1A0RP

Heterotrimeric complex of phosducin/transducin beta-gamma
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
218
structure length
188
Chain Sequence
FEGQASHTGPKGVINDWRKFKLESEFSRKMSVQEYELIHKDKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELESGEQFLETIEKEQKITTIVVHIYEDGIKGCDALNSSLICLAAEYPMVKFCKIKASNTGAGDRFSSDVLPTLLVYKGGELLSNFISVTEQLAEEFFTGDVESFLNEYGLLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSDUCIN (BETA SUBUNIT)
publication title Phosducin induces a structural change in transducin beta gamma.
pubmed doi rcsb
molecule tags Complex (transducer/transduction)
total genus 56
structure length 188
sequence length 218
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF02114 Phosducin Phosducin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.168.10 Mainly Alpha Orthogonal Bundle Phosducin; domain 2 Phosducin, domain 2 1a0rP02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a0rP01
2GVPA 2IL3A 1AQVA 1RW1A 4NMUA 4GSTA 2H71A 5HR3A 1GTIA 2L5LA 1XWGA 4MZBA 1K0CA 1GSQA 2M80A 2ES7A 2TRXA 4WXTA 2YV7A 13GSA 2J23A 3H79A 1J08A 4G10A 4F2IA 4TR4A 3QR6A 5KN3A 4ILFA 2VAFA 2IMKA 5IOWA 2ZNMA 3N5OA 4XRAA 5F05A 1TRWA 2OKAA 3J7Yb 4Q5RA 2HFDA 3UIWA 4MH2A 3TKPA 5ECQB 1N8JA 1PMTA 4K0GA 4ZB6A 1Z6MA 3ZMKA 1ILOA 3MSZA 2V6KA 3IV4A 3K8NA 4GF0A 5DCGA 2MMZA 4MP4A 2HSYA 1H4OA 1G6WA 3EWLA 1YKCA 4TXOB 5ECSA 4XHMA 2YJ7A 3TKRA 5C00A 5H5SA 1DSBA 5F8BA 3CSHA 2YNXA 2WZ9A 4TOPA 5ECLB 1HQOA 2HXKA 3FW2A 1FB6A 3CTGA 3GNJA 4PQHA 20GSA 2B1LA 1K0BA 2HE3A 1LU4A 1NM3A 4ML6A 5EVOA 3GA4A 3EMPA 1TRUA 4DEJA 3CSIA 2HSHA 2ON5A 3KM6A 3GRXA 3HYPA 3CXGA 2JU5A 2WCIA 3ERFA 4IKHA 1MD3A 1G6YA 4N0ZA 2TIRA 1G7EA 2H1AA 2GT5A 1V58A 5ECMB 1R26A 4L0UA 4WEYA 2DJKA 2QC7A 3JCML 2B6MA 1AXDA 2LEGA 2XHFA 2Z9SA 1ML6A 4JU5A 4V2MA 4ZBAA 4ECBA 1EV9A 3GMFA 3O3TA 3GTUA 3QPMA 5B6NA 2HI7A 2PUKC 3UVHA 4N30A 1HNBA 2L57A 3UL3A 1Z3EA 2LQOA 3F4TA 2I9HA 4OFNA 5CNWA 3UBKA 2R6KA 3GSTA 1CQHA 5JWOB 1A23A 4XIHA 5E59A 5IPHA 1FHEA 2X8GA 2VOCA 3LQ7A 2LS5A 1TP9A 5DJMA 1GUMA 1K0AA 2VM1A 1YF1A 3PINA 4MF5A 3KTLA 4F82A 2WULA 2C0DA 4O5RA 4MPGA 4FO5A 3KP8A 1PN9A 3TRQA 1TI3A 2EC4A 4DSRA 2HRNA 5D8IA 2RM6A 3F3QA 4GCIA 3G7IA 5D9XA 4MJCA 5HQPA 4V1Ap 4PQIA 3TRXA 3WYWA 2ON7A 3ISOA 1GULA 1R7HA 2E0QA 3ERWA 3HJMA 1NSWA 3ERGA 1THXA 3C8EA 1PRXA 4PUFC 2NBSA 1XWKA 3TRPA 3ZREA 3TKSE 3TJBA 2RUFA 4I5QA 5CRDA 3IE3A 1GTBA 3L78A 2FA8A 4KSMA 2CVKA 3I69A 1AW9A 2C3QA 2YWMA 2VD1A 2XPDA 2ZCTA 3GHAA 1XW5A 2CVDA 4L8EA 3OR5A 2IMEA 3GL3A 2OBKA 5IMVA 3KH9A 2RUEA 5G5EA 1H75A 2GS3A 2R37A 1XW9A 4MH3A 4PQ1A 2YPMA 2G0FA 4G2EA 2P31A 4IGJA 5KN2A 3TJJA 4GQFA 3QFAC 1VF1A 2B7KA 2IMFA 3FRCA 2FWEA 3KCMA 3VI5A 2REMA 1QGVA 2VCZA 2VLUA 4NAXA 5CO3A 1Z7PA 2HYXA 1LJRA 3QCPA 4AGSA 1GL8A 1EZKA 5ECHB 5F07A 4K9ZA 3H8QA 4X1UA 1ERVA 2OJLA 5DQYA 1PD21 4EDYA 1YDKA 1M0UA 3VWWA 4OCEA 4IN0A 1RK4A 4AF2A 2GZYA 2DIZA 1N2AA 1PX7A 2IMIA 3EINA 2H74A 5H5QA 5CP1A 3HKRA 1BX9A 2TRCP 1OVNA 1TU8A 3IOSA 2QGVA 3QAWA 1DBYA 1GUKA 4WETA 3A2XA 6GSTA 3GUSA 4HZ4A 4KA0A 1DE1A 4L5LA 1QFNA 1UVZA 2YANA 4P3YB 4IP6A 1VF3A 1O8XA 5INYA 4E8EA 2I81A 3GKNA 3UMAA 4QL7A 3ZITA 4EXJA 2QSIA 3EMXA 2L59A 2B5EA 2VIMA 1MDJA 2GSRA 2YCDA 1SD9A 1V98A 2GZPA 5ENUA 4OD7A 3UJ1A 5GZZB 1DUGA 3J7Yk 3CRUA 2XPEA 2V2GA 5HR2A 1A8YA 2XBIA 4TR3A 3IHQA 2DMLA 2DIYA 1TKDB 2YOIA 2I1UA 3QMXA 3Q74A 2GZZA 4PNGA 4GRFA 3TJFA 2HZEA 1OKTA 1XCCA 4WR4A 3F9UA 5DJLA 4HS1A 1V57A 2A2RA 3BJ5A 1A0RP 4IP1A 2DC5A 5G5FA 4JZQA 3KEBA 3FZ4A 3HCZA 1GLQA 2C3TA 3VURA 5ECNB 2C0FA 2MMOA 3BCIA 3APOA 2O85A 2OE0A 1VRSD 4RI6A 4LLRA 2HLSA 2VL9A 1QQ2A 1AC1A 4JR4A 4K0NA 5ECIB 2AJQB 2IFQB 5DALB 1V9WA 4O7HA 1FAAA 3QFBC 2ALBA 2H1DA 5GSTA 3MAKA 3L4NA 5D93A 3EURA 3ZIJA 2LJKA 3I6AA 3N9JA 2IFQA 2WFCA 1K0DA 2GSSA 1BYEA 3FZ9A 4J57E 4XCSA 1GRXA 5IMDA 1OC9B 2CA8A 4Q5NA 1CQGA 4HU7A 3HY2A 2OA7A 4O32A 1KNGA 4KH7A 2L6CA 4PNFA 3F3RA 2WRTA 5L71A 3GKXA 4LMWA 3LGCA 5AISA 5B6MA 1OE7A 4IJIA 2FY6A 1XIYA 19GSA 2B5XA 2LQQA 4XS4A 1KEBA 4OCFA 3HDCA 1U87A 1ERTA 4NXIA 2E7PA 3DIEA 4HUAA 5KN1A 3TDGA 3F6FA 4EDZA 1X5DA 1S3CA 2IMDA 2DJ1A 2N5BA 5DBQA 2ZUPA 4GLTA 3NZNA 5LCZA 3CBUA 2H1GA 1FB0A 4TR1B 1V40A 3VPTA 2CQ9A 1XOAA 1SYRA 2AUVA 3GX8A 1QK8A 1TOFA 1SYXA 4EUYA 2LV3A 1B8XA 4IHUA 3ZLPA 3IDVA 4HOJA 1X9SB 3BD2A 2KP2A 1FVJA 1JZDA 4NPBA 4K6XA 4KGIA 2PU9C 3GFKA 3IXRA 5AN1A 2H66A 2M46A 1G7OA 1SJ6A 4CDOA 5IM9A 4ECCA 3ME7A 1O81A 3WGEA 3GYKA 3HD5A 3DWVA 5ELGA 1MTCA 1I5GA 1F9MA 1IYHA 3TGZA 1PKZA 4D73B 5J5NA 1B4PA 3FEUA 3ZMLA 3KXOA 2PERA 4EC0A 5DQSA 3L9UA 1I9DA 1B9XC 5CREA 3GH9A 4G9HA 2VO4A 1WJKA 5A5KA 2R2JA 1PSQA 2H01A 3DEXA 4TXOA 2LUSA 2VLTA 1C72A 3LYPA 4POBA 3APQA 3GN3A 3KTBA 1WIKA 2GT6A 5DDLA 5IQYA 2LJAA 2VCQA 3VPQA 1SK2A 4NHWA 2XC2A 2X8CA 1X5EA 4GSSA 3E3EA 3ZRDA 3O76A 2OADA 1K0OA 3IC4A 4X43A 2VCTA 4RQRA 1VF2A 5IO0A 5HFIA 4ZBBA 3BBYA 1O73A 2H73A 2CX4A 2DJ3A 2F51A 2PPTA 12GSA 3P7XA 4FYUA 4YQUA 2MBSA 3FYGA 2JADA 3HVSA 1XWBA 2BMXA 1S3AA 2H0HA 1TRSA 3GV1A 1M99A 3F8UA 17GSA 3VFIA 3C7MA 1A2LA 3O6TA 5D9VA 4OFTA 1TRVA 3F63A 1GSYA 5ABRA 2WB9A 3IAS2 1SENA 4IQ1A 1QMVA 1U6TA 2JSYA 3F0IA 2GLRA 3BCKA 4V2NA 3FK8A 4FYBA 1MDKA 1SK0A 1K0NA 1SL1B 2OBIA 4TN8A 2A2SA 4WF5A 2YZHA 3V1WA 5LD0A 4YAVA 5JCWA 1F2EA 3LG6A 1R5PA 4KW6A 3LYKA 2DJ0A 1TW9A 4MABA 4MLYA 1ZOFA 3KMOA 3NOFA 1XOBA 2IIYA 1ZGNA 2IN3A 2FCHA 1ZCPA 1U3AA 5IMCA 3R2QA 4BL7A 5ECRB 2IWTA 2C1YA 1XPVA 4IJ3A 4OO5A 2JZRA 1O85A 2FWFA 1USBA 4KUNA 2V6OA 5H5RA 4F9ZA 3M9KA 3TKSA 1T00A 3TOTA 4WBRD 3IPZA 2GGTA 4BA7A 3L0HA 1TU7A 1YF0A 2LRTA 1BJXA 4IELA 1Z6NA 4I97A 2KLXA 4L5OA 3H4KA 2EIQA 4IQAA 4HI7A 2WDUA 2VCWA 4QL9A 1O6JA 4K1FA 1JZOA 3I43A 4K2DA 3S9FA 4ECIA 5FT3A 1B48A 3FZ5A 1B4QA 4DVCA 3DVXA 5IOXA 3M8NA 1AQXA 4MF7A 4EVMA 2MZCA 5ELAA 1Q4JA 3M1GA 4OFMA 3UAPA 3UBLA 3GL5A 5AIXA 2DMMA 5ECPB 2B7JA 1K3OA 2V41A 4KAEA 4K8MA 1OC8A 2N5AA 3EE2A 4N11A 3FHKA 3DRNA 3HVXA 2MMAA 4XS1A 2WS2A 2DLXA 5IIZA 2CZ2A 2N5FA 3ZYWA 5CRGA 4HQSA 2JZSA 4EL1A 2L4QA 3M3MA 7GSSA 1TI1A 4BVYA 3FR3A 3PR8A 2MMNA 5F06A 1GTUA 1GSSA 1M9AA 4AJ8A 2YWIA 5B8AA 2DBCA 4KCAA 5ECOB 1EOHA 3TB2A 4JBBA 2F8FA 1ERWA 4CW9A 3HVVA 1K0MA 3D0ZA 2O7KA 4NV2A 2L4CA 1GSEA 3Q18A 5ID2B 1GH2A 4NWYA 2AV4A 2LJRA 3E9JB 4Q5QA 2PWJA 4F03A 2LKUA 4YQMA 3D4MA 3P2AA 1ZMAA 1NHOA 3TUEA 3QOUA 3RHCA 2G2QA 5D73A 4LA1A 4WBJA 4EE0A 1E2YA 3H93A 2H19A 2VLVA 4POLA 1YZXA 3D21A 3RHBA 1MEKA 4ID0A 3D4TA 4BWSA 4JRRA 5LNKe 1KTEA 3LORA 3CYNA 2OE1A 2WJUA 14GSA 4XRDA 4HDEA 4IVFA 5A4UA 5A4VA 4OMVA 3IAM2 4HQZA 4RQXA 3VK9A 1XBSA 1G0TA 1X5CA 4LL4B 8GSSA 1M2DA 3FZAA 3MNGA 3I9V2 5HR1A 2NVLA 3DXBA 3ZFBA 2R5GA 5AGYA 3GIXA 4OO4A 2F8AA 4E8HA 4NV5A 5J9BA 5KEJA 4TR0A 4KDUA 5CYYA 4DSSB 2H70A 3ED3A 2KOKA 1GTAA 3EVIA 3UEMA 5DAKB 2GQKA 1PL2A 4GXZA 3F4SA 1EV4A 4DSSA 4ML1A 1QUWA 2K18A 1SKSB 2YV9A 5DALA 3QAGA 4J56E 2H6ZA 1TXXA 2KUCA 1TK0B 4OWYA 3SWLA 2C8UA 2GDRA 2M72A 4JEDA 4FH8A 3TJGA 3KD0A 1KBNA 3DYRA 2OACA 4K7OA 3A5WA 4I6XA 1A8LA 4MK3A 1SL2B 3ME8A 4K7NA 3TCOA 3A2WA 1GUHA 1M2BA 1F6MC 3HHVA 3HZ4A 1T4ZA 1OC9A 4F0CA 6GSSA 3IRAA 1SL0B 3GKKA 1T1VA 3HJPA 4PXOA 4IS0A 4KNDA 1EOGA 2FHEA 2I3YA 1JLWA 2LRCA 4BVXA 1X9WB 2CZ3A 2YWNA 1W4VA 5D96A 2QKEA 1M9BA 2GSTA 2LTKA 1OKDA 3RAZA 2EIRA 4NHZA 1M2AA 4ZBDA 2PVQA 5CAXA 4I8BA 1PX6A 1GLPA 4JE1A 3FY7A 2FWHA 3EYTA 3KIJA 4ZB9A 3DGQA 2CV4A 3EU3A 5HR0A 1EGRA 1K3YA 2JACA 3HA9A 3TJKA 3EC3A 2K8SA 1J9BA 2A4VA 1S3DA 1XZOA 4KB3A 5IMFA 3LFLA 2YJHA 3GX0A 4X0XA 3A3TA 2O8VB 4J2FA 5EY6A 1O7UA 1WMJA 1A2MA 1HD2A 4V1Ag 4KCEA 2V1MA 3TOUA 4MJBA 4KDYA 4TR1A 1FVKA 4FYCA 1XWCA 2VCVA 3ZIVA 5FWGA 1WWJA 5DVBA 1Z5YE 3TKSC 2H76A 1JZRA 2AYTA 3IK9A 1OC3A 2GQLA 1TJDA 3FR6A 3ZZXA 4RUVA 4KX4A 4FIWA 3HXSA 4ZXGA 2FA4A 1A24A 1UN2A 1FO5A 11GSA 1OYJA 1SD8A 2RIIA 2YZUA 3M9JA 1T3BA 3IA1A 5D9TA 1WOUA 4WR5A 1YEPA 2E2GA 3SBCA 1K3LA 4GSNA 2L6DA 1GSDA 2H6XA 4D73A 1ZL9A 2J9HA 1VGLA 1ACVA 4POMA 1BEDA 3EU4A 3F4RA 5G1KA 1O8WA 1SKRB 1YEXA 1WRYA 5J41A 4RI7A 3UARA 1ZYQB 2R4VA 2H1BA 2C80A 3LWAA 3C1SA 1YQ1A 4EF0A 3W8SA 2C0EA 1U88A 1W89A 4N10A 22GSA 9GSSA 1JZWA 1MDIA 1YKAA 4ZB8A 2V32A 5JCGA 1A2JA 1AQWA 4PUAA 1T4YA 4MCUA 2BJXA 1NW2A 3RPPA 4V2LA 1SU9A 3Q19A 1HYUA 2RLIA 4L0WA 4GQCA 1EP7A 4HJMA 4ZIJA 1J0FA 1A0FA 1DE2A 3CMIA 1EEMA 4XS6A 5B8BA 1HNAA 2X8HA 4MPFA 3GTUB 1WPIA 3VWVA 1IYIA 3GKMA 1SJZA 4BPYA 1EEJA 2F3MA 3TKQA 4ACSA 1UA5A 1MD4A 3H1NA 5J4UA 5COHA 2H0IA 3KGKA 3RPNA 2GSQA 1EWXA 2LNTA 4GTUA 4MF6A 4YH2A 4CHSA 3PGTA 3FKFA 5GSSA 1V2AA 2IJYA 2WGRA 1WE0A 5F0GA 4Q5FA 3CRTA 4LL1B 3BOAA 3DKSA 2H72A 2HT9A 1GNWA 2MBTA 3D22A 4I2UA 4I2TA 5IMZA 1OAZA 1E6BA 3C71A 2HNLA 5EPFA 2JL4A 1BAYA 2XBQA 4TW5A 2HZFA 1Z7RA 3MDKA 1GP1A 5CRHA 3VWXA 2YP6A 3P8WA 1BG5A 4N0VA 2X99A 2IPAA 4IBPA 1Q98A 3ZFLA 2FD3A 2DJJA 5DCHA 3U6VA 5G1LA 5IO2A 5EL8A 5HFGA 3WT2A 4MJEA 3F6DA 4PX1A 1GSUA 5JWRB 1GWCA 3WD6A 2PVOC 5IMAA 2VL2C 3C73A 3VI7A 3LXZA 1AUCA 2PGTA 3G9BA 2VM2A 1X9MB 4TKYA 4LMVA 3QAVA 4TVEA 5ECKB 4MZCA 5GAPD 2K6VA 4Z7XA 2K9FA 2P0GA 1FG4A 4PGTA 5C04A 1URMA 6GSWA 2NPBA 4ZILA 2HRFA 1Y6EA 3AY8A 1XVQA 5IPGA 1ERUA 4ZL8A 2GTUA 3IBHA 3W6GA 2H30A 3ZTLA 3M0FA 5AIVA 4F0BA 2D2ZA 1RQMA 1X0RA 4AJ7A 4YQVA 2DJ2A 3KJYA 1PKWA 1PGTA 1B9YC 4KE3A 2EIOA 1TK8B 3UVTA 2DSAA 1Z9HA 4YAPA 1NHYA 4IW9A 4H86A 1PQNA 5CRWA 5G30A 2KHPA 1JFUA 1FOVA 1JLVA 3DVWA 2FNOA 2R3XA 3RDWA 1Y25A 6GSVA 3US3A 3GH6A 2L5OA 4EO3A 5KN0A 2O89A 4MMMA 1BQ7A 1F3AA 1AIUA 4MA9A 2E2MA 1EP8A 4POKA 6GSYA 2FGXA 1AAZA 2H6YA 1VF4A 4HZ2A 3A2VA 2H75A 2CVBA 1SJIA 3GSSA 3DMLA 2AB6A 3KH7A 5E4WA 5HFKA 3QDNA 2BTOT 1T8EB 4PURA 2F9SA 3U5RE 1ST9A 1QXHA 1M7TA 2FWGA 3IR4A 3MWHA 2I4AA 3HZ8A 1XVWA 1FW1A 3GURA 2KP1A 5GAND 3UOMA 2JSZA 1XFLA 3IK7A 2VCXA 5ID2A 3WGXA 4KSOA 3QD9A 1XXUA 4KDXA 1XWAA 3PH9A 1ZYEA 5FHIA 4MJAA 1F3BA 3KP9A 3FR9A 4K7IA 16GSA 2P5QA 3LJRA 4ISDA 4WKWA 2O87A 2AAWA 2VD0A 2LRNA 2OE3A 3LSZA 3E0UA 1SKWB 5J9CA 5J3RA 2HZEB 3KZQA 4QQ7A 2CAIA 2YWOA 2C0GA 4EKZA 3APSA 4ZL7A 2C4JA 4TXVA 5JCUA 10GSA 3ZL5A 2B3SA 3KMNA 3LEFA 4WF4A 5JWQB 1PL1A 4MZWA 5A4WA 3D6IA 2VL2A 3Q6OA 4DSQA 3C1RA 4HJ2A 2B1KA 1YY7A 3L9VA 1TTZA 4AJ6A 3RBTA 2CT6A 2B5YA 2LSTA 1F37A 5D9WA 1HNCA 4HU9A 4GWRA 3P90A 2FUG2 4JR6A 2VUPA 4ZL9A 3DD3A 1GSFA 2GQMA 1GNEA 2MYGA 1R5AA 1TK5B 2X64A 5DAKA 5B7CA 3VLNA 2FLSA 3D5JA 6GSUA 3ZVJD 5G31A 1ON4A 4ECJA 2PBJA 2C3NA 1THOA 2YN1A 5G2ZA 2H8LA 3WGDA 3NIVA 3CSJA 4XTSA 2CAQA 3CTFA 4TRXA 6GSXA 3WT1A 2PMTA 1PA3A 1U3IA 1UC7A 3L9SA 2NDOA 2JZTA 1T7PB 1LBKA 3HJOA 2LNSA 1ZZYA 2CX3A 1OE8A 4HEA2 1YJ6A 4G19A 4XS4B 2VL3A 3G7JA 4ULXA 4MDCA 2RM5A 2H0GA 1JHBA 2K8VA 1XW6A 3VWUA 1TDIA 2PN8A 3ZVJA 2AHEA 2P5RA 3LXTA 4BWQA 3W8JA 1R4WA 18GSA 1SK1A 4O92A 1EGOA 3G7YA 1WP0A 1ABAA 2NTOA
chains in the Genus database with same CATH superfamily
2GVPA 5A2QI 2IL3A 1AQVA 1RW1A 4NMUA 4GSTA 2H71A 3J80I 1XG8A 5HR3A 1GTIA 2L5LA 1XWGA 4MZBA 1K0CA 1GSQA 2M80A 2ES7A 2TRXA 4WXTA 2YV7A 13GSA 2J23A 3H79A 1J08A 4G10A 4F2IA 4TR4A 3QR6A 5KN3A 4ILFA 2VAFA 2IMKA 5IOWA 2ZNMA 3N5OA 4XRAA 5F05A 1TRWA 2OKAA 3J7Yb 4Q5RA 2HFDA 3UIWA 4MH2A 3TKPA 5ECQB 1N8JA 1PMTA 4K0GA 4ZB6A 1Z6MA 3ZMKA 1ILOA 3MSZA 2V6KA 3IV4A 3K8NA 4BIKA 4YKGA 4GF0A 5DCGA 2MMZA 4MP4A 2HSYA 1H4OA 1G6WA 3EWLA 1YKCA 4TXOB 2HRKA 5ECSA 4XHMA 2YJ7A 3TKRA 5C00A 5H5SA 1DSBA 5F8BA 3CSHA 2YNXA 2WZ9A 4TOPA 5ECLB 1HQOA 2HXKA 3FW2A 1FB6A 3CTGA 3GNJA 4PQHA 20GSA 2B1LA 1K0BA 2HE3A 5KOXA 1LU4A 1NM3A 4ML6A 5EVOA 3GA4A 3EMPA 1TRUA 4DEJA 3CSIA 2HSHA 2ON5A 3KM6A 3GRXA 3HYPA 3CXGA 2JU5A 2WCIA 3ERFA 4IKHA 1MD3A 4CY6A 1G6YA 4N0ZA 2TIRA 1G7EA 2H1AA 2GT5A 1V58A 5ECMB 1R26A 4L0UA 4WEYA 2DJKA 2QC7A 3JCML 2B6MA 1AXDA 2LEGA 2XHFA 2Z9SA 1ML6A 4JU5A 4V2MA 4ZBAA 4ECBA 1EV9A 3GMFA 3O3TA 3GTUA 3QPMA 5B6NA 2HI7A 2PUKC 3UVHA 4N30A 1HNBA 2L57A 3UL3A 1Z3EA 2LQOA 3F4TA 2I9HA 4OFNA 5CNWA 3UBKA 2R6KA 5KOWA 3GSTA 1CQHA 5JWOB 1A23A 4XIHA 5E59A 4Z2TA 5IPHA 1FHEA 2X8GA 2VOCA 3LQ7A 2LS5A 1TP9A 5DJMA 1GUMA 2R0PA 1K0AA 2VM1A 1YF1A 3PINA 4MF5A 3KTLA 4F82A 2WULA 2C0DA 4O5RA 4MPGA 4FO5A 3KP8A 1PN9A 3TRQA 1TI3A 2EC4A 4DSRA 2HRNA 5D8IA 2RM6A 3F3QA 4GCIA 3G7IA 5D9XA 4MJCA 5HQPA 4V1Ap 4PQIA 3TRXA 3WYWA 2ON7A 3ISOA 4BL7B 1GULA 1R7HA 2E0QA 3ERWA 3HJMA 1NSWA 3ERGA 1THXA 3C8EA 1PRXA 4X4JA 4PUFC 2NBSA 1XWKA 3TRPA 3ZREA 3TKSE 3TJBA 2RUFA 4I5QA 5CRDA 3IE3A 1GTBA 3L78A 2FA8A 4KSMA 2CVKA 3I69A 1AW9A 2C3QA 2YWMA 2VD1A 2XPDA 2ZCTA 3GHAA 3LW9A 1XW5A 2CVDA 4L8EA 3OR5A 2IMEA 3A5IA 3GL3A 2OBKA 5IMVA 3KH9A 2RUEA 5G5EA 1H75A 2GS3A 2R37A 1XW9A 4Z2UA 4O5QA 4MH3A 4PQ1A 2YPMA 2G0FA 4G2EA 2P31A 4IGJA 5KN2A 3TJJA 4GQFA 3QFAC 1VF1A 2B7KA 2IMFA 3FRCA 2FWEA 3KCMA 3VI5A 2QA2A 2REMA 1QGVA 2VCZA 2VLUA 2A2PA 4NAXA 5CO3A 1Z7PA 2HYXA 1LJRA 3QCPA 4AGSA 1GL8A 1EZKA 5ECHB 5F07A 4K9ZA 3H8QA 3IHGA 4X1UA 1ERVA 2OJLA 5DQYA 1PD21 4EDYA 1YDKA 1M0UA 3VWWA 4OCEA 4IN0A 1RK4A 4AF2A 2HSMA 2GZYA 2DIZA 1N2AA 1PX7A 2IMIA 3EINA 2H74A 5H5QA 5CP1A 3HKRA 1BX9A 2TRCP 1OVNA 1TU8A 3IOSA 2QGVA 3QAWA 1DBYA 4MNNA 1GUKA 4WETA 3A2XA 6GSTA 3GUSA 4HZ4A 4KA0A 1DE1A 4L5LA 1QFNA 1UVZA 2YANA 4P3YB 4IP6A 1VF3A 1O8XA 5INYA 4E8EA 4K5RA 2I81A 3GKNA 3UMAA 4QL7A 3ZITA 4EXJA 2QSIA 3EMXA 2L59A 2B5EA 2VIMA 1MDJA 2GSRA 2YCDA 1SD9A 1V98A 2GZPA 5ENUA 4OD7A 3UJ1A 5GZZB 1DUGA 3J7Yk 3CRUA 4O5UA 2XPEA 2V2GA 5HR2A 1A8YA 2XBIA 4TR3A 3IHQA 2DMLA 2DIYA 1FOHA 1TKDB 2YOIA 2I1UA 3QMXA 3Q74A 2GZZA 4PNGA 4GRFA 3TJFA 2HZEA 1OKTA 1XCCA 4WR4A 3F9UA 5DJLA 4HS1A 1V57A 2A2RA 3IC8A 3BJ5A 1A0RP 4IP1A 2DC5A 5G5FA 4JZQA 3KEBA 3FZ4A 3HCZA 1GLQA 2C3TA 3VURA 5ECNB 2C0FA 2MMOA 3BCIA 3APOA 5LL6V 2O85A 2OE0A 1VRSD 4RI6A 4LLRA 2HLSA 2VL9A 1QQ2A 1AC1A 4JR4A 4K0NA 5ECIB 2AJQB 2IFQB 5DALB 1V9WA 4G0IA 4O7HA 1FAAA 3QFBC 2ALBA 2H1DA 5GSTA 3MAKA 4A5PA 3L4NA 5D93A 3EURA 3ZIJA 3EPTA 2LJKA 3I6AA 3N9JA 2IFQA 2WFCA 1K0DA 2GSSA 1BYEA 3FZ9A 4J57E 4XCSA 1GRXA 5IMDA 1OC9B 2CA8A 4Q5NA 1CQGA 4HU7A 3HY2A 4BVXB 2OA7A 4O32A 1KNGA 4KH7A 2L6CA 4PNFA 3F3RA 2WRTA 5L71A 2X49A 3GKXA 3LGCA 4LMWA 5AISA 5B6MA 1OE7A 2HRAA 4IJIA 1M3JA 2FY6A 1XIYA 19GSA 2B5XA 4Z2RA 2LQQA 4XS4A 1KEBA 4OCFA 3HDCA 5FLXI 1U87A 1ERTA 4NXIA 2E7PA 3DIEA 4HUAA 5KN1A 3TDGA 3F6FA 4EDZA 1X5DA 1S3CA 2IMDA 2DJ1A 2N5BA 5DBQA 2ZUPA 4GLTA 3NZNA 5LCZA 3CBUA 2H1GA 1FB0A 4TR1B 1V40A 3VPTA 2CQ9A 1XOAA 1SYRA 2AUVA 3GX8A 1QK8A 4KF9A 1TOFA 1SYXA 4EUYA 2LV3A 1B8XA 4IHUA 3ZLPA 3IDVA 4HOJA 1X9SB 3BD2A 2KP2A 1FVJA 1JZDA 4NPBA 4K6XA 4KGIA 2PU9C 3GFKA 3IXRA 5AN1A 2H66A 2M46A 1G7OA 1SJ6A 4CDOA 5IM9A 4ECCA 3ME7A 1O81A 3WGEA 3GYKA 3HD5A 3DWVA 5ELGA 1MTCA 1I5GA 1F9MA 1IYHA 3TGZA 1PKZA 4D73B 5J5NA 1B4PA 3FEUA 3ZMLA 3KXOA 2PERA 4EC0A 5DQSA 3L9UA 1PFOA 1I9DA 1B9XC 5CREA 3GH9A 1S3RA 4G9HA 2VO4A 1WJKA 4ICYA 5A5KA 2R2JA 1PSQA 2H01A 3DEXA 4TXOA 2LUSA 2VLTA 1C72A 3LYPA 4POBA 3APQA 3GN3A 3KTBA 1WIKA 2GT6A 5DDLA 5IQYA 2LJAA 2VCQA 3VPQA 1M3IA 1SK2A 2XC2A 4NHWA 2X8CA 1X5EA 4GSSA 3E3EA 3ZRDA 3O76A 2OADA 1K0OA 3IC4A 4X43A 2VCTA 4RQRA 1VF2A 5IO0A 5HFIA 2R0GA 4ZBBA 3BBYA 1O73A 2H73A 2CX4A 2DJ3A 2F51A 2PPTA 12GSA 3P7XA 4FYUA 4YQUA 2DKIA 2MBSA 3FYGA 2JADA 3HVSA 1XWBA 2BMXA 1S3AA 2H0HA 1TRSA 3GV1A 1M99A 3F8UA 17GSA 3VFIA 3C7MA 1A2LA 3O6TA 5D9VA 4OFTA 1TRVA 3F63A 1GSYA 5ABRA 2WB9A 3IAS2 1SENA 4IQ1A 1QMVA 1U6TA 2JSYA 3F0IA 2GLRA 3BCKA 4V2NA 3FK8A 4FYBA 1MDKA 1SK0A 1K0NA 1SL1B 2OBIA 4TN8A 2A2SA 4WF5A 2YZHA 3V1WA 5LD0A 1ZYNA 4YAVA 5JCWA 1F2EA 3LG6A 1R5PA 4KW6A 3LYKA 2DJ0A 1TW9A 4MABA 4MLYA 1ZOFA 3KMOA 3NOFA 1XOBA 2IIYA 1ZGNA 2IN3A 2FCHA 1ZCPA 1U3AA 5IMCA 3R2QA 4BL7A 5ECRB 2IWTA 2C1YA 1XPVA 4IJ3A 4OO5A 2JZRA 1O85A 2FWFA 1USBA 4KUNA 2V6OA 5H5RA 4F9ZA 3M9KA 3TKSA 1T00A 3TOTA 4WBRD 3IPZA 2GGTA 4BA7A 3L0HA 1TU7A 1YF0A 2LRTA 1BJXA 4IELA 1Z6NA 4I97A 2KLXA 4L5OA 4USSA 3H4KA 4IQAA 2EIQA 4HI7A 2WDUA 2VCWA 4QL9A 1O6JA 4K1FA 1JZOA 3I43A 4K2DA 3S9FA 3HVNA 4ECIA 5FT3A 1B48A 3FZ5A 1B4QA 4DVCA 3DVXA 5IOXA 3M8NA 1AQXA 4MF7A 4EVMA 2MZCA 5ELAA 1Q4JA 3M1GA 4OFMA 3UAPA 3UBLA 3GL5A 5AIXA 2DMMA 5ECPB 2B7JA 1K3OA 2V41A 4KAEA 4K8MA 1OC8A 2N5AA 3EE2A 4N11A 3FHKA 3DRNA 4BVYB 5BMUA 3HVXA 2MMAA 4XS1A 2WS2A 2DLXA 5IIZA 2CZ2A 2N5FA 3ZYWA 5CRGA 4HQSA 2JZSA 4EL1A 2L4QA 3M3MA 7GSSA 1TI1A 4BVYA 3FR3A 3PR8A 2MMNA 5F06A 1GTUA 1GSSA 1M9AA 4AJ8A 2YWIA 5B8AA 2DBCA 4KCAA 5ECOB 1EOHA 3TB2A 2A4HA 4JBBA 2F8FA 1ERWA 4CW9A 3HVVA 1K0MA 3D0ZA 2O7KA 4NV2A 2L4CA 1GSEA 3Q18A 5ID2B 1GH2A 4NWYA 2AV4A 2LJRA 3E9JB 4Q5QA 2PWJA 4F03A 2LKUA 4YQMA 3D4MA 3P2AA 1ZMAA 1NHOA 3TUEA 3QOUA 3RHCA 2G2QA 5D73A 4LA1A 4WBJA 4EE0A 1E2YA 3H93A 2H19A 2VLVA 4POLA 1YZXA 3D21A 3RHBA 1MEKA 4ID0A 3D4TA 4BWSA 4JRRA 5LNKe 1KTEA 3LORA 3CYNA 2OE1A 2WJUA 14GSA 4XRDA 4HDEA 4IVFA 5A4UA 5A4VA 2UZ8A 4OMVA 3IAM2 4HQZA 4RQXA 3VK9A 1XBSA 1G0TA 1X5CA 4LL4B 8GSSA 1M2DA 3FZAA 3MNGA 3I9V2 5HR1A 2NVLA 3DXBA 3ZFBA 2R5GA 5AGYA 4PTSA 3GIXA 4OO4A 2F8AA 4E8HA 4NV5A 5J9BA 5KEJA 4TR0A 4KDUA 5CYYA 4DSSB 2H70A 3ED3A 2KOKA 1GTAA 3EVIA 3UEMA 5DAKB 2GQKA 1PL2A 4GXZA 3F4SA 1EV4A 4DSSA 4ML1A 1QUWA 2K18A 1SKSB 2YV9A 5DALA 3QAGA 4J56E 2H6ZA 1TXXA 1ZYPA 2KUCA 1TK0B 4OWYA 3SWLA 2C8UA 2GDRA 2M72A 4JEDA 4FH8A 3TJGA 3KD0A 1KBNA 3DYRA 2OACA 4K7OA 3A5WA 4I6XA 1A8LA 4MK3A 1SL2B 3ME8A 4K7NA 4K5SA 3TCOA 3A2WA 1GUHA 1M2BA 1F6MC 3HHVA 3HZ4A 1T4ZA 1OC9A 4F0CA 6GSSA 3IRAA 1SL0B 3GKKA 1T1VA 3HJPA 4PXOA 4IS0A 4KNDA 1EOGA 2FHEA 2I3YA 1JLWA 2LRCA 4BVXA 1X9WB 2CZ3A 2YWNA 1W4VA 5D96A 2QKEA 1M9BA 2GSTA 2LTKA 1OKDA 3RAZA 2EIRA 4NHZA 1M2AA 4ZBDA 2PVQA 5CAXA 4I8BA 1PX6A 1GLPA 4JE1A 3FY7A 2FWHA 3EYTA 3KIJA 4ZB9A 3DGQA 2CV4A 3EU3A 5HR0A 1EGRA 1K3YA 2JACA 3HA9A 3TJKA 3EC3A 2K8SA 1J9BA 2A4VA 1S3DA 1XZOA 4KB3A 5IMFA 4EIPA 3LFLA 3JAMI 2YJHA 3GX0A 4X0XA 3A3TA 2O8VB 4J2FA 5EY6A 1O7UA 1WMJA 1A2MA 1HD2A 4V1Ag 4KCEA 2V1MA 3TOUA 4FQUA 4MJBA 4KDYA 4TR1A 1FVKA 4FYCA 1XWCA 2VCVA 3ZIVA 5FWGA 1WWJA 5DVBA 1Z5YE 3TKSC 2H76A 1JZRA 2AYTA 3IK9A 1OC3A 2GQLA 1TJDA 3FR6A 3ZZXA 4RUVA 4KX4A 4FIWA 3HXSA 4CY8A 4ZXGA 2FA4A 1A24A 1UN2A 1FO5A 11GSA 1OYJA 1SD8A 2RIIA 2YZUA 3M9JA 1T3BA 3IA1A 5D9TA 1WOUA 4WR5A 1YEPA 2E2GA 3SBCA 1K3LA 4GSNA 2L6DA 1GSDA 2H6XA 4D73A 1ZL9A 2J9HA 1VGLA 1ACVA 4POMA 1BEDA 3EU4A 3F4RA 3PPUA 5G1KA 1O8WA 1SKRB 1YEXA 1WRYA 5J41A 4RI7A 3UARA 1ZYQB 2R4VA 2H1BA 2C80A 3LWAA 3C1SA 1YQ1A 4EF0A 3W8SA 4G0LA 2C0EA 1U88A 1W89A 4N10A 22GSA 9GSSA 1JZWA 1MDIA 1YKAA 2QA1A 4ZB8A 2V32A 5JCGA 1A2JA 1AQWA 4PUAA 1T4YA 4MCUA 2BJXA 1NW2A 3RPPA 4V2LA 1SU9A 3Q19A 1HYUA 2RLIA 4L0WA 4GQCA 4HSCX 1EP7A 4HJMA 4ZIJA 1J0FA 1A0FA 1DE2A 3CMIA 1EEMA 4XS6A 5B8BA 1HNAA 2X8HA 2X4AA 4MPFA 3GTUB 1WPIA 3VWVA 1IYIA 3GKMA 1SJZA 4BPYA 1PN0A 1EEJA 2F3MA 3TKQA 4ACSA 1UA5A 1MD4A 3H1NA 3MIXA 5J4UA 5COHA 2H0IA 3KGKA 3RPNA 2GSQA 1EWXA 2LNTA 4GTUA 4MF6A 4YH2A 4CHSA 3PGTA 3FKFA 5GSSA 1V2AA 2IJYA 2WGRA 1WE0A 5F0GA 4Q5FA 3CRTA 4LL1B 3BOAA 3DKSA 2H72A 2HT9A 1GNWA 2MBTA 3D22A 4I2UA 4I2TA 5IMZA 1OAZA 1E6BA 3C71A 2HNLA 5EPFA 2JL4A 1BAYA 2XBQA 4TW5A 2HZFA 1Z7RA 3MDKA 1GP1A 5CRHA 3VWXA 2YP6A 3P8WA 1BG5A 4N0VA 2X99A 2IPAA 4IBPA 1Q98A 3ZFLA 2FD3A 2DJJA 5DCHA 5IT9I 4K2XA 3U6VA 5G1LA 5IO2A 5EL8A 5HFGA 3WT2A 4MJEA 3F6DA 4PX1A 1GSUA 5JWRB 1GWCA 3WD6A 2PVOC 5IMAA 2VL2C 3C73A 3VI7A 3LXZA 1AUCA 2PGTA 3G9BA 2VM2A 1X9MB 4TKYA 4LMVA 5BRTA 3QAVA 4TVEA 5ECKB 3R3EA 4MZCA 5GAPD 2K6VA 4Z7XA 2K9FA 2P0GA 1FG4A 4PGTA 5C04A 1URMA 6GSWA 2NPBA 4ZILA 2HRFA 1Y6EA 3AY8A 1XVQA 5IPGA 1ERUA 4ZL8A 2GTUA 3IBHA 3W6GA 2H30A 3ZTLA 3M0FA 5AIVA 4F0BA 2D2ZA 1RQMA 1X0RA 4AJ7A 4YQVA 2DJ2A 3KJYA 1PKWA 1PGTA 1B9YC 4KE3A 2EIOA 1TK8B 3UVTA 2DSAA 1Z9HA 4YAPA 1NHYA 4IW9A 4H86A 1PQNA 5CRWA 5G30A 2KHPA 1JFUA 1FOVA 1JLVA 3DVWA 2FNOA 2R3XA 3RDWA 1Y25A 6GSVA 3US3A 3FMWA 3GH6A 2L5OA 4EO3A 5KN0A 2O89A 3J81I 4MMMA 1BQ7A 1F3AA 1AIUA 4MA9A 2E2MA 4EIQA 1EP8A 4POKA 6GSYA 2FGXA 1AAZA 2H6YA 1VF4A 4HZ2A 3A2VA 2H75A 2CVBA 1SJIA 3GSSA 3DMLA 2AB6A 3KH7A 5E4WA 5HFKA 3QDNA 2BTOT 1T8EB 4PURA 2F9SA 3U5RE 1ST9A 1QXHA 1M7TA 2FWGA 3IR4A 3MWHA 2I4AA 3MYDA 3HZ8A 1XVWA 1FW1A 3GURA 2KP1A 5GAND 3UOMA 2JSZA 1XFLA 3IK7A 2VCXA 5ID2A 4YKFA 3WGXA 4KSOA 3QD9A 1XXUA 4KDXA 1XWAA 3PH9A 1ZYEA 5FHIA 4MJAA 1F3BA 3KP9A 3FR9A 4K7IA 16GSA 2P5QA 3LJRA 4ISDA 4WKWA 2O87A 2AAWA 2VD0A 2LRNA 2OE3A 3LSZA 3E0UA 1SKWB 5J9CA 5J3RA 2HZEB 3KZQA 4QQ7A 2CAIA 2YWOA 2C0GA 4EKZA 3APSA 4ZL7A 2C4JA 4TXVA 5JCUA 2R0CA 10GSA 3ZL5A 2B3SA 3KMNA 3LEFA 4WF4A 2DKHA 5JWQB 1PL1A 4MZWA 5A4WA 3D6IA 2VL2A 3Q6OA 4DSQA 3C1RA 4HJ2A 2B1KA 1YY7A 3L9VA 1TTZA 4AJ6A 3RBTA 2CT6A 2B5YA 2LSTA 1F37A 5D9WA 1HNCA 4HU9A 4GWRA 3P90A 2FUG2 4JR6A 2VUPA 4ZL9A 3DD3A 1GSFA 2GQMA 1GNEA 2MYGA 1R5AA 1TK5B 2X64A 5DAKA 5B7CA 3VLNA 2FLSA 3D5JA 6GSUA 3ZVJD 5G31A 1ON4A 4ECJA 2PBJA 2C3NA 1THOA 2YN1A 5G2ZA 2H8LA 3WGDA 3NIVA 3CSJA 4XTSA 2CAQA 3CTFA 4TRXA 6GSXA 3WT1A 2PMTA 3CQFA 1PA3A 1U3IA 1UC7A 3L9SA 2NDOA 2JZTA 1T7PB 1LBKA 3HJOA 2LNSA 1ZZYA 2CX3A 1OE8A 4HEA2 1YJ6A 4G19A 4XS4B 2VL3A 3G7JA 4ULXA 4MDCA 2RM5A 2H0GA 1JHBA 2K8VA 1XW6A 3VWUA 1TDIA 2PN8A 3ZVJA 2AHEA 2P5RA 3LXTA 4BWQA 3W8JA 1R4WA 18GSA 1SK1A 4O92A 1EGOA 3G7YA 1WP0A 4G0KA 1ABAA 2NTOA
chains in the Genus database with same CATH topology
2GVPA 2IL3A 1AQVA 1RW1A 4NMUA 4GSTA 2H71A 5HR3A 1GTIA 2L5LA 1XWGA 4MZBA 1K0CA 1GSQA 2M80A 2ES7A 2TRXA 4WXTA 2YV7A 13GSA 2J23A 3H79A 1J08A 4G10A 4F2IA 4TR4A 3QR6A 5KN3A 4ILFA 2VAFA 2IMKA 5IOWA 2ZNMA 3N5OA 4XRAA 5F05A 1TRWA 2OKAA 3J7Yb 4Q5RA 2HFDA 3UIWA 4MH2A 3TKPA 5ECQB 1N8JA 1PMTA 4K0GA 4ZB6A 1Z6MA 3ZMKA 1ILOA 3MSZA 2V6KA 3IV4A 3K8NA 4YKGA 4GF0A 5DCGA 2MMZA 4MP4A 2HSYA 1H4OA 1G6WA 3EWLA 1YKCA 4TXOB 2HRKA 5ECSA 4XHMA 2YJ7A 3TKRA 5C00A 5H5SA 1DSBA 5F8BA 3CSHA 2YNXA 2WZ9A 4TOPA 5ECLB 1HQOA 2HXKA 3FW2A 1FB6A 3CTGA 3GNJA 4PQHA 20GSA 2B1LA 1K0BA 2HE3A 5KOXA 1LU4A 1NM3A 4ML6A 5EVOA 3GA4A 3EMPA 1TRUA 4DEJA 3CSIA 2HSHA 2ON5A 3KM6A 3GRXA 3HYPA 3CXGA 2JU5A 2WCIA 3ERFA 4IKHA 1MD3A 4CY6A 1G6YA 4N0ZA 2TIRA 1G7EA 2H1AA 2GT5A 1V58A 5ECMB 1R26A 4L0UA 4WEYA 2DJKA 2QC7A 3JCML 2B6MA 1AXDA 2LEGA 2XHFA 2Z9SA 1ML6A 4JU5A 4V2MA 4ZBAA 4ECBA 1EV9A 3GMFA 3O3TA 3GTUA 3QPMA 5B6NA 2HI7A 2PUKC 3UVHA 4N30A 1HNBA 2L57A 3UL3A 1Z3EA 2LQOA 3F4TA 2I9HA 4OFNA 5CNWA 3UBKA 2R6KA 5KOWA 3GSTA 1CQHA 5JWOB 1A23A 4XIHA 5E59A 4Z2TA 5IPHA 1FHEA 2X8GA 2VOCA 3LQ7A 2LS5A 1TP9A 5DJMA 1GUMA 2R0PA 1K0AA 2VM1A 1YF1A 3PINA 4MF5A 3KTLA 4F82A 2WULA 2C0DA 4O5RA 4MPGA 4FO5A 3KP8A 1PN9A 3TRQA 1TI3A 2EC4A 4DSRA 2HRNA 5D8IA 2RM6A 3F3QA 4GCIA 3G7IA 5D9XA 4MJCA 5HQPA 4V1Ap 4PQIA 3TRXA 3WYWA 2ON7A 3ISOA 4BL7B 1GULA 1R7HA 2E0QA 3ERWA 3HJMA 1NSWA 3ERGA 1THXA 3C8EA 1PRXA 4X4JA 4PUFC 2NBSA 1XWKA 3TRPA 3ZREA 3TKSE 3TJBA 2RUFA 4I5QA 5CRDA 3IE3A 1GTBA 3L78A 2FA8A 4KSMA 2CVKA 3I69A 1AW9A 2C3QA 2YWMA 2VD1A 2XPDA 2ZCTA 3GHAA 3LW9A 1XW5A 2CVDA 4L8EA 3OR5A 2IMEA 3A5IA 3GL3A 2OBKA 5IMVA 3KH9A 2RUEA 5G5EA 1H75A 2GS3A 2R37A 1XW9A 4Z2UA 4O5QA 4MH3A 4PQ1A 2YPMA 2G0FA 4G2EA 2P31A 4IGJA 5KN2A 3TJJA 4GQFA 3QFAC 1VF1A 2B7KA 2IMFA 3FRCA 2FWEA 3KCMA 3VI5A 2QA2A 2REMA 1QGVA 2VCZA 2VLUA 2A2PA 4NAXA 5CO3A 1Z7PA 2HYXA 1LJRA 3QCPA 4AGSA 1GL8A 1EZKA 5ECHB 5F07A 4K9ZA 3H8QA 3IHGA 4X1UA 1ERVA 2OJLA 5DQYA 1PD21 4EDYA 1YDKA 1M0UA 3VWWA 4OCEA 4IN0A 1RK4A 4AF2A 2HSMA 2GZYA 2DIZA 1N2AA 1PX7A 2IMIA 3EINA 2H74A 5H5QA 5CP1A 3HKRA 1BX9A 2TRCP 1OVNA 1TU8A 3IOSA 2QGVA 3QAWA 1DBYA 4MNNA 1GUKA 4WETA 3A2XA 6GSTA 3GUSA 4HZ4A 4KA0A 1DE1A 4L5LA 1QFNA 1UVZA 2YANA 4P3YB 4IP6A 1VF3A 1O8XA 5INYA 4E8EA 4K5RA 2I81A 3GKNA 3UMAA 4QL7A 3ZITA 4EXJA 2QSIA 3EMXA 2L59A 2B5EA 2VIMA 1MDJA 2GSRA 2YCDA 1SD9A 1V98A 2GZPA 5ENUA 4OD7A 3UJ1A 5GZZB 1DUGA 3J7Yk 3CRUA 4O5UA 2XPEA 2V2GA 5HR2A 1A8YA 2XBIA 4TR3A 3IHQA 2DMLA 2DIYA 1FOHA 1TKDB 2YOIA 2I1UA 3QMXA 3Q74A 2GZZA 4PNGA 4GRFA 3TJFA 2HZEA 1OKTA 1XCCA 4WR4A 3F9UA 5DJLA 4HS1A 1V57A 2A2RA 3IC8A 3BJ5A 1A0RP 4IP1A 2DC5A 5G5FA 4JZQA 3KEBA 3FZ4A 3HCZA 1GLQA 2C3TA 3VURA 5ECNB 2C0FA 2MMOA 3BCIA 3APOA 2O85A 2OE0A 1VRSD 4RI6A 4LLRA 2HLSA 2VL9A 1QQ2A 1AC1A 4JR4A 4K0NA 5ECIB 2AJQB 2IFQB 5DALB 1V9WA 4G0IA 4O7HA 1FAAA 3QFBC 2ALBA 2H1DA 5GSTA 3MAKA 4A5PA 3L4NA 5D93A 3EURA 3ZIJA 3EPTA 2LJKA 3I6AA 3N9JA 2IFQA 2WFCA 1K0DA 2GSSA 1BYEA 3FZ9A 4J57E 4XCSA 1GRXA 5IMDA 1OC9B 2CA8A 4Q5NA 1CQGA 4HU7A 3HY2A 4BVXB 2OA7A 4O32A 1KNGA 4KH7A 2L6CA 4PNFA 3F3RA 2WRTA 5L71A 2X49A 3GKXA 3LGCA 4LMWA 5AISA 5B6MA 1OE7A 2HRAA 4IJIA 2FY6A 1XIYA 19GSA 2B5XA 4Z2RA 2LQQA 4XS4A 1KEBA 4OCFA 3HDCA 1U87A 1ERTA 4NXIA 2E7PA 3DIEA 4HUAA 5KN1A 3TDGA 3F6FA 4EDZA 1X5DA 1S3CA 2IMDA 2DJ1A 2N5BA 5DBQA 2ZUPA 4GLTA 3NZNA 5LCZA 3CBUA 2H1GA 1FB0A 4TR1B 1V40A 3VPTA 2CQ9A 1XOAA 1SYRA 2AUVA 3GX8A 1QK8A 4KF9A 1TOFA 1SYXA 4EUYA 2LV3A 1B8XA 4IHUA 3ZLPA 3IDVA 4HOJA 1X9SB 3BD2A 2KP2A 1FVJA 1JZDA 4NPBA 4K6XA 4KGIA 2PU9C 3GFKA 3IXRA 5AN1A 2H66A 2M46A 1G7OA 1SJ6A 4CDOA 5IM9A 4ECCA 3ME7A 1O81A 3WGEA 3GYKA 3HD5A 3DWVA 5ELGA 1MTCA 1I5GA 1F9MA 1IYHA 3TGZA 1PKZA 4D73B 5J5NA 1B4PA 3FEUA 3ZMLA 3KXOA 2PERA 4EC0A 5DQSA 3L9UA 1I9DA 1B9XC 5CREA 3GH9A 4G9HA 2VO4A 1WJKA 4ICYA 5A5KA 2R2JA 1PSQA 2H01A 3DEXA 4TXOA 2LUSA 2VLTA 1C72A 3LYPA 4POBA 3APQA 3GN3A 3KTBA 1WIKA 2GT6A 5DDLA 5IQYA 2LJAA 2VCQA 3VPQA 1SK2A 4NHWA 2XC2A 2X8CA 1X5EA 4GSSA 3E3EA 3ZRDA 3O76A 2OADA 1K0OA 3IC4A 4X43A 2VCTA 4RQRA 1VF2A 5IO0A 5HFIA 2R0GA 4ZBBA 3BBYA 1O73A 2H73A 2CX4A 2DJ3A 2F51A 2PPTA 12GSA 3P7XA 4FYUA 4YQUA 2DKIA 2MBSA 3FYGA 2JADA 3HVSA 1XWBA 2BMXA 1S3AA 2H0HA 1TRSA 3GV1A 1M99A 3F8UA 17GSA 3VFIA 3C7MA 1A2LA 3O6TA 5D9VA 4OFTA 1TRVA 3F63A 1GSYA 5ABRA 2WB9A 3IAS2 1SENA 4IQ1A 1QMVA 1U6TA 2JSYA 3F0IA 2GLRA 3BCKA 4V2NA 3FK8A 4FYBA 1MDKA 1SK0A 1K0NA 1SL1B 2OBIA 4TN8A 2A2SA 4WF5A 2YZHA 3V1WA 5LD0A 1ZYNA 4YAVA 5JCWA 1F2EA 3LG6A 1R5PA 4KW6A 3LYKA 2DJ0A 1TW9A 4MABA 4MLYA 1ZOFA 3KMOA 3NOFA 1XOBA 2IIYA 1ZGNA 2IN3A 2FCHA 1ZCPA 1U3AA 5IMCA 3R2QA 4BL7A 5ECRB 2IWTA 2C1YA 1XPVA 4IJ3A 4OO5A 2JZRA 1O85A 2FWFA 1USBA 4KUNA 2V6OA 5H5RA 4F9ZA 3M9KA 3TKSA 1T00A 3TOTA 4WBRD 3IPZA 2GGTA 4BA7A 3L0HA 1TU7A 1YF0A 2LRTA 1BJXA 4IELA 1Z6NA 4I97A 2KLXA 4L5OA 4USSA 3H4KA 4IQAA 2EIQA 4HI7A 2WDUA 2VCWA 4QL9A 1O6JA 4K1FA 1JZOA 3I43A 4K2DA 3S9FA 4ECIA 5FT3A 1B48A 3FZ5A 1B4QA 4DVCA 3DVXA 5IOXA 3M8NA 1AQXA 4MF7A 4EVMA 2MZCA 5ELAA 1Q4JA 3M1GA 4OFMA 3UAPA 3UBLA 3GL5A 5AIXA 2DMMA 5ECPB 2B7JA 1K3OA 2V41A 4KAEA 4K8MA 1OC8A 2N5AA 3EE2A 4N11A 3FHKA 3DRNA 4BVYB 5BMUA 3HVXA 2MMAA 4XS1A 2WS2A 2DLXA 5IIZA 2CZ2A 2N5FA 3ZYWA 5CRGA 4HQSA 2JZSA 4EL1A 2L4QA 3M3MA 7GSSA 1TI1A 4BVYA 3FR3A 3PR8A 2MMNA 5F06A 1GTUA 1GSSA 1M9AA 4AJ8A 2YWIA 5B8AA 2DBCA 4KCAA 5ECOB 1EOHA 3TB2A 2A4HA 4JBBA 2F8FA 1ERWA 4CW9A 3HVVA 1K0MA 3D0ZA 2O7KA 4NV2A 2L4CA 1GSEA 3Q18A 5ID2B 1GH2A 4NWYA 2AV4A 2LJRA 3E9JB 4Q5QA 2PWJA 4F03A 2LKUA 4YQMA 3D4MA 3P2AA 1ZMAA 1NHOA 3TUEA 3QOUA 3RHCA 2G2QA 5D73A 4LA1A 4WBJA 4EE0A 1E2YA 3H93A 2H19A 2VLVA 4POLA 1YZXA 3D21A 3RHBA 1MEKA 4ID0A 3D4TA 4BWSA 4JRRA 5LNKe 1KTEA 3LORA 3CYNA 2OE1A 2WJUA 14GSA 4XRDA 4HDEA 4IVFA 5A4UA 5A4VA 2UZ8A 4OMVA 3IAM2 4HQZA 4RQXA 3VK9A 1XBSA 1G0TA 1X5CA 4LL4B 8GSSA 1M2DA 3FZAA 3MNGA 3I9V2 5HR1A 2NVLA 3DXBA 3ZFBA 2R5GA 5AGYA 4PTSA 3GIXA 4OO4A 2F8AA 4E8HA 4NV5A 5J9BA 5KEJA 4TR0A 4KDUA 5CYYA 4DSSB 2H70A 3ED3A 2KOKA 1GTAA 3EVIA 3UEMA 5DAKB 2GQKA 1PL2A 4GXZA 3F4SA 1EV4A 4DSSA 4ML1A 1QUWA 2K18A 1SKSB 2YV9A 5DALA 3QAGA 4J56E 2H6ZA 1TXXA 1ZYPA 2KUCA 1TK0B 4OWYA 3SWLA 2C8UA 2GDRA 2M72A 4JEDA 4FH8A 3TJGA 3KD0A 1KBNA 3DYRA 2OACA 4K7OA 3A5WA 4I6XA 1A8LA 4MK3A 1SL2B 3ME8A 4K7NA 4K5SA 3TCOA 3A2WA 1GUHA 1M2BA 1F6MC 3HHVA 3HZ4A 1T4ZA 1OC9A 4F0CA 6GSSA 3IRAA 1SL0B 3GKKA 1T1VA 3HJPA 4PXOA 4IS0A 4KNDA 1EOGA 2FHEA 2I3YA 1JLWA 2LRCA 4BVXA 1X9WB 2CZ3A 2YWNA 1W4VA 5D96A 2QKEA 1M9BA 2GSTA 2LTKA 1OKDA 3RAZA 2EIRA 4NHZA 1M2AA 4ZBDA 2PVQA 5CAXA 4I8BA 1PX6A 1GLPA 4JE1A 3FY7A 2FWHA 3EYTA 3KIJA 4ZB9A 3DGQA 2CV4A 3EU3A 5HR0A 1EGRA 1K3YA 2JACA 3HA9A 3TJKA 3EC3A 2K8SA 1J9BA 2A4VA 1S3DA 1XZOA 4KB3A 5IMFA 4EIPA 3LFLA 2YJHA 3GX0A 4X0XA 3A3TA 2O8VB 4J2FA 5EY6A 1O7UA 1WMJA 1A2MA 1HD2A 4V1Ag 4KCEA 2V1MA 3TOUA 4FQUA 4MJBA 4KDYA 4TR1A 1FVKA 4FYCA 1XWCA 2VCVA 3ZIVA 5FWGA 1WWJA 5DVBA 1Z5YE 3TKSC 2H76A 1JZRA 2AYTA 3IK9A 1OC3A 2GQLA 1TJDA 3FR6A 3ZZXA 4RUVA 4KX4A 4FIWA 3HXSA 4CY8A 4ZXGA 2FA4A 1A24A 1UN2A 1FO5A 11GSA 1OYJA 1SD8A 2RIIA 2YZUA 3M9JA 1T3BA 3IA1A 5D9TA 1WOUA 4WR5A 1YEPA 2E2GA 3SBCA 1K3LA 4GSNA 2L6DA 1GSDA 2H6XA 4D73A 1ZL9A 2J9HA 1VGLA 1ACVA 4POMA 1BEDA 3EU4A 3F4RA 3PPUA 5G1KA 1O8WA 1SKRB 1YEXA 1WRYA 5J41A 4RI7A 3UARA 1ZYQB 2R4VA 2H1BA 2C80A 3LWAA 3C1SA 1YQ1A 4EF0A 3W8SA 4G0LA 2C0EA 1U88A 1W89A 4N10A 22GSA 9GSSA 1JZWA 1MDIA 1YKAA 2QA1A 4ZB8A 2V32A 5JCGA 1A2JA 1AQWA 4PUAA 1T4YA 4MCUA 2BJXA 1NW2A 3RPPA 4V2LA 1SU9A 3Q19A 1HYUA 2RLIA 4L0WA 4GQCA 1EP7A 4HJMA 4ZIJA 1J0FA 1A0FA 1DE2A 3CMIA 1EEMA 4XS6A 5B8BA 1HNAA 2X8HA 2X4AA 4MPFA 3GTUB 1WPIA 3VWVA 1IYIA 3GKMA 1SJZA 4BPYA 1PN0A 1EEJA 2F3MA 3TKQA 4ACSA 1UA5A 1MD4A 3H1NA 3MIXA 5J4UA 5COHA 2H0IA 3KGKA 3RPNA 2GSQA 1EWXA 2LNTA 4GTUA 4MF6A 4YH2A 4CHSA 3PGTA 3FKFA 5GSSA 1V2AA 2IJYA 2WGRA 1WE0A 5F0GA 4Q5FA 3CRTA 4LL1B 3BOAA 3DKSA 2H72A 2HT9A 1GNWA 2MBTA 3D22A 4I2UA 4I2TA 5IMZA 1OAZA 1E6BA 3C71A 2HNLA 5EPFA 2JL4A 1BAYA 2XBQA 4TW5A 2HZFA 1Z7RA 3MDKA 1GP1A 5CRHA 3VWXA 2YP6A 3P8WA 1BG5A 4N0VA 2X99A 2IPAA 4IBPA 1Q98A 3ZFLA 2FD3A 2DJJA 5DCHA 4K2XA 3U6VA 5G1LA 5IO2A 5EL8A 5HFGA 3WT2A 4MJEA 3F6DA 4PX1A 1GSUA 5JWRB 1GWCA 3WD6A 2PVOC 5IMAA 2VL2C 3C73A 3VI7A 3LXZA 1AUCA 2PGTA 3G9BA 2VM2A 1X9MB 4TKYA 4LMVA 5BRTA 3QAVA 4TVEA 5ECKB 3R3EA 4MZCA 5GAPD 2K6VA 4Z7XA 2K9FA 2P0GA 1FG4A 4PGTA 5C04A 1URMA 6GSWA 2NPBA 4ZILA 2HRFA 1Y6EA 3AY8A 1XVQA 5IPGA 1ERUA 4ZL8A 2GTUA 3IBHA 3W6GA 2H30A 3ZTLA 3M0FA 5AIVA 4F0BA 2D2ZA 1RQMA 1X0RA 4AJ7A 4YQVA 2DJ2A 3KJYA 1PKWA 1PGTA 1B9YC 4KE3A 2EIOA 1TK8B 3UVTA 2DSAA 1Z9HA 4YAPA 1NHYA 4IW9A 4H86A 1PQNA 5CRWA 5G30A 2KHPA 1JFUA 1FOVA 1JLVA 3DVWA 2FNOA 2R3XA 3RDWA 1Y25A 6GSVA 3US3A 3FMWA 3GH6A 2L5OA 4EO3A 5KN0A 2O89A 4MMMA 1BQ7A 1F3AA 1AIUA 4MA9A 2E2MA 4EIQA 1EP8A 4POKA 6GSYA 2FGXA 1AAZA 2H6YA 1VF4A 4HZ2A 3A2VA 2H75A 2CVBA 1SJIA 3GSSA 3DMLA 2AB6A 3KH7A 5E4WA 5HFKA 3QDNA 2BTOT 1T8EB 4PURA 2F9SA 3U5RE 1ST9A 1QXHA 1M7TA 2FWGA 3IR4A 3MWHA 2I4AA 3MYDA 3HZ8A 1XVWA 1FW1A 3GURA 2KP1A 5GAND 3UOMA 2JSZA 1XFLA 3IK7A 2VCXA 5ID2A 4YKFA 3WGXA 4KSOA 3QD9A 1XXUA 4KDXA 1XWAA 3PH9A 1ZYEA 5FHIA 4MJAA 1F3BA 3KP9A 3FR9A 4K7IA 16GSA 2P5QA 3LJRA 4ISDA 4WKWA 2O87A 2AAWA 2VD0A 2LRNA 2OE3A 3LSZA 3E0UA 1SKWB 5J9CA 5J3RA 2HZEB 3KZQA 4QQ7A 2CAIA 2YWOA 2C0GA 4EKZA 3APSA 4ZL7A 2C4JA 4TXVA 5JCUA 2R0CA 10GSA 3ZL5A 2B3SA 3KMNA 3LEFA 4WF4A 2DKHA 5JWQB 1PL1A 4MZWA 5A4WA 3D6IA 2VL2A 3Q6OA 4DSQA 3C1RA 4HJ2A 2B1KA 1YY7A 3L9VA 1TTZA 4AJ6A 3RBTA 2CT6A 2B5YA 2LSTA 1F37A 5D9WA 1HNCA 4HU9A 4GWRA 3P90A 2FUG2 4JR6A 2VUPA 4ZL9A 3DD3A 1GSFA 2GQMA 1GNEA 2MYGA 1R5AA 1TK5B 2X64A 5DAKA 5B7CA 3VLNA 2FLSA 3D5JA 6GSUA 3ZVJD 5G31A 1ON4A 4ECJA 2PBJA 2C3NA 1THOA 2YN1A 5G2ZA 2H8LA 3WGDA 3NIVA 3CSJA 4XTSA 2CAQA 3CTFA 4TRXA 6GSXA 3WT1A 2PMTA 1PA3A 1U3IA 1UC7A 3L9SA 2NDOA 2JZTA 1T7PB 1LBKA 3HJOA 2LNSA 1ZZYA 2CX3A 1OE8A 4HEA2 1YJ6A 4G19A 4XS4B 2VL3A 3G7JA 4ULXA 4MDCA 2RM5A 2H0GA 1JHBA 2K8VA 1XW6A 3VWUA 1TDIA 2PN8A 3ZVJA 2AHEA 2P5RA 3LXTA 4BWQA 3W8JA 1R4WA 18GSA 1SK1A 4O92A 1EGOA 3G7YA 1WP0A 4G0KA 1ABAA 2NTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GVP A;  2IL3 A;  1AQV A;  1RW1 A;  4NMU A;  4GST A;  2H71 A;  5HR3 A;  1GTI A;  2L5L A;  1XWG A;  4MZB A;  1K0C A;  1GSQ A;  2M80 A;  2ES7 A;  2TRX A;  4WXT A;  2YV7 A;  13GS A;  2J23 A;  3H79 A;  1J08 A;  4G10 A;  4F2I A;  4TR4 A;  3QR6 A;  5KN3 A;  4ILF A;  2VAF A;  2IMK A;  5IOW A;  2ZNM A;  3N5O A;  4XRA A;  5F05 A;  1TRW A;  2OKA A;  3J7Y b;  4Q5R A;  2HFD A;  3UIW A;  4MH2 A;  3TKP A;  5ECQ B;  1N8J A;  1PMT A;  4K0G A;  4ZB6 A;  1Z6M A;  3ZMK A;  1ILO A;  3MSZ A;  2V6K A;  3IV4 A;  3K8N A;  4GF0 A;  5DCG A;  2MMZ A;  4MP4 A;  2HSY A;  1H4O A;  1G6W A;  3EWL A;  1YKC A;  4TXO B;  5ECS A;  4XHM A;  2YJ7 A;  3TKR A;  5C00 A;  5H5S A;  1DSB A;  5F8B A;  3CSH A;  2YNX A;  2WZ9 A;  4TOP A;  5ECL B;  1HQO A;  2HXK A;  3FW2 A;  1FB6 A;  3CTG A;  3GNJ A;  4PQH A;  20GS A;  2B1L A;  1K0B A;  2HE3 A;  1LU4 A;  1NM3 A;  4ML6 A;  5EVO A;  3GA4 A;  3EMP A;  1TRU A;  4DEJ A;  3CSI A;  2HSH A;  2ON5 A;  3KM6 A;  3GRX A;  3HYP A;  3CXG A;  2JU5 A;  2WCI A;  3ERF A;  4IKH A;  1MD3 A;  1G6Y A;  4N0Z A;  2TIR A;  1G7E A;  2H1A A;  2GT5 A;  1V58 A;  5ECM B;  1R26 A;  4L0U A;  4WEY A;  2DJK A;  2QC7 A;  3JCM L;  2B6M A;  1AXD A;  2LEG A;  2XHF A;  2Z9S A;  1ML6 A;  4JU5 A;  4V2M A;  4ZBA A;  4ECB A;  1EV9 A;  3GMF A;  3O3T A;  3GTU A;  3QPM A;  5B6N A;  2HI7 A;  2PUK C;  3UVH A;  4N30 A;  1HNB A;  2L57 A;  3UL3 A;  1Z3E A;  2LQO A;  3F4T A;  2I9H A;  4OFN A;  5CNW A;  3UBK A;  2R6K A;  3GST A;  1CQH A;  5JWO B;  1A23 A;  4XIH A;  5E59 A;  5IPH A;  1FHE A;  2X8G A;  2VOC A;  3LQ7 A;  2LS5 A;  1TP9 A;  5DJM A;  1GUM A;  1K0A A;  2VM1 A;  1YF1 A;  3PIN A;  4MF5 A;  3KTL A;  4F82 A;  2WUL A;  2C0D A;  4O5R A;  4MPG A;  4FO5 A;  3KP8 A;  1PN9 A;  3TRQ A;  1TI3 A;  2EC4 A;  4DSR A;  2HRN A;  5D8I A;  2RM6 A;  3F3Q A;  4GCI A;  3G7I A;  5D9X A;  4MJC A;  5HQP A;  4V1A p;  4PQI A;  3TRX A;  3WYW A;  2ON7 A;  3ISO A;  1GUL A;  1R7H A;  2E0Q A;  3ERW A;  3HJM A;  1NSW A;  3ERG A;  1THX A;  3C8E A;  1PRX A;  4PUF C;  2NBS A;  1XWK A;  3TRP A;  3ZRE A;  3TKS E;  3TJB A;  2RUF A;  4I5Q A;  5CRD A;  3IE3 A;  1GTB A;  3L78 A;  2FA8 A;  4KSM A;  2CVK A;  3I69 A;  1AW9 A;  2C3Q A;  2YWM A;  2VD1 A;  2XPD A;  2ZCT A;  3GHA A;  1XW5 A;  2CVD A;  4L8E A;  3OR5 A;  2IME A;  3GL3 A;  2OBK A;  5IMV A;  3KH9 A;  2RUE A;  5G5E A;  1H75 A;  2GS3 A;  2R37 A;  1XW9 A;  4MH3 A;  4PQ1 A;  2YPM A;  2G0F A;  4G2E A;  2P31 A;  4IGJ A;  5KN2 A;  3TJJ A;  4GQF A;  3QFA C;  1VF1 A;  2B7K A;  2IMF A;  3FRC A;  2FWE A;  3KCM A;  3VI5 A;  2REM A;  1QGV A;  2VCZ A;  2VLU A;  4NAX A;  5CO3 A;  1Z7P A;  2HYX A;  1LJR A;  3QCP A;  4AGS A;  1GL8 A;  1EZK A;  5ECH B;  5F07 A;  4K9Z A;  3H8Q A;  4X1U A;  1ERV A;  2OJL A;  5DQY A;  1PD2 1;  4EDY A;  1YDK A;  1M0U A;  3VWW A;  4OCE A;  4IN0 A;  1RK4 A;  4AF2 A;  2GZY A;  2DIZ A;  1N2A A;  1PX7 A;  2IMI A;  3EIN A;  2H74 A;  5H5Q A;  5CP1 A;  3HKR A;  1BX9 A;  2TRC P;  1OVN A;  1TU8 A;  3IOS A;  2QGV A;  3QAW A;  1DBY A;  1GUK A;  4WET A;  3A2X A;  6GST A;  3GUS A;  4HZ4 A;  4KA0 A;  1DE1 A;  4L5L A;  1QFN A;  1UVZ A;  2YAN A;  4P3Y B;  4IP6 A;  1VF3 A;  1O8X A;  5INY A;  4E8E A;  2I81 A;  3GKN A;  3UMA A;  4QL7 A;  3ZIT A;  4EXJ A;  2QSI A;  3EMX A;  2L59 A;  2B5E A;  2VIM A;  1MDJ A;  2GSR A;  2YCD A;  1SD9 A;  1V98 A;  2GZP A;  5ENU A;  4OD7 A;  3UJ1 A;  5GZZ B;  1DUG A;  3J7Y k;  3CRU A;  2XPE A;  2V2G A;  5HR2 A;  1A8Y A;  2XBI A;  4TR3 A;  3IHQ A;  2DML A;  2DIY A;  1TKD B;  2YOI A;  2I1U A;  3QMX A;  3Q74 A;  2GZZ A;  4PNG A;  4GRF A;  3TJF A;  2HZE A;  1OKT A;  1XCC A;  4WR4 A;  3F9U A;  5DJL A;  4HS1 A;  1V57 A;  2A2R A;  3BJ5 A;  1A0R P;  4IP1 A;  2DC5 A;  5G5F A;  4JZQ A;  3KEB A;  3FZ4 A;  3HCZ A;  1GLQ A;  2C3T A;  3VUR A;  5ECN B;  2C0F A;  2MMO A;  3BCI A;  3APO A;  2O85 A;  2OE0 A;  1VRS D;  4RI6 A;  4LLR A;  2HLS A;  2VL9 A;  1QQ2 A;  1AC1 A;  4JR4 A;  4K0N A;  5ECI B;  2AJQ B;  2IFQ B;  5DAL B;  1V9W A;  4O7H A;  1FAA A;  3QFB C;  2ALB A;  2H1D A;  5GST A;  3MAK A;  3L4N A;  5D93 A;  3EUR A;  3ZIJ A;  2LJK A;  3I6A A;  3N9J A;  2IFQ A;  2WFC A;  1K0D A;  2GSS A;  1BYE A;  3FZ9 A;  4J57 E;  4XCS A;  1GRX A;  5IMD A;  1OC9 B;  2CA8 A;  4Q5N A;  1CQG A;  4HU7 A;  3HY2 A;  2OA7 A;  4O32 A;  1KNG A;  4KH7 A;  2L6C A;  4PNF A;  3F3R A;  2WRT A;  5L71 A;  3GKX A;  4LMW A;  3LGC A;  5AIS A;  5B6M A;  1OE7 A;  4IJI A;  2FY6 A;  1XIY A;  19GS A;  2B5X A;  2LQQ A;  4XS4 A;  1KEB A;  4OCF A;  3HDC A;  1U87 A;  1ERT A;  4NXI A;  2E7P A;  3DIE A;  4HUA A;  5KN1 A;  3TDG A;  3F6F A;  4EDZ A;  1X5D A;  1S3C A;  2IMD A;  2DJ1 A;  2N5B A;  5DBQ A;  2ZUP A;  4GLT A;  3NZN A;  5LCZ A;  3CBU A;  2H1G A;  1FB0 A;  4TR1 B;  1V40 A;  3VPT A;  2CQ9 A;  1XOA A;  1SYR A;  2AUV A;  3GX8 A;  1QK8 A;  1TOF A;  1SYX A;  4EUY A;  2LV3 A;  1B8X A;  4IHU A;  3ZLP A;  3IDV A;  4HOJ A;  1X9S B;  3BD2 A;  2KP2 A;  1FVJ A;  1JZD A;  4NPB A;  4K6X A;  4KGI A;  2PU9 C;  3GFK A;  3IXR A;  5AN1 A;  2H66 A;  2M46 A;  1G7O A;  1SJ6 A;  4CDO A;  5IM9 A;  4ECC A;  3ME7 A;  1O81 A;  3WGE A;  3GYK A;  3HD5 A;  3DWV A;  5ELG A;  1MTC A;  1I5G A;  1F9M A;  1IYH A;  3TGZ A;  1PKZ A;  4D73 B;  5J5N A;  1B4P A;  3FEU A;  3ZML A;  3KXO A;  2PER A;  4EC0 A;  5DQS A;  3L9U A;  1I9D A;  1B9X C;  5CRE A;  3GH9 A;  4G9H A;  2VO4 A;  1WJK A;  5A5K A;  2R2J A;  1PSQ A;  2H01 A;  3DEX A;  4TXO A;  2LUS A;  2VLT A;  1C72 A;  3LYP A;  4POB A;  3APQ A;  3GN3 A;  3KTB A;  1WIK A;  2GT6 A;  5DDL A;  5IQY A;  2LJA A;  2VCQ A;  3VPQ A;  1SK2 A;  4NHW A;  2XC2 A;  2X8C A;  1X5E A;  4GSS A;  3E3E A;  3ZRD A;  3O76 A;  2OAD A;  1K0O A;  3IC4 A;  4X43 A;  2VCT A;  4RQR A;  1VF2 A;  5IO0 A;  5HFI A;  4ZBB A;  3BBY A;  1O73 A;  2H73 A;  2CX4 A;  2DJ3 A;  2F51 A;  2PPT A;  12GS A;  3P7X A;  4FYU A;  4YQU A;  2MBS A;  3FYG A;  2JAD A;  3HVS A;  1XWB A;  2BMX A;  1S3A A;  2H0H A;  1TRS A;  3GV1 A;  1M99 A;  3F8U A;  17GS A;  3VFI A;  3C7M A;  1A2L A;  3O6T A;  5D9V A;  4OFT A;  1TRV A;  3F63 A;  1GSY A;  5ABR A;  2WB9 A;  3IAS 2;  1SEN A;  4IQ1 A;  1QMV A;  1U6T A;  2JSY A;  3F0I A;  2GLR A;  3BCK A;  4V2N A;  3FK8 A;  4FYB A;  1MDK A;  1SK0 A;  1K0N A;  1SL1 B;  2OBI A;  4TN8 A;  2A2S A;  4WF5 A;  2YZH A;  3V1W A;  5LD0 A;  4YAV A;  5JCW A;  1F2E A;  3LG6 A;  1R5P A;  4KW6 A;  3LYK A;  2DJ0 A;  1TW9 A;  4MAB A;  4MLY A;  1ZOF A;  3KMO A;  3NOF A;  1XOB A;  2IIY A;  1ZGN A;  2IN3 A;  2FCH A;  1ZCP A;  1U3A A;  5IMC A;  3R2Q A;  4BL7 A;  5ECR B;  2IWT A;  2C1Y A;  1XPV A;  4IJ3 A;  4OO5 A;  2JZR A;  1O85 A;  2FWF A;  1USB A;  4KUN A;  2V6O A;  5H5R A;  4F9Z A;  3M9K A;  3TKS A;  1T00 A;  3TOT A;  4WBR D;  3IPZ A;  2GGT A;  4BA7 A;  3L0H A;  1TU7 A;  1YF0 A;  2LRT A;  1BJX A;  4IEL A;  1Z6N A;  4I97 A;  2KLX A;  4L5O A;  3H4K A;  2EIQ A;  4IQA A;  4HI7 A;  2WDU A;  2VCW A;  4QL9 A;  1O6J A;  4K1F A;  1JZO A;  3I43 A;  4K2D A;  3S9F A;  4ECI A;  5FT3 A;  1B48 A;  3FZ5 A;  1B4Q A;  4DVC A;  3DVX A;  5IOX A;  3M8N A;  1AQX A;  4MF7 A;  4EVM A;  2MZC A;  5ELA A;  1Q4J A;  3M1G A;  4OFM A;  3UAP A;  3UBL A;  3GL5 A;  5AIX A;  2DMM A;  5ECP B;  2B7J A;  1K3O A;  2V41 A;  4KAE A;  4K8M A;  1OC8 A;  2N5A A;  3EE2 A;  4N11 A;  3FHK A;  3DRN A;  3HVX A;  2MMA A;  4XS1 A;  2WS2 A;  2DLX A;  5IIZ A;  2CZ2 A;  2N5F A;  3ZYW A;  5CRG A;  4HQS A;  2JZS A;  4EL1 A;  2L4Q A;  3M3M A;  7GSS A;  1TI1 A;  4BVY A;  3FR3 A;  3PR8 A;  2MMN A;  5F06 A;  1GTU A;  1GSS A;  1M9A A;  4AJ8 A;  2YWI A;  5B8A A;  2DBC A;  4KCA A;  5ECO B;  1EOH A;  3TB2 A;  4JBB A;  2F8F A;  1ERW A;  4CW9 A;  3HVV A;  1K0M A;  3D0Z A;  2O7K A;  4NV2 A;  2L4C A;  1GSE A;  3Q18 A;  5ID2 B;  1GH2 A;  4NWY A;  2AV4 A;  2LJR A;  3E9J B;  4Q5Q A;  2PWJ A;  4F03 A;  2LKU A;  4YQM A;  3D4M A;  3P2A A;  1ZMA A;  1NHO A;  3TUE A;  3QOU A;  3RHC A;  2G2Q A;  5D73 A;  4LA1 A;  4WBJ A;  4EE0 A;  1E2Y A;  3H93 A;  2H19 A;  2VLV A;  4POL A;  1YZX A;  3D21 A;  3RHB A;  1MEK A;  4ID0 A;  3D4T A;  4BWS A;  4JRR A;  5LNK e;  1KTE A;  3LOR A;  3CYN A;  2OE1 A;  2WJU A;  14GS A;  4XRD A;  4HDE A;  4IVF A;  5A4U A;  5A4V A;  4OMV A;  3IAM 2;  4HQZ A;  4RQX A;  3VK9 A;  1XBS A;  1G0T A;  1X5C A;  4LL4 B;  8GSS A;  1M2D A;  3FZA A;  3MNG A;  3I9V 2;  5HR1 A;  2NVL A;  3DXB A;  3ZFB A;  2R5G A;  5AGY A;  3GIX A;  4OO4 A;  2F8A A;  4E8H A;  4NV5 A;  5J9B A;  5KEJ A;  4TR0 A;  4KDU A;  5CYY A;  4DSS B;  2H70 A;  3ED3 A;  2KOK A;  1GTA A;  3EVI A;  3UEM A;  5DAK B;  2GQK A;  1PL2 A;  4GXZ A;  3F4S A;  1EV4 A;  4DSS A;  4ML1 A;  1QUW A;  2K18 A;  1SKS B;  2YV9 A;  5DAL A;  3QAG A;  4J56 E;  2H6Z A;  1TXX A;  2KUC A;  1TK0 B;  4OWY A;  3SWL A;  2C8U A;  2GDR A;  2M72 A;  4JED A;  4FH8 A;  3TJG A;  3KD0 A;  1KBN A;  3DYR A;  2OAC A;  4K7O A;  3A5W A;  4I6X A;  1A8L A;  4MK3 A;  1SL2 B;  3ME8 A;  4K7N A;  3TCO A;  3A2W A;  1GUH A;  1M2B A;  1F6M C;  3HHV A;  3HZ4 A;  1T4Z A;  1OC9 A;  4F0C A;  6GSS A;  3IRA A;  1SL0 B;  3GKK A;  1T1V A;  3HJP A;  4PXO A;  4IS0 A;  4KND A;  1EOG A;  2FHE A;  2I3Y A;  1JLW A;  2LRC A;  4BVX A;  1X9W B;  2CZ3 A;  2YWN A;  1W4V A;  5D96 A;  2QKE A;  1M9B A;  2GST A;  2LTK A;  1OKD A;  3RAZ A;  2EIR A;  4NHZ A;  1M2A A;  4ZBD A;  2PVQ A;  5CAX A;  4I8B A;  1PX6 A;  1GLP A;  4JE1 A;  3FY7 A;  2FWH A;  3EYT A;  3KIJ A;  4ZB9 A;  3DGQ A;  2CV4 A;  3EU3 A;  5HR0 A;  1EGR A;  1K3Y A;  2JAC A;  3HA9 A;  3TJK A;  3EC3 A;  2K8S A;  1J9B A;  2A4V A;  1S3D A;  1XZO A;  4KB3 A;  5IMF A;  3LFL A;  2YJH A;  3GX0 A;  4X0X A;  3A3T A;  2O8V B;  4J2F A;  5EY6 A;  1O7U A;  1WMJ A;  1A2M A;  1HD2 A;  4V1A g;  4KCE A;  2V1M A;  3TOU A;  4MJB A;  4KDY A;  4TR1 A;  1FVK A;  4FYC A;  1XWC A;  2VCV A;  3ZIV A;  5FWG A;  1WWJ A;  5DVB A;  1Z5Y E;  3TKS C;  2H76 A;  1JZR A;  2AYT A;  3IK9 A;  1OC3 A;  2GQL A;  1TJD A;  3FR6 A;  3ZZX A;  4RUV A;  4KX4 A;  4FIW A;  3HXS A;  4ZXG A;  2FA4 A;  1A24 A;  1UN2 A;  1FO5 A;  11GS A;  1OYJ A;  1SD8 A;  2RII A;  2YZU A;  3M9J A;  1T3B A;  3IA1 A;  5D9T A;  1WOU A;  4WR5 A;  1YEP A;  2E2G A;  3SBC A;  1K3L A;  4GSN A;  2L6D A;  1GSD A;  2H6X A;  4D73 A;  1ZL9 A;  2J9H A;  1VGL A;  1ACV A;  4POM A;  1BED A;  3EU4 A;  3F4R A;  5G1K A;  1O8W A;  1SKR B;  1YEX A;  1WRY A;  5J41 A;  4RI7 A;  3UAR A;  1ZYQ B;  2R4V A;  2H1B A;  2C80 A;  3LWA A;  3C1S A;  1YQ1 A;  4EF0 A;  3W8S A;  2C0E A;  1U88 A;  1W89 A;  4N10 A;  22GS A;  9GSS A;  1JZW A;  1MDI A;  1YKA A;  4ZB8 A;  2V32 A;  5JCG A;  1A2J A;  1AQW A;  4PUA A;  1T4Y A;  4MCU A;  2BJX A;  1NW2 A;  3RPP A;  4V2L A;  1SU9 A;  3Q19 A;  1HYU A;  2RLI A;  4L0W A;  4GQC A;  1EP7 A;  4HJM A;  4ZIJ A;  1J0F A;  1A0F A;  1DE2 A;  3CMI A;  1EEM A;  4XS6 A;  5B8B A;  1HNA A;  2X8H A;  4MPF A;  3GTU B;  1WPI A;  3VWV A;  1IYI A;  3GKM A;  1SJZ A;  4BPY A;  1EEJ A;  2F3M A;  3TKQ A;  4ACS A;  1UA5 A;  1MD4 A;  3H1N A;  5J4U A;  5COH A;  2H0I A;  3KGK A;  3RPN A;  2GSQ A;  1EWX A;  2LNT A;  4GTU A;  4MF6 A;  4YH2 A;  4CHS A;  3PGT A;  3FKF A;  5GSS A;  1V2A A;  2IJY A;  2WGR A;  1WE0 A;  5F0G A;  4Q5F A;  3CRT A;  4LL1 B;  3BOA A;  3DKS A;  2H72 A;  2HT9 A;  1GNW A;  2MBT A;  3D22 A;  4I2U A;  4I2T A;  5IMZ A;  1OAZ A;  1E6B A;  3C71 A;  2HNL A;  5EPF A;  2JL4 A;  1BAY A;  2XBQ A;  4TW5 A;  2HZF A;  1Z7R A;  3MDK A;  1GP1 A;  5CRH A;  3VWX A;  2YP6 A;  3P8W A;  1BG5 A;  4N0V A;  2X99 A;  2IPA A;  4IBP A;  1Q98 A;  3ZFL A;  2FD3 A;  2DJJ A;  5DCH A;  3U6V A;  5G1L A;  5IO2 A;  5EL8 A;  5HFG A;  3WT2 A;  4MJE A;  3F6D A;  4PX1 A;  1GSU A;  5JWR B;  1GWC A;  3WD6 A;  2PVO C;  5IMA A;  2VL2 C;  3C73 A;  3VI7 A;  3LXZ A;  1AUC A;  2PGT A;  3G9B A;  2VM2 A;  1X9M B;  4TKY A;  4LMV A;  3QAV A;  4TVE A;  5ECK B;  4MZC A;  5GAP D;  2K6V A;  4Z7X A;  2K9F A;  2P0G A;  1FG4 A;  4PGT A;  5C04 A;  1URM A;  6GSW A;  2NPB A;  4ZIL A;  2HRF A;  1Y6E A;  3AY8 A;  1XVQ A;  5IPG A;  1ERU A;  4ZL8 A;  2GTU A;  3IBH A;  3W6G A;  2H30 A;  3ZTL A;  3M0F A;  5AIV A;  4F0B A;  2D2Z A;  1RQM A;  1X0R A;  4AJ7 A;  4YQV A;  2DJ2 A;  3KJY A;  1PKW A;  1PGT A;  1B9Y C;  4KE3 A;  2EIO A;  1TK8 B;  3UVT A;  2DSA A;  1Z9H A;  4YAP A;  1NHY A;  4IW9 A;  4H86 A;  1PQN A;  5CRW A;  5G30 A;  2KHP A;  1JFU A;  1FOV A;  1JLV A;  3DVW A;  2FNO A;  2R3X A;  3RDW A;  1Y25 A;  6GSV A;  3US3 A;  3GH6 A;  2L5O A;  4EO3 A;  5KN0 A;  2O89 A;  4MMM A;  1BQ7 A;  1F3A A;  1AIU A;  4MA9 A;  2E2M A;  1EP8 A;  4POK A;  6GSY A;  2FGX A;  1AAZ A;  2H6Y A;  1VF4 A;  4HZ2 A;  3A2V A;  2H75 A;  2CVB A;  1SJI A;  3GSS A;  3DML A;  2AB6 A;  3KH7 A;  5E4W A;  5HFK A;  3QDN A;  2BTO T;  1T8E B;  4PUR A;  2F9S A;  3U5R E;  1ST9 A;  1QXH A;  1M7T A;  2FWG A;  3IR4 A;  3MWH A;  2I4A A;  3HZ8 A;  1XVW A;  1FW1 A;  3GUR A;  2KP1 A;  5GAN D;  3UOM A;  2JSZ A;  1XFL A;  3IK7 A;  2VCX A;  5ID2 A;  3WGX A;  4KSO A;  3QD9 A;  1XXU A;  4KDX A;  1XWA A;  3PH9 A;  1ZYE A;  5FHI A;  4MJA A;  1F3B A;  3KP9 A;  3FR9 A;  4K7I A;  16GS A;  2P5Q A;  3LJR A;  4ISD A;  4WKW A;  2O87 A;  2AAW A;  2VD0 A;  2LRN A;  2OE3 A;  3LSZ A;  3E0U A;  1SKW B;  5J9C A;  5J3R A;  2HZE B;  3KZQ A;  4QQ7 A;  2CAI A;  2YWO A;  2C0G A;  4EKZ A;  3APS A;  4ZL7 A;  2C4J A;  4TXV A;  5JCU A;  10GS A;  3ZL5 A;  2B3S A;  3KMN A;  3LEF A;  4WF4 A;  5JWQ B;  1PL1 A;  4MZW A;  5A4W A;  3D6I A;  2VL2 A;  3Q6O A;  4DSQ A;  3C1R A;  4HJ2 A;  2B1K A;  1YY7 A;  3L9V A;  1TTZ A;  4AJ6 A;  3RBT A;  2CT6 A;  2B5Y A;  2LST A;  1F37 A;  5D9W A;  1HNC A;  4HU9 A;  4GWR A;  3P90 A;  2FUG 2;  4JR6 A;  2VUP A;  4ZL9 A;  3DD3 A;  1GSF A;  2GQM A;  1GNE A;  2MYG A;  1R5A A;  1TK5 B;  2X64 A;  5DAK A;  5B7C A;  3VLN A;  2FLS A;  3D5J A;  6GSU A;  3ZVJ D;  5G31 A;  1ON4 A;  4ECJ A;  2PBJ A;  2C3N A;  1THO A;  2YN1 A;  5G2Z A;  2H8L A;  3WGD A;  3NIV A;  3CSJ A;  4XTS A;  2CAQ A;  3CTF A;  4TRX A;  6GSX A;  3WT1 A;  2PMT A;  1PA3 A;  1U3I A;  1UC7 A;  3L9S A;  2NDO A;  2JZT A;  1T7P B;  1LBK A;  3HJO A;  2LNS A;  1ZZY A;  2CX3 A;  1OE8 A;  4HEA 2;  1YJ6 A;  4G19 A;  4XS4 B;  2VL3 A;  3G7J A;  4ULX A;  4MDC A;  2RM5 A;  2H0G A;  1JHB A;  2K8V A;  1XW6 A;  3VWU A;  1TDI A;  2PN8 A;  3ZVJ A;  2AHE A;  2P5R A;  3LXT A;  4BWQ A;  3W8J A;  1R4W A;  18GS A;  1SK1 A;  4O92 A;  1EGO A;  3G7Y A;  1WP0 A;  1ABA A;  2NTO A; 
#chains in the Genus database with same CATH topology
 2GVP A;  5A2Q I;  2IL3 A;  1AQV A;  1RW1 A;  4NMU A;  4GST A;  2H71 A;  3J80 I;  1XG8 A;  5HR3 A;  1GTI A;  2L5L A;  1XWG A;  4MZB A;  1K0C A;  1GSQ A;  2M80 A;  2ES7 A;  2TRX A;  4WXT A;  2YV7 A;  13GS A;  2J23 A;  3H79 A;  1J08 A;  4G10 A;  4F2I A;  4TR4 A;  3QR6 A;  5KN3 A;  4ILF A;  2VAF A;  2IMK A;  5IOW A;  2ZNM A;  3N5O A;  4XRA A;  5F05 A;  1TRW A;  2OKA A;  3J7Y b;  4Q5R A;  2HFD A;  3UIW A;  4MH2 A;  3TKP A;  5ECQ B;  1N8J A;  1PMT A;  4K0G A;  4ZB6 A;  1Z6M A;  3ZMK A;  1ILO A;  3MSZ A;  2V6K A;  3IV4 A;  3K8N A;  4BIK A;  4YKG A;  4GF0 A;  5DCG A;  2MMZ A;  4MP4 A;  2HSY A;  1H4O A;  1G6W A;  3EWL A;  1YKC A;  4TXO B;  2HRK A;  5ECS A;  4XHM A;  2YJ7 A;  3TKR A;  5C00 A;  5H5S A;  1DSB A;  5F8B A;  3CSH A;  2YNX A;  2WZ9 A;  4TOP A;  5ECL B;  1HQO A;  2HXK A;  3FW2 A;  1FB6 A;  3CTG A;  3GNJ A;  4PQH A;  20GS A;  2B1L A;  1K0B A;  2HE3 A;  5KOX A;  1LU4 A;  1NM3 A;  4ML6 A;  5EVO A;  3GA4 A;  3EMP A;  1TRU A;  4DEJ A;  3CSI A;  2HSH A;  2ON5 A;  3KM6 A;  3GRX A;  3HYP A;  3CXG A;  2JU5 A;  2WCI A;  3ERF A;  4IKH A;  1MD3 A;  4CY6 A;  1G6Y A;  4N0Z A;  2TIR A;  1G7E A;  2H1A A;  2GT5 A;  1V58 A;  5ECM B;  1R26 A;  4L0U A;  4WEY A;  2DJK A;  2QC7 A;  3JCM L;  2B6M A;  1AXD A;  2LEG A;  2XHF A;  2Z9S A;  1ML6 A;  4JU5 A;  4V2M A;  4ZBA A;  4ECB A;  1EV9 A;  3GMF A;  3O3T A;  3GTU A;  3QPM A;  5B6N A;  2HI7 A;  2PUK C;  3UVH A;  4N30 A;  1HNB A;  2L57 A;  3UL3 A;  1Z3E A;  2LQO A;  3F4T A;  2I9H A;  4OFN A;  5CNW A;  3UBK A;  2R6K A;  5KOW A;  3GST A;  1CQH A;  5JWO B;  1A23 A;  4XIH A;  5E59 A;  4Z2T A;  5IPH A;  1FHE A;  2X8G A;  2VOC A;  3LQ7 A;  2LS5 A;  1TP9 A;  5DJM A;  1GUM A;  2R0P A;  1K0A A;  2VM1 A;  1YF1 A;  3PIN A;  4MF5 A;  3KTL A;  4F82 A;  2WUL A;  2C0D A;  4O5R A;  4MPG A;  4FO5 A;  3KP8 A;  1PN9 A;  3TRQ A;  1TI3 A;  2EC4 A;  4DSR A;  2HRN A;  5D8I A;  2RM6 A;  3F3Q A;  4GCI A;  3G7I A;  5D9X A;  4MJC A;  5HQP A;  4V1A p;  4PQI A;  3TRX A;  3WYW A;  2ON7 A;  3ISO A;  4BL7 B;  1GUL A;  1R7H A;  2E0Q A;  3ERW A;  3HJM A;  1NSW A;  3ERG A;  1THX A;  3C8E A;  1PRX A;  4X4J A;  4PUF C;  2NBS A;  1XWK A;  3TRP A;  3ZRE A;  3TKS E;  3TJB A;  2RUF A;  4I5Q A;  5CRD A;  3IE3 A;  1GTB A;  3L78 A;  2FA8 A;  4KSM A;  2CVK A;  3I69 A;  1AW9 A;  2C3Q A;  2YWM A;  2VD1 A;  2XPD A;  2ZCT A;  3GHA A;  3LW9 A;  1XW5 A;  2CVD A;  4L8E A;  3OR5 A;  2IME A;  3A5I A;  3GL3 A;  2OBK A;  5IMV A;  3KH9 A;  2RUE A;  5G5E A;  1H75 A;  2GS3 A;  2R37 A;  1XW9 A;  4Z2U A;  4O5Q A;  4MH3 A;  4PQ1 A;  2YPM A;  2G0F A;  4G2E A;  2P31 A;  4IGJ A;  5KN2 A;  3TJJ A;  4GQF A;  3QFA C;  1VF1 A;  2B7K A;  2IMF A;  3FRC A;  2FWE A;  3KCM A;  3VI5 A;  2QA2 A;  2REM A;  1QGV A;  2VCZ A;  2VLU A;  2A2P A;  4NAX A;  5CO3 A;  1Z7P A;  2HYX A;  1LJR A;  3QCP A;  4AGS A;  1GL8 A;  1EZK A;  5ECH B;  5F07 A;  4K9Z A;  3H8Q A;  3IHG A;  4X1U A;  1ERV A;  2OJL A;  5DQY A;  1PD2 1;  4EDY A;  1YDK A;  1M0U A;  3VWW A;  4OCE A;  4IN0 A;  1RK4 A;  4AF2 A;  2HSM A;  2GZY A;  2DIZ A;  1N2A A;  1PX7 A;  2IMI A;  3EIN A;  2H74 A;  5H5Q A;  5CP1 A;  3HKR A;  1BX9 A;  2TRC P;  1OVN A;  1TU8 A;  3IOS A;  2QGV A;  3QAW A;  1DBY A;  4MNN A;  1GUK A;  4WET A;  3A2X A;  6GST A;  3GUS A;  4HZ4 A;  4KA0 A;  1DE1 A;  4L5L A;  1QFN A;  1UVZ A;  2YAN A;  4P3Y B;  4IP6 A;  1VF3 A;  1O8X A;  5INY A;  4E8E A;  4K5R A;  2I81 A;  3GKN A;  3UMA A;  4QL7 A;  3ZIT A;  4EXJ A;  2QSI A;  3EMX A;  2L59 A;  2B5E A;  2VIM A;  1MDJ A;  2GSR A;  2YCD A;  1SD9 A;  1V98 A;  2GZP A;  5ENU A;  4OD7 A;  3UJ1 A;  5GZZ B;  1DUG A;  3J7Y k;  3CRU A;  4O5U A;  2XPE A;  2V2G A;  5HR2 A;  1A8Y A;  2XBI A;  4TR3 A;  3IHQ A;  2DML A;  2DIY A;  1FOH A;  1TKD B;  2YOI A;  2I1U A;  3QMX A;  3Q74 A;  2GZZ A;  4PNG A;  4GRF A;  3TJF A;  2HZE A;  1OKT A;  1XCC A;  4WR4 A;  3F9U A;  5DJL A;  4HS1 A;  1V57 A;  2A2R A;  3IC8 A;  3BJ5 A;  1A0R P;  4IP1 A;  2DC5 A;  5G5F A;  4JZQ A;  3KEB A;  3FZ4 A;  3HCZ A;  1GLQ A;  2C3T A;  3VUR A;  5ECN B;  2C0F A;  2MMO A;  3BCI A;  3APO A;  5LL6 V;  2O85 A;  2OE0 A;  1VRS D;  4RI6 A;  4LLR A;  2HLS A;  2VL9 A;  1QQ2 A;  1AC1 A;  4JR4 A;  4K0N A;  5ECI B;  2AJQ B;  2IFQ B;  5DAL B;  1V9W A;  4G0I A;  4O7H A;  1FAA A;  3QFB C;  2ALB A;  2H1D A;  5GST A;  3MAK A;  4A5P A;  3L4N A;  5D93 A;  3EUR A;  3ZIJ A;  3EPT A;  2LJK A;  3I6A A;  3N9J A;  2IFQ A;  2WFC A;  1K0D A;  2GSS A;  1BYE A;  3FZ9 A;  4J57 E;  4XCS A;  1GRX A;  5IMD A;  1OC9 B;  2CA8 A;  4Q5N A;  1CQG A;  4HU7 A;  3HY2 A;  4BVX B;  2OA7 A;  4O32 A;  1KNG A;  4KH7 A;  2L6C A;  4PNF A;  3F3R A;  2WRT A;  5L71 A;  2X49 A;  3GKX A;  3LGC A;  4LMW A;  5AIS A;  5B6M A;  1OE7 A;  2HRA A;  4IJI A;  1M3J A;  2FY6 A;  1XIY A;  19GS A;  2B5X A;  4Z2R A;  2LQQ A;  4XS4 A;  1KEB A;  4OCF A;  3HDC A;  5FLX I;  1U87 A;  1ERT A;  4NXI A;  2E7P A;  3DIE A;  4HUA A;  5KN1 A;  3TDG A;  3F6F A;  4EDZ A;  1X5D A;  1S3C A;  2IMD A;  2DJ1 A;  2N5B A;  5DBQ A;  2ZUP A;  4GLT A;  3NZN A;  5LCZ A;  3CBU A;  2H1G A;  1FB0 A;  4TR1 B;  1V40 A;  3VPT A;  2CQ9 A;  1XOA A;  1SYR A;  2AUV A;  3GX8 A;  1QK8 A;  4KF9 A;  1TOF A;  1SYX A;  4EUY A;  2LV3 A;  1B8X A;  4IHU A;  3ZLP A;  3IDV A;  4HOJ A;  1X9S B;  3BD2 A;  2KP2 A;  1FVJ A;  1JZD A;  4NPB A;  4K6X A;  4KGI A;  2PU9 C;  3GFK A;  3IXR A;  5AN1 A;  2H66 A;  2M46 A;  1G7O A;  1SJ6 A;  4CDO A;  5IM9 A;  4ECC A;  3ME7 A;  1O81 A;  3WGE A;  3GYK A;  3HD5 A;  3DWV A;  5ELG A;  1MTC A;  1I5G A;  1F9M A;  1IYH A;  3TGZ A;  1PKZ A;  4D73 B;  5J5N A;  1B4P A;  3FEU A;  3ZML A;  3KXO A;  2PER A;  4EC0 A;  5DQS A;  3L9U A;  1PFO A;  1I9D A;  1B9X C;  5CRE A;  3GH9 A;  1S3R A;  4G9H A;  2VO4 A;  1WJK A;  4ICY A;  5A5K A;  2R2J A;  1PSQ A;  2H01 A;  3DEX A;  4TXO A;  2LUS A;  2VLT A;  1C72 A;  3LYP A;  4POB A;  3APQ A;  3GN3 A;  3KTB A;  1WIK A;  2GT6 A;  5DDL A;  5IQY A;  2LJA A;  2VCQ A;  3VPQ A;  1M3I A;  1SK2 A;  2XC2 A;  4NHW A;  2X8C A;  1X5E A;  4GSS A;  3E3E A;  3ZRD A;  3O76 A;  2OAD A;  1K0O A;  3IC4 A;  4X43 A;  2VCT A;  4RQR A;  1VF2 A;  5IO0 A;  5HFI A;  2R0G A;  4ZBB A;  3BBY A;  1O73 A;  2H73 A;  2CX4 A;  2DJ3 A;  2F51 A;  2PPT A;  12GS A;  3P7X A;  4FYU A;  4YQU A;  2DKI A;  2MBS A;  3FYG A;  2JAD A;  3HVS A;  1XWB A;  2BMX A;  1S3A A;  2H0H A;  1TRS A;  3GV1 A;  1M99 A;  3F8U A;  17GS A;  3VFI A;  3C7M A;  1A2L A;  3O6T A;  5D9V A;  4OFT A;  1TRV A;  3F63 A;  1GSY A;  5ABR A;  2WB9 A;  3IAS 2;  1SEN A;  4IQ1 A;  1QMV A;  1U6T A;  2JSY A;  3F0I A;  2GLR A;  3BCK A;  4V2N A;  3FK8 A;  4FYB A;  1MDK A;  1SK0 A;  1K0N A;  1SL1 B;  2OBI A;  4TN8 A;  2A2S A;  4WF5 A;  2YZH A;  3V1W A;  5LD0 A;  1ZYN A;  4YAV A;  5JCW A;  1F2E A;  3LG6 A;  1R5P A;  4KW6 A;  3LYK A;  2DJ0 A;  1TW9 A;  4MAB A;  4MLY A;  1ZOF A;  3KMO A;  3NOF A;  1XOB A;  2IIY A;  1ZGN A;  2IN3 A;  2FCH A;  1ZCP A;  1U3A A;  5IMC A;  3R2Q A;  4BL7 A;  5ECR B;  2IWT A;  2C1Y A;  1XPV A;  4IJ3 A;  4OO5 A;  2JZR A;  1O85 A;  2FWF A;  1USB A;  4KUN A;  2V6O A;  5H5R A;  4F9Z A;  3M9K A;  3TKS A;  1T00 A;  3TOT A;  4WBR D;  3IPZ A;  2GGT A;  4BA7 A;  3L0H A;  1TU7 A;  1YF0 A;  2LRT A;  1BJX A;  4IEL A;  1Z6N A;  4I97 A;  2KLX A;  4L5O A;  4USS A;  3H4K A;  4IQA A;  2EIQ A;  4HI7 A;  2WDU A;  2VCW A;  4QL9 A;  1O6J A;  4K1F A;  1JZO A;  3I43 A;  4K2D A;  3S9F A;  3HVN A;  4ECI A;  5FT3 A;  1B48 A;  3FZ5 A;  1B4Q A;  4DVC A;  3DVX A;  5IOX A;  3M8N A;  1AQX A;  4MF7 A;  4EVM A;  2MZC A;  5ELA A;  1Q4J A;  3M1G A;  4OFM A;  3UAP A;  3UBL A;  3GL5 A;  5AIX A;  2DMM A;  5ECP B;  2B7J A;  1K3O A;  2V41 A;  4KAE A;  4K8M A;  1OC8 A;  2N5A A;  3EE2 A;  4N11 A;  3FHK A;  3DRN A;  4BVY B;  5BMU A;  3HVX A;  2MMA A;  4XS1 A;  2WS2 A;  2DLX A;  5IIZ A;  2CZ2 A;  2N5F A;  3ZYW A;  5CRG A;  4HQS A;  2JZS A;  4EL1 A;  2L4Q A;  3M3M A;  7GSS A;  1TI1 A;  4BVY A;  3FR3 A;  3PR8 A;  2MMN A;  5F06 A;  1GTU A;  1GSS A;  1M9A A;  4AJ8 A;  2YWI A;  5B8A A;  2DBC A;  4KCA A;  5ECO B;  1EOH A;  3TB2 A;  2A4H A;  4JBB A;  2F8F A;  1ERW A;  4CW9 A;  3HVV A;  1K0M A;  3D0Z A;  2O7K A;  4NV2 A;  2L4C A;  1GSE A;  3Q18 A;  5ID2 B;  1GH2 A;  4NWY A;  2AV4 A;  2LJR A;  3E9J B;  4Q5Q A;  2PWJ A;  4F03 A;  2LKU A;  4YQM A;  3D4M A;  3P2A A;  1ZMA A;  1NHO A;  3TUE A;  3QOU A;  3RHC A;  2G2Q A;  5D73 A;  4LA1 A;  4WBJ A;  4EE0 A;  1E2Y A;  3H93 A;  2H19 A;  2VLV A;  4POL A;  1YZX A;  3D21 A;  3RHB A;  1MEK A;  4ID0 A;  3D4T A;  4BWS A;  4JRR A;  5LNK e;  1KTE A;  3LOR A;  3CYN A;  2OE1 A;  2WJU A;  14GS A;  4XRD A;  4HDE A;  4IVF A;  5A4U A;  5A4V A;  2UZ8 A;  4OMV A;  3IAM 2;  4HQZ A;  4RQX A;  3VK9 A;  1XBS A;  1G0T A;  1X5C A;  4LL4 B;  8GSS A;  1M2D A;  3FZA A;  3MNG A;  3I9V 2;  5HR1 A;  2NVL A;  3DXB A;  3ZFB A;  2R5G A;  5AGY A;  4PTS A;  3GIX A;  4OO4 A;  2F8A A;  4E8H A;  4NV5 A;  5J9B A;  5KEJ A;  4TR0 A;  4KDU A;  5CYY A;  4DSS B;  2H70 A;  3ED3 A;  2KOK A;  1GTA A;  3EVI A;  3UEM A;  5DAK B;  2GQK A;  1PL2 A;  4GXZ A;  3F4S A;  1EV4 A;  4DSS A;  4ML1 A;  1QUW A;  2K18 A;  1SKS B;  2YV9 A;  5DAL A;  3QAG A;  4J56 E;  2H6Z A;  1TXX A;  1ZYP A;  2KUC A;  1TK0 B;  4OWY A;  3SWL A;  2C8U A;  2GDR A;  2M72 A;  4JED A;  4FH8 A;  3TJG A;  3KD0 A;  1KBN A;  3DYR A;  2OAC A;  4K7O A;  3A5W A;  4I6X A;  1A8L A;  4MK3 A;  1SL2 B;  3ME8 A;  4K7N A;  4K5S A;  3TCO A;  3A2W A;  1GUH A;  1M2B A;  1F6M C;  3HHV A;  3HZ4 A;  1T4Z A;  1OC9 A;  4F0C A;  6GSS A;  3IRA A;  1SL0 B;  3GKK A;  1T1V A;  3HJP A;  4PXO A;  4IS0 A;  4KND A;  1EOG A;  2FHE A;  2I3Y A;  1JLW A;  2LRC A;  4BVX A;  1X9W B;  2CZ3 A;  2YWN A;  1W4V A;  5D96 A;  2QKE A;  1M9B A;  2GST A;  2LTK A;  1OKD A;  3RAZ A;  2EIR A;  4NHZ A;  1M2A A;  4ZBD A;  2PVQ A;  5CAX A;  4I8B A;  1PX6 A;  1GLP A;  4JE1 A;  3FY7 A;  2FWH A;  3EYT A;  3KIJ A;  4ZB9 A;  3DGQ A;  2CV4 A;  3EU3 A;  5HR0 A;  1EGR A;  1K3Y A;  2JAC A;  3HA9 A;  3TJK A;  3EC3 A;  2K8S A;  1J9B A;  2A4V A;  1S3D A;  1XZO A;  4KB3 A;  5IMF A;  4EIP A;  3LFL A;  3JAM I;  2YJH A;  3GX0 A;  4X0X A;  3A3T A;  2O8V B;  4J2F A;  5EY6 A;  1O7U A;  1WMJ A;  1A2M A;  1HD2 A;  4V1A g;  4KCE A;  2V1M A;  3TOU A;  4FQU A;  4MJB A;  4KDY A;  4TR1 A;  1FVK A;  4FYC A;  1XWC A;  2VCV A;  3ZIV A;  5FWG A;  1WWJ A;  5DVB A;  1Z5Y E;  3TKS C;  2H76 A;  1JZR A;  2AYT A;  3IK9 A;  1OC3 A;  2GQL A;  1TJD A;  3FR6 A;  3ZZX A;  4RUV A;  4KX4 A;  4FIW A;  3HXS A;  4CY8 A;  4ZXG A;  2FA4 A;  1A24 A;  1UN2 A;  1FO5 A;  11GS A;  1OYJ A;  1SD8 A;  2RII A;  2YZU A;  3M9J A;  1T3B A;  3IA1 A;  5D9T A;  1WOU A;  4WR5 A;  1YEP A;  2E2G A;  3SBC A;  1K3L A;  4GSN A;  2L6D A;  1GSD A;  2H6X A;  4D73 A;  1ZL9 A;  2J9H A;  1VGL A;  1ACV A;  4POM A;  1BED A;  3EU4 A;  3F4R A;  3PPU A;  5G1K A;  1O8W A;  1SKR B;  1YEX A;  1WRY A;  5J41 A;  4RI7 A;  3UAR A;  1ZYQ B;  2R4V A;  2H1B A;  2C80 A;  3LWA A;  3C1S A;  1YQ1 A;  4EF0 A;  3W8S A;  4G0L A;  2C0E A;  1U88 A;  1W89 A;  4N10 A;  22GS A;  9GSS A;  1JZW A;  1MDI A;  1YKA A;  2QA1 A;  4ZB8 A;  2V32 A;  5JCG A;  1A2J A;  1AQW A;  4PUA A;  1T4Y A;  4MCU A;  2BJX A;  1NW2 A;  3RPP A;  4V2L A;  1SU9 A;  3Q19 A;  1HYU A;  2RLI A;  4L0W A;  4GQC A;  4HSC X;  1EP7 A;  4HJM A;  4ZIJ A;  1J0F A;  1A0F A;  1DE2 A;  3CMI A;  1EEM A;  4XS6 A;  5B8B A;  1HNA A;  2X8H A;  2X4A A;  4MPF A;  3GTU B;  1WPI A;  3VWV A;  1IYI A;  3GKM A;  1SJZ A;  4BPY A;  1PN0 A;  1EEJ A;  2F3M A;  3TKQ A;  4ACS A;  1UA5 A;  1MD4 A;  3H1N A;  3MIX A;  5J4U A;  5COH A;  2H0I A;  3KGK A;  3RPN A;  2GSQ A;  1EWX A;  2LNT A;  4GTU A;  4MF6 A;  4YH2 A;  4CHS A;  3PGT A;  3FKF A;  5GSS A;  1V2A A;  2IJY A;  2WGR A;  1WE0 A;  5F0G A;  4Q5F A;  3CRT A;  4LL1 B;  3BOA A;  3DKS A;  2H72 A;  2HT9 A;  1GNW A;  2MBT A;  3D22 A;  4I2U A;  4I2T A;  5IMZ A;  1OAZ A;  1E6B A;  3C71 A;  2HNL A;  5EPF A;  2JL4 A;  1BAY A;  2XBQ A;  4TW5 A;  2HZF A;  1Z7R A;  3MDK A;  1GP1 A;  5CRH A;  3VWX A;  2YP6 A;  3P8W A;  1BG5 A;  4N0V A;  2X99 A;  2IPA A;  4IBP A;  1Q98 A;  3ZFL A;  2FD3 A;  2DJJ A;  5DCH A;  5IT9 I;  4K2X A;  3U6V A;  5G1L A;  5IO2 A;  5EL8 A;  5HFG A;  3WT2 A;  4MJE A;  3F6D A;  4PX1 A;  1GSU A;  5JWR B;  1GWC A;  3WD6 A;  2PVO C;  5IMA A;  2VL2 C;  3C73 A;  3VI7 A;  3LXZ A;  1AUC A;  2PGT A;  3G9B A;  2VM2 A;  1X9M B;  4TKY A;  4LMV A;  5BRT A;  3QAV A;  4TVE A;  5ECK B;  3R3E A;  4MZC A;  5GAP D;  2K6V A;  4Z7X A;  2K9F A;  2P0G A;  1FG4 A;  4PGT A;  5C04 A;  1URM A;  6GSW A;  2NPB A;  4ZIL A;  2HRF A;  1Y6E A;  3AY8 A;  1XVQ A;  5IPG A;  1ERU A;  4ZL8 A;  2GTU A;  3IBH A;  3W6G A;  2H30 A;  3ZTL A;  3M0F A;  5AIV A;  4F0B A;  2D2Z A;  1RQM A;  1X0R A;  4AJ7 A;  4YQV A;  2DJ2 A;  3KJY A;  1PKW A;  1PGT A;  1B9Y C;  4KE3 A;  2EIO A;  1TK8 B;  3UVT A;  2DSA A;  1Z9H A;  4YAP A;  1NHY A;  4IW9 A;  4H86 A;  1PQN A;  5CRW A;  5G30 A;  2KHP A;  1JFU A;  1FOV A;  1JLV A;  3DVW A;  2FNO A;  2R3X A;  3RDW A;  1Y25 A;  6GSV A;  3US3 A;  3FMW A;  3GH6 A;  2L5O A;  4EO3 A;  5KN0 A;  2O89 A;  3J81 I;  4MMM A;  1BQ7 A;  1F3A A;  1AIU A;  4MA9 A;  2E2M A;  4EIQ A;  1EP8 A;  4POK A;  6GSY A;  2FGX A;  1AAZ A;  2H6Y A;  1VF4 A;  4HZ2 A;  3A2V A;  2H75 A;  2CVB A;  1SJI A;  3GSS A;  3DML A;  2AB6 A;  3KH7 A;  5E4W A;  5HFK A;  3QDN A;  2BTO T;  1T8E B;  4PUR A;  2F9S A;  3U5R E;  1ST9 A;  1QXH A;  1M7T A;  2FWG A;  3IR4 A;  3MWH A;  2I4A A;  3MYD A;  3HZ8 A;  1XVW A;  1FW1 A;  3GUR A;  2KP1 A;  5GAN D;  3UOM A;  2JSZ A;  1XFL A;  3IK7 A;  2VCX A;  5ID2 A;  4YKF A;  3WGX A;  4KSO A;  3QD9 A;  1XXU A;  4KDX A;  1XWA A;  3PH9 A;  1ZYE A;  5FHI A;  4MJA A;  1F3B A;  3KP9 A;  3FR9 A;  4K7I A;  16GS A;  2P5Q A;  3LJR A;  4ISD A;  4WKW A;  2O87 A;  2AAW A;  2VD0 A;  2LRN A;  2OE3 A;  3LSZ A;  3E0U A;  1SKW B;  5J9C A;  5J3R A;  2HZE B;  3KZQ A;  4QQ7 A;  2CAI A;  2YWO A;  2C0G A;  4EKZ A;  3APS A;  4ZL7 A;  2C4J A;  4TXV A;  5JCU A;  2R0C A;  10GS A;  3ZL5 A;  2B3S A;  3KMN A;  3LEF A;  4WF4 A;  2DKH A;  5JWQ B;  1PL1 A;  4MZW A;  5A4W A;  3D6I A;  2VL2 A;  3Q6O A;  4DSQ A;  3C1R A;  4HJ2 A;  2B1K A;  1YY7 A;  3L9V A;  1TTZ A;  4AJ6 A;  3RBT A;  2CT6 A;  2B5Y A;  2LST A;  1F37 A;  5D9W A;  1HNC A;  4HU9 A;  4GWR A;  3P90 A;  2FUG 2;  4JR6 A;  2VUP A;  4ZL9 A;  3DD3 A;  1GSF A;  2GQM A;  1GNE A;  2MYG A;  1R5A A;  1TK5 B;  2X64 A;  5DAK A;  5B7C A;  3VLN A;  2FLS A;  3D5J A;  6GSU A;  3ZVJ D;  5G31 A;  1ON4 A;  4ECJ A;  2PBJ A;  2C3N A;  1THO A;  2YN1 A;  5G2Z A;  2H8L A;  3WGD A;  3NIV A;  3CSJ A;  4XTS A;  2CAQ A;  3CTF A;  4TRX A;  6GSX A;  3WT1 A;  2PMT A;  3CQF A;  1PA3 A;  1U3I A;  1UC7 A;  3L9S A;  2NDO A;  2JZT A;  1T7P B;  1LBK A;  3HJO A;  2LNS A;  1ZZY A;  2CX3 A;  1OE8 A;  4HEA 2;  1YJ6 A;  4G19 A;  4XS4 B;  2VL3 A;  3G7J A;  4ULX A;  4MDC A;  2RM5 A;  2H0G A;  1JHB A;  2K8V A;  1XW6 A;  3VWU A;  1TDI A;  2PN8 A;  3ZVJ A;  2AHE A;  2P5R A;  3LXT A;  4BWQ A;  3W8J A;  1R4W A;  18GS A;  1SK1 A;  4O92 A;  1EGO A;  3G7Y A;  1WP0 A;  4G0K A;  1ABA A;  2NTO A; 
#chains in the Genus database with same CATH homology
 2GVP A;  2IL3 A;  1AQV A;  1RW1 A;  4NMU A;  4GST A;  2H71 A;  5HR3 A;  1GTI A;  2L5L A;  1XWG A;  4MZB A;  1K0C A;  1GSQ A;  2M80 A;  2ES7 A;  2TRX A;  4WXT A;  2YV7 A;  13GS A;  2J23 A;  3H79 A;  1J08 A;  4G10 A;  4F2I A;  4TR4 A;  3QR6 A;  5KN3 A;  4ILF A;  2VAF A;  2IMK A;  5IOW A;  2ZNM A;  3N5O A;  4XRA A;  5F05 A;  1TRW A;  2OKA A;  3J7Y b;  4Q5R A;  2HFD A;  3UIW A;  4MH2 A;  3TKP A;  5ECQ B;  1N8J A;  1PMT A;  4K0G A;  4ZB6 A;  1Z6M A;  3ZMK A;  1ILO A;  3MSZ A;  2V6K A;  3IV4 A;  3K8N A;  4YKG A;  4GF0 A;  5DCG A;  2MMZ A;  4MP4 A;  2HSY A;  1H4O A;  1G6W A;  3EWL A;  1YKC A;  4TXO B;  2HRK A;  5ECS A;  4XHM A;  2YJ7 A;  3TKR A;  5C00 A;  5H5S A;  1DSB A;  5F8B A;  3CSH A;  2YNX A;  2WZ9 A;  4TOP A;  5ECL B;  1HQO A;  2HXK A;  3FW2 A;  1FB6 A;  3CTG A;  3GNJ A;  4PQH A;  20GS A;  2B1L A;  1K0B A;  2HE3 A;  5KOX A;  1LU4 A;  1NM3 A;  4ML6 A;  5EVO A;  3GA4 A;  3EMP A;  1TRU A;  4DEJ A;  3CSI A;  2HSH A;  2ON5 A;  3KM6 A;  3GRX A;  3HYP A;  3CXG A;  2JU5 A;  2WCI A;  3ERF A;  4IKH A;  1MD3 A;  4CY6 A;  1G6Y A;  4N0Z A;  2TIR A;  1G7E A;  2H1A A;  2GT5 A;  1V58 A;  5ECM B;  1R26 A;  4L0U A;  4WEY A;  2DJK A;  2QC7 A;  3JCM L;  2B6M A;  1AXD A;  2LEG A;  2XHF A;  2Z9S A;  1ML6 A;  4JU5 A;  4V2M A;  4ZBA A;  4ECB A;  1EV9 A;  3GMF A;  3O3T A;  3GTU A;  3QPM A;  5B6N A;  2HI7 A;  2PUK C;  3UVH A;  4N30 A;  1HNB A;  2L57 A;  3UL3 A;  1Z3E A;  2LQO A;  3F4T A;  2I9H A;  4OFN A;  5CNW A;  3UBK A;  2R6K A;  5KOW A;  3GST A;  1CQH A;  5JWO B;  1A23 A;  4XIH A;  5E59 A;  4Z2T A;  5IPH A;  1FHE A;  2X8G A;  2VOC A;  3LQ7 A;  2LS5 A;  1TP9 A;  5DJM A;  1GUM A;  2R0P A;  1K0A A;  2VM1 A;  1YF1 A;  3PIN A;  4MF5 A;  3KTL A;  4F82 A;  2WUL A;  2C0D A;  4O5R A;  4MPG A;  4FO5 A;  3KP8 A;  1PN9 A;  3TRQ A;  1TI3 A;  2EC4 A;  4DSR A;  2HRN A;  5D8I A;  2RM6 A;  3F3Q A;  4GCI A;  3G7I A;  5D9X A;  4MJC A;  5HQP A;  4V1A p;  4PQI A;  3TRX A;  3WYW A;  2ON7 A;  3ISO A;  4BL7 B;  1GUL A;  1R7H A;  2E0Q A;  3ERW A;  3HJM A;  1NSW A;  3ERG A;  1THX A;  3C8E A;  1PRX A;  4X4J A;  4PUF C;  2NBS A;  1XWK A;  3TRP A;  3ZRE A;  3TKS E;  3TJB A;  2RUF A;  4I5Q A;  5CRD A;  3IE3 A;  1GTB A;  3L78 A;  2FA8 A;  4KSM A;  2CVK A;  3I69 A;  1AW9 A;  2C3Q A;  2YWM A;  2VD1 A;  2XPD A;  2ZCT A;  3GHA A;  3LW9 A;  1XW5 A;  2CVD A;  4L8E A;  3OR5 A;  2IME A;  3A5I A;  3GL3 A;  2OBK A;  5IMV A;  3KH9 A;  2RUE A;  5G5E A;  1H75 A;  2GS3 A;  2R37 A;  1XW9 A;  4Z2U A;  4O5Q A;  4MH3 A;  4PQ1 A;  2YPM A;  2G0F A;  4G2E A;  2P31 A;  4IGJ A;  5KN2 A;  3TJJ A;  4GQF A;  3QFA C;  1VF1 A;  2B7K A;  2IMF A;  3FRC A;  2FWE A;  3KCM A;  3VI5 A;  2QA2 A;  2REM A;  1QGV A;  2VCZ A;  2VLU A;  2A2P A;  4NAX A;  5CO3 A;  1Z7P A;  2HYX A;  1LJR A;  3QCP A;  4AGS A;  1GL8 A;  1EZK A;  5ECH B;  5F07 A;  4K9Z A;  3H8Q A;  3IHG A;  4X1U A;  1ERV A;  2OJL A;  5DQY A;  1PD2 1;  4EDY A;  1YDK A;  1M0U A;  3VWW A;  4OCE A;  4IN0 A;  1RK4 A;  4AF2 A;  2HSM A;  2GZY A;  2DIZ A;  1N2A A;  1PX7 A;  2IMI A;  3EIN A;  2H74 A;  5H5Q A;  5CP1 A;  3HKR A;  1BX9 A;  2TRC P;  1OVN A;  1TU8 A;  3IOS A;  2QGV A;  3QAW A;  1DBY A;  4MNN A;  1GUK A;  4WET A;  3A2X A;  6GST A;  3GUS A;  4HZ4 A;  4KA0 A;  1DE1 A;  4L5L A;  1QFN A;  1UVZ A;  2YAN A;  4P3Y B;  4IP6 A;  1VF3 A;  1O8X A;  5INY A;  4E8E A;  4K5R A;  2I81 A;  3GKN A;  3UMA A;  4QL7 A;  3ZIT A;  4EXJ A;  2QSI A;  3EMX A;  2L59 A;  2B5E A;  2VIM A;  1MDJ A;  2GSR A;  2YCD A;  1SD9 A;  1V98 A;  2GZP A;  5ENU A;  4OD7 A;  3UJ1 A;  5GZZ B;  1DUG A;  3J7Y k;  3CRU A;  4O5U A;  2XPE A;  2V2G A;  5HR2 A;  1A8Y A;  2XBI A;  4TR3 A;  3IHQ A;  2DML A;  2DIY A;  1FOH A;  1TKD B;  2YOI A;  2I1U A;  3QMX A;  3Q74 A;  2GZZ A;  4PNG A;  4GRF A;  3TJF A;  2HZE A;  1OKT A;  1XCC A;  4WR4 A;  3F9U A;  5DJL A;  4HS1 A;  1V57 A;  2A2R A;  3IC8 A;  3BJ5 A;  1A0R P;  4IP1 A;  2DC5 A;  5G5F A;  4JZQ A;  3KEB A;  3FZ4 A;  3HCZ A;  1GLQ A;  2C3T A;  3VUR A;  5ECN B;  2C0F A;  2MMO A;  3BCI A;  3APO A;  2O85 A;  2OE0 A;  1VRS D;  4RI6 A;  4LLR A;  2HLS A;  2VL9 A;  1QQ2 A;  1AC1 A;  4JR4 A;  4K0N A;  5ECI B;  2AJQ B;  2IFQ B;  5DAL B;  1V9W A;  4G0I A;  4O7H A;  1FAA A;  3QFB C;  2ALB A;  2H1D A;  5GST A;  3MAK A;  4A5P A;  3L4N A;  5D93 A;  3EUR A;  3ZIJ A;  3EPT A;  2LJK A;  3I6A A;  3N9J A;  2IFQ A;  2WFC A;  1K0D A;  2GSS A;  1BYE A;  3FZ9 A;  4J57 E;  4XCS A;  1GRX A;  5IMD A;  1OC9 B;  2CA8 A;  4Q5N A;  1CQG A;  4HU7 A;  3HY2 A;  4BVX B;  2OA7 A;  4O32 A;  1KNG A;  4KH7 A;  2L6C A;  4PNF A;  3F3R A;  2WRT A;  5L71 A;  2X49 A;  3GKX A;  3LGC A;  4LMW A;  5AIS A;  5B6M A;  1OE7 A;  2HRA A;  4IJI A;  2FY6 A;  1XIY A;  19GS A;  2B5X A;  4Z2R A;  2LQQ A;  4XS4 A;  1KEB A;  4OCF A;  3HDC A;  1U87 A;  1ERT A;  4NXI A;  2E7P A;  3DIE A;  4HUA A;  5KN1 A;  3TDG A;  3F6F A;  4EDZ A;  1X5D A;  1S3C A;  2IMD A;  2DJ1 A;  2N5B A;  5DBQ A;  2ZUP A;  4GLT A;  3NZN A;  5LCZ A;  3CBU A;  2H1G A;  1FB0 A;  4TR1 B;  1V40 A;  3VPT A;  2CQ9 A;  1XOA A;  1SYR A;  2AUV A;  3GX8 A;  1QK8 A;  4KF9 A;  1TOF A;  1SYX A;  4EUY A;  2LV3 A;  1B8X A;  4IHU A;  3ZLP A;  3IDV A;  4HOJ A;  1X9S B;  3BD2 A;  2KP2 A;  1FVJ A;  1JZD A;  4NPB A;  4K6X A;  4KGI A;  2PU9 C;  3GFK A;  3IXR A;  5AN1 A;  2H66 A;  2M46 A;  1G7O A;  1SJ6 A;  4CDO A;  5IM9 A;  4ECC A;  3ME7 A;  1O81 A;  3WGE A;  3GYK A;  3HD5 A;  3DWV A;  5ELG A;  1MTC A;  1I5G A;  1F9M A;  1IYH A;  3TGZ A;  1PKZ A;  4D73 B;  5J5N A;  1B4P A;  3FEU A;  3ZML A;  3KXO A;  2PER A;  4EC0 A;  5DQS A;  3L9U A;  1I9D A;  1B9X C;  5CRE A;  3GH9 A;  4G9H A;  2VO4 A;  1WJK A;  4ICY A;  5A5K A;  2R2J A;  1PSQ A;  2H01 A;  3DEX A;  4TXO A;  2LUS A;  2VLT A;  1C72 A;  3LYP A;  4POB A;  3APQ A;  3GN3 A;  3KTB A;  1WIK A;  2GT6 A;  5DDL A;  5IQY A;  2LJA A;  2VCQ A;  3VPQ A;  1SK2 A;  4NHW A;  2XC2 A;  2X8C A;  1X5E A;  4GSS A;  3E3E A;  3ZRD A;  3O76 A;  2OAD A;  1K0O A;  3IC4 A;  4X43 A;  2VCT A;  4RQR A;  1VF2 A;  5IO0 A;  5HFI A;  2R0G A;  4ZBB A;  3BBY A;  1O73 A;  2H73 A;  2CX4 A;  2DJ3 A;  2F51 A;  2PPT A;  12GS A;  3P7X A;  4FYU A;  4YQU A;  2DKI A;  2MBS A;  3FYG A;  2JAD A;  3HVS A;  1XWB A;  2BMX A;  1S3A A;  2H0H A;  1TRS A;  3GV1 A;  1M99 A;  3F8U A;  17GS A;  3VFI A;  3C7M A;  1A2L A;  3O6T A;  5D9V A;  4OFT A;  1TRV A;  3F63 A;  1GSY A;  5ABR A;  2WB9 A;  3IAS 2;  1SEN A;  4IQ1 A;  1QMV A;  1U6T A;  2JSY A;  3F0I A;  2GLR A;  3BCK A;  4V2N A;  3FK8 A;  4FYB A;  1MDK A;  1SK0 A;  1K0N A;  1SL1 B;  2OBI A;  4TN8 A;  2A2S A;  4WF5 A;  2YZH A;  3V1W A;  5LD0 A;  1ZYN A;  4YAV A;  5JCW A;  1F2E A;  3LG6 A;  1R5P A;  4KW6 A;  3LYK A;  2DJ0 A;  1TW9 A;  4MAB A;  4MLY A;  1ZOF A;  3KMO A;  3NOF A;  1XOB A;  2IIY A;  1ZGN A;  2IN3 A;  2FCH A;  1ZCP A;  1U3A A;  5IMC A;  3R2Q A;  4BL7 A;  5ECR B;  2IWT A;  2C1Y A;  1XPV A;  4IJ3 A;  4OO5 A;  2JZR A;  1O85 A;  2FWF A;  1USB A;  4KUN A;  2V6O A;  5H5R A;  4F9Z A;  3M9K A;  3TKS A;  1T00 A;  3TOT A;  4WBR D;  3IPZ A;  2GGT A;  4BA7 A;  3L0H A;  1TU7 A;  1YF0 A;  2LRT A;  1BJX A;  4IEL A;  1Z6N A;  4I97 A;  2KLX A;  4L5O A;  4USS A;  3H4K A;  4IQA A;  2EIQ A;  4HI7 A;  2WDU A;  2VCW A;  4QL9 A;  1O6J A;  4K1F A;  1JZO A;  3I43 A;  4K2D A;  3S9F A;  4ECI A;  5FT3 A;  1B48 A;  3FZ5 A;  1B4Q A;  4DVC A;  3DVX A;  5IOX A;  3M8N A;  1AQX A;  4MF7 A;  4EVM A;  2MZC A;  5ELA A;  1Q4J A;  3M1G A;  4OFM A;  3UAP A;  3UBL A;  3GL5 A;  5AIX A;  2DMM A;  5ECP B;  2B7J A;  1K3O A;  2V41 A;  4KAE A;  4K8M A;  1OC8 A;  2N5A A;  3EE2 A;  4N11 A;  3FHK A;  3DRN A;  4BVY B;  5BMU A;  3HVX A;  2MMA A;  4XS1 A;  2WS2 A;  2DLX A;  5IIZ A;  2CZ2 A;  2N5F A;  3ZYW A;  5CRG A;  4HQS A;  2JZS A;  4EL1 A;  2L4Q A;  3M3M A;  7GSS A;  1TI1 A;  4BVY A;  3FR3 A;  3PR8 A;  2MMN A;  5F06 A;  1GTU A;  1GSS A;  1M9A A;  4AJ8 A;  2YWI A;  5B8A A;  2DBC A;  4KCA A;  5ECO B;  1EOH A;  3TB2 A;  2A4H A;  4JBB A;  2F8F A;  1ERW A;  4CW9 A;  3HVV A;  1K0M A;  3D0Z A;  2O7K A;  4NV2 A;  2L4C A;  1GSE A;  3Q18 A;  5ID2 B;  1GH2 A;  4NWY A;  2AV4 A;  2LJR A;  3E9J B;  4Q5Q A;  2PWJ A;  4F03 A;  2LKU A;  4YQM A;  3D4M A;  3P2A A;  1ZMA A;  1NHO A;  3TUE A;  3QOU A;  3RHC A;  2G2Q A;  5D73 A;  4LA1 A;  4WBJ A;  4EE0 A;  1E2Y A;  3H93 A;  2H19 A;  2VLV A;  4POL A;  1YZX A;  3D21 A;  3RHB A;  1MEK A;  4ID0 A;  3D4T A;  4BWS A;  4JRR A;  5LNK e;  1KTE A;  3LOR A;  3CYN A;  2OE1 A;  2WJU A;  14GS A;  4XRD A;  4HDE A;  4IVF A;  5A4U A;  5A4V A;  2UZ8 A;  4OMV A;  3IAM 2;  4HQZ A;  4RQX A;  3VK9 A;  1XBS A;  1G0T A;  1X5C A;  4LL4 B;  8GSS A;  1M2D A;  3FZA A;  3MNG A;  3I9V 2;  5HR1 A;  2NVL A;  3DXB A;  3ZFB A;  2R5G A;  5AGY A;  4PTS A;  3GIX A;  4OO4 A;  2F8A A;  4E8H A;  4NV5 A;  5J9B A;  5KEJ A;  4TR0 A;  4KDU A;  5CYY A;  4DSS B;  2H70 A;  3ED3 A;  2KOK A;  1GTA A;  3EVI A;  3UEM A;  5DAK B;  2GQK A;  1PL2 A;  4GXZ A;  3F4S A;  1EV4 A;  4DSS A;  4ML1 A;  1QUW A;  2K18 A;  1SKS B;  2YV9 A;  5DAL A;  3QAG A;  4J56 E;  2H6Z A;  1TXX A;  1ZYP A;  2KUC A;  1TK0 B;  4OWY A;  3SWL A;  2C8U A;  2GDR A;  2M72 A;  4JED A;  4FH8 A;  3TJG A;  3KD0 A;  1KBN A;  3DYR A;  2OAC A;  4K7O A;  3A5W A;  4I6X A;  1A8L A;  4MK3 A;  1SL2 B;  3ME8 A;  4K7N A;  4K5S A;  3TCO A;  3A2W A;  1GUH A;  1M2B A;  1F6M C;  3HHV A;  3HZ4 A;  1T4Z A;  1OC9 A;  4F0C A;  6GSS A;  3IRA A;  1SL0 B;  3GKK A;  1T1V A;  3HJP A;  4PXO A;  4IS0 A;  4KND A;  1EOG A;  2FHE A;  2I3Y A;  1JLW A;  2LRC A;  4BVX A;  1X9W B;  2CZ3 A;  2YWN A;  1W4V A;  5D96 A;  2QKE A;  1M9B A;  2GST A;  2LTK A;  1OKD A;  3RAZ A;  2EIR A;  4NHZ A;  1M2A A;  4ZBD A;  2PVQ A;  5CAX A;  4I8B A;  1PX6 A;  1GLP A;  4JE1 A;  3FY7 A;  2FWH A;  3EYT A;  3KIJ A;  4ZB9 A;  3DGQ A;  2CV4 A;  3EU3 A;  5HR0 A;  1EGR A;  1K3Y A;  2JAC A;  3HA9 A;  3TJK A;  3EC3 A;  2K8S A;  1J9B A;  2A4V A;  1S3D A;  1XZO A;  4KB3 A;  5IMF A;  4EIP A;  3LFL A;  2YJH A;  3GX0 A;  4X0X A;  3A3T A;  2O8V B;  4J2F A;  5EY6 A;  1O7U A;  1WMJ A;  1A2M A;  1HD2 A;  4V1A g;  4KCE A;  2V1M A;  3TOU A;  4FQU A;  4MJB A;  4KDY A;  4TR1 A;  1FVK A;  4FYC A;  1XWC A;  2VCV A;  3ZIV A;  5FWG A;  1WWJ A;  5DVB A;  1Z5Y E;  3TKS C;  2H76 A;  1JZR A;  2AYT A;  3IK9 A;  1OC3 A;  2GQL A;  1TJD A;  3FR6 A;  3ZZX A;  4RUV A;  4KX4 A;  4FIW A;  3HXS A;  4CY8 A;  4ZXG A;  2FA4 A;  1A24 A;  1UN2 A;  1FO5 A;  11GS A;  1OYJ A;  1SD8 A;  2RII A;  2YZU A;  3M9J A;  1T3B A;  3IA1 A;  5D9T A;  1WOU A;  4WR5 A;  1YEP A;  2E2G A;  3SBC A;  1K3L A;  4GSN A;  2L6D A;  1GSD A;  2H6X A;  4D73 A;  1ZL9 A;  2J9H A;  1VGL A;  1ACV A;  4POM A;  1BED A;  3EU4 A;  3F4R A;  3PPU A;  5G1K A;  1O8W A;  1SKR B;  1YEX A;  1WRY A;  5J41 A;  4RI7 A;  3UAR A;  1ZYQ B;  2R4V A;  2H1B A;  2C80 A;  3LWA A;  3C1S A;  1YQ1 A;  4EF0 A;  3W8S A;  4G0L A;  2C0E A;  1U88 A;  1W89 A;  4N10 A;  22GS A;  9GSS A;  1JZW A;  1MDI A;  1YKA A;  2QA1 A;  4ZB8 A;  2V32 A;  5JCG A;  1A2J A;  1AQW A;  4PUA A;  1T4Y A;  4MCU A;  2BJX A;  1NW2 A;  3RPP A;  4V2L A;  1SU9 A;  3Q19 A;  1HYU A;  2RLI A;  4L0W A;  4GQC A;  1EP7 A;  4HJM A;  4ZIJ A;  1J0F A;  1A0F A;  1DE2 A;  3CMI A;  1EEM A;  4XS6 A;  5B8B A;  1HNA A;  2X8H A;  2X4A A;  4MPF A;  3GTU B;  1WPI A;  3VWV A;  1IYI A;  3GKM A;  1SJZ A;  4BPY A;  1PN0 A;  1EEJ A;  2F3M A;  3TKQ A;  4ACS A;  1UA5 A;  1MD4 A;  3H1N A;  3MIX A;  5J4U A;  5COH A;  2H0I A;  3KGK A;  3RPN A;  2GSQ A;  1EWX A;  2LNT A;  4GTU A;  4MF6 A;  4YH2 A;  4CHS A;  3PGT A;  3FKF A;  5GSS A;  1V2A A;  2IJY A;  2WGR A;  1WE0 A;  5F0G A;  4Q5F A;  3CRT A;  4LL1 B;  3BOA A;  3DKS A;  2H72 A;  2HT9 A;  1GNW A;  2MBT A;  3D22 A;  4I2U A;  4I2T A;  5IMZ A;  1OAZ A;  1E6B A;  3C71 A;  2HNL A;  5EPF A;  2JL4 A;  1BAY A;  2XBQ A;  4TW5 A;  2HZF A;  1Z7R A;  3MDK A;  1GP1 A;  5CRH A;  3VWX A;  2YP6 A;  3P8W A;  1BG5 A;  4N0V A;  2X99 A;  2IPA A;  4IBP A;  1Q98 A;  3ZFL A;  2FD3 A;  2DJJ A;  5DCH A;  4K2X A;  3U6V A;  5G1L A;  5IO2 A;  5EL8 A;  5HFG A;  3WT2 A;  4MJE A;  3F6D A;  4PX1 A;  1GSU A;  5JWR B;  1GWC A;  3WD6 A;  2PVO C;  5IMA A;  2VL2 C;  3C73 A;  3VI7 A;  3LXZ A;  1AUC A;  2PGT A;  3G9B A;  2VM2 A;  1X9M B;  4TKY A;  4LMV A;  5BRT A;  3QAV A;  4TVE A;  5ECK B;  3R3E A;  4MZC A;  5GAP D;  2K6V A;  4Z7X A;  2K9F A;  2P0G A;  1FG4 A;  4PGT A;  5C04 A;  1URM A;  6GSW A;  2NPB A;  4ZIL A;  2HRF A;  1Y6E A;  3AY8 A;  1XVQ A;  5IPG A;  1ERU A;  4ZL8 A;  2GTU A;  3IBH A;  3W6G A;  2H30 A;  3ZTL A;  3M0F A;  5AIV A;  4F0B A;  2D2Z A;  1RQM A;  1X0R A;  4AJ7 A;  4YQV A;  2DJ2 A;  3KJY A;  1PKW A;  1PGT A;  1B9Y C;  4KE3 A;  2EIO A;  1TK8 B;  3UVT A;  2DSA A;  1Z9H A;  4YAP A;  1NHY A;  4IW9 A;  4H86 A;  1PQN A;  5CRW A;  5G30 A;  2KHP A;  1JFU A;  1FOV A;  1JLV A;  3DVW A;  2FNO A;  2R3X A;  3RDW A;  1Y25 A;  6GSV A;  3US3 A;  3FMW A;  3GH6 A;  2L5O A;  4EO3 A;  5KN0 A;  2O89 A;  4MMM A;  1BQ7 A;  1F3A A;  1AIU A;  4MA9 A;  2E2M A;  4EIQ A;  1EP8 A;  4POK A;  6GSY A;  2FGX A;  1AAZ A;  2H6Y A;  1VF4 A;  4HZ2 A;  3A2V A;  2H75 A;  2CVB A;  1SJI A;  3GSS A;  3DML A;  2AB6 A;  3KH7 A;  5E4W A;  5HFK A;  3QDN A;  2BTO T;  1T8E B;  4PUR A;  2F9S A;  3U5R E;  1ST9 A;  1QXH A;  1M7T A;  2FWG A;  3IR4 A;  3MWH A;  2I4A A;  3MYD A;  3HZ8 A;  1XVW A;  1FW1 A;  3GUR A;  2KP1 A;  5GAN D;  3UOM A;  2JSZ A;  1XFL A;  3IK7 A;  2VCX A;  5ID2 A;  4YKF A;  3WGX A;  4KSO A;  3QD9 A;  1XXU A;  4KDX A;  1XWA A;  3PH9 A;  1ZYE A;  5FHI A;  4MJA A;  1F3B A;  3KP9 A;  3FR9 A;  4K7I A;  16GS A;  2P5Q A;  3LJR A;  4ISD A;  4WKW A;  2O87 A;  2AAW A;  2VD0 A;  2LRN A;  2OE3 A;  3LSZ A;  3E0U A;  1SKW B;  5J9C A;  5J3R A;  2HZE B;  3KZQ A;  4QQ7 A;  2CAI A;  2YWO A;  2C0G A;  4EKZ A;  3APS A;  4ZL7 A;  2C4J A;  4TXV A;  5JCU A;  2R0C A;  10GS A;  3ZL5 A;  2B3S A;  3KMN A;  3LEF A;  4WF4 A;  2DKH A;  5JWQ B;  1PL1 A;  4MZW A;  5A4W A;  3D6I A;  2VL2 A;  3Q6O A;  4DSQ A;  3C1R A;  4HJ2 A;  2B1K A;  1YY7 A;  3L9V A;  1TTZ A;  4AJ6 A;  3RBT A;  2CT6 A;  2B5Y A;  2LST A;  1F37 A;  5D9W A;  1HNC A;  4HU9 A;  4GWR A;  3P90 A;  2FUG 2;  4JR6 A;  2VUP A;  4ZL9 A;  3DD3 A;  1GSF A;  2GQM A;  1GNE A;  2MYG A;  1R5A A;  1TK5 B;  2X64 A;  5DAK A;  5B7C A;  3VLN A;  2FLS A;  3D5J A;  6GSU A;  3ZVJ D;  5G31 A;  1ON4 A;  4ECJ A;  2PBJ A;  2C3N A;  1THO A;  2YN1 A;  5G2Z A;  2H8L A;  3WGD A;  3NIV A;  3CSJ A;  4XTS A;  2CAQ A;  3CTF A;  4TRX A;  6GSX A;  3WT1 A;  2PMT A;  1PA3 A;  1U3I A;  1UC7 A;  3L9S A;  2NDO A;  2JZT A;  1T7P B;  1LBK A;  3HJO A;  2LNS A;  1ZZY A;  2CX3 A;  1OE8 A;  4HEA 2;  1YJ6 A;  4G19 A;  4XS4 B;  2VL3 A;  3G7J A;  4ULX A;  4MDC A;  2RM5 A;  2H0G A;  1JHB A;  2K8V A;  1XW6 A;  3VWU A;  1TDI A;  2PN8 A;  3ZVJ A;  2AHE A;  2P5R A;  3LXT A;  4BWQ A;  3W8J A;  1R4W A;  18GS A;  1SK1 A;  4O92 A;  1EGO A;  3G7Y A;  1WP0 A;  4G0K A;  1ABA A;  2NTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...