2GT5A

Solution structure of apo human sco1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
173
structure length
173
Chain Sequence
b'SFTGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCO1 protein homolog, mitochondrial
publication title A hint for the function of human Sco1 from different structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 42
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2gt5A00
5G2ZA 2R6KA 1TW9A 1PKZA 3FYGA 3APQA 3QR6A 3HVXA 5AIVA 3GL5A 3TKSA 5B6MA 4POBA 2VCXA 1M7TA 2B7JA 3L4NA 3M8NA 4MZBA 5IM9A 1QQ2A 3ZMKA 1GWCA 2VCTA 4EL1A 3CYNA 1O8XA 2CAIA 3C71A 1F2EA 1UN2A 4V1Ap 5HFIA 4TOPA 3S9FA 3I43A 3IV4A 3F63A 1FOVA 2HFDA 3F4RA 1X5DA 2DMLA 18GSA 3ZFLA 3TKPA 2DMMA 5D9VA 2NBSA 3KTLA 4JE1A 5CYYA 2F8FA 2IL3A 2KP1A 5AN1A 2B7KA 1ZL9A 5ECLB 1X9SB 3HKRA 5LCZA 5IPHA 2YJ7A 5ECNB 4KUNA 1GTIA 3UMAA 1ACVA 2X64A 1BAYA 3UOMA 1Z7PA 2JADA 4MJAA 3TKRA 1OKDA 1M2AA 3TJGA 2VOCA 1FB6A 4ZB8A 4HZ4A 2H72A 1B48A 1R4WA 2FNOA 4KSMA 2LRNA 1X9MB 4IGJA 3NZNA 3EC3A 1EGOA 3D22A 4WXTA 1GSQA 3GYKA 3ZVJD 1AC1A 5FHIA 3GL3A 5C00A 14GSA 3LSZA 4ML1A 5A4WA 5IO0A 2K8VA 3TOTA 2VO4A 5G5EA 3A5WA 4F9ZA 3ZIJA 4EUYA 2KP2A 4WBRD 2C3TA 4TVEA 1C72A 3BCKA 4RI6A 2XPEA 2F9SA 3E0UA 4ILFA 2I3YA 4X43A 1A23A 4IS0A 3GKKA 1EOHA 3LWAA 2WULA 3VWVA 3C1SA 1HNBA 4QQ7A 2JZRA 3RAZA 1CQGA 2WRTA 2CZ2A 1PL1A 3QAGA 2DJ3A 3GSSA 2R37A 1R5AA 3UAPA 5AGYA 1WE0A 2PU9C 5KN3A 4HQZA 3IDVA 3CMIA 1QGVA 2X8CA 3QFAC 4FH8A 2FWFA 1K0DA 3VURA 3H93A 3KEBA 5A5KA 2E2MA 3DVXA 4Q5NA 1ZMAA 2GGTA 2R2JA 5E59A 4PX1A 2L5LA 4MF6A 5G31A 5JCGA 3EU4A 2EC4A 5JCUA 2H30A 1WWJA 3BJ5A 5G5FA 3TCOA 3ZLPA 5ECPB 5J9BA 5FWGA 2RM6A 4KE3A 1EEMA 2QSIA 6GSXA 2F3MA 3ZL5A 5GSTA 1OYJA 6GSVA 3C8EA 2L6CA 4MABA 4D73A 3TKSE 3A2WA 1EWXA 2V41A 2L59A 1TDIA 1BJXA 3M9KA 3I69A 4BL7A 2YOIA 3VWUA 2P31A 4DSQA 3TKQA 4ECBA 4I97A 2O7KA 2DC5A 2WB9A 1OC9A 4KW6A 2YV9A 2G2QA 1SKSB 1PX6A 4LL1B 4P3YB 3FZ4A 3FR6A 2FA4A 5CO3A 2L4QA 3HY2A 1XVWA 4DSSA 2H73A 4ML6A 10GSA 5HFKA 1KBNA 1Z9HA 2IWTA 3ERGA 4TXOB 4EDZA 1AQWA 1K3LA 5D73A 2I1UA 2CAQA 4ULXA 4PURA 3ZMLA 4MJEA 2QC7A 3GV1A 3QD9A 3WD6A 1TRUA 4ECIA 2DIYA 4TR1B 1WRYA 4GTUA 2VLUA 3LXTA 1XZOA 1SENA 1LJRA 1KEBA 3ED3A 2LQQA 3L78A 3D6IA 1GH2A 4O32A 3HHVA 4FYCA 2VM1A 3FK8A 1GTBA 3UIWA 5D93A 1SK2A 3LG6A 3M1GA 4XRAA 3F0IA 2WZ9A 2XC2A 3MAKA 2H6YA 2K6VA 2VD1A 2CA8A 1A2JA 3FHKA 4WR4A 5IO2A 1XVQA 2B5XA 4E8EA 4JEDA 2A2SA 1SYRA 3HVVA 3KJYA 2D2ZA 5DAKA 1SK1A 1M99A 3L9SA 4WBJA 1FW1A 2CX4A 3LEFA 1MTCA 2MBTA 4TRXA 4K7OA 1S3AA 4BVXA 2BTOT 3TDGA 2G0FA 2I9HA 5HR3A 1YEXA 3CSHA 2HE3A 3P2AA 3TJJA 2L57A 3G7YA 1AUCA 2JSYA 5CNWA 3W8JA 3PR8A 4K6XA 4CHSA 4JRRA 4G2EA 1NW2A 4KCEA 1Y6EA 3HZ4A 5JWQB 5F06A 4K7IA 4POLA 1S3CA 3KH7A 4TR3A 1ERUA 4POMA 1GSSA 3D5JA 3HJMA 1VRSD 5ELGA 1A8LA 3N9JA 2AAWA 2C1YA 4K2DA 2XBIA 4K8MA 1SYXA 4ID0A 3HYPA 2ES7A 2PGTA 3LXZA 4OWYA 3VI5A 5LNKe 2GDRA 4KAEA 2J23A 3IAM2 4I8BA 5KEJA 2VLVA 3ERWA 2ON5A 3HJOA 3W8SA 1TI1A 2MZCA 19GSA 4MPFA 1SD8A 3CBUA 2HZFA 3TRPA 3HCZA 1QMVA 3IK9A 5D96A 2GZZA 4CW9A 5J5NA 5F0GA 4OO5A 2IMEA 3IRAA 2C0GA 3HA9A 2LRCA 2H74A 2BJXA 3R2QA 5F05A 1XWBA 2DJKA 2FWGA 5IMAA 3HD5A 2TIRA 4MH2A 2EIOA 3U5RE 1DUGA 4FYBA 2YZHA 3TJBA 2C0DA 5J9CA 5IMFA 1ON4A 4L0UA 2QGVA 3KP9A 5ID2A 2GLRA 1U6TA 1OE8A 1GLPA 4H86A 4PUAA 2VD0A 3I9V2 1T1VA 1PL2A 4E8HA 1BX9A 1XFLA 4JR4A 2A4VA 2OE1A 2V2GA 2M80A 2H66A 3APOA 4V2MA 5ECRB 1GTAA 1EEJA 1VF3A 4LMWA 1ERTA 5J41A 3CTFA 4BA7A 1UC7A 2HI7A 1X5CA 3U6VA 3N5OA 4ZIJA 2H0IA 3CRUA 3H8QA 4ZBDA 3KXOA 1LBKA 4GWRA 4QL7A 3C7MA 4XS1A 5D9XA 4MZWA 2KOKA 2F51A 1YJ6A 4TN8A 4HU7A 4IVFA 4ZL8A 1WPIA 3HVSA 1V98A 2HRNA 2LUSA 4YQMA 4AJ6A 2H01A 2AUVA 4GCIA 3ZYWA 1B4QA 1URMA 2LKUA 1SU9A 1JZRA 1M9AA 4I2UA 4AJ7A 3ZITA 2IMIA 4MK3A 2CQ9A 4EKZA 5G1LA 1OAZA 4ZBAA 3F9UA 4J56E 2R3XA 3GMFA 5ECKB 2OADA 1FVKA 1V2AA 2CZ3A 4WETA 1BQ7A 3I6AA 1TTZA 4IN0A 1VF4A 5HR0A 4IQAA 4KSOA 2IIYA 2GT5A 3KM6A 4BVYA 2NVLA 1ZGNA 3WGDA 5ECMB 2C4JA 3PINA 1T4YA 1GSFA 4IJ3A 2GQLA 13GSA 2H19A 4KDYA 3L9VA 1WIKA 2XPDA 3G9BA 4EDYA 3P90A 3KIJA 4K1FA 1U3IA 5IMVA 2PMTA 3QMXA 1TK8B 2CVKA 1Z6NA 1IYIA 3F3RA 2RUFA 1WMJA 1VGLA 2JU5A 4MJCA 2WGRA 2FA8A 3GSTA 1HNCA 2DJ2A 2H1AA 4PXOA 3SBCA 4IKHA 4AGSA 3Q74A 4BWQA 1X0RA 4NXIA 2H0GA 3L0HA 2PUKC 3A3TA 3DIEA 2H76A 1GNWA 1YZXA 4TXOA 1Z3EA 4N0ZA 2L4CA 1PRXA 1A2LA 3CSIA 4K9ZA 4ACSA 1V9WA 1R5PA 1XXUA 1GL8A 3GNJA 3ZTLA 2TRXA 1MD4A 1THOA 3IBHA 4NPBA 3WT2A 5IOXA 1UA5A 3F8UA 5GAPD 1Z5YE 4DEJA 4WR5A 2VAFA 2B3SA 4TR1A 3DMLA 4XS4A 4KA0A 7GSSA 1K0NA 3QAWA 4IHUA 2YZUA 1J0FA 4TKYA 3H1NA 2LEGA 1A0RP 4V2LA 2GTUA 2YWMA 1ST9A 1BYEA 4DSRA 1G6WA 1F6MC 2GQKA 4KCAA 5D9TA 2E7PA 5IMCA 2TRCP 4ECJA 1F3AA 2DSAA 3GKXA 5B8AA 2GZYA 5INYA 4F03A 1MDKA 2V6KA 1SD9A 2GSSA 1AIUA 3GURA 2IN3A 2CVBA 1KNGA 4WKWA 3BBYA 2GVPA 4JZQA 3GN3A 2OJLA 1GSUA 2PBJA 4L5OA 2MMZA 4YH2A 3IK7A 2VL2C 1X9WB 1O6JA 4YQUA 1YF0A 4XHMA 3FZ9A 4EF0A 1NHOA 3QPMA 1TK0B 1XW6A 5J3RA 5DVBA 3W6GA 3DGQA 4K0GA 1GUHA 5KN2A 3TKSC 2IFQB 1VF1A 3HXSA 4MMMA 2C0FA 2N5BA 3DD3A 3FR9A 1IYHA 1XWAA 3LFLA 4ECCA 22GSA 4XRDA 1K3YA 1TOFA 2JZTA 3F6FA 2AJQB 4HDEA 2H6XA 3IA1A 3WGEA 3TJKA 1NSWA 4GXZA 1ERVA 2IMFA 5FT3A 3JCML 3UJ1A 2B1KA 2HZEA 2V1MA 2I81A 4PQIA 4OFMA 4PNGA 3DVWA 4NV5A 2H1BA 3UARA 1T00A 1YKAA 2DLXA 3KGKA 5DALA 3MWHA 5ECHB 2HLSA 3VFIA 4IELA 1XBSA 2YWNA 1ZYQB 1G7OA 1FVJA 1W89A 2X99A 2VM2A 1S3DA 3K8NA 3FRCA 3E9JB 2LRTA 2WJUA 4QL9A 1JFUA 2KUCA 4NWYA 4RI7A 5H5QA 1XW9A 5HQPA 4LL4B 2V32A 2YWIA 4ZB6A 4FIWA 2N5FA 1GSEA 2X8HA 5H5RA 3UVTA 2YJHA 2WDUA 1ZCPA 4ZL9A 1YY7A 3LGCA 5EL8A 4EC0A 4L5LA 3EMXA 1NHYA 1NM3A 2P5RA 5IMZA 5JCWA 4OMVA 4KDUA 4HI7A 3P8WA 1WOUA 1B9YC 1EZKA 4HS1A 5B7CA 1YF1A 2J9HA 3VI7A 2YPMA 3Q18A 1PKWA 3GA4A 4K0NA 2LNTA 3KP8A 4HJ2A 1B8XA 1HYUA 4Q5RA 1Y25A 3F4TA 1AQVA 1AQXA 5D9WA 1U88A 1G6YA 6GSYA 3APSA 4TR0A 3CSJA 1V57A 4KGIA 4MF5A 1R26A 1FB0A 1USBA 2JACA 2MMOA 1JLWA 4IBPA 1W4VA 4Q5FA 3KCMA 2FHEA 1MD3A 1OC9B 2AYTA 2N5AA 5B8BA 5HFGA 4NHZA 2XBQA 1TU7A 3CXGA 2H1DA 1I9DA 4DSSB 4I2TA 2LJKA 1XWKA 3WGXA 4RQRA 1OKTA 2L5OA 1JZDA 1Q4JA 2AB6A 2P0GA 5G1KA 2YWOA 2HSHA 1SJ6A 3FZAA 3NOFA 2H71A 4MJBA 3DRNA 2AV4A 4EVMA 3IOSA 4ZB9A 2LNSA 1M2BA 4XIHA 2QKEA 1V58A 3ZIVA 2NTOA 2GT6A 2CT6A 5HR2A 4LA1A 2PWJA 1TKDB 3FY7A 1QFNA 3GUSA 3PGTA 2MMAA 2VCZA 3LYKA 2B6MA 4HJMA 2IPAA 4Q5QA 2VCQA 2VUPA 2E0QA 2K9FA 11GSA 2WCIA 3WT1A 1TK5B 1WJKA 1U3AA 1PA3A 4ZL7A 3IC4A 1V40A 1THXA 2GSQA 1QK8A 2PVQA 2H75A 1HD2A 1XCCA 1H4OA 3QAVA 3PH9A 3EWLA 2YANA 1TU8A 2BMXA 3QOUA 4FO5A 5KN1A 2GSTA 2RUEA 3FW2A 1A2MA 1DE1A 5ECOB 2A2RA 5CREA 5DAKB 2PVOC 1YDKA 1PMTA 3GTUB 3D4MA 1RK4A 2HXKA 1MDIA 4XS6A 3FR3A 4KDXA 4G10A 3ZREA 4KX4A 4GSNA 2C0EA 5ELAA 2LV3A 4WF5A 2KHPA 3BOAA 1BG5A 2DJ1A 5AIXA 1K0AA 4K7NA 3VWWA 1TXXA 4L0WA 4KH7A 4F82A 3Q6OA 2REMA 2DJ0A 3VPQA 2H1GA 1ZYEA 1DSBA 4NMUA 2K8SA 3LORA 3HDCA 3LJRA 1XPVA 1QXHA 4J2FA 4N30A 3QFBC 1PD21 2YN1A 4OD7A 1GRXA 4ZXGA 1ABAA 3Q19A 5DDLA 2YNXA 1HQOA 4GSSA 3TB2A 1O85A 3WYWA 5A4VA 1TP9A 2OBKA 4RQXA 2IMKA 4G9HA 2OE3A 4MLYA 2OE0A 3VWXA 2HT9A 1XIYA 3F3QA 5F07A 2CV4A 4LLRA 3OR5A 1N2AA 3KMOA 3ISOA 1M0UA 3IAS2 3G7JA 2ON7A 5ABRA 1N8JA 5KN0A 3LYPA 1CQHA 1GLQA 1K0CA 1ML6A 3QDNA 4IQ1A 1EGRA 2IFQA 3GFKA 4J57E 2M72A 4MZCA 1TJDA 5DCGA 5AISA 2LJRA 2IMDA 1OE7A 2V6OA 1QUWA 1R7HA 4BWSA 3G7IA 4IP1A 3QCPA 3UBLA 2R4VA 1JZWA 3D21A 1F37A 1PQNA 3ZVJA 3RPPA 2EIRA 4N0VA 2AHEA 20GSA 5EPFA 5CAXA 3DWVA 1GSDA 5H5SA 3L9UA 1Z7RA 2B5YA 1GP1A 2WFCA 3MDKA 1G7EA 5ID2B 3O3TA 4MF7A 3ZZXA 3AY8A 1MEKA 1U87A 6GSTA 2LJAA 4TW5A 4XTSA 1Q98A 3ZRDA 4WF4A 3UEMA 1EP8A 2I4AA 1B9XC 1ZOFA 3KH9A 2HNLA 1ILOA 1ERWA 2ALBA 2VL3A 2ZNMA 3GX8A 2C8UA 2GS3A 5DQSA 2RM5A 4IW9A 2HRFA 1DE2A 4GRFA 2VLTA 2HSYA 3FEUA 4O7HA 1VF2A 3FZ5A 1PX7A 3LQ7A 3IXRA 2CVDA 3J7Yk 5DJLA 3E3EA 2H70A 2RIIA 1E6BA 4JBBA 1TRVA 1FHEA 3BCIA 1GULA 4OFNA 4GQFA 16GSA 2VIMA 3KTBA 5ECSA 4L8EA 4GSTA 3NIVA 2MYGA 1K0MA 3O76A 3MSZA 5DQYA 4TXVA 4EO3A 2PERA 1SKWB 4V2NA 5ENUA 3UBKA 4I5QA 4KB3A 4ZILA 2LTKA 5CRGA 3GKNA 4RUVA 3TRXA 1AAZA 5ECQB 1XW5A 4F0BA 1FO5A 2PN8A 2VCWA 4FYUA 1DBYA 1BEDA 3RHBA 2H6ZA 5COHA 3V1WA 2KLXA 2WS2A 3F4SA 4POKA 4DVCA 1WP0A 4O5RA 3CTGA 1SJIA 5E4WA 4KNDA 4OO4A 1J9BA 5GSSA 4MCUA 4HOJA 4GLTA 2DBCA 4ISDA 3GH6A 3TGZA 2B1LA 2P5QA 3SWLA 2FCHA 2FD3A 3VLNA 6GSWA 1A0FA 4BPYA 1K3OA 2VL9A 3ME8A 2CX3A 1AXDA 9GSSA 2O85A 1KTEA 2FUG2 4JR6A 1UVZA 1FG4A 4IJIA 3EE2A 2MBSA 1SL0B 2ZUPA 1SK0A 1K0BA 4JU5A 1XOBA 2FY6A 3DEXA 8GSSA 1EV9A 1AW9A 5DCHA 1JZOA 2YCDA 1T7PB 1SJZA 4OFTA 4YAPA 3VK9A 3EINA 2H0HA 2LS5A 2DJJA 4IP6A 3GH9A 2YV7A 4N11A 1EOGA 3DYRA 3O6TA 3EMPA 4XS4B 3IE3A 1O8WA 2O89A 3HJPA 4OCFA 5IQYA 2H8LA 3ERFA 1YQ1A 2GSRA 1M2DA 4G19A 1HNAA 2HYXA 5DJMA 3M3MA 1LU4A 3MNGA 1PGTA 4MPGA 3VPTA 4V1Ag 5IMDA 5JWOB 5A4UA 2YP6A 3US3A 5IIZA 1T4ZA 1SKRB 1F3BA 2XHFA 17GSA 3C73A 4MH3A 1EV4A 2Z9SA 1SL1B 1RQMA 2IJYA 3C1RA 1EP7A 2O87A 4TR4A 2JSZA 5ECIB 6GSSA 5HR1A 3FKFA 1K0OA 4HUAA 2X8GA 1PSQA 1GUKA 4AJ8A 3GTUA 4MP4A 2GQMA 1G0TA 1PN9A 3KMNA 4D73B 3RBTA 1O73A 2FGXA 5EY6A 5DBQA 2VCVA 12GSA 3BD2A 2EIQA 3EYTA 1O81A 3A2VA 2C80A 4O92A 3D4TA 2FLSA 1F9MA 3ME7A 2E2GA 1A8YA 5CRWA 2NPBA 2OBIA 4AF2A 2F8AA 2DIZA 3IPZA 2K18A 4NAXA 1OVNA 4OCEA 2HZEB 3EVIA 2C3NA 3TOUA 5CRDA 4HU9A 1TI3A 2PPTA 1I5GA 5F8BA 3EU3A 4GQCA 1A24A 3M0FA 2OA7A 2C3QA 5DALB 1GNEA 4HZ2A 4NHWA 4XCSA 1MDJA 5G30A 2L6DA 3KZQA 1Z6MA 3KD0A 2FWHA 3RHCA 1M9BA 4EE0A 2FWEA 1YEPA 5B6NA 3F6DA 5LD0A 3GHAA 4WEYA 1X5EA 3IR4A 4N10A 3EURA 2MMNA 1FAAA 5JWRB 4CDOA 3UVHA 2JL4A 2RLIA 6GSUA 1JHBA 3H79A 4Z7XA 4NV2A 1GTUA 1OC3A 1YKCA 4PUFC 2LSTA 4PQHA 3GKMA 3HZ8A 3GIXA 3IHQA 2M46A 1J08A 2OKAA 1E2YA 4HQSA 1XWCA 3GRXA 1T3BA 3TUEA 1OC8A 1O7UA 2B5EA 2NDOA 5C04A 2ZCTA 1ZZYA 2GZPA 1GSYA 1RW1A 4EXJA 5CRHA 2R5GA 3ZFBA 4PQ1A 3H4KA 4YQVA 1JLVA 5L71A 3RDWA 5GZZB 3DXBA 3M9JA 4X1UA 4PGTA 4ZBBA 4MDCA 3CRTA 4LMVA 2LQOA 4X0XA 4F2IA 4MA9A 5D8IA 4YAVA 5IOWA 4I6XA 3A2XA 1SL2B 3D0ZA 3RPNA 4F0CA 1TRWA 3GX0A 5CP1A 3P7XA 1H75A 1B4PA 4PNFA 3TJFA 5IPGA 2OACA 3TRQA 1XOAA 1T8EB 2JZSA 5GAND 1XWGA 3UL3A 4HEA2 4GF0A 3J7Yb 3DKSA 2O8VB 2VL2A 1GUMA 5J4UA 5EVOA 1TRSA
chains in the Genus database with same CATH superfamily
5G2ZA 2R6KA 1TW9A 1PKZA 3FYGA 3APQA 3QR6A 3HVXA 5AIVA 3GL5A 3TKSA 5B6MA 4POBA 2VCXA 1M7TA 2B7JA 3L4NA 3M8NA 4MZBA 5IM9A 1QQ2A 3ZMKA 1GWCA 2VCTA 4EL1A 3CYNA 1O8XA 2CAIA 3C71A 1F2EA 1UN2A 4V1Ap 5HFIA 4TOPA 3S9FA 3I43A 3IV4A 3F63A 1FOVA 2HFDA 2QA1A 3F4RA 1X5DA 2DMLA 18GSA 3ZFLA 3TKPA 2DMMA 5D9VA 2NBSA 3KTLA 4JE1A 1FOHA 5CYYA 2F8FA 2IL3A 2KP1A 5AN1A 2B7KA 1ZL9A 5ECLB 1X9SB 3HKRA 5LCZA 1ZYPA 5IPHA 2YJ7A 5ECNB 4KUNA 1GTIA 4K2XA 3UMAA 1ACVA 2X64A 1BAYA 3UOMA 1Z7PA 2JADA 4MJAA 3TKRA 5BMUA 1OKDA 1M2AA 3TJGA 2VOCA 1FB6A 4ZB8A 2X4AA 4HZ4A 2H72A 1B48A 1R4WA 2FNOA 4KSMA 2LRNA 1X9MB 4IGJA 3NZNA 3EC3A 1EGOA 3D22A 4WXTA 1GSQA 3GYKA 3ZVJD 1AC1A 5FHIA 3GL3A 5C00A 14GSA 3LSZA 4ML1A 5A4WA 5IO0A 2K8VA 3TOTA 2VO4A 5G5EA 3A5WA 4F9ZA 3ZIJA 4EUYA 2KP2A 4WBRD 2C3TA 4TVEA 1C72A 3BCKA 4RI6A 2XPEA 2F9SA 3E0UA 4ILFA 2I3YA 4X43A 1A23A 4IS0A 3GKKA 1EOHA 3LWAA 2WULA 3VWVA 3C1SA 1HNBA 4QQ7A 2JZRA 3RAZA 1CQGA 4CY8A 2WRTA 2CZ2A 1PL1A 3QAGA 2DJ3A 3GSSA 2R37A 1R5AA 3UAPA 5AGYA 1WE0A 2PU9C 5KN3A 4HQZA 3IDVA 3CMIA 1QGVA 2X8CA 3QFAC 2DKIA 4FH8A 2FWFA 1K0DA 3VURA 3H93A 3KEBA 5A5KA 2E2MA 3DVXA 4Q5NA 1ZMAA 2GGTA 2R2JA 5E59A 4PX1A 2L5LA 4MF6A 5G31A 5JCGA 3EU4A 2EC4A 5JCUA 2H30A 4K5RA 1WWJA 3BJ5A 5G5FA 3TCOA 3ZLPA 5ECPB 5J9BA 5FWGA 2RM6A 4KE3A 1EEMA 2QSIA 6GSXA 2F3MA 3ZL5A 4BVYB 5GSTA 1OYJA 6GSVA 3C8EA 2L6CA 4MABA 4D73A 3TKSE 3A2WA 1EWXA 2V41A 2L59A 1TDIA 1BJXA 3M9KA 3I69A 4BL7A 2YOIA 3VWUA 2P31A 4DSQA 3TKQA 4ECBA 4I97A 2O7KA 3PPUA 2DC5A 2WB9A 1OC9A 4KW6A 2YV9A 2G2QA 1SKSB 1PX6A 4LL1B 4P3YB 3FZ4A 3FR6A 2FA4A 5CO3A 2L4QA 3HY2A 1XVWA 4DSSA 4PTSA 2H73A 4ML6A 10GSA 5HFKA 1KBNA 1Z9HA 2IWTA 3ERGA 4TXOB 4EDZA 1AQWA 1K3LA 5D73A 2DKHA 2I1UA 2CAQA 4ULXA 4PURA 3ZMLA 4MJEA 2QC7A 3GV1A 3QD9A 3WD6A 1TRUA 4ECIA 2DIYA 4TR1B 1WRYA 4GTUA 2VLUA 3LXTA 1XZOA 1SENA 1LJRA 1KEBA 3ED3A 2LQQA 3L78A 3D6IA 1GH2A 4O32A 3HHVA 4FYCA 2VM1A 3FK8A 4KF9A 1GTBA 3UIWA 5D93A 1SK2A 3LG6A 3M1GA 4XRAA 3F0IA 2WZ9A 3LW9A 2XC2A 3MAKA 2H6YA 2K6VA 2VD1A 2CA8A 1A2JA 3FHKA 4WR4A 5IO2A 1XVQA 2B5XA 4E8EA 4JEDA 2A2SA 1SYRA 3HVVA 3KJYA 4Z2RA 2D2ZA 5DAKA 1SK1A 1M99A 3L9SA 4WBJA 1FW1A 2CX4A 3LEFA 1MTCA 2MBTA 4EIQA 4TRXA 4K7OA 1S3AA 4BVXA 2BTOT 3TDGA 2G0FA 2I9HA 5HR3A 1YEXA 3CSHA 2HE3A 3P2AA 1PN0A 3TJJA 2L57A 3G7YA 1AUCA 2JSYA 5CNWA 3W8JA 3PR8A 4K6XA 4CHSA 4JRRA 4G2EA 1NW2A 4KCEA 1Y6EA 3HZ4A 5JWQB 5F06A 4K7IA 4POLA 1S3CA 3KH7A 4TR3A 3HVNA 1ERUA 4POMA 1GSSA 3D5JA 3HJMA 1VRSD 5ELGA 1A8LA 3N9JA 2AAWA 2C1YA 4K2DA 2XBIA 4K8MA 1SYXA 4ID0A 3HYPA 2ES7A 2PGTA 3LXZA 4OWYA 3VI5A 5LNKe 2GDRA 4KAEA 2J23A 3IAM2 4I8BA 5KEJA 2VLVA 3ERWA 2ON5A 3HJOA 3W8SA 3FMWA 1TI1A 2MZCA 19GSA 4MPFA 1SD8A 3CBUA 2HZFA 3TRPA 3HCZA 1QMVA 3IK9A 5D96A 2GZZA 4CW9A 5J5NA 5F0GA 4OO5A 2IMEA 3IRAA 2C0GA 3HA9A 2LRCA 2H74A 2BJXA 3R2QA 5F05A 1XWBA 2DJKA 2FWGA 5IMAA 3HD5A 2TIRA 4MH2A 2EIOA 3U5RE 1DUGA 4FYBA 2YZHA 3TJBA 2C0DA 5J9CA 5IMFA 1ON4A 4L0UA 2QGVA 3KP9A 5ID2A 2GLRA 1U6TA 1OE8A 1GLPA 4H86A 4PUAA 2VD0A 3I9V2 4MNNA 1T1VA 1PL2A 4E8HA 1BX9A 1XFLA 4JR4A 2A4VA 2OE1A 2V2GA 2M80A 2H66A 3APOA 4V2MA 5ECRB 1GTAA 1EEJA 1VF3A 4LMWA 1ERTA 5J41A 3CTFA 4BA7A 1UC7A 2HI7A 1X5CA 3U6VA 3N5OA 4ZIJA 2H0IA 3CRUA 3H8QA 4ZBDA 3KXOA 1LBKA 4GWRA 4QL7A 3C7MA 4XS1A 5D9XA 4MZWA 2KOKA 2F51A 1YJ6A 4TN8A 4HU7A 4IVFA 4ZL8A 1WPIA 3HVSA 1V98A 2HRNA 2LUSA 4YQMA 4AJ6A 2H01A 2AUVA 4GCIA 3ZYWA 1B4QA 1URMA 2LKUA 1SU9A 1JZRA 1M9AA 4I2UA 4AJ7A 3ZITA 2IMIA 4MK3A 2HRKA 2CQ9A 4EKZA 5G1LA 1OAZA 4ZBAA 3F9UA 4J56E 2R3XA 3GMFA 5ECKB 2OADA 1FVKA 1V2AA 2CZ3A 4WETA 1BQ7A 3I6AA 1TTZA 4IN0A 1VF4A 5HR0A 4IQAA 4KSOA 2IIYA 2GT5A 3KM6A 4BVYA 2NVLA 5KOXA 1ZGNA 3WGDA 5ECMB 2C4JA 3PINA 1T4YA 1GSFA 4IJ3A 2GQLA 13GSA 2H19A 4KDYA 3L9VA 1WIKA 2XPDA 3G9BA 4EDYA 3P90A 3KIJA 4K1FA 1U3IA 5IMVA 2PMTA 3QMXA 1TK8B 2CVKA 1Z6NA 1IYIA 3F3RA 2RUFA 1WMJA 1VGLA 2JU5A 4MJCA 2WGRA 2FA8A 3GSTA 1HNCA 2DJ2A 2H1AA 4PXOA 3SBCA 4IKHA 4AGSA 3Q74A 4BWQA 1X0RA 4NXIA 2H0GA 3L0HA 2PUKC 3A3TA 3DIEA 2H76A 1GNWA 1YZXA 4TXOA 1Z3EA 4N0ZA 4EIPA 2L4CA 1PRXA 1A2LA 3CSIA 4K9ZA 4ACSA 1V9WA 1R5PA 1XXUA 1GL8A 3GNJA 3ZTLA 2TRXA 1MD4A 1THOA 3IBHA 4NPBA 3WT2A 5IOXA 1UA5A 3F8UA 5GAPD 1Z5YE 4DEJA 4WR5A 2VAFA 2B3SA 4TR1A 3DMLA 4XS4A 4KA0A 7GSSA 1K0NA 3QAWA 4IHUA 2YZUA 1J0FA 4TKYA 3H1NA 2LEGA 1A0RP 4V2LA 2GTUA 2YWMA 1ST9A 2HSMA 4CY6A 1BYEA 4DSRA 1G6WA 1F6MC 2A2PA 2GQKA 4KCAA 5D9TA 2E7PA 5IMCA 2TRCP 4ECJA 1F3AA 2DSAA 3GKXA 5B8AA 2GZYA 5INYA 4F03A 1MDKA 2V6KA 1SD9A 2GSSA 1AIUA 3GURA 2IN3A 2CVBA 1KNGA 4WKWA 3BBYA 2GVPA 4JZQA 3GN3A 2OJLA 1GSUA 2PBJA 4L5OA 2MMZA 4YH2A 3IK7A 2VL2C 1X9WB 1O6JA 4YQUA 1YF0A 4XHMA 3FZ9A 4EF0A 1NHOA 3QPMA 1TK0B 1XW6A 5J3RA 5DVBA 3W6GA 3DGQA 4K0GA 1GUHA 3MYDA 4G0IA 5KN2A 3TKSC 2IFQB 1VF1A 3HXSA 4MMMA 2C0FA 2N5BA 3DD3A 3FR9A 1IYHA 1XWAA 3LFLA 4ECCA 22GSA 4XRDA 1K3YA 1TOFA 2JZTA 3F6FA 2AJQB 4HDEA 2H6XA 3IA1A 3WGEA 3TJKA 1PFOA 1NSWA 4GXZA 1ERVA 2IMFA 5FT3A 3JCML 3UJ1A 2B1KA 2HZEA 2V1MA 2I81A 4PQIA 4OFMA 4PNGA 3DVWA 4NV5A 2H1BA 3UARA 1XG8A 1T00A 1YKAA 2DLXA 3KGKA 5DALA 3MWHA 5ECHB 2HLSA 3VFIA 4IELA 1XBSA 2YWNA 1ZYQB 1G7OA 1FVJA 1W89A 3R3EA 2X99A 2VM2A 1S3DA 3K8NA 3FRCA 3E9JB 2LRTA 2WJUA 4QL9A 1JFUA 2KUCA 4NWYA 4RI7A 5H5QA 1XW9A 5HQPA 4Z2UA 4LL4B 2V32A 2YWIA 4ZB6A 4FIWA 2N5FA 1GSEA 2X8HA 5H5RA 3UVTA 2YJHA 2WDUA 1ZCPA 4ZL9A 1YY7A 3LGCA 5EL8A 4EC0A 4L5LA 3EMXA 1NHYA 1NM3A 2P5RA 5IMZA 5JCWA 4OMVA 4KDUA 4HI7A 3P8WA 1WOUA 1B9YC 1EZKA 4HS1A 5B7CA 2A4HA 1YF1A 2J9HA 3VI7A 2YPMA 3Q18A 1PKWA 3GA4A 4K0NA 2LNTA 3KP8A 4HJ2A 1B8XA 1HYUA 4Q5RA 1Y25A 3F4TA 1AQVA 1AQXA 5D9WA 1U88A 1G6YA 6GSYA 3APSA 4TR0A 3CSJA 1V57A 4KGIA 1S3RA 4MF5A 1R26A 1FB0A 1USBA 2JACA 2MMOA 2R0PA 1JLWA 4IBPA 1W4VA 4Q5FA 3KCMA 2FHEA 1MD3A 1OC9B 2AYTA 2N5AA 5B8BA 5HFGA 4NHZA 2XBQA 1TU7A 3CXGA 2H1DA 1I9DA 4DSSB 4I2TA 2LJKA 1XWKA 3WGXA 4RQRA 1OKTA 2L5OA 1JZDA 1Q4JA 2HRAA 2AB6A 2P0GA 5G1KA 2YWOA 2HSHA 1SJ6A 3FZAA 3NOFA 2H71A 4MJBA 3DRNA 2AV4A 4EVMA 3IOSA 4ZB9A 2LNSA 1M2BA 4XIHA 2QKEA 1V58A 3ZIVA 2NTOA 2GT6A 2CT6A 5HR2A 4LA1A 2PWJA 1TKDB 3FY7A 1QFNA 3GUSA 3PGTA 2MMAA 2VCZA 3LYKA 2B6MA 4HJMA 2IPAA 4Q5QA 2VCQA 2VUPA 2E0QA 2K9FA 11GSA 2WCIA 3WT1A 1TK5B 1WJKA 1U3AA 1PA3A 2R0CA 4ZL7A 3IC4A 1V40A 1THXA 2GSQA 1QK8A 2PVQA 2H75A 1HD2A 1XCCA 4USSA 1H4OA 3QAVA 3PH9A 3MIXA 3EWLA 2YANA 1TU8A 2BMXA 3QOUA 4FO5A 5KN1A 2GSTA 2RUEA 3FW2A 1A2MA 1DE1A 5ECOB 2A2RA 4BIKA 5CREA 5DAKB 2PVOC 1YDKA 1PMTA 3GTUB 3D4MA 1RK4A 2HXKA 1MDIA 4XS6A 3FR3A 4KDXA 4ICYA 4G10A 3ZREA 4KX4A 4BVXB 4GSNA 2C0EA 5ELAA 2LV3A 4WF5A 2KHPA 3BOAA 1BG5A 2DJ1A 5AIXA 1K0AA 4K5SA 4K7NA 3VWWA 1TXXA 4L0WA 4KH7A 4F82A 3Q6OA 2REMA 2DJ0A 3VPQA 2H1GA 1ZYEA 1DSBA 4NMUA 3IC8A 2K8SA 3LORA 3HDCA 3LJRA 1XPVA 1QXHA 4J2FA 4N30A 3QFBC 1PD21 2YN1A 4OD7A 1GRXA 4ZXGA 1ABAA 3Q19A 5DDLA 2YNXA 1HQOA 4GSSA 3TB2A 1O85A 3WYWA 5A4VA 1TP9A 2OBKA 4RQXA 2IMKA 4G9HA 2OE3A 4MLYA 2OE0A 3VWXA 2HT9A 1XIYA 3F3QA 5F07A 2CV4A 4LLRA 4G0LA 3OR5A 1N2AA 3KMOA 3ISOA 1M0UA 3IAS2 3G7JA 2ON7A 5ABRA 1N8JA 5KN0A 3LYPA 1CQHA 1GLQA 1K0CA 1ML6A 3QDNA 4IQ1A 1EGRA 2IFQA 3GFKA 4J57E 2M72A 2R0GA 4MZCA 1TJDA 5DCGA 5AISA 2LJRA 2IMDA 1OE7A 2V6OA 1QUWA 1R7HA 4BWSA 3G7IA 4IP1A 3QCPA 3UBLA 2R4VA 1JZWA 3D21A 1F37A 1PQNA 3ZVJA 3RPPA 2EIRA 4N0VA 2AHEA 20GSA 5EPFA 5CAXA 3DWVA 1GSDA 5H5SA 3L9UA 1Z7RA 2B5YA 1GP1A 2WFCA 3MDKA 1G7EA 5ID2B 3O3TA 4MF7A 3ZZXA 3AY8A 1MEKA 1U87A 6GSTA 5KOWA 2LJAA 4TW5A 4XTSA 1Q98A 3ZRDA 4WF4A 3UEMA 1EP8A 2I4AA 1B9XC 1ZOFA 3KH9A 2HNLA 5BRTA 1ILOA 1ERWA 2ALBA 2VL3A 2ZNMA 3GX8A 2C8UA 3EPTA 2GS3A 5DQSA 2RM5A 4IW9A 2HRFA 1DE2A 4GRFA 2VLTA 2HSYA 3FEUA 4O7HA 1VF2A 3FZ5A 1PX7A 3LQ7A 3IXRA 2CVDA 3J7Yk 5DJLA 3E3EA 2H70A 2RIIA 2QA2A 3A5IA 1E6BA 4JBBA 1TRVA 1FHEA 3BCIA 1GULA 4OFNA 4GQFA 16GSA 4HSCX 2VIMA 3KTBA 5ECSA 4L8EA 4GSTA 3NIVA 2MYGA 1K0MA 3O76A 3MSZA 5DQYA 4TXVA 4EO3A 2PERA 1SKWB 4V2NA 5ENUA 3UBKA 2X49A 4I5QA 4KB3A 4ZILA 2LTKA 5CRGA 3GKNA 4RUVA 3TRXA 1AAZA 5ECQB 1XW5A 4F0BA 1FO5A 2PN8A 2VCWA 4FYUA 1DBYA 1BEDA 3RHBA 2H6ZA 5COHA 3V1WA 2KLXA 1ZYNA 2WS2A 3F4SA 4POKA 4DVCA 1WP0A 4O5RA 4O5UA 3CTGA 1SJIA 5E4WA 4KNDA 4OO4A 1J9BA 5GSSA 4MCUA 4HOJA 4GLTA 2DBCA 4ISDA 3GH6A 3TGZA 2B1LA 2P5QA 4X4JA 3SWLA 2FCHA 2FD3A 3VLNA 6GSWA 1A0FA 4BPYA 1K3OA 2VL9A 3ME8A 2CX3A 1AXDA 9GSSA 2O85A 1KTEA 2FUG2 4JR6A 1UVZA 1FG4A 4IJIA 3EE2A 4A5PA 2MBSA 1SL0B 2ZUPA 1SK0A 1K0BA 4JU5A 1XOBA 2FY6A 3DEXA 8GSSA 1EV9A 1AW9A 5DCHA 1JZOA 2YCDA 1T7PB 1SJZA 4OFTA 4YAPA 3VK9A 3EINA 2H0HA 2LS5A 2DJJA 4IP6A 3GH9A 2YV7A 4N11A 1EOGA 3DYRA 3O6TA 3EMPA 4XS4B 3IE3A 1O8WA 4O5QA 2O89A 3HJPA 4OCFA 5IQYA 2H8LA 3ERFA 1YQ1A 2GSRA 1M2DA 4G19A 1HNAA 2HYXA 5DJMA 3M3MA 1LU4A 3MNGA 1PGTA 4MPGA 3VPTA 4V1Ag 5IMDA 5JWOB 5A4UA 2YP6A 3US3A 5IIZA 1T4ZA 1SKRB 1F3BA 2XHFA 17GSA 3C73A 4MH3A 1EV4A 2Z9SA 1SL1B 1RQMA 2IJYA 3C1RA 4FQUA 4YKFA 1EP7A 2O87A 4TR4A 2JSZA 5ECIB 6GSSA 5HR1A 3FKFA 1K0OA 4HUAA 2X8GA 1PSQA 1M3JA 1GUKA 4AJ8A 3GTUA 4MP4A 2GQMA 1G0TA 1PN9A 3KMNA 4D73B 3RBTA 1O73A 2FGXA 5EY6A 5DBQA 2VCVA 12GSA 3BD2A 2EIQA 3EYTA 1O81A 3A2VA 2C80A 4O92A 4BL7B 3D4TA 2FLSA 1F9MA 3ME7A 2E2GA 1A8YA 5CRWA 2NPBA 2OBIA 4AF2A 2F8AA 2DIZA 3IPZA 2K18A 4NAXA 1OVNA 4OCEA 2HZEB 3EVIA 2C3NA 3TOUA 5CRDA 4HU9A 1TI3A 2PPTA 1I5GA 5F8BA 3EU3A 4GQCA 1A24A 3M0FA 3CQFA 2OA7A 2C3QA 5DALB 4Z2TA 1GNEA 4HZ2A 4NHWA 4XCSA 1MDJA 5G30A 2L6DA 3KZQA 1Z6MA 3KD0A 2FWHA 3RHCA 1M9BA 4EE0A 2FWEA 1YEPA 5B6NA 3F6DA 5LD0A 4WEYA 3GHAA 4G0KA 1X5EA 3IR4A 4N10A 3EURA 2MMNA 1FAAA 5JWRB 4CDOA 3UVHA 2JL4A 2RLIA 6GSUA 1JHBA 3H79A 4Z7XA 4NV2A 1GTUA 1OC3A 1YKCA 4PUFC 2LSTA 4PQHA 3GKMA 3HZ8A 3GIXA 3IHQA 2M46A 1J08A 2OKAA 1E2YA 4HQSA 1XWCA 3GRXA 1T3BA 2UZ8A 3TUEA 1OC8A 1O7UA 2B5EA 2NDOA 5C04A 2ZCTA 1ZZYA 2GZPA 1GSYA 1RW1A 4EXJA 5CRHA 2R5GA 3ZFBA 4PQ1A 3H4KA 4YQVA 1JLVA 5L71A 3RDWA 5GZZB 3DXBA 3M9JA 4X1UA 4PGTA 4ZBBA 4MDCA 3CRTA 4LMVA 2LQOA 4X0XA 4F2IA 4MA9A 5D8IA 4YAVA 5IOWA 4I6XA 3A2XA 1SL2B 3D0ZA 3RPNA 1M3IA 4F0CA 1TRWA 3GX0A 5CP1A 3P7XA 1H75A 1B4PA 4PNFA 3TJFA 5IPGA 2OACA 3TRQA 1XOAA 1T8EB 2JZSA 5GAND 1XWGA 4YKGA 3UL3A 4HEA2 3IHGA 4GF0A 3J7Yb 3DKSA 2O8VB 2VL2A 1GUMA 5J4UA 5EVOA 1TRSA
chains in the Genus database with same CATH topology
5G2ZA 2R6KA 1TW9A 1PKZA 3FYGA 3APQA 3QR6A 3HVXA 5AIVA 3GL5A 3TKSA 5B6MA 4POBA 2VCXA 1M7TA 2B7JA 3L4NA 3M8NA 4MZBA 5IM9A 1QQ2A 3ZMKA 1GWCA 2VCTA 4EL1A 3CYNA 1O8XA 2CAIA 3C71A 1F2EA 1UN2A 4V1Ap 5HFIA 4TOPA 3S9FA 3I43A 3IV4A 3F63A 1FOVA 2HFDA 2QA1A 3F4RA 1X5DA 2DMLA 18GSA 3ZFLA 3TKPA 2DMMA 5D9VA 2NBSA 3KTLA 4JE1A 1FOHA 5CYYA 2F8FA 2IL3A 2KP1A 5AN1A 2B7KA 1ZL9A 5ECLB 1X9SB 3HKRA 5LCZA 1ZYPA 5IPHA 2YJ7A 5ECNB 4KUNA 1GTIA 4K2XA 3UMAA 1ACVA 2X64A 1BAYA 3UOMA 1Z7PA 2JADA 4MJAA 3TKRA 5BMUA 1OKDA 1M2AA 3TJGA 2VOCA 1FB6A 4ZB8A 2X4AA 4HZ4A 2H72A 1B48A 1R4WA 2FNOA 4KSMA 2LRNA 1X9MB 4IGJA 3NZNA 3EC3A 1EGOA 3D22A 4WXTA 1GSQA 3GYKA 3ZVJD 1AC1A 5FHIA 3GL3A 5C00A 14GSA 3LSZA 4ML1A 5A4WA 5IO0A 2K8VA 3TOTA 2VO4A 5G5EA 3A5WA 4F9ZA 3ZIJA 4EUYA 2KP2A 4WBRD 2C3TA 4TVEA 1C72A 3BCKA 4RI6A 2XPEA 2F9SA 3E0UA 4ILFA 2I3YA 4X43A 1A23A 4IS0A 3GKKA 1EOHA 3LWAA 2WULA 3VWVA 3C1SA 1HNBA 4QQ7A 2JZRA 3RAZA 1CQGA 4CY8A 2WRTA 2CZ2A 1PL1A 3QAGA 2DJ3A 3GSSA 2R37A 1R5AA 3UAPA 5AGYA 1WE0A 2PU9C 5KN3A 4HQZA 3IDVA 3CMIA 1QGVA 2X8CA 3QFAC 2DKIA 4FH8A 2FWFA 1K0DA 3VURA 3H93A 3KEBA 5A5KA 2E2MA 3DVXA 4Q5NA 1ZMAA 2GGTA 2R2JA 5E59A 4PX1A 2L5LA 4MF6A 5G31A 5JCGA 3EU4A 2EC4A 5JCUA 2H30A 4K5RA 1WWJA 3BJ5A 5G5FA 3TCOA 3ZLPA 5ECPB 5J9BA 5FWGA 2RM6A 4KE3A 1EEMA 2QSIA 6GSXA 2F3MA 3ZL5A 4BVYB 5GSTA 1OYJA 6GSVA 3C8EA 2L6CA 4MABA 4D73A 3TKSE 3A2WA 1EWXA 2V41A 2L59A 1TDIA 1BJXA 3M9KA 3I69A 4BL7A 2YOIA 3VWUA 2P31A 4DSQA 3TKQA 4ECBA 4I97A 2O7KA 3PPUA 2DC5A 2WB9A 1OC9A 4KW6A 2YV9A 2G2QA 1SKSB 1PX6A 4LL1B 4P3YB 3FZ4A 3FR6A 2FA4A 5CO3A 2L4QA 3HY2A 1XVWA 4DSSA 4PTSA 2H73A 4ML6A 10GSA 5HFKA 1KBNA 1Z9HA 2IWTA 3ERGA 4TXOB 4EDZA 1AQWA 1K3LA 5D73A 2DKHA 2I1UA 2CAQA 4ULXA 4PURA 3ZMLA 4MJEA 2QC7A 3GV1A 3QD9A 3WD6A 1TRUA 4ECIA 2DIYA 4TR1B 1WRYA 4GTUA 2VLUA 3LXTA 1XZOA 1SENA 1LJRA 1KEBA 3ED3A 2LQQA 3L78A 3D6IA 1GH2A 4O32A 3HHVA 4FYCA 2VM1A 3FK8A 4KF9A 1GTBA 3UIWA 5D93A 1SK2A 3LG6A 3M1GA 4XRAA 3F0IA 2WZ9A 3LW9A 2XC2A 3MAKA 2H6YA 2K6VA 2VD1A 2CA8A 1A2JA 3FHKA 4WR4A 5IO2A 1XVQA 2B5XA 4E8EA 4JEDA 2A2SA 1SYRA 3HVVA 3KJYA 4Z2RA 2D2ZA 5DAKA 1SK1A 1M99A 3L9SA 4WBJA 1FW1A 2CX4A 3LEFA 1MTCA 2MBTA 4EIQA 4TRXA 4K7OA 1S3AA 4BVXA 2BTOT 3TDGA 2G0FA 2I9HA 5HR3A 1YEXA 3CSHA 2HE3A 3P2AA 1PN0A 3TJJA 2L57A 3G7YA 1AUCA 2JSYA 5CNWA 3W8JA 3PR8A 4K6XA 4CHSA 4JRRA 4G2EA 1NW2A 4KCEA 1Y6EA 3HZ4A 5JWQB 5F06A 4K7IA 4POLA 1S3CA 3KH7A 4TR3A 1ERUA 4POMA 1GSSA 3D5JA 3HJMA 1VRSD 5ELGA 1A8LA 3N9JA 2AAWA 2C1YA 4K2DA 2XBIA 4K8MA 1SYXA 4ID0A 3HYPA 2ES7A 2PGTA 3LXZA 4OWYA 3VI5A 5LNKe 2GDRA 4KAEA 2J23A 3IAM2 4I8BA 5KEJA 2VLVA 3ERWA 2ON5A 3HJOA 3W8SA 3FMWA 1TI1A 2MZCA 19GSA 4MPFA 1SD8A 3CBUA 2HZFA 3TRPA 3HCZA 1QMVA 3IK9A 5D96A 2GZZA 4CW9A 5J5NA 5F0GA 4OO5A 2IMEA 3IRAA 2C0GA 3HA9A 2LRCA 2H74A 2BJXA 3R2QA 5F05A 1XWBA 2DJKA 2FWGA 5IMAA 3HD5A 2TIRA 4MH2A 2EIOA 3U5RE 1DUGA 4FYBA 2YZHA 3TJBA 2C0DA 5J9CA 5IMFA 1ON4A 4L0UA 2QGVA 3KP9A 5ID2A 2GLRA 1U6TA 1OE8A 1GLPA 4H86A 4PUAA 2VD0A 3I9V2 4MNNA 1T1VA 1PL2A 4E8HA 1BX9A 1XFLA 4JR4A 2A4VA 2OE1A 2V2GA 2M80A 2H66A 3APOA 4V2MA 5ECRB 1GTAA 1EEJA 1VF3A 4LMWA 1ERTA 5J41A 3CTFA 4BA7A 1UC7A 2HI7A 1X5CA 3U6VA 3N5OA 4ZIJA 2H0IA 3CRUA 3H8QA 4ZBDA 3KXOA 1LBKA 4GWRA 4QL7A 3C7MA 4XS1A 5D9XA 4MZWA 2KOKA 2F51A 1YJ6A 4TN8A 4HU7A 4IVFA 4ZL8A 1WPIA 3HVSA 1V98A 2HRNA 2LUSA 4YQMA 4AJ6A 2H01A 2AUVA 4GCIA 3ZYWA 1B4QA 1URMA 2LKUA 1SU9A 1JZRA 1M9AA 4I2UA 4AJ7A 3ZITA 2IMIA 4MK3A 2HRKA 2CQ9A 4EKZA 5G1LA 1OAZA 4ZBAA 3F9UA 4J56E 2R3XA 3GMFA 5ECKB 2OADA 1FVKA 1V2AA 2CZ3A 4WETA 1BQ7A 3I6AA 1TTZA 4IN0A 1VF4A 5HR0A 4IQAA 4KSOA 2IIYA 2GT5A 3KM6A 4BVYA 2NVLA 5KOXA 1ZGNA 3WGDA 5ECMB 2C4JA 3PINA 1T4YA 1GSFA 4IJ3A 2GQLA 13GSA 2H19A 4KDYA 3L9VA 1WIKA 2XPDA 3G9BA 4EDYA 3P90A 3KIJA 4K1FA 1U3IA 5IMVA 2PMTA 3QMXA 1TK8B 2CVKA 1Z6NA 1IYIA 3F3RA 2RUFA 1WMJA 1VGLA 2JU5A 4MJCA 2WGRA 2FA8A 3GSTA 1HNCA 2DJ2A 2H1AA 4PXOA 3SBCA 4IKHA 4AGSA 3Q74A 4BWQA 1X0RA 4NXIA 2H0GA 3L0HA 2PUKC 3A3TA 3DIEA 2H76A 1GNWA 1YZXA 4TXOA 1Z3EA 4N0ZA 4EIPA 2L4CA 1PRXA 1A2LA 3CSIA 4K9ZA 4ACSA 1V9WA 1R5PA 1XXUA 1GL8A 3GNJA 3ZTLA 2TRXA 1MD4A 1THOA 3IBHA 4NPBA 3WT2A 5IOXA 1UA5A 3F8UA 5GAPD 1Z5YE 4DEJA 4WR5A 2VAFA 2B3SA 4TR1A 3DMLA 4XS4A 4KA0A 7GSSA 1K0NA 3QAWA 4IHUA 2YZUA 1J0FA 4TKYA 3H1NA 2LEGA 1A0RP 4V2LA 2GTUA 2YWMA 1ST9A 2HSMA 4CY6A 1BYEA 4DSRA 1G6WA 1F6MC 2A2PA 2GQKA 4KCAA 5D9TA 2E7PA 5IMCA 2TRCP 4ECJA 1F3AA 2DSAA 3GKXA 5B8AA 2GZYA 5INYA 4F03A 1MDKA 2V6KA 1SD9A 2GSSA 1AIUA 3GURA 2IN3A 2CVBA 1KNGA 4WKWA 3BBYA 2GVPA 4JZQA 3GN3A 2OJLA 1GSUA 2PBJA 4L5OA 2MMZA 4YH2A 3IK7A 2VL2C 1X9WB 1O6JA 4YQUA 1YF0A 4XHMA 3FZ9A 4EF0A 1NHOA 3QPMA 1TK0B 1XW6A 5J3RA 5DVBA 3W6GA 3DGQA 4K0GA 1GUHA 3MYDA 4G0IA 5KN2A 3TKSC 2IFQB 1VF1A 3HXSA 4MMMA 2C0FA 2N5BA 3DD3A 3FR9A 1IYHA 1XWAA 3LFLA 4ECCA 22GSA 4XRDA 1K3YA 1TOFA 2JZTA 3F6FA 2AJQB 4HDEA 2H6XA 3IA1A 3WGEA 3TJKA 1NSWA 4GXZA 1ERVA 2IMFA 5FT3A 3JCML 3UJ1A 2B1KA 2HZEA 2V1MA 2I81A 4PQIA 4OFMA 4PNGA 3DVWA 4NV5A 2H1BA 3UARA 1T00A 1YKAA 2DLXA 3KGKA 5DALA 3MWHA 5ECHB 2HLSA 3VFIA 4IELA 1XBSA 2YWNA 1ZYQB 1G7OA 1FVJA 1W89A 3R3EA 2X99A 2VM2A 1S3DA 3K8NA 3FRCA 3E9JB 2LRTA 2WJUA 4QL9A 1JFUA 2KUCA 4NWYA 4RI7A 5H5QA 1XW9A 5HQPA 4Z2UA 4LL4B 2V32A 2YWIA 4ZB6A 4FIWA 2N5FA 1GSEA 2X8HA 5H5RA 3UVTA 2YJHA 2WDUA 1ZCPA 4ZL9A 1YY7A 3LGCA 5EL8A 4EC0A 4L5LA 3EMXA 1NHYA 1NM3A 2P5RA 5IMZA 5JCWA 4OMVA 4KDUA 4HI7A 3P8WA 1WOUA 1B9YC 1EZKA 4HS1A 5B7CA 2A4HA 1YF1A 2J9HA 3VI7A 2YPMA 3Q18A 1PKWA 3GA4A 4K0NA 2LNTA 3KP8A 4HJ2A 1B8XA 1HYUA 4Q5RA 1Y25A 3F4TA 1AQVA 1AQXA 5D9WA 1U88A 1G6YA 6GSYA 3APSA 4TR0A 3CSJA 1V57A 4KGIA 4MF5A 1R26A 1FB0A 1USBA 2JACA 2MMOA 2R0PA 1JLWA 4IBPA 1W4VA 4Q5FA 3KCMA 2FHEA 1MD3A 1OC9B 2AYTA 2N5AA 5B8BA 5HFGA 4NHZA 2XBQA 1TU7A 3CXGA 2H1DA 1I9DA 4DSSB 4I2TA 2LJKA 1XWKA 3WGXA 4RQRA 1OKTA 2L5OA 1JZDA 1Q4JA 2HRAA 2AB6A 2P0GA 5G1KA 2YWOA 2HSHA 1SJ6A 3FZAA 3NOFA 2H71A 4MJBA 3DRNA 2AV4A 4EVMA 3IOSA 4ZB9A 2LNSA 1M2BA 4XIHA 2QKEA 1V58A 3ZIVA 2NTOA 2GT6A 2CT6A 5HR2A 4LA1A 2PWJA 1TKDB 3FY7A 1QFNA 3GUSA 3PGTA 2MMAA 2VCZA 3LYKA 2B6MA 4HJMA 2IPAA 4Q5QA 2VCQA 2VUPA 2E0QA 2K9FA 11GSA 2WCIA 3WT1A 1TK5B 1WJKA 1U3AA 1PA3A 2R0CA 4ZL7A 3IC4A 1V40A 1THXA 2GSQA 1QK8A 2PVQA 2H75A 1HD2A 1XCCA 4USSA 1H4OA 3QAVA 3PH9A 3MIXA 3EWLA 2YANA 1TU8A 2BMXA 3QOUA 4FO5A 5KN1A 2GSTA 2RUEA 3FW2A 1A2MA 1DE1A 5ECOB 2A2RA 5CREA 5DAKB 2PVOC 1YDKA 1PMTA 3GTUB 3D4MA 1RK4A 2HXKA 1MDIA 4XS6A 3FR3A 4KDXA 4ICYA 4G10A 3ZREA 4KX4A 4BVXB 4GSNA 2C0EA 5ELAA 2LV3A 4WF5A 2KHPA 3BOAA 1BG5A 2DJ1A 5AIXA 1K0AA 4K5SA 4K7NA 3VWWA 1TXXA 4L0WA 4KH7A 4F82A 3Q6OA 2REMA 2DJ0A 3VPQA 2H1GA 1ZYEA 1DSBA 4NMUA 3IC8A 2K8SA 3LORA 3HDCA 3LJRA 1XPVA 1QXHA 4J2FA 4N30A 3QFBC 1PD21 2YN1A 4OD7A 1GRXA 4ZXGA 1ABAA 3Q19A 5DDLA 2YNXA 1HQOA 4GSSA 3TB2A 1O85A 3WYWA 5A4VA 1TP9A 2OBKA 4RQXA 2IMKA 4G9HA 2OE3A 4MLYA 2OE0A 3VWXA 2HT9A 1XIYA 3F3QA 5F07A 2CV4A 4LLRA 4G0LA 3OR5A 1N2AA 3KMOA 3ISOA 1M0UA 3IAS2 3G7JA 2ON7A 5ABRA 1N8JA 5KN0A 3LYPA 1CQHA 1GLQA 1K0CA 1ML6A 3QDNA 4IQ1A 1EGRA 2IFQA 3GFKA 4J57E 2M72A 2R0GA 4MZCA 1TJDA 5DCGA 5AISA 2LJRA 2IMDA 1OE7A 2V6OA 1QUWA 1R7HA 4BWSA 3G7IA 4IP1A 3QCPA 3UBLA 2R4VA 1JZWA 3D21A 1F37A 1PQNA 3ZVJA 3RPPA 2EIRA 4N0VA 2AHEA 20GSA 5EPFA 5CAXA 3DWVA 1GSDA 5H5SA 3L9UA 1Z7RA 2B5YA 1GP1A 2WFCA 3MDKA 1G7EA 5ID2B 3O3TA 4MF7A 3ZZXA 3AY8A 1MEKA 1U87A 6GSTA 5KOWA 2LJAA 4TW5A 4XTSA 1Q98A 3ZRDA 4WF4A 3UEMA 1EP8A 2I4AA 1B9XC 1ZOFA 3KH9A 2HNLA 5BRTA 1ILOA 1ERWA 2ALBA 2VL3A 2ZNMA 3GX8A 2C8UA 3EPTA 2GS3A 5DQSA 2RM5A 4IW9A 2HRFA 1DE2A 4GRFA 2VLTA 2HSYA 3FEUA 4O7HA 1VF2A 3FZ5A 1PX7A 3LQ7A 3IXRA 2CVDA 3J7Yk 5DJLA 3E3EA 2H70A 2RIIA 2QA2A 3A5IA 1E6BA 4JBBA 1TRVA 1FHEA 3BCIA 1GULA 4OFNA 4GQFA 16GSA 2VIMA 3KTBA 5ECSA 4L8EA 4GSTA 3NIVA 2MYGA 1K0MA 3O76A 3MSZA 5DQYA 4TXVA 4EO3A 2PERA 1SKWB 4V2NA 5ENUA 3UBKA 2X49A 4I5QA 4KB3A 4ZILA 2LTKA 5CRGA 3GKNA 4RUVA 3TRXA 1AAZA 5ECQB 1XW5A 4F0BA 1FO5A 2PN8A 2VCWA 4FYUA 1DBYA 1BEDA 3RHBA 2H6ZA 5COHA 3V1WA 2KLXA 1ZYNA 2WS2A 3F4SA 4POKA 4DVCA 1WP0A 4O5RA 4O5UA 3CTGA 1SJIA 5E4WA 4KNDA 4OO4A 1J9BA 5GSSA 4MCUA 4HOJA 4GLTA 2DBCA 4ISDA 3GH6A 3TGZA 2B1LA 2P5QA 4X4JA 3SWLA 2FCHA 2FD3A 3VLNA 6GSWA 1A0FA 4BPYA 1K3OA 2VL9A 3ME8A 2CX3A 1AXDA 9GSSA 2O85A 1KTEA 2FUG2 4JR6A 1UVZA 1FG4A 4IJIA 3EE2A 4A5PA 2MBSA 1SL0B 2ZUPA 1SK0A 1K0BA 4JU5A 1XOBA 2FY6A 3DEXA 8GSSA 1EV9A 1AW9A 5DCHA 1JZOA 2YCDA 1T7PB 1SJZA 4OFTA 4YAPA 3VK9A 3EINA 2H0HA 2LS5A 2DJJA 4IP6A 3GH9A 2YV7A 4N11A 1EOGA 3DYRA 3O6TA 3EMPA 4XS4B 3IE3A 1O8WA 4O5QA 2O89A 3HJPA 4OCFA 5IQYA 2H8LA 3ERFA 1YQ1A 2GSRA 1M2DA 4G19A 1HNAA 2HYXA 5DJMA 3M3MA 1LU4A 3MNGA 1PGTA 4MPGA 3VPTA 4V1Ag 5IMDA 5JWOB 5A4UA 2YP6A 3US3A 5IIZA 1T4ZA 1SKRB 1F3BA 2XHFA 17GSA 3C73A 4MH3A 1EV4A 2Z9SA 1SL1B 1RQMA 2IJYA 3C1RA 4FQUA 4YKFA 1EP7A 2O87A 4TR4A 2JSZA 5ECIB 6GSSA 5HR1A 3FKFA 1K0OA 4HUAA 2X8GA 1PSQA 1GUKA 4AJ8A 3GTUA 4MP4A 2GQMA 1G0TA 1PN9A 3KMNA 4D73B 3RBTA 1O73A 2FGXA 5EY6A 5DBQA 2VCVA 12GSA 3BD2A 2EIQA 3EYTA 1O81A 3A2VA 2C80A 4O92A 4BL7B 3D4TA 2FLSA 1F9MA 3ME7A 2E2GA 1A8YA 5CRWA 2NPBA 2OBIA 4AF2A 2F8AA 2DIZA 3IPZA 2K18A 4NAXA 1OVNA 4OCEA 2HZEB 3EVIA 2C3NA 3TOUA 5CRDA 4HU9A 1TI3A 2PPTA 1I5GA 5F8BA 3EU3A 4GQCA 1A24A 3M0FA 2OA7A 2C3QA 5DALB 4Z2TA 1GNEA 4HZ2A 4NHWA 4XCSA 1MDJA 5G30A 2L6DA 3KZQA 1Z6MA 3KD0A 2FWHA 3RHCA 1M9BA 4EE0A 2FWEA 1YEPA 5B6NA 3F6DA 5LD0A 4WEYA 3GHAA 4G0KA 1X5EA 3IR4A 4N10A 3EURA 2MMNA 1FAAA 5JWRB 4CDOA 3UVHA 2JL4A 2RLIA 6GSUA 1JHBA 3H79A 4Z7XA 4NV2A 1GTUA 1OC3A 1YKCA 4PUFC 2LSTA 4PQHA 3GKMA 3HZ8A 3GIXA 3IHQA 2M46A 1J08A 2OKAA 1E2YA 4HQSA 1XWCA 3GRXA 1T3BA 2UZ8A 3TUEA 1OC8A 1O7UA 2B5EA 2NDOA 5C04A 2ZCTA 1ZZYA 2GZPA 1GSYA 1RW1A 4EXJA 5CRHA 2R5GA 3ZFBA 4PQ1A 3H4KA 4YQVA 1JLVA 5L71A 3RDWA 5GZZB 3DXBA 3M9JA 4X1UA 4PGTA 4ZBBA 4MDCA 3CRTA 4LMVA 2LQOA 4X0XA 4F2IA 4MA9A 5D8IA 4YAVA 5IOWA 4I6XA 3A2XA 1SL2B 3D0ZA 3RPNA 4F0CA 1TRWA 3GX0A 5CP1A 3P7XA 1H75A 1B4PA 4PNFA 3TJFA 5IPGA 2OACA 3TRQA 1XOAA 1T8EB 2JZSA 5GAND 1XWGA 4YKGA 3UL3A 4HEA2 3IHGA 4GF0A 3J7Yb 3DKSA 2O8VB 2VL2A 1GUMA 5J4UA 5EVOA 1TRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G2Z A;  2R6K A;  1TW9 A;  1PKZ A;  3FYG A;  3APQ A;  3QR6 A;  3HVX A;  5AIV A;  3GL5 A;  3TKS A;  5B6M A;  4POB A;  2VCX A;  1M7T A;  2B7J A;  3L4N A;  3M8N A;  4MZB A;  5IM9 A;  1QQ2 A;  3ZMK A;  1GWC A;  2VCT A;  4EL1 A;  3CYN A;  1O8X A;  2CAI A;  3C71 A;  1F2E A;  1UN2 A;  4V1A p;  5HFI A;  4TOP A;  3S9F A;  3I43 A;  3IV4 A;  3F63 A;  1FOV A;  2HFD A;  3F4R A;  1X5D A;  2DML A;  18GS A;  3ZFL A;  3TKP A;  2DMM A;  5D9V A;  2NBS A;  3KTL A;  4JE1 A;  5CYY A;  2F8F A;  2IL3 A;  2KP1 A;  5AN1 A;  2B7K A;  1ZL9 A;  5ECL B;  1X9S B;  3HKR A;  5LCZ A;  5IPH A;  2YJ7 A;  5ECN B;  4KUN A;  1GTI A;  3UMA A;  1ACV A;  2X64 A;  1BAY A;  3UOM A;  1Z7P A;  2JAD A;  4MJA A;  3TKR A;  1OKD A;  1M2A A;  3TJG A;  2VOC A;  1FB6 A;  4ZB8 A;  4HZ4 A;  2H72 A;  1B48 A;  1R4W A;  2FNO A;  4KSM A;  2LRN A;  1X9M B;  4IGJ A;  3NZN A;  3EC3 A;  1EGO A;  3D22 A;  4WXT A;  1GSQ A;  3GYK A;  3ZVJ D;  1AC1 A;  5FHI A;  3GL3 A;  5C00 A;  14GS A;  3LSZ A;  4ML1 A;  5A4W A;  5IO0 A;  2K8V A;  3TOT A;  2VO4 A;  5G5E A;  3A5W A;  4F9Z A;  3ZIJ A;  4EUY A;  2KP2 A;  4WBR D;  2C3T A;  4TVE A;  1C72 A;  3BCK A;  4RI6 A;  2XPE A;  2F9S A;  3E0U A;  4ILF A;  2I3Y A;  4X43 A;  1A23 A;  4IS0 A;  3GKK A;  1EOH A;  3LWA A;  2WUL A;  3VWV A;  3C1S A;  1HNB A;  4QQ7 A;  2JZR A;  3RAZ A;  1CQG A;  2WRT A;  2CZ2 A;  1PL1 A;  3QAG A;  2DJ3 A;  3GSS A;  2R37 A;  1R5A A;  3UAP A;  5AGY A;  1WE0 A;  2PU9 C;  5KN3 A;  4HQZ A;  3IDV A;  3CMI A;  1QGV A;  2X8C A;  3QFA C;  4FH8 A;  2FWF A;  1K0D A;  3VUR A;  3H93 A;  3KEB A;  5A5K A;  2E2M A;  3DVX A;  4Q5N A;  1ZMA A;  2GGT A;  2R2J A;  5E59 A;  4PX1 A;  2L5L A;  4MF6 A;  5G31 A;  5JCG A;  3EU4 A;  2EC4 A;  5JCU A;  2H30 A;  1WWJ A;  3BJ5 A;  5G5F A;  3TCO A;  3ZLP A;  5ECP B;  5J9B A;  5FWG A;  2RM6 A;  4KE3 A;  1EEM A;  2QSI A;  6GSX A;  2F3M A;  3ZL5 A;  5GST A;  1OYJ A;  6GSV A;  3C8E A;  2L6C A;  4MAB A;  4D73 A;  3TKS E;  3A2W A;  1EWX A;  2V41 A;  2L59 A;  1TDI A;  1BJX A;  3M9K A;  3I69 A;  4BL7 A;  2YOI A;  3VWU A;  2P31 A;  4DSQ A;  3TKQ A;  4ECB A;  4I97 A;  2O7K A;  2DC5 A;  2WB9 A;  1OC9 A;  4KW6 A;  2YV9 A;  2G2Q A;  1SKS B;  1PX6 A;  4LL1 B;  4P3Y B;  3FZ4 A;  3FR6 A;  2FA4 A;  5CO3 A;  2L4Q A;  3HY2 A;  1XVW A;  4DSS A;  2H73 A;  4ML6 A;  10GS A;  5HFK A;  1KBN A;  1Z9H A;  2IWT A;  3ERG A;  4TXO B;  4EDZ A;  1AQW A;  1K3L A;  5D73 A;  2I1U A;  2CAQ A;  4ULX A;  4PUR A;  3ZML A;  4MJE A;  2QC7 A;  3GV1 A;  3QD9 A;  3WD6 A;  1TRU A;  4ECI A;  2DIY A;  4TR1 B;  1WRY A;  4GTU A;  2VLU A;  3LXT A;  1XZO A;  1SEN A;  1LJR A;  1KEB A;  3ED3 A;  2LQQ A;  3L78 A;  3D6I A;  1GH2 A;  4O32 A;  3HHV A;  4FYC A;  2VM1 A;  3FK8 A;  1GTB A;  3UIW A;  5D93 A;  1SK2 A;  3LG6 A;  3M1G A;  4XRA A;  3F0I A;  2WZ9 A;  2XC2 A;  3MAK A;  2H6Y A;  2K6V A;  2VD1 A;  2CA8 A;  1A2J A;  3FHK A;  4WR4 A;  5IO2 A;  1XVQ A;  2B5X A;  4E8E A;  4JED A;  2A2S A;  1SYR A;  3HVV A;  3KJY A;  2D2Z A;  5DAK A;  1SK1 A;  1M99 A;  3L9S A;  4WBJ A;  1FW1 A;  2CX4 A;  3LEF A;  1MTC A;  2MBT A;  4TRX A;  4K7O A;  1S3A A;  4BVX A;  2BTO T;  3TDG A;  2G0F A;  2I9H A;  5HR3 A;  1YEX A;  3CSH A;  2HE3 A;  3P2A A;  3TJJ A;  2L57 A;  3G7Y A;  1AUC A;  2JSY A;  5CNW A;  3W8J A;  3PR8 A;  4K6X A;  4CHS A;  4JRR A;  4G2E A;  1NW2 A;  4KCE A;  1Y6E A;  3HZ4 A;  5JWQ B;  5F06 A;  4K7I A;  4POL A;  1S3C A;  3KH7 A;  4TR3 A;  1ERU A;  4POM A;  1GSS A;  3D5J A;  3HJM A;  1VRS D;  5ELG A;  1A8L A;  3N9J A;  2AAW A;  2C1Y A;  4K2D A;  2XBI A;  4K8M A;  1SYX A;  4ID0 A;  3HYP A;  2ES7 A;  2PGT A;  3LXZ A;  4OWY A;  3VI5 A;  5LNK e;  2GDR A;  4KAE A;  2J23 A;  3IAM 2;  4I8B A;  5KEJ A;  2VLV A;  3ERW A;  2ON5 A;  3HJO A;  3W8S A;  1TI1 A;  2MZC A;  19GS A;  4MPF A;  1SD8 A;  3CBU A;  2HZF A;  3TRP A;  3HCZ A;  1QMV A;  3IK9 A;  5D96 A;  2GZZ A;  4CW9 A;  5J5N A;  5F0G A;  4OO5 A;  2IME A;  3IRA A;  2C0G A;  3HA9 A;  2LRC A;  2H74 A;  2BJX A;  3R2Q A;  5F05 A;  1XWB A;  2DJK A;  2FWG A;  5IMA A;  3HD5 A;  2TIR A;  4MH2 A;  2EIO A;  3U5R E;  1DUG A;  4FYB A;  2YZH A;  3TJB A;  2C0D A;  5J9C A;  5IMF A;  1ON4 A;  4L0U A;  2QGV A;  3KP9 A;  5ID2 A;  2GLR A;  1U6T A;  1OE8 A;  1GLP A;  4H86 A;  4PUA A;  2VD0 A;  3I9V 2;  1T1V A;  1PL2 A;  4E8H A;  1BX9 A;  1XFL A;  4JR4 A;  2A4V A;  2OE1 A;  2V2G A;  2M80 A;  2H66 A;  3APO A;  4V2M A;  5ECR B;  1GTA A;  1EEJ A;  1VF3 A;  4LMW A;  1ERT A;  5J41 A;  3CTF A;  4BA7 A;  1UC7 A;  2HI7 A;  1X5C A;  3U6V A;  3N5O A;  4ZIJ A;  2H0I A;  3CRU A;  3H8Q A;  4ZBD A;  3KXO A;  1LBK A;  4GWR A;  4QL7 A;  3C7M A;  4XS1 A;  5D9X A;  4MZW A;  2KOK A;  2F51 A;  1YJ6 A;  4TN8 A;  4HU7 A;  4IVF A;  4ZL8 A;  1WPI A;  3HVS A;  1V98 A;  2HRN A;  2LUS A;  4YQM A;  4AJ6 A;  2H01 A;  2AUV A;  4GCI A;  3ZYW A;  1B4Q A;  1URM A;  2LKU A;  1SU9 A;  1JZR A;  1M9A A;  4I2U A;  4AJ7 A;  3ZIT A;  2IMI A;  4MK3 A;  2CQ9 A;  4EKZ A;  5G1L A;  1OAZ A;  4ZBA A;  3F9U A;  4J56 E;  2R3X A;  3GMF A;  5ECK B;  2OAD A;  1FVK A;  1V2A A;  2CZ3 A;  4WET A;  1BQ7 A;  3I6A A;  1TTZ A;  4IN0 A;  1VF4 A;  5HR0 A;  4IQA A;  4KSO A;  2IIY A;  2GT5 A;  3KM6 A;  4BVY A;  2NVL A;  1ZGN A;  3WGD A;  5ECM B;  2C4J A;  3PIN A;  1T4Y A;  1GSF A;  4IJ3 A;  2GQL A;  13GS A;  2H19 A;  4KDY A;  3L9V A;  1WIK A;  2XPD A;  3G9B A;  4EDY A;  3P90 A;  3KIJ A;  4K1F A;  1U3I A;  5IMV A;  2PMT A;  3QMX A;  1TK8 B;  2CVK A;  1Z6N A;  1IYI A;  3F3R A;  2RUF A;  1WMJ A;  1VGL A;  2JU5 A;  4MJC A;  2WGR A;  2FA8 A;  3GST A;  1HNC A;  2DJ2 A;  2H1A A;  4PXO A;  3SBC A;  4IKH A;  4AGS A;  3Q74 A;  4BWQ A;  1X0R A;  4NXI A;  2H0G A;  3L0H A;  2PUK C;  3A3T A;  3DIE A;  2H76 A;  1GNW A;  1YZX A;  4TXO A;  1Z3E A;  4N0Z A;  2L4C A;  1PRX A;  1A2L A;  3CSI A;  4K9Z A;  4ACS A;  1V9W A;  1R5P A;  1XXU A;  1GL8 A;  3GNJ A;  3ZTL A;  2TRX A;  1MD4 A;  1THO A;  3IBH A;  4NPB A;  3WT2 A;  5IOX A;  1UA5 A;  3F8U A;  5GAP D;  1Z5Y E;  4DEJ A;  4WR5 A;  2VAF A;  2B3S A;  4TR1 A;  3DML A;  4XS4 A;  4KA0 A;  7GSS A;  1K0N A;  3QAW A;  4IHU A;  2YZU A;  1J0F A;  4TKY A;  3H1N A;  2LEG A;  1A0R P;  4V2L A;  2GTU A;  2YWM A;  1ST9 A;  1BYE A;  4DSR A;  1G6W A;  1F6M C;  2GQK A;  4KCA A;  5D9T A;  2E7P A;  5IMC A;  2TRC P;  4ECJ A;  1F3A A;  2DSA A;  3GKX A;  5B8A A;  2GZY A;  5INY A;  4F03 A;  1MDK A;  2V6K A;  1SD9 A;  2GSS A;  1AIU A;  3GUR A;  2IN3 A;  2CVB A;  1KNG A;  4WKW A;  3BBY A;  2GVP A;  4JZQ A;  3GN3 A;  2OJL A;  1GSU A;  2PBJ A;  4L5O A;  2MMZ A;  4YH2 A;  3IK7 A;  2VL2 C;  1X9W B;  1O6J A;  4YQU A;  1YF0 A;  4XHM A;  3FZ9 A;  4EF0 A;  1NHO A;  3QPM A;  1TK0 B;  1XW6 A;  5J3R A;  5DVB A;  3W6G A;  3DGQ A;  4K0G A;  1GUH A;  5KN2 A;  3TKS C;  2IFQ B;  1VF1 A;  3HXS A;  4MMM A;  2C0F A;  2N5B A;  3DD3 A;  3FR9 A;  1IYH A;  1XWA A;  3LFL A;  4ECC A;  22GS A;  4XRD A;  1K3Y A;  1TOF A;  2JZT A;  3F6F A;  2AJQ B;  4HDE A;  2H6X A;  3IA1 A;  3WGE A;  3TJK A;  1NSW A;  4GXZ A;  1ERV A;  2IMF A;  5FT3 A;  3JCM L;  3UJ1 A;  2B1K A;  2HZE A;  2V1M A;  2I81 A;  4PQI A;  4OFM A;  4PNG A;  3DVW A;  4NV5 A;  2H1B A;  3UAR A;  1T00 A;  1YKA A;  2DLX A;  3KGK A;  5DAL A;  3MWH A;  5ECH B;  2HLS A;  3VFI A;  4IEL A;  1XBS A;  2YWN A;  1ZYQ B;  1G7O A;  1FVJ A;  1W89 A;  2X99 A;  2VM2 A;  1S3D A;  3K8N A;  3FRC A;  3E9J B;  2LRT A;  2WJU A;  4QL9 A;  1JFU A;  2KUC A;  4NWY A;  4RI7 A;  5H5Q A;  1XW9 A;  5HQP A;  4LL4 B;  2V32 A;  2YWI A;  4ZB6 A;  4FIW A;  2N5F A;  1GSE A;  2X8H A;  5H5R A;  3UVT A;  2YJH A;  2WDU A;  1ZCP A;  4ZL9 A;  1YY7 A;  3LGC A;  5EL8 A;  4EC0 A;  4L5L A;  3EMX A;  1NHY A;  1NM3 A;  2P5R A;  5IMZ A;  5JCW A;  4OMV A;  4KDU A;  4HI7 A;  3P8W A;  1WOU A;  1B9Y C;  1EZK A;  4HS1 A;  5B7C A;  1YF1 A;  2J9H A;  3VI7 A;  2YPM A;  3Q18 A;  1PKW A;  3GA4 A;  4K0N A;  2LNT A;  3KP8 A;  4HJ2 A;  1B8X A;  1HYU A;  4Q5R A;  1Y25 A;  3F4T A;  1AQV A;  1AQX A;  5D9W A;  1U88 A;  1G6Y A;  6GSY A;  3APS A;  4TR0 A;  3CSJ A;  1V57 A;  4KGI A;  4MF5 A;  1R26 A;  1FB0 A;  1USB A;  2JAC A;  2MMO A;  1JLW A;  4IBP A;  1W4V A;  4Q5F A;  3KCM A;  2FHE A;  1MD3 A;  1OC9 B;  2AYT A;  2N5A A;  5B8B A;  5HFG A;  4NHZ A;  2XBQ A;  1TU7 A;  3CXG A;  2H1D A;  1I9D A;  4DSS B;  4I2T A;  2LJK A;  1XWK A;  3WGX A;  4RQR A;  1OKT A;  2L5O A;  1JZD A;  1Q4J A;  2AB6 A;  2P0G A;  5G1K A;  2YWO A;  2HSH A;  1SJ6 A;  3FZA A;  3NOF A;  2H71 A;  4MJB A;  3DRN A;  2AV4 A;  4EVM A;  3IOS A;  4ZB9 A;  2LNS A;  1M2B A;  4XIH A;  2QKE A;  1V58 A;  3ZIV A;  2NTO A;  2GT6 A;  2CT6 A;  5HR2 A;  4LA1 A;  2PWJ A;  1TKD B;  3FY7 A;  1QFN A;  3GUS A;  3PGT A;  2MMA A;  2VCZ A;  3LYK A;  2B6M A;  4HJM A;  2IPA A;  4Q5Q A;  2VCQ A;  2VUP A;  2E0Q A;  2K9F A;  11GS A;  2WCI A;  3WT1 A;  1TK5 B;  1WJK A;  1U3A A;  1PA3 A;  4ZL7 A;  3IC4 A;  1V40 A;  1THX A;  2GSQ A;  1QK8 A;  2PVQ A;  2H75 A;  1HD2 A;  1XCC A;  1H4O A;  3QAV A;  3PH9 A;  3EWL A;  2YAN A;  1TU8 A;  2BMX A;  3QOU A;  4FO5 A;  5KN1 A;  2GST A;  2RUE A;  3FW2 A;  1A2M A;  1DE1 A;  5ECO B;  2A2R A;  5CRE A;  5DAK B;  2PVO C;  1YDK A;  1PMT A;  3GTU B;  3D4M A;  1RK4 A;  2HXK A;  1MDI A;  4XS6 A;  3FR3 A;  4KDX A;  4G10 A;  3ZRE A;  4KX4 A;  4GSN A;  2C0E A;  5ELA A;  2LV3 A;  4WF5 A;  2KHP A;  3BOA A;  1BG5 A;  2DJ1 A;  5AIX A;  1K0A A;  4K7N A;  3VWW A;  1TXX A;  4L0W A;  4KH7 A;  4F82 A;  3Q6O A;  2REM A;  2DJ0 A;  3VPQ A;  2H1G A;  1ZYE A;  1DSB A;  4NMU A;  2K8S A;  3LOR A;  3HDC A;  3LJR A;  1XPV A;  1QXH A;  4J2F A;  4N30 A;  3QFB C;  1PD2 1;  2YN1 A;  4OD7 A;  1GRX A;  4ZXG A;  1ABA A;  3Q19 A;  5DDL A;  2YNX A;  1HQO A;  4GSS A;  3TB2 A;  1O85 A;  3WYW A;  5A4V A;  1TP9 A;  2OBK A;  4RQX A;  2IMK A;  4G9H A;  2OE3 A;  4MLY A;  2OE0 A;  3VWX A;  2HT9 A;  1XIY A;  3F3Q A;  5F07 A;  2CV4 A;  4LLR A;  3OR5 A;  1N2A A;  3KMO A;  3ISO A;  1M0U A;  3IAS 2;  3G7J A;  2ON7 A;  5ABR A;  1N8J A;  5KN0 A;  3LYP A;  1CQH A;  1GLQ A;  1K0C A;  1ML6 A;  3QDN A;  4IQ1 A;  1EGR A;  2IFQ A;  3GFK A;  4J57 E;  2M72 A;  4MZC A;  1TJD A;  5DCG A;  5AIS A;  2LJR A;  2IMD A;  1OE7 A;  2V6O A;  1QUW A;  1R7H A;  4BWS A;  3G7I A;  4IP1 A;  3QCP A;  3UBL A;  2R4V A;  1JZW A;  3D21 A;  1F37 A;  1PQN A;  3ZVJ A;  3RPP A;  2EIR A;  4N0V A;  2AHE A;  20GS A;  5EPF A;  5CAX A;  3DWV A;  1GSD A;  5H5S A;  3L9U A;  1Z7R A;  2B5Y A;  1GP1 A;  2WFC A;  3MDK A;  1G7E A;  5ID2 B;  3O3T A;  4MF7 A;  3ZZX A;  3AY8 A;  1MEK A;  1U87 A;  6GST A;  2LJA A;  4TW5 A;  4XTS A;  1Q98 A;  3ZRD A;  4WF4 A;  3UEM A;  1EP8 A;  2I4A A;  1B9X C;  1ZOF A;  3KH9 A;  2HNL A;  1ILO A;  1ERW A;  2ALB A;  2VL3 A;  2ZNM A;  3GX8 A;  2C8U A;  2GS3 A;  5DQS A;  2RM5 A;  4IW9 A;  2HRF A;  1DE2 A;  4GRF A;  2VLT A;  2HSY A;  3FEU A;  4O7H A;  1VF2 A;  3FZ5 A;  1PX7 A;  3LQ7 A;  3IXR A;  2CVD A;  3J7Y k;  5DJL A;  3E3E A;  2H70 A;  2RII A;  1E6B A;  4JBB A;  1TRV A;  1FHE A;  3BCI A;  1GUL A;  4OFN A;  4GQF A;  16GS A;  2VIM A;  3KTB A;  5ECS A;  4L8E A;  4GST A;  3NIV A;  2MYG A;  1K0M A;  3O76 A;  3MSZ A;  5DQY A;  4TXV A;  4EO3 A;  2PER A;  1SKW B;  4V2N A;  5ENU A;  3UBK A;  4I5Q A;  4KB3 A;  4ZIL A;  2LTK A;  5CRG A;  3GKN A;  4RUV A;  3TRX A;  1AAZ A;  5ECQ B;  1XW5 A;  4F0B A;  1FO5 A;  2PN8 A;  2VCW A;  4FYU A;  1DBY A;  1BED A;  3RHB A;  2H6Z A;  5COH A;  3V1W A;  2KLX A;  2WS2 A;  3F4S A;  4POK A;  4DVC A;  1WP0 A;  4O5R A;  3CTG A;  1SJI A;  5E4W A;  4KND A;  4OO4 A;  1J9B A;  5GSS A;  4MCU A;  4HOJ A;  4GLT A;  2DBC A;  4ISD A;  3GH6 A;  3TGZ A;  2B1L A;  2P5Q A;  3SWL A;  2FCH A;  2FD3 A;  3VLN A;  6GSW A;  1A0F A;  4BPY A;  1K3O A;  2VL9 A;  3ME8 A;  2CX3 A;  1AXD A;  9GSS A;  2O85 A;  1KTE A;  2FUG 2;  4JR6 A;  1UVZ A;  1FG4 A;  4IJI A;  3EE2 A;  2MBS A;  1SL0 B;  2ZUP A;  1SK0 A;  1K0B A;  4JU5 A;  1XOB A;  2FY6 A;  3DEX A;  8GSS A;  1EV9 A;  1AW9 A;  5DCH A;  1JZO A;  2YCD A;  1T7P B;  1SJZ A;  4OFT A;  4YAP A;  3VK9 A;  3EIN A;  2H0H A;  2LS5 A;  2DJJ A;  4IP6 A;  3GH9 A;  2YV7 A;  4N11 A;  1EOG A;  3DYR A;  3O6T A;  3EMP A;  4XS4 B;  3IE3 A;  1O8W A;  2O89 A;  3HJP A;  4OCF A;  5IQY A;  2H8L A;  3ERF A;  1YQ1 A;  2GSR A;  1M2D A;  4G19 A;  1HNA A;  2HYX A;  5DJM A;  3M3M A;  1LU4 A;  3MNG A;  1PGT A;  4MPG A;  3VPT A;  4V1A g;  5IMD A;  5JWO B;  5A4U A;  2YP6 A;  3US3 A;  5IIZ A;  1T4Z A;  1SKR B;  1F3B A;  2XHF A;  17GS A;  3C73 A;  4MH3 A;  1EV4 A;  2Z9S A;  1SL1 B;  1RQM A;  2IJY A;  3C1R A;  1EP7 A;  2O87 A;  4TR4 A;  2JSZ A;  5ECI B;  6GSS A;  5HR1 A;  3FKF A;  1K0O A;  4HUA A;  2X8G A;  1PSQ A;  1GUK A;  4AJ8 A;  3GTU A;  4MP4 A;  2GQM A;  1G0T A;  1PN9 A;  3KMN A;  4D73 B;  3RBT A;  1O73 A;  2FGX A;  5EY6 A;  5DBQ A;  2VCV A;  12GS A;  3BD2 A;  2EIQ A;  3EYT A;  1O81 A;  3A2V A;  2C80 A;  4O92 A;  3D4T A;  2FLS A;  1F9M A;  3ME7 A;  2E2G A;  1A8Y A;  5CRW A;  2NPB A;  2OBI A;  4AF2 A;  2F8A A;  2DIZ A;  3IPZ A;  2K18 A;  4NAX A;  1OVN A;  4OCE A;  2HZE B;  3EVI A;  2C3N A;  3TOU A;  5CRD A;  4HU9 A;  1TI3 A;  2PPT A;  1I5G A;  5F8B A;  3EU3 A;  4GQC A;  1A24 A;  3M0F A;  2OA7 A;  2C3Q A;  5DAL B;  1GNE A;  4HZ2 A;  4NHW A;  4XCS A;  1MDJ A;  5G30 A;  2L6D A;  3KZQ A;  1Z6M A;  3KD0 A;  2FWH A;  3RHC A;  1M9B A;  4EE0 A;  2FWE A;  1YEP A;  5B6N A;  3F6D A;  5LD0 A;  3GHA A;  4WEY A;  1X5E A;  3IR4 A;  4N10 A;  3EUR A;  2MMN A;  1FAA A;  5JWR B;  4CDO A;  3UVH A;  2JL4 A;  2RLI A;  6GSU A;  1JHB A;  3H79 A;  4Z7X A;  4NV2 A;  1GTU A;  1OC3 A;  1YKC A;  4PUF C;  2LST A;  4PQH A;  3GKM A;  3HZ8 A;  3GIX A;  3IHQ A;  2M46 A;  1J08 A;  2OKA A;  1E2Y A;  4HQS A;  1XWC A;  3GRX A;  1T3B A;  3TUE A;  1OC8 A;  1O7U A;  2B5E A;  2NDO A;  5C04 A;  2ZCT A;  1ZZY A;  2GZP A;  1GSY A;  1RW1 A;  4EXJ A;  5CRH A;  2R5G A;  3ZFB A;  4PQ1 A;  3H4K A;  4YQV A;  1JLV A;  5L71 A;  3RDW A;  5GZZ B;  3DXB A;  3M9J A;  4X1U A;  4PGT A;  4ZBB A;  4MDC A;  3CRT A;  4LMV A;  2LQO A;  4X0X A;  4F2I A;  4MA9 A;  5D8I A;  4YAV A;  5IOW A;  4I6X A;  3A2X A;  1SL2 B;  3D0Z A;  3RPN A;  4F0C A;  1TRW A;  3GX0 A;  5CP1 A;  3P7X A;  1H75 A;  1B4P A;  4PNF A;  3TJF A;  5IPG A;  2OAC A;  3TRQ A;  1XOA A;  1T8E B;  2JZS A;  5GAN D;  1XWG A;  3UL3 A;  4HEA 2;  4GF0 A;  3J7Y b;  3DKS A;  2O8V B;  2VL2 A;  1GUM A;  5J4U A;  5EVO A;  1TRS A; 
#chains in the Genus database with same CATH topology
 5G2Z A;  2R6K A;  1TW9 A;  1PKZ A;  3FYG A;  3APQ A;  3QR6 A;  3HVX A;  5AIV A;  3GL5 A;  3TKS A;  5B6M A;  4POB A;  2VCX A;  1M7T A;  2B7J A;  3L4N A;  3M8N A;  4MZB A;  5IM9 A;  1QQ2 A;  3ZMK A;  1GWC A;  2VCT A;  4EL1 A;  3CYN A;  1O8X A;  2CAI A;  3C71 A;  1F2E A;  1UN2 A;  4V1A p;  5HFI A;  4TOP A;  3S9F A;  3I43 A;  3IV4 A;  3F63 A;  1FOV A;  2HFD A;  2QA1 A;  3F4R A;  1X5D A;  2DML A;  18GS A;  3ZFL A;  3TKP A;  2DMM A;  5D9V A;  2NBS A;  3KTL A;  4JE1 A;  1FOH A;  5CYY A;  2F8F A;  2IL3 A;  2KP1 A;  5AN1 A;  2B7K A;  1ZL9 A;  5ECL B;  1X9S B;  3HKR A;  5LCZ A;  1ZYP A;  5IPH A;  2YJ7 A;  5ECN B;  4KUN A;  1GTI A;  4K2X A;  3UMA A;  1ACV A;  2X64 A;  1BAY A;  3UOM A;  1Z7P A;  2JAD A;  4MJA A;  3TKR A;  5BMU A;  1OKD A;  1M2A A;  3TJG A;  2VOC A;  1FB6 A;  4ZB8 A;  2X4A A;  4HZ4 A;  2H72 A;  1B48 A;  1R4W A;  2FNO A;  4KSM A;  2LRN A;  1X9M B;  4IGJ A;  3NZN A;  3EC3 A;  1EGO A;  3D22 A;  4WXT A;  1GSQ A;  3GYK A;  3ZVJ D;  1AC1 A;  5FHI A;  3GL3 A;  5C00 A;  14GS A;  3LSZ A;  4ML1 A;  5A4W A;  5IO0 A;  2K8V A;  3TOT A;  2VO4 A;  5G5E A;  3A5W A;  4F9Z A;  3ZIJ A;  4EUY A;  2KP2 A;  4WBR D;  2C3T A;  4TVE A;  1C72 A;  3BCK A;  4RI6 A;  2XPE A;  2F9S A;  3E0U A;  4ILF A;  2I3Y A;  4X43 A;  1A23 A;  4IS0 A;  3GKK A;  1EOH A;  3LWA A;  2WUL A;  3VWV A;  3C1S A;  1HNB A;  4QQ7 A;  2JZR A;  3RAZ A;  1CQG A;  4CY8 A;  2WRT A;  2CZ2 A;  1PL1 A;  3QAG A;  2DJ3 A;  3GSS A;  2R37 A;  1R5A A;  3UAP A;  5AGY A;  1WE0 A;  2PU9 C;  5KN3 A;  4HQZ A;  3IDV A;  3CMI A;  1QGV A;  2X8C A;  3QFA C;  2DKI A;  4FH8 A;  2FWF A;  1K0D A;  3VUR A;  3H93 A;  3KEB A;  5A5K A;  2E2M A;  3DVX A;  4Q5N A;  1ZMA A;  2GGT A;  2R2J A;  5E59 A;  4PX1 A;  2L5L A;  4MF6 A;  5G31 A;  5JCG A;  3EU4 A;  2EC4 A;  5JCU A;  2H30 A;  4K5R A;  1WWJ A;  3BJ5 A;  5G5F A;  3TCO A;  3ZLP A;  5ECP B;  5J9B A;  5FWG A;  2RM6 A;  4KE3 A;  1EEM A;  2QSI A;  6GSX A;  2F3M A;  3ZL5 A;  4BVY B;  5GST A;  1OYJ A;  6GSV A;  3C8E A;  2L6C A;  4MAB A;  4D73 A;  3TKS E;  3A2W A;  1EWX A;  2V41 A;  2L59 A;  1TDI A;  1BJX A;  3M9K A;  3I69 A;  4BL7 A;  2YOI A;  3VWU A;  2P31 A;  4DSQ A;  3TKQ A;  4ECB A;  4I97 A;  2O7K A;  3PPU A;  2DC5 A;  2WB9 A;  1OC9 A;  4KW6 A;  2YV9 A;  2G2Q A;  1SKS B;  1PX6 A;  4LL1 B;  4P3Y B;  3FZ4 A;  3FR6 A;  2FA4 A;  5CO3 A;  2L4Q A;  3HY2 A;  1XVW A;  4DSS A;  4PTS A;  2H73 A;  4ML6 A;  10GS A;  5HFK A;  1KBN A;  1Z9H A;  2IWT A;  3ERG A;  4TXO B;  4EDZ A;  1AQW A;  1K3L A;  5D73 A;  2DKH A;  2I1U A;  2CAQ A;  4ULX A;  4PUR A;  3ZML A;  4MJE A;  2QC7 A;  3GV1 A;  3QD9 A;  3WD6 A;  1TRU A;  4ECI A;  2DIY A;  4TR1 B;  1WRY A;  4GTU A;  2VLU A;  3LXT A;  1XZO A;  1SEN A;  1LJR A;  1KEB A;  3ED3 A;  2LQQ A;  3L78 A;  3D6I A;  1GH2 A;  4O32 A;  3HHV A;  4FYC A;  2VM1 A;  3FK8 A;  4KF9 A;  1GTB A;  3UIW A;  5D93 A;  1SK2 A;  3LG6 A;  3M1G A;  4XRA A;  3F0I A;  2WZ9 A;  3LW9 A;  2XC2 A;  3MAK A;  2H6Y A;  2K6V A;  2VD1 A;  2CA8 A;  1A2J A;  3FHK A;  4WR4 A;  5IO2 A;  1XVQ A;  2B5X A;  4E8E A;  4JED A;  2A2S A;  1SYR A;  3HVV A;  3KJY A;  4Z2R A;  2D2Z A;  5DAK A;  1SK1 A;  1M99 A;  3L9S A;  4WBJ A;  1FW1 A;  2CX4 A;  3LEF A;  1MTC A;  2MBT A;  4EIQ A;  4TRX A;  4K7O A;  1S3A A;  4BVX A;  2BTO T;  3TDG A;  2G0F A;  2I9H A;  5HR3 A;  1YEX A;  3CSH A;  2HE3 A;  3P2A A;  1PN0 A;  3TJJ A;  2L57 A;  3G7Y A;  1AUC A;  2JSY A;  5CNW A;  3W8J A;  3PR8 A;  4K6X A;  4CHS A;  4JRR A;  4G2E A;  1NW2 A;  4KCE A;  1Y6E A;  3HZ4 A;  5JWQ B;  5F06 A;  4K7I A;  4POL A;  1S3C A;  3KH7 A;  4TR3 A;  3HVN A;  1ERU A;  4POM A;  1GSS A;  3D5J A;  3HJM A;  1VRS D;  5ELG A;  1A8L A;  3N9J A;  2AAW A;  2C1Y A;  4K2D A;  2XBI A;  4K8M A;  1SYX A;  4ID0 A;  3HYP A;  2ES7 A;  2PGT A;  3LXZ A;  4OWY A;  3VI5 A;  5LNK e;  2GDR A;  4KAE A;  2J23 A;  3IAM 2;  4I8B A;  5KEJ A;  2VLV A;  3ERW A;  2ON5 A;  3HJO A;  3W8S A;  3FMW A;  1TI1 A;  2MZC A;  19GS A;  4MPF A;  1SD8 A;  3CBU A;  2HZF A;  3TRP A;  3HCZ A;  1QMV A;  3IK9 A;  5D96 A;  2GZZ A;  4CW9 A;  5J5N A;  5F0G A;  4OO5 A;  2IME A;  3IRA A;  2C0G A;  3HA9 A;  2LRC A;  2H74 A;  2BJX A;  3R2Q A;  5F05 A;  1XWB A;  2DJK A;  2FWG A;  5IMA A;  3HD5 A;  2TIR A;  4MH2 A;  2EIO A;  3U5R E;  1DUG A;  4FYB A;  2YZH A;  3TJB A;  2C0D A;  5J9C A;  5IMF A;  1ON4 A;  4L0U A;  2QGV A;  3KP9 A;  5ID2 A;  2GLR A;  1U6T A;  1OE8 A;  1GLP A;  4H86 A;  4PUA A;  2VD0 A;  3I9V 2;  4MNN A;  1T1V A;  1PL2 A;  4E8H A;  1BX9 A;  1XFL A;  4JR4 A;  2A4V A;  2OE1 A;  2V2G A;  2M80 A;  2H66 A;  3APO A;  4V2M A;  5ECR B;  1GTA A;  1EEJ A;  1VF3 A;  4LMW A;  1ERT A;  5J41 A;  3CTF A;  4BA7 A;  1UC7 A;  2HI7 A;  1X5C A;  3U6V A;  3N5O A;  4ZIJ A;  2H0I A;  3CRU A;  3H8Q A;  4ZBD A;  3KXO A;  1LBK A;  4GWR A;  4QL7 A;  3C7M A;  4XS1 A;  5D9X A;  4MZW A;  2KOK A;  2F51 A;  1YJ6 A;  4TN8 A;  4HU7 A;  4IVF A;  4ZL8 A;  1WPI A;  3HVS A;  1V98 A;  2HRN A;  2LUS A;  4YQM A;  4AJ6 A;  2H01 A;  2AUV A;  4GCI A;  3ZYW A;  1B4Q A;  1URM A;  2LKU A;  1SU9 A;  1JZR A;  1M9A A;  4I2U A;  4AJ7 A;  3ZIT A;  2IMI A;  4MK3 A;  2HRK A;  2CQ9 A;  4EKZ A;  5G1L A;  1OAZ A;  4ZBA A;  3F9U A;  4J56 E;  2R3X A;  3GMF A;  5ECK B;  2OAD A;  1FVK A;  1V2A A;  2CZ3 A;  4WET A;  1BQ7 A;  3I6A A;  1TTZ A;  4IN0 A;  1VF4 A;  5HR0 A;  4IQA A;  4KSO A;  2IIY A;  2GT5 A;  3KM6 A;  4BVY A;  2NVL A;  5KOX A;  1ZGN A;  3WGD A;  5ECM B;  2C4J A;  3PIN A;  1T4Y A;  1GSF A;  4IJ3 A;  2GQL A;  13GS A;  2H19 A;  4KDY A;  3L9V A;  1WIK A;  2XPD A;  3G9B A;  4EDY A;  3P90 A;  3KIJ A;  4K1F A;  1U3I A;  5IMV A;  2PMT A;  3QMX A;  1TK8 B;  2CVK A;  1Z6N A;  1IYI A;  3F3R A;  2RUF A;  1WMJ A;  1VGL A;  2JU5 A;  4MJC A;  2WGR A;  2FA8 A;  3GST A;  1HNC A;  2DJ2 A;  2H1A A;  4PXO A;  3SBC A;  4IKH A;  4AGS A;  3Q74 A;  4BWQ A;  1X0R A;  4NXI A;  2H0G A;  3L0H A;  2PUK C;  3A3T A;  3DIE A;  2H76 A;  1GNW A;  1YZX A;  4TXO A;  1Z3E A;  4N0Z A;  4EIP A;  2L4C A;  1PRX A;  1A2L A;  3CSI A;  4K9Z A;  4ACS A;  1V9W A;  1R5P A;  1XXU A;  1GL8 A;  3GNJ A;  3ZTL A;  2TRX A;  1MD4 A;  1THO A;  3IBH A;  4NPB A;  3WT2 A;  5IOX A;  1UA5 A;  3F8U A;  5GAP D;  1Z5Y E;  4DEJ A;  4WR5 A;  2VAF A;  2B3S A;  4TR1 A;  3DML A;  4XS4 A;  4KA0 A;  7GSS A;  1K0N A;  3QAW A;  4IHU A;  2YZU A;  1J0F A;  4TKY A;  3H1N A;  2LEG A;  1A0R P;  4V2L A;  2GTU A;  2YWM A;  1ST9 A;  2HSM A;  4CY6 A;  1BYE A;  4DSR A;  1G6W A;  1F6M C;  2A2P A;  2GQK A;  4KCA A;  5D9T A;  2E7P A;  5IMC A;  2TRC P;  4ECJ A;  1F3A A;  2DSA A;  3GKX A;  5B8A A;  2GZY A;  5INY A;  4F03 A;  1MDK A;  2V6K A;  1SD9 A;  2GSS A;  1AIU A;  3GUR A;  2IN3 A;  2CVB A;  1KNG A;  4WKW A;  3BBY A;  2GVP A;  4JZQ A;  3GN3 A;  2OJL A;  1GSU A;  2PBJ A;  4L5O A;  2MMZ A;  4YH2 A;  3IK7 A;  2VL2 C;  1X9W B;  1O6J A;  4YQU A;  1YF0 A;  4XHM A;  3FZ9 A;  4EF0 A;  1NHO A;  3QPM A;  1TK0 B;  1XW6 A;  5J3R A;  5DVB A;  3W6G A;  3DGQ A;  4K0G A;  1GUH A;  3MYD A;  4G0I A;  5KN2 A;  3TKS C;  2IFQ B;  1VF1 A;  3HXS A;  4MMM A;  2C0F A;  2N5B A;  3DD3 A;  3FR9 A;  1IYH A;  1XWA A;  3LFL A;  4ECC A;  22GS A;  4XRD A;  1K3Y A;  1TOF A;  2JZT A;  3F6F A;  2AJQ B;  4HDE A;  2H6X A;  3IA1 A;  3WGE A;  3TJK A;  1PFO A;  1NSW A;  4GXZ A;  1ERV A;  2IMF A;  5FT3 A;  3JCM L;  3UJ1 A;  2B1K A;  2HZE A;  2V1M A;  2I81 A;  4PQI A;  4OFM A;  4PNG A;  3DVW A;  4NV5 A;  2H1B A;  3UAR A;  1XG8 A;  1T00 A;  1YKA A;  2DLX A;  3KGK A;  5DAL A;  3MWH A;  5ECH B;  2HLS A;  3VFI A;  4IEL A;  1XBS A;  2YWN A;  1ZYQ B;  1G7O A;  1FVJ A;  1W89 A;  3R3E A;  2X99 A;  2VM2 A;  1S3D A;  3K8N A;  3FRC A;  3E9J B;  2LRT A;  2WJU A;  4QL9 A;  1JFU A;  2KUC A;  4NWY A;  4RI7 A;  5H5Q A;  1XW9 A;  5HQP A;  4Z2U A;  4LL4 B;  2V32 A;  2YWI A;  4ZB6 A;  4FIW A;  2N5F A;  1GSE A;  2X8H A;  5H5R A;  3UVT A;  2YJH A;  2WDU A;  1ZCP A;  4ZL9 A;  1YY7 A;  3LGC A;  5EL8 A;  4EC0 A;  4L5L A;  3EMX A;  1NHY A;  1NM3 A;  2P5R A;  5IMZ A;  5JCW A;  4OMV A;  4KDU A;  4HI7 A;  3P8W A;  1WOU A;  1B9Y C;  1EZK A;  4HS1 A;  5B7C A;  2A4H A;  1YF1 A;  2J9H A;  3VI7 A;  2YPM A;  3Q18 A;  1PKW A;  3GA4 A;  4K0N A;  2LNT A;  3KP8 A;  4HJ2 A;  1B8X A;  1HYU A;  4Q5R A;  1Y25 A;  3F4T A;  1AQV A;  1AQX A;  5D9W A;  1U88 A;  1G6Y A;  6GSY A;  3APS A;  4TR0 A;  3CSJ A;  1V57 A;  4KGI A;  1S3R A;  4MF5 A;  1R26 A;  1FB0 A;  1USB A;  2JAC A;  2MMO A;  2R0P A;  1JLW A;  4IBP A;  1W4V A;  4Q5F A;  3KCM A;  2FHE A;  1MD3 A;  1OC9 B;  2AYT A;  2N5A A;  5B8B A;  5HFG A;  4NHZ A;  2XBQ A;  1TU7 A;  3CXG A;  2H1D A;  1I9D A;  4DSS B;  4I2T A;  2LJK A;  1XWK A;  3WGX A;  4RQR A;  1OKT A;  2L5O A;  1JZD A;  1Q4J A;  2HRA A;  2AB6 A;  2P0G A;  5G1K A;  2YWO A;  2HSH A;  1SJ6 A;  3FZA A;  3NOF A;  2H71 A;  4MJB A;  3DRN A;  2AV4 A;  4EVM A;  3IOS A;  4ZB9 A;  2LNS A;  1M2B A;  4XIH A;  2QKE A;  1V58 A;  3ZIV A;  2NTO A;  2GT6 A;  2CT6 A;  5HR2 A;  4LA1 A;  2PWJ A;  1TKD B;  3FY7 A;  1QFN A;  3GUS A;  3PGT A;  2MMA A;  2VCZ A;  3LYK A;  2B6M A;  4HJM A;  2IPA A;  4Q5Q A;  2VCQ A;  2VUP A;  2E0Q A;  2K9F A;  11GS A;  2WCI A;  3WT1 A;  1TK5 B;  1WJK A;  1U3A A;  1PA3 A;  2R0C A;  4ZL7 A;  3IC4 A;  1V40 A;  1THX A;  2GSQ A;  1QK8 A;  2PVQ A;  2H75 A;  1HD2 A;  1XCC A;  4USS A;  1H4O A;  3QAV A;  3PH9 A;  3MIX A;  3EWL A;  2YAN A;  1TU8 A;  2BMX A;  3QOU A;  4FO5 A;  5KN1 A;  2GST A;  2RUE A;  3FW2 A;  1A2M A;  1DE1 A;  5ECO B;  2A2R A;  4BIK A;  5CRE A;  5DAK B;  2PVO C;  1YDK A;  1PMT A;  3GTU B;  3D4M A;  1RK4 A;  2HXK A;  1MDI A;  4XS6 A;  3FR3 A;  4KDX A;  4ICY A;  4G10 A;  3ZRE A;  4KX4 A;  4BVX B;  4GSN A;  2C0E A;  5ELA A;  2LV3 A;  4WF5 A;  2KHP A;  3BOA A;  1BG5 A;  2DJ1 A;  5AIX A;  1K0A A;  4K5S A;  4K7N A;  3VWW A;  1TXX A;  4L0W A;  4KH7 A;  4F82 A;  3Q6O A;  2REM A;  2DJ0 A;  3VPQ A;  2H1G A;  1ZYE A;  1DSB A;  4NMU A;  3IC8 A;  2K8S A;  3LOR A;  3HDC A;  3LJR A;  1XPV A;  1QXH A;  4J2F A;  4N30 A;  3QFB C;  1PD2 1;  2YN1 A;  4OD7 A;  1GRX A;  4ZXG A;  1ABA A;  3Q19 A;  5DDL A;  2YNX A;  1HQO A;  4GSS A;  3TB2 A;  1O85 A;  3WYW A;  5A4V A;  1TP9 A;  2OBK A;  4RQX A;  2IMK A;  4G9H A;  2OE3 A;  4MLY A;  2OE0 A;  3VWX A;  2HT9 A;  1XIY A;  3F3Q A;  5F07 A;  2CV4 A;  4LLR A;  4G0L A;  3OR5 A;  1N2A A;  3KMO A;  3ISO A;  1M0U A;  3IAS 2;  3G7J A;  2ON7 A;  5ABR A;  1N8J A;  5KN0 A;  3LYP A;  1CQH A;  1GLQ A;  1K0C A;  1ML6 A;  3QDN A;  4IQ1 A;  1EGR A;  2IFQ A;  3GFK A;  4J57 E;  2M72 A;  2R0G A;  4MZC A;  1TJD A;  5DCG A;  5AIS A;  2LJR A;  2IMD A;  1OE7 A;  2V6O A;  1QUW A;  1R7H A;  4BWS A;  3G7I A;  4IP1 A;  3QCP A;  3UBL A;  2R4V A;  1JZW A;  3D21 A;  1F37 A;  1PQN A;  3ZVJ A;  3RPP A;  2EIR A;  4N0V A;  2AHE A;  20GS A;  5EPF A;  5CAX A;  3DWV A;  1GSD A;  5H5S A;  3L9U A;  1Z7R A;  2B5Y A;  1GP1 A;  2WFC A;  3MDK A;  1G7E A;  5ID2 B;  3O3T A;  4MF7 A;  3ZZX A;  3AY8 A;  1MEK A;  1U87 A;  6GST A;  5KOW A;  2LJA A;  4TW5 A;  4XTS A;  1Q98 A;  3ZRD A;  4WF4 A;  3UEM A;  1EP8 A;  2I4A A;  1B9X C;  1ZOF A;  3KH9 A;  2HNL A;  5BRT A;  1ILO A;  1ERW A;  2ALB A;  2VL3 A;  2ZNM A;  3GX8 A;  2C8U A;  3EPT A;  2GS3 A;  5DQS A;  2RM5 A;  4IW9 A;  2HRF A;  1DE2 A;  4GRF A;  2VLT A;  2HSY A;  3FEU A;  4O7H A;  1VF2 A;  3FZ5 A;  1PX7 A;  3LQ7 A;  3IXR A;  2CVD A;  3J7Y k;  5DJL A;  3E3E A;  2H70 A;  2RII A;  2QA2 A;  3A5I A;  1E6B A;  4JBB A;  1TRV A;  1FHE A;  3BCI A;  1GUL A;  4OFN A;  4GQF A;  16GS A;  4HSC X;  2VIM A;  3KTB A;  5ECS A;  4L8E A;  4GST A;  3NIV A;  2MYG A;  1K0M A;  3O76 A;  3MSZ A;  5DQY A;  4TXV A;  4EO3 A;  2PER A;  1SKW B;  4V2N A;  5ENU A;  3UBK A;  2X49 A;  4I5Q A;  4KB3 A;  4ZIL A;  2LTK A;  5CRG A;  3GKN A;  4RUV A;  3TRX A;  1AAZ A;  5ECQ B;  1XW5 A;  4F0B A;  1FO5 A;  2PN8 A;  2VCW A;  4FYU A;  1DBY A;  1BED A;  3RHB A;  2H6Z A;  5COH A;  3V1W A;  2KLX A;  1ZYN A;  2WS2 A;  3F4S A;  4POK A;  4DVC A;  1WP0 A;  4O5R A;  4O5U A;  3CTG A;  1SJI A;  5E4W A;  4KND A;  4OO4 A;  1J9B A;  5GSS A;  4MCU A;  4HOJ A;  4GLT A;  2DBC A;  4ISD A;  3GH6 A;  3TGZ A;  2B1L A;  2P5Q A;  4X4J A;  3SWL A;  2FCH A;  2FD3 A;  3VLN A;  6GSW A;  1A0F A;  4BPY A;  1K3O A;  2VL9 A;  3ME8 A;  2CX3 A;  1AXD A;  9GSS A;  2O85 A;  1KTE A;  2FUG 2;  4JR6 A;  1UVZ A;  1FG4 A;  4IJI A;  3EE2 A;  4A5P A;  2MBS A;  1SL0 B;  2ZUP A;  1SK0 A;  1K0B A;  4JU5 A;  1XOB A;  2FY6 A;  3DEX A;  8GSS A;  1EV9 A;  1AW9 A;  5DCH A;  1JZO A;  2YCD A;  1T7P B;  1SJZ A;  4OFT A;  4YAP A;  3VK9 A;  3EIN A;  2H0H A;  2LS5 A;  2DJJ A;  4IP6 A;  3GH9 A;  2YV7 A;  4N11 A;  1EOG A;  3DYR A;  3O6T A;  3EMP A;  4XS4 B;  3IE3 A;  1O8W A;  4O5Q A;  2O89 A;  3HJP A;  4OCF A;  5IQY A;  2H8L A;  3ERF A;  1YQ1 A;  2GSR A;  1M2D A;  4G19 A;  1HNA A;  2HYX A;  5DJM A;  3M3M A;  1LU4 A;  3MNG A;  1PGT A;  4MPG A;  3VPT A;  4V1A g;  5IMD A;  5JWO B;  5A4U A;  2YP6 A;  3US3 A;  5IIZ A;  1T4Z A;  1SKR B;  1F3B A;  2XHF A;  17GS A;  3C73 A;  4MH3 A;  1EV4 A;  2Z9S A;  1SL1 B;  1RQM A;  2IJY A;  3C1R A;  4FQU A;  4YKF A;  1EP7 A;  2O87 A;  4TR4 A;  2JSZ A;  5ECI B;  6GSS A;  5HR1 A;  3FKF A;  1K0O A;  4HUA A;  2X8G A;  1PSQ A;  1M3J A;  1GUK A;  4AJ8 A;  3GTU A;  4MP4 A;  2GQM A;  1G0T A;  1PN9 A;  3KMN A;  4D73 B;  3RBT A;  1O73 A;  2FGX A;  5EY6 A;  5DBQ A;  2VCV A;  12GS A;  3BD2 A;  2EIQ A;  3EYT A;  1O81 A;  3A2V A;  2C80 A;  4O92 A;  4BL7 B;  3D4T A;  2FLS A;  1F9M A;  3ME7 A;  2E2G A;  1A8Y A;  5CRW A;  2NPB A;  2OBI A;  4AF2 A;  2F8A A;  2DIZ A;  3IPZ A;  2K18 A;  4NAX A;  1OVN A;  4OCE A;  2HZE B;  3EVI A;  2C3N A;  3TOU A;  5CRD A;  4HU9 A;  1TI3 A;  2PPT A;  1I5G A;  5F8B A;  3EU3 A;  4GQC A;  1A24 A;  3M0F A;  3CQF A;  2OA7 A;  2C3Q A;  5DAL B;  4Z2T A;  1GNE A;  4HZ2 A;  4NHW A;  4XCS A;  1MDJ A;  5G30 A;  2L6D A;  3KZQ A;  1Z6M A;  3KD0 A;  2FWH A;  3RHC A;  1M9B A;  4EE0 A;  2FWE A;  1YEP A;  5B6N A;  3F6D A;  5LD0 A;  4WEY A;  3GHA A;  4G0K A;  1X5E A;  3IR4 A;  4N10 A;  3EUR A;  2MMN A;  1FAA A;  5JWR B;  4CDO A;  3UVH A;  2JL4 A;  2RLI A;  6GSU A;  1JHB A;  3H79 A;  4Z7X A;  4NV2 A;  1GTU A;  1OC3 A;  1YKC A;  4PUF C;  2LST A;  4PQH A;  3GKM A;  3HZ8 A;  3GIX A;  3IHQ A;  2M46 A;  1J08 A;  2OKA A;  1E2Y A;  4HQS A;  1XWC A;  3GRX A;  1T3B A;  2UZ8 A;  3TUE A;  1OC8 A;  1O7U A;  2B5E A;  2NDO A;  5C04 A;  2ZCT A;  1ZZY A;  2GZP A;  1GSY A;  1RW1 A;  4EXJ A;  5CRH A;  2R5G A;  3ZFB A;  4PQ1 A;  3H4K A;  4YQV A;  1JLV A;  5L71 A;  3RDW A;  5GZZ B;  3DXB A;  3M9J A;  4X1U A;  4PGT A;  4ZBB A;  4MDC A;  3CRT A;  4LMV A;  2LQO A;  4X0X A;  4F2I A;  4MA9 A;  5D8I A;  4YAV A;  5IOW A;  4I6X A;  3A2X A;  1SL2 B;  3D0Z A;  3RPN A;  1M3I A;  4F0C A;  1TRW A;  3GX0 A;  5CP1 A;  3P7X A;  1H75 A;  1B4P A;  4PNF A;  3TJF A;  5IPG A;  2OAC A;  3TRQ A;  1XOA A;  1T8E B;  2JZS A;  5GAN D;  1XWG A;  4YKG A;  3UL3 A;  4HEA 2;  3IHG A;  4GF0 A;  3J7Y b;  3DKS A;  2O8V B;  2VL2 A;  1GUM A;  5J4U A;  5EVO A;  1TRS A; 
#chains in the Genus database with same CATH homology
 5G2Z A;  2R6K A;  1TW9 A;  1PKZ A;  3FYG A;  3APQ A;  3QR6 A;  3HVX A;  5AIV A;  3GL5 A;  3TKS A;  5B6M A;  4POB A;  2VCX A;  1M7T A;  2B7J A;  3L4N A;  3M8N A;  4MZB A;  5IM9 A;  1QQ2 A;  3ZMK A;  1GWC A;  2VCT A;  4EL1 A;  3CYN A;  1O8X A;  2CAI A;  3C71 A;  1F2E A;  1UN2 A;  4V1A p;  5HFI A;  4TOP A;  3S9F A;  3I43 A;  3IV4 A;  3F63 A;  1FOV A;  2HFD A;  2QA1 A;  3F4R A;  1X5D A;  2DML A;  18GS A;  3ZFL A;  3TKP A;  2DMM A;  5D9V A;  2NBS A;  3KTL A;  4JE1 A;  1FOH A;  5CYY A;  2F8F A;  2IL3 A;  2KP1 A;  5AN1 A;  2B7K A;  1ZL9 A;  5ECL B;  1X9S B;  3HKR A;  5LCZ A;  1ZYP A;  5IPH A;  2YJ7 A;  5ECN B;  4KUN A;  1GTI A;  4K2X A;  3UMA A;  1ACV A;  2X64 A;  1BAY A;  3UOM A;  1Z7P A;  2JAD A;  4MJA A;  3TKR A;  5BMU A;  1OKD A;  1M2A A;  3TJG A;  2VOC A;  1FB6 A;  4ZB8 A;  2X4A A;  4HZ4 A;  2H72 A;  1B48 A;  1R4W A;  2FNO A;  4KSM A;  2LRN A;  1X9M B;  4IGJ A;  3NZN A;  3EC3 A;  1EGO A;  3D22 A;  4WXT A;  1GSQ A;  3GYK A;  3ZVJ D;  1AC1 A;  5FHI A;  3GL3 A;  5C00 A;  14GS A;  3LSZ A;  4ML1 A;  5A4W A;  5IO0 A;  2K8V A;  3TOT A;  2VO4 A;  5G5E A;  3A5W A;  4F9Z A;  3ZIJ A;  4EUY A;  2KP2 A;  4WBR D;  2C3T A;  4TVE A;  1C72 A;  3BCK A;  4RI6 A;  2XPE A;  2F9S A;  3E0U A;  4ILF A;  2I3Y A;  4X43 A;  1A23 A;  4IS0 A;  3GKK A;  1EOH A;  3LWA A;  2WUL A;  3VWV A;  3C1S A;  1HNB A;  4QQ7 A;  2JZR A;  3RAZ A;  1CQG A;  4CY8 A;  2WRT A;  2CZ2 A;  1PL1 A;  3QAG A;  2DJ3 A;  3GSS A;  2R37 A;  1R5A A;  3UAP A;  5AGY A;  1WE0 A;  2PU9 C;  5KN3 A;  4HQZ A;  3IDV A;  3CMI A;  1QGV A;  2X8C A;  3QFA C;  2DKI A;  4FH8 A;  2FWF A;  1K0D A;  3VUR A;  3H93 A;  3KEB A;  5A5K A;  2E2M A;  3DVX A;  4Q5N A;  1ZMA A;  2GGT A;  2R2J A;  5E59 A;  4PX1 A;  2L5L A;  4MF6 A;  5G31 A;  5JCG A;  3EU4 A;  2EC4 A;  5JCU A;  2H30 A;  4K5R A;  1WWJ A;  3BJ5 A;  5G5F A;  3TCO A;  3ZLP A;  5ECP B;  5J9B A;  5FWG A;  2RM6 A;  4KE3 A;  1EEM A;  2QSI A;  6GSX A;  2F3M A;  3ZL5 A;  4BVY B;  5GST A;  1OYJ A;  6GSV A;  3C8E A;  2L6C A;  4MAB A;  4D73 A;  3TKS E;  3A2W A;  1EWX A;  2V41 A;  2L59 A;  1TDI A;  1BJX A;  3M9K A;  3I69 A;  4BL7 A;  2YOI A;  3VWU A;  2P31 A;  4DSQ A;  3TKQ A;  4ECB A;  4I97 A;  2O7K A;  3PPU A;  2DC5 A;  2WB9 A;  1OC9 A;  4KW6 A;  2YV9 A;  2G2Q A;  1SKS B;  1PX6 A;  4LL1 B;  4P3Y B;  3FZ4 A;  3FR6 A;  2FA4 A;  5CO3 A;  2L4Q A;  3HY2 A;  1XVW A;  4DSS A;  4PTS A;  2H73 A;  4ML6 A;  10GS A;  5HFK A;  1KBN A;  1Z9H A;  2IWT A;  3ERG A;  4TXO B;  4EDZ A;  1AQW A;  1K3L A;  5D73 A;  2DKH A;  2I1U A;  2CAQ A;  4ULX A;  4PUR A;  3ZML A;  4MJE A;  2QC7 A;  3GV1 A;  3QD9 A;  3WD6 A;  1TRU A;  4ECI A;  2DIY A;  4TR1 B;  1WRY A;  4GTU A;  2VLU A;  3LXT A;  1XZO A;  1SEN A;  1LJR A;  1KEB A;  3ED3 A;  2LQQ A;  3L78 A;  3D6I A;  1GH2 A;  4O32 A;  3HHV A;  4FYC A;  2VM1 A;  3FK8 A;  4KF9 A;  1GTB A;  3UIW A;  5D93 A;  1SK2 A;  3LG6 A;  3M1G A;  4XRA A;  3F0I A;  2WZ9 A;  3LW9 A;  2XC2 A;  3MAK A;  2H6Y A;  2K6V A;  2VD1 A;  2CA8 A;  1A2J A;  3FHK A;  4WR4 A;  5IO2 A;  1XVQ A;  2B5X A;  4E8E A;  4JED A;  2A2S A;  1SYR A;  3HVV A;  3KJY A;  4Z2R A;  2D2Z A;  5DAK A;  1SK1 A;  1M99 A;  3L9S A;  4WBJ A;  1FW1 A;  2CX4 A;  3LEF A;  1MTC A;  2MBT A;  4EIQ A;  4TRX A;  4K7O A;  1S3A A;  4BVX A;  2BTO T;  3TDG A;  2G0F A;  2I9H A;  5HR3 A;  1YEX A;  3CSH A;  2HE3 A;  3P2A A;  1PN0 A;  3TJJ A;  2L57 A;  3G7Y A;  1AUC A;  2JSY A;  5CNW A;  3W8J A;  3PR8 A;  4K6X A;  4CHS A;  4JRR A;  4G2E A;  1NW2 A;  4KCE A;  1Y6E A;  3HZ4 A;  5JWQ B;  5F06 A;  4K7I A;  4POL A;  1S3C A;  3KH7 A;  4TR3 A;  1ERU A;  4POM A;  1GSS A;  3D5J A;  3HJM A;  1VRS D;  5ELG A;  1A8L A;  3N9J A;  2AAW A;  2C1Y A;  4K2D A;  2XBI A;  4K8M A;  1SYX A;  4ID0 A;  3HYP A;  2ES7 A;  2PGT A;  3LXZ A;  4OWY A;  3VI5 A;  5LNK e;  2GDR A;  4KAE A;  2J23 A;  3IAM 2;  4I8B A;  5KEJ A;  2VLV A;  3ERW A;  2ON5 A;  3HJO A;  3W8S A;  3FMW A;  1TI1 A;  2MZC A;  19GS A;  4MPF A;  1SD8 A;  3CBU A;  2HZF A;  3TRP A;  3HCZ A;  1QMV A;  3IK9 A;  5D96 A;  2GZZ A;  4CW9 A;  5J5N A;  5F0G A;  4OO5 A;  2IME A;  3IRA A;  2C0G A;  3HA9 A;  2LRC A;  2H74 A;  2BJX A;  3R2Q A;  5F05 A;  1XWB A;  2DJK A;  2FWG A;  5IMA A;  3HD5 A;  2TIR A;  4MH2 A;  2EIO A;  3U5R E;  1DUG A;  4FYB A;  2YZH A;  3TJB A;  2C0D A;  5J9C A;  5IMF A;  1ON4 A;  4L0U A;  2QGV A;  3KP9 A;  5ID2 A;  2GLR A;  1U6T A;  1OE8 A;  1GLP A;  4H86 A;  4PUA A;  2VD0 A;  3I9V 2;  4MNN A;  1T1V A;  1PL2 A;  4E8H A;  1BX9 A;  1XFL A;  4JR4 A;  2A4V A;  2OE1 A;  2V2G A;  2M80 A;  2H66 A;  3APO A;  4V2M A;  5ECR B;  1GTA A;  1EEJ A;  1VF3 A;  4LMW A;  1ERT A;  5J41 A;  3CTF A;  4BA7 A;  1UC7 A;  2HI7 A;  1X5C A;  3U6V A;  3N5O A;  4ZIJ A;  2H0I A;  3CRU A;  3H8Q A;  4ZBD A;  3KXO A;  1LBK A;  4GWR A;  4QL7 A;  3C7M A;  4XS1 A;  5D9X A;  4MZW A;  2KOK A;  2F51 A;  1YJ6 A;  4TN8 A;  4HU7 A;  4IVF A;  4ZL8 A;  1WPI A;  3HVS A;  1V98 A;  2HRN A;  2LUS A;  4YQM A;  4AJ6 A;  2H01 A;  2AUV A;  4GCI A;  3ZYW A;  1B4Q A;  1URM A;  2LKU A;  1SU9 A;  1JZR A;  1M9A A;  4I2U A;  4AJ7 A;  3ZIT A;  2IMI A;  4MK3 A;  2HRK A;  2CQ9 A;  4EKZ A;  5G1L A;  1OAZ A;  4ZBA A;  3F9U A;  4J56 E;  2R3X A;  3GMF A;  5ECK B;  2OAD A;  1FVK A;  1V2A A;  2CZ3 A;  4WET A;  1BQ7 A;  3I6A A;  1TTZ A;  4IN0 A;  1VF4 A;  5HR0 A;  4IQA A;  4KSO A;  2IIY A;  2GT5 A;  3KM6 A;  4BVY A;  2NVL A;  5KOX A;  1ZGN A;  3WGD A;  5ECM B;  2C4J A;  3PIN A;  1T4Y A;  1GSF A;  4IJ3 A;  2GQL A;  13GS A;  2H19 A;  4KDY A;  3L9V A;  1WIK A;  2XPD A;  3G9B A;  4EDY A;  3P90 A;  3KIJ A;  4K1F A;  1U3I A;  5IMV A;  2PMT A;  3QMX A;  1TK8 B;  2CVK A;  1Z6N A;  1IYI A;  3F3R A;  2RUF A;  1WMJ A;  1VGL A;  2JU5 A;  4MJC A;  2WGR A;  2FA8 A;  3GST A;  1HNC A;  2DJ2 A;  2H1A A;  4PXO A;  3SBC A;  4IKH A;  4AGS A;  3Q74 A;  4BWQ A;  1X0R A;  4NXI A;  2H0G A;  3L0H A;  2PUK C;  3A3T A;  3DIE A;  2H76 A;  1GNW A;  1YZX A;  4TXO A;  1Z3E A;  4N0Z A;  4EIP A;  2L4C A;  1PRX A;  1A2L A;  3CSI A;  4K9Z A;  4ACS A;  1V9W A;  1R5P A;  1XXU A;  1GL8 A;  3GNJ A;  3ZTL A;  2TRX A;  1MD4 A;  1THO A;  3IBH A;  4NPB A;  3WT2 A;  5IOX A;  1UA5 A;  3F8U A;  5GAP D;  1Z5Y E;  4DEJ A;  4WR5 A;  2VAF A;  2B3S A;  4TR1 A;  3DML A;  4XS4 A;  4KA0 A;  7GSS A;  1K0N A;  3QAW A;  4IHU A;  2YZU A;  1J0F A;  4TKY A;  3H1N A;  2LEG A;  1A0R P;  4V2L A;  2GTU A;  2YWM A;  1ST9 A;  2HSM A;  4CY6 A;  1BYE A;  4DSR A;  1G6W A;  1F6M C;  2A2P A;  2GQK A;  4KCA A;  5D9T A;  2E7P A;  5IMC A;  2TRC P;  4ECJ A;  1F3A A;  2DSA A;  3GKX A;  5B8A A;  2GZY A;  5INY A;  4F03 A;  1MDK A;  2V6K A;  1SD9 A;  2GSS A;  1AIU A;  3GUR A;  2IN3 A;  2CVB A;  1KNG A;  4WKW A;  3BBY A;  2GVP A;  4JZQ A;  3GN3 A;  2OJL A;  1GSU A;  2PBJ A;  4L5O A;  2MMZ A;  4YH2 A;  3IK7 A;  2VL2 C;  1X9W B;  1O6J A;  4YQU A;  1YF0 A;  4XHM A;  3FZ9 A;  4EF0 A;  1NHO A;  3QPM A;  1TK0 B;  1XW6 A;  5J3R A;  5DVB A;  3W6G A;  3DGQ A;  4K0G A;  1GUH A;  3MYD A;  4G0I A;  5KN2 A;  3TKS C;  2IFQ B;  1VF1 A;  3HXS A;  4MMM A;  2C0F A;  2N5B A;  3DD3 A;  3FR9 A;  1IYH A;  1XWA A;  3LFL A;  4ECC A;  22GS A;  4XRD A;  1K3Y A;  1TOF A;  2JZT A;  3F6F A;  2AJQ B;  4HDE A;  2H6X A;  3IA1 A;  3WGE A;  3TJK A;  1NSW A;  4GXZ A;  1ERV A;  2IMF A;  5FT3 A;  3JCM L;  3UJ1 A;  2B1K A;  2HZE A;  2V1M A;  2I81 A;  4PQI A;  4OFM A;  4PNG A;  3DVW A;  4NV5 A;  2H1B A;  3UAR A;  1T00 A;  1YKA A;  2DLX A;  3KGK A;  5DAL A;  3MWH A;  5ECH B;  2HLS A;  3VFI A;  4IEL A;  1XBS A;  2YWN A;  1ZYQ B;  1G7O A;  1FVJ A;  1W89 A;  3R3E A;  2X99 A;  2VM2 A;  1S3D A;  3K8N A;  3FRC A;  3E9J B;  2LRT A;  2WJU A;  4QL9 A;  1JFU A;  2KUC A;  4NWY A;  4RI7 A;  5H5Q A;  1XW9 A;  5HQP A;  4Z2U A;  4LL4 B;  2V32 A;  2YWI A;  4ZB6 A;  4FIW A;  2N5F A;  1GSE A;  2X8H A;  5H5R A;  3UVT A;  2YJH A;  2WDU A;  1ZCP A;  4ZL9 A;  1YY7 A;  3LGC A;  5EL8 A;  4EC0 A;  4L5L A;  3EMX A;  1NHY A;  1NM3 A;  2P5R A;  5IMZ A;  5JCW A;  4OMV A;  4KDU A;  4HI7 A;  3P8W A;  1WOU A;  1B9Y C;  1EZK A;  4HS1 A;  5B7C A;  2A4H A;  1YF1 A;  2J9H A;  3VI7 A;  2YPM A;  3Q18 A;  1PKW A;  3GA4 A;  4K0N A;  2LNT A;  3KP8 A;  4HJ2 A;  1B8X A;  1HYU A;  4Q5R A;  1Y25 A;  3F4T A;  1AQV A;  1AQX A;  5D9W A;  1U88 A;  1G6Y A;  6GSY A;  3APS A;  4TR0 A;  3CSJ A;  1V57 A;  4KGI A;  4MF5 A;  1R26 A;  1FB0 A;  1USB A;  2JAC A;  2MMO A;  2R0P A;  1JLW A;  4IBP A;  1W4V A;  4Q5F A;  3KCM A;  2FHE A;  1MD3 A;  1OC9 B;  2AYT A;  2N5A A;  5B8B A;  5HFG A;  4NHZ A;  2XBQ A;  1TU7 A;  3CXG A;  2H1D A;  1I9D A;  4DSS B;  4I2T A;  2LJK A;  1XWK A;  3WGX A;  4RQR A;  1OKT A;  2L5O A;  1JZD A;  1Q4J A;  2HRA A;  2AB6 A;  2P0G A;  5G1K A;  2YWO A;  2HSH A;  1SJ6 A;  3FZA A;  3NOF A;  2H71 A;  4MJB A;  3DRN A;  2AV4 A;  4EVM A;  3IOS A;  4ZB9 A;  2LNS A;  1M2B A;  4XIH A;  2QKE A;  1V58 A;  3ZIV A;  2NTO A;  2GT6 A;  2CT6 A;  5HR2 A;  4LA1 A;  2PWJ A;  1TKD B;  3FY7 A;  1QFN A;  3GUS A;  3PGT A;  2MMA A;  2VCZ A;  3LYK A;  2B6M A;  4HJM A;  2IPA A;  4Q5Q A;  2VCQ A;  2VUP A;  2E0Q A;  2K9F A;  11GS A;  2WCI A;  3WT1 A;  1TK5 B;  1WJK A;  1U3A A;  1PA3 A;  2R0C A;  4ZL7 A;  3IC4 A;  1V40 A;  1THX A;  2GSQ A;  1QK8 A;  2PVQ A;  2H75 A;  1HD2 A;  1XCC A;  4USS A;  1H4O A;  3QAV A;  3PH9 A;  3MIX A;  3EWL A;  2YAN A;  1TU8 A;  2BMX A;  3QOU A;  4FO5 A;  5KN1 A;  2GST A;  2RUE A;  3FW2 A;  1A2M A;  1DE1 A;  5ECO B;  2A2R A;  5CRE A;  5DAK B;  2PVO C;  1YDK A;  1PMT A;  3GTU B;  3D4M A;  1RK4 A;  2HXK A;  1MDI A;  4XS6 A;  3FR3 A;  4KDX A;  4ICY A;  4G10 A;  3ZRE A;  4KX4 A;  4BVX B;  4GSN A;  2C0E A;  5ELA A;  2LV3 A;  4WF5 A;  2KHP A;  3BOA A;  1BG5 A;  2DJ1 A;  5AIX A;  1K0A A;  4K5S A;  4K7N A;  3VWW A;  1TXX A;  4L0W A;  4KH7 A;  4F82 A;  3Q6O A;  2REM A;  2DJ0 A;  3VPQ A;  2H1G A;  1ZYE A;  1DSB A;  4NMU A;  3IC8 A;  2K8S A;  3LOR A;  3HDC A;  3LJR A;  1XPV A;  1QXH A;  4J2F A;  4N30 A;  3QFB C;  1PD2 1;  2YN1 A;  4OD7 A;  1GRX A;  4ZXG A;  1ABA A;  3Q19 A;  5DDL A;  2YNX A;  1HQO A;  4GSS A;  3TB2 A;  1O85 A;  3WYW A;  5A4V A;  1TP9 A;  2OBK A;  4RQX A;  2IMK A;  4G9H A;  2OE3 A;  4MLY A;  2OE0 A;  3VWX A;  2HT9 A;  1XIY A;  3F3Q A;  5F07 A;  2CV4 A;  4LLR A;  4G0L A;  3OR5 A;  1N2A A;  3KMO A;  3ISO A;  1M0U A;  3IAS 2;  3G7J A;  2ON7 A;  5ABR A;  1N8J A;  5KN0 A;  3LYP A;  1CQH A;  1GLQ A;  1K0C A;  1ML6 A;  3QDN A;  4IQ1 A;  1EGR A;  2IFQ A;  3GFK A;  4J57 E;  2M72 A;  2R0G A;  4MZC A;  1TJD A;  5DCG A;  5AIS A;  2LJR A;  2IMD A;  1OE7 A;  2V6O A;  1QUW A;  1R7H A;  4BWS A;  3G7I A;  4IP1 A;  3QCP A;  3UBL A;  2R4V A;  1JZW A;  3D21 A;  1F37 A;  1PQN A;  3ZVJ A;  3RPP A;  2EIR A;  4N0V A;  2AHE A;  20GS A;  5EPF A;  5CAX A;  3DWV A;  1GSD A;  5H5S A;  3L9U A;  1Z7R A;  2B5Y A;  1GP1 A;  2WFC A;  3MDK A;  1G7E A;  5ID2 B;  3O3T A;  4MF7 A;  3ZZX A;  3AY8 A;  1MEK A;  1U87 A;  6GST A;  5KOW A;  2LJA A;  4TW5 A;  4XTS A;  1Q98 A;  3ZRD A;  4WF4 A;  3UEM A;  1EP8 A;  2I4A A;  1B9X C;  1ZOF A;  3KH9 A;  2HNL A;  5BRT A;  1ILO A;  1ERW A;  2ALB A;  2VL3 A;  2ZNM A;  3GX8 A;  2C8U A;  3EPT A;  2GS3 A;  5DQS A;  2RM5 A;  4IW9 A;  2HRF A;  1DE2 A;  4GRF A;  2VLT A;  2HSY A;  3FEU A;  4O7H A;  1VF2 A;  3FZ5 A;  1PX7 A;  3LQ7 A;  3IXR A;  2CVD A;  3J7Y k;  5DJL A;  3E3E A;  2H70 A;  2RII A;  2QA2 A;  3A5I A;  1E6B A;  4JBB A;  1TRV A;  1FHE A;  3BCI A;  1GUL A;  4OFN A;  4GQF A;  16GS A;  2VIM A;  3KTB A;  5ECS A;  4L8E A;  4GST A;  3NIV A;  2MYG A;  1K0M A;  3O76 A;  3MSZ A;  5DQY A;  4TXV A;  4EO3 A;  2PER A;  1SKW B;  4V2N A;  5ENU A;  3UBK A;  2X49 A;  4I5Q A;  4KB3 A;  4ZIL A;  2LTK A;  5CRG A;  3GKN A;  4RUV A;  3TRX A;  1AAZ A;  5ECQ B;  1XW5 A;  4F0B A;  1FO5 A;  2PN8 A;  2VCW A;  4FYU A;  1DBY A;  1BED A;  3RHB A;  2H6Z A;  5COH A;  3V1W A;  2KLX A;  1ZYN A;  2WS2 A;  3F4S A;  4POK A;  4DVC A;  1WP0 A;  4O5R A;  4O5U A;  3CTG A;  1SJI A;  5E4W A;  4KND A;  4OO4 A;  1J9B A;  5GSS A;  4MCU A;  4HOJ A;  4GLT A;  2DBC A;  4ISD A;  3GH6 A;  3TGZ A;  2B1L A;  2P5Q A;  4X4J A;  3SWL A;  2FCH A;  2FD3 A;  3VLN A;  6GSW A;  1A0F A;  4BPY A;  1K3O A;  2VL9 A;  3ME8 A;  2CX3 A;  1AXD A;  9GSS A;  2O85 A;  1KTE A;  2FUG 2;  4JR6 A;  1UVZ A;  1FG4 A;  4IJI A;  3EE2 A;  4A5P A;  2MBS A;  1SL0 B;  2ZUP A;  1SK0 A;  1K0B A;  4JU5 A;  1XOB A;  2FY6 A;  3DEX A;  8GSS A;  1EV9 A;  1AW9 A;  5DCH A;  1JZO A;  2YCD A;  1T7P B;  1SJZ A;  4OFT A;  4YAP A;  3VK9 A;  3EIN A;  2H0H A;  2LS5 A;  2DJJ A;  4IP6 A;  3GH9 A;  2YV7 A;  4N11 A;  1EOG A;  3DYR A;  3O6T A;  3EMP A;  4XS4 B;  3IE3 A;  1O8W A;  4O5Q A;  2O89 A;  3HJP A;  4OCF A;  5IQY A;  2H8L A;  3ERF A;  1YQ1 A;  2GSR A;  1M2D A;  4G19 A;  1HNA A;  2HYX A;  5DJM A;  3M3M A;  1LU4 A;  3MNG A;  1PGT A;  4MPG A;  3VPT A;  4V1A g;  5IMD A;  5JWO B;  5A4U A;  2YP6 A;  3US3 A;  5IIZ A;  1T4Z A;  1SKR B;  1F3B A;  2XHF A;  17GS A;  3C73 A;  4MH3 A;  1EV4 A;  2Z9S A;  1SL1 B;  1RQM A;  2IJY A;  3C1R A;  4FQU A;  4YKF A;  1EP7 A;  2O87 A;  4TR4 A;  2JSZ A;  5ECI B;  6GSS A;  5HR1 A;  3FKF A;  1K0O A;  4HUA A;  2X8G A;  1PSQ A;  1GUK A;  4AJ8 A;  3GTU A;  4MP4 A;  2GQM A;  1G0T A;  1PN9 A;  3KMN A;  4D73 B;  3RBT A;  1O73 A;  2FGX A;  5EY6 A;  5DBQ A;  2VCV A;  12GS A;  3BD2 A;  2EIQ A;  3EYT A;  1O81 A;  3A2V A;  2C80 A;  4O92 A;  4BL7 B;  3D4T A;  2FLS A;  1F9M A;  3ME7 A;  2E2G A;  1A8Y A;  5CRW A;  2NPB A;  2OBI A;  4AF2 A;  2F8A A;  2DIZ A;  3IPZ A;  2K18 A;  4NAX A;  1OVN A;  4OCE A;  2HZE B;  3EVI A;  2C3N A;  3TOU A;  5CRD A;  4HU9 A;  1TI3 A;  2PPT A;  1I5G A;  5F8B A;  3EU3 A;  4GQC A;  1A24 A;  3M0F A;  2OA7 A;  2C3Q A;  5DAL B;  4Z2T A;  1GNE A;  4HZ2 A;  4NHW A;  4XCS A;  1MDJ A;  5G30 A;  2L6D A;  3KZQ A;  1Z6M A;  3KD0 A;  2FWH A;  3RHC A;  1M9B A;  4EE0 A;  2FWE A;  1YEP A;  5B6N A;  3F6D A;  5LD0 A;  4WEY A;  3GHA A;  4G0K A;  1X5E A;  3IR4 A;  4N10 A;  3EUR A;  2MMN A;  1FAA A;  5JWR B;  4CDO A;  3UVH A;  2JL4 A;  2RLI A;  6GSU A;  1JHB A;  3H79 A;  4Z7X A;  4NV2 A;  1GTU A;  1OC3 A;  1YKC A;  4PUF C;  2LST A;  4PQH A;  3GKM A;  3HZ8 A;  3GIX A;  3IHQ A;  2M46 A;  1J08 A;  2OKA A;  1E2Y A;  4HQS A;  1XWC A;  3GRX A;  1T3B A;  2UZ8 A;  3TUE A;  1OC8 A;  1O7U A;  2B5E A;  2NDO A;  5C04 A;  2ZCT A;  1ZZY A;  2GZP A;  1GSY A;  1RW1 A;  4EXJ A;  5CRH A;  2R5G A;  3ZFB A;  4PQ1 A;  3H4K A;  4YQV A;  1JLV A;  5L71 A;  3RDW A;  5GZZ B;  3DXB A;  3M9J A;  4X1U A;  4PGT A;  4ZBB A;  4MDC A;  3CRT A;  4LMV A;  2LQO A;  4X0X A;  4F2I A;  4MA9 A;  5D8I A;  4YAV A;  5IOW A;  4I6X A;  3A2X A;  1SL2 B;  3D0Z A;  3RPN A;  4F0C A;  1TRW A;  3GX0 A;  5CP1 A;  3P7X A;  1H75 A;  1B4P A;  4PNF A;  3TJF A;  5IPG A;  2OAC A;  3TRQ A;  1XOA A;  1T8E B;  2JZS A;  5GAN D;  1XWG A;  4YKG A;  3UL3 A;  4HEA 2;  3IHG A;  4GF0 A;  3J7Y b;  3DKS A;  2O8V B;  2VL2 A;  1GUM A;  5J4U A;  5EVO A;  1TRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...