2N5BA

Structures of the oxidized state of the mutant d24a of yeast thioredoxin 1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
MVTQFKTASEFDSAIAQDKLVVVAFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin-1
publication title Structures of the reduced and oxidized state of the mutant D24A of yeast thioredoxin 1: insights into the mechanism for the closing of the water cavity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 26
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2n5bA00
2B7KA 2L57A 6GSYA 2FUG2 2MBTA 4IJIA 5AN1A 3FHKA 2JZRA 6GSTA 2WB9A 2VCXA 3QR6A 1PSQA 17GSA 4JU5A 1YF0A 2OE0A 3DYRA 4MLYA 6GSUA 1QGVA 1T00A 4XS1A 2WCIA 4K1FA 1EWXA 2X99A 5J9CA 3LSZA 2PBJA 2H75A 1TK8B 1GUHA 2I81A 1GTUA 1PA3A 2FA4A 1TK5B 5DALA 5IMFA 4NHZA 1GUMA 4ULXA 5DDLA 2HI7A 4V2LA 5D8IA 1XOBA 3VPTA 2D2ZA 5HFGA 2VCWA 1YJ6A 4I97A 4WBJA 2ZCTA 3ISOA 1U3AA 3ZRDA 3O76A 1NM3A 1GULA 2DLXA 3GL3A 5JWRB 5JWQB 3TJFA 5DJLA 2VCQA 2N5AA 1OC3A 4H86A 2C4JA 2BTOT 2V41A 2BMXA 2CV4A 1XWBA 1FG4A 3US3A 4RI7A 4WF4A 2E7PA 3ZMKA 1FVJA 1YY7A 1XW9A 1ZL9A 2J9HA 4O7HA 5AISA 2YANA 3GX8A 1EEMA 3ZITA 1SYXA 5FHIA 3PH9A 3UBKA 1XWAA 4Q5FA 1S3AA 4MA9A 2LRCA 1F37A 2LKUA 2GTUA 1Z6MA 5GAND 2C0GA 2HNLA 1TRVA 2VAFA 4NXIA 4J2FA 1THOA 3H79A 3CRTA 5HR0A 2HRFA 2DJ0A 4HQSA 4L0WA 2VUPA 1X5DA 1ZMAA 5AGYA 4PNGA 3CRUA 3LORA 5A4WA 1GTIA 1YZXA 2GGTA 1MD3A 1XVWA 3ZIVA 3Q6OA 5G1KA 4XRDA 5D9TA 3D4TA 2A2SA 4XS4B 3E0UA 1KNGA 1TW9A 2LNSA 2GSSA 3RDWA 2VLTA 3QFBC 3DKSA 4DSQA 3H93A 2L4QA 1QQ2A 5D9VA 2H6XA 3CYNA 3E9JB 5IMVA 4EO3A 2WGRA 3LYKA 4N0ZA 1XWGA 5IPGA 2YJHA 1EZKA 2GT5A 4YAPA 3GSSA 4KE3A 3CSHA 2FWHA 2VM1A 1ERWA 3HVSA 3CBUA 4HI7A 2NPBA 1O8WA 1X9MB 4ZB8A 4POMA 1EP8A 2R37A 4IBPA 4ZIJA 4KDXA 3UVTA 3IV4A 3LWAA 5IOXA 1FVKA 5JCWA 4WBRD 1K0NA 1X0RA 2IMEA 3LXZA 1FO5A 2GS3A 2YP6A 3HCZA 1DUGA 5D93A 4KSMA 1JLVA 2XBQA 4PQHA 3WD6A 2H71A 4K0NA 22GSA 5JCGA 3HD5A 2X8CA 2HZEB 5DCGA 4GRFA 1GSDA 1VF4A 1PRXA 2AHEA 1YEXA 1ILOA 1Y6EA 3KMNA 2V32A 2IIYA 7GSSA 1YQ1A 2YJ7A 3KMOA 1PL2A 2OADA 1QFNA 2H01A 4FYCA 3UJ1A 2OBIA 3QAWA 3EWLA 3QD9A 3EC3A 4YQVA 2VCTA 2PWJA 5FWGA 2AUVA 2JZSA 5G1LA 4ZL8A 1U6TA 3MAKA 2C1YA 3FEUA 4WEYA 2CQ9A 2H74A 1O6JA 4POBA 4HEA2 3GV1A 5DAKB 1THXA 2GQLA 3FR3A 1A0RP 4MMMA 1OYJA 2LJKA 3BJ5A 2MMNA 1WJKA 5HFKA 4MF6A 4OFMA 1TKDB 2KP2A 3TJJA 2G0FA 2K18A 3WGXA 2KLXA 3HJPA 2H72A 3M9KA 4PGTA 3E3EA 1ERTA 1E2YA 5LD0A 1O73A 2B6MA 3A2XA 3IAS2 3UL3A 2DMMA 3GSTA 4IKHA 5CREA 5EVOA 1USBA 3LEFA 4ZL9A 9GSSA 20GSA 3CTFA 3NIVA 4IGJA 1Y25A 2HZFA 3IA1A 3EYTA 2FWFA 3VI5A 3NZNA 1OC9A 3TKQA 1R4WA 4V2NA 1BEDA 4KDUA 3TKPA 2B1KA 4ZL7A 4ECBA 5CAXA 3TJGA 4PQ1A 4J56E 2TRXA 3LJRA 3UIWA 1Q4JA 1M0UA 2IMKA 4ZB9A 3IAM2 4MZWA 2LRTA 4K6XA 2L5OA 5IO0A 5KEJA 2NBSA 3RAZA 2I4AA 3ZYWA 1F2EA 1A8LA 2C3NA 2H0HA 1XBSA 4HJ2A 3GA4A 4BA7A 4N0VA 3WYWA 4WR5A 1SL0B 2FA8A 3KP9A 1ML6A 1PMTA 2QKEA 5ECLB 2K8VA 2V6KA 4MF5A 4YQMA 3LG6A 1OKTA 4OD7A 2LSTA 3RBTA 4PQIA 4BVYA 1Z3EA 2M72A 4ZBAA 4MJCA 2QC7A 5IPHA 3R2QA 4WETA 4OO4A 2FWGA 2RIIA 2CX3A 1AQXA 1B8XA 1U87A 4MK3A 4MPFA 2HE3A 4TOPA 3CSJA 1PKZA 2R3XA 2KHPA 2GZPA 2XPEA 1B4QA 19GSA 3DIEA 1Z5YE 3TOUA 3D21A 4KNDA 3IDVA 4O92A 2EIRA 1WOUA 4KDYA 1A24A 4JR4A 1SYRA 4GF0A 3EE2A 1JHBA 2YZUA 3QMXA 5ECSA 5IMCA 1GSEA 1ZZYA 3VURA 1XZOA 1UC7A 2PU9C 3VWUA 1SL1B 2H76A 2R5GA 5ID2B 1ERUA 1N8JA 3GH6A 3AY8A 3QAGA 2M80A 5CRHA 3GNJA 4EDZA 1TU7A 4N11A 3TJKA 1T7PB 4K7NA 4MJEA 1BG5A 1XFLA 4BWQA 4BVXA 5J3RA 1BX9A 3Q18A 4WXTA 4L5OA 1TOFA 4GQFA 3FY7A 2M46A 1K3LA 2CVBA 1DSBA 5DALB 1X5CA 3LFLA 1AAZA 3D4MA 4YH2A 4CW9A 3PGTA 1EP7A 3TKSE 2JSYA 1AIUA 1GLPA 2H6ZA 2DSAA 3ZIJA 3F3RA 1EGRA 1AQWA 4K0GA 4WKWA 3RHBA 1EV4A 3KJYA 4G2EA 2JL4A 3QDNA 1OAZA 2C3TA 3IRAA 5ID2A 2B3SA 2H0GA 4TRXA 1B9XC 2X64A 2F8FA 2O89A 1XVQA 1HNAA 2J23A 3G7IA 2PPTA 4LMVA 4F0CA 4XRAA 1A2JA 4J57E 1TRUA 2XHFA 4TW5A 4RQRA 4K9ZA 2ALBA 1SJZA 1LU4A 3SBCA 4OFTA 4BWSA 4MABA 1FOVA 2WDUA 2G2QA 1M9BA 2H1BA 3WGDA 2LTKA 3APQA 4POLA 4JE1A 5GAPD 1V58A 3KZQA 2L6CA 4I8BA 4GSSA 2E2GA 4GCIA 1Z9HA 2K8SA 2I3YA 1NSWA 3ERWA 4IN0A 3ZREA 2HT9A 6GSVA 2FNOA 3G9BA 2PERA 8GSSA 2MZCA 2PN8A 4I2TA 2H30A 4AJ6A 5B7CA 2HSHA 2H19A 2C80A 2OE1A 5CYYA 3Q19A 5FT3A 3P7XA 4RI6A 2GQKA 3S9FA 3J7Yb 1ZCPA 3IK9A 2BJXA 3D0ZA 1B48A 2RM6A 5CO3A 5DJMA 2YWIA 4QL7A 2C0FA 1AC1A 1FAAA 2GLRA 1OC8A 1FHEA 5GZZB 3L78A 1SK1A 3UVHA 3J7Yk 6GSSA 2H73A 2ON7A 2X8GA 3U5RE 2GSRA 3KIJA 2ZNMA 4ECCA 3ED3A 1A2MA 2LRNA 1WPIA 4O5RA 3V1WA 2C0EA 5ECPB 3UEMA 5G5FA 5IMDA 4ID0A 5EPFA 1GNWA 2LQOA 2CAIA 4F82A 3MWHA 3DWVA 1PGTA 4IJ3A 5KN3A 5F05A 4K7IA 3EMPA 2A2RA 5CRWA 2ON5A 4KCEA 1SJ6A 1VGLA 4X0XA 1GSSA 4HJMA 2PVOC 3ZLPA 1HNBA 3WT2A 1IYHA 1V40A 2DJJA 1EGOA 2LUSA 1ZYEA 3L0HA 1U3IA 3QPMA 1SU9A 4LL4B 2OKAA 3P90A 2CVKA 4I5QA 2MMZA 1B9YC 4EUYA 4ZBBA 3LXTA 2GZZA 1X5EA 1SK0A 1TJDA 4V1Ag 5C04A 2LQQA 3A5WA 3EURA 2VL2C 3LYPA 1EOGA 3APSA 5JWOB 3VLNA 2HLSA 2LNTA 3KM6A 1GRXA 5J5NA 3EINA 1G7EA 2I9HA 3TUEA 2YWOA 3KTBA 1XPVA 5IMAA 2RUEA 3HZ4A 2AJQB 5B6MA 4FH8A 5D9WA 1K3YA 2VIMA 3PINA 1R7HA 1RW1A 4TKYA 3WT1A 5CRDA 1S3DA 1NHYA 3FR6A 3HDCA 5CP1A 2NVLA 2E2MA 4ZBDA 1XIYA 2EIOA 2VCZA 1GTBA 2JADA 1RK4A 2VL3A 2AYTA 2IPAA 2N5BA 4JZQA 13GSA 4TVEA 1YKAA 1A0FA 2XC2A 5B8AA 2F8AA 3TRXA 2CX4A 4ZB6A 4KH7A 2NDOA 3ERFA 3GYKA 1MD4A 2FHEA 2OE3A 3LQ7A 4HZ2A 1JZWA 3QFAC 4OMVA 5ECIB 3BCIA 3GTUA 4IW9A 5G31A 5HR3A 4N30A 5IO2A 4F03A 2VD1A 4G19A 2GQMA 4TR3A 3FZAA 2YN1A 2DJKA 3C1SA 5HQPA 1EEJA 3F63A 4GLTA 2IMFA 3HJMA 1OC9B 5INYA 1G6WA 5F07A 3IK7A 4EDYA 1GUKA 1K0CA 3VWWA 3O3TA 1OE7A 4RUVA 5JCUA 4AF2A 3IPZA 5B6NA 1K0OA 3NOFA 4HQZA 1UN2A 1F3BA 4NAXA 1C72A 2KOKA 3FYGA 1TXXA 4DEJA 1FW1A 3IC4A 1WMJA 1I9DA 1O85A 3MNGA 3CXGA 2FY6A 5D9XA 4PXOA 1QXHA 3D6IA 2L4CA 3ZVJD 1CQGA 3TOTA 5IOWA 1AXDA 2DIZA 3QOUA 3D22A 4AJ8A 2R6KA 4HUAA 3C8EA 3ZFBA 2CVDA 2X8HA 1Z7PA 1PN9A 4I2UA 5GSSA 5COHA 1LBKA 2F51A 2CA8A 4MZBA 5EY6A 2WJUA 1Q98A 2LV3A 5A4UA 4GSTA 1SD8A 3ZL5A 2NTOA 4HZ4A 3FW2A 2P5RA 3FZ5A 1TRSA 1TP9A 3EVIA 12GSA 4D73A 4MZCA 5CRGA 1VRSD 1SKSB 3W6GA 3QAVA 1SK2A 1B4PA 2DBCA 3M1GA 2IL3A 5H5SA 1PKWA 3OR5A 4PNFA 1JZOA 5KN0A 4WF5A 3ME7A 3GIXA 2L59A 4E8EA 2AV4A 4KW6A 4ACSA 1TDIA 2AB6A 3GUSA 4IQAA 5ELGA 1XOAA 1A8YA 3HXSA 3TDGA 5LCZA 4ZXGA 1VF2A 2V1MA 1HNCA 3EU3A 1BQ7A 2GSTA 3DVWA 3RPNA 1AUCA 3F0IA 2GDRA 2VL9A 2VCVA 1JZDA 1UVZA 3PR8A 5AIVA 5ECQB 3IXRA 4HU7A 3F8UA 1I5GA 3DRNA 3IHQA 3KD0A 4GTUA 5AIXA 2O7KA 1AW9A 4KSOA 4L5LA 5ENUA 4EXJA 1FB6A 1W89A 4YQUA 3HA9A 3C1RA 1Z6NA 4Q5QA 4OO5A 2IJYA 4JR6A 2RUFA 2PUKC 2OA7A 2F9SA 4DSSA 2GSQA 1GSYA 1SKRB 1K0BA 4FYBA 2YCDA 2O85A 2DJ2A 1KEBA 3APOA 3DMLA 5H5RA 3QCPA 4N10A 1ABAA 1SD9A 5F8BA 3P2AA 2YV7A 1V98A 1V2AA 4XCSA 1V57A 2CZ3A 1IYIA 2B5EA 4NV5A 1A2LA 1GWCA 4TR1A 2FGXA 1OE8A 4F9ZA 3UOMA 2YZHA 1KBNA 2PVQA 4NMUA 1VF3A 2CZ2A 2C8UA 2PMTA 4GXZA 4PX1A 1DBYA 4F0BA 18GSA 1ZYQB 1T3BA 1TI1A 4DSRA 3DVXA 2ES7A 4AJ7A 5IIZA 3M8NA 1HYUA 2DIYA 2YPMA 2JU5A 4XS6A 3ME8A 2C3QA 1PX7A 4KX4A 4MF7A 2HFDA 3N9JA 4JBBA 3DD3A 2KP1A 4V1Ap 1XWCA 4K2DA 3GX0A 1GSQA 3BOAA 3HY2A 3F4SA 3DEXA 4LL1B 1WRYA 4GWRA 1XWKA 1F6MC 3ERGA 3BBYA 2KUCA 1JLWA 3ZZXA 3L4NA 3TRPA 4TXOA 3BD2A 3HYPA 2VD0A 1OKDA 4X1UA 1DE1A 1E6BA 2QGVA 2E0QA 3KH7A 1SENA 1YDKA 3MDKA 10GSA 1R26A 1G0TA 5DBQA 4EVMA 1G7OA 1FB0A 2C0DA 4FYUA 2OJLA 2L6DA 3FZ4A 4IS0A 4BPYA 1T8EB 2HSYA 2K9FA 4DVCA 5H5QA 3C73A 1NW2A 1A23A 2IMIA 1TU8A 2GZYA 1Z7RA 2LS5A 4BL7A 3L9VA 2HRNA 2OBKA 3UAPA 4K7OA 1SL2B 1X9SB 2VO4A 2H70A 3I69A 1SKWB 2GVPA 4K8MA 3KGKA 1EOHA 1ZOFA 1EV9A 3ZMLA 3MSZA 2H1DA 2EIQA 2B7JA 3UARA 2YWNA 1PD21 5ECMB 4ZILA 1ST9A 4XHMA 1J0FA 4Z7XA 3F4RA 1PL1A 4AGSA 4RQXA 2DJ1A 1PX6A 1GL8A 3CSIA 2VL2A 4IHUA 3GN3A 1TI3A 2WS2A 6GSWA 16GSA 3KH9A 3JCML 2O8VB 1XW5A 3VPQA 4OCEA 4ECJA 3DGQA 1T1VA 4L0UA 4QQ7A 3GHAA 3VWXA 3K8NA 1H4OA 2H0IA 1BAYA 3F9UA 1K0DA 4FO5A 2MBSA 4NPBA 1JZRA 4MP4A 1QMVA 3IBHA 5IM9A 5ECKB 2DC5A 1M2BA 3W8SA 5D96A 3W8JA 3GTUB 3CMIA 3FZ9A 3GURA 5A4VA 1VF1A 2HYXA 4IELA 4Q5RA 1M9AA 4WR4A 3A2WA 4NWYA 3N5OA 4TXVA 2XPDA 1M2AA 2H1GA 3HKRA 1K3OA 5HR2A 5GSTA 5J41A 2LJRA 1O81A 1WE0A 4POKA 5DVBA 5G30A 2H66A 3TKRA 2VLVA 2VM2A 1GTAA 3RPPA 4EKZA 4MPGA 4YAVA 4HOJA 2V2GA 4V2MA 3EMXA 4HDEA 2IMDA 4X43A 3TGZA 4G10A 5DQSA 3O6TA 5ECNB 4KB3A 5G2ZA 4ISDA 1BJXA 1GP1A 1QUWA 4LMWA 2H1AA 3HZ8A 1RQMA 3L9UA 4HU9A 4IP1A 4LLRA 1K0AA 5KN1A 2FCHA 3IE3A 4I6XA 4XIHA 5G5EA 5IMZA 1J08A 5LNKe 3KXOA 1SJIA 2I1UA 3A2VA 3H1NA 3TJBA 1MDIA 2OACA 3VI7A 3F4TA 5DQYA 1LJRA 4JRRA 1X9WB 1TK0B 3I9V2 2N5FA 4GSNA 4XS4A 2YOIA 1GSFA 5F0GA 1YF1A 14GSA 1K0MA 2R2JA 4TN8A 3DXBA 1J9BA 1ON4A 1U88A 3F3QA 4MCUA 2GT6A 5D73A 4E8HA 2VLUA 3TKSA 2PGTA 1O8XA 3GMFA 1ZGNA 2B5XA 4ML1A 2REMA 1N2AA 3HVXA 1MTCA 1ACVA 3D5JA 3SWLA 2H6YA 1BYEA 4D73B 5L71A 1UA5A 1M99A 1MDKA 3C71A 4HS1A 4IP6A 4KA0A 1S3CA 4O32A 4LA1A 2JACA 2CAQA 3BCKA 1YEPA 3I6AA 4ML6A 4OCFA 3GKXA 3M3MA 5B8BA 3VK9A 3GFKA 3EU4A 4G9HA 1O7UA 3IOSA 2CT6A 2DMLA 6GSXA 1R5PA 5E59A 3FRCA 1GSUA 2HZEA 5ECRB 2MMAA 1WIKA 5E4WA 1GH2A 2K6VA 4JEDA 5F06A 4MJAA 5CNWA 3TKSC 3GRXA 2L5LA 3ZTLA 2TIRA 3L9SA 5DCHA 4KAEA 4TR0A 3TCOA 2RLIA 4L8EA 4PUAA 2MMOA 5J4UA 1YKCA 3TRQA 2AAWA 3A3TA 3HJOA 1WWJA 4CHSA 2YNXA 3M0FA 3GKNA 3HVVA 1XXUA 3KEBA 5IQYA 2P31A 3UBLA 3F6DA 1M2DA 2DJ3A 2VOCA 2Z9SA 1WP0A 1T4ZA 1CQHA 4MH3A 1HQOA 1TRWA 5ECHB 5DAKA 2R4VA 2IFQB 3FR9A 4DSSB 1TTZA 1HD2A 3FKFA 2EC4A 3G7JA 1GNEA 4FIWA 3C7MA 1URMA 1MEKA 4PURA 4NHWA 4GQCA 5KN2A 4IVFA 1R5AA 3GH9A 4P3YB 1PQNA 3RHCA 4EL1A 3ZVJA 1XW6A 3I43A 2B5YA 1XCCA 2WULA 1G6YA 2B1LA 5ECOB 3H8QA 3GL5A 2JZTA 2JSZA 3WGEA 3KP8A 4XTSA 4EF0A 4OWYA 2F3MA 3LGCA 3GKMA 4TR1B 3UMAA 1JFUA 4EC0A 5HR1A 3ZFLA 2P0GA 3IR4A 3M9JA 2HXKA 3HHVA 5HFIA 5C00A 4CDOA 1DE2A 2ZUPA 2IFQA 5A5KA 3GKKA 2QSIA 2YWMA 2YV9A 1OVNA 4KUNA 11GSA 4MH2A 4TR4A 2LEGA 2LJAA 2XBIA 1H75A 3CTGA 4EE0A 4ECIA 1F3AA 1GLQA 4TXOB 2IN3A 5ABRA 1M7TA 2WFCA 1AQVA 3Q74A 2FLSA 4Q5NA 4ILFA 2WRTA 1W4VA 4MJBA 3P8WA 3VWVA 1F9MA 2TRCP 3VFIA 2IWTA 3KTLA 4KGIA 4PUFC 3H4KA 1ERVA 3U6VA 1MDJA 2MYGA 5ELAA 2O87A 1QK8A 3TB2A 1NHOA 4KCAA 2P5QA 3G7YA 3KCMA 1KTEA 4F2IA 1V9WA 3FK8A 2FWEA 4QL9A 4MDCA 2RM5A 2V6OA 2A4VA 5EL8A 4NV2A 4OFNA 5J9BA 3F6FA 1T4YA 2H8LA 4IQ1A 2WZ9A 2FD3A
chains in the Genus database with same CATH superfamily
2HRAA 2B7KA 2L57A 6GSYA 2FUG2 2MBTA 4IJIA 5AN1A 3FHKA 2JZRA 6GSTA 2WB9A 2VCXA 3QR6A 1PSQA 17GSA 4JU5A 1YF0A 2OE0A 3DYRA 4MLYA 6GSUA 1QGVA 1T00A 4XS1A 2WCIA 4K1FA 1EWXA 2X99A 5J9CA 3LSZA 2PBJA 2H75A 1TK8B 1GUHA 2I81A 4Z2RA 1GTUA 1PA3A 2FA4A 4EIQA 1TK5B 5DALA 5IMFA 4NHZA 1GUMA 4ULXA 5DDLA 2HI7A 3MYDA 4V2LA 5D8IA 1XOBA 3VPTA 2D2ZA 5HFGA 2VCWA 1YJ6A 4I97A 4WBJA 2ZCTA 3ISOA 1U3AA 3ZRDA 3O76A 1NM3A 1GULA 2DLXA 3GL3A 5JWRB 5JWQB 3TJFA 5DJLA 2VCQA 2A2PA 2N5AA 1OC3A 4H86A 2C4JA 2BTOT 2V41A 2A4HA 2BMXA 2CV4A 1XWBA 1FG4A 3US3A 4RI7A 4WF4A 2E7PA 3ZMKA 1FVJA 1YY7A 1XW9A 1ZL9A 2J9HA 4O7HA 5AISA 2YANA 3GX8A 1EEMA 3ZITA 1SYXA 5FHIA 3PH9A 3UBKA 1XWAA 4Q5FA 1S3AA 4MA9A 2LRCA 1F37A 2LKUA 2GTUA 1Z6MA 5GAND 2C0GA 2HNLA 1TRVA 2VAFA 4NXIA 4J2FA 1THOA 3H79A 3CRTA 5HR0A 2HRFA 2DJ0A 4HQSA 4L0WA 2VUPA 1X5DA 1ZMAA 5AGYA 4PNGA 3CRUA 2UZ8A 3LORA 5A4WA 1GTIA 1YZXA 2GGTA 1MD3A 1XVWA 3ZIVA 3Q6OA 5G1KA 4XRDA 5D9TA 3D4TA 2A2SA 4XS4B 3E0UA 1KNGA 1TW9A 2LNSA 2GSSA 3RDWA 2VLTA 3QFBC 3DKSA 4DSQA 3H93A 2L4QA 1QQ2A 5D9VA 2H6XA 3CYNA 3E9JB 5IMVA 4EO3A 2WGRA 3LYKA 4N0ZA 1XWGA 5IPGA 2YJHA 1EZKA 2GT5A 4YAPA 3GSSA 4KE3A 3CSHA 2X4AA 2FWHA 2VM1A 1ERWA 3HVSA 3CBUA 4HI7A 2NPBA 1O8WA 1X9MB 4ZB8A 4POMA 1EP8A 2R37A 4IBPA 4ZIJA 4KDXA 3UVTA 1XG8A 3IV4A 3LWAA 5IOXA 1FVKA 5JCWA 4WBRD 1K0NA 1X0RA 2IMEA 3LXZA 1FO5A 2GS3A 2YP6A 1S3RA 3HCZA 1DUGA 5D93A 4KSMA 1JLVA 2XBQA 4PQHA 3WD6A 2H71A 4K0NA 22GSA 5JCGA 3HD5A 3MIXA 2X8CA 2HZEB 5DCGA 4GRFA 1GSDA 1VF4A 1PRXA 2AHEA 1YEXA 1ILOA 1Y6EA 3KMNA 2V32A 2IIYA 7GSSA 1PFOA 1YQ1A 2YJ7A 3KMOA 4USSA 1PL2A 2OADA 1QFNA 2H01A 4FYCA 3UJ1A 2OBIA 3QAWA 3EWLA 3QD9A 3EC3A 4YQVA 2VCTA 2PWJA 5FWGA 2AUVA 2JZSA 5G1LA 5KOXA 4ZL8A 1U6TA 3MAKA 2C1YA 3FEUA 4WEYA 2CQ9A 2H74A 1O6JA 4POBA 4HEA2 3GV1A 3LW9A 5DAKB 1THXA 2GQLA 3FR3A 1A0RP 4MMMA 1OYJA 2LJKA 3BJ5A 2MMNA 1WJKA 3A5IA 4MF6A 5HFKA 4OFMA 1TKDB 2KP2A 3TJJA 2G0FA 2K18A 3WGXA 2KLXA 3HJPA 2H72A 3M9KA 4PGTA 3E3EA 1ERTA 1E2YA 5LD0A 1O73A 2B6MA 3A2XA 3IAS2 3UL3A 2DMMA 3GSTA 3EPTA 5CREA 4IKHA 5EVOA 1USBA 3LEFA 1ZYPA 4ZL9A 9GSSA 20GSA 3CTFA 3NIVA 4IGJA 1Y25A 2HZFA 3IA1A 3EYTA 2FWFA 3VI5A 3NZNA 1OC9A 3TKQA 1R4WA 2QA1A 4V2NA 1BEDA 4KDUA 3TKPA 2B1KA 4ZL7A 4ECBA 5CAXA 3TJGA 4PQ1A 4J56E 4Z2UA 2TRXA 3LJRA 3UIWA 1Q4JA 1M0UA 2IMKA 4ZB9A 3IAM2 4MNNA 4MZWA 2LRTA 4K6XA 2L5OA 5IO0A 5KEJA 2NBSA 3RAZA 2I4AA 3ZYWA 1F2EA 1A8LA 2C3NA 2H0HA 1XBSA 4HJ2A 3GA4A 4BA7A 4N0VA 3WYWA 4WR5A 1SL0B 2FA8A 3KP9A 4YKGA 1ML6A 1PMTA 2QKEA 5ECLB 2K8VA 2V6KA 4MF5A 4YQMA 3LG6A 1OKTA 4OD7A 2LSTA 3RBTA 4PQIA 4BVYA 1Z3EA 2M72A 4ZBAA 4MJCA 2QC7A 5IPHA 3R2QA 4WETA 4OO4A 2FWGA 2RIIA 2CX3A 1AQXA 1B8XA 1U87A 4MK3A 4MPFA 2HE3A 4TOPA 3CSJA 1PKZA 2R3XA 2KHPA 2GZPA 2XPEA 1B4QA 19GSA 3DIEA 1Z5YE 3TOUA 3D21A 4KNDA 3IDVA 4O92A 2EIRA 1WOUA 4KDYA 1A24A 4JR4A 1SYRA 4GF0A 3EE2A 1JHBA 2YZUA 3QMXA 5ECSA 5IMCA 1GSEA 1ZZYA 3VURA 1XZOA 1UC7A 2PU9C 3VWUA 1SL1B 2H76A 2R5GA 5ID2B 1ERUA 1N8JA 3GH6A 3AY8A 3QAGA 2M80A 5CRHA 3GNJA 4EDZA 1TU7A 4N11A 3TJKA 1T7PB 4K7NA 4MJEA 1BG5A 1XFLA 4BWQA 4BVXA 5J3RA 1BX9A 3Q18A 4WXTA 4L5OA 1TOFA 2X49A 4GQFA 3FY7A 2M46A 1K3LA 2CVBA 1DSBA 5DALB 1X5CA 3LFLA 1AAZA 3D4MA 4YH2A 4CW9A 3PGTA 1EP7A 3TKSE 2JSYA 1AIUA 1GLPA 2H6ZA 2DSAA 3ZIJA 3F3RA 1EGRA 1AQWA 4K0GA 4WKWA 3RHBA 1EV4A 3KJYA 4G2EA 2JL4A 3QDNA 1OAZA 2C3TA 3IRAA 5ID2A 2B3SA 2H0GA 4TRXA 1B9XC 2X64A 2F8FA 2O89A 1XVQA 1HNAA 2J23A 3G7IA 2PPTA 4LMVA 4F0CA 4XRAA 1A2JA 4J57E 1TRUA 2XHFA 4TW5A 4RQRA 4K9ZA 2ALBA 1SJZA 1LU4A 3SBCA 4OFTA 4BWSA 4MABA 1FOVA 2WDUA 2G2QA 1M9BA 2H1BA 3WGDA 2LTKA 3APQA 4POLA 4JE1A 5GAPD 1V58A 3KZQA 2L6CA 4I8BA 4GSSA 2E2GA 4GCIA 1Z9HA 2K8SA 2I3YA 1NSWA 3ERWA 4IN0A 3ZREA 2HT9A 6GSVA 2DKIA 2FNOA 3G9BA 2PERA 8GSSA 2MZCA 2PN8A 4I2TA 2H30A 4AJ6A 5B7CA 2HSHA 2H19A 4FQUA 2C80A 2OE1A 5CYYA 3Q19A 5FT3A 4G0KA 3P7XA 4RI6A 2GQKA 3S9FA 3J7Yb 1ZCPA 3IK9A 2BJXA 3D0ZA 1B48A 2RM6A 5CO3A 5DJMA 2YWIA 4QL7A 2C0FA 1AC1A 1FAAA 2GLRA 1OC8A 1FHEA 5GZZB 3L78A 1SK1A 3UVHA 3J7Yk 6GSSA 2H73A 2ON7A 2X8GA 3U5RE 2GSRA 3KIJA 2ZNMA 4ECCA 3ED3A 1A2MA 2LRNA 1WPIA 4O5RA 3V1WA 2C0EA 5ECPB 3UEMA 5G5FA 5IMDA 4ID0A 5EPFA 1GNWA 2LQOA 2CAIA 4F82A 3MWHA 3DWVA 1PGTA 4IJ3A 5KN3A 4K7IA 5F05A 3EMPA 2A2RA 5CRWA 2ON5A 4KCEA 1SJ6A 1VGLA 4X0XA 1GSSA 4HJMA 2PVOC 3ZLPA 1HNBA 3WT2A 1IYHA 1V40A 2DJJA 1EGOA 2LUSA 1ZYEA 3L0HA 1U3IA 3QPMA 1SU9A 4LL4B 2OKAA 3P90A 2CVKA 4I5QA 2MMZA 1B9YC 4EUYA 4ZBBA 3LXTA 2GZZA 1X5EA 1SK0A 1TJDA 4V1Ag 5C04A 2LQQA 3A5WA 3EURA 2VL2C 3LYPA 1EOGA 3APSA 5JWOB 3VLNA 2HLSA 2LNTA 3KM6A 1GRXA 5J5NA 3EINA 4G0LA 1G7EA 2I9HA 3TUEA 2YWOA 3KTBA 1XPVA 5IMAA 2RUEA 3HZ4A 2AJQB 5B6MA 4FH8A 4X4JA 1K3YA 2VIMA 5D9WA 3PINA 1R7HA 1RW1A 4TKYA 3WT1A 5CRDA 3FMWA 1S3DA 1NHYA 3FR6A 3HDCA 5CP1A 2NVLA 2E2MA 4ZBDA 1XIYA 2EIOA 2VCZA 1GTBA 2JADA 1RK4A 2VL3A 2AYTA 2IPAA 2N5BA 4JZQA 13GSA 4TVEA 1YKAA 1A0FA 2XC2A 5B8AA 2F8AA 3TRXA 2CX4A 4ZB6A 4KH7A 2NDOA 3ERFA 3GYKA 1MD4A 2FHEA 2OE3A 3LQ7A 4HZ2A 1JZWA 3QFAC 4OMVA 5ECIB 3BCIA 3GTUA 4IW9A 5G31A 5HR3A 4N30A 5IO2A 4F03A 2VD1A 4G19A 2GQMA 4TR3A 3FZAA 2YN1A 2DJKA 3C1SA 5HQPA 1EEJA 3F63A 4GLTA 2IMFA 3HJMA 1OC9B 5INYA 1G6WA 5F07A 3IK7A 4EDYA 1GUKA 1K0CA 3VWWA 3O3TA 1OE7A 4RUVA 5JCUA 4AF2A 3IPZA 5B6NA 1K0OA 3NOFA 4HQZA 1UN2A 1F3BA 4NAXA 1C72A 2KOKA 3FYGA 1TXXA 5KOWA 4DEJA 1FW1A 3IC4A 1WMJA 1I9DA 1O85A 3MNGA 3CXGA 2FY6A 5D9XA 4PXOA 1QXHA 3D6IA 2L4CA 3ZVJD 1M3IA 1CQGA 3TOTA 5IOWA 1AXDA 2DIZA 3QOUA 3D22A 4AJ8A 2R6KA 4HUAA 3C8EA 3ZFBA 2CVDA 2X8HA 1Z7PA 1PN9A 4BVYB 4I2UA 5GSSA 5COHA 1LBKA 2F51A 2CA8A 4MZBA 5EY6A 2WJUA 1Q98A 2LV3A 5A4UA 4GSTA 4O5UA 1SD8A 3ZL5A 2NTOA 4HZ4A 3FW2A 4ICYA 2P5RA 3FZ5A 1TRSA 1TP9A 3EVIA 12GSA 4D73A 4MZCA 5CRGA 1VRSD 1SKSB 3W6GA 3QAVA 1SK2A 1B4PA 2DBCA 3M1GA 2IL3A 5H5SA 1PKWA 3OR5A 4PNFA 1JZOA 5KN0A 4WF5A 3ME7A 3GIXA 2L59A 4E8EA 2AV4A 4KW6A 4ACSA 1TDIA 2AB6A 3GUSA 4IQAA 4EIPA 5ELGA 1XOAA 1A8YA 3HXSA 3TDGA 5LCZA 4ZXGA 1PN0A 1VF2A 2V1MA 1HNCA 3EU3A 4BVXB 1BQ7A 2GSTA 3DVWA 3RPNA 1AUCA 3F0IA 2GDRA 2VL9A 2VCVA 1JZDA 1UVZA 3PR8A 5AIVA 5ECQB 3IXRA 4HU7A 3F8UA 1I5GA 3DRNA 3IHQA 3KD0A 4GTUA 5AIXA 2O7KA 1AW9A 4KSOA 4L5LA 5ENUA 4EXJA 1FB6A 1W89A 4YQUA 3HA9A 3C1RA 1Z6NA 4Q5QA 4OO5A 2IJYA 4JR6A 2RUFA 2PUKC 2OA7A 2F9SA 4DSSA 2GSQA 1GSYA 1SKRB 1K0BA 4FYBA 2YCDA 2O85A 2DJ2A 1KEBA 3APOA 3DMLA 5H5RA 3QCPA 4N10A 1ABAA 1SD9A 5F8BA 3HVNA 3P2AA 2YV7A 1V98A 1V2AA 4XCSA 1V57A 2CZ3A 1IYIA 2B5EA 4NV5A 1A2LA 5BRTA 1GWCA 4TR1A 2FGXA 1OE8A 4F9ZA 3UOMA 2YZHA 1KBNA 2PVQA 4NMUA 1VF3A 2CZ2A 2C8UA 2PMTA 4GXZA 4PX1A 1DBYA 4F0BA 18GSA 1ZYQB 1T3BA 1TI1A 4DSRA 3DVXA 2ES7A 4AJ7A 5IIZA 3M8NA 1HYUA 2DIYA 2YPMA 2JU5A 4XS6A 3ME8A 2C3QA 1PX7A 4KX4A 4MF7A 2HFDA 3N9JA 4JBBA 3DD3A 2KP1A 4V1Ap 2R0PA 1XWCA 4K2DA 3GX0A 1GSQA 3BOAA 3HY2A 3F4SA 3DEXA 4LL1B 1WRYA 4GWRA 1XWKA 1F6MC 3ERGA 3BBYA 2KUCA 1JLWA 3ZZXA 3L4NA 3TRPA 4TXOA 3BD2A 3HYPA 2VD0A 1OKDA 4X1UA 1DE1A 1E6BA 2QGVA 2E0QA 3KH7A 1SENA 1YDKA 3MDKA 10GSA 1R26A 1G0TA 5DBQA 4EVMA 1G7OA 1FB0A 2C0DA 4FYUA 2OJLA 2L6DA 3FZ4A 4IS0A 4BPYA 2HSMA 1T8EB 2HSYA 2K9FA 4DVCA 5H5QA 3C73A 1NW2A 1A23A 2IMIA 1TU8A 2GZYA 1Z7RA 2LS5A 2R0GA 4BL7A 3L9VA 5BMUA 2HRNA 2OBKA 3UAPA 4K7OA 1SL2B 4A5PA 1X9SB 2VO4A 2H70A 3I69A 1SKWB 2GVPA 4K8MA 3KGKA 1EOHA 1ZOFA 1EV9A 3ZMLA 3MSZA 2H1DA 2EIQA 2B7JA 3UARA 2YWNA 1PD21 1M3JA 5ECMB 4ZILA 1ST9A 4XHMA 1J0FA 4K5RA 4Z7XA 3F4RA 1PL1A 4CY6A 4AGSA 4RQXA 2DJ1A 4YKFA 1PX6A 1GL8A 3CSIA 2VL2A 4IHUA 3GN3A 1TI3A 2WS2A 6GSWA 16GSA 3KH9A 3JCML 2O8VB 1XW5A 3VPQA 4OCEA 4ECJA 3DGQA 1T1VA 4L0UA 4QQ7A 3GHAA 3VWXA 3K8NA 1H4OA 2H0IA 1BAYA 3F9UA 4HSCX 1K0DA 4FO5A 2MBSA 4NPBA 1JZRA 4MP4A 1QMVA 3IBHA 5IM9A 5ECKB 2DC5A 1M2BA 3W8SA 5D96A 3W8JA 3GTUB 4K5SA 3CMIA 3FZ9A 3GURA 5A4VA 1VF1A 2HYXA 4IELA 4Q5RA 1M9AA 4WR4A 3A2WA 4NWYA 3N5OA 4TXVA 2XPDA 1M2AA 2H1GA 3HKRA 1K3OA 5HR2A 5GSTA 5J41A 2LJRA 1O81A 1WE0A 4POKA 5DVBA 5G30A 2H66A 3TKRA 2VLVA 2VM2A 1GTAA 3RPPA 4EKZA 4MPGA 4YAVA 4HOJA 2V2GA 4V2MA 3EMXA 4HDEA 2IMDA 4X43A 3TGZA 4G10A 5DQSA 3O6TA 5ECNB 4KB3A 5G2ZA 4ISDA 1BJXA 1GP1A 1QUWA 4LMWA 2H1AA 3HZ8A 1RQMA 3L9UA 4HU9A 4IP1A 4LLRA 1K0AA 5KN1A 2FCHA 3IE3A 4I6XA 4XIHA 5G5EA 5IMZA 1J08A 5LNKe 3KXOA 1SJIA 2I1UA 3A2VA 3H1NA 3TJBA 1MDIA 2OACA 3VI7A 3F4TA 5DQYA 1LJRA 4JRRA 1X9WB 1TK0B 3I9V2 2N5FA 4GSNA 4XS4A 2YOIA 1GSFA 5F0GA 1YF1A 14GSA 1K0MA 2R2JA 4TN8A 3DXBA 1J9BA 1ON4A 1U88A 3F3QA 4MCUA 2GT6A 5D73A 4E8HA 2VLUA 3IHGA 3TKSA 2PGTA 1O8XA 3GMFA 1ZGNA 2B5XA 4ML1A 2REMA 1N2AA 3HVXA 1MTCA 1ACVA 3D5JA 3SWLA 2H6YA 1BYEA 4D73B 5L71A 1UA5A 1M99A 1MDKA 3C71A 4HS1A 4IP6A 4KA0A 1S3CA 4O32A 4LA1A 2JACA 4G0IA 2CAQA 3BCKA 1YEPA 3I6AA 4ML6A 4OCFA 3GKXA 3M3MA 5B8BA 3VK9A 3GFKA 3EU4A 3PPUA 3R3EA 4G9HA 2DKHA 1O7UA 3IOSA 2CT6A 2DMLA 6GSXA 1R5PA 5E59A 3FRCA 1GSUA 2HZEA 5ECRB 2MMAA 1WIKA 5E4WA 1GH2A 2K6VA 4JEDA 5F06A 4MJAA 5CNWA 3TKSC 3GRXA 2L5LA 3ZTLA 2TIRA 3L9SA 5DCHA 4KAEA 4TR0A 3TCOA 2RLIA 4L8EA 4PUAA 2MMOA 3CQFA 5J4UA 1YKCA 3TRQA 2AAWA 3A3TA 3HJOA 1WWJA 4CHSA 2YNXA 3M0FA 3GKNA 3HVVA 1XXUA 3KEBA 5IQYA 2P31A 1ZYNA 3UBLA 3F6DA 1M2DA 2DJ3A 2VOCA 2Z9SA 1WP0A 2QA2A 1T4ZA 1CQHA 4MH3A 1HQOA 1TRWA 5ECHB 5DAKA 2R4VA 2IFQB 3FR9A 4DSSB 1TTZA 1HD2A 2HRKA 3FKFA 2EC4A 3G7JA 4PTSA 1GNEA 4FIWA 4CY8A 3C7MA 1URMA 4BIKA 1MEKA 4PURA 4NHWA 4GQCA 5KN2A 4IVFA 1R5AA 3GH9A 4P3YB 1PQNA 3RHCA 4EL1A 3ZVJA 1XW6A 3I43A 2B5YA 1XCCA 2WULA 1G6YA 2B1LA 5ECOB 3H8QA 3GL5A 2JZTA 2JSZA 1FOHA 3WGEA 3KP8A 4XTSA 4EF0A 4OWYA 2F3MA 3LGCA 3GKMA 4TR1B 4Z2TA 3UMAA 1JFUA 4EC0A 2R0CA 5HR1A 3ZFLA 2P0GA 3IR4A 3M9JA 2HXKA 3HHVA 5HFIA 5C00A 4CDOA 1DE2A 2ZUPA 2IFQA 5A5KA 3GKKA 2QSIA 2YWMA 2YV9A 1OVNA 4KF9A 4KUNA 11GSA 4MH2A 4TR4A 2LEGA 2LJAA 2XBIA 1H75A 3CTGA 4EE0A 4ECIA 4K2XA 1F3AA 3IC8A 1GLQA 4TXOB 2IN3A 5ABRA 1M7TA 2WFCA 1AQVA 3Q74A 2FLSA 4Q5NA 4ILFA 2WRTA 1W4VA 4MJBA 3P8WA 3VWVA 1F9MA 2TRCP 3VFIA 2IWTA 3KTLA 4KGIA 4PUFC 3H4KA 1ERVA 3U6VA 1MDJA 2MYGA 5ELAA 2O87A 1QK8A 3TB2A 1NHOA 4BL7B 4KCAA 2P5QA 3G7YA 3KCMA 1KTEA 4F2IA 1V9WA 3FK8A 2FWEA 4QL9A 4MDCA 2RM5A 2V6OA 2A4VA 5EL8A 4NV2A 4OFNA 5J9BA 3F6FA 1T4YA 4O5QA 2H8LA 4IQ1A 2WZ9A 2FD3A
chains in the Genus database with same CATH topology
2HRAA 2B7KA 2L57A 6GSYA 2FUG2 2MBTA 4IJIA 5AN1A 3FHKA 2JZRA 6GSTA 2WB9A 2VCXA 3QR6A 1PSQA 17GSA 4JU5A 1YF0A 2OE0A 3DYRA 4MLYA 6GSUA 1QGVA 1T00A 4XS1A 2WCIA 4K1FA 1EWXA 2X99A 5J9CA 3LSZA 2PBJA 2H75A 1TK8B 1GUHA 2I81A 4Z2RA 1GTUA 1PA3A 2FA4A 4EIQA 1TK5B 5DALA 5IMFA 4NHZA 1GUMA 4ULXA 5DDLA 2HI7A 3MYDA 4V2LA 5D8IA 1XOBA 3VPTA 2D2ZA 5HFGA 2VCWA 1YJ6A 4I97A 4WBJA 2ZCTA 3ISOA 1U3AA 3ZRDA 3O76A 1NM3A 1GULA 2DLXA 3GL3A 5JWRB 5JWQB 3TJFA 5DJLA 2VCQA 2A2PA 2N5AA 1OC3A 4H86A 2C4JA 2BTOT 2V41A 2A4HA 2BMXA 2CV4A 1XWBA 1FG4A 3US3A 4RI7A 4WF4A 2E7PA 3ZMKA 1FVJA 1YY7A 1XW9A 1ZL9A 2J9HA 4O7HA 5AISA 2YANA 3GX8A 1EEMA 3ZITA 1SYXA 5FHIA 3PH9A 3UBKA 1XWAA 4Q5FA 1S3AA 4MA9A 2LRCA 1F37A 2LKUA 2GTUA 1Z6MA 5GAND 2C0GA 2HNLA 1TRVA 2VAFA 4NXIA 4J2FA 1THOA 3H79A 3CRTA 5HR0A 2HRFA 2DJ0A 4HQSA 4L0WA 2VUPA 1X5DA 1ZMAA 5AGYA 4PNGA 3CRUA 2UZ8A 3LORA 5A4WA 1GTIA 1YZXA 2GGTA 1MD3A 1XVWA 3ZIVA 3Q6OA 5G1KA 4XRDA 5D9TA 3D4TA 2A2SA 4XS4B 3E0UA 1KNGA 1TW9A 2LNSA 2GSSA 3RDWA 2VLTA 3QFBC 3DKSA 4DSQA 3H93A 2L4QA 1QQ2A 5D9VA 2H6XA 3CYNA 3E9JB 5IMVA 4EO3A 2WGRA 3LYKA 4N0ZA 1XWGA 5IPGA 2YJHA 1EZKA 2GT5A 4YAPA 3GSSA 4KE3A 3CSHA 2X4AA 2FWHA 2VM1A 1ERWA 3HVSA 3CBUA 4HI7A 2NPBA 1O8WA 1X9MB 4ZB8A 4POMA 1EP8A 2R37A 4IBPA 4ZIJA 4KDXA 3UVTA 3IV4A 3LWAA 5IOXA 1FVKA 5JCWA 4WBRD 1K0NA 1X0RA 2IMEA 3LXZA 1FO5A 2GS3A 2YP6A 3HCZA 1DUGA 5D93A 4KSMA 1JLVA 2XBQA 4PQHA 3WD6A 2H71A 4K0NA 22GSA 5JCGA 3HD5A 3MIXA 2X8CA 2HZEB 5DCGA 4GRFA 1GSDA 1VF4A 1PRXA 2AHEA 1YEXA 1ILOA 1Y6EA 3KMNA 2V32A 2IIYA 7GSSA 1YQ1A 2YJ7A 3KMOA 4USSA 1PL2A 2OADA 1QFNA 2H01A 4FYCA 3UJ1A 2OBIA 3QAWA 3EWLA 3QD9A 3EC3A 4YQVA 2VCTA 2PWJA 5FWGA 2AUVA 2JZSA 5G1LA 5KOXA 4ZL8A 1U6TA 3MAKA 2C1YA 3FEUA 4WEYA 2CQ9A 2H74A 1O6JA 4POBA 4HEA2 3GV1A 3LW9A 5DAKB 1THXA 2GQLA 3FR3A 1A0RP 4MMMA 1OYJA 2LJKA 3BJ5A 2MMNA 1WJKA 3A5IA 4MF6A 5HFKA 4OFMA 1TKDB 2KP2A 3TJJA 2G0FA 2K18A 3WGXA 2KLXA 3HJPA 2H72A 3M9KA 4PGTA 3E3EA 1ERTA 1E2YA 5LD0A 1O73A 2B6MA 3A2XA 3IAS2 3UL3A 2DMMA 3GSTA 3EPTA 5CREA 4IKHA 5EVOA 1USBA 3LEFA 1ZYPA 4ZL9A 9GSSA 20GSA 3CTFA 3NIVA 4IGJA 1Y25A 2HZFA 3IA1A 3EYTA 2FWFA 3VI5A 3NZNA 1OC9A 3TKQA 1R4WA 2QA1A 4V2NA 1BEDA 4KDUA 3TKPA 2B1KA 4ZL7A 4ECBA 5CAXA 3TJGA 4PQ1A 4J56E 4Z2UA 2TRXA 3LJRA 3UIWA 1Q4JA 1M0UA 2IMKA 4ZB9A 3IAM2 4MNNA 4MZWA 2LRTA 4K6XA 2L5OA 5IO0A 5KEJA 2NBSA 3RAZA 2I4AA 3ZYWA 1F2EA 1A8LA 2C3NA 2H0HA 1XBSA 4HJ2A 3GA4A 4BA7A 4N0VA 3WYWA 4WR5A 1SL0B 2FA8A 3KP9A 4YKGA 1ML6A 1PMTA 2QKEA 5ECLB 2K8VA 2V6KA 4MF5A 4YQMA 3LG6A 1OKTA 4OD7A 2LSTA 3RBTA 4PQIA 4BVYA 1Z3EA 2M72A 4ZBAA 4MJCA 2QC7A 5IPHA 3R2QA 4WETA 4OO4A 2FWGA 2RIIA 2CX3A 1AQXA 1B8XA 1U87A 4MK3A 4MPFA 2HE3A 4TOPA 3CSJA 1PKZA 2R3XA 2KHPA 2GZPA 2XPEA 1B4QA 19GSA 3DIEA 1Z5YE 3TOUA 3D21A 4KNDA 3IDVA 4O92A 2EIRA 1WOUA 4KDYA 1A24A 4JR4A 1SYRA 4GF0A 3EE2A 1JHBA 2YZUA 3QMXA 5ECSA 5IMCA 1GSEA 1ZZYA 3VURA 1XZOA 1UC7A 2PU9C 3VWUA 1SL1B 2H76A 2R5GA 5ID2B 1ERUA 1N8JA 3GH6A 3AY8A 3QAGA 2M80A 5CRHA 3GNJA 4EDZA 1TU7A 4N11A 3TJKA 1T7PB 4K7NA 4MJEA 1BG5A 1XFLA 4BWQA 4BVXA 5J3RA 1BX9A 3Q18A 4WXTA 4L5OA 1TOFA 2X49A 4GQFA 3FY7A 2M46A 1K3LA 2CVBA 1DSBA 5DALB 1X5CA 3LFLA 1AAZA 3D4MA 4YH2A 4CW9A 3PGTA 1EP7A 3TKSE 2JSYA 1AIUA 1GLPA 2H6ZA 2DSAA 3ZIJA 3F3RA 1EGRA 1AQWA 4K0GA 4WKWA 3RHBA 1EV4A 3KJYA 4G2EA 2JL4A 3QDNA 1OAZA 2C3TA 3IRAA 5ID2A 2B3SA 2H0GA 4TRXA 1B9XC 2X64A 2F8FA 2O89A 1XVQA 1HNAA 2J23A 3G7IA 2PPTA 4LMVA 4F0CA 4XRAA 1A2JA 4J57E 1TRUA 2XHFA 4TW5A 4RQRA 4K9ZA 2ALBA 1SJZA 1LU4A 3SBCA 4OFTA 4BWSA 4MABA 1FOVA 2WDUA 2G2QA 1M9BA 2H1BA 3WGDA 2LTKA 3APQA 4POLA 4JE1A 5GAPD 1V58A 3KZQA 2L6CA 4I8BA 4GSSA 2E2GA 4GCIA 1Z9HA 2K8SA 2I3YA 1NSWA 3ERWA 4IN0A 3ZREA 2HT9A 6GSVA 2DKIA 2FNOA 3G9BA 2PERA 8GSSA 2MZCA 2PN8A 4I2TA 2H30A 4AJ6A 5B7CA 2HSHA 2H19A 4FQUA 2C80A 2OE1A 5CYYA 3Q19A 5FT3A 4G0KA 3P7XA 4RI6A 2GQKA 3S9FA 3J7Yb 1ZCPA 3IK9A 2BJXA 3D0ZA 1B48A 2RM6A 5CO3A 5DJMA 2YWIA 4QL7A 2C0FA 1AC1A 1FAAA 2GLRA 1OC8A 1FHEA 5GZZB 3L78A 1SK1A 3UVHA 3J7Yk 6GSSA 2H73A 2ON7A 2X8GA 3U5RE 2GSRA 3KIJA 2ZNMA 4ECCA 3ED3A 1A2MA 2LRNA 1WPIA 4O5RA 3V1WA 2C0EA 5ECPB 3UEMA 5G5FA 5IMDA 4ID0A 5EPFA 1GNWA 2LQOA 2CAIA 4F82A 3MWHA 3DWVA 1PGTA 4IJ3A 5KN3A 4K7IA 5F05A 3EMPA 2A2RA 5CRWA 2ON5A 4KCEA 1SJ6A 1VGLA 4X0XA 1GSSA 4HJMA 2PVOC 3ZLPA 1HNBA 3WT2A 1IYHA 1V40A 2DJJA 1EGOA 2LUSA 1ZYEA 3L0HA 1U3IA 3QPMA 1SU9A 4LL4B 2OKAA 3P90A 2CVKA 4I5QA 2MMZA 1B9YC 4EUYA 4ZBBA 3LXTA 2GZZA 1X5EA 1SK0A 1TJDA 4V1Ag 5C04A 2LQQA 3A5WA 3EURA 2VL2C 3LYPA 1EOGA 3APSA 5JWOB 3VLNA 2HLSA 2LNTA 3KM6A 1GRXA 5J5NA 3EINA 4G0LA 1G7EA 2I9HA 3TUEA 2YWOA 3KTBA 1XPVA 5IMAA 2RUEA 3HZ4A 2AJQB 5B6MA 4FH8A 4X4JA 1K3YA 2VIMA 5D9WA 3PINA 1R7HA 1RW1A 4TKYA 3WT1A 5CRDA 3FMWA 1S3DA 1NHYA 3FR6A 3HDCA 5CP1A 2NVLA 2E2MA 4ZBDA 1XIYA 2EIOA 2VCZA 1GTBA 2JADA 1RK4A 2VL3A 2AYTA 2IPAA 2N5BA 4JZQA 13GSA 4TVEA 1YKAA 1A0FA 2XC2A 5B8AA 2F8AA 3TRXA 2CX4A 4ZB6A 4KH7A 2NDOA 3ERFA 3GYKA 1MD4A 2FHEA 2OE3A 3LQ7A 4HZ2A 1JZWA 3QFAC 4OMVA 5ECIB 3BCIA 3GTUA 4IW9A 5G31A 5HR3A 4N30A 5IO2A 4F03A 2VD1A 4G19A 2GQMA 4TR3A 3FZAA 2YN1A 2DJKA 3C1SA 5HQPA 1EEJA 3F63A 4GLTA 2IMFA 3HJMA 1OC9B 5INYA 1G6WA 5F07A 3IK7A 4EDYA 1GUKA 1K0CA 3VWWA 3O3TA 1OE7A 4RUVA 5JCUA 4AF2A 3IPZA 5B6NA 1K0OA 3NOFA 4HQZA 1UN2A 1F3BA 4NAXA 1C72A 2KOKA 3FYGA 1TXXA 5KOWA 4DEJA 1FW1A 3IC4A 1WMJA 1I9DA 1O85A 3MNGA 3CXGA 2FY6A 5D9XA 4PXOA 1QXHA 3D6IA 2L4CA 3ZVJD 1CQGA 3TOTA 5IOWA 1AXDA 2DIZA 3QOUA 3D22A 4AJ8A 2R6KA 4HUAA 3C8EA 3ZFBA 2CVDA 2X8HA 1Z7PA 1PN9A 4BVYB 4I2UA 5GSSA 5COHA 1LBKA 2F51A 2CA8A 4MZBA 5EY6A 2WJUA 1Q98A 2LV3A 5A4UA 4GSTA 4O5UA 1SD8A 3ZL5A 2NTOA 4HZ4A 3FW2A 4ICYA 2P5RA 3FZ5A 1TRSA 1TP9A 3EVIA 12GSA 4D73A 4MZCA 5CRGA 1VRSD 1SKSB 3W6GA 3QAVA 1SK2A 1B4PA 2DBCA 3M1GA 2IL3A 5H5SA 1PKWA 3OR5A 4PNFA 1JZOA 5KN0A 4WF5A 3ME7A 3GIXA 2L59A 4E8EA 2AV4A 4KW6A 4ACSA 1TDIA 2AB6A 3GUSA 4IQAA 4EIPA 5ELGA 1XOAA 1A8YA 3HXSA 3TDGA 5LCZA 4ZXGA 1PN0A 1VF2A 2V1MA 1HNCA 3EU3A 4BVXB 1BQ7A 2GSTA 3DVWA 3RPNA 1AUCA 3F0IA 2GDRA 2VL9A 2VCVA 1JZDA 1UVZA 3PR8A 5AIVA 5ECQB 3IXRA 4HU7A 3F8UA 1I5GA 3DRNA 3IHQA 3KD0A 4GTUA 5AIXA 2O7KA 1AW9A 4KSOA 4L5LA 5ENUA 4EXJA 1FB6A 1W89A 4YQUA 3HA9A 3C1RA 1Z6NA 4Q5QA 4OO5A 2IJYA 4JR6A 2RUFA 2PUKC 2OA7A 2F9SA 4DSSA 2GSQA 1GSYA 1SKRB 1K0BA 4FYBA 2YCDA 2O85A 2DJ2A 1KEBA 3APOA 3DMLA 5H5RA 3QCPA 4N10A 1ABAA 1SD9A 5F8BA 3P2AA 2YV7A 1V98A 1V2AA 4XCSA 1V57A 2CZ3A 1IYIA 2B5EA 4NV5A 1A2LA 5BRTA 1GWCA 4TR1A 2FGXA 1OE8A 4F9ZA 3UOMA 2YZHA 1KBNA 2PVQA 4NMUA 1VF3A 2CZ2A 2C8UA 2PMTA 4GXZA 4PX1A 1DBYA 4F0BA 18GSA 1ZYQB 1T3BA 1TI1A 4DSRA 3DVXA 2ES7A 4AJ7A 5IIZA 3M8NA 1HYUA 2DIYA 2YPMA 2JU5A 4XS6A 3ME8A 2C3QA 1PX7A 4KX4A 4MF7A 2HFDA 3N9JA 4JBBA 3DD3A 2KP1A 4V1Ap 2R0PA 1XWCA 4K2DA 3GX0A 1GSQA 3BOAA 3HY2A 3F4SA 3DEXA 4LL1B 1WRYA 4GWRA 1XWKA 1F6MC 3ERGA 3BBYA 2KUCA 1JLWA 3ZZXA 3L4NA 3TRPA 4TXOA 3BD2A 3HYPA 2VD0A 1OKDA 4X1UA 1DE1A 1E6BA 2QGVA 2E0QA 3KH7A 1SENA 1YDKA 3MDKA 10GSA 1R26A 1G0TA 5DBQA 4EVMA 1G7OA 1FB0A 2C0DA 4FYUA 2OJLA 2L6DA 3FZ4A 4IS0A 4BPYA 2HSMA 1T8EB 2HSYA 2K9FA 4DVCA 5H5QA 3C73A 1NW2A 1A23A 2IMIA 1TU8A 2GZYA 1Z7RA 2LS5A 2R0GA 4BL7A 3L9VA 5BMUA 2HRNA 2OBKA 3UAPA 4K7OA 1SL2B 4A5PA 1X9SB 2VO4A 2H70A 3I69A 1SKWB 2GVPA 4K8MA 3KGKA 1EOHA 1ZOFA 1EV9A 3ZMLA 3MSZA 2H1DA 2EIQA 2B7JA 3UARA 2YWNA 1PD21 5ECMB 4ZILA 1ST9A 4XHMA 1J0FA 4K5RA 4Z7XA 3F4RA 1PL1A 4CY6A 4AGSA 4RQXA 2DJ1A 4YKFA 1PX6A 1GL8A 3CSIA 2VL2A 4IHUA 3GN3A 1TI3A 2WS2A 6GSWA 16GSA 3KH9A 3JCML 2O8VB 1XW5A 3VPQA 4OCEA 4ECJA 3DGQA 1T1VA 4L0UA 4QQ7A 3GHAA 3VWXA 3K8NA 1H4OA 2H0IA 1BAYA 3F9UA 1K0DA 4FO5A 2MBSA 4NPBA 1JZRA 4MP4A 1QMVA 3IBHA 5IM9A 5ECKB 2DC5A 1M2BA 3W8SA 5D96A 3W8JA 3GTUB 4K5SA 3CMIA 3FZ9A 3GURA 5A4VA 1VF1A 2HYXA 4IELA 4Q5RA 1M9AA 4WR4A 3A2WA 4NWYA 3N5OA 4TXVA 2XPDA 1M2AA 2H1GA 3HKRA 1K3OA 5HR2A 5GSTA 5J41A 2LJRA 1O81A 1WE0A 4POKA 5DVBA 5G30A 2H66A 3TKRA 2VLVA 2VM2A 1GTAA 3RPPA 4EKZA 4MPGA 4YAVA 4HOJA 2V2GA 4V2MA 3EMXA 4HDEA 2IMDA 4X43A 3TGZA 4G10A 5DQSA 3O6TA 5ECNB 4KB3A 5G2ZA 4ISDA 1BJXA 1GP1A 1QUWA 4LMWA 2H1AA 3HZ8A 1RQMA 3L9UA 4HU9A 4IP1A 4LLRA 1K0AA 5KN1A 2FCHA 3IE3A 4I6XA 4XIHA 5G5EA 5IMZA 1J08A 5LNKe 3KXOA 1SJIA 2I1UA 3A2VA 3H1NA 3TJBA 1MDIA 2OACA 3VI7A 3F4TA 5DQYA 1LJRA 4JRRA 1X9WB 1TK0B 3I9V2 2N5FA 4GSNA 4XS4A 2YOIA 1GSFA 5F0GA 1YF1A 14GSA 1K0MA 2R2JA 4TN8A 3DXBA 1J9BA 1ON4A 1U88A 3F3QA 4MCUA 2GT6A 5D73A 4E8HA 2VLUA 3IHGA 3TKSA 2PGTA 1O8XA 3GMFA 1ZGNA 2B5XA 4ML1A 2REMA 1N2AA 3HVXA 1MTCA 1ACVA 3D5JA 3SWLA 2H6YA 1BYEA 4D73B 5L71A 1UA5A 1M99A 1MDKA 3C71A 4HS1A 4IP6A 4KA0A 1S3CA 4O32A 4LA1A 2JACA 4G0IA 2CAQA 3BCKA 1YEPA 3I6AA 4ML6A 4OCFA 3GKXA 3M3MA 5B8BA 3VK9A 3GFKA 3EU4A 3PPUA 3R3EA 4G9HA 2DKHA 1O7UA 3IOSA 2CT6A 2DMLA 6GSXA 1R5PA 5E59A 3FRCA 1GSUA 2HZEA 5ECRB 2MMAA 1WIKA 5E4WA 1GH2A 2K6VA 4JEDA 5F06A 4MJAA 5CNWA 3TKSC 3GRXA 2L5LA 3ZTLA 2TIRA 3L9SA 5DCHA 4KAEA 4TR0A 3TCOA 2RLIA 4L8EA 4PUAA 2MMOA 5J4UA 1YKCA 3TRQA 2AAWA 3A3TA 3HJOA 1WWJA 4CHSA 2YNXA 3M0FA 3GKNA 3HVVA 1XXUA 3KEBA 5IQYA 2P31A 1ZYNA 3UBLA 3F6DA 1M2DA 2DJ3A 2VOCA 2Z9SA 1WP0A 2QA2A 1T4ZA 1CQHA 4MH3A 1HQOA 1TRWA 5ECHB 5DAKA 2R4VA 2IFQB 3FR9A 4DSSB 1TTZA 1HD2A 2HRKA 3FKFA 2EC4A 3G7JA 4PTSA 1GNEA 4FIWA 4CY8A 3C7MA 1URMA 1MEKA 4PURA 4NHWA 4GQCA 5KN2A 4IVFA 1R5AA 3GH9A 4P3YB 1PQNA 3RHCA 4EL1A 3ZVJA 1XW6A 3I43A 2B5YA 1XCCA 2WULA 1G6YA 2B1LA 5ECOB 3H8QA 3GL5A 2JZTA 2JSZA 1FOHA 3WGEA 3KP8A 4XTSA 4EF0A 4OWYA 2F3MA 3LGCA 3GKMA 4TR1B 4Z2TA 3UMAA 1JFUA 4EC0A 2R0CA 5HR1A 3ZFLA 2P0GA 3IR4A 3M9JA 2HXKA 3HHVA 5HFIA 5C00A 4CDOA 1DE2A 2ZUPA 2IFQA 5A5KA 3GKKA 2QSIA 2YWMA 2YV9A 1OVNA 4KF9A 4KUNA 11GSA 4MH2A 4TR4A 2LEGA 2LJAA 2XBIA 1H75A 3CTGA 4EE0A 4ECIA 4K2XA 1F3AA 3IC8A 1GLQA 4TXOB 2IN3A 5ABRA 1M7TA 2WFCA 1AQVA 3Q74A 2FLSA 4Q5NA 4ILFA 2WRTA 1W4VA 4MJBA 3P8WA 3VWVA 1F9MA 2TRCP 3VFIA 2IWTA 3KTLA 4KGIA 4PUFC 3H4KA 1ERVA 3U6VA 1MDJA 2MYGA 5ELAA 2O87A 1QK8A 3TB2A 1NHOA 4BL7B 4KCAA 2P5QA 3G7YA 3KCMA 1KTEA 4F2IA 1V9WA 3FK8A 2FWEA 4QL9A 4MDCA 2RM5A 2V6OA 2A4VA 5EL8A 4NV2A 4OFNA 5J9BA 3F6FA 1T4YA 4O5QA 2H8LA 4IQ1A 2WZ9A 2FD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7K A;  2L57 A;  6GSY A;  2FUG 2;  2MBT A;  4IJI A;  5AN1 A;  3FHK A;  2JZR A;  6GST A;  2WB9 A;  2VCX A;  3QR6 A;  1PSQ A;  17GS A;  4JU5 A;  1YF0 A;  2OE0 A;  3DYR A;  4MLY A;  6GSU A;  1QGV A;  1T00 A;  4XS1 A;  2WCI A;  4K1F A;  1EWX A;  2X99 A;  5J9C A;  3LSZ A;  2PBJ A;  2H75 A;  1TK8 B;  1GUH A;  2I81 A;  1GTU A;  1PA3 A;  2FA4 A;  1TK5 B;  5DAL A;  5IMF A;  4NHZ A;  1GUM A;  4ULX A;  5DDL A;  2HI7 A;  4V2L A;  5D8I A;  1XOB A;  3VPT A;  2D2Z A;  5HFG A;  2VCW A;  1YJ6 A;  4I97 A;  4WBJ A;  2ZCT A;  3ISO A;  1U3A A;  3ZRD A;  3O76 A;  1NM3 A;  1GUL A;  2DLX A;  3GL3 A;  5JWR B;  5JWQ B;  3TJF A;  5DJL A;  2VCQ A;  2N5A A;  1OC3 A;  4H86 A;  2C4J A;  2BTO T;  2V41 A;  2BMX A;  2CV4 A;  1XWB A;  1FG4 A;  3US3 A;  4RI7 A;  4WF4 A;  2E7P A;  3ZMK A;  1FVJ A;  1YY7 A;  1XW9 A;  1ZL9 A;  2J9H A;  4O7H A;  5AIS A;  2YAN A;  3GX8 A;  1EEM A;  3ZIT A;  1SYX A;  5FHI A;  3PH9 A;  3UBK A;  1XWA A;  4Q5F A;  1S3A A;  4MA9 A;  2LRC A;  1F37 A;  2LKU A;  2GTU A;  1Z6M A;  5GAN D;  2C0G A;  2HNL A;  1TRV A;  2VAF A;  4NXI A;  4J2F A;  1THO A;  3H79 A;  3CRT A;  5HR0 A;  2HRF A;  2DJ0 A;  4HQS A;  4L0W A;  2VUP A;  1X5D A;  1ZMA A;  5AGY A;  4PNG A;  3CRU A;  3LOR A;  5A4W A;  1GTI A;  1YZX A;  2GGT A;  1MD3 A;  1XVW A;  3ZIV A;  3Q6O A;  5G1K A;  4XRD A;  5D9T A;  3D4T A;  2A2S A;  4XS4 B;  3E0U A;  1KNG A;  1TW9 A;  2LNS A;  2GSS A;  3RDW A;  2VLT A;  3QFB C;  3DKS A;  4DSQ A;  3H93 A;  2L4Q A;  1QQ2 A;  5D9V A;  2H6X A;  3CYN A;  3E9J B;  5IMV A;  4EO3 A;  2WGR A;  3LYK A;  4N0Z A;  1XWG A;  5IPG A;  2YJH A;  1EZK A;  2GT5 A;  4YAP A;  3GSS A;  4KE3 A;  3CSH A;  2FWH A;  2VM1 A;  1ERW A;  3HVS A;  3CBU A;  4HI7 A;  2NPB A;  1O8W A;  1X9M B;  4ZB8 A;  4POM A;  1EP8 A;  2R37 A;  4IBP A;  4ZIJ A;  4KDX A;  3UVT A;  3IV4 A;  3LWA A;  5IOX A;  1FVK A;  5JCW A;  4WBR D;  1K0N A;  1X0R A;  2IME A;  3LXZ A;  1FO5 A;  2GS3 A;  2YP6 A;  3HCZ A;  1DUG A;  5D93 A;  4KSM A;  1JLV A;  2XBQ A;  4PQH A;  3WD6 A;  2H71 A;  4K0N A;  22GS A;  5JCG A;  3HD5 A;  2X8C A;  2HZE B;  5DCG A;  4GRF A;  1GSD A;  1VF4 A;  1PRX A;  2AHE A;  1YEX A;  1ILO A;  1Y6E A;  3KMN A;  2V32 A;  2IIY A;  7GSS A;  1YQ1 A;  2YJ7 A;  3KMO A;  1PL2 A;  2OAD A;  1QFN A;  2H01 A;  4FYC A;  3UJ1 A;  2OBI A;  3QAW A;  3EWL A;  3QD9 A;  3EC3 A;  4YQV A;  2VCT A;  2PWJ A;  5FWG A;  2AUV A;  2JZS A;  5G1L A;  4ZL8 A;  1U6T A;  3MAK A;  2C1Y A;  3FEU A;  4WEY A;  2CQ9 A;  2H74 A;  1O6J A;  4POB A;  4HEA 2;  3GV1 A;  5DAK B;  1THX A;  2GQL A;  3FR3 A;  1A0R P;  4MMM A;  1OYJ A;  2LJK A;  3BJ5 A;  2MMN A;  1WJK A;  5HFK A;  4MF6 A;  4OFM A;  1TKD B;  2KP2 A;  3TJJ A;  2G0F A;  2K18 A;  3WGX A;  2KLX A;  3HJP A;  2H72 A;  3M9K A;  4PGT A;  3E3E A;  1ERT A;  1E2Y A;  5LD0 A;  1O73 A;  2B6M A;  3A2X A;  3IAS 2;  3UL3 A;  2DMM A;  3GST A;  4IKH A;  5CRE A;  5EVO A;  1USB A;  3LEF A;  4ZL9 A;  9GSS A;  20GS A;  3CTF A;  3NIV A;  4IGJ A;  1Y25 A;  2HZF A;  3IA1 A;  3EYT A;  2FWF A;  3VI5 A;  3NZN A;  1OC9 A;  3TKQ A;  1R4W A;  4V2N A;  1BED A;  4KDU A;  3TKP A;  2B1K A;  4ZL7 A;  4ECB A;  5CAX A;  3TJG A;  4PQ1 A;  4J56 E;  2TRX A;  3LJR A;  3UIW A;  1Q4J A;  1M0U A;  2IMK A;  4ZB9 A;  3IAM 2;  4MZW A;  2LRT A;  4K6X A;  2L5O A;  5IO0 A;  5KEJ A;  2NBS A;  3RAZ A;  2I4A A;  3ZYW A;  1F2E A;  1A8L A;  2C3N A;  2H0H A;  1XBS A;  4HJ2 A;  3GA4 A;  4BA7 A;  4N0V A;  3WYW A;  4WR5 A;  1SL0 B;  2FA8 A;  3KP9 A;  1ML6 A;  1PMT A;  2QKE A;  5ECL B;  2K8V A;  2V6K A;  4MF5 A;  4YQM A;  3LG6 A;  1OKT A;  4OD7 A;  2LST A;  3RBT A;  4PQI A;  4BVY A;  1Z3E A;  2M72 A;  4ZBA A;  4MJC A;  2QC7 A;  5IPH A;  3R2Q A;  4WET A;  4OO4 A;  2FWG A;  2RII A;  2CX3 A;  1AQX A;  1B8X A;  1U87 A;  4MK3 A;  4MPF A;  2HE3 A;  4TOP A;  3CSJ A;  1PKZ A;  2R3X A;  2KHP A;  2GZP A;  2XPE A;  1B4Q A;  19GS A;  3DIE A;  1Z5Y E;  3TOU A;  3D21 A;  4KND A;  3IDV A;  4O92 A;  2EIR A;  1WOU A;  4KDY A;  1A24 A;  4JR4 A;  1SYR A;  4GF0 A;  3EE2 A;  1JHB A;  2YZU A;  3QMX A;  5ECS A;  5IMC A;  1GSE A;  1ZZY A;  3VUR A;  1XZO A;  1UC7 A;  2PU9 C;  3VWU A;  1SL1 B;  2H76 A;  2R5G A;  5ID2 B;  1ERU A;  1N8J A;  3GH6 A;  3AY8 A;  3QAG A;  2M80 A;  5CRH A;  3GNJ A;  4EDZ A;  1TU7 A;  4N11 A;  3TJK A;  1T7P B;  4K7N A;  4MJE A;  1BG5 A;  1XFL A;  4BWQ A;  4BVX A;  5J3R A;  1BX9 A;  3Q18 A;  4WXT A;  4L5O A;  1TOF A;  4GQF A;  3FY7 A;  2M46 A;  1K3L A;  2CVB A;  1DSB A;  5DAL B;  1X5C A;  3LFL A;  1AAZ A;  3D4M A;  4YH2 A;  4CW9 A;  3PGT A;  1EP7 A;  3TKS E;  2JSY A;  1AIU A;  1GLP A;  2H6Z A;  2DSA A;  3ZIJ A;  3F3R A;  1EGR A;  1AQW A;  4K0G A;  4WKW A;  3RHB A;  1EV4 A;  3KJY A;  4G2E A;  2JL4 A;  3QDN A;  1OAZ A;  2C3T A;  3IRA A;  5ID2 A;  2B3S A;  2H0G A;  4TRX A;  1B9X C;  2X64 A;  2F8F A;  2O89 A;  1XVQ A;  1HNA A;  2J23 A;  3G7I A;  2PPT A;  4LMV A;  4F0C A;  4XRA A;  1A2J A;  4J57 E;  1TRU A;  2XHF A;  4TW5 A;  4RQR A;  4K9Z A;  2ALB A;  1SJZ A;  1LU4 A;  3SBC A;  4OFT A;  4BWS A;  4MAB A;  1FOV A;  2WDU A;  2G2Q A;  1M9B A;  2H1B A;  3WGD A;  2LTK A;  3APQ A;  4POL A;  4JE1 A;  5GAP D;  1V58 A;  3KZQ A;  2L6C A;  4I8B A;  4GSS A;  2E2G A;  4GCI A;  1Z9H A;  2K8S A;  2I3Y A;  1NSW A;  3ERW A;  4IN0 A;  3ZRE A;  2HT9 A;  6GSV A;  2FNO A;  3G9B A;  2PER A;  8GSS A;  2MZC A;  2PN8 A;  4I2T A;  2H30 A;  4AJ6 A;  5B7C A;  2HSH A;  2H19 A;  2C80 A;  2OE1 A;  5CYY A;  3Q19 A;  5FT3 A;  3P7X A;  4RI6 A;  2GQK A;  3S9F A;  3J7Y b;  1ZCP A;  3IK9 A;  2BJX A;  3D0Z A;  1B48 A;  2RM6 A;  5CO3 A;  5DJM A;  2YWI A;  4QL7 A;  2C0F A;  1AC1 A;  1FAA A;  2GLR A;  1OC8 A;  1FHE A;  5GZZ B;  3L78 A;  1SK1 A;  3UVH A;  3J7Y k;  6GSS A;  2H73 A;  2ON7 A;  2X8G A;  3U5R E;  2GSR A;  3KIJ A;  2ZNM A;  4ECC A;  3ED3 A;  1A2M A;  2LRN A;  1WPI A;  4O5R A;  3V1W A;  2C0E A;  5ECP B;  3UEM A;  5G5F A;  5IMD A;  4ID0 A;  5EPF A;  1GNW A;  2LQO A;  2CAI A;  4F82 A;  3MWH A;  3DWV A;  1PGT A;  4IJ3 A;  5KN3 A;  5F05 A;  4K7I A;  3EMP A;  2A2R A;  5CRW A;  2ON5 A;  4KCE A;  1SJ6 A;  1VGL A;  4X0X A;  1GSS A;  4HJM A;  2PVO C;  3ZLP A;  1HNB A;  3WT2 A;  1IYH A;  1V40 A;  2DJJ A;  1EGO A;  2LUS A;  1ZYE A;  3L0H A;  1U3I A;  3QPM A;  1SU9 A;  4LL4 B;  2OKA A;  3P90 A;  2CVK A;  4I5Q A;  2MMZ A;  1B9Y C;  4EUY A;  4ZBB A;  3LXT A;  2GZZ A;  1X5E A;  1SK0 A;  1TJD A;  4V1A g;  5C04 A;  2LQQ A;  3A5W A;  3EUR A;  2VL2 C;  3LYP A;  1EOG A;  3APS A;  5JWO B;  3VLN A;  2HLS A;  2LNT A;  3KM6 A;  1GRX A;  5J5N A;  3EIN A;  1G7E A;  2I9H A;  3TUE A;  2YWO A;  3KTB A;  1XPV A;  5IMA A;  2RUE A;  3HZ4 A;  2AJQ B;  5B6M A;  4FH8 A;  5D9W A;  1K3Y A;  2VIM A;  3PIN A;  1R7H A;  1RW1 A;  4TKY A;  3WT1 A;  5CRD A;  1S3D A;  1NHY A;  3FR6 A;  3HDC A;  5CP1 A;  2NVL A;  2E2M A;  4ZBD A;  1XIY A;  2EIO A;  2VCZ A;  1GTB A;  2JAD A;  1RK4 A;  2VL3 A;  2AYT A;  2IPA A;  2N5B A;  4JZQ A;  13GS A;  4TVE A;  1YKA A;  1A0F A;  2XC2 A;  5B8A A;  2F8A A;  3TRX A;  2CX4 A;  4ZB6 A;  4KH7 A;  2NDO A;  3ERF A;  3GYK A;  1MD4 A;  2FHE A;  2OE3 A;  3LQ7 A;  4HZ2 A;  1JZW A;  3QFA C;  4OMV A;  5ECI B;  3BCI A;  3GTU A;  4IW9 A;  5G31 A;  5HR3 A;  4N30 A;  5IO2 A;  4F03 A;  2VD1 A;  4G19 A;  2GQM A;  4TR3 A;  3FZA A;  2YN1 A;  2DJK A;  3C1S A;  5HQP A;  1EEJ A;  3F63 A;  4GLT A;  2IMF A;  3HJM A;  1OC9 B;  5INY A;  1G6W A;  5F07 A;  3IK7 A;  4EDY A;  1GUK A;  1K0C A;  3VWW A;  3O3T A;  1OE7 A;  4RUV A;  5JCU A;  4AF2 A;  3IPZ A;  5B6N A;  1K0O A;  3NOF A;  4HQZ A;  1UN2 A;  1F3B A;  4NAX A;  1C72 A;  2KOK A;  3FYG A;  1TXX A;  4DEJ A;  1FW1 A;  3IC4 A;  1WMJ A;  1I9D A;  1O85 A;  3MNG A;  3CXG A;  2FY6 A;  5D9X A;  4PXO A;  1QXH A;  3D6I A;  2L4C A;  3ZVJ D;  1CQG A;  3TOT A;  5IOW A;  1AXD A;  2DIZ A;  3QOU A;  3D22 A;  4AJ8 A;  2R6K A;  4HUA A;  3C8E A;  3ZFB A;  2CVD A;  2X8H A;  1Z7P A;  1PN9 A;  4I2U A;  5GSS A;  5COH A;  1LBK A;  2F51 A;  2CA8 A;  4MZB A;  5EY6 A;  2WJU A;  1Q98 A;  2LV3 A;  5A4U A;  4GST A;  1SD8 A;  3ZL5 A;  2NTO A;  4HZ4 A;  3FW2 A;  2P5R A;  3FZ5 A;  1TRS A;  1TP9 A;  3EVI A;  12GS A;  4D73 A;  4MZC A;  5CRG A;  1VRS D;  1SKS B;  3W6G A;  3QAV A;  1SK2 A;  1B4P A;  2DBC A;  3M1G A;  2IL3 A;  5H5S A;  1PKW A;  3OR5 A;  4PNF A;  1JZO A;  5KN0 A;  4WF5 A;  3ME7 A;  3GIX A;  2L59 A;  4E8E A;  2AV4 A;  4KW6 A;  4ACS A;  1TDI A;  2AB6 A;  3GUS A;  4IQA A;  5ELG A;  1XOA A;  1A8Y A;  3HXS A;  3TDG A;  5LCZ A;  4ZXG A;  1VF2 A;  2V1M A;  1HNC A;  3EU3 A;  1BQ7 A;  2GST A;  3DVW A;  3RPN A;  1AUC A;  3F0I A;  2GDR A;  2VL9 A;  2VCV A;  1JZD A;  1UVZ A;  3PR8 A;  5AIV A;  5ECQ B;  3IXR A;  4HU7 A;  3F8U A;  1I5G A;  3DRN A;  3IHQ A;  3KD0 A;  4GTU A;  5AIX A;  2O7K A;  1AW9 A;  4KSO A;  4L5L A;  5ENU A;  4EXJ A;  1FB6 A;  1W89 A;  4YQU A;  3HA9 A;  3C1R A;  1Z6N A;  4Q5Q A;  4OO5 A;  2IJY A;  4JR6 A;  2RUF A;  2PUK C;  2OA7 A;  2F9S A;  4DSS A;  2GSQ A;  1GSY A;  1SKR B;  1K0B A;  4FYB A;  2YCD A;  2O85 A;  2DJ2 A;  1KEB A;  3APO A;  3DML A;  5H5R A;  3QCP A;  4N10 A;  1ABA A;  1SD9 A;  5F8B A;  3P2A A;  2YV7 A;  1V98 A;  1V2A A;  4XCS A;  1V57 A;  2CZ3 A;  1IYI A;  2B5E A;  4NV5 A;  1A2L A;  1GWC A;  4TR1 A;  2FGX A;  1OE8 A;  4F9Z A;  3UOM A;  2YZH A;  1KBN A;  2PVQ A;  4NMU A;  1VF3 A;  2CZ2 A;  2C8U A;  2PMT A;  4GXZ A;  4PX1 A;  1DBY A;  4F0B A;  18GS A;  1ZYQ B;  1T3B A;  1TI1 A;  4DSR A;  3DVX A;  2ES7 A;  4AJ7 A;  5IIZ A;  3M8N A;  1HYU A;  2DIY A;  2YPM A;  2JU5 A;  4XS6 A;  3ME8 A;  2C3Q A;  1PX7 A;  4KX4 A;  4MF7 A;  2HFD A;  3N9J A;  4JBB A;  3DD3 A;  2KP1 A;  4V1A p;  1XWC A;  4K2D A;  3GX0 A;  1GSQ A;  3BOA A;  3HY2 A;  3F4S A;  3DEX A;  4LL1 B;  1WRY A;  4GWR A;  1XWK A;  1F6M C;  3ERG A;  3BBY A;  2KUC A;  1JLW A;  3ZZX A;  3L4N A;  3TRP A;  4TXO A;  3BD2 A;  3HYP A;  2VD0 A;  1OKD A;  4X1U A;  1DE1 A;  1E6B A;  2QGV A;  2E0Q A;  3KH7 A;  1SEN A;  1YDK A;  3MDK A;  10GS A;  1R26 A;  1G0T A;  5DBQ A;  4EVM A;  1G7O A;  1FB0 A;  2C0D A;  4FYU A;  2OJL A;  2L6D A;  3FZ4 A;  4IS0 A;  4BPY A;  1T8E B;  2HSY A;  2K9F A;  4DVC A;  5H5Q A;  3C73 A;  1NW2 A;  1A23 A;  2IMI A;  1TU8 A;  2GZY A;  1Z7R A;  2LS5 A;  4BL7 A;  3L9V A;  2HRN A;  2OBK A;  3UAP A;  4K7O A;  1SL2 B;  1X9S B;  2VO4 A;  2H70 A;  3I69 A;  1SKW B;  2GVP A;  4K8M A;  3KGK A;  1EOH A;  1ZOF A;  1EV9 A;  3ZML A;  3MSZ A;  2H1D A;  2EIQ A;  2B7J A;  3UAR A;  2YWN A;  1PD2 1;  5ECM B;  4ZIL A;  1ST9 A;  4XHM A;  1J0F A;  4Z7X A;  3F4R A;  1PL1 A;  4AGS A;  4RQX A;  2DJ1 A;  1PX6 A;  1GL8 A;  3CSI A;  2VL2 A;  4IHU A;  3GN3 A;  1TI3 A;  2WS2 A;  6GSW A;  16GS A;  3KH9 A;  3JCM L;  2O8V B;  1XW5 A;  3VPQ A;  4OCE A;  4ECJ A;  3DGQ A;  1T1V A;  4L0U A;  4QQ7 A;  3GHA A;  3VWX A;  3K8N A;  1H4O A;  2H0I A;  1BAY A;  3F9U A;  1K0D A;  4FO5 A;  2MBS A;  4NPB A;  1JZR A;  4MP4 A;  1QMV A;  3IBH A;  5IM9 A;  5ECK B;  2DC5 A;  1M2B A;  3W8S A;  5D96 A;  3W8J A;  3GTU B;  3CMI A;  3FZ9 A;  3GUR A;  5A4V A;  1VF1 A;  2HYX A;  4IEL A;  4Q5R A;  1M9A A;  4WR4 A;  3A2W A;  4NWY A;  3N5O A;  4TXV A;  2XPD A;  1M2A A;  2H1G A;  3HKR A;  1K3O A;  5HR2 A;  5GST A;  5J41 A;  2LJR A;  1O81 A;  1WE0 A;  4POK A;  5DVB A;  5G30 A;  2H66 A;  3TKR A;  2VLV A;  2VM2 A;  1GTA A;  3RPP A;  4EKZ A;  4MPG A;  4YAV A;  4HOJ A;  2V2G A;  4V2M A;  3EMX A;  4HDE A;  2IMD A;  4X43 A;  3TGZ A;  4G10 A;  5DQS A;  3O6T A;  5ECN B;  4KB3 A;  5G2Z A;  4ISD A;  1BJX A;  1GP1 A;  1QUW A;  4LMW A;  2H1A A;  3HZ8 A;  1RQM A;  3L9U A;  4HU9 A;  4IP1 A;  4LLR A;  1K0A A;  5KN1 A;  2FCH A;  3IE3 A;  4I6X A;  4XIH A;  5G5E A;  5IMZ A;  1J08 A;  5LNK e;  3KXO A;  1SJI A;  2I1U A;  3A2V A;  3H1N A;  3TJB A;  1MDI A;  2OAC A;  3VI7 A;  3F4T A;  5DQY A;  1LJR A;  4JRR A;  1X9W B;  1TK0 B;  3I9V 2;  2N5F A;  4GSN A;  4XS4 A;  2YOI A;  1GSF A;  5F0G A;  1YF1 A;  14GS A;  1K0M A;  2R2J A;  4TN8 A;  3DXB A;  1J9B A;  1ON4 A;  1U88 A;  3F3Q A;  4MCU A;  2GT6 A;  5D73 A;  4E8H A;  2VLU A;  3TKS A;  2PGT A;  1O8X A;  3GMF A;  1ZGN A;  2B5X A;  4ML1 A;  2REM A;  1N2A A;  3HVX A;  1MTC A;  1ACV A;  3D5J A;  3SWL A;  2H6Y A;  1BYE A;  4D73 B;  5L71 A;  1UA5 A;  1M99 A;  1MDK A;  3C71 A;  4HS1 A;  4IP6 A;  4KA0 A;  1S3C A;  4O32 A;  4LA1 A;  2JAC A;  2CAQ A;  3BCK A;  1YEP A;  3I6A A;  4ML6 A;  4OCF A;  3GKX A;  3M3M A;  5B8B A;  3VK9 A;  3GFK A;  3EU4 A;  4G9H A;  1O7U A;  3IOS A;  2CT6 A;  2DML A;  6GSX A;  1R5P A;  5E59 A;  3FRC A;  1GSU A;  2HZE A;  5ECR B;  2MMA A;  1WIK A;  5E4W A;  1GH2 A;  2K6V A;  4JED A;  5F06 A;  4MJA A;  5CNW A;  3TKS C;  3GRX A;  2L5L A;  3ZTL A;  2TIR A;  3L9S A;  5DCH A;  4KAE A;  4TR0 A;  3TCO A;  2RLI A;  4L8E A;  4PUA A;  2MMO A;  5J4U A;  1YKC A;  3TRQ A;  2AAW A;  3A3T A;  3HJO A;  1WWJ A;  4CHS A;  2YNX A;  3M0F A;  3GKN A;  3HVV A;  1XXU A;  3KEB A;  5IQY A;  2P31 A;  3UBL A;  3F6D A;  1M2D A;  2DJ3 A;  2VOC A;  2Z9S A;  1WP0 A;  1T4Z A;  1CQH A;  4MH3 A;  1HQO A;  1TRW A;  5ECH B;  5DAK A;  2R4V A;  2IFQ B;  3FR9 A;  4DSS B;  1TTZ A;  1HD2 A;  3FKF A;  2EC4 A;  3G7J A;  1GNE A;  4FIW A;  3C7M A;  1URM A;  1MEK A;  4PUR A;  4NHW A;  4GQC A;  5KN2 A;  4IVF A;  1R5A A;  3GH9 A;  4P3Y B;  1PQN A;  3RHC A;  4EL1 A;  3ZVJ A;  1XW6 A;  3I43 A;  2B5Y A;  1XCC A;  2WUL A;  1G6Y A;  2B1L A;  5ECO B;  3H8Q A;  3GL5 A;  2JZT A;  2JSZ A;  3WGE A;  3KP8 A;  4XTS A;  4EF0 A;  4OWY A;  2F3M A;  3LGC A;  3GKM A;  4TR1 B;  3UMA A;  1JFU A;  4EC0 A;  5HR1 A;  3ZFL A;  2P0G A;  3IR4 A;  3M9J A;  2HXK A;  3HHV A;  5HFI A;  5C00 A;  4CDO A;  1DE2 A;  2ZUP A;  2IFQ A;  5A5K A;  3GKK A;  2QSI A;  2YWM A;  2YV9 A;  1OVN A;  4KUN A;  11GS A;  4MH2 A;  4TR4 A;  2LEG A;  2LJA A;  2XBI A;  1H75 A;  3CTG A;  4EE0 A;  4ECI A;  1F3A A;  1GLQ A;  4TXO B;  2IN3 A;  5ABR A;  1M7T A;  2WFC A;  1AQV A;  3Q74 A;  2FLS A;  4Q5N A;  4ILF A;  2WRT A;  1W4V A;  4MJB A;  3P8W A;  3VWV A;  1F9M A;  2TRC P;  3VFI A;  2IWT A;  3KTL A;  4KGI A;  4PUF C;  3H4K A;  1ERV A;  3U6V A;  1MDJ A;  2MYG A;  5ELA A;  2O87 A;  1QK8 A;  3TB2 A;  1NHO A;  4KCA A;  2P5Q A;  3G7Y A;  3KCM A;  1KTE A;  4F2I A;  1V9W A;  3FK8 A;  2FWE A;  4QL9 A;  4MDC A;  2RM5 A;  2V6O A;  2A4V A;  5EL8 A;  4NV2 A;  4OFN A;  5J9B A;  3F6F A;  1T4Y A;  2H8L A;  4IQ1 A;  2WZ9 A;  2FD3 A; 
#chains in the Genus database with same CATH topology
 2HRA A;  2B7K A;  2L57 A;  6GSY A;  2FUG 2;  2MBT A;  4IJI A;  5AN1 A;  3FHK A;  2JZR A;  6GST A;  2WB9 A;  2VCX A;  3QR6 A;  1PSQ A;  17GS A;  4JU5 A;  1YF0 A;  2OE0 A;  3DYR A;  4MLY A;  6GSU A;  1QGV A;  1T00 A;  4XS1 A;  2WCI A;  4K1F A;  1EWX A;  2X99 A;  5J9C A;  3LSZ A;  2PBJ A;  2H75 A;  1TK8 B;  1GUH A;  2I81 A;  4Z2R A;  1GTU A;  1PA3 A;  2FA4 A;  4EIQ A;  1TK5 B;  5DAL A;  5IMF A;  4NHZ A;  1GUM A;  4ULX A;  5DDL A;  2HI7 A;  3MYD A;  4V2L A;  5D8I A;  1XOB A;  3VPT A;  2D2Z A;  5HFG A;  2VCW A;  1YJ6 A;  4I97 A;  4WBJ A;  2ZCT A;  3ISO A;  1U3A A;  3ZRD A;  3O76 A;  1NM3 A;  1GUL A;  2DLX A;  3GL3 A;  5JWR B;  5JWQ B;  3TJF A;  5DJL A;  2VCQ A;  2A2P A;  2N5A A;  1OC3 A;  4H86 A;  2C4J A;  2BTO T;  2V41 A;  2A4H A;  2BMX A;  2CV4 A;  1XWB A;  1FG4 A;  3US3 A;  4RI7 A;  4WF4 A;  2E7P A;  3ZMK A;  1FVJ A;  1YY7 A;  1XW9 A;  1ZL9 A;  2J9H A;  4O7H A;  5AIS A;  2YAN A;  3GX8 A;  1EEM A;  3ZIT A;  1SYX A;  5FHI A;  3PH9 A;  3UBK A;  1XWA A;  4Q5F A;  1S3A A;  4MA9 A;  2LRC A;  1F37 A;  2LKU A;  2GTU A;  1Z6M A;  5GAN D;  2C0G A;  2HNL A;  1TRV A;  2VAF A;  4NXI A;  4J2F A;  1THO A;  3H79 A;  3CRT A;  5HR0 A;  2HRF A;  2DJ0 A;  4HQS A;  4L0W A;  2VUP A;  1X5D A;  1ZMA A;  5AGY A;  4PNG A;  3CRU A;  2UZ8 A;  3LOR A;  5A4W A;  1GTI A;  1YZX A;  2GGT A;  1MD3 A;  1XVW A;  3ZIV A;  3Q6O A;  5G1K A;  4XRD A;  5D9T A;  3D4T A;  2A2S A;  4XS4 B;  3E0U A;  1KNG A;  1TW9 A;  2LNS A;  2GSS A;  3RDW A;  2VLT A;  3QFB C;  3DKS A;  4DSQ A;  3H93 A;  2L4Q A;  1QQ2 A;  5D9V A;  2H6X A;  3CYN A;  3E9J B;  5IMV A;  4EO3 A;  2WGR A;  3LYK A;  4N0Z A;  1XWG A;  5IPG A;  2YJH A;  1EZK A;  2GT5 A;  4YAP A;  3GSS A;  4KE3 A;  3CSH A;  2X4A A;  2FWH A;  2VM1 A;  1ERW A;  3HVS A;  3CBU A;  4HI7 A;  2NPB A;  1O8W A;  1X9M B;  4ZB8 A;  4POM A;  1EP8 A;  2R37 A;  4IBP A;  4ZIJ A;  4KDX A;  3UVT A;  1XG8 A;  3IV4 A;  3LWA A;  5IOX A;  1FVK A;  5JCW A;  4WBR D;  1K0N A;  1X0R A;  2IME A;  3LXZ A;  1FO5 A;  2GS3 A;  2YP6 A;  1S3R A;  3HCZ A;  1DUG A;  5D93 A;  4KSM A;  1JLV A;  2XBQ A;  4PQH A;  3WD6 A;  2H71 A;  4K0N A;  22GS A;  5JCG A;  3HD5 A;  3MIX A;  2X8C A;  2HZE B;  5DCG A;  4GRF A;  1GSD A;  1VF4 A;  1PRX A;  2AHE A;  1YEX A;  1ILO A;  1Y6E A;  3KMN A;  2V32 A;  2IIY A;  7GSS A;  1PFO A;  1YQ1 A;  2YJ7 A;  3KMO A;  4USS A;  1PL2 A;  2OAD A;  1QFN A;  2H01 A;  4FYC A;  3UJ1 A;  2OBI A;  3QAW A;  3EWL A;  3QD9 A;  3EC3 A;  4YQV A;  2VCT A;  2PWJ A;  5FWG A;  2AUV A;  2JZS A;  5G1L A;  5KOX A;  4ZL8 A;  1U6T A;  3MAK A;  2C1Y A;  3FEU A;  4WEY A;  2CQ9 A;  2H74 A;  1O6J A;  4POB A;  4HEA 2;  3GV1 A;  3LW9 A;  5DAK B;  1THX A;  2GQL A;  3FR3 A;  1A0R P;  4MMM A;  1OYJ A;  2LJK A;  3BJ5 A;  2MMN A;  1WJK A;  3A5I A;  4MF6 A;  5HFK A;  4OFM A;  1TKD B;  2KP2 A;  3TJJ A;  2G0F A;  2K18 A;  3WGX A;  2KLX A;  3HJP A;  2H72 A;  3M9K A;  4PGT A;  3E3E A;  1ERT A;  1E2Y A;  5LD0 A;  1O73 A;  2B6M A;  3A2X A;  3IAS 2;  3UL3 A;  2DMM A;  3GST A;  3EPT A;  5CRE A;  4IKH A;  5EVO A;  1USB A;  3LEF A;  1ZYP A;  4ZL9 A;  9GSS A;  20GS A;  3CTF A;  3NIV A;  4IGJ A;  1Y25 A;  2HZF A;  3IA1 A;  3EYT A;  2FWF A;  3VI5 A;  3NZN A;  1OC9 A;  3TKQ A;  1R4W A;  2QA1 A;  4V2N A;  1BED A;  4KDU A;  3TKP A;  2B1K A;  4ZL7 A;  4ECB A;  5CAX A;  3TJG A;  4PQ1 A;  4J56 E;  4Z2U A;  2TRX A;  3LJR A;  3UIW A;  1Q4J A;  1M0U A;  2IMK A;  4ZB9 A;  3IAM 2;  4MNN A;  4MZW A;  2LRT A;  4K6X A;  2L5O A;  5IO0 A;  5KEJ A;  2NBS A;  3RAZ A;  2I4A A;  3ZYW A;  1F2E A;  1A8L A;  2C3N A;  2H0H A;  1XBS A;  4HJ2 A;  3GA4 A;  4BA7 A;  4N0V A;  3WYW A;  4WR5 A;  1SL0 B;  2FA8 A;  3KP9 A;  4YKG A;  1ML6 A;  1PMT A;  2QKE A;  5ECL B;  2K8V A;  2V6K A;  4MF5 A;  4YQM A;  3LG6 A;  1OKT A;  4OD7 A;  2LST A;  3RBT A;  4PQI A;  4BVY A;  1Z3E A;  2M72 A;  4ZBA A;  4MJC A;  2QC7 A;  5IPH A;  3R2Q A;  4WET A;  4OO4 A;  2FWG A;  2RII A;  2CX3 A;  1AQX A;  1B8X A;  1U87 A;  4MK3 A;  4MPF A;  2HE3 A;  4TOP A;  3CSJ A;  1PKZ A;  2R3X A;  2KHP A;  2GZP A;  2XPE A;  1B4Q A;  19GS A;  3DIE A;  1Z5Y E;  3TOU A;  3D21 A;  4KND A;  3IDV A;  4O92 A;  2EIR A;  1WOU A;  4KDY A;  1A24 A;  4JR4 A;  1SYR A;  4GF0 A;  3EE2 A;  1JHB A;  2YZU A;  3QMX A;  5ECS A;  5IMC A;  1GSE A;  1ZZY A;  3VUR A;  1XZO A;  1UC7 A;  2PU9 C;  3VWU A;  1SL1 B;  2H76 A;  2R5G A;  5ID2 B;  1ERU A;  1N8J A;  3GH6 A;  3AY8 A;  3QAG A;  2M80 A;  5CRH A;  3GNJ A;  4EDZ A;  1TU7 A;  4N11 A;  3TJK A;  1T7P B;  4K7N A;  4MJE A;  1BG5 A;  1XFL A;  4BWQ A;  4BVX A;  5J3R A;  1BX9 A;  3Q18 A;  4WXT A;  4L5O A;  1TOF A;  2X49 A;  4GQF A;  3FY7 A;  2M46 A;  1K3L A;  2CVB A;  1DSB A;  5DAL B;  1X5C A;  3LFL A;  1AAZ A;  3D4M A;  4YH2 A;  4CW9 A;  3PGT A;  1EP7 A;  3TKS E;  2JSY A;  1AIU A;  1GLP A;  2H6Z A;  2DSA A;  3ZIJ A;  3F3R A;  1EGR A;  1AQW A;  4K0G A;  4WKW A;  3RHB A;  1EV4 A;  3KJY A;  4G2E A;  2JL4 A;  3QDN A;  1OAZ A;  2C3T A;  3IRA A;  5ID2 A;  2B3S A;  2H0G A;  4TRX A;  1B9X C;  2X64 A;  2F8F A;  2O89 A;  1XVQ A;  1HNA A;  2J23 A;  3G7I A;  2PPT A;  4LMV A;  4F0C A;  4XRA A;  1A2J A;  4J57 E;  1TRU A;  2XHF A;  4TW5 A;  4RQR A;  4K9Z A;  2ALB A;  1SJZ A;  1LU4 A;  3SBC A;  4OFT A;  4BWS A;  4MAB A;  1FOV A;  2WDU A;  2G2Q A;  1M9B A;  2H1B A;  3WGD A;  2LTK A;  3APQ A;  4POL A;  4JE1 A;  5GAP D;  1V58 A;  3KZQ A;  2L6C A;  4I8B A;  4GSS A;  2E2G A;  4GCI A;  1Z9H A;  2K8S A;  2I3Y A;  1NSW A;  3ERW A;  4IN0 A;  3ZRE A;  2HT9 A;  6GSV A;  2DKI A;  2FNO A;  3G9B A;  2PER A;  8GSS A;  2MZC A;  2PN8 A;  4I2T A;  2H30 A;  4AJ6 A;  5B7C A;  2HSH A;  2H19 A;  4FQU A;  2C80 A;  2OE1 A;  5CYY A;  3Q19 A;  5FT3 A;  4G0K A;  3P7X A;  4RI6 A;  2GQK A;  3S9F A;  3J7Y b;  1ZCP A;  3IK9 A;  2BJX A;  3D0Z A;  1B48 A;  2RM6 A;  5CO3 A;  5DJM A;  2YWI A;  4QL7 A;  2C0F A;  1AC1 A;  1FAA A;  2GLR A;  1OC8 A;  1FHE A;  5GZZ B;  3L78 A;  1SK1 A;  3UVH A;  3J7Y k;  6GSS A;  2H73 A;  2ON7 A;  2X8G A;  3U5R E;  2GSR A;  3KIJ A;  2ZNM A;  4ECC A;  3ED3 A;  1A2M A;  2LRN A;  1WPI A;  4O5R A;  3V1W A;  2C0E A;  5ECP B;  3UEM A;  5G5F A;  5IMD A;  4ID0 A;  5EPF A;  1GNW A;  2LQO A;  2CAI A;  4F82 A;  3MWH A;  3DWV A;  1PGT A;  4IJ3 A;  5KN3 A;  4K7I A;  5F05 A;  3EMP A;  2A2R A;  5CRW A;  2ON5 A;  4KCE A;  1SJ6 A;  1VGL A;  4X0X A;  1GSS A;  4HJM A;  2PVO C;  3ZLP A;  1HNB A;  3WT2 A;  1IYH A;  1V40 A;  2DJJ A;  1EGO A;  2LUS A;  1ZYE A;  3L0H A;  1U3I A;  3QPM A;  1SU9 A;  4LL4 B;  2OKA A;  3P90 A;  2CVK A;  4I5Q A;  2MMZ A;  1B9Y C;  4EUY A;  4ZBB A;  3LXT A;  2GZZ A;  1X5E A;  1SK0 A;  1TJD A;  4V1A g;  5C04 A;  2LQQ A;  3A5W A;  3EUR A;  2VL2 C;  3LYP A;  1EOG A;  3APS A;  5JWO B;  3VLN A;  2HLS A;  2LNT A;  3KM6 A;  1GRX A;  5J5N A;  3EIN A;  4G0L A;  1G7E A;  2I9H A;  3TUE A;  2YWO A;  3KTB A;  1XPV A;  5IMA A;  2RUE A;  3HZ4 A;  2AJQ B;  5B6M A;  4FH8 A;  4X4J A;  1K3Y A;  2VIM A;  5D9W A;  3PIN A;  1R7H A;  1RW1 A;  4TKY A;  3WT1 A;  5CRD A;  3FMW A;  1S3D A;  1NHY A;  3FR6 A;  3HDC A;  5CP1 A;  2NVL A;  2E2M A;  4ZBD A;  1XIY A;  2EIO A;  2VCZ A;  1GTB A;  2JAD A;  1RK4 A;  2VL3 A;  2AYT A;  2IPA A;  2N5B A;  4JZQ A;  13GS A;  4TVE A;  1YKA A;  1A0F A;  2XC2 A;  5B8A A;  2F8A A;  3TRX A;  2CX4 A;  4ZB6 A;  4KH7 A;  2NDO A;  3ERF A;  3GYK A;  1MD4 A;  2FHE A;  2OE3 A;  3LQ7 A;  4HZ2 A;  1JZW A;  3QFA C;  4OMV A;  5ECI B;  3BCI A;  3GTU A;  4IW9 A;  5G31 A;  5HR3 A;  4N30 A;  5IO2 A;  4F03 A;  2VD1 A;  4G19 A;  2GQM A;  4TR3 A;  3FZA A;  2YN1 A;  2DJK A;  3C1S A;  5HQP A;  1EEJ A;  3F63 A;  4GLT A;  2IMF A;  3HJM A;  1OC9 B;  5INY A;  1G6W A;  5F07 A;  3IK7 A;  4EDY A;  1GUK A;  1K0C A;  3VWW A;  3O3T A;  1OE7 A;  4RUV A;  5JCU A;  4AF2 A;  3IPZ A;  5B6N A;  1K0O A;  3NOF A;  4HQZ A;  1UN2 A;  1F3B A;  4NAX A;  1C72 A;  2KOK A;  3FYG A;  1TXX A;  5KOW A;  4DEJ A;  1FW1 A;  3IC4 A;  1WMJ A;  1I9D A;  1O85 A;  3MNG A;  3CXG A;  2FY6 A;  5D9X A;  4PXO A;  1QXH A;  3D6I A;  2L4C A;  3ZVJ D;  1M3I A;  1CQG A;  3TOT A;  5IOW A;  1AXD A;  2DIZ A;  3QOU A;  3D22 A;  4AJ8 A;  2R6K A;  4HUA A;  3C8E A;  3ZFB A;  2CVD A;  2X8H A;  1Z7P A;  1PN9 A;  4BVY B;  4I2U A;  5GSS A;  5COH A;  1LBK A;  2F51 A;  2CA8 A;  4MZB A;  5EY6 A;  2WJU A;  1Q98 A;  2LV3 A;  5A4U A;  4GST A;  4O5U A;  1SD8 A;  3ZL5 A;  2NTO A;  4HZ4 A;  3FW2 A;  4ICY A;  2P5R A;  3FZ5 A;  1TRS A;  1TP9 A;  3EVI A;  12GS A;  4D73 A;  4MZC A;  5CRG A;  1VRS D;  1SKS B;  3W6G A;  3QAV A;  1SK2 A;  1B4P A;  2DBC A;  3M1G A;  2IL3 A;  5H5S A;  1PKW A;  3OR5 A;  4PNF A;  1JZO A;  5KN0 A;  4WF5 A;  3ME7 A;  3GIX A;  2L59 A;  4E8E A;  2AV4 A;  4KW6 A;  4ACS A;  1TDI A;  2AB6 A;  3GUS A;  4IQA A;  4EIP A;  5ELG A;  1XOA A;  1A8Y A;  3HXS A;  3TDG A;  5LCZ A;  4ZXG A;  1PN0 A;  1VF2 A;  2V1M A;  1HNC A;  3EU3 A;  4BVX B;  1BQ7 A;  2GST A;  3DVW A;  3RPN A;  1AUC A;  3F0I A;  2GDR A;  2VL9 A;  2VCV A;  1JZD A;  1UVZ A;  3PR8 A;  5AIV A;  5ECQ B;  3IXR A;  4HU7 A;  3F8U A;  1I5G A;  3DRN A;  3IHQ A;  3KD0 A;  4GTU A;  5AIX A;  2O7K A;  1AW9 A;  4KSO A;  4L5L A;  5ENU A;  4EXJ A;  1FB6 A;  1W89 A;  4YQU A;  3HA9 A;  3C1R A;  1Z6N A;  4Q5Q A;  4OO5 A;  2IJY A;  4JR6 A;  2RUF A;  2PUK C;  2OA7 A;  2F9S A;  4DSS A;  2GSQ A;  1GSY A;  1SKR B;  1K0B A;  4FYB A;  2YCD A;  2O85 A;  2DJ2 A;  1KEB A;  3APO A;  3DML A;  5H5R A;  3QCP A;  4N10 A;  1ABA A;  1SD9 A;  5F8B A;  3HVN A;  3P2A A;  2YV7 A;  1V98 A;  1V2A A;  4XCS A;  1V57 A;  2CZ3 A;  1IYI A;  2B5E A;  4NV5 A;  1A2L A;  5BRT A;  1GWC A;  4TR1 A;  2FGX A;  1OE8 A;  4F9Z A;  3UOM A;  2YZH A;  1KBN A;  2PVQ A;  4NMU A;  1VF3 A;  2CZ2 A;  2C8U A;  2PMT A;  4GXZ A;  4PX1 A;  1DBY A;  4F0B A;  18GS A;  1ZYQ B;  1T3B A;  1TI1 A;  4DSR A;  3DVX A;  2ES7 A;  4AJ7 A;  5IIZ A;  3M8N A;  1HYU A;  2DIY A;  2YPM A;  2JU5 A;  4XS6 A;  3ME8 A;  2C3Q A;  1PX7 A;  4KX4 A;  4MF7 A;  2HFD A;  3N9J A;  4JBB A;  3DD3 A;  2KP1 A;  4V1A p;  2R0P A;  1XWC A;  4K2D A;  3GX0 A;  1GSQ A;  3BOA A;  3HY2 A;  3F4S A;  3DEX A;  4LL1 B;  1WRY A;  4GWR A;  1XWK A;  1F6M C;  3ERG A;  3BBY A;  2KUC A;  1JLW A;  3ZZX A;  3L4N A;  3TRP A;  4TXO A;  3BD2 A;  3HYP A;  2VD0 A;  1OKD A;  4X1U A;  1DE1 A;  1E6B A;  2QGV A;  2E0Q A;  3KH7 A;  1SEN A;  1YDK A;  3MDK A;  10GS A;  1R26 A;  1G0T A;  5DBQ A;  4EVM A;  1G7O A;  1FB0 A;  2C0D A;  4FYU A;  2OJL A;  2L6D A;  3FZ4 A;  4IS0 A;  4BPY A;  2HSM A;  1T8E B;  2HSY A;  2K9F A;  4DVC A;  5H5Q A;  3C73 A;  1NW2 A;  1A23 A;  2IMI A;  1TU8 A;  2GZY A;  1Z7R A;  2LS5 A;  2R0G A;  4BL7 A;  3L9V A;  5BMU A;  2HRN A;  2OBK A;  3UAP A;  4K7O A;  1SL2 B;  4A5P A;  1X9S B;  2VO4 A;  2H70 A;  3I69 A;  1SKW B;  2GVP A;  4K8M A;  3KGK A;  1EOH A;  1ZOF A;  1EV9 A;  3ZML A;  3MSZ A;  2H1D A;  2EIQ A;  2B7J A;  3UAR A;  2YWN A;  1PD2 1;  1M3J A;  5ECM B;  4ZIL A;  1ST9 A;  4XHM A;  1J0F A;  4K5R A;  4Z7X A;  3F4R A;  1PL1 A;  4CY6 A;  4AGS A;  4RQX A;  2DJ1 A;  4YKF A;  1PX6 A;  1GL8 A;  3CSI A;  2VL2 A;  4IHU A;  3GN3 A;  1TI3 A;  2WS2 A;  6GSW A;  16GS A;  3KH9 A;  3JCM L;  2O8V B;  1XW5 A;  3VPQ A;  4OCE A;  4ECJ A;  3DGQ A;  1T1V A;  4L0U A;  4QQ7 A;  3GHA A;  3VWX A;  3K8N A;  1H4O A;  2H0I A;  1BAY A;  3F9U A;  4HSC X;  1K0D A;  4FO5 A;  2MBS A;  4NPB A;  1JZR A;  4MP4 A;  1QMV A;  3IBH A;  5IM9 A;  5ECK B;  2DC5 A;  1M2B A;  3W8S A;  5D96 A;  3W8J A;  3GTU B;  4K5S A;  3CMI A;  3FZ9 A;  3GUR A;  5A4V A;  1VF1 A;  2HYX A;  4IEL A;  4Q5R A;  1M9A A;  4WR4 A;  3A2W A;  4NWY A;  3N5O A;  4TXV A;  2XPD A;  1M2A A;  2H1G A;  3HKR A;  1K3O A;  5HR2 A;  5GST A;  5J41 A;  2LJR A;  1O81 A;  1WE0 A;  4POK A;  5DVB A;  5G30 A;  2H66 A;  3TKR A;  2VLV A;  2VM2 A;  1GTA A;  3RPP A;  4EKZ A;  4MPG A;  4YAV A;  4HOJ A;  2V2G A;  4V2M A;  3EMX A;  4HDE A;  2IMD A;  4X43 A;  3TGZ A;  4G10 A;  5DQS A;  3O6T A;  5ECN B;  4KB3 A;  5G2Z A;  4ISD A;  1BJX A;  1GP1 A;  1QUW A;  4LMW A;  2H1A A;  3HZ8 A;  1RQM A;  3L9U A;  4HU9 A;  4IP1 A;  4LLR A;  1K0A A;  5KN1 A;  2FCH A;  3IE3 A;  4I6X A;  4XIH A;  5G5E A;  5IMZ A;  1J08 A;  5LNK e;  3KXO A;  1SJI A;  2I1U A;  3A2V A;  3H1N A;  3TJB A;  1MDI A;  2OAC A;  3VI7 A;  3F4T A;  5DQY A;  1LJR A;  4JRR A;  1X9W B;  1TK0 B;  3I9V 2;  2N5F A;  4GSN A;  4XS4 A;  2YOI A;  1GSF A;  5F0G A;  1YF1 A;  14GS A;  1K0M A;  2R2J A;  4TN8 A;  3DXB A;  1J9B A;  1ON4 A;  1U88 A;  3F3Q A;  4MCU A;  2GT6 A;  5D73 A;  4E8H A;  2VLU A;  3IHG A;  3TKS A;  2PGT A;  1O8X A;  3GMF A;  1ZGN A;  2B5X A;  4ML1 A;  2REM A;  1N2A A;  3HVX A;  1MTC A;  1ACV A;  3D5J A;  3SWL A;  2H6Y A;  1BYE A;  4D73 B;  5L71 A;  1UA5 A;  1M99 A;  1MDK A;  3C71 A;  4HS1 A;  4IP6 A;  4KA0 A;  1S3C A;  4O32 A;  4LA1 A;  2JAC A;  4G0I A;  2CAQ A;  3BCK A;  1YEP A;  3I6A A;  4ML6 A;  4OCF A;  3GKX A;  3M3M A;  5B8B A;  3VK9 A;  3GFK A;  3EU4 A;  3PPU A;  3R3E A;  4G9H A;  2DKH A;  1O7U A;  3IOS A;  2CT6 A;  2DML A;  6GSX A;  1R5P A;  5E59 A;  3FRC A;  1GSU A;  2HZE A;  5ECR B;  2MMA A;  1WIK A;  5E4W A;  1GH2 A;  2K6V A;  4JED A;  5F06 A;  4MJA A;  5CNW A;  3TKS C;  3GRX A;  2L5L A;  3ZTL A;  2TIR A;  3L9S A;  5DCH A;  4KAE A;  4TR0 A;  3TCO A;  2RLI A;  4L8E A;  4PUA A;  2MMO A;  3CQF A;  5J4U A;  1YKC A;  3TRQ A;  2AAW A;  3A3T A;  3HJO A;  1WWJ A;  4CHS A;  2YNX A;  3M0F A;  3GKN A;  3HVV A;  1XXU A;  3KEB A;  5IQY A;  2P31 A;  1ZYN A;  3UBL A;  3F6D A;  1M2D A;  2DJ3 A;  2VOC A;  2Z9S A;  1WP0 A;  2QA2 A;  1T4Z A;  1CQH A;  4MH3 A;  1HQO A;  1TRW A;  5ECH B;  5DAK A;  2R4V A;  2IFQ B;  3FR9 A;  4DSS B;  1TTZ A;  1HD2 A;  2HRK A;  3FKF A;  2EC4 A;  3G7J A;  4PTS A;  1GNE A;  4FIW A;  4CY8 A;  3C7M A;  1URM A;  4BIK A;  1MEK A;  4PUR A;  4NHW A;  4GQC A;  5KN2 A;  4IVF A;  1R5A A;  3GH9 A;  4P3Y B;  1PQN A;  3RHC A;  4EL1 A;  3ZVJ A;  1XW6 A;  3I43 A;  2B5Y A;  1XCC A;  2WUL A;  1G6Y A;  2B1L A;  5ECO B;  3H8Q A;  3GL5 A;  2JZT A;  2JSZ A;  1FOH A;  3WGE A;  3KP8 A;  4XTS A;  4EF0 A;  4OWY A;  2F3M A;  3LGC A;  3GKM A;  4TR1 B;  4Z2T A;  3UMA A;  1JFU A;  4EC0 A;  2R0C A;  5HR1 A;  3ZFL A;  2P0G A;  3IR4 A;  3M9J A;  2HXK A;  3HHV A;  5HFI A;  5C00 A;  4CDO A;  1DE2 A;  2ZUP A;  2IFQ A;  5A5K A;  3GKK A;  2QSI A;  2YWM A;  2YV9 A;  1OVN A;  4KF9 A;  4KUN A;  11GS A;  4MH2 A;  4TR4 A;  2LEG A;  2LJA A;  2XBI A;  1H75 A;  3CTG A;  4EE0 A;  4ECI A;  4K2X A;  1F3A A;  3IC8 A;  1GLQ A;  4TXO B;  2IN3 A;  5ABR A;  1M7T A;  2WFC A;  1AQV A;  3Q74 A;  2FLS A;  4Q5N A;  4ILF A;  2WRT A;  1W4V A;  4MJB A;  3P8W A;  3VWV A;  1F9M A;  2TRC P;  3VFI A;  2IWT A;  3KTL A;  4KGI A;  4PUF C;  3H4K A;  1ERV A;  3U6V A;  1MDJ A;  2MYG A;  5ELA A;  2O87 A;  1QK8 A;  3TB2 A;  1NHO A;  4BL7 B;  4KCA A;  2P5Q A;  3G7Y A;  3KCM A;  1KTE A;  4F2I A;  1V9W A;  3FK8 A;  2FWE A;  4QL9 A;  4MDC A;  2RM5 A;  2V6O A;  2A4V A;  5EL8 A;  4NV2 A;  4OFN A;  5J9B A;  3F6F A;  1T4Y A;  4O5Q A;  2H8L A;  4IQ1 A;  2WZ9 A;  2FD3 A; 
#chains in the Genus database with same CATH homology
 2HRA A;  2B7K A;  2L57 A;  6GSY A;  2FUG 2;  2MBT A;  4IJI A;  5AN1 A;  3FHK A;  2JZR A;  6GST A;  2WB9 A;  2VCX A;  3QR6 A;  1PSQ A;  17GS A;  4JU5 A;  1YF0 A;  2OE0 A;  3DYR A;  4MLY A;  6GSU A;  1QGV A;  1T00 A;  4XS1 A;  2WCI A;  4K1F A;  1EWX A;  2X99 A;  5J9C A;  3LSZ A;  2PBJ A;  2H75 A;  1TK8 B;  1GUH A;  2I81 A;  4Z2R A;  1GTU A;  1PA3 A;  2FA4 A;  4EIQ A;  1TK5 B;  5DAL A;  5IMF A;  4NHZ A;  1GUM A;  4ULX A;  5DDL A;  2HI7 A;  3MYD A;  4V2L A;  5D8I A;  1XOB A;  3VPT A;  2D2Z A;  5HFG A;  2VCW A;  1YJ6 A;  4I97 A;  4WBJ A;  2ZCT A;  3ISO A;  1U3A A;  3ZRD A;  3O76 A;  1NM3 A;  1GUL A;  2DLX A;  3GL3 A;  5JWR B;  5JWQ B;  3TJF A;  5DJL A;  2VCQ A;  2A2P A;  2N5A A;  1OC3 A;  4H86 A;  2C4J A;  2BTO T;  2V41 A;  2A4H A;  2BMX A;  2CV4 A;  1XWB A;  1FG4 A;  3US3 A;  4RI7 A;  4WF4 A;  2E7P A;  3ZMK A;  1FVJ A;  1YY7 A;  1XW9 A;  1ZL9 A;  2J9H A;  4O7H A;  5AIS A;  2YAN A;  3GX8 A;  1EEM A;  3ZIT A;  1SYX A;  5FHI A;  3PH9 A;  3UBK A;  1XWA A;  4Q5F A;  1S3A A;  4MA9 A;  2LRC A;  1F37 A;  2LKU A;  2GTU A;  1Z6M A;  5GAN D;  2C0G A;  2HNL A;  1TRV A;  2VAF A;  4NXI A;  4J2F A;  1THO A;  3H79 A;  3CRT A;  5HR0 A;  2HRF A;  2DJ0 A;  4HQS A;  4L0W A;  2VUP A;  1X5D A;  1ZMA A;  5AGY A;  4PNG A;  3CRU A;  2UZ8 A;  3LOR A;  5A4W A;  1GTI A;  1YZX A;  2GGT A;  1MD3 A;  1XVW A;  3ZIV A;  3Q6O A;  5G1K A;  4XRD A;  5D9T A;  3D4T A;  2A2S A;  4XS4 B;  3E0U A;  1KNG A;  1TW9 A;  2LNS A;  2GSS A;  3RDW A;  2VLT A;  3QFB C;  3DKS A;  4DSQ A;  3H93 A;  2L4Q A;  1QQ2 A;  5D9V A;  2H6X A;  3CYN A;  3E9J B;  5IMV A;  4EO3 A;  2WGR A;  3LYK A;  4N0Z A;  1XWG A;  5IPG A;  2YJH A;  1EZK A;  2GT5 A;  4YAP A;  3GSS A;  4KE3 A;  3CSH A;  2X4A A;  2FWH A;  2VM1 A;  1ERW A;  3HVS A;  3CBU A;  4HI7 A;  2NPB A;  1O8W A;  1X9M B;  4ZB8 A;  4POM A;  1EP8 A;  2R37 A;  4IBP A;  4ZIJ A;  4KDX A;  3UVT A;  3IV4 A;  3LWA A;  5IOX A;  1FVK A;  5JCW A;  4WBR D;  1K0N A;  1X0R A;  2IME A;  3LXZ A;  1FO5 A;  2GS3 A;  2YP6 A;  3HCZ A;  1DUG A;  5D93 A;  4KSM A;  1JLV A;  2XBQ A;  4PQH A;  3WD6 A;  2H71 A;  4K0N A;  22GS A;  5JCG A;  3HD5 A;  3MIX A;  2X8C A;  2HZE B;  5DCG A;  4GRF A;  1GSD A;  1VF4 A;  1PRX A;  2AHE A;  1YEX A;  1ILO A;  1Y6E A;  3KMN A;  2V32 A;  2IIY A;  7GSS A;  1YQ1 A;  2YJ7 A;  3KMO A;  4USS A;  1PL2 A;  2OAD A;  1QFN A;  2H01 A;  4FYC A;  3UJ1 A;  2OBI A;  3QAW A;  3EWL A;  3QD9 A;  3EC3 A;  4YQV A;  2VCT A;  2PWJ A;  5FWG A;  2AUV A;  2JZS A;  5G1L A;  5KOX A;  4ZL8 A;  1U6T A;  3MAK A;  2C1Y A;  3FEU A;  4WEY A;  2CQ9 A;  2H74 A;  1O6J A;  4POB A;  4HEA 2;  3GV1 A;  3LW9 A;  5DAK B;  1THX A;  2GQL A;  3FR3 A;  1A0R P;  4MMM A;  1OYJ A;  2LJK A;  3BJ5 A;  2MMN A;  1WJK A;  3A5I A;  4MF6 A;  5HFK A;  4OFM A;  1TKD B;  2KP2 A;  3TJJ A;  2G0F A;  2K18 A;  3WGX A;  2KLX A;  3HJP A;  2H72 A;  3M9K A;  4PGT A;  3E3E A;  1ERT A;  1E2Y A;  5LD0 A;  1O73 A;  2B6M A;  3A2X A;  3IAS 2;  3UL3 A;  2DMM A;  3GST A;  3EPT A;  5CRE A;  4IKH A;  5EVO A;  1USB A;  3LEF A;  1ZYP A;  4ZL9 A;  9GSS A;  20GS A;  3CTF A;  3NIV A;  4IGJ A;  1Y25 A;  2HZF A;  3IA1 A;  3EYT A;  2FWF A;  3VI5 A;  3NZN A;  1OC9 A;  3TKQ A;  1R4W A;  2QA1 A;  4V2N A;  1BED A;  4KDU A;  3TKP A;  2B1K A;  4ZL7 A;  4ECB A;  5CAX A;  3TJG A;  4PQ1 A;  4J56 E;  4Z2U A;  2TRX A;  3LJR A;  3UIW A;  1Q4J A;  1M0U A;  2IMK A;  4ZB9 A;  3IAM 2;  4MNN A;  4MZW A;  2LRT A;  4K6X A;  2L5O A;  5IO0 A;  5KEJ A;  2NBS A;  3RAZ A;  2I4A A;  3ZYW A;  1F2E A;  1A8L A;  2C3N A;  2H0H A;  1XBS A;  4HJ2 A;  3GA4 A;  4BA7 A;  4N0V A;  3WYW A;  4WR5 A;  1SL0 B;  2FA8 A;  3KP9 A;  4YKG A;  1ML6 A;  1PMT A;  2QKE A;  5ECL B;  2K8V A;  2V6K A;  4MF5 A;  4YQM A;  3LG6 A;  1OKT A;  4OD7 A;  2LST A;  3RBT A;  4PQI A;  4BVY A;  1Z3E A;  2M72 A;  4ZBA A;  4MJC A;  2QC7 A;  5IPH A;  3R2Q A;  4WET A;  4OO4 A;  2FWG A;  2RII A;  2CX3 A;  1AQX A;  1B8X A;  1U87 A;  4MK3 A;  4MPF A;  2HE3 A;  4TOP A;  3CSJ A;  1PKZ A;  2R3X A;  2KHP A;  2GZP A;  2XPE A;  1B4Q A;  19GS A;  3DIE A;  1Z5Y E;  3TOU A;  3D21 A;  4KND A;  3IDV A;  4O92 A;  2EIR A;  1WOU A;  4KDY A;  1A24 A;  4JR4 A;  1SYR A;  4GF0 A;  3EE2 A;  1JHB A;  2YZU A;  3QMX A;  5ECS A;  5IMC A;  1GSE A;  1ZZY A;  3VUR A;  1XZO A;  1UC7 A;  2PU9 C;  3VWU A;  1SL1 B;  2H76 A;  2R5G A;  5ID2 B;  1ERU A;  1N8J A;  3GH6 A;  3AY8 A;  3QAG A;  2M80 A;  5CRH A;  3GNJ A;  4EDZ A;  1TU7 A;  4N11 A;  3TJK A;  1T7P B;  4K7N A;  4MJE A;  1BG5 A;  1XFL A;  4BWQ A;  4BVX A;  5J3R A;  1BX9 A;  3Q18 A;  4WXT A;  4L5O A;  1TOF A;  2X49 A;  4GQF A;  3FY7 A;  2M46 A;  1K3L A;  2CVB A;  1DSB A;  5DAL B;  1X5C A;  3LFL A;  1AAZ A;  3D4M A;  4YH2 A;  4CW9 A;  3PGT A;  1EP7 A;  3TKS E;  2JSY A;  1AIU A;  1GLP A;  2H6Z A;  2DSA A;  3ZIJ A;  3F3R A;  1EGR A;  1AQW A;  4K0G A;  4WKW A;  3RHB A;  1EV4 A;  3KJY A;  4G2E A;  2JL4 A;  3QDN A;  1OAZ A;  2C3T A;  3IRA A;  5ID2 A;  2B3S A;  2H0G A;  4TRX A;  1B9X C;  2X64 A;  2F8F A;  2O89 A;  1XVQ A;  1HNA A;  2J23 A;  3G7I A;  2PPT A;  4LMV A;  4F0C A;  4XRA A;  1A2J A;  4J57 E;  1TRU A;  2XHF A;  4TW5 A;  4RQR A;  4K9Z A;  2ALB A;  1SJZ A;  1LU4 A;  3SBC A;  4OFT A;  4BWS A;  4MAB A;  1FOV A;  2WDU A;  2G2Q A;  1M9B A;  2H1B A;  3WGD A;  2LTK A;  3APQ A;  4POL A;  4JE1 A;  5GAP D;  1V58 A;  3KZQ A;  2L6C A;  4I8B A;  4GSS A;  2E2G A;  4GCI A;  1Z9H A;  2K8S A;  2I3Y A;  1NSW A;  3ERW A;  4IN0 A;  3ZRE A;  2HT9 A;  6GSV A;  2DKI A;  2FNO A;  3G9B A;  2PER A;  8GSS A;  2MZC A;  2PN8 A;  4I2T A;  2H30 A;  4AJ6 A;  5B7C A;  2HSH A;  2H19 A;  4FQU A;  2C80 A;  2OE1 A;  5CYY A;  3Q19 A;  5FT3 A;  4G0K A;  3P7X A;  4RI6 A;  2GQK A;  3S9F A;  3J7Y b;  1ZCP A;  3IK9 A;  2BJX A;  3D0Z A;  1B48 A;  2RM6 A;  5CO3 A;  5DJM A;  2YWI A;  4QL7 A;  2C0F A;  1AC1 A;  1FAA A;  2GLR A;  1OC8 A;  1FHE A;  5GZZ B;  3L78 A;  1SK1 A;  3UVH A;  3J7Y k;  6GSS A;  2H73 A;  2ON7 A;  2X8G A;  3U5R E;  2GSR A;  3KIJ A;  2ZNM A;  4ECC A;  3ED3 A;  1A2M A;  2LRN A;  1WPI A;  4O5R A;  3V1W A;  2C0E A;  5ECP B;  3UEM A;  5G5F A;  5IMD A;  4ID0 A;  5EPF A;  1GNW A;  2LQO A;  2CAI A;  4F82 A;  3MWH A;  3DWV A;  1PGT A;  4IJ3 A;  5KN3 A;  4K7I A;  5F05 A;  3EMP A;  2A2R A;  5CRW A;  2ON5 A;  4KCE A;  1SJ6 A;  1VGL A;  4X0X A;  1GSS A;  4HJM A;  2PVO C;  3ZLP A;  1HNB A;  3WT2 A;  1IYH A;  1V40 A;  2DJJ A;  1EGO A;  2LUS A;  1ZYE A;  3L0H A;  1U3I A;  3QPM A;  1SU9 A;  4LL4 B;  2OKA A;  3P90 A;  2CVK A;  4I5Q A;  2MMZ A;  1B9Y C;  4EUY A;  4ZBB A;  3LXT A;  2GZZ A;  1X5E A;  1SK0 A;  1TJD A;  4V1A g;  5C04 A;  2LQQ A;  3A5W A;  3EUR A;  2VL2 C;  3LYP A;  1EOG A;  3APS A;  5JWO B;  3VLN A;  2HLS A;  2LNT A;  3KM6 A;  1GRX A;  5J5N A;  3EIN A;  4G0L A;  1G7E A;  2I9H A;  3TUE A;  2YWO A;  3KTB A;  1XPV A;  5IMA A;  2RUE A;  3HZ4 A;  2AJQ B;  5B6M A;  4FH8 A;  4X4J A;  1K3Y A;  2VIM A;  5D9W A;  3PIN A;  1R7H A;  1RW1 A;  4TKY A;  3WT1 A;  5CRD A;  3FMW A;  1S3D A;  1NHY A;  3FR6 A;  3HDC A;  5CP1 A;  2NVL A;  2E2M A;  4ZBD A;  1XIY A;  2EIO A;  2VCZ A;  1GTB A;  2JAD A;  1RK4 A;  2VL3 A;  2AYT A;  2IPA A;  2N5B A;  4JZQ A;  13GS A;  4TVE A;  1YKA A;  1A0F A;  2XC2 A;  5B8A A;  2F8A A;  3TRX A;  2CX4 A;  4ZB6 A;  4KH7 A;  2NDO A;  3ERF A;  3GYK A;  1MD4 A;  2FHE A;  2OE3 A;  3LQ7 A;  4HZ2 A;  1JZW A;  3QFA C;  4OMV A;  5ECI B;  3BCI A;  3GTU A;  4IW9 A;  5G31 A;  5HR3 A;  4N30 A;  5IO2 A;  4F03 A;  2VD1 A;  4G19 A;  2GQM A;  4TR3 A;  3FZA A;  2YN1 A;  2DJK A;  3C1S A;  5HQP A;  1EEJ A;  3F63 A;  4GLT A;  2IMF A;  3HJM A;  1OC9 B;  5INY A;  1G6W A;  5F07 A;  3IK7 A;  4EDY A;  1GUK A;  1K0C A;  3VWW A;  3O3T A;  1OE7 A;  4RUV A;  5JCU A;  4AF2 A;  3IPZ A;  5B6N A;  1K0O A;  3NOF A;  4HQZ A;  1UN2 A;  1F3B A;  4NAX A;  1C72 A;  2KOK A;  3FYG A;  1TXX A;  5KOW A;  4DEJ A;  1FW1 A;  3IC4 A;  1WMJ A;  1I9D A;  1O85 A;  3MNG A;  3CXG A;  2FY6 A;  5D9X A;  4PXO A;  1QXH A;  3D6I A;  2L4C A;  3ZVJ D;  1CQG A;  3TOT A;  5IOW A;  1AXD A;  2DIZ A;  3QOU A;  3D22 A;  4AJ8 A;  2R6K A;  4HUA A;  3C8E A;  3ZFB A;  2CVD A;  2X8H A;  1Z7P A;  1PN9 A;  4BVY B;  4I2U A;  5GSS A;  5COH A;  1LBK A;  2F51 A;  2CA8 A;  4MZB A;  5EY6 A;  2WJU A;  1Q98 A;  2LV3 A;  5A4U A;  4GST A;  4O5U A;  1SD8 A;  3ZL5 A;  2NTO A;  4HZ4 A;  3FW2 A;  4ICY A;  2P5R A;  3FZ5 A;  1TRS A;  1TP9 A;  3EVI A;  12GS A;  4D73 A;  4MZC A;  5CRG A;  1VRS D;  1SKS B;  3W6G A;  3QAV A;  1SK2 A;  1B4P A;  2DBC A;  3M1G A;  2IL3 A;  5H5S A;  1PKW A;  3OR5 A;  4PNF A;  1JZO A;  5KN0 A;  4WF5 A;  3ME7 A;  3GIX A;  2L59 A;  4E8E A;  2AV4 A;  4KW6 A;  4ACS A;  1TDI A;  2AB6 A;  3GUS A;  4IQA A;  4EIP A;  5ELG A;  1XOA A;  1A8Y A;  3HXS A;  3TDG A;  5LCZ A;  4ZXG A;  1PN0 A;  1VF2 A;  2V1M A;  1HNC A;  3EU3 A;  4BVX B;  1BQ7 A;  2GST A;  3DVW A;  3RPN A;  1AUC A;  3F0I A;  2GDR A;  2VL9 A;  2VCV A;  1JZD A;  1UVZ A;  3PR8 A;  5AIV A;  5ECQ B;  3IXR A;  4HU7 A;  3F8U A;  1I5G A;  3DRN A;  3IHQ A;  3KD0 A;  4GTU A;  5AIX A;  2O7K A;  1AW9 A;  4KSO A;  4L5L A;  5ENU A;  4EXJ A;  1FB6 A;  1W89 A;  4YQU A;  3HA9 A;  3C1R A;  1Z6N A;  4Q5Q A;  4OO5 A;  2IJY A;  4JR6 A;  2RUF A;  2PUK C;  2OA7 A;  2F9S A;  4DSS A;  2GSQ A;  1GSY A;  1SKR B;  1K0B A;  4FYB A;  2YCD A;  2O85 A;  2DJ2 A;  1KEB A;  3APO A;  3DML A;  5H5R A;  3QCP A;  4N10 A;  1ABA A;  1SD9 A;  5F8B A;  3P2A A;  2YV7 A;  1V98 A;  1V2A A;  4XCS A;  1V57 A;  2CZ3 A;  1IYI A;  2B5E A;  4NV5 A;  1A2L A;  5BRT A;  1GWC A;  4TR1 A;  2FGX A;  1OE8 A;  4F9Z A;  3UOM A;  2YZH A;  1KBN A;  2PVQ A;  4NMU A;  1VF3 A;  2CZ2 A;  2C8U A;  2PMT A;  4GXZ A;  4PX1 A;  1DBY A;  4F0B A;  18GS A;  1ZYQ B;  1T3B A;  1TI1 A;  4DSR A;  3DVX A;  2ES7 A;  4AJ7 A;  5IIZ A;  3M8N A;  1HYU A;  2DIY A;  2YPM A;  2JU5 A;  4XS6 A;  3ME8 A;  2C3Q A;  1PX7 A;  4KX4 A;  4MF7 A;  2HFD A;  3N9J A;  4JBB A;  3DD3 A;  2KP1 A;  4V1A p;  2R0P A;  1XWC A;  4K2D A;  3GX0 A;  1GSQ A;  3BOA A;  3HY2 A;  3F4S A;  3DEX A;  4LL1 B;  1WRY A;  4GWR A;  1XWK A;  1F6M C;  3ERG A;  3BBY A;  2KUC A;  1JLW A;  3ZZX A;  3L4N A;  3TRP A;  4TXO A;  3BD2 A;  3HYP A;  2VD0 A;  1OKD A;  4X1U A;  1DE1 A;  1E6B A;  2QGV A;  2E0Q A;  3KH7 A;  1SEN A;  1YDK A;  3MDK A;  10GS A;  1R26 A;  1G0T A;  5DBQ A;  4EVM A;  1G7O A;  1FB0 A;  2C0D A;  4FYU A;  2OJL A;  2L6D A;  3FZ4 A;  4IS0 A;  4BPY A;  2HSM A;  1T8E B;  2HSY A;  2K9F A;  4DVC A;  5H5Q A;  3C73 A;  1NW2 A;  1A23 A;  2IMI A;  1TU8 A;  2GZY A;  1Z7R A;  2LS5 A;  2R0G A;  4BL7 A;  3L9V A;  5BMU A;  2HRN A;  2OBK A;  3UAP A;  4K7O A;  1SL2 B;  4A5P A;  1X9S B;  2VO4 A;  2H70 A;  3I69 A;  1SKW B;  2GVP A;  4K8M A;  3KGK A;  1EOH A;  1ZOF A;  1EV9 A;  3ZML A;  3MSZ A;  2H1D A;  2EIQ A;  2B7J A;  3UAR A;  2YWN A;  1PD2 1;  5ECM B;  4ZIL A;  1ST9 A;  4XHM A;  1J0F A;  4K5R A;  4Z7X A;  3F4R A;  1PL1 A;  4CY6 A;  4AGS A;  4RQX A;  2DJ1 A;  4YKF A;  1PX6 A;  1GL8 A;  3CSI A;  2VL2 A;  4IHU A;  3GN3 A;  1TI3 A;  2WS2 A;  6GSW A;  16GS A;  3KH9 A;  3JCM L;  2O8V B;  1XW5 A;  3VPQ A;  4OCE A;  4ECJ A;  3DGQ A;  1T1V A;  4L0U A;  4QQ7 A;  3GHA A;  3VWX A;  3K8N A;  1H4O A;  2H0I A;  1BAY A;  3F9U A;  1K0D A;  4FO5 A;  2MBS A;  4NPB A;  1JZR A;  4MP4 A;  1QMV A;  3IBH A;  5IM9 A;  5ECK B;  2DC5 A;  1M2B A;  3W8S A;  5D96 A;  3W8J A;  3GTU B;  4K5S A;  3CMI A;  3FZ9 A;  3GUR A;  5A4V A;  1VF1 A;  2HYX A;  4IEL A;  4Q5R A;  1M9A A;  4WR4 A;  3A2W A;  4NWY A;  3N5O A;  4TXV A;  2XPD A;  1M2A A;  2H1G A;  3HKR A;  1K3O A;  5HR2 A;  5GST A;  5J41 A;  2LJR A;  1O81 A;  1WE0 A;  4POK A;  5DVB A;  5G30 A;  2H66 A;  3TKR A;  2VLV A;  2VM2 A;  1GTA A;  3RPP A;  4EKZ A;  4MPG A;  4YAV A;  4HOJ A;  2V2G A;  4V2M A;  3EMX A;  4HDE A;  2IMD A;  4X43 A;  3TGZ A;  4G10 A;  5DQS A;  3O6T A;  5ECN B;  4KB3 A;  5G2Z A;  4ISD A;  1BJX A;  1GP1 A;  1QUW A;  4LMW A;  2H1A A;  3HZ8 A;  1RQM A;  3L9U A;  4HU9 A;  4IP1 A;  4LLR A;  1K0A A;  5KN1 A;  2FCH A;  3IE3 A;  4I6X A;  4XIH A;  5G5E A;  5IMZ A;  1J08 A;  5LNK e;  3KXO A;  1SJI A;  2I1U A;  3A2V A;  3H1N A;  3TJB A;  1MDI A;  2OAC A;  3VI7 A;  3F4T A;  5DQY A;  1LJR A;  4JRR A;  1X9W B;  1TK0 B;  3I9V 2;  2N5F A;  4GSN A;  4XS4 A;  2YOI A;  1GSF A;  5F0G A;  1YF1 A;  14GS A;  1K0M A;  2R2J A;  4TN8 A;  3DXB A;  1J9B A;  1ON4 A;  1U88 A;  3F3Q A;  4MCU A;  2GT6 A;  5D73 A;  4E8H A;  2VLU A;  3IHG A;  3TKS A;  2PGT A;  1O8X A;  3GMF A;  1ZGN A;  2B5X A;  4ML1 A;  2REM A;  1N2A A;  3HVX A;  1MTC A;  1ACV A;  3D5J A;  3SWL A;  2H6Y A;  1BYE A;  4D73 B;  5L71 A;  1UA5 A;  1M99 A;  1MDK A;  3C71 A;  4HS1 A;  4IP6 A;  4KA0 A;  1S3C A;  4O32 A;  4LA1 A;  2JAC A;  4G0I A;  2CAQ A;  3BCK A;  1YEP A;  3I6A A;  4ML6 A;  4OCF A;  3GKX A;  3M3M A;  5B8B A;  3VK9 A;  3GFK A;  3EU4 A;  3PPU A;  3R3E A;  4G9H A;  2DKH A;  1O7U A;  3IOS A;  2CT6 A;  2DML A;  6GSX A;  1R5P A;  5E59 A;  3FRC A;  1GSU A;  2HZE A;  5ECR B;  2MMA A;  1WIK A;  5E4W A;  1GH2 A;  2K6V A;  4JED A;  5F06 A;  4MJA A;  5CNW A;  3TKS C;  3GRX A;  2L5L A;  3ZTL A;  2TIR A;  3L9S A;  5DCH A;  4KAE A;  4TR0 A;  3TCO A;  2RLI A;  4L8E A;  4PUA A;  2MMO A;  5J4U A;  1YKC A;  3TRQ A;  2AAW A;  3A3T A;  3HJO A;  1WWJ A;  4CHS A;  2YNX A;  3M0F A;  3GKN A;  3HVV A;  1XXU A;  3KEB A;  5IQY A;  2P31 A;  1ZYN A;  3UBL A;  3F6D A;  1M2D A;  2DJ3 A;  2VOC A;  2Z9S A;  1WP0 A;  2QA2 A;  1T4Z A;  1CQH A;  4MH3 A;  1HQO A;  1TRW A;  5ECH B;  5DAK A;  2R4V A;  2IFQ B;  3FR9 A;  4DSS B;  1TTZ A;  1HD2 A;  2HRK A;  3FKF A;  2EC4 A;  3G7J A;  4PTS A;  1GNE A;  4FIW A;  4CY8 A;  3C7M A;  1URM A;  1MEK A;  4PUR A;  4NHW A;  4GQC A;  5KN2 A;  4IVF A;  1R5A A;  3GH9 A;  4P3Y B;  1PQN A;  3RHC A;  4EL1 A;  3ZVJ A;  1XW6 A;  3I43 A;  2B5Y A;  1XCC A;  2WUL A;  1G6Y A;  2B1L A;  5ECO B;  3H8Q A;  3GL5 A;  2JZT A;  2JSZ A;  1FOH A;  3WGE A;  3KP8 A;  4XTS A;  4EF0 A;  4OWY A;  2F3M A;  3LGC A;  3GKM A;  4TR1 B;  4Z2T A;  3UMA A;  1JFU A;  4EC0 A;  2R0C A;  5HR1 A;  3ZFL A;  2P0G A;  3IR4 A;  3M9J A;  2HXK A;  3HHV A;  5HFI A;  5C00 A;  4CDO A;  1DE2 A;  2ZUP A;  2IFQ A;  5A5K A;  3GKK A;  2QSI A;  2YWM A;  2YV9 A;  1OVN A;  4KF9 A;  4KUN A;  11GS A;  4MH2 A;  4TR4 A;  2LEG A;  2LJA A;  2XBI A;  1H75 A;  3CTG A;  4EE0 A;  4ECI A;  4K2X A;  1F3A A;  3IC8 A;  1GLQ A;  4TXO B;  2IN3 A;  5ABR A;  1M7T A;  2WFC A;  1AQV A;  3Q74 A;  2FLS A;  4Q5N A;  4ILF A;  2WRT A;  1W4V A;  4MJB A;  3P8W A;  3VWV A;  1F9M A;  2TRC P;  3VFI A;  2IWT A;  3KTL A;  4KGI A;  4PUF C;  3H4K A;  1ERV A;  3U6V A;  1MDJ A;  2MYG A;  5ELA A;  2O87 A;  1QK8 A;  3TB2 A;  1NHO A;  4BL7 B;  4KCA A;  2P5Q A;  3G7Y A;  3KCM A;  1KTE A;  4F2I A;  1V9W A;  3FK8 A;  2FWE A;  4QL9 A;  4MDC A;  2RM5 A;  2V6O A;  2A4V A;  5EL8 A;  4NV2 A;  4OFN A;  5J9B A;  3F6F A;  1T4Y A;  4O5Q A;  2H8L A;  4IQ1 A;  2WZ9 A;  2FD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...