2GT5A

Solution structure of apo human sco1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
173
structure length
173
Chain Sequence
SFTGKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords SCO1 protein homolog, mitochondrial
publication title A hint for the function of human Sco1 from different structures.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2gt5A00
2YV7A 4KDYA 2HRFA 3RBTA 5DALB 2WS2A 3V1WA 3WT1A 2OE1A 7GSSA 4HJ2A 2XBIA 3MAKA 4N0VA 2XPEA 2GGTA 2V32A 2DIYA 4KCEA 1IYHA 1TU7A 3DMLA 5EPFA 5ENUA 1FHEA 3MNGA 2LNSA 2WFCA 1EV4A 3CMIA 5CREA 3M9JA 2DJ2A 1TRUA 3QOUA 2WULA 5J41A 5E4WA 2C3QA 3W8JA 1BX9A 4E8EA 2CQ9A 3LWAA 5ABRA 1BAYA 5CYYA 1Y6EA 1AXDA 2CAIA 5JCUA 2J9HA 2IMDA 5HR0A 1Z9HA 2LKUA 1UC7A 3IR4A 4EC0A 1GWCA 2IPAA 4MJEA 2DJ3A 4AJ6A 1A8YA 4IJIA 2C3TA 3P90A 1NHYA 2QKEA 2LJAA 4NHWA 3TB2A 3HJOA 1GTAA 4PUAA 2RM6A 1TTZA 2H6ZA 4L5LA 1EP8A 3KGKA 1OC8A 1SENA 1OKTA 2C3NA 1YF0A 1CQGA 1JFUA 4GCIA 3M3MA 3GHAA 2K6VA 2HT9A 4KSMA 4GWRA 2R3XA 4FYCA 1GSEA 1WJKA 2YPMA 3Q18A 1OYJA 2GS3A 1F6MC 2TRXA 3P7XA 1K0DA 1Q4JA 3HA9A 4WBRD 2VCTA 3LXTA 2HI7A 4G2EA 5A4UA 4LMVA 3IHQA 1PKWA 4V1Ag 1ZGNA 3QMXA 2AB6A 3GSSA 2LEGA 3WGDA 2FWEA 4L8EA 4I2TA 3GURA 3VI7A 5J5NA 1GTUA 1SYRA 1Z6MA 3QCPA 1GRXA 3ERGA 3HZ8A 4I5QA 3EYTA 1PA3A 1K0AA 3EINA 5FT3A 3A2XA 3RHCA 3KJYA 3A3TA 2A2SA 5F0GA 3GSTA 1TRSA 4XS4B 2DSAA 3GH6A 3FR3A 3TJGA 1X9MB 2LQQA 2WZ9A 1JZDA 2EIQA 2V41A 3L78A 2RUEA 3QAWA 5J4UA 1YF1A 5CAXA 5CRDA 1M9BA 3S9FA 4P3YB 22GSA 4ML6A 2NVLA 4EF0A 4YQUA 2HSHA 3C73A 4GXZA 1XZOA 2L59A 1LBKA 1FOVA 2YP6A 3GKMA 5ECIB 1SL2B 3ZVJD 1TRWA 1VF4A 3IRAA 3FR9A 4K9ZA 4ILFA 2K8VA 2V1MA 3LYKA 2PPTA 3KMNA 3M1GA 3D5JA 1ZYEA 4POBA 2JADA 3QFBC 5IIZA 3UIWA 3L4NA 2OKAA 2HSYA 1S3CA 2LRTA 4WR5A 3APOA 3TKSA 3RPNA 3GL5A 2DBCA 3QPMA 5IPGA 1O81A 1PMTA 2PUKC 3EC3A 5D9TA 3VPQA 2FHEA 2IMFA 3VK9A 2FCHA 3FEUA 2CT6A 1N2AA 1SKWB 4H86A 4YQVA 3APSA 3KP9A 3CRUA 3CTGA 5ELGA 1W4VA 2IWTA 1T7PB 1O7UA 5HR1A 4CHSA 1U3AA 1HD2A 1H75A 2FA8A 3HYPA 2L5OA 1GNWA 1NW2A 3GTUA 1EP7A 2A2RA 4ZXGA 4TR1A 2H6YA 3ME8A 1MEKA 4TR0A 1VF3A 5DQYA 3FZ5A 3UJ1A 3TKQA 1XWKA 2GSRA 2B1LA 3IOSA 3SBCA 1X9WB 1SL1B 1GL8A 1THOA 2PVQA 4KCAA 5KN1A 2FWFA 2VOCA 4RQRA 4JEDA 3UL3A 2NTOA 1ON4A 1XWCA 4ML1A 3VWWA 5ECHB 4OFMA 3QDNA 2JACA 2CVKA 2ZCTA 1T4YA 2IJYA 3FHKA 4AGSA 2HZFA 1J0FA 2VAFA 1T1VA 4IQ1A 1WOUA 5DAKB 3LEFA 3BCIA 4NPBA 1WMJA 3EMPA 1OC3A 3CSHA 3ZVJA 1RW1A 2KLXA 1G7EA 1A8LA 3MDKA 4D73A 2VL3A 3KMOA 4JRRA 3CTFA 3OR5A 2LRNA 2K9FA 2OBIA 3IAM2 2LSTA 3KM6A 3RDWA 1WP0A 1GP1A 3FZ4A 2IN3A 4TR3A 1DUGA 2LNTA 2ON7A 2H1DA 2P5QA 3FY7A 1GSFA 4O32A 3H79A 4HZ2A 4MJAA 1M2DA 4EVMA 3R2QA 4Z7XA 4PX1A 2O87A 5LCZA 4POLA 4GTUA 1EEJA 1PSQA 3DD3A 2JSZA 4FO5A 4MLYA 1V98A 2YANA 3GX8A 4TVEA 4MF7A 4KNDA 2F8AA 2GQLA 3QD9A 1T4ZA 4X43A 5G5EA 3LSZA 1PQNA 1BQ7A 3IC4A 1G6WA 2VUPA 3P8WA 5EVOA 2YWIA 5ECQB 3DXBA 5DQSA 5CRWA 3TRPA 1QMVA 2Z9SA 6GSYA 5LNKe 1V40A 1EV9A 5GSTA 4TXOB 3BOAA 1YJ6A 3IK9A 2HE3A 3PINA 4PQIA 3L9SA 1QQ2A 5IO2A 2GT5A 1FW1A 2NPBA 4ZL7A 3FK8A 5DVBA 2KOKA 1U88A 1C72A 3J7Yk 3F6FA 1USBA 20GSA 2L6DA 4G19A 4YAVA 4WBJA 1A2LA 3RHBA 2FY6A 4V2MA 1MDJA 18GSA 3O3TA 1XWGA 5G1KA 3WD6A 4F0CA 3LORA 4MJBA 2AJQB 5DCHA 3F8UA 2DMLA 1M2AA 1AQXA 3IA1A 5HQPA 5F07A 3CSIA 1K3LA 2HZEA 2VL2C 4BA7A 1I5GA 2I3YA 1B9YC 4HU9A 3TDGA 1TKDB 3MSZA 3M8NA 3J7Yb 3VWVA 16GSA 3GN3A 1WPIA 4K7OA 5FWGA 5J9CA 4N0ZA 1Z7RA 4KX4A 5GSSA 2V6OA 2LQOA 4IBPA 1OC9B 2B5XA 1PRXA 5ECMB 4OCFA 1TP9A 4XHMA 5D73A 2E0QA 4O7HA 11GSA 2IFQA 3EWLA 4TKYA 5ECOB 3KZQA 1A0RP 4WF4A 1URMA 5ID2B 2H74A 3UOMA 4V1Ap 1T3BA 1SJ6A 5ECNB 1BG5A 3LJRA 3VWUA 5DJMA 3Q19A 2YJHA 1X0RA 2R37A 3N9JA 4XS4A 2JZTA 4EDZA 3KXOA 4HEA2 4NWYA 2PGTA 1T8EB 5GAND 2H66A 1SJZA 3TJJA 1O85A 5IMAA 4XS1A 1TOFA 1ZZYA 1ERVA 4ZL8A 3ZZXA 1F3BA 1HQOA 4NV5A 2WDUA 2F51A 4KDXA 5F05A 5IMVA 4L5OA 2LRCA 1GULA 4JU5A 2E2GA 3NZNA 4IS0A 5A4WA 3F3QA 1LU4A 3CXGA 1XXUA 3UARA 3DYRA 4TRXA 3GIXA 1XWAA 3ZIJA 4OCEA 4RI7A 3O6TA 3ZREA 3GMFA 5G30A 4NXIA 5JCGA 1X9SB 4IQAA 1XW5A 2PVOC 3LGCA 5CRHA 1VGLA 4OFTA 5AIXA 5B6MA 1K0CA 2NDOA 1DE2A 4JBBA 3TJBA 2IIYA 4HUAA 2DJJA 2KP1A 1VF2A 3EURA 2ZUPA 3F6DA 3BBYA 3HD5A 2F8FA 3QAVA 2GQMA 1I9DA 2DIZA 5C04A 1U3IA 4BWQA 4G9HA 4KB3A 4LLRA 5IOXA 4RUVA 4LL1B 2VM2A 1J08A 2I4AA 3EE2A 2IMEA 4XS6A 1A2MA 2M46A 4XRAA 4EL1A 4EXJA 4BVXA 5C00A 1AQWA 5KN2A 4ZB9A 2CX4A 1WWJA 3GUSA 1SK1A 5HFKA 2YZUA 2C80A 5EL8A 2N5FA 4BPYA 2E2MA 3D4MA 1JLVA 2YN1A 4MF5A 10GSA 2F9SA 5CNWA 1B4QA 4AJ8A 13GSA 1XFLA 1DE1A 1GLQA 2X8GA 3KH9A 2YWNA 1R7HA 3U5RE 4ECCA 1E2YA 2H0HA 3G7YA 3UVHA 2C1YA 1XBSA 3VFIA 3F4RA 4DSQA 1FB0A 2R4VA 2JL4A 3FZ9A 5IO0A 1MD3A 3EU3A 3QFAC 3M9KA 4GSSA 4F2IA 3H4KA 4DSSB 2L4QA 1V2AA 2L57A 3TUEA 5D8IA 6GSWA 3D6IA 1TRVA 4JE1A 2GVPA 5HR2A 4K7NA 3DEXA 2YJ7A 3TCOA 4PNGA 6GSSA 4EKZA 4X1UA 3D21A 1RK4A 4KSOA 2PU9C 3ZYWA 1KNGA 2GT6A 4IGJA 2MMAA 4YQMA 3EMXA 1M99A 12GSA 2B1KA 1SU9A 2R5GA 3LG6A 3E9JB 2RLIA 2V2GA 4IHUA 1FB6A 2E7PA 3BD2A 1V57A 4F03A 3HZ4A 2VLUA 2VCVA 3TRQA 2WB9A 3L9UA 2GZPA 2G2QA 1O8WA 3QR6A 2R2JA 4IP6A 3P2AA 2RUFA 1PD21 4WF5A 5EY6A 4KGIA 1AIUA 1V9WA 4MK3A 2NBSA 2P0GA 3HXSA 3DRNA 1ABAA 3GFKA 4DSRA 4OWYA 3GL3A 4OO5A 1R4WA 1SD9A 2AAWA 5D93A 4ZBAA 3F3RA 4QL7A 3KIJA 5CO3A 1O8XA 4MPFA 4MZBA 2H0GA 1U87A 2OJLA 1OKDA 2VCXA 4KDUA 1HYUA 2B7KA 3GNJA 3PGTA 3VLNA 2QGVA 1F37A 3C1SA 3GA4A 3HVVA 4MH2A 4PNFA 4HU7A 4XCSA 1QUWA 4V2LA 2CVDA 3DIEA 4F0BA 5KN0A 1MDKA 2AHEA 2C0EA 4Q5RA 2VO4A 3TOUA 2YWMA 2BTOT 4YH2A 2ES7A 4QL9A 4Q5QA 1UN2A 3LQ7A 1WE0A 2O8VB 3KCMA 1XWBA 2MMZA 1XOBA 5AGYA 2F3MA 4PQ1A 1TXXA 1ZL9A 3IDVA 2FNOA 1X5DA 4L0UA 3FRCA 1NM3A 3NIVA 3UBLA 4BWSA 2VL9A 5B6NA 1JLWA 3IXRA 3L0HA 2CVBA 4L0WA 4J56E 1JHBA 1UA5A 4LA1A 2ZNMA 1JZRA 1F2EA 2X99A 1R26A 1U6TA 3Q74A 3HJPA 2V6KA 2EC4A 5INYA 3TJKA 2HXKA 3FR6A 14GSA 1EOHA 1K0BA 2X8CA 4PUFC 2TIRA 2CX3A 2WJUA 5G2ZA 3ME7A 1ACVA 3WYWA 3G7JA 3QAGA 1Z3EA 1TU8A 3C71A 1XVWA 3GH9A 2GTUA 2H0IA 5F8BA 3A2WA 5D9WA 1S3AA 2YWOA 4MPGA 4F82A 1QXHA 2P31A 1YEXA 5DALA 4O92A 1GUMA 4FH8A 3E0UA 4MP4A 2M72A 3APQA 1OVNA 3IE3A 1KEBA 4KH7A 2H1BA 2LJKA 1ZYQB 1PL2A 2DJKA 3L9VA 1GTBA 1Z6NA 4MMMA 4XTSA 4HJMA 3A2VA 2LJRA 2MYGA 4JR6A 1EGOA 3GTUB 4OFNA 4TR1B 3DGQA 1AQVA 1MD4A 1R5PA 2CV4A 3H1NA 3D22A 2CZ2A 2YZHA 3F9UA 3VWXA 2FLSA 1ERWA 2L6CA 4DVCA 4PXOA 1ST9A 4TXVA 3M0FA 3EVIA 4OD7A 3HKRA 1H4OA 2O85A 3C1RA 3DVWA 4HQSA 3Q6OA 5J3RA 2OE3A 2H8LA 5IPHA 1ZOFA 3KEBA 5E59A 5B7CA 2N5BA 2FWHA 3A5WA 1M9AA 1Q98A 5CP1A 2OACA 4F9ZA 1PL1A 4ZBDA 1QK8A 3GRXA 1B8XA 1BYEA 2XBQA 2L4CA 4D73B 1N8JA 2TRCP 1X5CA 5KEJA 2MMOA 4LL4B 1GSQA 4NAXA 2B6MA 5J9BA 2BMXA 4IN0A 1Z7PA 1SJIA 3K8NA 4IW9A 3IAS2 3GKKA 1EOGA 2CA8A 4WR4A 3U6VA 1EGRA 1E6BA 4G10A 2A4VA 1RQMA 1GTIA 3TKPA 2VCQA 4BVYA 1KBNA 2VCZA 2XC2A 1YKAA 1ZMAA 4XRDA 3W6GA 3PR8A 1ILOA 1YY7A 1A24A 3UAPA 2H19A 3IPZA 4N10A 2GSQA 4DSSA 3H8QA 4N30A 2JZRA 3WGEA 1ZCPA 1LJRA 2H72A 2BJXA 4N11A 4KA0A 1YQ1A 3GV1A 4ECJA 5AN1A 2C0GA 2GQKA 1SKSB 4ECIA 1M7TA 4PQHA 1PX6A 2HFDA 1B48A 3EU4A 3FW2A 1K3OA 1XW6A 2LV3A 4ID0A 3LYPA 5D9VA 5GZZB 2B3SA 4MZWA 5A4VA 4LMWA 3MWHA 5ECKB 3DKSA 3SWLA 3ERWA 2P5RA 1AW9A 2H1GA 4I2UA 5GAPD 2KP2A 1UVZA 4TOPA 1OE7A 2B5YA 5G5FA 4X0XA 4PGTA 17GSA 4CDOA 3I69A 3ZITA 4TN8A 1GSUA 3ZRDA 5G1LA 5H5RA 1XIYA 2IL3A 3GKXA 1F9MA 5AISA 4KUNA 1SK0A 2C0FA 3US3A 1TW9A 3DVXA 5FHIA 3HDCA 2JZSA 2HYXA 4E8HA 1F3AA 1VRSD 2FWGA 3CYNA 2X64A 2VD0A 3G7IA 5IQYA 4FYUA 2HZEB 3HCZA 5HFGA 4GSNA 3FZAA 3CSJA 4JZQA 1Y25A 3NOFA 2VIMA 1O6JA 1J9BA 5IMDA 5L71A 4KE3A 1TK8B 5JCWA 3VI5A 4K0NA 2C8UA 4ISDA 2KUCA 5ELAA 2H71A 3UVTA 1G6YA 3UMAA 19GSA 4ECBA 2ON5A 2AV4A 4HI7A 2PN8A 2JSYA 2DC5A 5B8AA 4ZB8A 6GSXA 5HFIA 2LUSA 2IFQB 2EIOA 2FGXA 4JR4A 1O73A 1THXA 2G0FA 1GSYA 2REMA 3VURA 1XPVA 3F63A 5DAKA 1FVKA 1QFNA 2PERA 2MBSA 3HVSA 1G0TA 3I6AA 4ZILA 3JCML 5IMZA 4I97A 2L5LA 2QSIA 3ZLPA 4IELA 2AYTA 1OAZA 5LD0A 4I6XA 4OMVA 1FAAA 1T00A 4RQXA 1K3YA 2M80A 2PBJA 4DEJA 4MA9A 2K18A 4K2DA 1XW9A 3GKNA 1PX7A 4XIHA 4GQCA 3TJFA 1GUHA 2MMNA 1WIKA 4WXTA 2MZCA 5B8BA 4NHZA 3ZMLA 2PWJA 5JWQB 3GYKA 1SD8A 4ZBBA 2I9HA 3F4SA 2VLVA 4HQZA 1GLPA 3KP8A 5JWRB 1TI3A 3RPPA 1Z5YE 3WGXA 4MH3A 4IP1A 4J57E 1EZKA 1ERTA 2H30A 3BCKA 2HLSA 1K0OA 1PGTA 4EO3A 2OBKA 1VF1A 2PMTA 3ZIVA 3DWVA 1R5AA 2IMKA 4PURA 4ZIJA 3ERFA 3ED3A 2AUVA 3FKFA 4RI6A 1M2BA 5ECRB 1YKCA 1SKRB 2H01A 4GLTA 3TRXA 4ACSA 5IMFA 4TXOA 3O76A 4EDYA 2GLRA 2CAQA 1KTEA 3PH9A 2H1AA 4Q5FA 4HS1A 3RAZA 1SL0B 2X8HA 4HZ4A 2HRNA 1XCCA 4QQ7A 3TKSC 1G7OA 3KTBA 4BL7A 3WT2A 1V58A 4K7IA 2H73A 4MABA 2XHFA 5JWOB 1GH2A 2WGRA 3I43A 4K6XA 1K0NA 2I1UA 5IMCA 1AUCA 3E3EA 4POMA 2RM5A 1GSSA 3TKSE 4MF6A 1EEMA 2DJ0A 1FO5A 1DBYA 5CRGA 2VM1A 5HR3A 1BEDA 2OADA 4MCUA 4Q5NA 3HHVA 1K0MA 1B9XC 3ZFLA 2VLTA 2IMIA 2H6XA 2MBTA 5DBQA 2VCWA 3LXZA 3HY2A 3KH7A 2DLXA 5F06A 3GX0A 3IV4A 5G31A 3AY8A 4O5RA 4POKA 1DSBA 4J2FA 3N5OA 3C8EA 4V2NA 2DMMA 2WRTA 1OC9A 4GF0A 2YV9A 4MJCA 5COHA 1GUKA 2FD3A 3F0IA 5IOWA 3F4TA 4ZB6A 5ECSA 2OA7A 3C7MA 2I81A 3FYGA 1FG4A 3CBUA 2GSSA 1XVQA 2YCDA 2XPDA 5ID2A 3IBHA 5DJLA 1AC1A 2H76A 3TOTA 1YDKA 5H5QA 2B5EA 1WRYA 4GSTA 3BJ5A 4WKWA 2O7KA 1SK2A 1W89A 1EWXA 5KN3A 1XOAA 1PKZA 1MTCA 4K1FA 1JZOA 1X5EA 1NHOA 1TI1A 5ECPB 2VL2A 4GRFA 3CRTA 5DCGA 2RIIA 2YOIA 4TW5A 1CQHA 1HNCA 3ZL5A 3ZFBA 1OE8A 9GSSA 4HOJA 4IJ3A 6GSTA 1TK5B 4WEYA 2WCIA 4MZCA 6GSVA 5AIVA 1M0UA 3ZMKA 4EUYA 2GDRA 3VPTA 3KTLA 1YEPA 1AAZA 2ALBA 4CW9A 8GSSA 2O89A 1GSDA 2KHPA 2FA4A 2QC7A 1PN9A 2K8SA 5DDLA 2R6KA 3TKRA 2H70A 3I9V2 2J23A 3UEMA 2C0DA 2B7JA 2H75A 6GSUA 4IKHA 4MDCA 2HNLA 4K8MA 4KW6A 3W8SA 4KAEA 2DJ1A 4ZL9A 1HNBA 2LTKA 5D9XA 4FIWA 2FUG2 1S3DA 2VD1A 1SYXA 1HNAA 3H93A 3D0ZA 4NV2A 5H5SA 2LS5A 1ML6A 2CZ3A 1NSWA 1YZXA 2GZZA 1FVJA 1A23A 1A0FA 3KD0A 3IK7A 5D96A 4ULXA 2N5AA 1MDIA 2EIRA 4FYBA 2C4JA 4GQFA 4NMUA 5IM9A 4AJ7A 3D4TA 1B4PA 1JZWA 4WETA 3ISOA 3TGZA 4OO4A 4TR4A 4EE0A 5A5KA 4HDEA 2YNXA 3G9BA 4K0GA 4I8BA 4IVFA 1TK0B 3ZTLA 5ECLB 1QGVA 4YAPA 1A2JA 4AF2A 1ERUA 3HJMA 2OE0A 2GSTA 3UBKA 2JU5A 1TDIA 1IYIA 1GNEA 1BJXA 3HVXA 1TJDA 3LFLA 2GZYA 2D2ZA
chains in the Genus database with same CATH superfamily
2YV7A 4KDYA 2HRFA 3RBTA 5DALB 2WS2A 3V1WA 3WT1A 2OE1A 7GSSA 1M3JA 4HJ2A 2XBIA 3MAKA 4N0VA 2XPEA 2GGTA 2V32A 2DIYA 4KCEA 1IYHA 1TU7A 3DMLA 5EPFA 5ENUA 1FHEA 3MNGA 2LNSA 2WFCA 1EV4A 3CMIA 5CREA 3M9JA 2DJ2A 1TRUA 3QOUA 2WULA 5J41A 5E4WA 2C3QA 3W8JA 1BX9A 4E8EA 2CQ9A 3LWAA 2R0CA 5ABRA 1BAYA 5CYYA 1Y6EA 1AXDA 2CAIA 5JCUA 2J9HA 2IMDA 5HR0A 1Z9HA 2LKUA 1UC7A 3IR4A 4EC0A 1GWCA 2IPAA 4MJEA 2DJ3A 4AJ6A 1A8YA 4IJIA 2C3TA 3P90A 1NHYA 2QKEA 2LJAA 4NHWA 3TB2A 2A4HA 3HJOA 1GTAA 4PUAA 2RM6A 1TTZA 2H6ZA 4L5LA 1EP8A 3KGKA 1OC8A 1SENA 1OKTA 2C3NA 1YF0A 1CQGA 1JFUA 4GCIA 3M3MA 3GHAA 2K6VA 2HT9A 4KSMA 4GWRA 2R3XA 4FYCA 1GSEA 1WJKA 2YPMA 3Q18A 1OYJA 2GS3A 1F6MC 2TRXA 3P7XA 1K0DA 1Q4JA 3HA9A 4WBRD 2VCTA 3LXTA 2HI7A 4G2EA 5A4UA 4LMVA 3IHQA 1PKWA 4V1Ag 1ZGNA 3QMXA 2AB6A 3GSSA 2LEGA 3WGDA 2FWEA 4L8EA 4I2TA 3GURA 3VI7A 5J5NA 1GTUA 1SYRA 1Z6MA 3QCPA 1GRXA 3ERGA 3HZ8A 4I5QA 3EYTA 4BVYB 1PA3A 1K0AA 3EINA 5FT3A 3A2XA 3RHCA 3KJYA 3A3TA 2A2SA 5F0GA 1PN0A 3GSTA 1TRSA 4XS4B 2DSAA 3GH6A 3FR3A 3TJGA 1X9MB 2LQQA 2WZ9A 1JZDA 2EIQA 2V41A 3L78A 2RUEA 3QAWA 5KOXA 5J4UA 1YF1A 5CAXA 5CRDA 1M9BA 3S9FA 4Z2RA 4P3YB 22GSA 4ML6A 2DKIA 2NVLA 4EF0A 4YQUA 2HSHA 3C73A 4HSCX 4GXZA 1XZOA 2L59A 1LBKA 1FOVA 2YP6A 3GKMA 5ECIB 1SL2B 3ZVJD 1TRWA 1VF4A 3IRAA 3FR9A 4K9ZA 4ILFA 2K8VA 2V1MA 3LYKA 2PPTA 3KMNA 3M1GA 3D5JA 1ZYEA 4POBA 2JADA 3QFBC 5IIZA 3UIWA 3L4NA 2OKAA 2HSYA 1S3CA 2LRTA 4WR5A 5BRTA 3APOA 3TKSA 3RPNA 3GL5A 2DBCA 3QPMA 5IPGA 1O81A 1PMTA 2PUKC 3EC3A 5D9TA 3VPQA 2FHEA 2IMFA 3VK9A 2FCHA 3FEUA 2CT6A 4YKFA 1N2AA 1SKWB 4H86A 4YKGA 4YQVA 3APSA 3KP9A 3A5IA 3CRUA 3CTGA 5ELGA 1W4VA 2IWTA 1T7PB 1O7UA 5HR1A 4CHSA 1U3AA 1HD2A 1H75A 2FA8A 3HYPA 2L5OA 1GNWA 1NW2A 3GTUA 1EP7A 2A2RA 4ZXGA 4TR1A 2H6YA 3ME8A 1MEKA 4TR0A 1VF3A 5DQYA 3FZ5A 3UJ1A 3TKQA 1XWKA 2GSRA 2B1LA 3IOSA 3SBCA 1X9WB 1SL1B 1GL8A 1THOA 2PVQA 4KCAA 5KN1A 2FWFA 2VOCA 4RQRA 4JEDA 3UL3A 2NTOA 1ON4A 1XWCA 4ML1A 3VWWA 5ECHB 4OFMA 3QDNA 2JACA 2CVKA 2ZCTA 1T4YA 2IJYA 3FHKA 4AGSA 2HZFA 1J0FA 2VAFA 1T1VA 4IQ1A 1WOUA 5DAKB 3LEFA 3BCIA 4NPBA 1WMJA 3EMPA 4X4JA 1OC3A 3CSHA 3ZVJA 1RW1A 2KLXA 1G7EA 1A8LA 3MDKA 4D73A 2VL3A 3KMOA 4JRRA 3CTFA 3OR5A 2LRNA 2K9FA 2OBIA 3IAM2 2LSTA 3KM6A 3RDWA 1WP0A 1GP1A 3FZ4A 2IN3A 4TR3A 1DUGA 2LNTA 2ON7A 2H1DA 5BMUA 2P5QA 3FY7A 1GSFA 4O32A 3H79A 4HZ2A 4MJAA 1M2DA 4EVMA 3R2QA 4Z7XA 4PX1A 2O87A 5LCZA 4POLA 4GTUA 1EEJA 1PSQA 3DD3A 2JSZA 4FO5A 4MLYA 1V98A 2YANA 3GX8A 4TVEA 4MF7A 4KNDA 2F8AA 2GQLA 3QD9A 1T4ZA 4X43A 5G5EA 3LSZA 1PQNA 1BQ7A 3IC4A 1G6WA 2VUPA 3P8WA 5EVOA 2YWIA 5ECQB 3DXBA 5DQSA 5CRWA 3TRPA 1QMVA 2Z9SA 6GSYA 5LNKe 1V40A 1EV9A 5GSTA 4TXOB 3BOAA 1YJ6A 3IK9A 2HE3A 3PINA 4PQIA 4A5PA 3L9SA 1QQ2A 5IO2A 2GT5A 1FW1A 2NPBA 4ZL7A 3FK8A 5DVBA 2KOKA 4BL7B 4EIQA 1U88A 1C72A 3J7Yk 3F6FA 1USBA 20GSA 2L6DA 4G19A 4YAVA 4WBJA 1A2LA 3RHBA 2FY6A 4V2MA 1MDJA 18GSA 3O3TA 1XWGA 5G1KA 3WD6A 4F0CA 3LORA 4MJBA 2AJQB 5DCHA 3F8UA 2DMLA 1M2AA 1AQXA 3IA1A 5HQPA 5F07A 3CSIA 1K3LA 2HZEA 2VL2C 4BA7A 1I5GA 2I3YA 1B9YC 4HU9A 3TDGA 1TKDB 3MSZA 3M8NA 3J7Yb 3VWVA 16GSA 3GN3A 1WPIA 4K7OA 5FWGA 5J9CA 4N0ZA 1Z7RA 4Z2UA 4KX4A 5GSSA 2V6OA 2LQOA 4IBPA 1OC9B 2B5XA 1PRXA 5ECMB 4BIKA 4OCFA 1TP9A 4XHMA 5D73A 2E0QA 4O7HA 11GSA 2IFQA 3EWLA 4TKYA 5ECOB 3KZQA 1A0RP 4WF4A 1URMA 5ID2B 2H74A 3UOMA 4V1Ap 1T3BA 1SJ6A 5ECNB 1BG5A 3LJRA 3VWUA 5DJMA 3Q19A 2YJHA 1X0RA 2R37A 3N9JA 4XS4A 2JZTA 4EDZA 3KXOA 4HEA2 4NWYA 2PGTA 1T8EB 5GAND 2H66A 1SJZA 3TJJA 1O85A 5IMAA 4XS1A 1TOFA 1ZZYA 1ERVA 4ZL8A 3ZZXA 1F3BA 1HQOA 4NV5A 4O5QA 2WDUA 2F51A 4KDXA 5F05A 5IMVA 4L5OA 2LRCA 1GULA 4JU5A 2E2GA 3NZNA 4IS0A 5A4WA 3F3QA 1LU4A 3CXGA 1XXUA 3UARA 3DYRA 4TRXA 4K5RA 3GIXA 1XWAA 3ZIJA 4OCEA 4RI7A 3O6TA 3ZREA 3GMFA 5G30A 4NXIA 5JCGA 1X9SB 4IQAA 1XW5A 2PVOC 3LGCA 5CRHA 1VGLA 4OFTA 5AIXA 5B6MA 1K0CA 2NDOA 3IC8A 1DE2A 4JBBA 3TJBA 2IIYA 4HUAA 2DJJA 2KP1A 1VF2A 3EURA 2ZUPA 3F6DA 3BBYA 3HD5A 2F8FA 3QAVA 2GQMA 1I9DA 2DIZA 5C04A 1U3IA 4BWQA 4G9HA 4KB3A 4LLRA 5IOXA 4RUVA 4LL1B 2VM2A 1J08A 2I4AA 3EE2A 2IMEA 3IHGA 4XS6A 1A2MA 2M46A 4XRAA 4EL1A 4EXJA 4BVXA 5C00A 1AQWA 5KN2A 4ZB9A 2CX4A 1WWJA 3GUSA 1SK1A 5HFKA 2YZUA 2C80A 5EL8A 2N5FA 4BPYA 2E2MA 3D4MA 1JLVA 2YN1A 4MF5A 10GSA 2F9SA 5CNWA 1B4QA 4AJ8A 13GSA 1XFLA 1DE1A 1GLQA 2X8GA 3KH9A 2YWNA 1R7HA 3U5RE 4ECCA 1E2YA 2H0HA 2X49A 3G7YA 3UVHA 2C1YA 1XBSA 3VFIA 3F4RA 4DSQA 1FB0A 2R4VA 2JL4A 3FZ9A 5IO0A 1MD3A 3EU3A 3QFAC 3M9KA 4GSSA 4F2IA 3H4KA 4DSSB 2L4QA 1V2AA 2L57A 3TUEA 5D8IA 6GSWA 3D6IA 1TRVA 4JE1A 2GVPA 5HR2A 4K7NA 3DEXA 2YJ7A 3TCOA 4PNGA 6GSSA 4EKZA 2QA2A 4X1UA 3D21A 1RK4A 4KSOA 2PU9C 3ZYWA 1KNGA 2GT6A 4IGJA 2MMAA 4YQMA 3EMXA 1M99A 12GSA 2B1KA 1SU9A 2R5GA 2UZ8A 3LG6A 3E9JB 2RLIA 2V2GA 4IHUA 1FB6A 2E7PA 3BD2A 1V57A 4F03A 3HZ4A 2VLUA 2VCVA 3TRQA 2WB9A 3L9UA 2GZPA 2G2QA 1O8WA 3QR6A 2R2JA 4IP6A 3P2AA 2RUFA 1PD21 4WF5A 5EY6A 4KGIA 1AIUA 1V9WA 4MK3A 2NBSA 2P0GA 3HXSA 4ICYA 3DRNA 1ABAA 3GFKA 4DSRA 4OWYA 3GL3A 4OO5A 1R4WA 1SD9A 2AAWA 5D93A 4ZBAA 3F3RA 4QL7A 3KIJA 5CO3A 1O8XA 4MPFA 4MZBA 2H0GA 1U87A 2OJLA 1OKDA 2VCXA 4KDUA 1HYUA 2B7KA 3GNJA 3PGTA 3VLNA 2QGVA 1F37A 3C1SA 3GA4A 3HVVA 4MH2A 4PNFA 4HU7A 4XCSA 1QUWA 4V2LA 2CVDA 3DIEA 4F0BA 5KN0A 1MDKA 2AHEA 2C0EA 4Z2TA 4Q5RA 3CQFA 2VO4A 3TOUA 2YWMA 2BTOT 4YH2A 2ES7A 4QL9A 4Q5QA 1UN2A 3LQ7A 1WE0A 2O8VB 3KCMA 1XWBA 2MMZA 1XOBA 5AGYA 2F3MA 4PQ1A 1TXXA 1ZL9A 3IDVA 2FNOA 1X5DA 4L0UA 3FRCA 1NM3A 3NIVA 3UBLA 4BWSA 2HRAA 2VL9A 5B6NA 1JLWA 3IXRA 3L0HA 2X4AA 2CVBA 3FMWA 4L0WA 4J56E 1JHBA 1UA5A 4LA1A 2ZNMA 1JZRA 1F2EA 2X99A 1R26A 1U6TA 3Q74A 3HJPA 2V6KA 2EC4A 2R0GA 5INYA 3TJKA 2HXKA 3FR6A 14GSA 4K5SA 1EOHA 1K0BA 2X8CA 1ZYNA 4PUFC 2TIRA 2CX3A 2WJUA 5G2ZA 3ME7A 1ACVA 3WYWA 3G7JA 3QAGA 1Z3EA 1TU8A 3C71A 1XVWA 3GH9A 2GTUA 2H0IA 5F8BA 3A2WA 5D9WA 1S3AA 2YWOA 4MPGA 4F82A 1QXHA 2P31A 1YEXA 5DALA 4O92A 1GUMA 4FH8A 3E0UA 4MP4A 2M72A 3APQA 1OVNA 3IE3A 1KEBA 4KH7A 2H1BA 2LJKA 1ZYQB 1PL2A 2DJKA 3L9VA 1GTBA 1Z6NA 4MMMA 4XTSA 2R0PA 4HJMA 3A2VA 2LJRA 2MYGA 4JR6A 1EGOA 4CY6A 3GTUB 4OFNA 4TR1B 3DGQA 1AQVA 1MD4A 1R5PA 1M3IA 2CV4A 3H1NA 3D22A 2CZ2A 2YZHA 3F9UA 3VWXA 2FLSA 1ERWA 2L6CA 4DVCA 4PXOA 1ST9A 4TXVA 3M0FA 3EVIA 4G0IA 4OD7A 3HKRA 1H4OA 2O85A 3C1RA 3DVWA 4HQSA 3PPUA 3Q6OA 5J3RA 2OE3A 2H8LA 5IPHA 1ZOFA 3KEBA 5E59A 5B7CA 2N5BA 4EIPA 2FWHA 3A5WA 1M9AA 1Q98A 5CP1A 2OACA 4F9ZA 1PL1A 4ZBDA 1QK8A 3GRXA 1B8XA 1BYEA 2XBQA 2L4CA 4D73B 1PFOA 1N8JA 2TRCP 1X5CA 5KEJA 2MMOA 4LL4B 1GSQA 4NAXA 2B6MA 5J9BA 2BMXA 4FQUA 4IN0A 1Z7PA 1SJIA 3K8NA 4IW9A 3IAS2 3GKKA 1EOGA 2CA8A 4WR4A 3U6VA 1EGRA 1E6BA 4G10A 2A4VA 1RQMA 1GTIA 3TKPA 2VCQA 4BVYA 1KBNA 2VCZA 2XC2A 1YKAA 1ZMAA 4XRDA 3W6GA 3PR8A 1ILOA 1YY7A 1A24A 3UAPA 2H19A 3IPZA 4N10A 2GSQA 4DSSA 3H8QA 4N30A 2JZRA 3WGEA 1ZCPA 1LJRA 2H72A 2BJXA 4N11A 4KA0A 3HVNA 1YQ1A 3GV1A 4ECJA 5AN1A 2C0GA 2GQKA 1SKSB 4ECIA 1M7TA 4PQHA 1PX6A 2HFDA 1B48A 3EU4A 3FW2A 1K3OA 1XW6A 2LV3A 4ID0A 3LYPA 5D9VA 5GZZB 2B3SA 4MZWA 5A4VA 4LMWA 3MWHA 5ECKB 3DKSA 3SWLA 3ERWA 2P5RA 1AW9A 2H1GA 4I2UA 5GAPD 2KP2A 1UVZA 4TOPA 1OE7A 2B5YA 5G5FA 5KOWA 4X0XA 4PGTA 17GSA 4CDOA 1XG8A 3I69A 3ZITA 3EPTA 4TN8A 1GSUA 3ZRDA 5G1LA 5H5RA 1XIYA 2IL3A 3GKXA 1F9MA 5AISA 4KUNA 1SK0A 2C0FA 3US3A 1TW9A 3DVXA 5FHIA 3HDCA 2JZSA 2HYXA 4E8HA 1F3AA 3LW9A 1VRSD 2FWGA 3CYNA 2X64A 2VD0A 3G7IA 5IQYA 4FYUA 2HZEB 3HCZA 5HFGA 4GSNA 3FZAA 3CSJA 4JZQA 1Y25A 3NOFA 2VIMA 1O6JA 1J9BA 5IMDA 5L71A 4KE3A 1TK8B 5JCWA 3VI5A 4K0NA 2C8UA 4ISDA 2KUCA 2H71A 5ELAA 3UVTA 1G6YA 3UMAA 19GSA 4ECBA 2ON5A 2AV4A 4HI7A 2PN8A 2JSYA 2DC5A 5B8AA 4ZB8A 6GSXA 5HFIA 2LUSA 2IFQB 4O5UA 2EIOA 2FGXA 4JR4A 1O73A 1THXA 2G0FA 1GSYA 2REMA 3VURA 1XPVA 3F63A 5DAKA 1FVKA 1QFNA 2PERA 2MBSA 3HVSA 1G0TA 3I6AA 4ZILA 3JCML 5IMZA 4I97A 2L5LA 2QSIA 3ZLPA 4IELA 2AYTA 1OAZA 5LD0A 4I6XA 4OMVA 1FAAA 1T00A 4RQXA 1K3YA 2M80A 2PBJA 4DEJA 4MA9A 2K18A 4K2DA 1XW9A 3GKNA 1PX7A 4XIHA 4GQCA 3TJFA 1GUHA 2MMNA 1WIKA 4WXTA 2MZCA 5B8BA 4MNNA 4NHZA 3ZMLA 2PWJA 5JWQB 3GYKA 1SD8A 4ZBBA 2I9HA 3F4SA 3MIXA 2VLVA 4HQZA 1GLPA 3KP8A 5JWRB 1TI3A 3RPPA 1Z5YE 3WGXA 4MH3A 4IP1A 4J57E 1EZKA 1ERTA 2H30A 3BCKA 2HLSA 1K0OA 1PGTA 4EO3A 2OBKA 1VF1A 2PMTA 3ZIVA 3DWVA 1R5AA 2IMKA 4PURA 4ZIJA 3ERFA 3ED3A 2AUVA 3FKFA 4RI6A 1M2BA 5ECRB 1YKCA 1SKRB 2H01A 4GLTA 1S3RA 3TRXA 4ACSA 1FOHA 5IMFA 4TXOA 3O76A 4EDYA 2GLRA 2CAQA 4BVXB 2A2PA 1KTEA 3PH9A 2H1AA 4Q5FA 4HS1A 3RAZA 1SL0B 2X8HA 4HZ4A 2HRNA 1XCCA 4QQ7A 3TKSC 1G7OA 3KTBA 4BL7A 3WT2A 1V58A 4K7IA 2H73A 4K2XA 4MABA 2XHFA 5JWOB 1GH2A 2WGRA 3I43A 4K6XA 4G0LA 1ZYPA 4KF9A 1K0NA 2I1UA 5IMCA 1AUCA 3E3EA 4POMA 2RM5A 1GSSA 3TKSE 4MF6A 1EEMA 2DJ0A 1FO5A 1DBYA 5CRGA 4PTSA 2VM1A 5HR3A 1BEDA 2OADA 4MCUA 4Q5NA 3HHVA 1K0MA 1B9XC 2DKHA 3ZFLA 2VLTA 2IMIA 2H6XA 2MBTA 5DBQA 2VCWA 3LXZA 3HY2A 3KH7A 2DLXA 5F06A 3GX0A 3IV4A 5G31A 3AY8A 4O5RA 4POKA 1DSBA 4J2FA 3N5OA 3C8EA 4V2NA 2DMMA 2WRTA 1OC9A 4GF0A 2YV9A 4MJCA 5COHA 1GUKA 2FD3A 3F0IA 5IOWA 3F4TA 4ZB6A 5ECSA 2OA7A 3C7MA 2I81A 3FYGA 1FG4A 3CBUA 2GSSA 3R3EA 1XVQA 2YCDA 2XPDA 5ID2A 3IBHA 5DJLA 1AC1A 2HRKA 2H76A 3TOTA 1YDKA 5H5QA 2B5EA 1WRYA 4GSTA 3BJ5A 4WKWA 2O7KA 1SK2A 1W89A 1EWXA 4CY8A 5KN3A 1XOAA 1PKZA 1MTCA 4K1FA 1JZOA 1X5EA 2HSMA 1NHOA 1TI1A 5ECPB 2VL2A 4GRFA 3CRTA 5DCGA 2RIIA 4TW5A 2YOIA 4USSA 1CQHA 1HNCA 3ZL5A 3ZFBA 1OE8A 9GSSA 4HOJA 4IJ3A 6GSTA 1TK5B 4WEYA 2WCIA 4MZCA 6GSVA 5AIVA 1M0UA 3ZMKA 4EUYA 2GDRA 3VPTA 3KTLA 1YEPA 1AAZA 2ALBA 4CW9A 8GSSA 2O89A 1GSDA 2KHPA 2FA4A 2QC7A 1PN9A 2K8SA 5DDLA 2R6KA 3TKRA 3MYDA 2H70A 3I9V2 2J23A 3UEMA 2C0DA 2B7JA 2H75A 6GSUA 4IKHA 4MDCA 2HNLA 4K8MA 4KW6A 3W8SA 4KAEA 2DJ1A 4ZL9A 1HNBA 2LTKA 2QA1A 5D9XA 4FIWA 2FUG2 1S3DA 2VD1A 1SYXA 1HNAA 3H93A 3D0ZA 4NV2A 5H5SA 2LS5A 1ML6A 2CZ3A 1NSWA 1YZXA 2GZZA 1FVJA 1A23A 1A0FA 3KD0A 3IK7A 5D96A 4ULXA 2N5AA 1MDIA 2EIRA 4FYBA 2C4JA 4GQFA 4NMUA 5IM9A 4AJ7A 3D4TA 1B4PA 1JZWA 4WETA 3ISOA 3TGZA 4OO4A 4TR4A 4EE0A 5A5KA 4HDEA 2YNXA 3G9BA 4K0GA 4I8BA 4IVFA 1TK0B 3ZTLA 5ECLB 1QGVA 4YAPA 4G0KA 1A2JA 4AF2A 1ERUA 3HJMA 2OE0A 2GSTA 3UBKA 2JU5A 1TDIA 1IYIA 1GNEA 1BJXA 3HVXA 1TJDA 3LFLA 2GZYA 2D2ZA
chains in the Genus database with same CATH topology
2YV7A 4KDYA 2HRFA 3RBTA 5DALB 2WS2A 3V1WA 3WT1A 2OE1A 7GSSA 4HJ2A 2XBIA 3MAKA 4N0VA 2XPEA 2GGTA 2V32A 2DIYA 4KCEA 1IYHA 1TU7A 3DMLA 5EPFA 5ENUA 1FHEA 3MNGA 2LNSA 2WFCA 1EV4A 3CMIA 5CREA 3M9JA 2DJ2A 1TRUA 3QOUA 2WULA 5J41A 5E4WA 2C3QA 3W8JA 1BX9A 4E8EA 2CQ9A 3LWAA 2R0CA 5ABRA 1BAYA 5CYYA 1Y6EA 1AXDA 2CAIA 5JCUA 2J9HA 2IMDA 5HR0A 1Z9HA 2LKUA 1UC7A 3IR4A 4EC0A 1GWCA 2IPAA 4MJEA 2DJ3A 4AJ6A 1A8YA 4IJIA 2C3TA 3P90A 1NHYA 2QKEA 2LJAA 4NHWA 3TB2A 2A4HA 3HJOA 1GTAA 4PUAA 2RM6A 1TTZA 2H6ZA 4L5LA 1EP8A 3KGKA 1OC8A 1SENA 1OKTA 2C3NA 1YF0A 1CQGA 1JFUA 4GCIA 3M3MA 3GHAA 2K6VA 2HT9A 4KSMA 4GWRA 2R3XA 4FYCA 1GSEA 1WJKA 2YPMA 3Q18A 1OYJA 2GS3A 1F6MC 2TRXA 3P7XA 1K0DA 1Q4JA 3HA9A 4WBRD 2VCTA 3LXTA 2HI7A 4G2EA 5A4UA 4LMVA 3IHQA 1PKWA 4V1Ag 1ZGNA 3QMXA 2AB6A 3GSSA 2LEGA 3WGDA 2FWEA 4L8EA 4I2TA 3GURA 3VI7A 5J5NA 1GTUA 1SYRA 1Z6MA 3QCPA 1GRXA 3ERGA 3HZ8A 4I5QA 3EYTA 4BVYB 1PA3A 1K0AA 3EINA 5FT3A 3A2XA 3RHCA 3KJYA 3A3TA 2A2SA 5F0GA 1PN0A 3GSTA 1TRSA 4XS4B 2DSAA 3GH6A 3FR3A 3TJGA 1X9MB 2LQQA 2WZ9A 1JZDA 2EIQA 2V41A 3L78A 2RUEA 3QAWA 5KOXA 5J4UA 1YF1A 5CAXA 5CRDA 1M9BA 3S9FA 4Z2RA 4P3YB 22GSA 4ML6A 2DKIA 2NVLA 4EF0A 4YQUA 2HSHA 3C73A 4GXZA 1XZOA 2L59A 1LBKA 1FOVA 2YP6A 3GKMA 5ECIB 1SL2B 3ZVJD 1TRWA 1VF4A 3IRAA 3FR9A 4K9ZA 4ILFA 2K8VA 2V1MA 3LYKA 2PPTA 3KMNA 3M1GA 3D5JA 1ZYEA 4POBA 2JADA 3QFBC 5IIZA 3UIWA 3L4NA 2OKAA 2HSYA 1S3CA 2LRTA 4WR5A 5BRTA 3APOA 3TKSA 3RPNA 3GL5A 2DBCA 3QPMA 5IPGA 1O81A 1PMTA 2PUKC 3EC3A 5D9TA 3VPQA 2FHEA 2IMFA 3VK9A 2FCHA 3FEUA 2CT6A 4YKFA 1N2AA 1SKWB 4H86A 4YKGA 4YQVA 3APSA 3KP9A 3A5IA 3CRUA 3CTGA 5ELGA 1W4VA 2IWTA 1T7PB 1O7UA 5HR1A 4CHSA 1U3AA 1HD2A 1H75A 2FA8A 3HYPA 2L5OA 1GNWA 1NW2A 3GTUA 1EP7A 2A2RA 4ZXGA 4TR1A 2H6YA 3ME8A 1MEKA 4TR0A 1VF3A 5DQYA 3FZ5A 3UJ1A 3TKQA 1XWKA 2GSRA 2B1LA 3IOSA 3SBCA 1X9WB 1SL1B 1GL8A 1THOA 2PVQA 4KCAA 5KN1A 2FWFA 2VOCA 4RQRA 4JEDA 3UL3A 2NTOA 1ON4A 1XWCA 4ML1A 3VWWA 5ECHB 4OFMA 3QDNA 2JACA 2CVKA 2ZCTA 1T4YA 2IJYA 3FHKA 4AGSA 2HZFA 1J0FA 2VAFA 1T1VA 4IQ1A 1WOUA 5DAKB 3LEFA 3BCIA 4NPBA 1WMJA 3EMPA 4X4JA 1OC3A 3CSHA 3ZVJA 1RW1A 2KLXA 1G7EA 1A8LA 3MDKA 4D73A 2VL3A 3KMOA 4JRRA 3CTFA 3OR5A 2LRNA 2K9FA 2OBIA 3IAM2 2LSTA 3KM6A 3RDWA 1WP0A 1GP1A 3FZ4A 2IN3A 4TR3A 1DUGA 2LNTA 2ON7A 2H1DA 5BMUA 2P5QA 3FY7A 1GSFA 4O32A 3H79A 4HZ2A 4MJAA 1M2DA 4EVMA 3R2QA 4Z7XA 4PX1A 2O87A 5LCZA 4POLA 4GTUA 1EEJA 1PSQA 3DD3A 2JSZA 4FO5A 4MLYA 1V98A 2YANA 3GX8A 4TVEA 4MF7A 4KNDA 2F8AA 2GQLA 3QD9A 1T4ZA 4X43A 5G5EA 3LSZA 1PQNA 1BQ7A 3IC4A 1G6WA 2VUPA 3P8WA 5EVOA 2YWIA 5ECQB 3DXBA 5DQSA 5CRWA 3TRPA 1QMVA 2Z9SA 6GSYA 5LNKe 1V40A 1EV9A 5GSTA 4TXOB 3BOAA 1YJ6A 3IK9A 2HE3A 3PINA 4PQIA 4A5PA 3L9SA 1QQ2A 5IO2A 2GT5A 1FW1A 2NPBA 4ZL7A 3FK8A 5DVBA 2KOKA 4BL7B 4EIQA 1U88A 1C72A 3J7Yk 3F6FA 1USBA 20GSA 2L6DA 4G19A 4YAVA 4WBJA 1A2LA 3RHBA 2FY6A 4V2MA 1MDJA 18GSA 3O3TA 1XWGA 5G1KA 3WD6A 4F0CA 3LORA 4MJBA 2AJQB 5DCHA 3F8UA 2DMLA 1M2AA 1AQXA 3IA1A 5HQPA 5F07A 3CSIA 1K3LA 2HZEA 2VL2C 4BA7A 1I5GA 2I3YA 1B9YC 4HU9A 3TDGA 1TKDB 3MSZA 3M8NA 3J7Yb 3VWVA 16GSA 3GN3A 1WPIA 4K7OA 5FWGA 5J9CA 4N0ZA 1Z7RA 4Z2UA 4KX4A 5GSSA 2V6OA 2LQOA 4IBPA 1OC9B 2B5XA 1PRXA 5ECMB 4OCFA 1TP9A 4XHMA 5D73A 2E0QA 4O7HA 11GSA 2IFQA 3EWLA 4TKYA 5ECOB 3KZQA 1A0RP 4WF4A 1URMA 5ID2B 2H74A 3UOMA 4V1Ap 1T3BA 1SJ6A 5ECNB 1BG5A 3LJRA 3VWUA 5DJMA 3Q19A 2YJHA 1X0RA 2R37A 3N9JA 4XS4A 2JZTA 4EDZA 3KXOA 4HEA2 4NWYA 2PGTA 1T8EB 5GAND 2H66A 1SJZA 3TJJA 1O85A 5IMAA 4XS1A 1TOFA 1ZZYA 1ERVA 4ZL8A 3ZZXA 1F3BA 1HQOA 4NV5A 4O5QA 2WDUA 2F51A 4KDXA 5F05A 5IMVA 4L5OA 2LRCA 1GULA 4JU5A 2E2GA 3NZNA 4IS0A 5A4WA 3F3QA 1LU4A 3CXGA 1XXUA 3UARA 3DYRA 4TRXA 4K5RA 3GIXA 1XWAA 3ZIJA 4OCEA 4RI7A 3O6TA 3ZREA 3GMFA 5G30A 4NXIA 5JCGA 1X9SB 4IQAA 1XW5A 2PVOC 3LGCA 5CRHA 1VGLA 4OFTA 5AIXA 5B6MA 1K0CA 2NDOA 3IC8A 1DE2A 4JBBA 3TJBA 2IIYA 4HUAA 2DJJA 2KP1A 1VF2A 3EURA 2ZUPA 3F6DA 3BBYA 3HD5A 2F8FA 3QAVA 2GQMA 1I9DA 2DIZA 5C04A 1U3IA 4BWQA 4G9HA 4KB3A 4LLRA 5IOXA 4RUVA 4LL1B 2VM2A 1J08A 2I4AA 3EE2A 2IMEA 3IHGA 4XS6A 1A2MA 2M46A 4XRAA 4EL1A 4EXJA 4BVXA 5C00A 1AQWA 5KN2A 4ZB9A 2CX4A 1WWJA 3GUSA 1SK1A 5HFKA 2YZUA 2C80A 5EL8A 2N5FA 4BPYA 2E2MA 3D4MA 1JLVA 2YN1A 4MF5A 10GSA 2F9SA 5CNWA 1B4QA 4AJ8A 13GSA 1XFLA 1DE1A 1GLQA 2X8GA 3KH9A 2YWNA 1R7HA 3U5RE 4ECCA 1E2YA 2H0HA 2X49A 3G7YA 3UVHA 2C1YA 1XBSA 3VFIA 3F4RA 4DSQA 1FB0A 2R4VA 2JL4A 3FZ9A 5IO0A 1MD3A 3EU3A 3QFAC 3M9KA 4GSSA 4F2IA 3H4KA 4DSSB 2L4QA 1V2AA 2L57A 3TUEA 5D8IA 6GSWA 3D6IA 1TRVA 4JE1A 2GVPA 5HR2A 4K7NA 3DEXA 2YJ7A 3TCOA 4PNGA 6GSSA 4EKZA 2QA2A 4X1UA 3D21A 1RK4A 4KSOA 2PU9C 3ZYWA 1KNGA 2GT6A 4IGJA 2MMAA 4YQMA 3EMXA 1M99A 12GSA 2B1KA 1SU9A 2R5GA 2UZ8A 3LG6A 3E9JB 2RLIA 2V2GA 4IHUA 1FB6A 2E7PA 3BD2A 1V57A 4F03A 3HZ4A 2VLUA 2VCVA 3TRQA 2WB9A 3L9UA 2GZPA 2G2QA 1O8WA 3QR6A 2R2JA 4IP6A 3P2AA 2RUFA 1PD21 4WF5A 5EY6A 4KGIA 1AIUA 1V9WA 4MK3A 2NBSA 2P0GA 3HXSA 4ICYA 3DRNA 1ABAA 3GFKA 4DSRA 4OWYA 3GL3A 4OO5A 1R4WA 1SD9A 2AAWA 5D93A 4ZBAA 3F3RA 4QL7A 3KIJA 5CO3A 1O8XA 4MPFA 4MZBA 2H0GA 1U87A 2OJLA 1OKDA 2VCXA 4KDUA 1HYUA 2B7KA 3GNJA 3PGTA 3VLNA 2QGVA 1F37A 3C1SA 3GA4A 3HVVA 4MH2A 4PNFA 4HU7A 4XCSA 1QUWA 4V2LA 2CVDA 3DIEA 4F0BA 5KN0A 1MDKA 2AHEA 2C0EA 4Z2TA 4Q5RA 2VO4A 3TOUA 2YWMA 2BTOT 4YH2A 2ES7A 4QL9A 4Q5QA 1UN2A 3LQ7A 1WE0A 2O8VB 3KCMA 1XWBA 2MMZA 1XOBA 5AGYA 2F3MA 4PQ1A 1TXXA 1ZL9A 3IDVA 2FNOA 1X5DA 4L0UA 3FRCA 1NM3A 3NIVA 3UBLA 4BWSA 2HRAA 2VL9A 5B6NA 1JLWA 3IXRA 3L0HA 2X4AA 2CVBA 3FMWA 4L0WA 4J56E 1JHBA 1UA5A 4LA1A 2ZNMA 1JZRA 1F2EA 2X99A 1R26A 1U6TA 3Q74A 3HJPA 2V6KA 2EC4A 2R0GA 5INYA 3TJKA 2HXKA 3FR6A 14GSA 4K5SA 1EOHA 1K0BA 2X8CA 1ZYNA 4PUFC 2TIRA 2CX3A 2WJUA 5G2ZA 3ME7A 1ACVA 3WYWA 3G7JA 3QAGA 1Z3EA 1TU8A 3C71A 1XVWA 3GH9A 2GTUA 2H0IA 5F8BA 3A2WA 5D9WA 1S3AA 2YWOA 4MPGA 4F82A 1QXHA 2P31A 1YEXA 5DALA 4O92A 1GUMA 4FH8A 3E0UA 4MP4A 2M72A 3APQA 1OVNA 3IE3A 1KEBA 4KH7A 2H1BA 2LJKA 1ZYQB 1PL2A 2DJKA 3L9VA 1GTBA 1Z6NA 4MMMA 4XTSA 2R0PA 4HJMA 3A2VA 2LJRA 2MYGA 4JR6A 1EGOA 4CY6A 3GTUB 4OFNA 4TR1B 3DGQA 1AQVA 1MD4A 1R5PA 2CV4A 3H1NA 3D22A 2CZ2A 2YZHA 3F9UA 3VWXA 2FLSA 1ERWA 2L6CA 4DVCA 4PXOA 1ST9A 4TXVA 3M0FA 3EVIA 4G0IA 4OD7A 3HKRA 1H4OA 2O85A 3C1RA 3DVWA 4HQSA 3PPUA 3Q6OA 5J3RA 2OE3A 2H8LA 5IPHA 1ZOFA 3KEBA 5E59A 5B7CA 2N5BA 4EIPA 2FWHA 3A5WA 1M9AA 1Q98A 5CP1A 2OACA 4F9ZA 1PL1A 4ZBDA 1QK8A 3GRXA 1B8XA 1BYEA 2XBQA 2L4CA 4D73B 1N8JA 2TRCP 1X5CA 5KEJA 2MMOA 4LL4B 1GSQA 4NAXA 2B6MA 5J9BA 2BMXA 4FQUA 4IN0A 1Z7PA 1SJIA 3K8NA 4IW9A 3IAS2 3GKKA 1EOGA 2CA8A 4WR4A 3U6VA 1EGRA 1E6BA 4G10A 2A4VA 1RQMA 1GTIA 3TKPA 2VCQA 4BVYA 1KBNA 2VCZA 2XC2A 1YKAA 1ZMAA 4XRDA 3W6GA 3PR8A 1ILOA 1YY7A 1A24A 3UAPA 2H19A 3IPZA 4N10A 2GSQA 4DSSA 3H8QA 4N30A 2JZRA 3WGEA 1ZCPA 1LJRA 2H72A 2BJXA 4N11A 4KA0A 1YQ1A 3GV1A 4ECJA 5AN1A 2C0GA 2GQKA 1SKSB 4ECIA 1M7TA 4PQHA 1PX6A 2HFDA 1B48A 3EU4A 3FW2A 1K3OA 1XW6A 2LV3A 4ID0A 3LYPA 5D9VA 5GZZB 2B3SA 4MZWA 5A4VA 4LMWA 3MWHA 5ECKB 3DKSA 3SWLA 3ERWA 2P5RA 1AW9A 2H1GA 4I2UA 5GAPD 2KP2A 1UVZA 4TOPA 1OE7A 2B5YA 5G5FA 5KOWA 4X0XA 4PGTA 17GSA 4CDOA 3I69A 3ZITA 3EPTA 4TN8A 1GSUA 3ZRDA 5G1LA 5H5RA 1XIYA 2IL3A 3GKXA 1F9MA 5AISA 4KUNA 1SK0A 2C0FA 3US3A 1TW9A 3DVXA 5FHIA 3HDCA 2JZSA 2HYXA 4E8HA 1F3AA 3LW9A 1VRSD 2FWGA 3CYNA 2X64A 2VD0A 3G7IA 5IQYA 4FYUA 2HZEB 3HCZA 5HFGA 4GSNA 3FZAA 3CSJA 4JZQA 1Y25A 3NOFA 2VIMA 1O6JA 1J9BA 5IMDA 5L71A 4KE3A 1TK8B 5JCWA 3VI5A 4K0NA 2C8UA 4ISDA 2KUCA 2H71A 5ELAA 3UVTA 1G6YA 3UMAA 19GSA 4ECBA 2ON5A 2AV4A 4HI7A 2PN8A 2JSYA 2DC5A 5B8AA 4ZB8A 6GSXA 5HFIA 2LUSA 2IFQB 4O5UA 2EIOA 2FGXA 4JR4A 1O73A 1THXA 2G0FA 1GSYA 2REMA 3VURA 1XPVA 3F63A 5DAKA 1FVKA 1QFNA 2PERA 2MBSA 3HVSA 1G0TA 3I6AA 4ZILA 3JCML 5IMZA 4I97A 2L5LA 2QSIA 3ZLPA 4IELA 2AYTA 1OAZA 5LD0A 4I6XA 4OMVA 1FAAA 1T00A 4RQXA 1K3YA 2M80A 2PBJA 4DEJA 4MA9A 2K18A 4K2DA 1XW9A 3GKNA 1PX7A 4XIHA 4GQCA 3TJFA 1GUHA 2MMNA 1WIKA 4WXTA 2MZCA 5B8BA 4MNNA 4NHZA 3ZMLA 2PWJA 5JWQB 3GYKA 1SD8A 4ZBBA 2I9HA 3F4SA 3MIXA 2VLVA 4HQZA 1GLPA 3KP8A 5JWRB 1TI3A 3RPPA 1Z5YE 3WGXA 4MH3A 4IP1A 4J57E 1EZKA 1ERTA 2H30A 3BCKA 2HLSA 1K0OA 1PGTA 4EO3A 2OBKA 1VF1A 2PMTA 3ZIVA 3DWVA 1R5AA 2IMKA 4PURA 4ZIJA 3ERFA 3ED3A 2AUVA 3FKFA 4RI6A 1M2BA 5ECRB 1YKCA 1SKRB 2H01A 4GLTA 3TRXA 4ACSA 1FOHA 5IMFA 4TXOA 3O76A 4EDYA 2GLRA 2CAQA 4BVXB 2A2PA 1KTEA 3PH9A 2H1AA 4Q5FA 4HS1A 3RAZA 1SL0B 2X8HA 4HZ4A 2HRNA 1XCCA 4QQ7A 3TKSC 1G7OA 3KTBA 4BL7A 3WT2A 1V58A 4K7IA 2H73A 4K2XA 4MABA 2XHFA 5JWOB 1GH2A 2WGRA 3I43A 4K6XA 4G0LA 1ZYPA 4KF9A 1K0NA 2I1UA 5IMCA 1AUCA 3E3EA 4POMA 2RM5A 1GSSA 3TKSE 4MF6A 1EEMA 2DJ0A 1FO5A 1DBYA 5CRGA 4PTSA 2VM1A 5HR3A 1BEDA 2OADA 4MCUA 4Q5NA 3HHVA 1K0MA 1B9XC 2DKHA 3ZFLA 2VLTA 2IMIA 2H6XA 2MBTA 5DBQA 2VCWA 3LXZA 3HY2A 3KH7A 2DLXA 5F06A 3GX0A 3IV4A 5G31A 3AY8A 4O5RA 4POKA 1DSBA 4J2FA 3N5OA 3C8EA 4V2NA 2DMMA 2WRTA 1OC9A 4GF0A 2YV9A 4MJCA 5COHA 1GUKA 2FD3A 3F0IA 5IOWA 3F4TA 4ZB6A 5ECSA 2OA7A 3C7MA 2I81A 3FYGA 1FG4A 3CBUA 2GSSA 3R3EA 1XVQA 2YCDA 2XPDA 5ID2A 3IBHA 5DJLA 1AC1A 2HRKA 2H76A 3TOTA 1YDKA 5H5QA 2B5EA 1WRYA 4GSTA 3BJ5A 4WKWA 2O7KA 1SK2A 1W89A 1EWXA 4CY8A 5KN3A 1XOAA 1PKZA 1MTCA 4K1FA 1JZOA 1X5EA 2HSMA 1NHOA 1TI1A 5ECPB 2VL2A 4GRFA 3CRTA 5DCGA 2RIIA 4TW5A 2YOIA 4USSA 1CQHA 1HNCA 3ZL5A 3ZFBA 1OE8A 9GSSA 4HOJA 4IJ3A 6GSTA 1TK5B 4WEYA 2WCIA 4MZCA 6GSVA 5AIVA 1M0UA 3ZMKA 4EUYA 2GDRA 3VPTA 3KTLA 1YEPA 1AAZA 2ALBA 4CW9A 8GSSA 2O89A 1GSDA 2KHPA 2FA4A 2QC7A 1PN9A 2K8SA 5DDLA 2R6KA 3TKRA 3MYDA 2H70A 3I9V2 2J23A 3UEMA 2C0DA 2B7JA 2H75A 6GSUA 4IKHA 4MDCA 2HNLA 4K8MA 4KW6A 3W8SA 4KAEA 2DJ1A 4ZL9A 1HNBA 2LTKA 2QA1A 5D9XA 4FIWA 2FUG2 1S3DA 2VD1A 1SYXA 1HNAA 3H93A 3D0ZA 4NV2A 5H5SA 2LS5A 1ML6A 2CZ3A 1NSWA 1YZXA 2GZZA 1FVJA 1A23A 1A0FA 3KD0A 3IK7A 5D96A 4ULXA 2N5AA 1MDIA 2EIRA 4FYBA 2C4JA 4GQFA 4NMUA 5IM9A 4AJ7A 3D4TA 1B4PA 1JZWA 4WETA 3ISOA 3TGZA 4OO4A 4TR4A 4EE0A 5A5KA 4HDEA 2YNXA 3G9BA 4K0GA 4I8BA 4IVFA 1TK0B 3ZTLA 5ECLB 1QGVA 4YAPA 4G0KA 1A2JA 4AF2A 1ERUA 3HJMA 2OE0A 2GSTA 3UBKA 2JU5A 1TDIA 1IYIA 1GNEA 1BJXA 3HVXA 1TJDA 3LFLA 2GZYA 2D2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YV7 A;  4KDY A;  2HRF A;  3RBT A;  5DAL B;  2WS2 A;  3V1W A;  3WT1 A;  2OE1 A;  7GSS A;  4HJ2 A;  2XBI A;  3MAK A;  4N0V A;  2XPE A;  2GGT A;  2V32 A;  2DIY A;  4KCE A;  1IYH A;  1TU7 A;  3DML A;  5EPF A;  5ENU A;  1FHE A;  3MNG A;  2LNS A;  2WFC A;  1EV4 A;  3CMI A;  5CRE A;  3M9J A;  2DJ2 A;  1TRU A;  3QOU A;  2WUL A;  5J41 A;  5E4W A;  2C3Q A;  3W8J A;  1BX9 A;  4E8E A;  2CQ9 A;  3LWA A;  5ABR A;  1BAY A;  5CYY A;  1Y6E A;  1AXD A;  2CAI A;  5JCU A;  2J9H A;  2IMD A;  5HR0 A;  1Z9H A;  2LKU A;  1UC7 A;  3IR4 A;  4EC0 A;  1GWC A;  2IPA A;  4MJE A;  2DJ3 A;  4AJ6 A;  1A8Y A;  4IJI A;  2C3T A;  3P90 A;  1NHY A;  2QKE A;  2LJA A;  4NHW A;  3TB2 A;  3HJO A;  1GTA A;  4PUA A;  2RM6 A;  1TTZ A;  2H6Z A;  4L5L A;  1EP8 A;  3KGK A;  1OC8 A;  1SEN A;  1OKT A;  2C3N A;  1YF0 A;  1CQG A;  1JFU A;  4GCI A;  3M3M A;  3GHA A;  2K6V A;  2HT9 A;  4KSM A;  4GWR A;  2R3X A;  4FYC A;  1GSE A;  1WJK A;  2YPM A;  3Q18 A;  1OYJ A;  2GS3 A;  1F6M C;  2TRX A;  3P7X A;  1K0D A;  1Q4J A;  3HA9 A;  4WBR D;  2VCT A;  3LXT A;  2HI7 A;  4G2E A;  5A4U A;  4LMV A;  3IHQ A;  1PKW A;  4V1A g;  1ZGN A;  3QMX A;  2AB6 A;  3GSS A;  2LEG A;  3WGD A;  2FWE A;  4L8E A;  4I2T A;  3GUR A;  3VI7 A;  5J5N A;  1GTU A;  1SYR A;  1Z6M A;  3QCP A;  1GRX A;  3ERG A;  3HZ8 A;  4I5Q A;  3EYT A;  1PA3 A;  1K0A A;  3EIN A;  5FT3 A;  3A2X A;  3RHC A;  3KJY A;  3A3T A;  2A2S A;  5F0G A;  3GST A;  1TRS A;  4XS4 B;  2DSA A;  3GH6 A;  3FR3 A;  3TJG A;  1X9M B;  2LQQ A;  2WZ9 A;  1JZD A;  2EIQ A;  2V41 A;  3L78 A;  2RUE A;  3QAW A;  5J4U A;  1YF1 A;  5CAX A;  5CRD A;  1M9B A;  3S9F A;  4P3Y B;  22GS A;  4ML6 A;  2NVL A;  4EF0 A;  4YQU A;  2HSH A;  3C73 A;  4GXZ A;  1XZO A;  2L59 A;  1LBK A;  1FOV A;  2YP6 A;  3GKM A;  5ECI B;  1SL2 B;  3ZVJ D;  1TRW A;  1VF4 A;  3IRA A;  3FR9 A;  4K9Z A;  4ILF A;  2K8V A;  2V1M A;  3LYK A;  2PPT A;  3KMN A;  3M1G A;  3D5J A;  1ZYE A;  4POB A;  2JAD A;  3QFB C;  5IIZ A;  3UIW A;  3L4N A;  2OKA A;  2HSY A;  1S3C A;  2LRT A;  4WR5 A;  3APO A;  3TKS A;  3RPN A;  3GL5 A;  2DBC A;  3QPM A;  5IPG A;  1O81 A;  1PMT A;  2PUK C;  3EC3 A;  5D9T A;  3VPQ A;  2FHE A;  2IMF A;  3VK9 A;  2FCH A;  3FEU A;  2CT6 A;  1N2A A;  1SKW B;  4H86 A;  4YQV A;  3APS A;  3KP9 A;  3CRU A;  3CTG A;  5ELG A;  1W4V A;  2IWT A;  1T7P B;  1O7U A;  5HR1 A;  4CHS A;  1U3A A;  1HD2 A;  1H75 A;  2FA8 A;  3HYP A;  2L5O A;  1GNW A;  1NW2 A;  3GTU A;  1EP7 A;  2A2R A;  4ZXG A;  4TR1 A;  2H6Y A;  3ME8 A;  1MEK A;  4TR0 A;  1VF3 A;  5DQY A;  3FZ5 A;  3UJ1 A;  3TKQ A;  1XWK A;  2GSR A;  2B1L A;  3IOS A;  3SBC A;  1X9W B;  1SL1 B;  1GL8 A;  1THO A;  2PVQ A;  4KCA A;  5KN1 A;  2FWF A;  2VOC A;  4RQR A;  4JED A;  3UL3 A;  2NTO A;  1ON4 A;  1XWC A;  4ML1 A;  3VWW A;  5ECH B;  4OFM A;  3QDN A;  2JAC A;  2CVK A;  2ZCT A;  1T4Y A;  2IJY A;  3FHK A;  4AGS A;  2HZF A;  1J0F A;  2VAF A;  1T1V A;  4IQ1 A;  1WOU A;  5DAK B;  3LEF A;  3BCI A;  4NPB A;  1WMJ A;  3EMP A;  1OC3 A;  3CSH A;  3ZVJ A;  1RW1 A;  2KLX A;  1G7E A;  1A8L A;  3MDK A;  4D73 A;  2VL3 A;  3KMO A;  4JRR A;  3CTF A;  3OR5 A;  2LRN A;  2K9F A;  2OBI A;  3IAM 2;  2LST A;  3KM6 A;  3RDW A;  1WP0 A;  1GP1 A;  3FZ4 A;  2IN3 A;  4TR3 A;  1DUG A;  2LNT A;  2ON7 A;  2H1D A;  2P5Q A;  3FY7 A;  1GSF A;  4O32 A;  3H79 A;  4HZ2 A;  4MJA A;  1M2D A;  4EVM A;  3R2Q A;  4Z7X A;  4PX1 A;  2O87 A;  5LCZ A;  4POL A;  4GTU A;  1EEJ A;  1PSQ A;  3DD3 A;  2JSZ A;  4FO5 A;  4MLY A;  1V98 A;  2YAN A;  3GX8 A;  4TVE A;  4MF7 A;  4KND A;  2F8A A;  2GQL A;  3QD9 A;  1T4Z A;  4X43 A;  5G5E A;  3LSZ A;  1PQN A;  1BQ7 A;  3IC4 A;  1G6W A;  2VUP A;  3P8W A;  5EVO A;  2YWI A;  5ECQ B;  3DXB A;  5DQS A;  5CRW A;  3TRP A;  1QMV A;  2Z9S A;  6GSY A;  5LNK e;  1V40 A;  1EV9 A;  5GST A;  4TXO B;  3BOA A;  1YJ6 A;  3IK9 A;  2HE3 A;  3PIN A;  4PQI A;  3L9S A;  1QQ2 A;  5IO2 A;  2GT5 A;  1FW1 A;  2NPB A;  4ZL7 A;  3FK8 A;  5DVB A;  2KOK A;  1U88 A;  1C72 A;  3J7Y k;  3F6F A;  1USB A;  20GS A;  2L6D A;  4G19 A;  4YAV A;  4WBJ A;  1A2L A;  3RHB A;  2FY6 A;  4V2M A;  1MDJ A;  18GS A;  3O3T A;  1XWG A;  5G1K A;  3WD6 A;  4F0C A;  3LOR A;  4MJB A;  2AJQ B;  5DCH A;  3F8U A;  2DML A;  1M2A A;  1AQX A;  3IA1 A;  5HQP A;  5F07 A;  3CSI A;  1K3L A;  2HZE A;  2VL2 C;  4BA7 A;  1I5G A;  2I3Y A;  1B9Y C;  4HU9 A;  3TDG A;  1TKD B;  3MSZ A;  3M8N A;  3J7Y b;  3VWV A;  16GS A;  3GN3 A;  1WPI A;  4K7O A;  5FWG A;  5J9C A;  4N0Z A;  1Z7R A;  4KX4 A;  5GSS A;  2V6O A;  2LQO A;  4IBP A;  1OC9 B;  2B5X A;  1PRX A;  5ECM B;  4OCF A;  1TP9 A;  4XHM A;  5D73 A;  2E0Q A;  4O7H A;  11GS A;  2IFQ A;  3EWL A;  4TKY A;  5ECO B;  3KZQ A;  1A0R P;  4WF4 A;  1URM A;  5ID2 B;  2H74 A;  3UOM A;  4V1A p;  1T3B A;  1SJ6 A;  5ECN B;  1BG5 A;  3LJR A;  3VWU A;  5DJM A;  3Q19 A;  2YJH A;  1X0R A;  2R37 A;  3N9J A;  4XS4 A;  2JZT A;  4EDZ A;  3KXO A;  4HEA 2;  4NWY A;  2PGT A;  1T8E B;  5GAN D;  2H66 A;  1SJZ A;  3TJJ A;  1O85 A;  5IMA A;  4XS1 A;  1TOF A;  1ZZY A;  1ERV A;  4ZL8 A;  3ZZX A;  1F3B A;  1HQO A;  4NV5 A;  2WDU A;  2F51 A;  4KDX A;  5F05 A;  5IMV A;  4L5O A;  2LRC A;  1GUL A;  4JU5 A;  2E2G A;  3NZN A;  4IS0 A;  5A4W A;  3F3Q A;  1LU4 A;  3CXG A;  1XXU A;  3UAR A;  3DYR A;  4TRX A;  3GIX A;  1XWA A;  3ZIJ A;  4OCE A;  4RI7 A;  3O6T A;  3ZRE A;  3GMF A;  5G30 A;  4NXI A;  5JCG A;  1X9S B;  4IQA A;  1XW5 A;  2PVO C;  3LGC A;  5CRH A;  1VGL A;  4OFT A;  5AIX A;  5B6M A;  1K0C A;  2NDO A;  1DE2 A;  4JBB A;  3TJB A;  2IIY A;  4HUA A;  2DJJ A;  2KP1 A;  1VF2 A;  3EUR A;  2ZUP A;  3F6D A;  3BBY A;  3HD5 A;  2F8F A;  3QAV A;  2GQM A;  1I9D A;  2DIZ A;  5C04 A;  1U3I A;  4BWQ A;  4G9H A;  4KB3 A;  4LLR A;  5IOX A;  4RUV A;  4LL1 B;  2VM2 A;  1J08 A;  2I4A A;  3EE2 A;  2IME A;  4XS6 A;  1A2M A;  2M46 A;  4XRA A;  4EL1 A;  4EXJ A;  4BVX A;  5C00 A;  1AQW A;  5KN2 A;  4ZB9 A;  2CX4 A;  1WWJ A;  3GUS A;  1SK1 A;  5HFK A;  2YZU A;  2C80 A;  5EL8 A;  2N5F A;  4BPY A;  2E2M A;  3D4M A;  1JLV A;  2YN1 A;  4MF5 A;  10GS A;  2F9S A;  5CNW A;  1B4Q A;  4AJ8 A;  13GS A;  1XFL A;  1DE1 A;  1GLQ A;  2X8G A;  3KH9 A;  2YWN A;  1R7H A;  3U5R E;  4ECC A;  1E2Y A;  2H0H A;  3G7Y A;  3UVH A;  2C1Y A;  1XBS A;  3VFI A;  3F4R A;  4DSQ A;  1FB0 A;  2R4V A;  2JL4 A;  3FZ9 A;  5IO0 A;  1MD3 A;  3EU3 A;  3QFA C;  3M9K A;  4GSS A;  4F2I A;  3H4K A;  4DSS B;  2L4Q A;  1V2A A;  2L57 A;  3TUE A;  5D8I A;  6GSW A;  3D6I A;  1TRV A;  4JE1 A;  2GVP A;  5HR2 A;  4K7N A;  3DEX A;  2YJ7 A;  3TCO A;  4PNG A;  6GSS A;  4EKZ A;  4X1U A;  3D21 A;  1RK4 A;  4KSO A;  2PU9 C;  3ZYW A;  1KNG A;  2GT6 A;  4IGJ A;  2MMA A;  4YQM A;  3EMX A;  1M99 A;  12GS A;  2B1K A;  1SU9 A;  2R5G A;  3LG6 A;  3E9J B;  2RLI A;  2V2G A;  4IHU A;  1FB6 A;  2E7P A;  3BD2 A;  1V57 A;  4F03 A;  3HZ4 A;  2VLU A;  2VCV A;  3TRQ A;  2WB9 A;  3L9U A;  2GZP A;  2G2Q A;  1O8W A;  3QR6 A;  2R2J A;  4IP6 A;  3P2A A;  2RUF A;  1PD2 1;  4WF5 A;  5EY6 A;  4KGI A;  1AIU A;  1V9W A;  4MK3 A;  2NBS A;  2P0G A;  3HXS A;  3DRN A;  1ABA A;  3GFK A;  4DSR A;  4OWY A;  3GL3 A;  4OO5 A;  1R4W A;  1SD9 A;  2AAW A;  5D93 A;  4ZBA A;  3F3R A;  4QL7 A;  3KIJ A;  5CO3 A;  1O8X A;  4MPF A;  4MZB A;  2H0G A;  1U87 A;  2OJL A;  1OKD A;  2VCX A;  4KDU A;  1HYU A;  2B7K A;  3GNJ A;  3PGT A;  3VLN A;  2QGV A;  1F37 A;  3C1S A;  3GA4 A;  3HVV A;  4MH2 A;  4PNF A;  4HU7 A;  4XCS A;  1QUW A;  4V2L A;  2CVD A;  3DIE A;  4F0B A;  5KN0 A;  1MDK A;  2AHE A;  2C0E A;  4Q5R A;  2VO4 A;  3TOU A;  2YWM A;  2BTO T;  4YH2 A;  2ES7 A;  4QL9 A;  4Q5Q A;  1UN2 A;  3LQ7 A;  1WE0 A;  2O8V B;  3KCM A;  1XWB A;  2MMZ A;  1XOB A;  5AGY A;  2F3M A;  4PQ1 A;  1TXX A;  1ZL9 A;  3IDV A;  2FNO A;  1X5D A;  4L0U A;  3FRC A;  1NM3 A;  3NIV A;  3UBL A;  4BWS A;  2VL9 A;  5B6N A;  1JLW A;  3IXR A;  3L0H A;  2CVB A;  4L0W A;  4J56 E;  1JHB A;  1UA5 A;  4LA1 A;  2ZNM A;  1JZR A;  1F2E A;  2X99 A;  1R26 A;  1U6T A;  3Q74 A;  3HJP A;  2V6K A;  2EC4 A;  5INY A;  3TJK A;  2HXK A;  3FR6 A;  14GS A;  1EOH A;  1K0B A;  2X8C A;  4PUF C;  2TIR A;  2CX3 A;  2WJU A;  5G2Z A;  3ME7 A;  1ACV A;  3WYW A;  3G7J A;  3QAG A;  1Z3E A;  1TU8 A;  3C71 A;  1XVW A;  3GH9 A;  2GTU A;  2H0I A;  5F8B A;  3A2W A;  5D9W A;  1S3A A;  2YWO A;  4MPG A;  4F82 A;  1QXH A;  2P31 A;  1YEX A;  5DAL A;  4O92 A;  1GUM A;  4FH8 A;  3E0U A;  4MP4 A;  2M72 A;  3APQ A;  1OVN A;  3IE3 A;  1KEB A;  4KH7 A;  2H1B A;  2LJK A;  1ZYQ B;  1PL2 A;  2DJK A;  3L9V A;  1GTB A;  1Z6N A;  4MMM A;  4XTS A;  4HJM A;  3A2V A;  2LJR A;  2MYG A;  4JR6 A;  1EGO A;  3GTU B;  4OFN A;  4TR1 B;  3DGQ A;  1AQV A;  1MD4 A;  1R5P A;  2CV4 A;  3H1N A;  3D22 A;  2CZ2 A;  2YZH A;  3F9U A;  3VWX A;  2FLS A;  1ERW A;  2L6C A;  4DVC A;  4PXO A;  1ST9 A;  4TXV A;  3M0F A;  3EVI A;  4OD7 A;  3HKR A;  1H4O A;  2O85 A;  3C1R A;  3DVW A;  4HQS A;  3Q6O A;  5J3R A;  2OE3 A;  2H8L A;  5IPH A;  1ZOF A;  3KEB A;  5E59 A;  5B7C A;  2N5B A;  2FWH A;  3A5W A;  1M9A A;  1Q98 A;  5CP1 A;  2OAC A;  4F9Z A;  1PL1 A;  4ZBD A;  1QK8 A;  3GRX A;  1B8X A;  1BYE A;  2XBQ A;  2L4C A;  4D73 B;  1N8J A;  2TRC P;  1X5C A;  5KEJ A;  2MMO A;  4LL4 B;  1GSQ A;  4NAX A;  2B6M A;  5J9B A;  2BMX A;  4IN0 A;  1Z7P A;  1SJI A;  3K8N A;  4IW9 A;  3IAS 2;  3GKK A;  1EOG A;  2CA8 A;  4WR4 A;  3U6V A;  1EGR A;  1E6B A;  4G10 A;  2A4V A;  1RQM A;  1GTI A;  3TKP A;  2VCQ A;  4BVY A;  1KBN A;  2VCZ A;  2XC2 A;  1YKA A;  1ZMA A;  4XRD A;  3W6G A;  3PR8 A;  1ILO A;  1YY7 A;  1A24 A;  3UAP A;  2H19 A;  3IPZ A;  4N10 A;  2GSQ A;  4DSS A;  3H8Q A;  4N30 A;  2JZR A;  3WGE A;  1ZCP A;  1LJR A;  2H72 A;  2BJX A;  4N11 A;  4KA0 A;  1YQ1 A;  3GV1 A;  4ECJ A;  5AN1 A;  2C0G A;  2GQK A;  1SKS B;  4ECI A;  1M7T A;  4PQH A;  1PX6 A;  2HFD A;  1B48 A;  3EU4 A;  3FW2 A;  1K3O A;  1XW6 A;  2LV3 A;  4ID0 A;  3LYP A;  5D9V A;  5GZZ B;  2B3S A;  4MZW A;  5A4V A;  4LMW A;  3MWH A;  5ECK B;  3DKS A;  3SWL A;  3ERW A;  2P5R A;  1AW9 A;  2H1G A;  4I2U A;  5GAP D;  2KP2 A;  1UVZ A;  4TOP A;  1OE7 A;  2B5Y A;  5G5F A;  4X0X A;  4PGT A;  17GS A;  4CDO A;  3I69 A;  3ZIT A;  4TN8 A;  1GSU A;  3ZRD A;  5G1L A;  5H5R A;  1XIY A;  2IL3 A;  3GKX A;  1F9M A;  5AIS A;  4KUN A;  1SK0 A;  2C0F A;  3US3 A;  1TW9 A;  3DVX A;  5FHI A;  3HDC A;  2JZS A;  2HYX A;  4E8H A;  1F3A A;  1VRS D;  2FWG A;  3CYN A;  2X64 A;  2VD0 A;  3G7I A;  5IQY A;  4FYU A;  2HZE B;  3HCZ A;  5HFG A;  4GSN A;  3FZA A;  3CSJ A;  4JZQ A;  1Y25 A;  3NOF A;  2VIM A;  1O6J A;  1J9B A;  5IMD A;  5L71 A;  4KE3 A;  1TK8 B;  5JCW A;  3VI5 A;  4K0N A;  2C8U A;  4ISD A;  2KUC A;  5ELA A;  2H71 A;  3UVT A;  1G6Y A;  3UMA A;  19GS A;  4ECB A;  2ON5 A;  2AV4 A;  4HI7 A;  2PN8 A;  2JSY A;  2DC5 A;  5B8A A;  4ZB8 A;  6GSX A;  5HFI A;  2LUS A;  2IFQ B;  2EIO A;  2FGX A;  4JR4 A;  1O73 A;  1THX A;  2G0F A;  1GSY A;  2REM A;  3VUR A;  1XPV A;  3F63 A;  5DAK A;  1FVK A;  1QFN A;  2PER A;  2MBS A;  3HVS A;  1G0T A;  3I6A A;  4ZIL A;  3JCM L;  5IMZ A;  4I97 A;  2L5L A;  2QSI A;  3ZLP A;  4IEL A;  2AYT A;  1OAZ A;  5LD0 A;  4I6X A;  4OMV A;  1FAA A;  1T00 A;  4RQX A;  1K3Y A;  2M80 A;  2PBJ A;  4DEJ A;  4MA9 A;  2K18 A;  4K2D A;  1XW9 A;  3GKN A;  1PX7 A;  4XIH A;  4GQC A;  3TJF A;  1GUH A;  2MMN A;  1WIK A;  4WXT A;  2MZC A;  5B8B A;  4NHZ A;  3ZML A;  2PWJ A;  5JWQ B;  3GYK A;  1SD8 A;  4ZBB A;  2I9H A;  3F4S A;  2VLV A;  4HQZ A;  1GLP A;  3KP8 A;  5JWR B;  1TI3 A;  3RPP A;  1Z5Y E;  3WGX A;  4MH3 A;  4IP1 A;  4J57 E;  1EZK A;  1ERT A;  2H30 A;  3BCK A;  2HLS A;  1K0O A;  1PGT A;  4EO3 A;  2OBK A;  1VF1 A;  2PMT A;  3ZIV A;  3DWV A;  1R5A A;  2IMK A;  4PUR A;  4ZIJ A;  3ERF A;  3ED3 A;  2AUV A;  3FKF A;  4RI6 A;  1M2B A;  5ECR B;  1YKC A;  1SKR B;  2H01 A;  4GLT A;  3TRX A;  4ACS A;  5IMF A;  4TXO A;  3O76 A;  4EDY A;  2GLR A;  2CAQ A;  1KTE A;  3PH9 A;  2H1A A;  4Q5F A;  4HS1 A;  3RAZ A;  1SL0 B;  2X8H A;  4HZ4 A;  2HRN A;  1XCC A;  4QQ7 A;  3TKS C;  1G7O A;  3KTB A;  4BL7 A;  3WT2 A;  1V58 A;  4K7I A;  2H73 A;  4MAB A;  2XHF A;  5JWO B;  1GH2 A;  2WGR A;  3I43 A;  4K6X A;  1K0N A;  2I1U A;  5IMC A;  1AUC A;  3E3E A;  4POM A;  2RM5 A;  1GSS A;  3TKS E;  4MF6 A;  1EEM A;  2DJ0 A;  1FO5 A;  1DBY A;  5CRG A;  2VM1 A;  5HR3 A;  1BED A;  2OAD A;  4MCU A;  4Q5N A;  3HHV A;  1K0M A;  1B9X C;  3ZFL A;  2VLT A;  2IMI A;  2H6X A;  2MBT A;  5DBQ A;  2VCW A;  3LXZ A;  3HY2 A;  3KH7 A;  2DLX A;  5F06 A;  3GX0 A;  3IV4 A;  5G31 A;  3AY8 A;  4O5R A;  4POK A;  1DSB A;  4J2F A;  3N5O A;  3C8E A;  4V2N A;  2DMM A;  2WRT A;  1OC9 A;  4GF0 A;  2YV9 A;  4MJC A;  5COH A;  1GUK A;  2FD3 A;  3F0I A;  5IOW A;  3F4T A;  4ZB6 A;  5ECS A;  2OA7 A;  3C7M A;  2I81 A;  3FYG A;  1FG4 A;  3CBU A;  2GSS A;  1XVQ A;  2YCD A;  2XPD A;  5ID2 A;  3IBH A;  5DJL A;  1AC1 A;  2H76 A;  3TOT A;  1YDK A;  5H5Q A;  2B5E A;  1WRY A;  4GST A;  3BJ5 A;  4WKW A;  2O7K A;  1SK2 A;  1W89 A;  1EWX A;  5KN3 A;  1XOA A;  1PKZ A;  1MTC A;  4K1F A;  1JZO A;  1X5E A;  1NHO A;  1TI1 A;  5ECP B;  2VL2 A;  4GRF A;  3CRT A;  5DCG A;  2RII A;  2YOI A;  4TW5 A;  1CQH A;  1HNC A;  3ZL5 A;  3ZFB A;  1OE8 A;  9GSS A;  4HOJ A;  4IJ3 A;  6GST A;  1TK5 B;  4WEY A;  2WCI A;  4MZC A;  6GSV A;  5AIV A;  1M0U A;  3ZMK A;  4EUY A;  2GDR A;  3VPT A;  3KTL A;  1YEP A;  1AAZ A;  2ALB A;  4CW9 A;  8GSS A;  2O89 A;  1GSD A;  2KHP A;  2FA4 A;  2QC7 A;  1PN9 A;  2K8S A;  5DDL A;  2R6K A;  3TKR A;  2H70 A;  3I9V 2;  2J23 A;  3UEM A;  2C0D A;  2B7J A;  2H75 A;  6GSU A;  4IKH A;  4MDC A;  2HNL A;  4K8M A;  4KW6 A;  3W8S A;  4KAE A;  2DJ1 A;  4ZL9 A;  1HNB A;  2LTK A;  5D9X A;  4FIW A;  2FUG 2;  1S3D A;  2VD1 A;  1SYX A;  1HNA A;  3H93 A;  3D0Z A;  4NV2 A;  5H5S A;  2LS5 A;  1ML6 A;  2CZ3 A;  1NSW A;  1YZX A;  2GZZ A;  1FVJ A;  1A23 A;  1A0F A;  3KD0 A;  3IK7 A;  5D96 A;  4ULX A;  2N5A A;  1MDI A;  2EIR A;  4FYB A;  2C4J A;  4GQF A;  4NMU A;  5IM9 A;  4AJ7 A;  3D4T A;  1B4P A;  1JZW A;  4WET A;  3ISO A;  3TGZ A;  4OO4 A;  4TR4 A;  4EE0 A;  5A5K A;  4HDE A;  2YNX A;  3G9B A;  4K0G A;  4I8B A;  4IVF A;  1TK0 B;  3ZTL A;  5ECL B;  1QGV A;  4YAP A;  1A2J A;  4AF2 A;  1ERU A;  3HJM A;  2OE0 A;  2GST A;  3UBK A;  2JU5 A;  1TDI A;  1IYI A;  1GNE A;  1BJX A;  3HVX A;  1TJD A;  3LFL A;  2GZY A;  2D2Z A; 
#chains in the Genus database with same CATH topology
 2YV7 A;  4KDY A;  2HRF A;  3RBT A;  5DAL B;  2WS2 A;  3V1W A;  3WT1 A;  2OE1 A;  7GSS A;  1M3J A;  4HJ2 A;  2XBI A;  3MAK A;  4N0V A;  2XPE A;  2GGT A;  2V32 A;  2DIY A;  4KCE A;  1IYH A;  1TU7 A;  3DML A;  5EPF A;  5ENU A;  1FHE A;  3MNG A;  2LNS A;  2WFC A;  1EV4 A;  3CMI A;  5CRE A;  3M9J A;  2DJ2 A;  1TRU A;  3QOU A;  2WUL A;  5J41 A;  5E4W A;  2C3Q A;  3W8J A;  1BX9 A;  4E8E A;  2CQ9 A;  3LWA A;  2R0C A;  5ABR A;  1BAY A;  5CYY A;  1Y6E A;  1AXD A;  2CAI A;  5JCU A;  2J9H A;  2IMD A;  5HR0 A;  1Z9H A;  2LKU A;  1UC7 A;  3IR4 A;  4EC0 A;  1GWC A;  2IPA A;  4MJE A;  2DJ3 A;  4AJ6 A;  1A8Y A;  4IJI A;  2C3T A;  3P90 A;  1NHY A;  2QKE A;  2LJA A;  4NHW A;  3TB2 A;  2A4H A;  3HJO A;  1GTA A;  4PUA A;  2RM6 A;  1TTZ A;  2H6Z A;  4L5L A;  1EP8 A;  3KGK A;  1OC8 A;  1SEN A;  1OKT A;  2C3N A;  1YF0 A;  1CQG A;  1JFU A;  4GCI A;  3M3M A;  3GHA A;  2K6V A;  2HT9 A;  4KSM A;  4GWR A;  2R3X A;  4FYC A;  1GSE A;  1WJK A;  2YPM A;  3Q18 A;  1OYJ A;  2GS3 A;  1F6M C;  2TRX A;  3P7X A;  1K0D A;  1Q4J A;  3HA9 A;  4WBR D;  2VCT A;  3LXT A;  2HI7 A;  4G2E A;  5A4U A;  4LMV A;  3IHQ A;  1PKW A;  4V1A g;  1ZGN A;  3QMX A;  2AB6 A;  3GSS A;  2LEG A;  3WGD A;  2FWE A;  4L8E A;  4I2T A;  3GUR A;  3VI7 A;  5J5N A;  1GTU A;  1SYR A;  1Z6M A;  3QCP A;  1GRX A;  3ERG A;  3HZ8 A;  4I5Q A;  3EYT A;  4BVY B;  1PA3 A;  1K0A A;  3EIN A;  5FT3 A;  3A2X A;  3RHC A;  3KJY A;  3A3T A;  2A2S A;  5F0G A;  1PN0 A;  3GST A;  1TRS A;  4XS4 B;  2DSA A;  3GH6 A;  3FR3 A;  3TJG A;  1X9M B;  2LQQ A;  2WZ9 A;  1JZD A;  2EIQ A;  2V41 A;  3L78 A;  2RUE A;  3QAW A;  5KOX A;  5J4U A;  1YF1 A;  5CAX A;  5CRD A;  1M9B A;  3S9F A;  4Z2R A;  4P3Y B;  22GS A;  4ML6 A;  2DKI A;  2NVL A;  4EF0 A;  4YQU A;  2HSH A;  3C73 A;  4HSC X;  4GXZ A;  1XZO A;  2L59 A;  1LBK A;  1FOV A;  2YP6 A;  3GKM A;  5ECI B;  1SL2 B;  3ZVJ D;  1TRW A;  1VF4 A;  3IRA A;  3FR9 A;  4K9Z A;  4ILF A;  2K8V A;  2V1M A;  3LYK A;  2PPT A;  3KMN A;  3M1G A;  3D5J A;  1ZYE A;  4POB A;  2JAD A;  3QFB C;  5IIZ A;  3UIW A;  3L4N A;  2OKA A;  2HSY A;  1S3C A;  2LRT A;  4WR5 A;  5BRT A;  3APO A;  3TKS A;  3RPN A;  3GL5 A;  2DBC A;  3QPM A;  5IPG A;  1O81 A;  1PMT A;  2PUK C;  3EC3 A;  5D9T A;  3VPQ A;  2FHE A;  2IMF A;  3VK9 A;  2FCH A;  3FEU A;  2CT6 A;  4YKF A;  1N2A A;  1SKW B;  4H86 A;  4YKG A;  4YQV A;  3APS A;  3KP9 A;  3A5I A;  3CRU A;  3CTG A;  5ELG A;  1W4V A;  2IWT A;  1T7P B;  1O7U A;  5HR1 A;  4CHS A;  1U3A A;  1HD2 A;  1H75 A;  2FA8 A;  3HYP A;  2L5O A;  1GNW A;  1NW2 A;  3GTU A;  1EP7 A;  2A2R A;  4ZXG A;  4TR1 A;  2H6Y A;  3ME8 A;  1MEK A;  4TR0 A;  1VF3 A;  5DQY A;  3FZ5 A;  3UJ1 A;  3TKQ A;  1XWK A;  2GSR A;  2B1L A;  3IOS A;  3SBC A;  1X9W B;  1SL1 B;  1GL8 A;  1THO A;  2PVQ A;  4KCA A;  5KN1 A;  2FWF A;  2VOC A;  4RQR A;  4JED A;  3UL3 A;  2NTO A;  1ON4 A;  1XWC A;  4ML1 A;  3VWW A;  5ECH B;  4OFM A;  3QDN A;  2JAC A;  2CVK A;  2ZCT A;  1T4Y A;  2IJY A;  3FHK A;  4AGS A;  2HZF A;  1J0F A;  2VAF A;  1T1V A;  4IQ1 A;  1WOU A;  5DAK B;  3LEF A;  3BCI A;  4NPB A;  1WMJ A;  3EMP A;  4X4J A;  1OC3 A;  3CSH A;  3ZVJ A;  1RW1 A;  2KLX A;  1G7E A;  1A8L A;  3MDK A;  4D73 A;  2VL3 A;  3KMO A;  4JRR A;  3CTF A;  3OR5 A;  2LRN A;  2K9F A;  2OBI A;  3IAM 2;  2LST A;  3KM6 A;  3RDW A;  1WP0 A;  1GP1 A;  3FZ4 A;  2IN3 A;  4TR3 A;  1DUG A;  2LNT A;  2ON7 A;  2H1D A;  5BMU A;  2P5Q A;  3FY7 A;  1GSF A;  4O32 A;  3H79 A;  4HZ2 A;  4MJA A;  1M2D A;  4EVM A;  3R2Q A;  4Z7X A;  4PX1 A;  2O87 A;  5LCZ A;  4POL A;  4GTU A;  1EEJ A;  1PSQ A;  3DD3 A;  2JSZ A;  4FO5 A;  4MLY A;  1V98 A;  2YAN A;  3GX8 A;  4TVE A;  4MF7 A;  4KND A;  2F8A A;  2GQL A;  3QD9 A;  1T4Z A;  4X43 A;  5G5E A;  3LSZ A;  1PQN A;  1BQ7 A;  3IC4 A;  1G6W A;  2VUP A;  3P8W A;  5EVO A;  2YWI A;  5ECQ B;  3DXB A;  5DQS A;  5CRW A;  3TRP A;  1QMV A;  2Z9S A;  6GSY A;  5LNK e;  1V40 A;  1EV9 A;  5GST A;  4TXO B;  3BOA A;  1YJ6 A;  3IK9 A;  2HE3 A;  3PIN A;  4PQI A;  4A5P A;  3L9S A;  1QQ2 A;  5IO2 A;  2GT5 A;  1FW1 A;  2NPB A;  4ZL7 A;  3FK8 A;  5DVB A;  2KOK A;  4BL7 B;  4EIQ A;  1U88 A;  1C72 A;  3J7Y k;  3F6F A;  1USB A;  20GS A;  2L6D A;  4G19 A;  4YAV A;  4WBJ A;  1A2L A;  3RHB A;  2FY6 A;  4V2M A;  1MDJ A;  18GS A;  3O3T A;  1XWG A;  5G1K A;  3WD6 A;  4F0C A;  3LOR A;  4MJB A;  2AJQ B;  5DCH A;  3F8U A;  2DML A;  1M2A A;  1AQX A;  3IA1 A;  5HQP A;  5F07 A;  3CSI A;  1K3L A;  2HZE A;  2VL2 C;  4BA7 A;  1I5G A;  2I3Y A;  1B9Y C;  4HU9 A;  3TDG A;  1TKD B;  3MSZ A;  3M8N A;  3J7Y b;  3VWV A;  16GS A;  3GN3 A;  1WPI A;  4K7O A;  5FWG A;  5J9C A;  4N0Z A;  1Z7R A;  4Z2U A;  4KX4 A;  5GSS A;  2V6O A;  2LQO A;  4IBP A;  1OC9 B;  2B5X A;  1PRX A;  5ECM B;  4BIK A;  4OCF A;  1TP9 A;  4XHM A;  5D73 A;  2E0Q A;  4O7H A;  11GS A;  2IFQ A;  3EWL A;  4TKY A;  5ECO B;  3KZQ A;  1A0R P;  4WF4 A;  1URM A;  5ID2 B;  2H74 A;  3UOM A;  4V1A p;  1T3B A;  1SJ6 A;  5ECN B;  1BG5 A;  3LJR A;  3VWU A;  5DJM A;  3Q19 A;  2YJH A;  1X0R A;  2R37 A;  3N9J A;  4XS4 A;  2JZT A;  4EDZ A;  3KXO A;  4HEA 2;  4NWY A;  2PGT A;  1T8E B;  5GAN D;  2H66 A;  1SJZ A;  3TJJ A;  1O85 A;  5IMA A;  4XS1 A;  1TOF A;  1ZZY A;  1ERV A;  4ZL8 A;  3ZZX A;  1F3B A;  1HQO A;  4NV5 A;  4O5Q A;  2WDU A;  2F51 A;  4KDX A;  5F05 A;  5IMV A;  4L5O A;  2LRC A;  1GUL A;  4JU5 A;  2E2G A;  3NZN A;  4IS0 A;  5A4W A;  3F3Q A;  1LU4 A;  3CXG A;  1XXU A;  3UAR A;  3DYR A;  4TRX A;  4K5R A;  3GIX A;  1XWA A;  3ZIJ A;  4OCE A;  4RI7 A;  3O6T A;  3ZRE A;  3GMF A;  5G30 A;  4NXI A;  5JCG A;  1X9S B;  4IQA A;  1XW5 A;  2PVO C;  3LGC A;  5CRH A;  1VGL A;  4OFT A;  5AIX A;  5B6M A;  1K0C A;  2NDO A;  3IC8 A;  1DE2 A;  4JBB A;  3TJB A;  2IIY A;  4HUA A;  2DJJ A;  2KP1 A;  1VF2 A;  3EUR A;  2ZUP A;  3F6D A;  3BBY A;  3HD5 A;  2F8F A;  3QAV A;  2GQM A;  1I9D A;  2DIZ A;  5C04 A;  1U3I A;  4BWQ A;  4G9H A;  4KB3 A;  4LLR A;  5IOX A;  4RUV A;  4LL1 B;  2VM2 A;  1J08 A;  2I4A A;  3EE2 A;  2IME A;  3IHG A;  4XS6 A;  1A2M A;  2M46 A;  4XRA A;  4EL1 A;  4EXJ A;  4BVX A;  5C00 A;  1AQW A;  5KN2 A;  4ZB9 A;  2CX4 A;  1WWJ A;  3GUS A;  1SK1 A;  5HFK A;  2YZU A;  2C80 A;  5EL8 A;  2N5F A;  4BPY A;  2E2M A;  3D4M A;  1JLV A;  2YN1 A;  4MF5 A;  10GS A;  2F9S A;  5CNW A;  1B4Q A;  4AJ8 A;  13GS A;  1XFL A;  1DE1 A;  1GLQ A;  2X8G A;  3KH9 A;  2YWN A;  1R7H A;  3U5R E;  4ECC A;  1E2Y A;  2H0H A;  2X49 A;  3G7Y A;  3UVH A;  2C1Y A;  1XBS A;  3VFI A;  3F4R A;  4DSQ A;  1FB0 A;  2R4V A;  2JL4 A;  3FZ9 A;  5IO0 A;  1MD3 A;  3EU3 A;  3QFA C;  3M9K A;  4GSS A;  4F2I A;  3H4K A;  4DSS B;  2L4Q A;  1V2A A;  2L57 A;  3TUE A;  5D8I A;  6GSW A;  3D6I A;  1TRV A;  4JE1 A;  2GVP A;  5HR2 A;  4K7N A;  3DEX A;  2YJ7 A;  3TCO A;  4PNG A;  6GSS A;  4EKZ A;  2QA2 A;  4X1U A;  3D21 A;  1RK4 A;  4KSO A;  2PU9 C;  3ZYW A;  1KNG A;  2GT6 A;  4IGJ A;  2MMA A;  4YQM A;  3EMX A;  1M99 A;  12GS A;  2B1K A;  1SU9 A;  2R5G A;  2UZ8 A;  3LG6 A;  3E9J B;  2RLI A;  2V2G A;  4IHU A;  1FB6 A;  2E7P A;  3BD2 A;  1V57 A;  4F03 A;  3HZ4 A;  2VLU A;  2VCV A;  3TRQ A;  2WB9 A;  3L9U A;  2GZP A;  2G2Q A;  1O8W A;  3QR6 A;  2R2J A;  4IP6 A;  3P2A A;  2RUF A;  1PD2 1;  4WF5 A;  5EY6 A;  4KGI A;  1AIU A;  1V9W A;  4MK3 A;  2NBS A;  2P0G A;  3HXS A;  4ICY A;  3DRN A;  1ABA A;  3GFK A;  4DSR A;  4OWY A;  3GL3 A;  4OO5 A;  1R4W A;  1SD9 A;  2AAW A;  5D93 A;  4ZBA A;  3F3R A;  4QL7 A;  3KIJ A;  5CO3 A;  1O8X A;  4MPF A;  4MZB A;  2H0G A;  1U87 A;  2OJL A;  1OKD A;  2VCX A;  4KDU A;  1HYU A;  2B7K A;  3GNJ A;  3PGT A;  3VLN A;  2QGV A;  1F37 A;  3C1S A;  3GA4 A;  3HVV A;  4MH2 A;  4PNF A;  4HU7 A;  4XCS A;  1QUW A;  4V2L A;  2CVD A;  3DIE A;  4F0B A;  5KN0 A;  1MDK A;  2AHE A;  2C0E A;  4Z2T A;  4Q5R A;  3CQF A;  2VO4 A;  3TOU A;  2YWM A;  2BTO T;  4YH2 A;  2ES7 A;  4QL9 A;  4Q5Q A;  1UN2 A;  3LQ7 A;  1WE0 A;  2O8V B;  3KCM A;  1XWB A;  2MMZ A;  1XOB A;  5AGY A;  2F3M A;  4PQ1 A;  1TXX A;  1ZL9 A;  3IDV A;  2FNO A;  1X5D A;  4L0U A;  3FRC A;  1NM3 A;  3NIV A;  3UBL A;  4BWS A;  2HRA A;  2VL9 A;  5B6N A;  1JLW A;  3IXR A;  3L0H A;  2X4A A;  2CVB A;  3FMW A;  4L0W A;  4J56 E;  1JHB A;  1UA5 A;  4LA1 A;  2ZNM A;  1JZR A;  1F2E A;  2X99 A;  1R26 A;  1U6T A;  3Q74 A;  3HJP A;  2V6K A;  2EC4 A;  2R0G A;  5INY A;  3TJK A;  2HXK A;  3FR6 A;  14GS A;  4K5S A;  1EOH A;  1K0B A;  2X8C A;  1ZYN A;  4PUF C;  2TIR A;  2CX3 A;  2WJU A;  5G2Z A;  3ME7 A;  1ACV A;  3WYW A;  3G7J A;  3QAG A;  1Z3E A;  1TU8 A;  3C71 A;  1XVW A;  3GH9 A;  2GTU A;  2H0I A;  5F8B A;  3A2W A;  5D9W A;  1S3A A;  2YWO A;  4MPG A;  4F82 A;  1QXH A;  2P31 A;  1YEX A;  5DAL A;  4O92 A;  1GUM A;  4FH8 A;  3E0U A;  4MP4 A;  2M72 A;  3APQ A;  1OVN A;  3IE3 A;  1KEB A;  4KH7 A;  2H1B A;  2LJK A;  1ZYQ B;  1PL2 A;  2DJK A;  3L9V A;  1GTB A;  1Z6N A;  4MMM A;  4XTS A;  2R0P A;  4HJM A;  3A2V A;  2LJR A;  2MYG A;  4JR6 A;  1EGO A;  4CY6 A;  3GTU B;  4OFN A;  4TR1 B;  3DGQ A;  1AQV A;  1MD4 A;  1R5P A;  1M3I A;  2CV4 A;  3H1N A;  3D22 A;  2CZ2 A;  2YZH A;  3F9U A;  3VWX A;  2FLS A;  1ERW A;  2L6C A;  4DVC A;  4PXO A;  1ST9 A;  4TXV A;  3M0F A;  3EVI A;  4G0I A;  4OD7 A;  3HKR A;  1H4O A;  2O85 A;  3C1R A;  3DVW A;  4HQS A;  3PPU A;  3Q6O A;  5J3R A;  2OE3 A;  2H8L A;  5IPH A;  1ZOF A;  3KEB A;  5E59 A;  5B7C A;  2N5B A;  4EIP A;  2FWH A;  3A5W A;  1M9A A;  1Q98 A;  5CP1 A;  2OAC A;  4F9Z A;  1PL1 A;  4ZBD A;  1QK8 A;  3GRX A;  1B8X A;  1BYE A;  2XBQ A;  2L4C A;  4D73 B;  1PFO A;  1N8J A;  2TRC P;  1X5C A;  5KEJ A;  2MMO A;  4LL4 B;  1GSQ A;  4NAX A;  2B6M A;  5J9B A;  2BMX A;  4FQU A;  4IN0 A;  1Z7P A;  1SJI A;  3K8N A;  4IW9 A;  3IAS 2;  3GKK A;  1EOG A;  2CA8 A;  4WR4 A;  3U6V A;  1EGR A;  1E6B A;  4G10 A;  2A4V A;  1RQM A;  1GTI A;  3TKP A;  2VCQ A;  4BVY A;  1KBN A;  2VCZ A;  2XC2 A;  1YKA A;  1ZMA A;  4XRD A;  3W6G A;  3PR8 A;  1ILO A;  1YY7 A;  1A24 A;  3UAP A;  2H19 A;  3IPZ A;  4N10 A;  2GSQ A;  4DSS A;  3H8Q A;  4N30 A;  2JZR A;  3WGE A;  1ZCP A;  1LJR A;  2H72 A;  2BJX A;  4N11 A;  4KA0 A;  3HVN A;  1YQ1 A;  3GV1 A;  4ECJ A;  5AN1 A;  2C0G A;  2GQK A;  1SKS B;  4ECI A;  1M7T A;  4PQH A;  1PX6 A;  2HFD A;  1B48 A;  3EU4 A;  3FW2 A;  1K3O A;  1XW6 A;  2LV3 A;  4ID0 A;  3LYP A;  5D9V A;  5GZZ B;  2B3S A;  4MZW A;  5A4V A;  4LMW A;  3MWH A;  5ECK B;  3DKS A;  3SWL A;  3ERW A;  2P5R A;  1AW9 A;  2H1G A;  4I2U A;  5GAP D;  2KP2 A;  1UVZ A;  4TOP A;  1OE7 A;  2B5Y A;  5G5F A;  5KOW A;  4X0X A;  4PGT A;  17GS A;  4CDO A;  1XG8 A;  3I69 A;  3ZIT A;  3EPT A;  4TN8 A;  1GSU A;  3ZRD A;  5G1L A;  5H5R A;  1XIY A;  2IL3 A;  3GKX A;  1F9M A;  5AIS A;  4KUN A;  1SK0 A;  2C0F A;  3US3 A;  1TW9 A;  3DVX A;  5FHI A;  3HDC A;  2JZS A;  2HYX A;  4E8H A;  1F3A A;  3LW9 A;  1VRS D;  2FWG A;  3CYN A;  2X64 A;  2VD0 A;  3G7I A;  5IQY A;  4FYU A;  2HZE B;  3HCZ A;  5HFG A;  4GSN A;  3FZA A;  3CSJ A;  4JZQ A;  1Y25 A;  3NOF A;  2VIM A;  1O6J A;  1J9B A;  5IMD A;  5L71 A;  4KE3 A;  1TK8 B;  5JCW A;  3VI5 A;  4K0N A;  2C8U A;  4ISD A;  2KUC A;  2H71 A;  5ELA A;  3UVT A;  1G6Y A;  3UMA A;  19GS A;  4ECB A;  2ON5 A;  2AV4 A;  4HI7 A;  2PN8 A;  2JSY A;  2DC5 A;  5B8A A;  4ZB8 A;  6GSX A;  5HFI A;  2LUS A;  2IFQ B;  4O5U A;  2EIO A;  2FGX A;  4JR4 A;  1O73 A;  1THX A;  2G0F A;  1GSY A;  2REM A;  3VUR A;  1XPV A;  3F63 A;  5DAK A;  1FVK A;  1QFN A;  2PER A;  2MBS A;  3HVS A;  1G0T A;  3I6A A;  4ZIL A;  3JCM L;  5IMZ A;  4I97 A;  2L5L A;  2QSI A;  3ZLP A;  4IEL A;  2AYT A;  1OAZ A;  5LD0 A;  4I6X A;  4OMV A;  1FAA A;  1T00 A;  4RQX A;  1K3Y A;  2M80 A;  2PBJ A;  4DEJ A;  4MA9 A;  2K18 A;  4K2D A;  1XW9 A;  3GKN A;  1PX7 A;  4XIH A;  4GQC A;  3TJF A;  1GUH A;  2MMN A;  1WIK A;  4WXT A;  2MZC A;  5B8B A;  4MNN A;  4NHZ A;  3ZML A;  2PWJ A;  5JWQ B;  3GYK A;  1SD8 A;  4ZBB A;  2I9H A;  3F4S A;  3MIX A;  2VLV A;  4HQZ A;  1GLP A;  3KP8 A;  5JWR B;  1TI3 A;  3RPP A;  1Z5Y E;  3WGX A;  4MH3 A;  4IP1 A;  4J57 E;  1EZK A;  1ERT A;  2H30 A;  3BCK A;  2HLS A;  1K0O A;  1PGT A;  4EO3 A;  2OBK A;  1VF1 A;  2PMT A;  3ZIV A;  3DWV A;  1R5A A;  2IMK A;  4PUR A;  4ZIJ A;  3ERF A;  3ED3 A;  2AUV A;  3FKF A;  4RI6 A;  1M2B A;  5ECR B;  1YKC A;  1SKR B;  2H01 A;  4GLT A;  1S3R A;  3TRX A;  4ACS A;  1FOH A;  5IMF A;  4TXO A;  3O76 A;  4EDY A;  2GLR A;  2CAQ A;  4BVX B;  2A2P A;  1KTE A;  3PH9 A;  2H1A A;  4Q5F A;  4HS1 A;  3RAZ A;  1SL0 B;  2X8H A;  4HZ4 A;  2HRN A;  1XCC A;  4QQ7 A;  3TKS C;  1G7O A;  3KTB A;  4BL7 A;  3WT2 A;  1V58 A;  4K7I A;  2H73 A;  4K2X A;  4MAB A;  2XHF A;  5JWO B;  1GH2 A;  2WGR A;  3I43 A;  4K6X A;  4G0L A;  1ZYP A;  4KF9 A;  1K0N A;  2I1U A;  5IMC A;  1AUC A;  3E3E A;  4POM A;  2RM5 A;  1GSS A;  3TKS E;  4MF6 A;  1EEM A;  2DJ0 A;  1FO5 A;  1DBY A;  5CRG A;  4PTS A;  2VM1 A;  5HR3 A;  1BED A;  2OAD A;  4MCU A;  4Q5N A;  3HHV A;  1K0M A;  1B9X C;  2DKH A;  3ZFL A;  2VLT A;  2IMI A;  2H6X A;  2MBT A;  5DBQ A;  2VCW A;  3LXZ A;  3HY2 A;  3KH7 A;  2DLX A;  5F06 A;  3GX0 A;  3IV4 A;  5G31 A;  3AY8 A;  4O5R A;  4POK A;  1DSB A;  4J2F A;  3N5O A;  3C8E A;  4V2N A;  2DMM A;  2WRT A;  1OC9 A;  4GF0 A;  2YV9 A;  4MJC A;  5COH A;  1GUK A;  2FD3 A;  3F0I A;  5IOW A;  3F4T A;  4ZB6 A;  5ECS A;  2OA7 A;  3C7M A;  2I81 A;  3FYG A;  1FG4 A;  3CBU A;  2GSS A;  3R3E A;  1XVQ A;  2YCD A;  2XPD A;  5ID2 A;  3IBH A;  5DJL A;  1AC1 A;  2HRK A;  2H76 A;  3TOT A;  1YDK A;  5H5Q A;  2B5E A;  1WRY A;  4GST A;  3BJ5 A;  4WKW A;  2O7K A;  1SK2 A;  1W89 A;  1EWX A;  4CY8 A;  5KN3 A;  1XOA A;  1PKZ A;  1MTC A;  4K1F A;  1JZO A;  1X5E A;  2HSM A;  1NHO A;  1TI1 A;  5ECP B;  2VL2 A;  4GRF A;  3CRT A;  5DCG A;  2RII A;  4TW5 A;  2YOI A;  4USS A;  1CQH A;  1HNC A;  3ZL5 A;  3ZFB A;  1OE8 A;  9GSS A;  4HOJ A;  4IJ3 A;  6GST A;  1TK5 B;  4WEY A;  2WCI A;  4MZC A;  6GSV A;  5AIV A;  1M0U A;  3ZMK A;  4EUY A;  2GDR A;  3VPT A;  3KTL A;  1YEP A;  1AAZ A;  2ALB A;  4CW9 A;  8GSS A;  2O89 A;  1GSD A;  2KHP A;  2FA4 A;  2QC7 A;  1PN9 A;  2K8S A;  5DDL A;  2R6K A;  3TKR A;  3MYD A;  2H70 A;  3I9V 2;  2J23 A;  3UEM A;  2C0D A;  2B7J A;  2H75 A;  6GSU A;  4IKH A;  4MDC A;  2HNL A;  4K8M A;  4KW6 A;  3W8S A;  4KAE A;  2DJ1 A;  4ZL9 A;  1HNB A;  2LTK A;  2QA1 A;  5D9X A;  4FIW A;  2FUG 2;  1S3D A;  2VD1 A;  1SYX A;  1HNA A;  3H93 A;  3D0Z A;  4NV2 A;  5H5S A;  2LS5 A;  1ML6 A;  2CZ3 A;  1NSW A;  1YZX A;  2GZZ A;  1FVJ A;  1A23 A;  1A0F A;  3KD0 A;  3IK7 A;  5D96 A;  4ULX A;  2N5A A;  1MDI A;  2EIR A;  4FYB A;  2C4J A;  4GQF A;  4NMU A;  5IM9 A;  4AJ7 A;  3D4T A;  1B4P A;  1JZW A;  4WET A;  3ISO A;  3TGZ A;  4OO4 A;  4TR4 A;  4EE0 A;  5A5K A;  4HDE A;  2YNX A;  3G9B A;  4K0G A;  4I8B A;  4IVF A;  1TK0 B;  3ZTL A;  5ECL B;  1QGV A;  4YAP A;  4G0K A;  1A2J A;  4AF2 A;  1ERU A;  3HJM A;  2OE0 A;  2GST A;  3UBK A;  2JU5 A;  1TDI A;  1IYI A;  1GNE A;  1BJX A;  3HVX A;  1TJD A;  3LFL A;  2GZY A;  2D2Z A; 
#chains in the Genus database with same CATH homology
 2YV7 A;  4KDY A;  2HRF A;  3RBT A;  5DAL B;  2WS2 A;  3V1W A;  3WT1 A;  2OE1 A;  7GSS A;  4HJ2 A;  2XBI A;  3MAK A;  4N0V A;  2XPE A;  2GGT A;  2V32 A;  2DIY A;  4KCE A;  1IYH A;  1TU7 A;  3DML A;  5EPF A;  5ENU A;  1FHE A;  3MNG A;  2LNS A;  2WFC A;  1EV4 A;  3CMI A;  5CRE A;  3M9J A;  2DJ2 A;  1TRU A;  3QOU A;  2WUL A;  5J41 A;  5E4W A;  2C3Q A;  3W8J A;  1BX9 A;  4E8E A;  2CQ9 A;  3LWA A;  2R0C A;  5ABR A;  1BAY A;  5CYY A;  1Y6E A;  1AXD A;  2CAI A;  5JCU A;  2J9H A;  2IMD A;  5HR0 A;  1Z9H A;  2LKU A;  1UC7 A;  3IR4 A;  4EC0 A;  1GWC A;  2IPA A;  4MJE A;  2DJ3 A;  4AJ6 A;  1A8Y A;  4IJI A;  2C3T A;  3P90 A;  1NHY A;  2QKE A;  2LJA A;  4NHW A;  3TB2 A;  2A4H A;  3HJO A;  1GTA A;  4PUA A;  2RM6 A;  1TTZ A;  2H6Z A;  4L5L A;  1EP8 A;  3KGK A;  1OC8 A;  1SEN A;  1OKT A;  2C3N A;  1YF0 A;  1CQG A;  1JFU A;  4GCI A;  3M3M A;  3GHA A;  2K6V A;  2HT9 A;  4KSM A;  4GWR A;  2R3X A;  4FYC A;  1GSE A;  1WJK A;  2YPM A;  3Q18 A;  1OYJ A;  2GS3 A;  1F6M C;  2TRX A;  3P7X A;  1K0D A;  1Q4J A;  3HA9 A;  4WBR D;  2VCT A;  3LXT A;  2HI7 A;  4G2E A;  5A4U A;  4LMV A;  3IHQ A;  1PKW A;  4V1A g;  1ZGN A;  3QMX A;  2AB6 A;  3GSS A;  2LEG A;  3WGD A;  2FWE A;  4L8E A;  4I2T A;  3GUR A;  3VI7 A;  5J5N A;  1GTU A;  1SYR A;  1Z6M A;  3QCP A;  1GRX A;  3ERG A;  3HZ8 A;  4I5Q A;  3EYT A;  4BVY B;  1PA3 A;  1K0A A;  3EIN A;  5FT3 A;  3A2X A;  3RHC A;  3KJY A;  3A3T A;  2A2S A;  5F0G A;  1PN0 A;  3GST A;  1TRS A;  4XS4 B;  2DSA A;  3GH6 A;  3FR3 A;  3TJG A;  1X9M B;  2LQQ A;  2WZ9 A;  1JZD A;  2EIQ A;  2V41 A;  3L78 A;  2RUE A;  3QAW A;  5KOX A;  5J4U A;  1YF1 A;  5CAX A;  5CRD A;  1M9B A;  3S9F A;  4Z2R A;  4P3Y B;  22GS A;  4ML6 A;  2DKI A;  2NVL A;  4EF0 A;  4YQU A;  2HSH A;  3C73 A;  4GXZ A;  1XZO A;  2L59 A;  1LBK A;  1FOV A;  2YP6 A;  3GKM A;  5ECI B;  1SL2 B;  3ZVJ D;  1TRW A;  1VF4 A;  3IRA A;  3FR9 A;  4K9Z A;  4ILF A;  2K8V A;  2V1M A;  3LYK A;  2PPT A;  3KMN A;  3M1G A;  3D5J A;  1ZYE A;  4POB A;  2JAD A;  3QFB C;  5IIZ A;  3UIW A;  3L4N A;  2OKA A;  2HSY A;  1S3C A;  2LRT A;  4WR5 A;  5BRT A;  3APO A;  3TKS A;  3RPN A;  3GL5 A;  2DBC A;  3QPM A;  5IPG A;  1O81 A;  1PMT A;  2PUK C;  3EC3 A;  5D9T A;  3VPQ A;  2FHE A;  2IMF A;  3VK9 A;  2FCH A;  3FEU A;  2CT6 A;  4YKF A;  1N2A A;  1SKW B;  4H86 A;  4YKG A;  4YQV A;  3APS A;  3KP9 A;  3A5I A;  3CRU A;  3CTG A;  5ELG A;  1W4V A;  2IWT A;  1T7P B;  1O7U A;  5HR1 A;  4CHS A;  1U3A A;  1HD2 A;  1H75 A;  2FA8 A;  3HYP A;  2L5O A;  1GNW A;  1NW2 A;  3GTU A;  1EP7 A;  2A2R A;  4ZXG A;  4TR1 A;  2H6Y A;  3ME8 A;  1MEK A;  4TR0 A;  1VF3 A;  5DQY A;  3FZ5 A;  3UJ1 A;  3TKQ A;  1XWK A;  2GSR A;  2B1L A;  3IOS A;  3SBC A;  1X9W B;  1SL1 B;  1GL8 A;  1THO A;  2PVQ A;  4KCA A;  5KN1 A;  2FWF A;  2VOC A;  4RQR A;  4JED A;  3UL3 A;  2NTO A;  1ON4 A;  1XWC A;  4ML1 A;  3VWW A;  5ECH B;  4OFM A;  3QDN A;  2JAC A;  2CVK A;  2ZCT A;  1T4Y A;  2IJY A;  3FHK A;  4AGS A;  2HZF A;  1J0F A;  2VAF A;  1T1V A;  4IQ1 A;  1WOU A;  5DAK B;  3LEF A;  3BCI A;  4NPB A;  1WMJ A;  3EMP A;  4X4J A;  1OC3 A;  3CSH A;  3ZVJ A;  1RW1 A;  2KLX A;  1G7E A;  1A8L A;  3MDK A;  4D73 A;  2VL3 A;  3KMO A;  4JRR A;  3CTF A;  3OR5 A;  2LRN A;  2K9F A;  2OBI A;  3IAM 2;  2LST A;  3KM6 A;  3RDW A;  1WP0 A;  1GP1 A;  3FZ4 A;  2IN3 A;  4TR3 A;  1DUG A;  2LNT A;  2ON7 A;  2H1D A;  5BMU A;  2P5Q A;  3FY7 A;  1GSF A;  4O32 A;  3H79 A;  4HZ2 A;  4MJA A;  1M2D A;  4EVM A;  3R2Q A;  4Z7X A;  4PX1 A;  2O87 A;  5LCZ A;  4POL A;  4GTU A;  1EEJ A;  1PSQ A;  3DD3 A;  2JSZ A;  4FO5 A;  4MLY A;  1V98 A;  2YAN A;  3GX8 A;  4TVE A;  4MF7 A;  4KND A;  2F8A A;  2GQL A;  3QD9 A;  1T4Z A;  4X43 A;  5G5E A;  3LSZ A;  1PQN A;  1BQ7 A;  3IC4 A;  1G6W A;  2VUP A;  3P8W A;  5EVO A;  2YWI A;  5ECQ B;  3DXB A;  5DQS A;  5CRW A;  3TRP A;  1QMV A;  2Z9S A;  6GSY A;  5LNK e;  1V40 A;  1EV9 A;  5GST A;  4TXO B;  3BOA A;  1YJ6 A;  3IK9 A;  2HE3 A;  3PIN A;  4PQI A;  4A5P A;  3L9S A;  1QQ2 A;  5IO2 A;  2GT5 A;  1FW1 A;  2NPB A;  4ZL7 A;  3FK8 A;  5DVB A;  2KOK A;  4BL7 B;  4EIQ A;  1U88 A;  1C72 A;  3J7Y k;  3F6F A;  1USB A;  20GS A;  2L6D A;  4G19 A;  4YAV A;  4WBJ A;  1A2L A;  3RHB A;  2FY6 A;  4V2M A;  1MDJ A;  18GS A;  3O3T A;  1XWG A;  5G1K A;  3WD6 A;  4F0C A;  3LOR A;  4MJB A;  2AJQ B;  5DCH A;  3F8U A;  2DML A;  1M2A A;  1AQX A;  3IA1 A;  5HQP A;  5F07 A;  3CSI A;  1K3L A;  2HZE A;  2VL2 C;  4BA7 A;  1I5G A;  2I3Y A;  1B9Y C;  4HU9 A;  3TDG A;  1TKD B;  3MSZ A;  3M8N A;  3J7Y b;  3VWV A;  16GS A;  3GN3 A;  1WPI A;  4K7O A;  5FWG A;  5J9C A;  4N0Z A;  1Z7R A;  4Z2U A;  4KX4 A;  5GSS A;  2V6O A;  2LQO A;  4IBP A;  1OC9 B;  2B5X A;  1PRX A;  5ECM B;  4OCF A;  1TP9 A;  4XHM A;  5D73 A;  2E0Q A;  4O7H A;  11GS A;  2IFQ A;  3EWL A;  4TKY A;  5ECO B;  3KZQ A;  1A0R P;  4WF4 A;  1URM A;  5ID2 B;  2H74 A;  3UOM A;  4V1A p;  1T3B A;  1SJ6 A;  5ECN B;  1BG5 A;  3LJR A;  3VWU A;  5DJM A;  3Q19 A;  2YJH A;  1X0R A;  2R37 A;  3N9J A;  4XS4 A;  2JZT A;  4EDZ A;  3KXO A;  4HEA 2;  4NWY A;  2PGT A;  1T8E B;  5GAN D;  2H66 A;  1SJZ A;  3TJJ A;  1O85 A;  5IMA A;  4XS1 A;  1TOF A;  1ZZY A;  1ERV A;  4ZL8 A;  3ZZX A;  1F3B A;  1HQO A;  4NV5 A;  4O5Q A;  2WDU A;  2F51 A;  4KDX A;  5F05 A;  5IMV A;  4L5O A;  2LRC A;  1GUL A;  4JU5 A;  2E2G A;  3NZN A;  4IS0 A;  5A4W A;  3F3Q A;  1LU4 A;  3CXG A;  1XXU A;  3UAR A;  3DYR A;  4TRX A;  4K5R A;  3GIX A;  1XWA A;  3ZIJ A;  4OCE A;  4RI7 A;  3O6T A;  3ZRE A;  3GMF A;  5G30 A;  4NXI A;  5JCG A;  1X9S B;  4IQA A;  1XW5 A;  2PVO C;  3LGC A;  5CRH A;  1VGL A;  4OFT A;  5AIX A;  5B6M A;  1K0C A;  2NDO A;  3IC8 A;  1DE2 A;  4JBB A;  3TJB A;  2IIY A;  4HUA A;  2DJJ A;  2KP1 A;  1VF2 A;  3EUR A;  2ZUP A;  3F6D A;  3BBY A;  3HD5 A;  2F8F A;  3QAV A;  2GQM A;  1I9D A;  2DIZ A;  5C04 A;  1U3I A;  4BWQ A;  4G9H A;  4KB3 A;  4LLR A;  5IOX A;  4RUV A;  4LL1 B;  2VM2 A;  1J08 A;  2I4A A;  3EE2 A;  2IME A;  3IHG A;  4XS6 A;  1A2M A;  2M46 A;  4XRA A;  4EL1 A;  4EXJ A;  4BVX A;  5C00 A;  1AQW A;  5KN2 A;  4ZB9 A;  2CX4 A;  1WWJ A;  3GUS A;  1SK1 A;  5HFK A;  2YZU A;  2C80 A;  5EL8 A;  2N5F A;  4BPY A;  2E2M A;  3D4M A;  1JLV A;  2YN1 A;  4MF5 A;  10GS A;  2F9S A;  5CNW A;  1B4Q A;  4AJ8 A;  13GS A;  1XFL A;  1DE1 A;  1GLQ A;  2X8G A;  3KH9 A;  2YWN A;  1R7H A;  3U5R E;  4ECC A;  1E2Y A;  2H0H A;  2X49 A;  3G7Y A;  3UVH A;  2C1Y A;  1XBS A;  3VFI A;  3F4R A;  4DSQ A;  1FB0 A;  2R4V A;  2JL4 A;  3FZ9 A;  5IO0 A;  1MD3 A;  3EU3 A;  3QFA C;  3M9K A;  4GSS A;  4F2I A;  3H4K A;  4DSS B;  2L4Q A;  1V2A A;  2L57 A;  3TUE A;  5D8I A;  6GSW A;  3D6I A;  1TRV A;  4JE1 A;  2GVP A;  5HR2 A;  4K7N A;  3DEX A;  2YJ7 A;  3TCO A;  4PNG A;  6GSS A;  4EKZ A;  2QA2 A;  4X1U A;  3D21 A;  1RK4 A;  4KSO A;  2PU9 C;  3ZYW A;  1KNG A;  2GT6 A;  4IGJ A;  2MMA A;  4YQM A;  3EMX A;  1M99 A;  12GS A;  2B1K A;  1SU9 A;  2R5G A;  2UZ8 A;  3LG6 A;  3E9J B;  2RLI A;  2V2G A;  4IHU A;  1FB6 A;  2E7P A;  3BD2 A;  1V57 A;  4F03 A;  3HZ4 A;  2VLU A;  2VCV A;  3TRQ A;  2WB9 A;  3L9U A;  2GZP A;  2G2Q A;  1O8W A;  3QR6 A;  2R2J A;  4IP6 A;  3P2A A;  2RUF A;  1PD2 1;  4WF5 A;  5EY6 A;  4KGI A;  1AIU A;  1V9W A;  4MK3 A;  2NBS A;  2P0G A;  3HXS A;  4ICY A;  3DRN A;  1ABA A;  3GFK A;  4DSR A;  4OWY A;  3GL3 A;  4OO5 A;  1R4W A;  1SD9 A;  2AAW A;  5D93 A;  4ZBA A;  3F3R A;  4QL7 A;  3KIJ A;  5CO3 A;  1O8X A;  4MPF A;  4MZB A;  2H0G A;  1U87 A;  2OJL A;  1OKD A;  2VCX A;  4KDU A;  1HYU A;  2B7K A;  3GNJ A;  3PGT A;  3VLN A;  2QGV A;  1F37 A;  3C1S A;  3GA4 A;  3HVV A;  4MH2 A;  4PNF A;  4HU7 A;  4XCS A;  1QUW A;  4V2L A;  2CVD A;  3DIE A;  4F0B A;  5KN0 A;  1MDK A;  2AHE A;  2C0E A;  4Z2T A;  4Q5R A;  2VO4 A;  3TOU A;  2YWM A;  2BTO T;  4YH2 A;  2ES7 A;  4QL9 A;  4Q5Q A;  1UN2 A;  3LQ7 A;  1WE0 A;  2O8V B;  3KCM A;  1XWB A;  2MMZ A;  1XOB A;  5AGY A;  2F3M A;  4PQ1 A;  1TXX A;  1ZL9 A;  3IDV A;  2FNO A;  1X5D A;  4L0U A;  3FRC A;  1NM3 A;  3NIV A;  3UBL A;  4BWS A;  2HRA A;  2VL9 A;  5B6N A;  1JLW A;  3IXR A;  3L0H A;  2X4A A;  2CVB A;  3FMW A;  4L0W A;  4J56 E;  1JHB A;  1UA5 A;  4LA1 A;  2ZNM A;  1JZR A;  1F2E A;  2X99 A;  1R26 A;  1U6T A;  3Q74 A;  3HJP A;  2V6K A;  2EC4 A;  2R0G A;  5INY A;  3TJK A;  2HXK A;  3FR6 A;  14GS A;  4K5S A;  1EOH A;  1K0B A;  2X8C A;  1ZYN A;  4PUF C;  2TIR A;  2CX3 A;  2WJU A;  5G2Z A;  3ME7 A;  1ACV A;  3WYW A;  3G7J A;  3QAG A;  1Z3E A;  1TU8 A;  3C71 A;  1XVW A;  3GH9 A;  2GTU A;  2H0I A;  5F8B A;  3A2W A;  5D9W A;  1S3A A;  2YWO A;  4MPG A;  4F82 A;  1QXH A;  2P31 A;  1YEX A;  5DAL A;  4O92 A;  1GUM A;  4FH8 A;  3E0U A;  4MP4 A;  2M72 A;  3APQ A;  1OVN A;  3IE3 A;  1KEB A;  4KH7 A;  2H1B A;  2LJK A;  1ZYQ B;  1PL2 A;  2DJK A;  3L9V A;  1GTB A;  1Z6N A;  4MMM A;  4XTS A;  2R0P A;  4HJM A;  3A2V A;  2LJR A;  2MYG A;  4JR6 A;  1EGO A;  4CY6 A;  3GTU B;  4OFN A;  4TR1 B;  3DGQ A;  1AQV A;  1MD4 A;  1R5P A;  2CV4 A;  3H1N A;  3D22 A;  2CZ2 A;  2YZH A;  3F9U A;  3VWX A;  2FLS A;  1ERW A;  2L6C A;  4DVC A;  4PXO A;  1ST9 A;  4TXV A;  3M0F A;  3EVI A;  4G0I A;  4OD7 A;  3HKR A;  1H4O A;  2O85 A;  3C1R A;  3DVW A;  4HQS A;  3PPU A;  3Q6O A;  5J3R A;  2OE3 A;  2H8L A;  5IPH A;  1ZOF A;  3KEB A;  5E59 A;  5B7C A;  2N5B A;  4EIP A;  2FWH A;  3A5W A;  1M9A A;  1Q98 A;  5CP1 A;  2OAC A;  4F9Z A;  1PL1 A;  4ZBD A;  1QK8 A;  3GRX A;  1B8X A;  1BYE A;  2XBQ A;  2L4C A;  4D73 B;  1N8J A;  2TRC P;  1X5C A;  5KEJ A;  2MMO A;  4LL4 B;  1GSQ A;  4NAX A;  2B6M A;  5J9B A;  2BMX A;  4FQU A;  4IN0 A;  1Z7P A;  1SJI A;  3K8N A;  4IW9 A;  3IAS 2;  3GKK A;  1EOG A;  2CA8 A;  4WR4 A;  3U6V A;  1EGR A;  1E6B A;  4G10 A;  2A4V A;  1RQM A;  1GTI A;  3TKP A;  2VCQ A;  4BVY A;  1KBN A;  2VCZ A;  2XC2 A;  1YKA A;  1ZMA A;  4XRD A;  3W6G A;  3PR8 A;  1ILO A;  1YY7 A;  1A24 A;  3UAP A;  2H19 A;  3IPZ A;  4N10 A;  2GSQ A;  4DSS A;  3H8Q A;  4N30 A;  2JZR A;  3WGE A;  1ZCP A;  1LJR A;  2H72 A;  2BJX A;  4N11 A;  4KA0 A;  1YQ1 A;  3GV1 A;  4ECJ A;  5AN1 A;  2C0G A;  2GQK A;  1SKS B;  4ECI A;  1M7T A;  4PQH A;  1PX6 A;  2HFD A;  1B48 A;  3EU4 A;  3FW2 A;  1K3O A;  1XW6 A;  2LV3 A;  4ID0 A;  3LYP A;  5D9V A;  5GZZ B;  2B3S A;  4MZW A;  5A4V A;  4LMW A;  3MWH A;  5ECK B;  3DKS A;  3SWL A;  3ERW A;  2P5R A;  1AW9 A;  2H1G A;  4I2U A;  5GAP D;  2KP2 A;  1UVZ A;  4TOP A;  1OE7 A;  2B5Y A;  5G5F A;  5KOW A;  4X0X A;  4PGT A;  17GS A;  4CDO A;  3I69 A;  3ZIT A;  3EPT A;  4TN8 A;  1GSU A;  3ZRD A;  5G1L A;  5H5R A;  1XIY A;  2IL3 A;  3GKX A;  1F9M A;  5AIS A;  4KUN A;  1SK0 A;  2C0F A;  3US3 A;  1TW9 A;  3DVX A;  5FHI A;  3HDC A;  2JZS A;  2HYX A;  4E8H A;  1F3A A;  3LW9 A;  1VRS D;  2FWG A;  3CYN A;  2X64 A;  2VD0 A;  3G7I A;  5IQY A;  4FYU A;  2HZE B;  3HCZ A;  5HFG A;  4GSN A;  3FZA A;  3CSJ A;  4JZQ A;  1Y25 A;  3NOF A;  2VIM A;  1O6J A;  1J9B A;  5IMD A;  5L71 A;  4KE3 A;  1TK8 B;  5JCW A;  3VI5 A;  4K0N A;  2C8U A;  4ISD A;  2KUC A;  2H71 A;  5ELA A;  3UVT A;  1G6Y A;  3UMA A;  19GS A;  4ECB A;  2ON5 A;  2AV4 A;  4HI7 A;  2PN8 A;  2JSY A;  2DC5 A;  5B8A A;  4ZB8 A;  6GSX A;  5HFI A;  2LUS A;  2IFQ B;  4O5U A;  2EIO A;  2FGX A;  4JR4 A;  1O73 A;  1THX A;  2G0F A;  1GSY A;  2REM A;  3VUR A;  1XPV A;  3F63 A;  5DAK A;  1FVK A;  1QFN A;  2PER A;  2MBS A;  3HVS A;  1G0T A;  3I6A A;  4ZIL A;  3JCM L;  5IMZ A;  4I97 A;  2L5L A;  2QSI A;  3ZLP A;  4IEL A;  2AYT A;  1OAZ A;  5LD0 A;  4I6X A;  4OMV A;  1FAA A;  1T00 A;  4RQX A;  1K3Y A;  2M80 A;  2PBJ A;  4DEJ A;  4MA9 A;  2K18 A;  4K2D A;  1XW9 A;  3GKN A;  1PX7 A;  4XIH A;  4GQC A;  3TJF A;  1GUH A;  2MMN A;  1WIK A;  4WXT A;  2MZC A;  5B8B A;  4MNN A;  4NHZ A;  3ZML A;  2PWJ A;  5JWQ B;  3GYK A;  1SD8 A;  4ZBB A;  2I9H A;  3F4S A;  3MIX A;  2VLV A;  4HQZ A;  1GLP A;  3KP8 A;  5JWR B;  1TI3 A;  3RPP A;  1Z5Y E;  3WGX A;  4MH3 A;  4IP1 A;  4J57 E;  1EZK A;  1ERT A;  2H30 A;  3BCK A;  2HLS A;  1K0O A;  1PGT A;  4EO3 A;  2OBK A;  1VF1 A;  2PMT A;  3ZIV A;  3DWV A;  1R5A A;  2IMK A;  4PUR A;  4ZIJ A;  3ERF A;  3ED3 A;  2AUV A;  3FKF A;  4RI6 A;  1M2B A;  5ECR B;  1YKC A;  1SKR B;  2H01 A;  4GLT A;  3TRX A;  4ACS A;  1FOH A;  5IMF A;  4TXO A;  3O76 A;  4EDY A;  2GLR A;  2CAQ A;  4BVX B;  2A2P A;  1KTE A;  3PH9 A;  2H1A A;  4Q5F A;  4HS1 A;  3RAZ A;  1SL0 B;  2X8H A;  4HZ4 A;  2HRN A;  1XCC A;  4QQ7 A;  3TKS C;  1G7O A;  3KTB A;  4BL7 A;  3WT2 A;  1V58 A;  4K7I A;  2H73 A;  4K2X A;  4MAB A;  2XHF A;  5JWO B;  1GH2 A;  2WGR A;  3I43 A;  4K6X A;  4G0L A;  1ZYP A;  4KF9 A;  1K0N A;  2I1U A;  5IMC A;  1AUC A;  3E3E A;  4POM A;  2RM5 A;  1GSS A;  3TKS E;  4MF6 A;  1EEM A;  2DJ0 A;  1FO5 A;  1DBY A;  5CRG A;  4PTS A;  2VM1 A;  5HR3 A;  1BED A;  2OAD A;  4MCU A;  4Q5N A;  3HHV A;  1K0M A;  1B9X C;  2DKH A;  3ZFL A;  2VLT A;  2IMI A;  2H6X A;  2MBT A;  5DBQ A;  2VCW A;  3LXZ A;  3HY2 A;  3KH7 A;  2DLX A;  5F06 A;  3GX0 A;  3IV4 A;  5G31 A;  3AY8 A;  4O5R A;  4POK A;  1DSB A;  4J2F A;  3N5O A;  3C8E A;  4V2N A;  2DMM A;  2WRT A;  1OC9 A;  4GF0 A;  2YV9 A;  4MJC A;  5COH A;  1GUK A;  2FD3 A;  3F0I A;  5IOW A;  3F4T A;  4ZB6 A;  5ECS A;  2OA7 A;  3C7M A;  2I81 A;  3FYG A;  1FG4 A;  3CBU A;  2GSS A;  3R3E A;  1XVQ A;  2YCD A;  2XPD A;  5ID2 A;  3IBH A;  5DJL A;  1AC1 A;  2HRK A;  2H76 A;  3TOT A;  1YDK A;  5H5Q A;  2B5E A;  1WRY A;  4GST A;  3BJ5 A;  4WKW A;  2O7K A;  1SK2 A;  1W89 A;  1EWX A;  4CY8 A;  5KN3 A;  1XOA A;  1PKZ A;  1MTC A;  4K1F A;  1JZO A;  1X5E A;  2HSM A;  1NHO A;  1TI1 A;  5ECP B;  2VL2 A;  4GRF A;  3CRT A;  5DCG A;  2RII A;  4TW5 A;  2YOI A;  4USS A;  1CQH A;  1HNC A;  3ZL5 A;  3ZFB A;  1OE8 A;  9GSS A;  4HOJ A;  4IJ3 A;  6GST A;  1TK5 B;  4WEY A;  2WCI A;  4MZC A;  6GSV A;  5AIV A;  1M0U A;  3ZMK A;  4EUY A;  2GDR A;  3VPT A;  3KTL A;  1YEP A;  1AAZ A;  2ALB A;  4CW9 A;  8GSS A;  2O89 A;  1GSD A;  2KHP A;  2FA4 A;  2QC7 A;  1PN9 A;  2K8S A;  5DDL A;  2R6K A;  3TKR A;  3MYD A;  2H70 A;  3I9V 2;  2J23 A;  3UEM A;  2C0D A;  2B7J A;  2H75 A;  6GSU A;  4IKH A;  4MDC A;  2HNL A;  4K8M A;  4KW6 A;  3W8S A;  4KAE A;  2DJ1 A;  4ZL9 A;  1HNB A;  2LTK A;  2QA1 A;  5D9X A;  4FIW A;  2FUG 2;  1S3D A;  2VD1 A;  1SYX A;  1HNA A;  3H93 A;  3D0Z A;  4NV2 A;  5H5S A;  2LS5 A;  1ML6 A;  2CZ3 A;  1NSW A;  1YZX A;  2GZZ A;  1FVJ A;  1A23 A;  1A0F A;  3KD0 A;  3IK7 A;  5D96 A;  4ULX A;  2N5A A;  1MDI A;  2EIR A;  4FYB A;  2C4J A;  4GQF A;  4NMU A;  5IM9 A;  4AJ7 A;  3D4T A;  1B4P A;  1JZW A;  4WET A;  3ISO A;  3TGZ A;  4OO4 A;  4TR4 A;  4EE0 A;  5A5K A;  4HDE A;  2YNX A;  3G9B A;  4K0G A;  4I8B A;  4IVF A;  1TK0 B;  3ZTL A;  5ECL B;  1QGV A;  4YAP A;  4G0K A;  1A2J A;  4AF2 A;  1ERU A;  3HJM A;  2OE0 A;  2GST A;  3UBK A;  2JU5 A;  1TDI A;  1IYI A;  1GNE A;  1BJX A;  3HVX A;  1TJD A;  3LFL A;  2GZY A;  2D2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...