA1 A;  1C72 A;  3KGK A;  1GRX A;  1J0F A;  3M9K A;  1TP9 A;  2L6D A;  4YAV A;  5HFI A;  3E0U A;  3NIV A;  3IPZ A;  1XOB A;  4ECC A;  3WT1 A;  1SJ6 A;  3QD9 A;  3HXS A;  4DEJ A;  2XHF A;  2YNX A;  2L57 A;  1GTB A;  2MMO A;  4IGJ A;  3N5O A;  1T4Y A;  4IKH A;  2HLS A;  2H6X A;  4MJC A;  3PH9 A;  5DAL A;  2CZ2 A;  1PQN A;  2KLX A;  3FEU A;  2GT6 A;  2FNO A;  5HFG A;  1SK2 A;  4IJ3 A;  3KTB A;  2IL3 A;  2JZT A;  5CP1 A;  1GNE A;  3LXT A;  3P7X A;  2DIZ A;  4FO5 A;  3KXO A;  4XS4 A;  1O85 A;  2N5A A;  3P2A A;  2L5L A;  3GTU B;  4DVC A;  1QUW A;  2LV3 A;  4Q5F A;  4V2M A;  4K7O A;  3QR6 A;  4EL1 A;  1M0U A;  1X0R A;  4HS1 A;  4NV5 A;  4PNG A;  1XVQ A;  1TI3 A;  3G9B A;  5IOX A;  2K18 A;  3Q18 A;  2GZP A;  4ZIJ A;  4E8H A;  5IPG A;  1OE8 A;  5F07 A;  1OAZ A;  5KN3 A;  3C73 A;  3KD0 A;  2YP6 A;  1WOU A;  1AQW A;  2VL2 A;  2AB6 A;  2JU5 A;  5IMD A;  2KHP A;  2RUE A;  1HNA A;  4ECI A;  1DBY A;  1EEJ A;  4GQC A;  2HNL A;  4E8E A;  1B9X C;  2TIR A;  1KEB A;  1BQ7 A;  3GL5 A;  4BPY A;  1K3O A;  4CW9 A;  1Z9H A;  2H1D A;  4GRF A;  5F06 A;  4MZW A;  5HR2 A;  5IO2 A;  2VL3 A;  3GH9 A;  2K8V A;  4V2L A;  4DSS A;  3DWV A;  1SEN A;  5KN1 A;  5A4W A;  3E3E A;  1XIY A;  3LFL A;  1XW9 A;  2H30 A;  2VD1 A;  2B6M A;  3GKX A;  4MP4 A;  5G5E A;  1JZR A;  5HQP A;  4TXO A;  5DQS A;  3DXB A;  2JZR A;  3VI7 A;  3VWW A;  3F9U A;  3A2V A;  4RUV A;  1FVJ A;  4YQV A;  4F03 A;  2DMM A;  3BOA A;  3WT2 A;  2IJY A;  4LMV A;  2XPE A;  3HHV A;  5ENU A;  4MLY A;  5D9W A;  4QL9 A;  1VF1 A;  2VD0 A;  1Z7P A;  2YPM A;  3M9J A;  5KN2 A;  4J56 E;  5EL8 A;  3CSH A;  3Q19 A;  4I2T A;  5DDL A;  3LWA A;  1GSU A;  3HJP A;  3QOU A;  3EU3 A;  4OFM A;  3TB2 A;  1A23 A;  4MMM A;  1Z6M A;  4GSN A;  4AJ8 A;  5F05 A;  3TCO A;  2C0E A;  3GKN A;  2K8S A;  1I5G A;  4XTS A;  4WR5 A;  4JU5 A;  2WUL A;  1ZMA A;  2VCQ A;  3QAG A;  3CXG A;  3Q6O A;  5HR3 A;  2C3Q A;  1G7E A;  3TJK A;  3GTU A;  1EP7 A;  2N5F A;  1B48 A;  3O3T A;  2REM A;  2RLI A;  3IK9 A;  2H6Y A;  3TKS A;  2LRT A;  3TRP A;  3UJ1 A;  2GT5 A;  2WS2 A;  2H75 A;  3GX8 A;  1FW1 A;  2B3S A;  2B7J A;  4GQF A;  1GUL A;  3ZMK A;  2F9S A;  5J4U A;  5AN1 A;  2WZ9 A;  4ML1 A;  4I8B A;  5ECM B;  2DBC A;  3LEF A;  4TXV A;  2GZY A;  3IC4 A;  2HZE B;  2IMD A;  4N30 A;  3RAZ A;  3AY8 A;  6GSY A;  5FHI A;  1NW2 A;  4PQH A;  1OYJ A;  4L8E A;  3L4N A;  4NMU A;  3UBK A;  1FG4 A;  4OFN A;  1EWX A;  1M7T A;  3GKK A;  2L4Q A;  2QGV A;  3NOF A;  2LNS A;  1X9S B;  3F4R A;  4K9Z A;  3L9V A;  3KM6 A;  3ERF A;  1GLP A;  4KCA A;  5JCW A;  2IPA A;  3WGX A;  2R5G A;  1ZOF A;  3TJG A;  2OJL A;  1OKD A;  5H5S A;  1JHB A;  2VCV A;  2VL9 A;  1RK4 A;  3QFA C;  1H75 A;  1ZZY A;  3J7Y b;  1YKC A;  4D73 B;  6GSS A;  3QMX A;  2B1L A;  1DUG A;  1A2L A;  4WEY A;  3VWV A;  2H0I A;  2P31 A;  5JWQ B;  3P90 A;  1TK8 B;  2PU9 C;  2WJU A;  1GSY A;  3U6V A;  4J57 E;  3BBY A;  3TJF A;  4NXI A;  3GH6 A;  1SD8 A;  2P5R A;  5IMZ A;  5LNK e;  3IOS A;  2C3N A;  3PIN A;  5ECH B;  2O7K A;  2G0F A;  2H19 A;  3FY7 A;  5ELG A;  1TXX A;  2YWM A;  1W4V A;  3W8J A;  1O6J A;  4BWQ A;  2GGT A;  3QCP A;  4KX4 A;  2DLX A;  4MH2 A;  2C8U A;  5HFK A;  4PNF A;  3O6T A;  3KP9 A;  3LSZ A;  4KE3 A;  4TW5 A;  3BJ5 A;  4RI6 A;  1PD2 1;  2R3X A;  5HR1 A;  4PX1 A;  3G7I A;  2R37 A;  3KP8 A;  1ZYQ B;  2C4J A;  2IME A;  4MF7 A;  1G0T A;  3F0I A;  3F3Q A;  3F6D A;  2FWF A;  4POM A;  2FWH A;  4TKY A;  1HNB A;  2H73 A;  1VF3 A;  5A4V A;  4I2U A;  5ID2 B;  2H71 A;  3WD6 A;  1OVN A;  2Z9S A;  2OAD A;  3L0H A;  1A0R P;  2HZE A;  1O81 A;  3MNG A;  1XPV A;  1SKW B;  4JBB A;  5GAN D;  2OE1 A;  3HKR A;  1XWG A;  1U87 A;  2HSY A;  4JED A;  1ILO A;  2YAN A;  2HT9 A;  2GZZ A;  3C1R A;  4HJ2 A;  3ZTL A;  1GUH A;  2YJ7 A;  2O85 A;  1JLV A;  2YN1 A;  1TDI A;  1Z7R A;  4EO3 A;  3L78 A;  2H6Z A;  3FK8 A;  1XZO A;  2JSY A;  2P5Q A;  1FB6 A;  3FZ9 A;  2AHE A;  3DRN A;  3M0F A;  4OD7 A;  1GH2 A;  1O8W A;  1V98 A;  5DCH A;  2JZS A;  2E0Q A;  3HVS A;  4GWR A;  1Y6E A;  3KJY A;  4IEL A;  4OMV A;  1K0D A;  5CYY A;  4D73 A;  3O76 A;  1TK5 B;  1B9Y C;  2AUV A;  4FIW A;  2IMF A;  4Q5N A;  1JFU A;  4HI7 A;  2OE3 A;  5CO3 A;  2H70 A;  5KEJ A;  2C1Y A;  2IFQ B;  2IN3 A;  3RDW A;  3F8U A;  4EDY A;  1QFN A;  4GTU A;  3WGD A;  3H79 A;  4G9H A;  2KP2 A;  4KH7 A;  1GTU A;  4QL7 A;  1TU7 A;  2H66 A;  1UC7 A;  2NPB A;  2NDO A;  5A4U A;  4MF6 A;  1VRS D;  3DEX A;  1QQ2 A;  4KSM A;  2MMN A;  1GSQ A;  3HVV A;  3DML A;  1Z3E A;  3ME7 A;  3FHK A;  1AQV A;  2LNT A;  4TR3 A;  1T3B A;  1LJR A;  4ZBB A;  3UVT A;  3VUR A;  5CNW A;  4EE0 A;  5JCG A;  3US3 A;  4MA9 A;  2XBI A;  4MK3 A;  3GIX A;  1S3D A;  3FR6 A;  1M9B A;  5FWG A;  1QGV A;  1GSE A;  3LG6 A;  1Z6N A;  3RPN A;  4MZB A;  1SD9 A;  4KGI A;  4BA7 A;  4N11 A;  3ME8 A;  2WB9 A;  2NTO A;  2K9F A;  5ID2 A;  2HFD A;  3IE3 A;  2B7K A;  4ID0 A;  4WKW A;  2CVB A;  4XRA A;  2VAF A;  1QK8 A;  3D4M A;  1ST9 A;  1M99 A;  4MH3 A;  4Q5R A;  3HJO A;  5D9V A;  1DSB A;  4ZB8 A;  3CTG A;  2TRC P;  2K6V A;  3A2W A;  5IQY A;  3LJR A;  2VUP A;  5G1K A;  5J9C A;  2I81 A;  3PGT A;  1EOH A;  3KH7 A;  1G7O A;  1LBK A;  4MF5 A;  2VIM A;  4ISD A;  4JRR A;  5GST A;  1OE7 A;  3UOM A;  2OBI A;  1UVZ A;  2H0H A;  3PR8 A;  4IHU A;  5IIZ A;  4PQ1 A;  4PUR A;  2VCW A;  3F63 A;  2QC7 A;  1N2A A;  1JZW A;  4JE1 A;  2WFC A;  4HUA A;  4LLR A;  4RQX A;  4AGS A; 
#chains in the Genus database with same CATH topology
 3W6G A;  5G2Z A;  4TR4 A;  1GUM A;  3H8Q A;  5JWR B;  2NBS A;  2B5Y A;  1EV9 A;  1ERW A;  2OE0 A;  3FW2 A;  4V2N A;  5ECL B;  5J9B A;  1SJZ A;  2RM6 A;  2IFQ A;  3EE2 A;  3HDC A;  5D73 A;  4YQU A;  3HZ8 A;  4KAE A;  2HYX A;  4KB3 A;  5IPH A;  2FHE A;  1PA3 A;  2E2M A;  2E7P A;  2LJA A;  5ECP B;  4ZXG A;  1NHY A;  3UBL A;  4N0Z A;  3UAR A;  1USB A;  5F8B A;  1K0A A;  4LMW A;  4O32 A;  1SJI A;  4TOP A;  3IBH A;  3CSI A;  2GLR A;  2YCD A;  5FLX I;  1XW5 A;  2P0G A;  2FCH A;  1NHO A;  1OC9 B;  1X9W B;  1YEP A;  2R0P A;  5ECO B;  2QSI A;  1HNC A;  2A2R A;  2H76 A;  5DJM A;  2FWE A;  3H93 A;  2YJH A;  3IHG A;  2V1M A;  4O5R A;  1B4P A;  1T8E B;  3J7Y k;  3EYT A;  3ERW A;  3TRQ A;  3CRU A;  3F4T A;  2GQM A;  2RII A;  5DJL A;  2DSA A;  3GHA A;  2LUS A;  2D2Z A;  4X4J A;  4I5Q A;  5AIV A;  4TN8 A;  2EIQ A;  4OO4 A;  3V1W A;  5ABR A;  5IMA A;  2LS5 A;  3ISO A;  3GFK A;  3A5W A;  4FYB A;  1ML6 A;  5ECN B;  4RI7 A;  4Z2U A;  4F9Z A;  1ERV A;  1XG8 A;  1WE0 A;  4N0V A;  2FY6 A;  5KN0 A;  2PN8 A;  3VLN A;  3MDK A;  5DQY A;  2F51 A;  1YQ1 A;  2ALB A;  1XWK A;  3QPM A;  2PUK C;  5D8I A;  3UEM A;  1G6W A;  1AAZ A;  2GSS A;  5CRH A;  5J5N A;  3ZVJ A;  4YKF A;  2XC2 A;  1GSF A;  4MPG A;  4KF9 A;  4OCF A;  3EVI A;  2AV4 A;  3KCM A;  3RPP A;  4YKG A;  3UVH A;  1TRW A;  2VO4 A;  2H1B A;  2V6K A;  2L6C A;  2L59 A;  3I69 A;  2GS3 A;  2O8V B;  2QKE A;  4PQI A;  2YZH A;  2F3M A;  3IR4 A;  2LQQ A;  1NM3 A;  1F3B A;  3Q74 A;  1YEX A;  1FO5 A;  1S3A A;  3CMI A;  1XFL A;  3ZIT A;  5CRG A;  1JZO A;  2HRN A;  3TRX A;  3TKS C;  2M72 A;  3FZA A;  3U5R E;  3TJJ A;  3G7J A;  2CVD A;  5G30 A;  1B4Q A;  3FKF A;  5EVO A;  2EIR A;  2CAI A;  1TJD A;  3TOT A;  2FA8 A;  3RHB A;  4A5P A;  3C8E A;  3VWU A;  2WDU A;  4XHM A;  1JLW A;  4YAP A;  5BRT A;  4EXJ A;  1OC9 A;  5CAX A;  1ERU A;  4L5L A;  5B7C A;  1O73 A;  1ERT A;  2GQK A;  4HEA 2;  4BL7 B;  2YOI A;  4G19 A;  1XWB A;  3GA4 A;  1WPI A;  2MMZ A;  3A2X A;  4WF5 A;  3BD2 A;  2R2J A;  2M46 A;  1BYE A;  1THO A;  2UZ8 A;  4G0K A;  2A4H A;  1OKT A;  3HYP A;  5L71 A;  5D96 A;  1VF2 A;  2C0D A;  5C00 A;  5B8A A;  1ZCP A;  4DSQ A;  3HCZ A;  3CSJ A;  2MBT A;  1KNG A;  1W89 A;  2J9H A;  1SL2 B;  1YKA A;  4ACS A;  1KTE A;  5JWO B;  2HE3 A;  3GUR A;  1U3A A;  2CX3 A;  1PL2 A;  9GSS A;  1FAA A;  1TI1 A;  4WR4 A;  3ZRD A;  2AJQ B;  5G5F A;  4EC0 A;  1AQX A;  1GTA A;  1WMJ A;  2DJJ A;  2MMA A;  1K0O A;  4IJI A;  2CA8 A;  3TKQ A;  4YQM A;  1M3I A;  3RHC A;  3TKS E;  4MPF A;  3IK7 A;  4IS0 A;  2CAQ A;  3APO A;  3F4S A;  2LJK A;  4HU9 A;  2R0G A;  1F6M C;  5DCG A;  3M8N A;  2OA7 A;  4Q5Q A;  3L9S A;  2LQO A;  2ES7 A;  1O7U A;  1BX9 A;  2V32 A;  2F8F A;  5B8B A;  2GSQ A;  3E9J B;  1BED A;  1WP0 A;  3C1S A;  4ZBA A;  2FLS A;  4NAX A;  3UMA A;  1T1V A;  1SKS B;  2H01 A;  3VPT A;  1PL1 A;  4PUF C;  4KND A;  4ZB6 A;  1R26 A;  1BG5 A;  4O7H A;  2BMX A;  2VCX A;  4KUN A;  3P8W A;  3EMX A;  1EZK A;  1X5D A;  3CYN A;  2EC4 A;  3EMP A;  1U88 A;  1S3C A;  4K5R A;  5B6M A;  1VGL A;  4HQZ A;  2DJK A;  5EY6 A;  5GSS A;  2VLU A;  4PTS A;  4JZQ A;  4NHW A;  4P3Y B;  1TKD B;  5ECQ B;  4F82 A;  1BAY A;  1SU9 A;  3TKR A;  14GS A;  1Q4J A;  3TDG A;  3L9U A;  1HYU A;  2LRC A;  5A5K A;  1PRX A;  2AYT A;  3ED3 A;  2DML A;  1TK0 B;  3HZ4 A;  3KEB A;  4IW9 A;  1SYX A;  3C71 A;  1V57 A;  1ZGN A;  2H0G A;  1TRV A;  2I4A A;  3IA1 A;  2PBJ A;  1KBN A;  1U3I A;  3A5I A;  4BL7 A;  1MDI A;  2VLV A;  4IP6 A;  4WBR D;  3NZN A;  1H4O A;  1R4W A;  2CX4 A;  2PMT A;  5IM9 A;  5CRD A;  3GL3 A;  4WF4 A;  1R5A A;  4PXO A;  2L5O A;  5IMF A;  4JR4 A;  1U6T A;  5E59 A;  5KOW A;  4POL A;  2JSZ A;  1SKR B;  1Q98 A;  2I1U A;  4POB A;  1M2D A;  5GAP D;  3ZFL A;  1R7H A;  4ECB A;  3TKP A;  1MDK A;  2E2G A;  4EVM A;  3MIX A;  4QQ7 A;  7GSS A;  1ACV A;  2FGX A;  1A8Y A;  3FR3 A;  4EIP A;  2XPD A;  2JAC A;  2DC5 A;  4FH8 A;  3RBT A;  1DE2 A;  1SK1 A;  2MZC A;  2GSR A;  4NWY A;  1FVK A;  4FYC A;  3SWL A;  3UIW A;  4K5S A;  4TR0 A;  2X99 A;  1T7P B;  1N8J A;  2C3T A;  1XBS A;  2ON7 A;  1AXD A;  1JZD A;  2ZNM A;  1MTC A;  3IHQ A;  2F8A A;  3APS A;  3GN3 A;  4PGT A;  2J23 A;  4ECJ A;  1A24 A;  1THX A;  4IQ1 A;  3GKM A;  1YZX A;  3UAP A;  4JR6 A;  4I97 A;  1V40 A;  4NV2 A;  3IC8 A;  2A4V A;  3MSZ A;  5ELA A;  1UA5 A;  2LST A;  4MDC A;  2H8L A;  3QDN A;  1M9A A;  3HD5 A;  5ECR B;  3VK9 A;  6GSU A;  3WGE A;  5AIX A;  1Y25 A;  2VCZ A;  3ZL5 A;  2O87 A;  4ZL8 A;  3ZZX A;  3TGZ A;  1ZYP A;  2PPT A;  2YZU A;  4N10 A;  2WCI A;  1A0F A;  5IT9 I;  2HI7 A;  4BWS A;  2L4C A;  1SYR A;  2G2Q A;  5C04 A;  1E2Y A;  4L0U A;  1CQG A;  5DVB A;  4K1F A;  2X8G A;  5INY A;  2BTO T;  4MAB A;  1WJK A;  3A3T A;  2R6K A;  3GV1 A;  4GST A;  1AC1 A;  5CRE A;  4X1U A;  2N5B A;  1TU8 A;  2YV9 A;  1YF1 A;  3F3R A;  4KDY A;  1FB0 A;  3HVX A;  6GSX A;  5H5Q A;  3TUE A;  1XVW A;  3LQ7 A;  3IAM 2;  19GS A;  2AAW A;  3ZIV A;  2HXK A;  2R4V A;  1TRS A;  4K0G A;  1K0B A;  4Z2T A;  5COH A;  1PN0 A;  5DAK B;  1K0N A;  4BVY A;  1BJX A;  2FD3 A;  6GST A;  2CQ9 A;  4XIH A;  3R3E A;  2VM1 A;  4BVX B;  5LD0 A;  3KIJ A;  1V9W A;  3GUS A;  3GSS A;  5EPF A;  2EIO A;  3FR9 A;  17GS A;  3BCI A;  2H74 A;  1GSD A;  5KOX A;  3FZ5 A;  3N9J A;  3LOR A;  4K2D A;  4XS1 A;  2C0F A;  4O5Q A;  1YJ6 A;  1PFO A;  3DYR A;  1WIK A;  2LRN A;  4PUA A;  2VLT A;  3ERG A;  5IO0 A;  2CT6 A;  3KTL A;  2HRK A;  2PVQ A;  1CQH A;  1ZYE A;  2H1G A;  2LTK A;  4OCE A;  2IIY A;  2H72 A;  1PX7 A;  1PGT A;  18GS A;  4HOJ A;  2X8C A;  20GS A;  3LYK A;  1Z5Y E;  2VL2 C;  2BJX A;  3DD3 A;  3QFB C;  2XBQ A;  4IP1 A;  1HD2 A;  4OWY A;  4IBP A;  1PSQ A;  4OO5 A;  3QAW A;  4F0C A;  5IMC A;  2YWO A;  4GCI A;  22GS A;  2FWG A;  1YF0 A;  1K0C A;  1AW9 A;  3CRT A;  1PX6 A;  2B5X A;  4AJ6 A;  16GS A;  2X64 A;  1K0M A;  3KMN A;  5H5R A;  2X4A A;  2HRF A;  3JCM L;  4AJ7 A;  4ZIL A;  5G1L A;  4POK A;  3VI5 A;  3WYW A;  1V2A A;  4KA0 A;  1R5P A;  4ZL7 A;  3ZFB A;  4GF0 A;  1GP1 A;  2C0G A;  5LCZ A;  2WRT A;  1X9M B;  4EDZ A;  12GS A;  2KOK A;  3GMF A;  2GQL A;  4MZC A;  4H86 A;  1M2B A;  1K3L A;  1A2M A;  2DIY A;  4WET A;  1EEM A;  4TRX A;  4XRD A;  5AGY A;  2PVO C;  3BCK A;  5ECI B;  2KUC A;  2GDR A;  3LXZ A;  2LEG A;  3ZYW A;  4MCU A;  4KCE A;  3H4K A;  1O8X A;  3H1N A;  1J08 A;  4EF0 A;  1J9B A;  3GNJ A;  5BMU A;  4LL1 B;  4TR1 B;  2A2S A;  4ULX A;  1EV4 A;  5DAK A;  4FYU A;  2H1A A;  1ABA A;  3C7M A;  1FOV A;  2ZCT A;  1LU4 A;  3APQ A;  3IXR A;  4G0I A;  4HQS A;  3SBC A;  5J41 A;  4ZB9 A;  4BVX A;  2YWI A;  4Z7X A;  4NHZ A;  4IVF A;  3I43 A;  4ILF A;  4K8M A;  2PWJ A;  4IQA A;  1MD3 A;  4GLT A;  4DSR A;  3ZIJ A;  3IDV A;  4MNN A;  1E6B A;  2I3Y A;  3HY2 A;  4GSS A;  4KSO A;  4OFT A;  3W8S A;  1ON4 A;  4LL4 B;  1MD4 A;  1PMT A;  4KDU A;  3G7Y A;  2NVL A;  4TVE A;  3EIN A;  1AUC A;  1PKW A;  1VF4 A;  5ECS A;  1IYH A;  2CZ3 A;  2MBS A;  2JAD A;  2HZF A;  2ON5 A;  1QMV A;  5D9T A;  1GNW A;  3VWX A;  1F9M A;  2RUF A;  4X0X A;  2V6O A;  1XXU A;  4HU7 A;  3D0Z A;  3DGQ A;  3VPQ A;  1EGR A;  2WGR A;  3GX0 A;  1T4Z A;  4EUY A;  1XWA A;  4EKZ A;  1URM A;  1X5C A;  4WBJ A;  2CVK A;  3MAK A;  3IAS 2;  3CBU A;  1ZL9 A;  2KP1 A;  2DJ0 A;  13GS A;  3D21 A;  4USS A;  1A8L A;  5FT3 A;  1EP8 A;  1WRY A;  4BIK A;  4L5O A;  3LYP A;  4MJA A;  1RW1 A;  4ML6 A;  6GSW A;  2CV4 A;  3MYD A;  2FA4 A;  4F0B A;  1F3A A;  1GWC A;  3DVW A;  3OR5 A;  1X5E A;  3GRX A;  4NPB A;  3CTF A;  4AF2 A;  3DKS A;  4HZ2 A;  1M3J A;  2HSH A;  1PKZ A;  4WXT A;  1NSW A;  1UN2 A;  1XWC A;  1TOF A;  1AIU A;  2LJR A;  4CHS A;  4HDE A;  4ZBD A;  3K8N A;  3D22 A;  11GS A;  4GXZ A;  2TRX A;  3EUR A;  3IV4 A;  4K6X A;  1EOG A;  3ZLP A;  2QA2 A;  4TR1 A;  5DBQ A;  4F2I A;  3GYK A;  4K7I A;  2ZUP A;  5CRW A;  1I9D A;  3D6I A;  1T00 A;  1YDK A;  2IMI A;  8GSS A;  1OC3 A;  5AIS A;  4HJM A;  1S3R A;  4G2E A;  1TRU A;  1SL1 B;  2GST A;  1V58 A;  3LW9 A;  2QA1 A;  1GTI A;  5E4W A;  1A2J A;  3MWH A;  5D93 A;  1GL8 A;  3KMO A;  2O89 A;  4MJB A;  4CY6 A;  1WWJ A;  1PN9 A;  2DJ3 A;  5IMV A;  2V41 A;  3M3M A;  10GS A;  4K0N A;  1XW6 A;  5DAL B;  4V1A g;  4YH2 A;  2IMK A;  5IOW A;  2YWN A;  4CDO A;  1IYI A;  3D5J A;  4KDX A;  1GUK A;  2IWT A;  1FHE A;  3I6A A;  4I6X A;  5G31 A;  2LKU A;  4XS4 B;  1DE1 A;  3LGC A;  3R2Q A;  5B6N A;  1MDJ A;  2OAC A;  3EC3 A;  5D9X A;  2RM5 A;  4IN0 A;  4BVY B;  5ECK B;  2FUG 2;  5HR0 A;  4KW6 A;  2PGT A;  3EU4 A;  1XOA A;  4L0W A;  3F6F A;  2VOC A;  2OBK A;  1B8X A;  5JCU A;  2HSM A;  1F37 A;  4ZL9 A;  3KH9 A;  1XCC A;  3KZQ A;  3S9F A;  1M2A A;  1SK0 A;  3M1G A;  2JL4 A;  3D4T A;  3J80 I;  2VM2 A;  2B1K A;  3VFI A;  3HA9 A;  1QXH A;  1GLQ A;  1OC8 A;  6GSV A;  2DJ1 A;  1TW9 A;  1GSS A;  2DJ2 A;  3EPT A;  2MYG A;  1YY7 A;  2C80 A;  2B5E A;  4HZ4 A;  3ZVJ D;  1EGO A;  1RQM A;  4K7N A;  5F0G A;  3I9V 2;  3FRC A;  3HJM A;  1G6Y A;  2PER A;  4RQR A;  4G10 A;  4X43 A;  2VCT A;  4XS6 A;  2V2G A;  3FYG A;  1MEK A;  1TTZ A;  1HQO A;  1K3Y A;  5J3R A;  4V1A p;  3ZRE A;  2I9H A;  4O92 A;  5GZZ B;  4XCS A;  2M80 A;  3TOU A;  2GTU A;  3GST A;  4J2F A;  3ZML A;  2OKA A;  4DSS B;  3QAV A;  3FZ4 A;  3IRA A;  3DVX A;  3UL3 A;  3DIE A;  3EWL A;  2YV7 A;  4TXO B;  3TJB A;  2GVP A;  2X8H A;  1F2E A;  4MJE A;  1SL0 B;  4LA1 A;  1C72 A;  3KGK A;  1GRX A;  1J0F A;  3M9K A;  1TP9 A;  2L6D A;  4YAV A;  5HFI A;  3E0U A;  3NIV A;  3IPZ A;  1XOB A;  4ECC A;  3WT1 A;  1SJ6 A;  3QD9 A;  3HXS A;  4DEJ A;  2XHF A;  2YNX A;  2L57 A;  1GTB A;  2MMO A;  4IGJ A;  3N5O A;  1T4Y A;  4IKH A;  2HLS A;  2H6X A;  4MJC A;  3PH9 A;  5DAL A;  2CZ2 A;  1PQN A;  2KLX A;  2HRA A;  2GT6 A;  3FEU A;  2FNO A;  5HFG A;  1SK2 A;  4IJ3 A;  3KTB A;  2IL3 A;  2JZT A;  5CP1 A;  1GNE A;  3LXT A;  3P7X A;  2DIZ A;  4FO5 A;  3KXO A;  4XS4 A;  1O85 A;  2N5A A;  3P2A A;  2L5L A;  3GTU B;  4DVC A;  1QUW A;  2LV3 A;  4Q5F A;  4V2M A;  4K7O A;  3CQF A;  3QR6 A;  4EL1 A;  1M0U A;  1X0R A;  4HS1 A;  4NV5 A;  4PNG A;  1XVQ A;  1TI3 A;  3G9B A;  5IOX A;  2K18 A;  3Q18 A;  2GZP A;  4ZIJ A;  4E8H A;  5IPG A;  1OE8 A;  5F07 A;  1OAZ A;  5KN3 A;  3C73 A;  3KD0 A;  2YP6 A;  1WOU A;  1AQW A;  2VL2 A;  2AB6 A;  2JU5 A;  5IMD A;  2KHP A;  2RUE A;  3PPU A;  1HNA A;  4ECI A;  1DBY A;  1EEJ A;  4GQC A;  2HNL A;  4E8E A;  1B9X C;  2TIR A;  1KEB A;  1BQ7 A;  3GL5 A;  4BPY A;  1K3O A;  4CW9 A;  1Z9H A;  4G0L A;  2H1D A;  4GRF A;  5F06 A;  4MZW A;  5HR2 A;  5IO2 A;  2VL3 A;  3GH9 A;  2K8V A;  4V2L A;  4DSS A;  3DWV A;  1SEN A;  5KN1 A;  5A4W A;  3E3E A;  1XIY A;  3LFL A;  1XW9 A;  2H30 A;  2VD1 A;  2B6M A;  3GKX A;  4MP4 A;  5G5E A;  1JZR A;  5HQP A;  4TXO A;  5DQS A;  3DXB A;  2JZR A;  3VI7 A;  3VWW A;  3F9U A;  3A2V A;  4RUV A;  1FVJ A;  4YQV A;  4F03 A;  3HVN A;  2DMM A;  3BOA A;  3WT2 A;  2IJY A;  4LMV A;  2XPE A;  3HHV A;  5ENU A;  4MLY A;  5D9W A;  4QL9 A;  1VF1 A;  5A2Q I;  2VD0 A;  1Z7P A;  2YPM A;  3M9J A;  5KN2 A;  4J56 E;  3CSH A;  5EL8 A;  3Q19 A;  4I2T A;  5DDL A;  3LWA A;  1GSU A;  3HJP A;  3QOU A;  3EU3 A;  4OFM A;  3TB2 A;  1A23 A;  4MMM A;  1Z6M A;  4GSN A;  4AJ8 A;  5F05 A;  3TCO A;  2C0E A;  3GKN A;  2K8S A;  1I5G A;  4XTS A;  4WR5 A;  4JU5 A;  2WUL A;  1FOH A;  1ZMA A;  2VCQ A;  3QAG A;  3CXG A;  3Q6O A;  5HR3 A;  2C3Q A;  1G7E A;  3TJK A;  3GTU A;  1EP7 A;  2N5F A;  1B48 A;  3O3T A;  2REM A;  2RLI A;  3IK9 A;  2H6Y A;  3TKS A;  2LRT A;  3TRP A;  3UJ1 A;  2GT5 A;  2WS2 A;  2H75 A;  3GX8 A;  1FW1 A;  2B3S A;  2B7J A;  2A2P A;  4GQF A;  1GUL A;  3ZMK A;  2F9S A;  5J4U A;  5AN1 A;  2WZ9 A;  4ML1 A;  4I8B A;  5ECM B;  2DBC A;  3LEF A;  4TXV A;  2GZY A;  3IC4 A;  2HZE B;  2IMD A;  4N30 A;  3RAZ A;  3AY8 A;  2DKI A;  2R0C A;  6GSY A;  5FHI A;  4K2X A;  1NW2 A;  4PQH A;  1OYJ A;  4L8E A;  3L4N A;  4NMU A;  3UBK A;  1FG4 A;  4OFN A;  1EWX A;  1M7T A;  3GKK A;  2L4Q A;  4CY8 A;  2QGV A;  3NOF A;  2LNS A;  1X9S B;  3F4R A;  4K9Z A;  3L9V A;  3KM6 A;  3ERF A;  1GLP A;  4KCA A;  5JCW A;  2IPA A;  3WGX A;  2R5G A;  1ZOF A;  3JAM I;  3TJG A;  2OJL A;  1OKD A;  5H5S A;  1JHB A;  2VCV A;  2VL9 A;  1RK4 A;  3QFA C;  1H75 A;  1ZZY A;  3J7Y b;  1YKC A;  4D73 B;  6GSS A;  3QMX A;  2B1L A;  1DUG A;  1A2L A;  4WEY A;  3VWV A;  2X49 A;  2H0I A;  2P31 A;  5JWQ B;  3P90 A;  1TK8 B;  2PU9 C;  2WJU A;  1GSY A;  3U6V A;  4J57 E;  3BBY A;  3TJF A;  4NXI A;  3GH6 A;  1SD8 A;  2P5R A;  5IMZ A;  5LNK e;  3IOS A;  2C3N A;  3PIN A;  5ECH B;  2O7K A;  2G0F A;  5LL6 V;  2H19 A;  3FY7 A;  4Z2R A;  5ELG A;  1TXX A;  2YWM A;  1W4V A;  4HSC X;  3W8J A;  1O6J A;  4BWQ A;  2GGT A;  3QCP A;  4KX4 A;  2DLX A;  4MH2 A;  2C8U A;  5HFK A;  4PNF A;  3O6T A;  3KP9 A;  3LSZ A;  4KE3 A;  4TW5 A;  3BJ5 A;  4RI6 A;  1PD2 1;  2R3X A;  5HR1 A;  4PX1 A;  3G7I A;  2R37 A;  3KP8 A;  1ZYQ B;  2C4J A;  2IME A;  4MF7 A;  1G0T A;  3F0I A;  3F3Q A;  3F6D A;  2FWF A;  4POM A;  2FWH A;  4TKY A;  1HNB A;  2H73 A;  1VF3 A;  5A4V A;  4I2U A;  5ID2 B;  2H71 A;  3WD6 A;  1OVN A;  4O5U A;  2Z9S A;  2OAD A;  3L0H A;  1A0R P;  2HZE A;  1O81 A;  3MNG A;  1XPV A;  1SKW B;  4JBB A;  5GAN D;  2OE1 A;  3HKR A;  1XWG A;  1U87 A;  2HSY A;  4JED A;  1ILO A;  2YAN A;  2HT9 A;  2GZZ A;  3C1R A;  4HJ2 A;  3ZTL A;  1GUH A;  2YJ7 A;  4ICY A;  2O85 A;  1JLV A;  2YN1 A;  1TDI A;  1Z7R A;  4FQU A;  4EO3 A;  3L78 A;  2H6Z A;  2DKH A;  3FK8 A;  1XZO A;  2JSY A;  2P5Q A;  1FB6 A;  3FZ9 A;  2AHE A;  3DRN A;  3M0F A;  4OD7 A;  1GH2 A;  1O8W A;  1V98 A;  5DCH A;  2JZS A;  2E0Q A;  3HVS A;  4GWR A;  1Y6E A;  3KJY A;  4IEL A;  4OMV A;  1K0D A;  5CYY A;  4D73 A;  3O76 A;  1TK5 B;  1B9Y C;  2AUV A;  3FMW A;  4FIW A;  2IMF A;  4Q5N A;  1JFU A;  4HI7 A;  2OE3 A;  5CO3 A;  2H70 A;  5KEJ A;  2C1Y A;  2IFQ B;  2IN3 A;  3RDW A;  3F8U A;  4EDY A;  1QFN A;  4GTU A;  3WGD A;  3H79 A;  4G9H A;  2KP2 A;  4KH7 A;  1GTU A;  4QL7 A;  1TU7 A;  2H66 A;  1UC7 A;  2NPB A;  2NDO A;  5A4U A;  4MF6 A;  1VRS D;  3DEX A;  1QQ2 A;  4KSM A;  2MMN A;  1GSQ A;  3J81 I;  3HVV A;  3DML A;  1Z3E A;  3ME7 A;  4EIQ A;  3FHK A;  1AQV A;  2LNT A;  4TR3 A;  1T3B A;  1LJR A;  4ZBB A;  3UVT A;  3VUR A;  5CNW A;  4EE0 A;  5JCG A;  3US3 A;  4MA9 A;  2XBI A;  4MK3 A;  3GIX A;  1S3D A;  3FR6 A;  1M9B A;  5FWG A;  1QGV A;  1GSE A;  3LG6 A;  1Z6N A;  3RPN A;  4MZB A;  1SD9 A;  4KGI A;  4BA7 A;  4N11 A;  3ME8 A;  2WB9 A;  2NTO A;  2K9F A;  5ID2 A;  2HFD A;  3IE3 A;  2B7K A;  4ID0 A;  4WKW A;  2CVB A;  4XRA A;  2VAF A;  1QK8 A;  3D4M A;  1ST9 A;  1M99 A;  4MH3 A;  4Q5R A;  3HJO A;  5D9V A;  1DSB A;  4ZB8 A;  3CTG A;  2TRC P;  2K6V A;  3A2W A;  5IQY A;  3LJR A;  2VUP A;  5G1K A;  5J9C A;  2I81 A;  3PGT A;  1EOH A;  1ZYN A;  3KH7 A;  1G7O A;  1LBK A;  4MF5 A;  2VIM A;  4ISD A;  4JRR A;  5GST A;  1OE7 A;  3UOM A;  2OBI A;  1UVZ A;  2H0H A;  3PR8 A;  4IHU A;  5IIZ A;  4PQ1 A;  4PUR A;  2VCW A;  3F63 A;  2QC7 A;  1N2A A;  1JZW A;  4JE1 A;  2WFC A;  4HUA A;  4LLR A;  4RQX A;  4AGS A; 
#chains in the Genus database with same CATH homology
 3W6G A;  5G2Z A;  4TR4 A;  1GUM A;  3H8Q A;  5JWR B;  2NBS A;  2B5Y A;  1EV9 A;  1ERW A;  2OE0 A;  3FW2 A;  4V2N A;  5ECL B;  5J9B A;  1SJZ A;  2RM6 A;  2IFQ A;  3EE2 A;  3HDC A;  5D73 A;  4YQU A;  3HZ8 A;  4KAE A;  2HYX A;  4KB3 A;  5IPH A;  2FHE A;  1PA3 A;  2E2M A;  2E7P A;  2LJA A;  5ECP B;  4ZXG A;  1NHY A;  3UBL A;  4N0Z A;  3UAR A;  1USB A;  5F8B A;  1K0A A;  4LMW A;  4O32 A;  1SJI A;  4TOP A;  3IBH A;  3CSI A;  2GLR A;  2YCD A;  1XW5 A;  2P0G A;  2FCH A;  1NHO A;  1OC9 B;  1X9W B;  1YEP A;  2R0P A;  5ECO B;  2QSI A;  1HNC A;  2A2R A;  2H76 A;  5DJM A;  2FWE A;  3H93 A;  2YJH A;  3IHG A;  2V1M A;  4O5R A;  1B4P A;  1T8E B;  3J7Y k;  3EYT A;  3ERW A;  3TRQ A;  3CRU A;  3F4T A;  2GQM A;  2RII A;  5DJL A;  2DSA A;  3GHA A;  2LUS A;  2D2Z A;  4X4J A;  4I5Q A;  5AIV A;  4TN8 A;  2EIQ A;  4OO4 A;  3V1W A;  5ABR A;  5IMA A;  2LS5 A;  3ISO A;  3GFK A;  3A5W A;  4FYB A;  1ML6 A;  5ECN B;  4RI7 A;  4Z2U A;  4F9Z A;  1ERV A;  1WE0 A;  4N0V A;  2FY6 A;  5KN0 A;  2PN8 A;  3VLN A;  3MDK A;  5DQY A;  2F51 A;  1YQ1 A;  2ALB A;  1XWK A;  3QPM A;  2PUK C;  5D8I A;  3UEM A;  1G6W A;  1AAZ A;  2GSS A;  5CRH A;  5J5N A;  3ZVJ A;  4YKF A;  2XC2 A;  1GSF A;  4MPG A;  4KF9 A;  4OCF A;  3EVI A;  2AV4 A;  3KCM A;  3RPP A;  4YKG A;  3UVH A;  1TRW A;  2VO4 A;  2H1B A;  2V6K A;  2L6C A;  2L59 A;  3I69 A;  2GS3 A;  2O8V B;  2QKE A;  4PQI A;  2YZH A;  2F3M A;  3IR4 A;  2LQQ A;  1NM3 A;  1F3B A;  3Q74 A;  1YEX A;  1FO5 A;  1S3A A;  3CMI A;  1XFL A;  3ZIT A;  5CRG A;  1JZO A;  2HRN A;  3TRX A;  3TKS C;  2M72 A;  3FZA A;  3U5R E;  3TJJ A;  3G7J A;  2CVD A;  5G30 A;  1B4Q A;  3FKF A;  5EVO A;  2EIR A;  2CAI A;  1TJD A;  3TOT A;  2FA8 A;  3RHB A;  4A5P A;  3C8E A;  3VWU A;  2WDU A;  4XHM A;  1JLW A;  4YAP A;  5BRT A;  4EXJ A;  1OC9 A;  5CAX A;  1ERU A;  4L5L A;  5B7C A;  1O73 A;  1ERT A;  2GQK A;  4HEA 2;  4BL7 B;  2YOI A;  4G19 A;  1XWB A;  3GA4 A;  1WPI A;  2MMZ A;  3A2X A;  4WF5 A;  3BD2 A;  2R2J A;  2M46 A;  1BYE A;  1THO A;  2UZ8 A;  4G0K A;  2A4H A;  1OKT A;  3HYP A;  5L71 A;  5D96 A;  1VF2 A;  2C0D A;  5C00 A;  5B8A A;  1ZCP A;  4DSQ A;  3HCZ A;  3CSJ A;  2MBT A;  1KNG A;  1W89 A;  2J9H A;  1SL2 B;  1YKA A;  4ACS A;  1KTE A;  5JWO B;  2HE3 A;  3GUR A;  1U3A A;  2CX3 A;  1PL2 A;  9GSS A;  1FAA A;  1TI1 A;  4WR4 A;  3ZRD A;  2AJQ B;  5G5F A;  4EC0 A;  1AQX A;  1GTA A;  1WMJ A;  2DJJ A;  2MMA A;  1K0O A;  4IJI A;  2CA8 A;  3TKQ A;  4YQM A;  3RHC A;  3TKS E;  4MPF A;  3IK7 A;  4IS0 A;  2CAQ A;  3APO A;  3F4S A;  2LJK A;  4HU9 A;  2R0G A;  1F6M C;  5DCG A;  3M8N A;  2OA7 A;  4Q5Q A;  3L9S A;  2LQO A;  2ES7 A;  1O7U A;  1BX9 A;  2V32 A;  2F8F A;  5B8B A;  2GSQ A;  3E9J B;  1BED A;  1WP0 A;  3C1S A;  4ZBA A;  2FLS A;  4NAX A;  3UMA A;  1T1V A;  1SKS B;  2H01 A;  3VPT A;  1PL1 A;  4PUF C;  4KND A;  4ZB6 A;  1R26 A;  1BG5 A;  4O7H A;  2BMX A;  2VCX A;  4KUN A;  3P8W A;  3EMX A;  1EZK A;  1X5D A;  3CYN A;  2EC4 A;  3EMP A;  1U88 A;  1S3C A;  4K5R A;  5B6M A;  1VGL A;  4HQZ A;  2DJK A;  5EY6 A;  5GSS A;  2VLU A;  4PTS A;  4JZQ A;  4NHW A;  4P3Y B;  1TKD B;  5ECQ B;  4F82 A;  1BAY A;  1SU9 A;  3TKR A;  14GS A;  1Q4J A;  3TDG A;  3L9U A;  1HYU A;  2LRC A;  5A5K A;  1PRX A;  2AYT A;  3ED3 A;  2DML A;  1TK0 B;  3HZ4 A;  3KEB A;  4IW9 A;  1SYX A;  3C71 A;  1V57 A;  1ZGN A;  2H0G A;  1TRV A;  2I4A A;  3IA1 A;  2PBJ A;  1KBN A;  1U3I A;  3A5I A;  4BL7 A;  1MDI A;  2VLV A;  4IP6 A;  4WBR D;  3NZN A;  1H4O A;  1R4W A;  2CX4 A;  2PMT A;  5IM9 A;  5CRD A;  3GL3 A;  4WF4 A;  1R5A A;  4PXO A;  2L5O A;  5IMF A;  4JR4 A;  1U6T A;  5E59 A;  5KOW A;  4POL A;  2JSZ A;  1SKR B;  1Q98 A;  2I1U A;  4POB A;  1M2D A;  5GAP D;  3ZFL A;  1R7H A;  4ECB A;  3TKP A;  1MDK A;  2E2G A;  4EVM A;  3MIX A;  4QQ7 A;  7GSS A;  1ACV A;  2FGX A;  1A8Y A;  3FR3 A;  4EIP A;  2XPD A;  2JAC A;  2DC5 A;  4FH8 A;  3RBT A;  1DE2 A;  1SK1 A;  2MZC A;  2GSR A;  4NWY A;  1FVK A;  4FYC A;  3SWL A;  3UIW A;  4K5S A;  4TR0 A;  2X99 A;  1T7P B;  1N8J A;  2C3T A;  1XBS A;  2ON7 A;  1AXD A;  1JZD A;  2ZNM A;  1MTC A;  3IHQ A;  2F8A A;  3APS A;  3GN3 A;  4PGT A;  2J23 A;  4ECJ A;  1A24 A;  1THX A;  4IQ1 A;  3GKM A;  1YZX A;  3UAP A;  4JR6 A;  4I97 A;  1V40 A;  4NV2 A;  3IC8 A;  2A4V A;  3MSZ A;  5ELA A;  1UA5 A;  2LST A;  4MDC A;  2H8L A;  3QDN A;  1M9A A;  3HD5 A;  5ECR B;  3VK9 A;  6GSU A;  3WGE A;  5AIX A;  1Y25 A;  2VCZ A;  3ZL5 A;  2O87 A;  4ZL8 A;  3ZZX A;  3TGZ A;  1ZYP A;  2PPT A;  2YZU A;  4N10 A;  2WCI A;  1A0F A;  2HI7 A;  4BWS A;  2L4C A;  1SYR A;  2G2Q A;  5C04 A;  1E2Y A;  4L0U A;  1CQG A;  5DVB A;  4K1F A;  2X8G A;  5INY A;  2BTO T;  4MAB A;  1WJK A;  3A3T A;  2R6K A;  3GV1 A;  4GST A;  1AC1 A;  5CRE A;  4X1U A;  2N5B A;  1TU8 A;  2YV9 A;  1YF1 A;  3F3R A;  4KDY A;  1FB0 A;  3HVX A;  6GSX A;  5H5Q A;  3TUE A;  1XVW A;  3LQ7 A;  3IAM 2;  19GS A;  2AAW A;  3ZIV A;  2HXK A;  2R4V A;  1TRS A;  4K0G A;  1K0B A;  4Z2T A;  5COH A;  1PN0 A;  5DAK B;  1K0N A;  4BVY A;  1BJX A;  2FD3 A;  6GST A;  2CQ9 A;  4XIH A;  3R3E A;  2VM1 A;  4BVX B;  5LD0 A;  3KIJ A;  1V9W A;  3GUS A;  3GSS A;  5EPF A;  2EIO A;  3FR9 A;  17GS A;  3BCI A;  2H74 A;  1GSD A;  5KOX A;  3FZ5 A;  3N9J A;  3LOR A;  4K2D A;  4XS1 A;  2C0F A;  4O5Q A;  1YJ6 A;  3DYR A;  1WIK A;  2LRN A;  4PUA A;  2VLT A;  3ERG A;  5IO0 A;  2CT6 A;  3KTL A;  2HRK A;  2PVQ A;  1CQH A;  1ZYE A;  2H1G A;  2LTK A;  4OCE A;  2IIY A;  2H72 A;  1PX7 A;  1PGT A;  18GS A;  4HOJ A;  2X8C A;  20GS A;  3LYK A;  1Z5Y E;  2VL2 C;  2BJX A;  3DD3 A;  3QFB C;  2XBQ A;  4IP1 A;  1HD2 A;  4OWY A;  4IBP A;  1PSQ A;  4OO5 A;  3QAW A;  4F0C A;  5IMC A;  2YWO A;  4GCI A;  22GS A;  2FWG A;  1YF0 A;  1K0C A;  1AW9 A;  3CRT A;  1PX6 A;  2B5X A;  4AJ6 A;  16GS A;  2X64 A;  1K0M A;  3KMN A;  5H5R A;  2X4A A;  2HRF A;  3JCM L;  4AJ7 A;  4ZIL A;  5G1L A;  4POK A;  3VI5 A;  3WYW A;  1V2A A;  4KA0 A;  1R5P A;  4ZL7 A;  3ZFB A;  4GF0 A;  1GP1 A;  2C0G A;  5LCZ A;  2WRT A;  1X9M B;  4EDZ A;  12GS A;  2KOK A;  3GMF A;  2GQL A;  4MZC A;  4H86 A;  1M2B A;  1K3L A;  1A2M A;  2DIY A;  4WET A;  1EEM A;  4TRX A;  4XRD A;  5AGY A;  2PVO C;  3BCK A;  5ECI B;  2KUC A;  2GDR A;  3LXZ A;  2LEG A;  3ZYW A;  4MCU A;  4KCE A;  3H4K A;  1O8X A;  3H1N A;  1J08 A;  4EF0 A;  1J9B A;  3GNJ A;  5BMU A;  4LL1 B;  4TR1 B;  2A2S A;  4ULX A;  1EV4 A;  5DAK A;  4FYU A;  2H1A A;  1ABA A;  3C7M A;  1FOV A;  2ZCT A;  1LU4 A;  3APQ A;  3IXR A;  4G0I A;  4HQS A;  3SBC A;  5J41 A;  4ZB9 A;  4BVX A;  2YWI A;  4Z7X A;  4NHZ A;  4IVF A;  3I43 A;  4ILF A;  4K8M A;  2PWJ A;  4IQA A;  1MD3 A;  4GLT A;  4DSR A;  3ZIJ A;  3IDV A;  4MNN A;  1E6B A;  2I3Y A;  3HY2 A;  4GSS A;  4KSO A;  4OFT A;  3W8S A;  1ON4 A;  4LL4 B;  1MD4 A;  1PMT A;  4KDU A;  3G7Y A;  2NVL A;  4TVE A;  3EIN A;  1AUC A;  1PKW A;  1VF4 A;  5ECS A;  1IYH A;  2CZ3 A;  2MBS A;  2JAD A;  2HZF A;  2ON5 A;  1QMV A;  5D9T A;  1GNW A;  3VWX A;  1F9M A;  2RUF A;  4X0X A;  2V6O A;  1XXU A;  4HU7 A;  3D0Z A;  3DGQ A;  3VPQ A;  1EGR A;  2WGR A;  3GX0 A;  1T4Z A;  4EUY A;  1XWA A;  4EKZ A;  1URM A;  1X5C A;  4WBJ A;  2CVK A;  3MAK A;  3IAS 2;  3CBU A;  1ZL9 A;  2KP1 A;  2DJ0 A;  13GS A;  3D21 A;  4USS A;  1A8L A;  5FT3 A;  1EP8 A;  1WRY A;  4L5O A;  3LYP A;  4MJA A;  1RW1 A;  4ML6 A;  6GSW A;  2CV4 A;  3MYD A;  2FA4 A;  4F0B A;  1F3A A;  1GWC A;  3DVW A;  3OR5 A;  1X5E A;  3GRX A;  4NPB A;  3CTF A;  4AF2 A;  3DKS A;  4HZ2 A;  2HSH A;  1PKZ A;  4WXT A;  1NSW A;  1UN2 A;  1XWC A;  1TOF A;  1AIU A;  2LJR A;  4CHS A;  4HDE A;  4ZBD A;  3K8N A;  3D22 A;  11GS A;  4GXZ A;  2TRX A;  3EUR A;  3IV4 A;  4K6X A;  1EOG A;  3ZLP A;  2QA2 A;  4TR1 A;  5DBQ A;  4F2I A;  3GYK A;  4K7I A;  2ZUP A;  5CRW A;  1I9D A;  3D6I A;  1T00 A;  1YDK A;  2IMI A;  8GSS A;  1OC3 A;  5AIS A;  4HJM A;  4G2E A;  1TRU A;  1SL1 B;  2GST A;  1V58 A;  3LW9 A;  2QA1 A;  1GTI A;  5E4W A;  1A2J A;  3MWH A;  5D93 A;  1GL8 A;  3KMO A;  2O89 A;  4MJB A;  4CY6 A;  1WWJ A;  1PN9 A;  2DJ3 A;  5IMV A;  2V41 A;  3M3M A;  10GS A;  4K0N A;  1XW6 A;  5DAL B;  4V1A g;  4YH2 A;  2IMK A;  5IOW A;  2YWN A;  4CDO A;  1IYI A;  3D5J A;  4KDX A;  1GUK A;  2IWT A;  1FHE A;  3I6A A;  4I6X A;  5G31 A;  2LKU A;  4XS4 B;  1DE1 A;  3LGC A;  3R2Q A;  5B6N A;  1MDJ A;  2OAC A;  3EC3 A;  5D9X A;  2RM5 A;  4IN0 A;  4BVY B;  5ECK B;  2FUG 2;  5HR0 A;  4KW6 A;  2PGT A;  3EU4 A;  1XOA A;  4L0W A;  3F6F A;  2VOC A;  2OBK A;  1B8X A;  5JCU A;  2HSM A;  1F37 A;  4ZL9 A;  3KH9 A;  1XCC A;  3KZQ A;  3S9F A;  1M2A A;  1SK0 A;  3M1G A;  2JL4 A;  3D4T A;  2VM2 A;  2B1K A;  3VFI A;  3HA9 A;  1QXH A;  1GLQ A;  1OC8 A;  6GSV A;  2DJ1 A;  1TW9 A;  1GSS A;  2DJ2 A;  3EPT A;  2MYG A;  1YY7 A;  2C80 A;  2B5E A;  4HZ4 A;  3ZVJ D;  1EGO A;  1RQM A;  4K7N A;  5F0G A;  3I9V 2;  3FRC A;  3HJM A;  1G6Y A;  2PER A;  4RQR A;  4G10 A;  4X43 A;  2VCT A;  4XS6 A;  2V2G A;  3FYG A;  1MEK A;  1TTZ A;  1HQO A;  1K3Y A;  5J3R A;  4V1A p;  3ZRE A;  2I9H A;  4O92 A;  5GZZ B;  4XCS A;  2M80 A;  3TOU A;  2GTU A;  3GST A;  4J2F A;  3ZML A;  2OKA A;  4DSS B;  3QAV A;  3FZ4 A;  3IRA A;  3DVX A;  3UL3 A;  3DIE A;  3EWL A;  2YV7 A;  4TXO B;  3TJB A;  2GVP A;  2X8H A;  1F2E A;  4MJE A;  1SL0 B;  4LA1 A;  1C72 A;  3KGK A;  1GRX A;  1J0F A;  3M9K A;  1TP9 A;  2L6D A;  4YAV A;  5HFI A;  3E0U A;  3NIV A;  3IPZ A;  1XOB A;  4ECC A;  3WT1 A;  1SJ6 A;  3QD9 A;  3HXS A;  4DEJ A;  2XHF A;  2YNX A;  2L57 A;  1GTB A;  2MMO A;  4IGJ A;  3N5O A;  1T4Y A;  4IKH A;  2HLS A;  2H6X A;  4MJC A;  3PH9 A;  5DAL A;  2CZ2 A;  1PQN A;  2KLX A;  2HRA A;  2GT6 A;  3FEU A;  2FNO A;  5HFG A;  1SK2 A;  4IJ3 A;  3KTB A;  2IL3 A;  2JZT A;  5CP1 A;  1GNE A;  3LXT A;  3P7X A;  2DIZ A;  4FO5 A;  3KXO A;  4XS4 A;  1O85 A;  2N5A A;  3P2A A;  2L5L A;  3GTU B;  4DVC A;  1QUW A;  2LV3 A;  4Q5F A;  4V2M A;  4K7O A;  3QR6 A;  4EL1 A;  1M0U A;  1X0R A;  4HS1 A;  4NV5 A;  4PNG A;  1XVQ A;  1TI3 A;  3G9B A;  5IOX A;  2K18 A;  3Q18 A;  2GZP A;  4ZIJ A;  4E8H A;  5IPG A;  1OE8 A;  5F07 A;  1OAZ A;  5KN3 A;  3C73 A;  3KD0 A;  2YP6 A;  1WOU A;  1AQW A;  2VL2 A;  2AB6 A;  2JU5 A;  5IMD A;  2KHP A;  2RUE A;  3PPU A;  1HNA A;  4ECI A;  1DBY A;  1EEJ A;  4GQC A;  2HNL A;  4E8E A;  1B9X C;  2TIR A;  1KEB A;  1BQ7 A;  3GL5 A;  4BPY A;  1K3O A;  4CW9 A;  1Z9H A;  4G0L A;  2H1D A;  4GRF A;  5F06 A;  4MZW A;  5HR2 A;  5IO2 A;  2VL3 A;  3GH9 A;  2K8V A;  4V2L A;  4DSS A;  3DWV A;  1SEN A;  5KN1 A;  5A4W A;  3E3E A;  1XIY A;  3LFL A;  1XW9 A;  2H30 A;  2VD1 A;  2B6M A;  3GKX A;  4MP4 A;  5G5E A;  1JZR A;  5HQP A;  4TXO A;  5DQS A;  3DXB A;  2JZR A;  3VI7 A;  3VWW A;  3F9U A;  3A2V A;  4RUV A;  1FVJ A;  4YQV A;  4F03 A;  2DMM A;  3BOA A;  3WT2 A;  2IJY A;  4LMV A;  2XPE A;  3HHV A;  5ENU A;  4MLY A;  5D9W A;  4QL9 A;  1VF1 A;  2VD0 A;  1Z7P A;  2YPM A;  3M9J A;  5KN2 A;  4J56 E;  3CSH A;  5EL8 A;  3Q19 A;  4I2T A;  5DDL A;  3LWA A;  1GSU A;  3HJP A;  3QOU A;  3EU3 A;  4OFM A;  3TB2 A;  1A23 A;  4MMM A;  1Z6M A;  4GSN A;  4AJ8 A;  5F05 A;  3TCO A;  2C0E A;  3GKN A;  2K8S A;  1I5G A;  4XTS A;  4WR5 A;  4JU5 A;  2WUL A;  1FOH A;  1ZMA A;  2VCQ A;  3QAG A;  3CXG A;  3Q6O A;  5HR3 A;  2C3Q A;  1G7E A;  3TJK A;  3GTU A;  1EP7 A;  2N5F A;  1B48 A;  3O3T A;  2REM A;  2RLI A;  3IK9 A;  2H6Y A;  3TKS A;  2LRT A;  3TRP A;  3UJ1 A;  2GT5 A;  2WS2 A;  2H75 A;  3GX8 A;  1FW1 A;  2B3S A;  2B7J A;  2A2P A;  4GQF A;  1GUL A;  3ZMK A;  2F9S A;  5J4U A;  5AN1 A;  2WZ9 A;  4ML1 A;  4I8B A;  5ECM B;  2DBC A;  3LEF A;  4TXV A;  2GZY A;  3IC4 A;  2HZE B;  2IMD A;  4N30 A;  3RAZ A;  3AY8 A;  2DKI A;  2R0C A;  6GSY A;  5FHI A;  4K2X A;  1NW2 A;  4PQH A;  1OYJ A;  4L8E A;  3L4N A;  4NMU A;  3UBK A;  1FG4 A;  4OFN A;  1EWX A;  1M7T A;  3GKK A;  2L4Q A;  4CY8 A;  2QGV A;  3NOF A;  2LNS A;  1X9S B;  3F4R A;  4K9Z A;  3L9V A;  3KM6 A;  3ERF A;  1GLP A;  4KCA A;  5JCW A;  2IPA A;  3WGX A;  2R5G A;  1ZOF A;  3TJG A;  2OJL A;  1OKD A;  5H5S A;  1JHB A;  2VCV A;  2VL9 A;  1RK4 A;  3QFA C;  1H75 A;  1ZZY A;  3J7Y b;  1YKC A;  4D73 B;  6GSS A;  3QMX A;  2B1L A;  1DUG A;  1A2L A;  4WEY A;  3VWV A;  2X49 A;  2H0I A;  2P31 A;  5JWQ B;  3P90 A;  1TK8 B;  2PU9 C;  2WJU A;  1GSY A;  3U6V A;  4J57 E;  3BBY A;  3TJF A;  4NXI A;  3GH6 A;  1SD8 A;  2P5R A;  5IMZ A;  5LNK e;  3IOS A;  2C3N A;  3PIN A;  5ECH B;  2O7K A;  2G0F A;  2H19 A;  3FY7 A;  4Z2R A;  5ELG A;  1TXX A;  2YWM A;  1W4V A;  3W8J A;  1O6J A;  4BWQ A;  2GGT A;  3QCP A;  4KX4 A;  2DLX A;  4MH2 A;  2C8U A;  5HFK A;  4PNF A;  3O6T A;  3KP9 A;  3LSZ A;  4KE3 A;  4TW5 A;  3BJ5 A;  4RI6 A;  1PD2 1;  2R3X A;  5HR1 A;  4PX1 A;  3G7I A;  2R37 A;  3KP8 A;  1ZYQ B;  2C4J A;  2IME A;  4MF7 A;  1G0T A;  3F0I A;  3F3Q A;  3F6D A;  2FWF A;  4POM A;  2FWH A;  4TKY A;  1HNB A;  2H73 A;  1VF3 A;  5A4V A;  4I2U A;  5ID2 B;  2H71 A;  3WD6 A;  1OVN A;  4O5U A;  2Z9S A;  2OAD A;  3L0H A;  1A0R P;  2HZE A;  1O81 A;  3MNG A;  1XPV A;  1SKW B;  4JBB A;  5GAN D;  2OE1 A;  3HKR A;  1XWG A;  1U87 A;  2HSY A;  4JED A;  1ILO A;  2YAN A;  2HT9 A;  2GZZ A;  3C1R A;  4HJ2 A;  3ZTL A;  1GUH A;  2YJ7 A;  4ICY A;  2O85 A;  1JLV A;  2YN1 A;  1TDI A;  1Z7R A;  4FQU A;  4EO3 A;  3L78 A;  2H6Z A;  2DKH A;  3FK8 A;  1XZO A;  2JSY A;  2P5Q A;  1FB6 A;  3FZ9 A;  2AHE A;  3DRN A;  3M0F A;  4OD7 A;  1GH2 A;  1O8W A;  1V98 A;  5DCH A;  2JZS A;  2E0Q A;  3HVS A;  4GWR A;  1Y6E A;  3KJY A;  4IEL A;  4OMV A;  1K0D A;  5CYY A;  4D73 A;  3O76 A;  1TK5 B;  1B9Y C;  2AUV A;  3FMW A;  4FIW A;  2IMF A;  4Q5N A;  1JFU A;  4HI7 A;  2OE3 A;  5CO3 A;  2H70 A;  5KEJ A;  2C1Y A;  2IFQ B;  2IN3 A;  3RDW A;  3F8U A;  4EDY A;  1QFN A;  4GTU A;  3WGD A;  3H79 A;  4G9H A;  2KP2 A;  4KH7 A;  1GTU A;  4QL7 A;  1TU7 A;  2H66 A;  1UC7 A;  2NPB A;  2NDO A;  5A4U A;  4MF6 A;  1VRS D;  3DEX A;  1QQ2 A;  4KSM A;  2MMN A;  1GSQ A;  3HVV A;  3DML A;  1Z3E A;  3ME7 A;  4EIQ A;  3FHK A;  1AQV A;  2LNT A;  4TR3 A;  1T3B A;  1LJR A;  4ZBB A;  3UVT A;  3VUR A;  5CNW A;  4EE0 A;  5JCG A;  3US3 A;  4MA9 A;  2XBI A;  4MK3 A;  3GIX A;  1S3D A;  3FR6 A;  1M9B A;  5FWG A;  1QGV A;  1GSE A;  3LG6 A;  1Z6N A;  3RPN A;  4MZB A;  1SD9 A;  4KGI A;  4BA7 A;  4N11 A;  3ME8 A;  2WB9 A;  2NTO A;  2K9F A;  5ID2 A;  2HFD A;  3IE3 A;  2B7K A;  4ID0 A;  4WKW A;  2CVB A;  4XRA A;  2VAF A;  1QK8 A;  3D4M A;  1ST9 A;  1M99 A;  4MH3 A;  4Q5R A;  3HJO A;  5D9V A;  1DSB A;  4ZB8 A;  3CTG A;  2TRC P;  2K6V A;  3A2W A;  5IQY A;  3LJR A;  2VUP A;  5G1K A;  5J9C A;  2I81 A;  3PGT A;  1EOH A;  1ZYN A;  3KH7 A;  1G7O A;  1LBK A;  4MF5 A;  2VIM A;  4ISD A;  4JRR A;  5GST A;  1OE7 A;  3UOM A;  2OBI A;  1UVZ A;  2H0H A;  3PR8 A;  4IHU A;  5IIZ A;  4PQ1 A;  4PUR A;  2VCW A;  3F63 A;  2QC7 A;  1N2A A;  1JZW A;  4JE1 A;  2WFC A;  4HUA A;  4LLR A;  4RQX A;  4AGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...