1TOFA

Thioredoxin h (oxidized form), nmr, 23 structures
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
112
structure length
112
Chain Sequence
GGSVIVIDSKAAWDAQLAKGKEEHKPIVVDFTATWCGPCKMIAPLFETLSNDYAGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords THIOREDOXIN H
publication title NMR solution structure of an oxidised thioredoxin h from the eukaryotic green alga Chlamydomonas reinhardtii.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 38
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1996-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1tofA00
18GSA 5D96A 5J41A 1T4ZA 4N0ZA 3FR6A 2YWMA 2DJJA 4OFMA 2GZPA 4OCEA 2I1UA 2VM1A 3ZFBA 1CQGA 2VOCA 1SJ6A 2XC2A 4NHZA 3BD2A 3L0HA 5F0GA 5HR1A 4ECBA 2FWGA 1VF4A 3HHVA 1WJKA 4GSNA 5COHA 1EV9A 1XFLA 1N8JA 4QL9A 4MZCA 4POLA 5DJMA 2V2GA 4TXOB 3W8SA 1S3AA 1ZYQB 4HDEA 5G5EA 2RM6A 4K2DA 1B8XA 4MPFA 5D9XA 5B8AA 5KN1A 2PGTA 1TI1A 2R5GA 3GX0A 1EWXA 1OYJA 2MBSA 4H86A 2I3YA 1EGRA 2N5FA 4HEA2 3HJPA 1SD8A 4GLTA 2C1YA 3F4RA 4KNDA 4IQ1A 3SBCA 4WR4A 3IV4A 3CRUA 5B6NA 4OMVA 3ZVJA 5G1KA 1QGVA 3BCIA 4WETA 3N5OA 4POBA 3FHKA 4IBPA 4MLYA 3ZITA 4E8EA 2VL2A 3GIXA 2R2JA 1GULA 2WGRA 2GT6A 2CV4A 2F51A 2YCDA 3FKFA 3WT1A 4DSSB 4K0NA 2QSIA 3BBYA 1X5DA 5JWQB 3WGDA 2VLUA 2ZNMA 5FWGA 4RI6A 1GSYA 3O6TA 1ERTA 1PA3A 3F4TA 2H8LA 3UVTA 2FY6A 3CXGA 5IMCA 5GZZB 1K3LA 1K0BA 5D93A 2B5XA 5CNWA 5A4VA 2H76A 2H73A 4ISDA 4DSSA 1OC3A 3C71A 3HXSA 4QQ7A 3UL3A 4D73B 2N5AA 3D5JA 4YQMA 4MCUA 2HRNA 2BTOT 6GSWA 1TW9A 2C0EA 1R5AA 1M0UA 4IGJA 3KP9A 4OFTA 2ZCTA 1NHYA 3QPMA 2HSYA 5CRDA 2VL9A 3O76A 2M72A 1SKWB 1DUGA 4HU7A 1A0RP 4HOJA 5F8BA 3ZMLA 2MMAA 3CYNA 4D73A 1B4PA 3EWLA 1PN9A 2GSRA 2LEGA 2DIZA 4KX4A 2KUCA 5EPFA 3GH9A 2YOIA 3W6GA 1SL2B 2FUG2 2NVLA 1YZXA 3GURA 3IA1A 1EZKA 1S3DA 2MZCA 4ULXA 3FZ9A 3GH6A 2CA8A 1O85A 1V58A 2HXKA 3IOSA 2C3NA 5IO0A 3G9BA 4AJ8A 2CZ3A 3GV1A 3FYGA 1RW1A 3IE3A 5ECPB 3VURA 3LSZA 4DSQA 3APQA 2RLIA 3VPQA 2GVPA 2MBTA 3AY8A 3VFIA 4KE3A 5DDLA 3RAZA 2GTUA 4N11A 2J23A 2WCIA 4MK3A 2E7PA 4HUAA 1FVKA 3VLNA 2C3TA 3KH9A 4XS1A 3EMPA 5IOWA 2R4VA 1SL1B 1O8XA 3TKPA 5INYA 1TJDA 4Q5NA 2O8VB 2MMZA 3ZMKA 5IPGA 2FHEA 4MF6A 2GZYA 1EP8A 2CT6A 4XS4B 4MABA 1H4OA 3TKSE 4OD7A 3FR9A 1Q98A 2PUKC 4ZIJA 2YN1A 1OVNA 2A2RA 2KP1A 2H1BA 4WKWA 3DEXA 2JU5A 1EOGA 3DIEA 5IMZA 5AGYA 1NSWA 4MF7A 1GL8A 2L5LA 1HYUA 2CX3A 1U88A 2ON7A 4I97A 4BWSA 3OR5A 1HNCA 1UVZA 2FA4A 1SKSB 1X0RA 4O92A 2XPEA 3UARA 2C8UA 1R7HA 2XPDA 2IL3A 2YNXA 2YV7A 1QFNA 3VI7A 1AAZA 2DMMA 3RPNA 2X8GA 5J4UA 1T7PB 4BA7A 1MEKA 3E9JB 1XWCA 4EVMA 1K0OA 5DQYA 1SD9A 4OCFA 1T4YA 4V1Ag 2C3QA 3EU3A 3TJKA 4IW9A 2IMEA 4IVFA 3IRAA 3IR4A 4KSOA 5EVOA 2V6OA 4MPGA 3ZIJA 6GSVA 3GHAA 1GSUA 4Z7XA 4YAVA 5D73A 1SJIA 2PPTA 1W4VA 4RQRA 5A5KA 2VLTA 1B9XC 3GNJA 3I69A 4HQZA 2FWFA 5J9BA 5IM9A 4AGSA 1YKCA 1QUWA 5DCGA 2LRTA 4YQVA 5C04A 4ZB8A 2CZ2A 1ABAA 5IO2A 1MDIA 2AUVA 4ECJA 2GSSA 3H93A 1XOAA 2MYGA 2GT5A 2RUEA 3G7IA 4JU5A 1Y25A 3KP8A 3ED3A 4ZB9A 3ERGA 4NWYA 4Q5FA 2P5RA 2WULA 1M2DA 1TRVA 4TR1A 3J7Yb 2DIYA 5IQYA 4TR4A 3ERWA 3GSTA 3MWHA 5ECHB 1GSSA 1K0CA 3ZIVA 2L6DA 1QMVA 4NHWA 1MDJA 3O3TA 1XW5A 3HYPA 3IBHA 1F3AA 2AV4A 3J7Yk 3DGQA 3KMOA 1JZDA 2GQMA 3UIWA 1ERVA 1O8WA 3E3EA 1ACVA 5EL8A 2L4CA 4L0UA 2DLXA 1WP0A 1ZMAA 2O7KA 1ZL9A 2C80A 1X5EA 3F0IA 4EC0A 3LXTA 1PL2A 1IYIA 4G2EA 3TOUA 3KIJA 3F4SA 2C0FA 1AQXA 4FYUA 1BJXA 2BJXA 1BX9A 4L5OA 1YQ1A 1F2EA 3RHBA 2J9HA 2V6KA 2V32A 1YEXA 1ZGNA 3CSJA 4MH3A 4MJCA 1MDKA 2L5OA 4IQAA 5HQPA 4E8HA 4HZ4A 1V40A 4GCIA 2LRCA 3S9FA 2KOKA 1EEJA 4JR6A 3C7MA 4YAPA 1EP7A 2AHEA 3GRXA 1ERUA 1XZOA 4LLRA 5J9CA 1IYHA 3IDVA 2OBKA 1BAYA 1FAAA 2C0DA 3GKXA 2CQ9A 1ZYEA 3F63A 4I6XA 2VCQA 3F3RA 2VD1A 4HJ2A 2LV3A 3ISOA 7GSSA 4TXVA 3A2VA 2CVBA 2DMLA 2TRCP 3GSSA 3IC4A 3EE2A 3NIVA 3IK7A 4HJMA 3H79A 4IKHA 2D2ZA 1WOUA 3TKRA 1JHBA 2VCWA 1QQ2A 4BPYA 2JSYA 3VWXA 2F9SA 3HJOA 4IELA 5ELAA 1SK2A 2ON5A 2LSTA 4TVEA 4WF4A 3WT2A 3Q74A 3GL5A 4MZBA 2V1MA 2C0GA 5H5RA 1M99A 3HCZA 5L71A 2H6XA 4FYBA 5JCUA 5GAPD 4V1Ap 4WBRD 5D8IA 4OO5A 1PX7A 1ON4A 2I81A 4GTUA 1A8YA 3GYKA 4X1UA 1WMJA 4PQ1A 1A2MA 3QR6A 2E2GA 4IHUA 3LGCA 3TJFA 3L78A 3JCML 1GNEA 1HNBA 3APOA 6GSTA 4AJ6A 5HR0A 1X9SB 5KN0A 2O87A 3NZNA 1I5GA 14GSA 1GUMA 1NW2A 2XHFA 4JRRA 1GUHA 4ECIA 1PMTA 3DWVA 2K9FA 4L5LA 4KGIA 2YV9A 5GAND 1RK4A 4ZBBA 1B4QA 3FR3A 1XVQA 5B6MA 2PBJA 5FT3A 4JBBA 4G10A 4PNGA 4LMVA 4K0GA 4F0BA 1URMA 1YJ6A 3KTLA 4KCEA 4PUFC 2HNLA 2H6YA 1NHOA 1SJZA 3LYKA 3UEMA 4N10A 3ZREA 3M9JA 5G1LA 3W8JA 3C73A 1BG5A 2H6ZA 5E4WA 1Z6MA 3P7XA 1DSBA 1SKRB 1T1VA 4X43A 5ECSA 4EF0A 2B7KA 2R3XA 2IJYA 1DE1A 1F6MC 17GSA 5CAXA 2L4QA 3I43A 4EXJA 1M9AA 4XRAA 2VLVA 2N5BA 1YKAA 5JWRB 2LKUA 1EGOA 4WF5A 5ECQB 3M9KA 1PQNA 3ME7A 1T3BA 2WJUA 2DC5A 2M80A 5AN1A 1Q4JA 3BCKA 4RQXA 4O5RA 1GNWA 3HKRA 5KEJA 3C8EA 3GKNA 3WGXA 4K1FA 3MSZA 3TDGA 2P5QA 4HI7A 1AQVA 1Z7PA 2VD0A 1A8LA 2VCZA 2B7JA 3GL3A 1FOVA 2PERA 3GA4A 2F8FA 1TU7A 5DVBA 2X8HA 2YPMA 3GFKA 3LWAA 2FD3A 5ECIB 1R4WA 2MMOA 2LUSA 2YP6A 4KUNA 1A23A 1FG4A 2ZUPA 4PXOA 1XW6A 2WRTA 1GTUA 2K18A 3TKSC 4TN8A 4ZL8A 5ECRB 1WIKA 4GXZA 4BWQA 4YQUA 2PMTA 3CBUA 3HA9A 4ID0A 1WE0A 3GKMA 3DYRA 3PR8A 1CQHA 4I5QA 4OWYA 4GQCA 4IN0A 1ML6A 4Q5QA 4L8EA 4O7HA 1YF0A 4TKYA 5HFGA 1OAZA 1E6BA 4ZXGA 3EINA 3TJGA 1SYXA 3A2WA 4MJBA 1XW9A 2JADA 3HVSA 3DXBA 3P90A 4NAXA 4ZL9A 3CSHA 1TTZA 3DVWA 5CRGA 1HD2A 1UA5A 3U6VA 3MNGA 2VUPA 1TI3A 1GWCA 3CSIA 2GGTA 2GQKA 3VK9A 5B7CA 1R26A 5F05A 2OE1A 5IIZA 5G5FA 4O32A 2LTKA 2BMXA 1J9BA 1PKWA 1ILOA 5DAKB 4BVYA 1V57A 4POKA 5G31A 3LG6A 3GN3A 3FRCA 3APSA 4F0CA 3DD3A 2A4VA 3KCMA 1OC8A 1WWJA 1M2AA 4ZBAA 1GP1A 5CRWA 1U87A 4NPBA 3HVXA 2B1LA 1THXA 4F2IA 1N2AA 1B48A 2H74A 9GSSA 5AIVA 2VO4A 1V98A 3H4KA 4L0WA 3WD6A 4CHSA 5DAKA 8GSSA 1B9YC 2AYTA 5H5SA 1DBYA 2HE3A 4NXIA 4ZL7A 3BJ5A 4GF0A 5ECLB 3P2AA 4EDYA 3ME8A 4KH7A 4NV2A 3VPTA 4KDYA 3EU4A 2XBIA 2X8CA 3KH7A 2OBIA 3HVVA 3KZQA 1EV4A 3A2XA 4GWRA 1Z5YE 2R6KA 4DVCA 19GSA 1PL1A 3IAS2 3QAWA 1OE7A 3H8QA 1A2LA 1TOFA 2PWJA 1TKDB 4LL1B 2JZTA 4ACSA 2GZZA 2LQQA 5AIXA 3U5RE 1PX6A 1GSFA 4TR1B 1XOBA 3GMFA 5F07A 1LBKA 4KB3A 5EY6A 1YDKA 1U6TA 4MZWA 2YJHA 5CREA 4MDCA 3CRTA 2V41A 1XVWA 4Q5RA 3EURA 2QKEA 1AUCA 3RDWA 4V2LA 2AB6A 3L4NA 2EIRA 3KXOA 6GSYA 2EIOA 1UN2A 1M7TA 1TK5B 3PGTA 1A2JA 3IAM2 1S3CA 3E0UA 5IMVA 2JACA 4JZQA 3KM6A 1TRWA 2HI7A 3LORA 1O6JA 2DJ2A 3GX8A 2K8VA 2FNOA 5ID2A 5J3RA 2G0FA 5JCGA 1JLWA 3A3TA 3GUSA 3UVHA 5C00A 2VL3A 4ML1A 1VRSD 3QFAC 2VCVA 1YEPA 1K0AA 3C1RA 1TRSA 3D21A 1QXHA 2A2SA 1G7EA 2PVOC 2OADA 4JEDA 3TKQA 1FVJA 2EC4A 1V9WA 3PINA 2OJLA 5CP1A 4TR0A 3TGZA 5JCWA 4K7NA 3D0ZA 4HZ2A 2YZUA 5LD0A 1TP9A 2VL2C 5FHIA 4WR5A 1HQOA 1TXXA 1OKDA 3ZTLA 6GSXA 1AIUA 3M0FA 1JLVA 4TW5A 4MA9A 4CW9A 3VWWA 5KN3A 2DSAA 3KEBA 5HR3A 3C1SA 4JR4A 4X0XA 2DJ3A 4I8BA 3Q6OA 3LJRA 2L6CA 2IIYA 4G9HA 2OE0A 5LCZA 1XXUA 5ENUA 3EVIA 1K0DA 1THOA 2VCTA 4HS1A 4LMWA 4XRDA 4EE0A 3TCOA 2IPAA 2LNTA 3KTBA 4GSTA 1XIYA 3ZFLA 2YJ7A 2K6VA 2O85A 3F6DA 1TRUA 2H75A 5GSSA 3F8UA 4PURA 4N0VA 3TB2A 3D6IA 1ERWA 2IMDA 2B5EA 1Z9HA 1TDIA 3FK8A 1SK1A 1SL0B 1VGLA 3L9VA 3K8NA 1RQMA 1J0FA 3TJBA 4PUAA 2LRNA 10GSA 4V2NA 2CVDA 5AISA 4EKZA 2IFQB 2JSZA 2I4AA 3UBKA 3TRXA 3GKKA 4K9ZA 5ECNB 4MMMA 2TIRA 4ZBDA 2I9HA 3IHQA 3UJ1A 3D4TA 1QK8A 2LQOA 1Z7RA 4JE1A 2ES7A 3BOAA 1ZCPA 1T00A 5DCHA 4IJIA 4FH8A 2FWEA 1BYEA 3LXZA 4TOPA 2H0IA 3DKSA 3KGKA 1TK0B 1PRXA 3DVXA 2IFQA 4XS6A 3I6AA 3VI5A 2YWIA 1O7UA 4OFNA 3D4MA 3IK9A 1K3YA 1TK8B 5IMDA 1GSEA 4LA1A 1EEMA 3F9UA 1A0FA 3F3QA 1O81A 3ZYWA 2G2QA 3HJMA 2RIIA 5GSTA 1O73A 1T8EB 2RM5A 2E2MA 4KCAA 1G6WA 4K6XA 4K8MA 1M9BA 3G7YA 4AJ7A 4TXOA 4PQIA 4FO5A 5ECMB 3QOUA 1LU4A 1PD21 2B3SA 2WDUA 2H66A 2YZHA 4P3YB 2LJRA 4K7OA 4F03A 1G6YA 2HLSA 2JZRA 2PN8A 1F37A 3DRNA 3UOMA 2KP2A 3IPZA 4EO3A 3ERFA 5JWOB 3HZ4A 2IWTA 2KLXA 1WPIA 2X64A 2NPBA 2PVQA 3FZ4A 4RI7A 4BL7A 3QFBC 5ECKB 2LJKA 4KA0A 5LNKe 2HYXA 4J2FA 3HDCA 3LQ7A 3QAGA 1PKZA 2FGXA 2YWOA 1AQWA 2M46A 2H72A 1XPVA 4KDXA 1FO5A 2YANA 1MD3A 1VF2A 3G7JA 4ILFA 3H1NA 1ZZYA 3NOFA 4ML6A 4LL4B 2IMFA 2CX4A 1ZOFA 4QL7A 4WEYA 4I2TA 5HFKA 4F82A 16GSA 4KAEA 4AF2A 2DJ1A 2WZ9A 2Z9SA 4DSRA 1GUKA 1LJRA 3US3A 4MJAA 1U3IA 2HRFA 4TR3A 4XHMA 2L57A 5F06A 1X9WB 2H70A 2LNSA 5DBQA 1C72A 2IMKA 3WGEA 1GSDA 2HFDA 1A24A 2QC7A 3EYTA 2RUFA 2H1GA 1YF1A 1J08A 1JZRA 3LFLA 1XWGA 4MH2A 1KNGA 2KHPA 3UMAA 1SYRA 5IOXA 4OO4A 3P8WA 4EUYA 1E2YA 2GSTA 4MP4A 1NM3A 2VAFA 4BVXA 1GTAA 4XCSA 4MJEA 5E59A 4EDZA 5CYYA 3Q18A 2X99A 3VWVA 2DJ0A 5IMFA 1AXDA 4GQFA 4EL1A 1KEBA 3DMLA 1MTCA 2JZSA 3M3MA 3LEFA 1TU8A 1BQ7A 2REMA 1U3AA 2CAIA 2NBSA 4GSSA 2WFCA 2HZEB 2IN3A 1KBNA 1F9MA 2WB9A 3RHCA 2FCHA 3TOTA 1XWKA 3UBLA 2NDOA 3QD9A 4I2UA 1XBSA 5D9WA 4IS0A 1OE8A 3TUEA 1G0TA 2CAQA 5IPHA 1YY7A 2ALBA 2HSHA 1HNAA 2HZEA 1XWAA 3EC3A 3WYWA 5D9TA 5KN2A 4MF5A 3KJYA 1SENA 5CO3A 3L9SA 1GRXA 1GSQA 3ZRDA 1GLPA 2AAWA 1JZOA 4PX1A 4XS4A 5J5NA 3EMXA 2F8AA 5H5QA 1DE2A 1GTBA 1M2BA 3ZL5A 2OA7A 1JFUA 1Z6NA 2FWHA 4PGTA 3TRQA 4IJ3A 1OC9B 2OACA 6GSUA 5DQSA 5ABRA 3FW2A 1K3OA 1Y6EA 22GSA 4KDUA 5HFIA 2AJQB 1AW9A 1FB6A 3KMNA 3MDKA 2HZFA 4XTSA 3PH9A 3ZVJD 1V2AA 3F6FA 4KSMA 2YWNA 4FYCA 2L59A 2P31A 4GRFA 1FB0A 3UAPA 1OC9A 1PGTA 4HQSA 3QCPA 6GSSA 1PSQA 1K0NA 3TKSA 4NMUA 5G30A 3L9UA 3KD0A 4CDOA 1UC7A 1USBA 4IP1A 4FIWA 2TRXA 2O89A 4ECCA 5ID2B 2H1AA 2FA8A 5IMAA 2JL4A 1SU9A 2R37A 13GSA 3VWUA 2GQLA 3N9JA 4WXTA 1H75A 1XWBA 5A4UA 4K7IA 2OKAA 5D9VA 3CTFA 2NTOA 3QMXA 3CTGA 3ZZXA 20GSA 3HD5A 1GTIA 1OKTA 2K8SA 2LS5A 1W89A 2QGVA 2C4JA 4J56E 4HU9A 2IMIA 2B5YA 2H30A 3A5WA 3FZAA 1JZWA 1SK0A 1G7OA 2DBCA 2WS2A 1I9DA 3TRPA 1KTEA 5A4WA 1AC1A 3FY7A 2FLSA 2H19A 4WBJA 5DALB 5B8BA 1BEDA 3RPPA 3QDNA 3RBTA 4TRXA 3M1GA 3ZLPA 2VM2A 1FW1A 4PQHA 2F3MA 4RUVA 2VCXA 3SWLA 2B1KA 2GS3A 3GTUB 4N30A 3MAKA 2OE3A 4KW6A 1GH2A 4G19A 2GSQA 2H71A 1XCCA 1X9MB 5ECOB 11GSA 4V2MA 4ZILA 2CVKA 5DJLA 5ELGA 1ST9A 3I9V2 1VF1A 2H1DA 4POMA 3FEUA 5DALA 3D22A 1MD4A 2H0HA 2GDRA 1Z3EA 5HR2A 4YH2A 3QAVA 3IXRA 2P0GA 2XBQA 3HZ8A 3TJJA 1F3BA 4ZB6A 1X5CA 3Q19A 3GTUA 3LYPA 4F9ZA 1GLQA 1WRYA 2H0GA 2HT9A 3R2QA 2EIQA 12GSA 2VIMA 3HY2A 1R5PA 1VF3A 4XIHA 2H01A 2PU9C 3V1WA 2B6MA 2MMNA 3FZ5A 2LJAA 4PNFA 5G2ZA 1K0MA 5CRHA 4IP6A 2DJKA 2E0QA 4J57E 4NV5A 3M8NA 1FHEA 4DEJA 2GLRA 1EOHA 3CMIA
chains in the Genus database with same CATH superfamily
18GSA 5D96A 5J41A 1T4ZA 4N0ZA 3FR6A 2YWMA 2DJJA 4OFMA 2GZPA 4OCEA 2I1UA 2VM1A 3ZFBA 1CQGA 2VOCA 1SJ6A 2XC2A 4NHZA 3BD2A 3L0HA 5F0GA 5HR1A 4ECBA 2FWGA 1VF4A 3HHVA 1WJKA 4GSNA 5COHA 1EV9A 1XFLA 1N8JA 4QL9A 4MZCA 4POLA 5DJMA 2V2GA 4TXOB 3W8SA 1S3AA 1ZYQB 4HDEA 5G5EA 2RM6A 4K2DA 1B8XA 4MPFA 5D9XA 5B8AA 5KN1A 2PGTA 1TI1A 2R5GA 3GX0A 1EWXA 1OYJA 2MBSA 4H86A 2I3YA 1EGRA 2N5FA 4HEA2 3HJPA 1SD8A 4GLTA 2C1YA 3F4RA 4KNDA 4IQ1A 3SBCA 4WR4A 3IV4A 3CRUA 5B6NA 4OMVA 3ZVJA 5G1KA 1PN0A 1QGVA 3BCIA 4WETA 3N5OA 4POBA 3FHKA 4IBPA 4MLYA 3ZITA 4E8EA 2VL2A 3GIXA 2R2JA 1GULA 1PFOA 2WGRA 2GT6A 2CV4A 2F51A 2YCDA 3FKFA 3WT1A 4DSSB 4K0NA 2QSIA 3R3EA 3BBYA 1X5DA 5JWQB 3WGDA 2VLUA 2ZNMA 5FWGA 4RI6A 1GSYA 3O6TA 1ERTA 1PA3A 3F4TA 2H8LA 3UVTA 2FY6A 3CXGA 5IMCA 2DKIA 5GZZB 1K3LA 1K0BA 5D93A 2B5XA 5CNWA 5A4VA 2H76A 2H73A 4ISDA 4DSSA 1OC3A 3C71A 3HXSA 4QQ7A 3UL3A 4A5PA 4D73B 2N5AA 3D5JA 4YQMA 4MCUA 2HRNA 2BTOT 6GSWA 1TW9A 2C0EA 1R5AA 1M0UA 4IGJA 3KP9A 4OFTA 2ZCTA 1NHYA 3QPMA 2HSYA 5CRDA 2R0CA 2VL9A 3O76A 2M72A 1SKWB 1DUGA 4HU7A 1A0RP 4HOJA 5F8BA 3ZMLA 2MMAA 3CYNA 4KF9A 4D73A 1B4PA 3EWLA 1PN9A 2GSRA 2LEGA 2DIZA 4KX4A 2KUCA 5EPFA 3GH9A 2YOIA 3W6GA 1SL2B 2FUG2 2NVLA 1YZXA 3GURA 3IA1A 1EZKA 1S3DA 2MZCA 4ULXA 3FZ9A 3GH6A 2CA8A 3A5IA 1O85A 1V58A 2HXKA 3IOSA 2C3NA 5IO0A 3G9BA 4AJ8A 2CZ3A 3GV1A 3FYGA 1RW1A 3IE3A 5ECPB 3VURA 3LSZA 4DSQA 3APQA 2RLIA 3VPQA 2GVPA 2MBTA 3AY8A 3VFIA 4KE3A 5DDLA 3RAZA 2GTUA 4N11A 2J23A 2WCIA 4MK3A 2HRKA 2E7PA 4HUAA 1FVKA 3VLNA 2C3TA 3KH9A 4XS1A 3EMPA 5IOWA 2R4VA 1SL1B 1O8XA 3TKPA 5INYA 1TJDA 4Q5NA 2O8VB 2MMZA 3ZMKA 5IPGA 2FHEA 4MF6A 2GZYA 1EP8A 2CT6A 4XS4B 4MABA 1H4OA 3TKSE 4G0KA 4OD7A 3FR9A 1Q98A 2PUKC 4ZIJA 2YN1A 1OVNA 2A2RA 2KP1A 2H1BA 4WKWA 3DEXA 2JU5A 1EOGA 3DIEA 5IMZA 5AGYA 4Z2RA 1NSWA 4MF7A 1GL8A 2L5LA 1HYUA 2CX3A 1U88A 2ON7A 4I97A 4BWSA 3OR5A 1HNCA 2R0GA 1UVZA 2FA4A 1SKSB 1X0RA 4O92A 2XPEA 3UARA 2C8UA 1R7HA 2XPDA 2IL3A 2YNXA 2YV7A 1QFNA 3VI7A 5KOWA 1AAZA 2DMMA 3RPNA 2X8GA 5J4UA 1T7PB 4BA7A 1MEKA 3E9JB 1XWCA 4EVMA 1K0OA 4Z2TA 5DQYA 1SD9A 4OCFA 1T4YA 4V1Ag 2C3QA 3EU3A 3TJKA 4IW9A 2IMEA 4IVFA 3IRAA 3IR4A 4KSOA 5EVOA 2V6OA 4MPGA 3ZIJA 6GSVA 3GHAA 1GSUA 4Z7XA 4O5UA 4YAVA 5D73A 1SJIA 2PPTA 1W4VA 4RQRA 5A5KA 2VLTA 1B9XC 3GNJA 3I69A 4HQZA 2FWFA 5J9BA 5IM9A 4AGSA 1YKCA 1QUWA 5DCGA 2LRTA 4YQVA 5C04A 4ZB8A 2CZ2A 1ABAA 5IO2A 1MDIA 2AUVA 4ECJA 2R0PA 2GSSA 3H93A 1XOAA 2MYGA 2GT5A 2RUEA 3G7IA 4JU5A 1Y25A 3KP8A 3ED3A 4ZB9A 3ERGA 4NWYA 4Q5FA 2P5RA 2WULA 1M2DA 1TRVA 4TR1A 3J7Yb 2DIYA 5IQYA 4TR4A 3ERWA 3GSTA 3MWHA 5ECHB 1GSSA 1K0CA 3ZIVA 2L6DA 1QMVA 4NHWA 1MDJA 3O3TA 1XW5A 3HYPA 3IBHA 1F3AA 2AV4A 3J7Yk 4USSA 3DGQA 3KMOA 1JZDA 2GQMA 3UIWA 1ERVA 1O8WA 3E3EA 1ACVA 5EL8A 2L4CA 4K5RA 4L0UA 2DLXA 1WP0A 1ZMAA 2O7KA 1ZL9A 2C80A 1X5EA 3F0IA 4EC0A 3LXTA 1PL2A 1IYIA 4G2EA 3TOUA 3KIJA 4HSCX 3F4SA 2C0FA 1AQXA 4FYUA 1BJXA 2BJXA 1BX9A 4L5OA 1YQ1A 1F2EA 3RHBA 4CY6A 2J9HA 2V6KA 2V32A 1YEXA 1ZGNA 3CSJA 4MH3A 4MJCA 1MDKA 2L5OA 4IQAA 5HQPA 4E8HA 4HZ4A 1V40A 4GCIA 2LRCA 3S9FA 2KOKA 1EEJA 4JR6A 3C7MA 4YAPA 1EP7A 2AHEA 3GRXA 1ERUA 1XZOA 4LLRA 5J9CA 1IYHA 3IDVA 2OBKA 2DKHA 1BAYA 1FAAA 4BIKA 2C0DA 3GKXA 2CQ9A 1ZYEA 3F63A 4I6XA 2VCQA 3F3RA 2VD1A 4HJ2A 2LV3A 3ISOA 7GSSA 4TXVA 3A2VA 2CVBA 2DMLA 2TRCP 3GSSA 3IC4A 3EE2A 3NIVA 3IK7A 4HJMA 3H79A 4IKHA 2D2ZA 1WOUA 3TKRA 1JHBA 2VCWA 1QQ2A 4BPYA 2JSYA 3VWXA 2F9SA 3HJOA 4IELA 5ELAA 1SK2A 2ON5A 2LSTA 4TVEA 4WF4A 3WT2A 3Q74A 3GL5A 4MZBA 2V1MA 2C0GA 5H5RA 1M99A 3HCZA 5L71A 2H6XA 4FYBA 5JCUA 5GAPD 4V1Ap 4WBRD 5D8IA 4OO5A 1PX7A 1ON4A 2I81A 4GTUA 1A8YA 3GYKA 4X1UA 1WMJA 4PQ1A 1A2MA 3QR6A 2E2GA 4IHUA 3LGCA 3TJFA 3L78A 3JCML 1GNEA 1HNBA 3APOA 6GSTA 4AJ6A 5HR0A 1X9SB 5KN0A 2O87A 3NZNA 1I5GA 14GSA 1GUMA 1NW2A 2XHFA 4JRRA 1GUHA 4ECIA 1PMTA 3DWVA 2K9FA 4L5LA 4KGIA 2YV9A 5GAND 1RK4A 4ZBBA 1B4QA 3FR3A 3MIXA 1XVQA 5B6MA 2PBJA 5FT3A 4JBBA 4G10A 4PNGA 4LMVA 4K0GA 4F0BA 1URMA 1YJ6A 3KTLA 4KCEA 4PUFC 2HNLA 2H6YA 1NHOA 1SJZA 3LYKA 3UEMA 4N10A 3ZREA 3M9JA 5G1LA 3W8JA 3C73A 1BG5A 2H6ZA 5E4WA 1Z6MA 3P7XA 1DSBA 1SKRB 1T1VA 4X43A 5ECSA 4EF0A 2B7KA 2R3XA 2IJYA 1DE1A 1F6MC 17GSA 5CAXA 2L4QA 3I43A 4EXJA 1M9AA 4XRAA 2VLVA 2N5BA 1YKAA 5JWRB 2LKUA 1EGOA 4WF5A 5ECQB 3M9KA 1PQNA 3ME7A 1T3BA 2WJUA 2DC5A 2M80A 5AN1A 1Q4JA 4RQXA 3BCKA 4O5RA 1GNWA 3HKRA 5KEJA 3C8EA 3GKNA 3WGXA 4K1FA 3MSZA 3TDGA 2P5QA 4HI7A 1AQVA 1Z7PA 2VD0A 1A8LA 2VCZA 2B7JA 3GL3A 1FOVA 2PERA 3GA4A 2F8FA 1TU7A 5DVBA 2X8HA 2YPMA 3GFKA 3LWAA 5KOXA 2FD3A 5ECIB 1R4WA 2MMOA 2LUSA 2YP6A 4KUNA 1A23A 1FG4A 2ZUPA 4PXOA 1XW6A 2WRTA 1GTUA 2K18A 3TKSC 4TN8A 4ZL8A 5ECRB 1WIKA 4GXZA 4BWQA 4YQUA 2PMTA 3CBUA 3HA9A 4ID0A 1WE0A 3GKMA 3DYRA 3PR8A 1CQHA 4I5QA 4OWYA 4GQCA 4IN0A 1ML6A 4Q5QA 4L8EA 4O7HA 1YF0A 4TKYA 5HFGA 1OAZA 1E6BA 4ZXGA 3EINA 3TJGA 1SYXA 3A2WA 4MJBA 1XW9A 2JADA 3HVSA 3DXBA 3P90A 4NAXA 4ZL9A 3CSHA 4BVYB 1TTZA 3DVWA 5CRGA 1HD2A 1UA5A 3U6VA 3MNGA 2VUPA 1TI3A 1GWCA 3CSIA 2GGTA 2GQKA 3VK9A 5B7CA 4K2XA 1R26A 5F05A 2OE1A 5IIZA 5G5FA 4O32A 2LTKA 2BMXA 1J9BA 1PKWA 1ILOA 1XG8A 5DAKB 4BVYA 1V57A 4POKA 3IHGA 5G31A 3LG6A 3GN3A 3FRCA 3APSA 4F0CA 3DD3A 2A4VA 3KCMA 2QA1A 1OC8A 1WWJA 1M2AA 4ZBAA 1GP1A 5CRWA 1U87A 4NPBA 3HVXA 2B1LA 1THXA 4F2IA 1N2AA 1B48A 2H74A 9GSSA 5AIVA 2VO4A 1V98A 3H4KA 4L0WA 3WD6A 3IC8A 4CHSA 5DAKA 8GSSA 1B9YC 2AYTA 5H5SA 1DBYA 2HE3A 4NXIA 4ZL7A 3BJ5A 4GF0A 5ECLB 3P2AA 4EDYA 2X4AA 3ME8A 4KH7A 4NV2A 3VPTA 4KDYA 3EU4A 2XBIA 2X8CA 3KH7A 2OBIA 3HVVA 3KZQA 1EV4A 3A2XA 4GWRA 2X49A 1Z5YE 2R6KA 4DVCA 19GSA 1PL1A 3IAS2 3QAWA 1OE7A 3H8QA 1A2LA 1TOFA 2PWJA 1TKDB 4LL1B 2JZTA 4ACSA 2GZZA 2LQQA 5AIXA 3U5RE 1PX6A 1GSFA 4TR1B 1M3JA 1XOBA 3GMFA 5F07A 1LBKA 2HSMA 4KB3A 5EY6A 1YDKA 1U6TA 4MZWA 2YJHA 5CREA 4MDCA 3CRTA 3PPUA 2V41A 1XVWA 4Q5RA 3EURA 2QKEA 1AUCA 3RDWA 4V2LA 2AB6A 3L4NA 2EIRA 3KXOA 6GSYA 2EIOA 1UN2A 2QA2A 1M7TA 1TK5B 3PGTA 1A2JA 3IAM2 1S3CA 3E0UA 5IMVA 2JACA 4JZQA 3KM6A 1TRWA 2HI7A 3LORA 1O6JA 2DJ2A 3GX8A 2K8VA 2FNOA 5ID2A 5J3RA 2G0FA 5JCGA 1JLWA 3A3TA 3GUSA 3UVHA 5C00A 2VL3A 4ML1A 1VRSD 3QFAC 2VCVA 1YEPA 1K0AA 3C1RA 1TRSA 3D21A 1QXHA 2A2SA 1G7EA 2PVOC 2OADA 4JEDA 3TKQA 1FVJA 2EC4A 1ZYNA 1V9WA 3PINA 2OJLA 5CP1A 4TR0A 3TGZA 5JCWA 4K7NA 3D0ZA 4HZ2A 2YZUA 5LD0A 1TP9A 2VL2C 5FHIA 4WR5A 1HQOA 1TXXA 1OKDA 3ZTLA 6GSXA 1AIUA 3M0FA 1JLVA 4K5SA 4TW5A 4MA9A 4CW9A 3VWWA 5KN3A 2DSAA 3KEBA 5HR3A 3C1SA 4JR4A 4X0XA 2DJ3A 4I8BA 3Q6OA 3LJRA 2L6CA 2IIYA 4G9HA 2OE0A 5LCZA 1XXUA 5ENUA 3EVIA 1K0DA 1THOA 2VCTA 4HS1A 4LMWA 4XRDA 4EE0A 3TCOA 2IPAA 2LNTA 3KTBA 4GSTA 1XIYA 3ZFLA 2YJ7A 2K6VA 2O85A 3F6DA 1TRUA 2H75A 5GSSA 3F8UA 4PURA 4N0VA 3TB2A 3D6IA 1ERWA 2IMDA 2B5EA 1Z9HA 5BRTA 1TDIA 3FK8A 1SK1A 1SL0B 1VGLA 3L9VA 3K8NA 1RQMA 1J0FA 5BMUA 3TJBA 4PUAA 2LRNA 10GSA 4V2NA 2CVDA 5AISA 4EKZA 2IFQB 2JSZA 2I4AA 3UBKA 3TRXA 3GKKA 4K9ZA 5ECNB 4MMMA 2TIRA 4ZBDA 2I9HA 3IHQA 3UJ1A 3D4TA 1QK8A 2LQOA 1Z7RA 4JE1A 2ES7A 3BOAA 1ZCPA 1T00A 5DCHA 4IJIA 4FH8A 2FWEA 1BYEA 3LXZA 4MNNA 4TOPA 2H0IA 3DKSA 3KGKA 1TK0B 1PRXA 3DVXA 2IFQA 4XS6A 3I6AA 3VI5A 2YWIA 1O7UA 4OFNA 3D4MA 3IK9A 1K3YA 1TK8B 5IMDA 1GSEA 4LA1A 1EEMA 3F9UA 1A0FA 3F3QA 1O81A 3ZYWA 2G2QA 3HJMA 2RIIA 5GSTA 1O73A 1T8EB 2RM5A 2E2MA 4KCAA 1G6WA 4K6XA 4K8MA 1M9BA 3G7YA 4AJ7A 4TXOA 4BL7B 4PQIA 4FO5A 5ECMB 3QOUA 1LU4A 1PD21 2B3SA 1FOHA 2WDUA 2H66A 2YZHA 4P3YB 2LJRA 4K7OA 4F03A 3FMWA 1G6YA 2HLSA 2JZRA 2PN8A 1F37A 3DRNA 3UOMA 4CY8A 2KP2A 3IPZA 4EO3A 3ERFA 5JWOB 3HZ4A 2IWTA 2KLXA 1WPIA 2X64A 2NPBA 2PVQA 3FZ4A 4RI7A 4BL7A 3QFBC 5ECKB 3MYDA 2LJKA 4KA0A 5LNKe 2HYXA 4J2FA 3HDCA 3LQ7A 3QAGA 1ZYPA 4G0IA 1PKZA 2FGXA 2YWOA 1AQWA 2M46A 2H72A 1XPVA 4KDXA 1FO5A 2YANA 1MD3A 1VF2A 3G7JA 4ILFA 3H1NA 1ZZYA 3NOFA 4Z2UA 4ML6A 4LL4B 2IMFA 4YKGA 2CX4A 1ZOFA 4QL7A 4WEYA 4I2TA 5HFKA 4F82A 16GSA 4KAEA 4AF2A 2DJ1A 2WZ9A 2Z9SA 4DSRA 1GUKA 1LJRA 3US3A 3HVNA 4MJAA 1U3IA 2HRFA 4TR3A 4XHMA 2L57A 5F06A 1X9WB 2H70A 2LNSA 5DBQA 1C72A 2IMKA 3WGEA 1GSDA 1S3RA 2HFDA 4BVXB 1A24A 2A2PA 2QC7A 3EYTA 2RUFA 2H1GA 1YF1A 1J08A 1JZRA 3LFLA 4EIPA 1XWGA 4MH2A 4ICYA 1KNGA 2KHPA 3UMAA 1SYRA 5IOXA 4OO4A 3P8WA 4EUYA 1E2YA 2GSTA 4MP4A 1NM3A 2VAFA 4BVXA 1GTAA 4XCSA 4MJEA 5E59A 4EDZA 5CYYA 3Q18A 2X99A 3VWVA 2DJ0A 5IMFA 1AXDA 4GQFA 4EL1A 1KEBA 3DMLA 1MTCA 2JZSA 3M3MA 3LEFA 1TU8A 1BQ7A 2REMA 1U3AA 2CAIA 2NBSA 4GSSA 2WFCA 2HZEB 3CQFA 2IN3A 1KBNA 2A4HA 1F9MA 2WB9A 4G0LA 3RHCA 2FCHA 3TOTA 1XWKA 3UBLA 2NDOA 3QD9A 4I2UA 1XBSA 5D9WA 4IS0A 2HRAA 1OE8A 3TUEA 1G0TA 2CAQA 5IPHA 1YY7A 2ALBA 2HSHA 1HNAA 2HZEA 1XWAA 3EC3A 3WYWA 5D9TA 5KN2A 4MF5A 3KJYA 1SENA 5CO3A 4PTSA 3L9SA 1GRXA 1GSQA 3ZRDA 1GLPA 4YKFA 2AAWA 1JZOA 4PX1A 4XS4A 5J5NA 3EMXA 2F8AA 5H5QA 1DE2A 1GTBA 1M2BA 3ZL5A 2OA7A 1JFUA 1Z6NA 2FWHA 4PGTA 3TRQA 4IJ3A 1OC9B 3EPTA 3LW9A 2OACA 6GSUA 5DQSA 5ABRA 3FW2A 1K3OA 1Y6EA 22GSA 4KDUA 5HFIA 2AJQB 1AW9A 1FB6A 3KMNA 3MDKA 2HZFA 4XTSA 3PH9A 3ZVJD 1V2AA 3F6FA 4KSMA 2UZ8A 2YWNA 4FYCA 2L59A 2P31A 4GRFA 1FB0A 3UAPA 1OC9A 1PGTA 4FQUA 3QCPA 4HQSA 6GSSA 1PSQA 1K0NA 3TKSA 4NMUA 5G30A 3L9UA 3KD0A 4CDOA 1UC7A 1USBA 4IP1A 4FIWA 2TRXA 2O89A 4ECCA 5ID2B 2H1AA 2FA8A 5IMAA 4EIQA 2JL4A 1SU9A 2R37A 13GSA 3VWUA 2GQLA 3N9JA 4WXTA 1H75A 1XWBA 5A4UA 4K7IA 2OKAA 5D9VA 4O5QA 3CTFA 2NTOA 3QMXA 3CTGA 3ZZXA 20GSA 3HD5A 1GTIA 1OKTA 2K8SA 2LS5A 1W89A 2QGVA 2C4JA 4J56E 4HU9A 2IMIA 2B5YA 2H30A 3A5WA 3FZAA 1JZWA 1SK0A 1G7OA 2DBCA 2WS2A 1I9DA 3TRPA 1KTEA 5A4WA 1AC1A 3FY7A 2FLSA 2H19A 4WBJA 5DALB 5B8BA 1BEDA 3RPPA 3QDNA 3RBTA 4TRXA 3M1GA 3ZLPA 2VM2A 1FW1A 4PQHA 2F3MA 4RUVA 2VCXA 3SWLA 2B1KA 2GS3A 3GTUB 4N30A 3MAKA 2OE3A 4KW6A 1GH2A 4G19A 2GSQA 2H71A 1XCCA 1X9MB 5ECOB 11GSA 4V2MA 4ZILA 2CVKA 5DJLA 5ELGA 1ST9A 3I9V2 1VF1A 2H1DA 4POMA 3FEUA 5DALA 3D22A 1MD4A 2H0HA 2GDRA 1Z3EA 5HR2A 4YH2A 3QAVA 3IXRA 2P0GA 2XBQA 3HZ8A 3TJJA 1M3IA 1F3BA 4ZB6A 1X5CA 3Q19A 3GTUA 3LYPA 4F9ZA 1GLQA 1WRYA 2H0GA 2HT9A 3R2QA 2EIQA 4X4JA 12GSA 2VIMA 3HY2A 1R5PA 1VF3A 4XIHA 2H01A 2PU9C 3V1WA 2B6MA 2MMNA 3FZ5A 2LJAA 4PNFA 5G2ZA 1K0MA 5CRHA 4IP6A 2DJKA 2E0QA 4J57E 4NV5A 3M8NA 1FHEA 4DEJA 2GLRA 1EOHA 3CMIA
chains in the Genus database with same CATH topology
18GSA 5D96A 5J41A 1T4ZA 4N0ZA 3FR6A 2YWMA 2DJJA 4OFMA 2GZPA 4OCEA 2I1UA 2VM1A 3ZFBA 1CQGA 2VOCA 1SJ6A 2XC2A 4NHZA 3BD2A 3L0HA 5F0GA 5HR1A 4ECBA 2FWGA 1VF4A 3HHVA 1WJKA 4GSNA 5COHA 1EV9A 1XFLA 1N8JA 4QL9A 4MZCA 4POLA 5DJMA 2V2GA 4TXOB 3W8SA 1S3AA 1ZYQB 4HDEA 5G5EA 2RM6A 4K2DA 1B8XA 4MPFA 5D9XA 5B8AA 5KN1A 2PGTA 1TI1A 2R5GA 3GX0A 1EWXA 1OYJA 2MBSA 4H86A 2I3YA 1EGRA 2N5FA 4HEA2 3HJPA 1SD8A 4GLTA 2C1YA 3F4RA 4KNDA 4IQ1A 3SBCA 4WR4A 3IV4A 3CRUA 5B6NA 4OMVA 3ZVJA 5G1KA 1PN0A 1QGVA 3BCIA 4WETA 3N5OA 4POBA 3FHKA 4IBPA 4MLYA 3ZITA 4E8EA 2VL2A 3GIXA 2R2JA 1GULA 2WGRA 2GT6A 2CV4A 2F51A 2YCDA 3FKFA 3WT1A 4DSSB 4K0NA 2QSIA 3R3EA 3BBYA 1X5DA 5JWQB 3WGDA 2VLUA 2ZNMA 5FWGA 4RI6A 1GSYA 3O6TA 1ERTA 1PA3A 3F4TA 2H8LA 3UVTA 2FY6A 3CXGA 5IMCA 2DKIA 5GZZB 1K3LA 1K0BA 5D93A 2B5XA 5CNWA 5A4VA 2H76A 2H73A 4ISDA 4DSSA 1OC3A 3C71A 3HXSA 4QQ7A 3UL3A 4A5PA 4D73B 2N5AA 3D5JA 4YQMA 4MCUA 2HRNA 2BTOT 6GSWA 1TW9A 2C0EA 1R5AA 1M0UA 4IGJA 3KP9A 4OFTA 2ZCTA 1NHYA 3QPMA 2HSYA 5CRDA 2R0CA 2VL9A 3O76A 2M72A 1SKWB 1DUGA 4HU7A 1A0RP 4HOJA 5F8BA 3ZMLA 2MMAA 3CYNA 4KF9A 4D73A 1B4PA 3EWLA 1PN9A 2GSRA 2LEGA 2DIZA 4KX4A 2KUCA 5EPFA 3GH9A 2YOIA 3W6GA 1SL2B 2FUG2 2NVLA 1YZXA 3GURA 3IA1A 1EZKA 1S3DA 2MZCA 4ULXA 3FZ9A 3GH6A 2CA8A 3A5IA 1O85A 1V58A 2HXKA 3IOSA 2C3NA 5IO0A 3G9BA 4AJ8A 2CZ3A 3GV1A 3FYGA 1RW1A 3IE3A 5ECPB 3VURA 3LSZA 4DSQA 3APQA 2RLIA 3VPQA 2GVPA 2MBTA 3AY8A 3VFIA 4KE3A 5DDLA 3RAZA 2GTUA 4N11A 2J23A 2WCIA 4MK3A 2HRKA 2E7PA 4HUAA 1FVKA 3VLNA 2C3TA 3KH9A 4XS1A 3EMPA 5IOWA 2R4VA 1SL1B 1O8XA 3TKPA 5INYA 1TJDA 4Q5NA 2O8VB 2MMZA 3ZMKA 5IPGA 2FHEA 4MF6A 2GZYA 1EP8A 2CT6A 4XS4B 4MABA 1H4OA 3TKSE 4G0KA 4OD7A 3FR9A 1Q98A 2PUKC 4ZIJA 2YN1A 1OVNA 2A2RA 2KP1A 2H1BA 4WKWA 3DEXA 2JU5A 1EOGA 3DIEA 5IMZA 5AGYA 4Z2RA 1NSWA 4MF7A 1GL8A 2L5LA 1HYUA 2CX3A 1U88A 2ON7A 4I97A 4BWSA 3OR5A 1HNCA 2R0GA 1UVZA 2FA4A 1SKSB 1X0RA 4O92A 2XPEA 3UARA 2C8UA 1R7HA 2XPDA 2IL3A 2YNXA 2YV7A 1QFNA 3VI7A 5KOWA 1AAZA 2DMMA 3RPNA 2X8GA 5J4UA 1T7PB 4BA7A 1MEKA 3E9JB 1XWCA 4EVMA 1K0OA 4Z2TA 5DQYA 1SD9A 4OCFA 1T4YA 4V1Ag 2C3QA 3EU3A 3TJKA 4IW9A 2IMEA 4IVFA 3IRAA 3IR4A 4KSOA 5EVOA 2V6OA 4MPGA 3ZIJA 6GSVA 3GHAA 1GSUA 4Z7XA 4O5UA 4YAVA 5D73A 1SJIA 2PPTA 1W4VA 4RQRA 5A5KA 2VLTA 1B9XC 3GNJA 3I69A 4HQZA 2FWFA 5J9BA 5IM9A 4AGSA 1YKCA 1QUWA 5DCGA 2LRTA 4YQVA 5C04A 4ZB8A 2CZ2A 1ABAA 5IO2A 1MDIA 2AUVA 4ECJA 2R0PA 2GSSA 3H93A 1XOAA 2MYGA 2GT5A 2RUEA 3G7IA 4JU5A 1Y25A 3KP8A 3ED3A 4ZB9A 3ERGA 4NWYA 4Q5FA 2P5RA 2WULA 1M2DA 1TRVA 4TR1A 3J7Yb 2DIYA 5IQYA 4TR4A 3ERWA 3GSTA 3MWHA 5ECHB 1GSSA 1K0CA 3ZIVA 2L6DA 1QMVA 4NHWA 1MDJA 3O3TA 1XW5A 3HYPA 3IBHA 1F3AA 2AV4A 3J7Yk 4USSA 3DGQA 3KMOA 1JZDA 2GQMA 3UIWA 1ERVA 1O8WA 3E3EA 1ACVA 5EL8A 2L4CA 4K5RA 4L0UA 2DLXA 1WP0A 1ZMAA 2O7KA 1ZL9A 2C80A 1X5EA 3F0IA 4EC0A 3LXTA 1PL2A 1IYIA 4G2EA 3TOUA 3KIJA 3F4SA 2C0FA 1AQXA 4FYUA 1BJXA 2BJXA 1BX9A 4L5OA 1YQ1A 1F2EA 3RHBA 4CY6A 2J9HA 2V6KA 2V32A 1YEXA 1ZGNA 3CSJA 4MH3A 4MJCA 1MDKA 2L5OA 4IQAA 5HQPA 4E8HA 4HZ4A 1V40A 4GCIA 2LRCA 3S9FA 2KOKA 1EEJA 4JR6A 3C7MA 4YAPA 1EP7A 2AHEA 3GRXA 1ERUA 1XZOA 4LLRA 5J9CA 1IYHA 3IDVA 2OBKA 2DKHA 1BAYA 1FAAA 2C0DA 3GKXA 2CQ9A 1ZYEA 3F63A 4I6XA 2VCQA 3F3RA 2VD1A 4HJ2A 2LV3A 3ISOA 7GSSA 4TXVA 3A2VA 2CVBA 2DMLA 2TRCP 3GSSA 3IC4A 3EE2A 3NIVA 3IK7A 4HJMA 3H79A 4IKHA 2D2ZA 1WOUA 3TKRA 1JHBA 2VCWA 1QQ2A 4BPYA 2JSYA 3VWXA 2F9SA 3HJOA 4IELA 5ELAA 1SK2A 2ON5A 2LSTA 4TVEA 4WF4A 3WT2A 3Q74A 3GL5A 4MZBA 2V1MA 2C0GA 5H5RA 1M99A 3HCZA 5L71A 2H6XA 4FYBA 5JCUA 5GAPD 4V1Ap 4WBRD 5D8IA 4OO5A 1PX7A 1ON4A 2I81A 4GTUA 1A8YA 3GYKA 4X1UA 1WMJA 4PQ1A 1A2MA 3QR6A 2E2GA 4IHUA 3LGCA 3TJFA 3L78A 3JCML 1GNEA 1HNBA 3APOA 6GSTA 4AJ6A 5HR0A 1X9SB 5KN0A 2O87A 3NZNA 1I5GA 14GSA 1GUMA 1NW2A 2XHFA 4JRRA 1GUHA 4ECIA 1PMTA 3DWVA 2K9FA 4L5LA 4KGIA 2YV9A 5GAND 1RK4A 4ZBBA 1B4QA 3FR3A 3MIXA 1XVQA 5B6MA 2PBJA 5FT3A 4JBBA 4G10A 4PNGA 4LMVA 4K0GA 4F0BA 1URMA 1YJ6A 3KTLA 4KCEA 4PUFC 2HNLA 2H6YA 1NHOA 1SJZA 3LYKA 3UEMA 4N10A 3ZREA 3M9JA 5G1LA 3W8JA 3C73A 1BG5A 2H6ZA 5E4WA 1Z6MA 3P7XA 1DSBA 1SKRB 1T1VA 4X43A 5ECSA 4EF0A 2B7KA 2R3XA 2IJYA 1DE1A 1F6MC 17GSA 5CAXA 2L4QA 3I43A 4EXJA 1M9AA 4XRAA 2VLVA 2N5BA 1YKAA 5JWRB 2LKUA 1EGOA 4WF5A 5ECQB 3M9KA 1PQNA 3ME7A 1T3BA 2WJUA 2DC5A 2M80A 5AN1A 1Q4JA 4RQXA 3BCKA 4O5RA 1GNWA 3HKRA 5KEJA 3C8EA 3GKNA 3WGXA 4K1FA 3MSZA 3TDGA 2P5QA 4HI7A 1AQVA 1Z7PA 2VD0A 1A8LA 2VCZA 2B7JA 3GL3A 1FOVA 2PERA 3GA4A 2F8FA 1TU7A 5DVBA 2X8HA 2YPMA 3GFKA 3LWAA 5KOXA 2FD3A 5ECIB 1R4WA 2MMOA 2LUSA 2YP6A 4KUNA 1A23A 1FG4A 2ZUPA 4PXOA 1XW6A 2WRTA 1GTUA 2K18A 3TKSC 4TN8A 4ZL8A 5ECRB 1WIKA 4GXZA 4BWQA 4YQUA 2PMTA 3CBUA 3HA9A 4ID0A 1WE0A 3GKMA 3DYRA 3PR8A 1CQHA 4I5QA 4OWYA 4GQCA 4IN0A 1ML6A 4Q5QA 4L8EA 4O7HA 1YF0A 4TKYA 5HFGA 1OAZA 1E6BA 4ZXGA 3EINA 3TJGA 1SYXA 3A2WA 4MJBA 1XW9A 2JADA 3HVSA 3DXBA 3P90A 4NAXA 4ZL9A 3CSHA 4BVYB 1TTZA 3DVWA 5CRGA 1HD2A 1UA5A 3U6VA 3MNGA 2VUPA 1TI3A 1GWCA 3CSIA 2GGTA 2GQKA 3VK9A 5B7CA 4K2XA 1R26A 5F05A 2OE1A 5IIZA 5G5FA 4O32A 2LTKA 2BMXA 1J9BA 1PKWA 1ILOA 5DAKB 4BVYA 1V57A 4POKA 3IHGA 5G31A 3LG6A 3GN3A 3FRCA 3APSA 4F0CA 3DD3A 2A4VA 3KCMA 2QA1A 1OC8A 1WWJA 1M2AA 4ZBAA 1GP1A 5CRWA 1U87A 4NPBA 3HVXA 2B1LA 1THXA 4F2IA 1N2AA 1B48A 2H74A 9GSSA 5AIVA 2VO4A 1V98A 3H4KA 4L0WA 3WD6A 3IC8A 4CHSA 5DAKA 8GSSA 1B9YC 2AYTA 5H5SA 1DBYA 2HE3A 4NXIA 4ZL7A 3BJ5A 4GF0A 5ECLB 3P2AA 4EDYA 2X4AA 3ME8A 4KH7A 4NV2A 3VPTA 4KDYA 3EU4A 2XBIA 2X8CA 3KH7A 2OBIA 3HVVA 3KZQA 1EV4A 3A2XA 4GWRA 2X49A 1Z5YE 2R6KA 4DVCA 19GSA 1PL1A 3IAS2 3QAWA 1OE7A 3H8QA 1A2LA 1TOFA 2PWJA 1TKDB 4LL1B 2JZTA 4ACSA 2GZZA 2LQQA 5AIXA 3U5RE 1PX6A 1GSFA 4TR1B 1XOBA 3GMFA 5F07A 1LBKA 2HSMA 4KB3A 5EY6A 1YDKA 1U6TA 4MZWA 2YJHA 5CREA 4MDCA 3CRTA 3PPUA 2V41A 1XVWA 4Q5RA 3EURA 2QKEA 1AUCA 3RDWA 4V2LA 2AB6A 3L4NA 2EIRA 3KXOA 6GSYA 2EIOA 1UN2A 2QA2A 1M7TA 1TK5B 3PGTA 1A2JA 3IAM2 1S3CA 3E0UA 5IMVA 2JACA 4JZQA 3KM6A 1TRWA 2HI7A 3LORA 1O6JA 2DJ2A 3GX8A 2K8VA 2FNOA 5ID2A 5J3RA 2G0FA 5JCGA 1JLWA 3A3TA 3GUSA 3UVHA 5C00A 2VL3A 4ML1A 1VRSD 3QFAC 2VCVA 1YEPA 1K0AA 3C1RA 1TRSA 3D21A 1QXHA 2A2SA 1G7EA 2PVOC 2OADA 4JEDA 3TKQA 1FVJA 2EC4A 1ZYNA 1V9WA 3PINA 2OJLA 5CP1A 4TR0A 3TGZA 5JCWA 4K7NA 3D0ZA 4HZ2A 2YZUA 5LD0A 1TP9A 2VL2C 5FHIA 4WR5A 1HQOA 1TXXA 1OKDA 3ZTLA 6GSXA 1AIUA 3M0FA 1JLVA 4K5SA 4TW5A 4MA9A 4CW9A 3VWWA 5KN3A 2DSAA 3KEBA 5HR3A 3C1SA 4JR4A 4X0XA 2DJ3A 4I8BA 3Q6OA 3LJRA 2L6CA 2IIYA 4G9HA 2OE0A 5LCZA 1XXUA 5ENUA 3EVIA 1K0DA 1THOA 2VCTA 4HS1A 4LMWA 4XRDA 4EE0A 3TCOA 2IPAA 2LNTA 3KTBA 4GSTA 1XIYA 3ZFLA 2YJ7A 2K6VA 2O85A 3F6DA 1TRUA 2H75A 5GSSA 3F8UA 4PURA 4N0VA 3TB2A 3D6IA 1ERWA 2IMDA 2B5EA 1Z9HA 5BRTA 1TDIA 3FK8A 1SK1A 1SL0B 1VGLA 3L9VA 3K8NA 1RQMA 1J0FA 5BMUA 3TJBA 4PUAA 2LRNA 10GSA 4V2NA 2CVDA 5AISA 4EKZA 2IFQB 2JSZA 2I4AA 3UBKA 3TRXA 3GKKA 4K9ZA 5ECNB 4MMMA 2TIRA 4ZBDA 2I9HA 3IHQA 3UJ1A 3D4TA 1QK8A 2LQOA 1Z7RA 4JE1A 2ES7A 3BOAA 1ZCPA 1T00A 5DCHA 4IJIA 4FH8A 2FWEA 1BYEA 3LXZA 4MNNA 4TOPA 2H0IA 3DKSA 3KGKA 1TK0B 1PRXA 3DVXA 2IFQA 4XS6A 3I6AA 3VI5A 2YWIA 1O7UA 4OFNA 3D4MA 3IK9A 1K3YA 1TK8B 5IMDA 1GSEA 4LA1A 1EEMA 3F9UA 1A0FA 3F3QA 1O81A 3ZYWA 2G2QA 3HJMA 2RIIA 5GSTA 1O73A 1T8EB 2RM5A 2E2MA 4KCAA 1G6WA 4K6XA 4K8MA 1M9BA 3G7YA 4AJ7A 4TXOA 4BL7B 4PQIA 4FO5A 5ECMB 3QOUA 1LU4A 1PD21 2B3SA 1FOHA 2WDUA 2H66A 2YZHA 4P3YB 2LJRA 4K7OA 4F03A 3FMWA 1G6YA 2HLSA 2JZRA 2PN8A 1F37A 3DRNA 3UOMA 4CY8A 2KP2A 3IPZA 4EO3A 3ERFA 5JWOB 3HZ4A 2IWTA 2KLXA 1WPIA 2X64A 2NPBA 2PVQA 3FZ4A 4RI7A 4BL7A 3QFBC 5ECKB 3MYDA 2LJKA 4KA0A 5LNKe 2HYXA 4J2FA 3HDCA 3LQ7A 3QAGA 1ZYPA 4G0IA 1PKZA 2FGXA 2YWOA 1AQWA 2M46A 2H72A 1XPVA 4KDXA 1FO5A 2YANA 1MD3A 1VF2A 3G7JA 4ILFA 3H1NA 1ZZYA 3NOFA 4Z2UA 4ML6A 4LL4B 2IMFA 4YKGA 2CX4A 1ZOFA 4QL7A 4WEYA 4I2TA 5HFKA 4F82A 16GSA 4KAEA 4AF2A 2DJ1A 2WZ9A 2Z9SA 4DSRA 1GUKA 1LJRA 3US3A 4MJAA 1U3IA 2HRFA 4TR3A 4XHMA 2L57A 5F06A 1X9WB 2H70A 2LNSA 5DBQA 1C72A 2IMKA 3WGEA 1GSDA 2HFDA 4BVXB 1A24A 2A2PA 2QC7A 3EYTA 2RUFA 2H1GA 1YF1A 1J08A 1JZRA 3LFLA 4EIPA 1XWGA 4MH2A 4ICYA 1KNGA 2KHPA 3UMAA 1SYRA 5IOXA 4OO4A 3P8WA 4EUYA 1E2YA 2GSTA 4MP4A 1NM3A 2VAFA 4BVXA 1GTAA 4XCSA 4MJEA 5E59A 4EDZA 5CYYA 3Q18A 2X99A 3VWVA 2DJ0A 5IMFA 1AXDA 4GQFA 4EL1A 1KEBA 3DMLA 1MTCA 2JZSA 3M3MA 3LEFA 1TU8A 1BQ7A 2REMA 1U3AA 2CAIA 2NBSA 4GSSA 2WFCA 2HZEB 2IN3A 1KBNA 2A4HA 1F9MA 2WB9A 4G0LA 3RHCA 2FCHA 3TOTA 1XWKA 3UBLA 2NDOA 3QD9A 4I2UA 1XBSA 5D9WA 4IS0A 2HRAA 1OE8A 3TUEA 1G0TA 2CAQA 5IPHA 1YY7A 2ALBA 2HSHA 1HNAA 2HZEA 1XWAA 3EC3A 3WYWA 5D9TA 5KN2A 4MF5A 3KJYA 1SENA 5CO3A 4PTSA 3L9SA 1GRXA 1GSQA 3ZRDA 1GLPA 4YKFA 2AAWA 1JZOA 4PX1A 4XS4A 5J5NA 3EMXA 2F8AA 5H5QA 1DE2A 1GTBA 1M2BA 3ZL5A 2OA7A 1JFUA 1Z6NA 2FWHA 4PGTA 3TRQA 4IJ3A 1OC9B 3EPTA 3LW9A 2OACA 6GSUA 5DQSA 5ABRA 3FW2A 1K3OA 1Y6EA 22GSA 4KDUA 5HFIA 2AJQB 1AW9A 1FB6A 3KMNA 3MDKA 2HZFA 4XTSA 3PH9A 3ZVJD 1V2AA 3F6FA 4KSMA 2UZ8A 2YWNA 4FYCA 2L59A 2P31A 4GRFA 1FB0A 3UAPA 1OC9A 1PGTA 4FQUA 3QCPA 4HQSA 6GSSA 1PSQA 1K0NA 3TKSA 4NMUA 5G30A 3L9UA 3KD0A 4CDOA 1UC7A 1USBA 4IP1A 4FIWA 2TRXA 2O89A 4ECCA 5ID2B 2H1AA 2FA8A 5IMAA 4EIQA 2JL4A 1SU9A 2R37A 13GSA 3VWUA 2GQLA 3N9JA 4WXTA 1H75A 1XWBA 5A4UA 4K7IA 2OKAA 5D9VA 4O5QA 3CTFA 2NTOA 3QMXA 3CTGA 3ZZXA 20GSA 3HD5A 1GTIA 1OKTA 2K8SA 2LS5A 1W89A 2QGVA 2C4JA 4J56E 4HU9A 2IMIA 2B5YA 2H30A 3A5WA 3FZAA 1JZWA 1SK0A 1G7OA 2DBCA 2WS2A 1I9DA 3TRPA 1KTEA 5A4WA 1AC1A 3FY7A 2FLSA 2H19A 4WBJA 5DALB 5B8BA 1BEDA 3RPPA 3QDNA 3RBTA 4TRXA 3M1GA 3ZLPA 2VM2A 1FW1A 4PQHA 2F3MA 4RUVA 2VCXA 3SWLA 2B1KA 2GS3A 3GTUB 4N30A 3MAKA 2OE3A 4KW6A 1GH2A 4G19A 2GSQA 2H71A 1XCCA 1X9MB 5ECOB 11GSA 4V2MA 4ZILA 2CVKA 5DJLA 5ELGA 1ST9A 3I9V2 1VF1A 2H1DA 4POMA 3FEUA 5DALA 3D22A 1MD4A 2H0HA 2GDRA 1Z3EA 5HR2A 4YH2A 3QAVA 3IXRA 2P0GA 2XBQA 3HZ8A 3TJJA 1F3BA 4ZB6A 1X5CA 3Q19A 3GTUA 3LYPA 4F9ZA 1GLQA 1WRYA 2H0GA 2HT9A 3R2QA 2EIQA 4X4JA 12GSA 2VIMA 3HY2A 1R5PA 1VF3A 4XIHA 2H01A 2PU9C 3V1WA 2B6MA 2MMNA 3FZ5A 2LJAA 4PNFA 5G2ZA 1K0MA 5CRHA 4IP6A 2DJKA 2E0QA 4J57E 4NV5A 3M8NA 1FHEA 4DEJA 2GLRA 1EOHA 3CMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 18GS A;  5D96 A;  5J41 A;  1T4Z A;  4N0Z A;  3FR6 A;  2YWM A;  2DJJ A;  4OFM A;  2GZP A;  4OCE A;  2I1U A;  2VM1 A;  3ZFB A;  1CQG A;  2VOC A;  1SJ6 A;  2XC2 A;  4NHZ A;  3BD2 A;  3L0H A;  5F0G A;  5HR1 A;  4ECB A;  2FWG A;  1VF4 A;  3HHV A;  1WJK A;  4GSN A;  5COH A;  1EV9 A;  1XFL A;  1N8J A;  4QL9 A;  4MZC A;  4POL A;  5DJM A;  2V2G A;  4TXO B;  3W8S A;  1S3A A;  1ZYQ B;  4HDE A;  5G5E A;  2RM6 A;  4K2D A;  1B8X A;  4MPF A;  5D9X A;  5B8A A;  5KN1 A;  2PGT A;  1TI1 A;  2R5G A;  3GX0 A;  1EWX A;  1OYJ A;  2MBS A;  4H86 A;  2I3Y A;  1EGR A;  2N5F A;  4HEA 2;  3HJP A;  1SD8 A;  4GLT A;  2C1Y A;  3F4R A;  4KND A;  4IQ1 A;  3SBC A;  4WR4 A;  3IV4 A;  3CRU A;  5B6N A;  4OMV A;  3ZVJ A;  5G1K A;  1QGV A;  3BCI A;  4WET A;  3N5O A;  4POB A;  3FHK A;  4IBP A;  4MLY A;  3ZIT A;  4E8E A;  2VL2 A;  3GIX A;  2R2J A;  1GUL A;  2WGR A;  2GT6 A;  2CV4 A;  2F51 A;  2YCD A;  3FKF A;  3WT1 A;  4DSS B;  4K0N A;  2QSI A;  3BBY A;  1X5D A;  5JWQ B;  3WGD A;  2VLU A;  2ZNM A;  5FWG A;  4RI6 A;  1GSY A;  3O6T A;  1ERT A;  1PA3 A;  3F4T A;  2H8L A;  3UVT A;  2FY6 A;  3CXG A;  5IMC A;  5GZZ B;  1K3L A;  1K0B A;  5D93 A;  2B5X A;  5CNW A;  5A4V A;  2H76 A;  2H73 A;  4ISD A;  4DSS A;  1OC3 A;  3C71 A;  3HXS A;  4QQ7 A;  3UL3 A;  4D73 B;  2N5A A;  3D5J A;  4YQM A;  4MCU A;  2HRN A;  2BTO T;  6GSW A;  1TW9 A;  2C0E A;  1R5A A;  1M0U A;  4IGJ A;  3KP9 A;  4OFT A;  2ZCT A;  1NHY A;  3QPM A;  2HSY A;  5CRD A;  2VL9 A;  3O76 A;  2M72 A;  1SKW B;  1DUG A;  4HU7 A;  1A0R P;  4HOJ A;  5F8B A;  3ZML A;  2MMA A;  3CYN A;  4D73 A;  1B4P A;  3EWL A;  1PN9 A;  2GSR A;  2LEG A;  2DIZ A;  4KX4 A;  2KUC A;  5EPF A;  3GH9 A;  2YOI A;  3W6G A;  1SL2 B;  2FUG 2;  2NVL A;  1YZX A;  3GUR A;  3IA1 A;  1EZK A;  1S3D A;  2MZC A;  4ULX A;  3FZ9 A;  3GH6 A;  2CA8 A;  1O85 A;  1V58 A;  2HXK A;  3IOS A;  2C3N A;  5IO0 A;  3G9B A;  4AJ8 A;  2CZ3 A;  3GV1 A;  3FYG A;  1RW1 A;  3IE3 A;  5ECP B;  3VUR A;  3LSZ A;  4DSQ A;  3APQ A;  2RLI A;  3VPQ A;  2GVP A;  2MBT A;  3AY8 A;  3VFI A;  4KE3 A;  5DDL A;  3RAZ A;  2GTU A;  4N11 A;  2J23 A;  2WCI A;  4MK3 A;  2E7P A;  4HUA A;  1FVK A;  3VLN A;  2C3T A;  3KH9 A;  4XS1 A;  3EMP A;  5IOW A;  2R4V A;  1SL1 B;  1O8X A;  3TKP A;  5INY A;  1TJD A;  4Q5N A;  2O8V B;  2MMZ A;  3ZMK A;  5IPG A;  2FHE A;  4MF6 A;  2GZY A;  1EP8 A;  2CT6 A;  4XS4 B;  4MAB A;  1H4O A;  3TKS E;  4OD7 A;  3FR9 A;  1Q98 A;  2PUK C;  4ZIJ A;  2YN1 A;  1OVN A;  2A2R A;  2KP1 A;  2H1B A;  4WKW A;  3DEX A;  2JU5 A;  1EOG A;  3DIE A;  5IMZ A;  5AGY A;  1NSW A;  4MF7 A;  1GL8 A;  2L5L A;  1HYU A;  2CX3 A;  1U88 A;  2ON7 A;  4I97 A;  4BWS A;  3OR5 A;  1HNC A;  1UVZ A;  2FA4 A;  1SKS B;  1X0R A;  4O92 A;  2XPE A;  3UAR A;  2C8U A;  1R7H A;  2XPD A;  2IL3 A;  2YNX A;  2YV7 A;  1QFN A;  3VI7 A;  1AAZ A;  2DMM A;  3RPN A;  2X8G A;  5J4U A;  1T7P B;  4BA7 A;  1MEK A;  3E9J B;  1XWC A;  4EVM A;  1K0O A;  5DQY A;  1SD9 A;  4OCF A;  1T4Y A;  4V1A g;  2C3Q A;  3EU3 A;  3TJK A;  4IW9 A;  2IME A;  4IVF A;  3IRA A;  3IR4 A;  4KSO A;  5EVO A;  2V6O A;  4MPG A;  3ZIJ A;  6GSV A;  3GHA A;  1GSU A;  4Z7X A;  4YAV A;  5D73 A;  1SJI A;  2PPT A;  1W4V A;  4RQR A;  5A5K A;  2VLT A;  1B9X C;  3GNJ A;  3I69 A;  4HQZ A;  2FWF A;  5J9B A;  5IM9 A;  4AGS A;  1YKC A;  1QUW A;  5DCG A;  2LRT A;  4YQV A;  5C04 A;  4ZB8 A;  2CZ2 A;  1ABA A;  5IO2 A;  1MDI A;  2AUV A;  4ECJ A;  2GSS A;  3H93 A;  1XOA A;  2MYG A;  2GT5 A;  2RUE A;  3G7I A;  4JU5 A;  1Y25 A;  3KP8 A;  3ED3 A;  4ZB9 A;  3ERG A;  4NWY A;  4Q5F A;  2P5R A;  2WUL A;  1M2D A;  1TRV A;  4TR1 A;  3J7Y b;  2DIY A;  5IQY A;  4TR4 A;  3ERW A;  3GST A;  3MWH A;  5ECH B;  1GSS A;  1K0C A;  3ZIV A;  2L6D A;  1QMV A;  4NHW A;  1MDJ A;  3O3T A;  1XW5 A;  3HYP A;  3IBH A;  1F3A A;  2AV4 A;  3J7Y k;  3DGQ A;  3KMO A;  1JZD A;  2GQM A;  3UIW A;  1ERV A;  1O8W A;  3E3E A;  1ACV A;  5EL8 A;  2L4C A;  4L0U A;  2DLX A;  1WP0 A;  1ZMA A;  2O7K A;  1ZL9 A;  2C80 A;  1X5E A;  3F0I A;  4EC0 A;  3LXT A;  1PL2 A;  1IYI A;  4G2E A;  3TOU A;  3KIJ A;  3F4S A;  2C0F A;  1AQX A;  4FYU A;  1BJX A;  2BJX A;  1BX9 A;  4L5O A;  1YQ1 A;  1F2E A;  3RHB A;  2J9H A;  2V6K A;  2V32 A;  1YEX A;  1ZGN A;  3CSJ A;  4MH3 A;  4MJC A;  1MDK A;  2L5O A;  4IQA A;  5HQP A;  4E8H A;  4HZ4 A;  1V40 A;  4GCI A;  2LRC A;  3S9F A;  2KOK A;  1EEJ A;  4JR6 A;  3C7M A;  4YAP A;  1EP7 A;  2AHE A;  3GRX A;  1ERU A;  1XZO A;  4LLR A;  5J9C A;  1IYH A;  3IDV A;  2OBK A;  1BAY A;  1FAA A;  2C0D A;  3GKX A;  2CQ9 A;  1ZYE A;  3F63 A;  4I6X A;  2VCQ A;  3F3R A;  2VD1 A;  4HJ2 A;  2LV3 A;  3ISO A;  7GSS A;  4TXV A;  3A2V A;  2CVB A;  2DML A;  2TRC P;  3GSS A;  3IC4 A;  3EE2 A;  3NIV A;  3IK7 A;  4HJM A;  3H79 A;  4IKH A;  2D2Z A;  1WOU A;  3TKR A;  1JHB A;  2VCW A;  1QQ2 A;  4BPY A;  2JSY A;  3VWX A;  2F9S A;  3HJO A;  4IEL A;  5ELA A;  1SK2 A;  2ON5 A;  2LST A;  4TVE A;  4WF4 A;  3WT2 A;  3Q74 A;  3GL5 A;  4MZB A;  2V1M A;  2C0G A;  5H5R A;  1M99 A;  3HCZ A;  5L71 A;  2H6X A;  4FYB A;  5JCU A;  5GAP D;  4V1A p;  4WBR D;  5D8I A;  4OO5 A;  1PX7 A;  1ON4 A;  2I81 A;  4GTU A;  1A8Y A;  3GYK A;  4X1U A;  1WMJ A;  4PQ1 A;  1A2M A;  3QR6 A;  2E2G A;  4IHU A;  3LGC A;  3TJF A;  3L78 A;  3JCM L;  1GNE A;  1HNB A;  3APO A;  6GST A;  4AJ6 A;  5HR0 A;  1X9S B;  5KN0 A;  2O87 A;  3NZN A;  1I5G A;  14GS A;  1GUM A;  1NW2 A;  2XHF A;  4JRR A;  1GUH A;  4ECI A;  1PMT A;  3DWV A;  2K9F A;  4L5L A;  4KGI A;  2YV9 A;  5GAN D;  1RK4 A;  4ZBB A;  1B4Q A;  3FR3 A;  1XVQ A;  5B6M A;  2PBJ A;  5FT3 A;  4JBB A;  4G10 A;  4PNG A;  4LMV A;  4K0G A;  4F0B A;  1URM A;  1YJ6 A;  3KTL A;  4KCE A;  4PUF C;  2HNL A;  2H6Y A;  1NHO A;  1SJZ A;  3LYK A;  3UEM A;  4N10 A;  3ZRE A;  3M9J A;  5G1L A;  3W8J A;  3C73 A;  1BG5 A;  2H6Z A;  5E4W A;  1Z6M A;  3P7X A;  1DSB A;  1SKR B;  1T1V A;  4X43 A;  5ECS A;  4EF0 A;  2B7K A;  2R3X A;  2IJY A;  1DE1 A;  1F6M C;  17GS A;  5CAX A;  2L4Q A;  3I43 A;  4EXJ A;  1M9A A;  4XRA A;  2VLV A;  2N5B A;  1YKA A;  5JWR B;  2LKU A;  1EGO A;  4WF5 A;  5ECQ B;  3M9K A;  1PQN A;  3ME7 A;  1T3B A;  2WJU A;  2DC5 A;  2M80 A;  5AN1 A;  1Q4J A;  3BCK A;  4RQX A;  4O5R A;  1GNW A;  3HKR A;  5KEJ A;  3C8E A;  3GKN A;  3WGX A;  4K1F A;  3MSZ A;  3TDG A;  2P5Q A;  4HI7 A;  1AQV A;  1Z7P A;  2VD0 A;  1A8L A;  2VCZ A;  2B7J A;  3GL3 A;  1FOV A;  2PER A;  3GA4 A;  2F8F A;  1TU7 A;  5DVB A;  2X8H A;  2YPM A;  3GFK A;  3LWA A;  2FD3 A;  5ECI B;  1R4W A;  2MMO A;  2LUS A;  2YP6 A;  4KUN A;  1A23 A;  1FG4 A;  2ZUP A;  4PXO A;  1XW6 A;  2WRT A;  1GTU A;  2K18 A;  3TKS C;  4TN8 A;  4ZL8 A;  5ECR B;  1WIK A;  4GXZ A;  4BWQ A;  4YQU A;  2PMT A;  3CBU A;  3HA9 A;  4ID0 A;  1WE0 A;  3GKM A;  3DYR A;  3PR8 A;  1CQH A;  4I5Q A;  4OWY A;  4GQC A;  4IN0 A;  1ML6 A;  4Q5Q A;  4L8E A;  4O7H A;  1YF0 A;  4TKY A;  5HFG A;  1OAZ A;  1E6B A;  4ZXG A;  3EIN A;  3TJG A;  1SYX A;  3A2W A;  4MJB A;  1XW9 A;  2JAD A;  3HVS A;  3DXB A;  3P90 A;  4NAX A;  4ZL9 A;  3CSH A;  1TTZ A;  3DVW A;  5CRG A;  1HD2 A;  1UA5 A;  3U6V A;  3MNG A;  2VUP A;  1TI3 A;  1GWC A;  3CSI A;  2GGT A;  2GQK A;  3VK9 A;  5B7C A;  1R26 A;  5F05 A;  2OE1 A;  5IIZ A;  5G5F A;  4O32 A;  2LTK A;  2BMX A;  1J9B A;  1PKW A;  1ILO A;  5DAK B;  4BVY A;  1V57 A;  4POK A;  5G31 A;  3LG6 A;  3GN3 A;  3FRC A;  3APS A;  4F0C A;  3DD3 A;  2A4V A;  3KCM A;  1OC8 A;  1WWJ A;  1M2A A;  4ZBA A;  1GP1 A;  5CRW A;  1U87 A;  4NPB A;  3HVX A;  2B1L A;  1THX A;  4F2I A;  1N2A A;  1B48 A;  2H74 A;  9GSS A;  5AIV A;  2VO4 A;  1V98 A;  3H4K A;  4L0W A;  3WD6 A;  4CHS A;  5DAK A;  8GSS A;  1B9Y C;  2AYT A;  5H5S A;  1DBY A;  2HE3 A;  4NXI A;  4ZL7 A;  3BJ5 A;  4GF0 A;  5ECL B;  3P2A A;  4EDY A;  3ME8 A;  4KH7 A;  4NV2 A;  3VPT A;  4KDY A;  3EU4 A;  2XBI A;  2X8C A;  3KH7 A;  2OBI A;  3HVV A;  3KZQ A;  1EV4 A;  3A2X A;  4GWR A;  1Z5Y E;  2R6K A;  4DVC A;  19GS A;  1PL1 A;  3IAS 2;  3QAW A;  1OE7 A;  3H8Q A;  1A2L A;  1TOF A;  2PWJ A;  1TKD B;  4LL1 B;  2JZT A;  4ACS A;  2GZZ A;  2LQQ A;  5AIX A;  3U5R E;  1PX6 A;  1GSF A;  4TR1 B;  1XOB A;  3GMF A;  5F07 A;  1LBK A;  4KB3 A;  5EY6 A;  1YDK A;  1U6T A;  4MZW A;  2YJH A;  5CRE A;  4MDC A;  3CRT A;  2V41 A;  1XVW A;  4Q5R A;  3EUR A;  2QKE A;  1AUC A;  3RDW A;  4V2L A;  2AB6 A;  3L4N A;  2EIR A;  3KXO A;  6GSY A;  2EIO A;  1UN2 A;  1M7T A;  1TK5 B;  3PGT A;  1A2J A;  3IAM 2;  1S3C A;  3E0U A;  5IMV A;  2JAC A;  4JZQ A;  3KM6 A;  1TRW A;  2HI7 A;  3LOR A;  1O6J A;  2DJ2 A;  3GX8 A;  2K8V A;  2FNO A;  5ID2 A;  5J3R A;  2G0F A;  5JCG A;  1JLW A;  3A3T A;  3GUS A;  3UVH A;  5C00 A;  2VL3 A;  4ML1 A;  1VRS D;  3QFA C;  2VCV A;  1YEP A;  1K0A A;  3C1R A;  1TRS A;  3D21 A;  1QXH A;  2A2S A;  1G7E A;  2PVO C;  2OAD A;  4JED A;  3TKQ A;  1FVJ A;  2EC4 A;  1V9W A;  3PIN A;  2OJL A;  5CP1 A;  4TR0 A;  3TGZ A;  5JCW A;  4K7N A;  3D0Z A;  4HZ2 A;  2YZU A;  5LD0 A;  1TP9 A;  2VL2 C;  5FHI A;  4WR5 A;  1HQO A;  1TXX A;  1OKD A;  3ZTL A;  6GSX A;  1AIU A;  3M0F A;  1JLV A;  4TW5 A;  4MA9 A;  4CW9 A;  3VWW A;  5KN3 A;  2DSA A;  3KEB A;  5HR3 A;  3C1S A;  4JR4 A;  4X0X A;  2DJ3 A;  4I8B A;  3Q6O A;  3LJR A;  2L6C A;  2IIY A;  4G9H A;  2OE0 A;  5LCZ A;  1XXU A;  5ENU A;  3EVI A;  1K0D A;  1THO A;  2VCT A;  4HS1 A;  4LMW A;  4XRD A;  4EE0 A;  3TCO A;  2IPA A;  2LNT A;  3KTB A;  4GST A;  1XIY A;  3ZFL A;  2YJ7 A;  2K6V A;  2O85 A;  3F6D A;  1TRU A;  2H75 A;  5GSS A;  3F8U A;  4PUR A;  4N0V A;  3TB2 A;  3D6I A;  1ERW A;  2IMD A;  2B5E A;  1Z9H A;  1TDI A;  3FK8 A;  1SK1 A;  1SL0 B;  1VGL A;  3L9V A;  3K8N A;  1RQM A;  1J0F A;  3TJB A;  4PUA A;  2LRN A;  10GS A;  4V2N A;  2CVD A;  5AIS A;  4EKZ A;  2IFQ B;  2JSZ A;  2I4A A;  3UBK A;  3TRX A;  3GKK A;  4K9Z A;  5ECN B;  4MMM A;  2TIR A;  4ZBD A;  2I9H A;  3IHQ A;  3UJ1 A;  3D4T A;  1QK8 A;  2LQO A;  1Z7R A;  4JE1 A;  2ES7 A;  3BOA A;  1ZCP A;  1T00 A;  5DCH A;  4IJI A;  4FH8 A;  2FWE A;  1BYE A;  3LXZ A;  4TOP A;  2H0I A;  3DKS A;  3KGK A;  1TK0 B;  1PRX A;  3DVX A;  2IFQ A;  4XS6 A;  3I6A A;  3VI5 A;  2YWI A;  1O7U A;  4OFN A;  3D4M A;  3IK9 A;  1K3Y A;  1TK8 B;  5IMD A;  1GSE A;  4LA1 A;  1EEM A;  3F9U A;  1A0F A;  3F3Q A;  1O81 A;  3ZYW A;  2G2Q A;  3HJM A;  2RII A;  5GST A;  1O73 A;  1T8E B;  2RM5 A;  2E2M A;  4KCA A;  1G6W A;  4K6X A;  4K8M A;  1M9B A;  3G7Y A;  4AJ7 A;  4TXO A;  4PQI A;  4FO5 A;  5ECM B;  3QOU A;  1LU4 A;  1PD2 1;  2B3S A;  2WDU A;  2H66 A;  2YZH A;  4P3Y B;  2LJR A;  4K7O A;  4F03 A;  1G6Y A;  2HLS A;  2JZR A;  2PN8 A;  1F37 A;  3DRN A;  3UOM A;  2KP2 A;  3IPZ A;  4EO3 A;  3ERF A;  5JWO B;  3HZ4 A;  2IWT A;  2KLX A;  1WPI A;  2X64 A;  2NPB A;  2PVQ A;  3FZ4 A;  4RI7 A;  4BL7 A;  3QFB C;  5ECK B;  2LJK A;  4KA0 A;  5LNK e;  2HYX A;  4J2F A;  3HDC A;  3LQ7 A;  3QAG A;  1PKZ A;  2FGX A;  2YWO A;  1AQW A;  2M46 A;  2H72 A;  1XPV A;  4KDX A;  1FO5 A;  2YAN A;  1MD3 A;  1VF2 A;  3G7J A;  4ILF A;  3H1N A;  1ZZY A;  3NOF A;  4ML6 A;  4LL4 B;  2IMF A;  2CX4 A;  1ZOF A;  4QL7 A;  4WEY A;  4I2T A;  5HFK A;  4F82 A;  16GS A;  4KAE A;  4AF2 A;  2DJ1 A;  2WZ9 A;  2Z9S A;  4DSR A;  1GUK A;  1LJR A;  3US3 A;  4MJA A;  1U3I A;  2HRF A;  4TR3 A;  4XHM A;  2L57 A;  5F06 A;  1X9W B;  2H70 A;  2LNS A;  5DBQ A;  1C72 A;  2IMK A;  3WGE A;  1GSD A;  2HFD A;  1A24 A;  2QC7 A;  3EYT A;  2RUF A;  2H1G A;  1YF1 A;  1J08 A;  1JZR A;  3LFL A;  1XWG A;  4MH2 A;  1KNG A;  2KHP A;  3UMA A;  1SYR A;  5IOX A;  4OO4 A;  3P8W A;  4EUY A;  1E2Y A;  2GST A;  4MP4 A;  1NM3 A;  2VAF A;  4BVX A;  1GTA A;  4XCS A;  4MJE A;  5E59 A;  4EDZ A;  5CYY A;  3Q18 A;  2X99 A;  3VWV A;  2DJ0 A;  5IMF A;  1AXD A;  4GQF A;  4EL1 A;  1KEB A;  3DML A;  1MTC A;  2JZS A;  3M3M A;  3LEF A;  1TU8 A;  1BQ7 A;  2REM A;  1U3A A;  2CAI A;  2NBS A;  4GSS A;  2WFC A;  2HZE B;  2IN3 A;  1KBN A;  1F9M A;  2WB9 A;  3RHC A;  2FCH A;  3TOT A;  1XWK A;  3UBL A;  2NDO A;  3QD9 A;  4I2U A;  1XBS A;  5D9W A;  4IS0 A;  1OE8 A;  3TUE A;  1G0T A;  2CAQ A;  5IPH A;  1YY7 A;  2ALB A;  2HSH A;  1HNA A;  2HZE A;  1XWA A;  3EC3 A;  3WYW A;  5D9T A;  5KN2 A;  4MF5 A;  3KJY A;  1SEN A;  5CO3 A;  3L9S A;  1GRX A;  1GSQ A;  3ZRD A;  1GLP A;  2AAW A;  1JZO A;  4PX1 A;  4XS4 A;  5J5N A;  3EMX A;  2F8A A;  5H5Q A;  1DE2 A;  1GTB A;  1M2B A;  3ZL5 A;  2OA7 A;  1JFU A;  1Z6N A;  2FWH A;  4PGT A;  3TRQ A;  4IJ3 A;  1OC9 B;  2OAC A;  6GSU A;  5DQS A;  5ABR A;  3FW2 A;  1K3O A;  1Y6E A;  22GS A;  4KDU A;  5HFI A;  2AJQ B;  1AW9 A;  1FB6 A;  3KMN A;  3MDK A;  2HZF A;  4XTS A;  3PH9 A;  3ZVJ D;  1V2A A;  3F6F A;  4KSM A;  2YWN A;  4FYC A;  2L59 A;  2P31 A;  4GRF A;  1FB0 A;  3UAP A;  1OC9 A;  1PGT A;  4HQS A;  3QCP A;  6GSS A;  1PSQ A;  1K0N A;  3TKS A;  4NMU A;  5G30 A;  3L9U A;  3KD0 A;  4CDO A;  1UC7 A;  1USB A;  4IP1 A;  4FIW A;  2TRX A;  2O89 A;  4ECC A;  5ID2 B;  2H1A A;  2FA8 A;  5IMA A;  2JL4 A;  1SU9 A;  2R37 A;  13GS A;  3VWU A;  2GQL A;  3N9J A;  4WXT A;  1H75 A;  1XWB A;  5A4U A;  4K7I A;  2OKA A;  5D9V A;  3CTF A;  2NTO A;  3QMX A;  3CTG A;  3ZZX A;  20GS A;  3HD5 A;  1GTI A;  1OKT A;  2K8S A;  2LS5 A;  1W89 A;  2QGV A;  2C4J A;  4J56 E;  4HU9 A;  2IMI A;  2B5Y A;  2H30 A;  3A5W A;  3FZA A;  1JZW A;  1SK0 A;  1G7O A;  2DBC A;  2WS2 A;  1I9D A;  3TRP A;  1KTE A;  5A4W A;  1AC1 A;  3FY7 A;  2FLS A;  2H19 A;  4WBJ A;  5DAL B;  5B8B A;  1BED A;  3RPP A;  3QDN A;  3RBT A;  4TRX A;  3M1G A;  3ZLP A;  2VM2 A;  1FW1 A;  4PQH A;  2F3M A;  4RUV A;  2VCX A;  3SWL A;  2B1K A;  2GS3 A;  3GTU B;  4N30 A;  3MAK A;  2OE3 A;  4KW6 A;  1GH2 A;  4G19 A;  2GSQ A;  2H71 A;  1XCC A;  1X9M B;  5ECO B;  11GS A;  4V2M A;  4ZIL A;  2CVK A;  5DJL A;  5ELG A;  1ST9 A;  3I9V 2;  1VF1 A;  2H1D A;  4POM A;  3FEU A;  5DAL A;  3D22 A;  1MD4 A;  2H0H A;  2GDR A;  1Z3E A;  5HR2 A;  4YH2 A;  3QAV A;  3IXR A;  2P0G A;  2XBQ A;  3HZ8 A;  3TJJ A;  1F3B A;  4ZB6 A;  1X5C A;  3Q19 A;  3GTU A;  3LYP A;  4F9Z A;  1GLQ A;  1WRY A;  2H0G A;  2HT9 A;  3R2Q A;  2EIQ A;  12GS A;  2VIM A;  3HY2 A;  1R5P A;  1VF3 A;  4XIH A;  2H01 A;  2PU9 C;  3V1W A;  2B6M A;  2MMN A;  3FZ5 A;  2LJA A;  4PNF A;  5G2Z A;  1K0M A;  5CRH A;  4IP6 A;  2DJK A;  2E0Q A;  4J57 E;  4NV5 A;  3M8N A;  1FHE A;  4DEJ A;  2GLR A;  1EOH A;  3CMI A; 
#chains in the Genus database with same CATH topology
 18GS A;  5D96 A;  5J41 A;  1T4Z A;  4N0Z A;  3FR6 A;  2YWM A;  2DJJ A;  4OFM A;  2GZP A;  4OCE A;  2I1U A;  2VM1 A;  3ZFB A;  1CQG A;  2VOC A;  1SJ6 A;  2XC2 A;  4NHZ A;  3BD2 A;  3L0H A;  5F0G A;  5HR1 A;  4ECB A;  2FWG A;  1VF4 A;  3HHV A;  1WJK A;  4GSN A;  5COH A;  1EV9 A;  1XFL A;  1N8J A;  4QL9 A;  4MZC A;  4POL A;  5DJM A;  2V2G A;  4TXO B;  3W8S A;  1S3A A;  1ZYQ B;  4HDE A;  5G5E A;  2RM6 A;  4K2D A;  1B8X A;  4MPF A;  5D9X A;  5B8A A;  5KN1 A;  2PGT A;  1TI1 A;  2R5G A;  3GX0 A;  1EWX A;  1OYJ A;  2MBS A;  4H86 A;  2I3Y A;  1EGR A;  2N5F A;  4HEA 2;  3HJP A;  1SD8 A;  4GLT A;  2C1Y A;  3F4R A;  4KND A;  4IQ1 A;  3SBC A;  4WR4 A;  3IV4 A;  3CRU A;  5B6N A;  4OMV A;  3ZVJ A;  5G1K A;  1PN0 A;  1QGV A;  3BCI A;  4WET A;  3N5O A;  4POB A;  3FHK A;  4IBP A;  4MLY A;  3ZIT A;  4E8E A;  2VL2 A;  3GIX A;  2R2J A;  1GUL A;  1PFO A;  2WGR A;  2GT6 A;  2CV4 A;  2F51 A;  2YCD A;  3FKF A;  3WT1 A;  4DSS B;  4K0N A;  2QSI A;  3R3E A;  3BBY A;  1X5D A;  5JWQ B;  3WGD A;  2VLU A;  2ZNM A;  5FWG A;  4RI6 A;  1GSY A;  3O6T A;  1ERT A;  1PA3 A;  3F4T A;  2H8L A;  3UVT A;  2FY6 A;  3CXG A;  5IMC A;  2DKI A;  5GZZ B;  1K3L A;  1K0B A;  5D93 A;  2B5X A;  5CNW A;  5A4V A;  2H76 A;  2H73 A;  4ISD A;  4DSS A;  1OC3 A;  3C71 A;  3HXS A;  4QQ7 A;  3UL3 A;  4A5P A;  4D73 B;  2N5A A;  3D5J A;  4YQM A;  4MCU A;  2HRN A;  2BTO T;  6GSW A;  1TW9 A;  2C0E A;  1R5A A;  1M0U A;  4IGJ A;  3KP9 A;  4OFT A;  2ZCT A;  1NHY A;  3QPM A;  2HSY A;  5CRD A;  2R0C A;  2VL9 A;  3O76 A;  2M72 A;  1SKW B;  1DUG A;  4HU7 A;  1A0R P;  4HOJ A;  5F8B A;  3ZML A;  2MMA A;  3CYN A;  4KF9 A;  4D73 A;  1B4P A;  3EWL A;  1PN9 A;  2GSR A;  2LEG A;  2DIZ A;  4KX4 A;  2KUC A;  5EPF A;  3GH9 A;  2YOI A;  3W6G A;  1SL2 B;  2FUG 2;  2NVL A;  1YZX A;  3GUR A;  3IA1 A;  1EZK A;  1S3D A;  2MZC A;  4ULX A;  3FZ9 A;  3GH6 A;  2CA8 A;  3A5I A;  1O85 A;  1V58 A;  2HXK A;  3IOS A;  2C3N A;  5IO0 A;  3G9B A;  4AJ8 A;  2CZ3 A;  3GV1 A;  3FYG A;  1RW1 A;  3IE3 A;  5ECP B;  3VUR A;  3LSZ A;  4DSQ A;  3APQ A;  2RLI A;  3VPQ A;  2GVP A;  2MBT A;  3AY8 A;  3VFI A;  4KE3 A;  5DDL A;  3RAZ A;  2GTU A;  4N11 A;  2J23 A;  2WCI A;  4MK3 A;  2HRK A;  2E7P A;  4HUA A;  1FVK A;  3VLN A;  2C3T A;  3KH9 A;  4XS1 A;  3EMP A;  5IOW A;  2R4V A;  1SL1 B;  1O8X A;  3TKP A;  5INY A;  1TJD A;  4Q5N A;  2O8V B;  2MMZ A;  3ZMK A;  5IPG A;  2FHE A;  4MF6 A;  2GZY A;  1EP8 A;  2CT6 A;  4XS4 B;  4MAB A;  1H4O A;  3TKS E;  4G0K A;  4OD7 A;  3FR9 A;  1Q98 A;  2PUK C;  4ZIJ A;  2YN1 A;  1OVN A;  2A2R A;  2KP1 A;  2H1B A;  4WKW A;  3DEX A;  2JU5 A;  1EOG A;  3DIE A;  5IMZ A;  5AGY A;  4Z2R A;  1NSW A;  4MF7 A;  1GL8 A;  2L5L A;  1HYU A;  2CX3 A;  1U88 A;  2ON7 A;  4I97 A;  4BWS A;  3OR5 A;  1HNC A;  2R0G A;  1UVZ A;  2FA4 A;  1SKS B;  1X0R A;  4O92 A;  2XPE A;  3UAR A;  2C8U A;  1R7H A;  2XPD A;  2IL3 A;  2YNX A;  2YV7 A;  1QFN A;  3VI7 A;  5KOW A;  1AAZ A;  2DMM A;  3RPN A;  2X8G A;  5J4U A;  1T7P B;  4BA7 A;  1MEK A;  3E9J B;  1XWC A;  4EVM A;  1K0O A;  4Z2T A;  5DQY A;  1SD9 A;  4OCF A;  1T4Y A;  4V1A g;  2C3Q A;  3EU3 A;  3TJK A;  4IW9 A;  2IME A;  4IVF A;  3IRA A;  3IR4 A;  4KSO A;  5EVO A;  2V6O A;  4MPG A;  3ZIJ A;  6GSV A;  3GHA A;  1GSU A;  4Z7X A;  4O5U A;  4YAV A;  5D73 A;  1SJI A;  2PPT A;  1W4V A;  4RQR A;  5A5K A;  2VLT A;  1B9X C;  3GNJ A;  3I69 A;  4HQZ A;  2FWF A;  5J9B A;  5IM9 A;  4AGS A;  1YKC A;  1QUW A;  5DCG A;  2LRT A;  4YQV A;  5C04 A;  4ZB8 A;  2CZ2 A;  1ABA A;  5IO2 A;  1MDI A;  2AUV A;  4ECJ A;  2R0P A;  2GSS A;  3H93 A;  1XOA A;  2MYG A;  2GT5 A;  2RUE A;  3G7I A;  4JU5 A;  1Y25 A;  3KP8 A;  3ED3 A;  4ZB9 A;  3ERG A;  4NWY A;  4Q5F A;  2P5R A;  2WUL A;  1M2D A;  1TRV A;  4TR1 A;  3J7Y b;  2DIY A;  5IQY A;  4TR4 A;  3ERW A;  3GST A;  3MWH A;  5ECH B;  1GSS A;  1K0C A;  3ZIV A;  2L6D A;  1QMV A;  4NHW A;  1MDJ A;  3O3T A;  1XW5 A;  3HYP A;  3IBH A;  1F3A A;  2AV4 A;  3J7Y k;  4USS A;  3DGQ A;  3KMO A;  1JZD A;  2GQM A;  3UIW A;  1ERV A;  1O8W A;  3E3E A;  1ACV A;  5EL8 A;  2L4C A;  4K5R A;  4L0U A;  2DLX A;  1WP0 A;  1ZMA A;  2O7K A;  1ZL9 A;  2C80 A;  1X5E A;  3F0I A;  4EC0 A;  3LXT A;  1PL2 A;  1IYI A;  4G2E A;  3TOU A;  3KIJ A;  4HSC X;  3F4S A;  2C0F A;  1AQX A;  4FYU A;  1BJX A;  2BJX A;  1BX9 A;  4L5O A;  1YQ1 A;  1F2E A;  3RHB A;  4CY6 A;  2J9H A;  2V6K A;  2V32 A;  1YEX A;  1ZGN A;  3CSJ A;  4MH3 A;  4MJC A;  1MDK A;  2L5O A;  4IQA A;  5HQP A;  4E8H A;  4HZ4 A;  1V40 A;  4GCI A;  2LRC A;  3S9F A;  2KOK A;  1EEJ A;  4JR6 A;  3C7M A;  4YAP A;  1EP7 A;  2AHE A;  3GRX A;  1ERU A;  1XZO A;  4LLR A;  5J9C A;  1IYH A;  3IDV A;  2OBK A;  2DKH A;  1BAY A;  1FAA A;  4BIK A;  2C0D A;  3GKX A;  2CQ9 A;  1ZYE A;  3F63 A;  4I6X A;  2VCQ A;  3F3R A;  2VD1 A;  4HJ2 A;  2LV3 A;  3ISO A;  7GSS A;  4TXV A;  3A2V A;  2CVB A;  2DML A;  2TRC P;  3GSS A;  3IC4 A;  3EE2 A;  3NIV A;  3IK7 A;  4HJM A;  3H79 A;  4IKH A;  2D2Z A;  1WOU A;  3TKR A;  1JHB A;  2VCW A;  1QQ2 A;  4BPY A;  2JSY A;  3VWX A;  2F9S A;  3HJO A;  4IEL A;  5ELA A;  1SK2 A;  2ON5 A;  2LST A;  4TVE A;  4WF4 A;  3WT2 A;  3Q74 A;  3GL5 A;  4MZB A;  2V1M A;  2C0G A;  5H5R A;  1M99 A;  3HCZ A;  5L71 A;  2H6X A;  4FYB A;  5JCU A;  5GAP D;  4V1A p;  4WBR D;  5D8I A;  4OO5 A;  1PX7 A;  1ON4 A;  2I81 A;  4GTU A;  1A8Y A;  3GYK A;  4X1U A;  1WMJ A;  4PQ1 A;  1A2M A;  3QR6 A;  2E2G A;  4IHU A;  3LGC A;  3TJF A;  3L78 A;  3JCM L;  1GNE A;  1HNB A;  3APO A;  6GST A;  4AJ6 A;  5HR0 A;  1X9S B;  5KN0 A;  2O87 A;  3NZN A;  1I5G A;  14GS A;  1GUM A;  1NW2 A;  2XHF A;  4JRR A;  1GUH A;  4ECI A;  1PMT A;  3DWV A;  2K9F A;  4L5L A;  4KGI A;  2YV9 A;  5GAN D;  1RK4 A;  4ZBB A;  1B4Q A;  3FR3 A;  3MIX A;  1XVQ A;  5B6M A;  2PBJ A;  5FT3 A;  4JBB A;  4G10 A;  4PNG A;  4LMV A;  4K0G A;  4F0B A;  1URM A;  1YJ6 A;  3KTL A;  4KCE A;  4PUF C;  2HNL A;  2H6Y A;  1NHO A;  1SJZ A;  3LYK A;  3UEM A;  4N10 A;  3ZRE A;  3M9J A;  5G1L A;  3W8J A;  3C73 A;  1BG5 A;  2H6Z A;  5E4W A;  1Z6M A;  3P7X A;  1DSB A;  1SKR B;  1T1V A;  4X43 A;  5ECS A;  4EF0 A;  2B7K A;  2R3X A;  2IJY A;  1DE1 A;  1F6M C;  17GS A;  5CAX A;  2L4Q A;  3I43 A;  4EXJ A;  1M9A A;  4XRA A;  2VLV A;  2N5B A;  1YKA A;  5JWR B;  2LKU A;  1EGO A;  4WF5 A;  5ECQ B;  3M9K A;  1PQN A;  3ME7 A;  1T3B A;  2WJU A;  2DC5 A;  2M80 A;  5AN1 A;  1Q4J A;  4RQX A;  3BCK A;  4O5R A;  1GNW A;  3HKR A;  5KEJ A;  3C8E A;  3GKN A;  3WGX A;  4K1F A;  3MSZ A;  3TDG A;  2P5Q A;  4HI7 A;  1AQV A;  1Z7P A;  2VD0 A;  1A8L A;  2VCZ A;  2B7J A;  3GL3 A;  1FOV A;  2PER A;  3GA4 A;  2F8F A;  1TU7 A;  5DVB A;  2X8H A;  2YPM A;  3GFK A;  3LWA A;  5KOX A;  2FD3 A;  5ECI B;  1R4W A;  2MMO A;  2LUS A;  2YP6 A;  4KUN A;  1A23 A;  1FG4 A;  2ZUP A;  4PXO A;  1XW6 A;  2WRT A;  1GTU A;  2K18 A;  3TKS C;  4TN8 A;  4ZL8 A;  5ECR B;  1WIK A;  4GXZ A;  4BWQ A;  4YQU A;  2PMT A;  3CBU A;  3HA9 A;  4ID0 A;  1WE0 A;  3GKM A;  3DYR A;  3PR8 A;  1CQH A;  4I5Q A;  4OWY A;  4GQC A;  4IN0 A;  1ML6 A;  4Q5Q A;  4L8E A;  4O7H A;  1YF0 A;  4TKY A;  5HFG A;  1OAZ A;  1E6B A;  4ZXG A;  3EIN A;  3TJG A;  1SYX A;  3A2W A;  4MJB A;  1XW9 A;  2JAD A;  3HVS A;  3DXB A;  3P90 A;  4NAX A;  4ZL9 A;  3CSH A;  4BVY B;  1TTZ A;  3DVW A;  5CRG A;  1HD2 A;  1UA5 A;  3U6V A;  3MNG A;  2VUP A;  1TI3 A;  1GWC A;  3CSI A;  2GGT A;  2GQK A;  3VK9 A;  5B7C A;  4K2X A;  1R26 A;  5F05 A;  2OE1 A;  5IIZ A;  5G5F A;  4O32 A;  2LTK A;  2BMX A;  1J9B A;  1PKW A;  1ILO A;  1XG8 A;  5DAK B;  4BVY A;  1V57 A;  4POK A;  3IHG A;  5G31 A;  3LG6 A;  3GN3 A;  3FRC A;  3APS A;  4F0C A;  3DD3 A;  2A4V A;  3KCM A;  2QA1 A;  1OC8 A;  1WWJ A;  1M2A A;  4ZBA A;  1GP1 A;  5CRW A;  1U87 A;  4NPB A;  3HVX A;  2B1L A;  1THX A;  4F2I A;  1N2A A;  1B48 A;  2H74 A;  9GSS A;  5AIV A;  2VO4 A;  1V98 A;  3H4K A;  4L0W A;  3WD6 A;  3IC8 A;  4CHS A;  5DAK A;  8GSS A;  1B9Y C;  2AYT A;  5H5S A;  1DBY A;  2HE3 A;  4NXI A;  4ZL7 A;  3BJ5 A;  4GF0 A;  5ECL B;  3P2A A;  4EDY A;  2X4A A;  3ME8 A;  4KH7 A;  4NV2 A;  3VPT A;  4KDY A;  3EU4 A;  2XBI A;  2X8C A;  3KH7 A;  2OBI A;  3HVV A;  3KZQ A;  1EV4 A;  3A2X A;  4GWR A;  2X49 A;  1Z5Y E;  2R6K A;  4DVC A;  19GS A;  1PL1 A;  3IAS 2;  3QAW A;  1OE7 A;  3H8Q A;  1A2L A;  1TOF A;  2PWJ A;  1TKD B;  4LL1 B;  2JZT A;  4ACS A;  2GZZ A;  2LQQ A;  5AIX A;  3U5R E;  1PX6 A;  1GSF A;  4TR1 B;  1M3J A;  1XOB A;  3GMF A;  5F07 A;  1LBK A;  2HSM A;  4KB3 A;  5EY6 A;  1YDK A;  1U6T A;  4MZW A;  2YJH A;  5CRE A;  4MDC A;  3CRT A;  3PPU A;  2V41 A;  1XVW A;  4Q5R A;  3EUR A;  2QKE A;  1AUC A;  3RDW A;  4V2L A;  2AB6 A;  3L4N A;  2EIR A;  3KXO A;  6GSY A;  2EIO A;  1UN2 A;  2QA2 A;  1M7T A;  1TK5 B;  3PGT A;  1A2J A;  3IAM 2;  1S3C A;  3E0U A;  5IMV A;  2JAC A;  4JZQ A;  3KM6 A;  1TRW A;  2HI7 A;  3LOR A;  1O6J A;  2DJ2 A;  3GX8 A;  2K8V A;  2FNO A;  5ID2 A;  5J3R A;  2G0F A;  5JCG A;  1JLW A;  3A3T A;  3GUS A;  3UVH A;  5C00 A;  2VL3 A;  4ML1 A;  1VRS D;  3QFA C;  2VCV A;  1YEP A;  1K0A A;  3C1R A;  1TRS A;  3D21 A;  1QXH A;  2A2S A;  1G7E A;  2PVO C;  2OAD A;  4JED A;  3TKQ A;  1FVJ A;  2EC4 A;  1ZYN A;  1V9W A;  3PIN A;  2OJL A;  5CP1 A;  4TR0 A;  3TGZ A;  5JCW A;  4K7N A;  3D0Z A;  4HZ2 A;  2YZU A;  5LD0 A;  1TP9 A;  2VL2 C;  5FHI A;  4WR5 A;  1HQO A;  1TXX A;  1OKD A;  3ZTL A;  6GSX A;  1AIU A;  3M0F A;  1JLV A;  4K5S A;  4TW5 A;  4MA9 A;  4CW9 A;  3VWW A;  5KN3 A;  2DSA A;  3KEB A;  5HR3 A;  3C1S A;  4JR4 A;  4X0X A;  2DJ3 A;  4I8B A;  3Q6O A;  3LJR A;  2L6C A;  2IIY A;  4G9H A;  2OE0 A;  5LCZ A;  1XXU A;  5ENU A;  3EVI A;  1K0D A;  1THO A;  2VCT A;  4HS1 A;  4LMW A;  4XRD A;  4EE0 A;  3TCO A;  2IPA A;  2LNT A;  3KTB A;  4GST A;  1XIY A;  3ZFL A;  2YJ7 A;  2K6V A;  2O85 A;  3F6D A;  1TRU A;  2H75 A;  5GSS A;  3F8U A;  4PUR A;  4N0V A;  3TB2 A;  3D6I A;  1ERW A;  2IMD A;  2B5E A;  1Z9H A;  5BRT A;  1TDI A;  3FK8 A;  1SK1 A;  1SL0 B;  1VGL A;  3L9V A;  3K8N A;  1RQM A;  1J0F A;  5BMU A;  3TJB A;  4PUA A;  2LRN A;  10GS A;  4V2N A;  2CVD A;  5AIS A;  4EKZ A;  2IFQ B;  2JSZ A;  2I4A A;  3UBK A;  3TRX A;  3GKK A;  4K9Z A;  5ECN B;  4MMM A;  2TIR A;  4ZBD A;  2I9H A;  3IHQ A;  3UJ1 A;  3D4T A;  1QK8 A;  2LQO A;  1Z7R A;  4JE1 A;  2ES7 A;  3BOA A;  1ZCP A;  1T00 A;  5DCH A;  4IJI A;  4FH8 A;  2FWE A;  1BYE A;  3LXZ A;  4MNN A;  4TOP A;  2H0I A;  3DKS A;  3KGK A;  1TK0 B;  1PRX A;  3DVX A;  2IFQ A;  4XS6 A;  3I6A A;  3VI5 A;  2YWI A;  1O7U A;  4OFN A;  3D4M A;  3IK9 A;  1K3Y A;  1TK8 B;  5IMD A;  1GSE A;  4LA1 A;  1EEM A;  3F9U A;  1A0F A;  3F3Q A;  1O81 A;  3ZYW A;  2G2Q A;  3HJM A;  2RII A;  5GST A;  1O73 A;  1T8E B;  2RM5 A;  2E2M A;  4KCA A;  1G6W A;  4K6X A;  4K8M A;  1M9B A;  3G7Y A;  4AJ7 A;  4TXO A;  4BL7 B;  4PQI A;  4FO5 A;  5ECM B;  3QOU A;  1LU4 A;  1PD2 1;  2B3S A;  1FOH A;  2WDU A;  2H66 A;  2YZH A;  4P3Y B;  2LJR A;  4K7O A;  4F03 A;  3FMW A;  1G6Y A;  2HLS A;  2JZR A;  2PN8 A;  1F37 A;  3DRN A;  3UOM A;  4CY8 A;  2KP2 A;  3IPZ A;  4EO3 A;  3ERF A;  5JWO B;  3HZ4 A;  2IWT A;  2KLX A;  1WPI A;  2X64 A;  2NPB A;  2PVQ A;  3FZ4 A;  4RI7 A;  4BL7 A;  3QFB C;  5ECK B;  3MYD A;  2LJK A;  4KA0 A;  5LNK e;  2HYX A;  4J2F A;  3HDC A;  3LQ7 A;  3QAG A;  1ZYP A;  4G0I A;  1PKZ A;  2FGX A;  2YWO A;  1AQW A;  2M46 A;  2H72 A;  1XPV A;  4KDX A;  1FO5 A;  2YAN A;  1MD3 A;  1VF2 A;  3G7J A;  4ILF A;  3H1N A;  1ZZY A;  3NOF A;  4Z2U A;  4ML6 A;  4LL4 B;  2IMF A;  4YKG A;  2CX4 A;  1ZOF A;  4QL7 A;  4WEY A;  4I2T A;  5HFK A;  4F82 A;  16GS A;  4KAE A;  4AF2 A;  2DJ1 A;  2WZ9 A;  2Z9S A;  4DSR A;  1GUK A;  1LJR A;  3US3 A;  3HVN A;  4MJA A;  1U3I A;  2HRF A;  4TR3 A;  4XHM A;  2L57 A;  5F06 A;  1X9W B;  2H70 A;  2LNS A;  5DBQ A;  1C72 A;  2IMK A;  3WGE A;  1GSD A;  1S3R A;  2HFD A;  4BVX B;  1A24 A;  2A2P A;  2QC7 A;  3EYT A;  2RUF A;  2H1G A;  1YF1 A;  1J08 A;  1JZR A;  3LFL A;  4EIP A;  1XWG A;  4MH2 A;  4ICY A;  1KNG A;  2KHP A;  3UMA A;  1SYR A;  5IOX A;  4OO4 A;  3P8W A;  4EUY A;  1E2Y A;  2GST A;  4MP4 A;  1NM3 A;  2VAF A;  4BVX A;  1GTA A;  4XCS A;  4MJE A;  5E59 A;  4EDZ A;  5CYY A;  3Q18 A;  2X99 A;  3VWV A;  2DJ0 A;  5IMF A;  1AXD A;  4GQF A;  4EL1 A;  1KEB A;  3DML A;  1MTC A;  2JZS A;  3M3M A;  3LEF A;  1TU8 A;  1BQ7 A;  2REM A;  1U3A A;  2CAI A;  2NBS A;  4GSS A;  2WFC A;  2HZE B;  3CQF A;  2IN3 A;  1KBN A;  2A4H A;  1F9M A;  2WB9 A;  4G0L A;  3RHC A;  2FCH A;  3TOT A;  1XWK A;  3UBL A;  2NDO A;  3QD9 A;  4I2U A;  1XBS A;  5D9W A;  4IS0 A;  2HRA A;  1OE8 A;  3TUE A;  1G0T A;  2CAQ A;  5IPH A;  1YY7 A;  2ALB A;  2HSH A;  1HNA A;  2HZE A;  1XWA A;  3EC3 A;  3WYW A;  5D9T A;  5KN2 A;  4MF5 A;  3KJY A;  1SEN A;  5CO3 A;  4PTS A;  3L9S A;  1GRX A;  1GSQ A;  3ZRD A;  1GLP A;  4YKF A;  2AAW A;  1JZO A;  4PX1 A;  4XS4 A;  5J5N A;  3EMX A;  2F8A A;  5H5Q A;  1DE2 A;  1GTB A;  1M2B A;  3ZL5 A;  2OA7 A;  1JFU A;  1Z6N A;  2FWH A;  4PGT A;  3TRQ A;  4IJ3 A;  1OC9 B;  3EPT A;  3LW9 A;  2OAC A;  6GSU A;  5DQS A;  5ABR A;  3FW2 A;  1K3O A;  1Y6E A;  22GS A;  4KDU A;  5HFI A;  2AJQ B;  1AW9 A;  1FB6 A;  3KMN A;  3MDK A;  2HZF A;  4XTS A;  3PH9 A;  3ZVJ D;  1V2A A;  3F6F A;  4KSM A;  2UZ8 A;  2YWN A;  4FYC A;  2L59 A;  2P31 A;  4GRF A;  1FB0 A;  3UAP A;  1OC9 A;  1PGT A;  4FQU A;  3QCP A;  4HQS A;  6GSS A;  1PSQ A;  1K0N A;  3TKS A;  4NMU A;  5G30 A;  3L9U A;  3KD0 A;  4CDO A;  1UC7 A;  1USB A;  4IP1 A;  4FIW A;  2TRX A;  2O89 A;  4ECC A;  5ID2 B;  2H1A A;  2FA8 A;  5IMA A;  4EIQ A;  2JL4 A;  1SU9 A;  2R37 A;  13GS A;  3VWU A;  2GQL A;  3N9J A;  4WXT A;  1H75 A;  1XWB A;  5A4U A;  4K7I A;  2OKA A;  5D9V A;  4O5Q A;  3CTF A;  2NTO A;  3QMX A;  3CTG A;  3ZZX A;  20GS A;  3HD5 A;  1GTI A;  1OKT A;  2K8S A;  2LS5 A;  1W89 A;  2QGV A;  2C4J A;  4J56 E;  4HU9 A;  2IMI A;  2B5Y A;  2H30 A;  3A5W A;  3FZA A;  1JZW A;  1SK0 A;  1G7O A;  2DBC A;  2WS2 A;  1I9D A;  3TRP A;  1KTE A;  5A4W A;  1AC1 A;  3FY7 A;  2FLS A;  2H19 A;  4WBJ A;  5DAL B;  5B8B A;  1BED A;  3RPP A;  3QDN A;  3RBT A;  4TRX A;  3M1G A;  3ZLP A;  2VM2 A;  1FW1 A;  4PQH A;  2F3M A;  4RUV A;  2VCX A;  3SWL A;  2B1K A;  2GS3 A;  3GTU B;  4N30 A;  3MAK A;  2OE3 A;  4KW6 A;  1GH2 A;  4G19 A;  2GSQ A;  2H71 A;  1XCC A;  1X9M B;  5ECO B;  11GS A;  4V2M A;  4ZIL A;  2CVK A;  5DJL A;  5ELG A;  1ST9 A;  3I9V 2;  1VF1 A;  2H1D A;  4POM A;  3FEU A;  5DAL A;  3D22 A;  1MD4 A;  2H0H A;  2GDR A;  1Z3E A;  5HR2 A;  4YH2 A;  3QAV A;  3IXR A;  2P0G A;  2XBQ A;  3HZ8 A;  3TJJ A;  1M3I A;  1F3B A;  4ZB6 A;  1X5C A;  3Q19 A;  3GTU A;  3LYP A;  4F9Z A;  1GLQ A;  1WRY A;  2H0G A;  2HT9 A;  3R2Q A;  2EIQ A;  4X4J A;  12GS A;  2VIM A;  3HY2 A;  1R5P A;  1VF3 A;  4XIH A;  2H01 A;  2PU9 C;  3V1W A;  2B6M A;  2MMN A;  3FZ5 A;  2LJA A;  4PNF A;  5G2Z A;  1K0M A;  5CRH A;  4IP6 A;  2DJK A;  2E0Q A;  4J57 E;  4NV5 A;  3M8N A;  1FHE A;  4DEJ A;  2GLR A;  1EOH A;  3CMI A; 
#chains in the Genus database with same CATH homology
 18GS A;  5D96 A;  5J41 A;  1T4Z A;  4N0Z A;  3FR6 A;  2YWM A;  2DJJ A;  4OFM A;  2GZP A;  4OCE A;  2I1U A;  2VM1 A;  3ZFB A;  1CQG A;  2VOC A;  1SJ6 A;  2XC2 A;  4NHZ A;  3BD2 A;  3L0H A;  5F0G A;  5HR1 A;  4ECB A;  2FWG A;  1VF4 A;  3HHV A;  1WJK A;  4GSN A;  5COH A;  1EV9 A;  1XFL A;  1N8J A;  4QL9 A;  4MZC A;  4POL A;  5DJM A;  2V2G A;  4TXO B;  3W8S A;  1S3A A;  1ZYQ B;  4HDE A;  5G5E A;  2RM6 A;  4K2D A;  1B8X A;  4MPF A;  5D9X A;  5B8A A;  5KN1 A;  2PGT A;  1TI1 A;  2R5G A;  3GX0 A;  1EWX A;  1OYJ A;  2MBS A;  4H86 A;  2I3Y A;  1EGR A;  2N5F A;  4HEA 2;  3HJP A;  1SD8 A;  4GLT A;  2C1Y A;  3F4R A;  4KND A;  4IQ1 A;  3SBC A;  4WR4 A;  3IV4 A;  3CRU A;  5B6N A;  4OMV A;  3ZVJ A;  5G1K A;  1PN0 A;  1QGV A;  3BCI A;  4WET A;  3N5O A;  4POB A;  3FHK A;  4IBP A;  4MLY A;  3ZIT A;  4E8E A;  2VL2 A;  3GIX A;  2R2J A;  1GUL A;  2WGR A;  2GT6 A;  2CV4 A;  2F51 A;  2YCD A;  3FKF A;  3WT1 A;  4DSS B;  4K0N A;  2QSI A;  3R3E A;  3BBY A;  1X5D A;  5JWQ B;  3WGD A;  2VLU A;  2ZNM A;  5FWG A;  4RI6 A;  1GSY A;  3O6T A;  1ERT A;  1PA3 A;  3F4T A;  2H8L A;  3UVT A;  2FY6 A;  3CXG A;  5IMC A;  2DKI A;  5GZZ B;  1K3L A;  1K0B A;  5D93 A;  2B5X A;  5CNW A;  5A4V A;  2H76 A;  2H73 A;  4ISD A;  4DSS A;  1OC3 A;  3C71 A;  3HXS A;  4QQ7 A;  3UL3 A;  4A5P A;  4D73 B;  2N5A A;  3D5J A;  4YQM A;  4MCU A;  2HRN A;  2BTO T;  6GSW A;  1TW9 A;  2C0E A;  1R5A A;  1M0U A;  4IGJ A;  3KP9 A;  4OFT A;  2ZCT A;  1NHY A;  3QPM A;  2HSY A;  5CRD A;  2R0C A;  2VL9 A;  3O76 A;  2M72 A;  1SKW B;  1DUG A;  4HU7 A;  1A0R P;  4HOJ A;  5F8B A;  3ZML A;  2MMA A;  3CYN A;  4KF9 A;  4D73 A;  1B4P A;  3EWL A;  1PN9 A;  2GSR A;  2LEG A;  2DIZ A;  4KX4 A;  2KUC A;  5EPF A;  3GH9 A;  2YOI A;  3W6G A;  1SL2 B;  2FUG 2;  2NVL A;  1YZX A;  3GUR A;  3IA1 A;  1EZK A;  1S3D A;  2MZC A;  4ULX A;  3FZ9 A;  3GH6 A;  2CA8 A;  3A5I A;  1O85 A;  1V58 A;  2HXK A;  3IOS A;  2C3N A;  5IO0 A;  3G9B A;  4AJ8 A;  2CZ3 A;  3GV1 A;  3FYG A;  1RW1 A;  3IE3 A;  5ECP B;  3VUR A;  3LSZ A;  4DSQ A;  3APQ A;  2RLI A;  3VPQ A;  2GVP A;  2MBT A;  3AY8 A;  3VFI A;  4KE3 A;  5DDL A;  3RAZ A;  2GTU A;  4N11 A;  2J23 A;  2WCI A;  4MK3 A;  2HRK A;  2E7P A;  4HUA A;  1FVK A;  3VLN A;  2C3T A;  3KH9 A;  4XS1 A;  3EMP A;  5IOW A;  2R4V A;  1SL1 B;  1O8X A;  3TKP A;  5INY A;  1TJD A;  4Q5N A;  2O8V B;  2MMZ A;  3ZMK A;  5IPG A;  2FHE A;  4MF6 A;  2GZY A;  1EP8 A;  2CT6 A;  4XS4 B;  4MAB A;  1H4O A;  3TKS E;  4G0K A;  4OD7 A;  3FR9 A;  1Q98 A;  2PUK C;  4ZIJ A;  2YN1 A;  1OVN A;  2A2R A;  2KP1 A;  2H1B A;  4WKW A;  3DEX A;  2JU5 A;  1EOG A;  3DIE A;  5IMZ A;  5AGY A;  4Z2R A;  1NSW A;  4MF7 A;  1GL8 A;  2L5L A;  1HYU A;  2CX3 A;  1U88 A;  2ON7 A;  4I97 A;  4BWS A;  3OR5 A;  1HNC A;  2R0G A;  1UVZ A;  2FA4 A;  1SKS B;  1X0R A;  4O92 A;  2XPE A;  3UAR A;  2C8U A;  1R7H A;  2XPD A;  2IL3 A;  2YNX A;  2YV7 A;  1QFN A;  3VI7 A;  5KOW A;  1AAZ A;  2DMM A;  3RPN A;  2X8G A;  5J4U A;  1T7P B;  4BA7 A;  1MEK A;  3E9J B;  1XWC A;  4EVM A;  1K0O A;  4Z2T A;  5DQY A;  1SD9 A;  4OCF A;  1T4Y A;  4V1A g;  2C3Q A;  3EU3 A;  3TJK A;  4IW9 A;  2IME A;  4IVF A;  3IRA A;  3IR4 A;  4KSO A;  5EVO A;  2V6O A;  4MPG A;  3ZIJ A;  6GSV A;  3GHA A;  1GSU A;  4Z7X A;  4O5U A;  4YAV A;  5D73 A;  1SJI A;  2PPT A;  1W4V A;  4RQR A;  5A5K A;  2VLT A;  1B9X C;  3GNJ A;  3I69 A;  4HQZ A;  2FWF A;  5J9B A;  5IM9 A;  4AGS A;  1YKC A;  1QUW A;  5DCG A;  2LRT A;  4YQV A;  5C04 A;  4ZB8 A;  2CZ2 A;  1ABA A;  5IO2 A;  1MDI A;  2AUV A;  4ECJ A;  2R0P A;  2GSS A;  3H93 A;  1XOA A;  2MYG A;  2GT5 A;  2RUE A;  3G7I A;  4JU5 A;  1Y25 A;  3KP8 A;  3ED3 A;  4ZB9 A;  3ERG A;  4NWY A;  4Q5F A;  2P5R A;  2WUL A;  1M2D A;  1TRV A;  4TR1 A;  3J7Y b;  2DIY A;  5IQY A;  4TR4 A;  3ERW A;  3GST A;  3MWH A;  5ECH B;  1GSS A;  1K0C A;  3ZIV A;  2L6D A;  1QMV A;  4NHW A;  1MDJ A;  3O3T A;  1XW5 A;  3HYP A;  3IBH A;  1F3A A;  2AV4 A;  3J7Y k;  4USS A;  3DGQ A;  3KMO A;  1JZD A;  2GQM A;  3UIW A;  1ERV A;  1O8W A;  3E3E A;  1ACV A;  5EL8 A;  2L4C A;  4K5R A;  4L0U A;  2DLX A;  1WP0 A;  1ZMA A;  2O7K A;  1ZL9 A;  2C80 A;  1X5E A;  3F0I A;  4EC0 A;  3LXT A;  1PL2 A;  1IYI A;  4G2E A;  3TOU A;  3KIJ A;  3F4S A;  2C0F A;  1AQX A;  4FYU A;  1BJX A;  2BJX A;  1BX9 A;  4L5O A;  1YQ1 A;  1F2E A;  3RHB A;  4CY6 A;  2J9H A;  2V6K A;  2V32 A;  1YEX A;  1ZGN A;  3CSJ A;  4MH3 A;  4MJC A;  1MDK A;  2L5O A;  4IQA A;  5HQP A;  4E8H A;  4HZ4 A;  1V40 A;  4GCI A;  2LRC A;  3S9F A;  2KOK A;  1EEJ A;  4JR6 A;  3C7M A;  4YAP A;  1EP7 A;  2AHE A;  3GRX A;  1ERU A;  1XZO A;  4LLR A;  5J9C A;  1IYH A;  3IDV A;  2OBK A;  2DKH A;  1BAY A;  1FAA A;  2C0D A;  3GKX A;  2CQ9 A;  1ZYE A;  3F63 A;  4I6X A;  2VCQ A;  3F3R A;  2VD1 A;  4HJ2 A;  2LV3 A;  3ISO A;  7GSS A;  4TXV A;  3A2V A;  2CVB A;  2DML A;  2TRC P;  3GSS A;  3IC4 A;  3EE2 A;  3NIV A;  3IK7 A;  4HJM A;  3H79 A;  4IKH A;  2D2Z A;  1WOU A;  3TKR A;  1JHB A;  2VCW A;  1QQ2 A;  4BPY A;  2JSY A;  3VWX A;  2F9S A;  3HJO A;  4IEL A;  5ELA A;  1SK2 A;  2ON5 A;  2LST A;  4TVE A;  4WF4 A;  3WT2 A;  3Q74 A;  3GL5 A;  4MZB A;  2V1M A;  2C0G A;  5H5R A;  1M99 A;  3HCZ A;  5L71 A;  2H6X A;  4FYB A;  5JCU A;  5GAP D;  4V1A p;  4WBR D;  5D8I A;  4OO5 A;  1PX7 A;  1ON4 A;  2I81 A;  4GTU A;  1A8Y A;  3GYK A;  4X1U A;  1WMJ A;  4PQ1 A;  1A2M A;  3QR6 A;  2E2G A;  4IHU A;  3LGC A;  3TJF A;  3L78 A;  3JCM L;  1GNE A;  1HNB A;  3APO A;  6GST A;  4AJ6 A;  5HR0 A;  1X9S B;  5KN0 A;  2O87 A;  3NZN A;  1I5G A;  14GS A;  1GUM A;  1NW2 A;  2XHF A;  4JRR A;  1GUH A;  4ECI A;  1PMT A;  3DWV A;  2K9F A;  4L5L A;  4KGI A;  2YV9 A;  5GAN D;  1RK4 A;  4ZBB A;  1B4Q A;  3FR3 A;  3MIX A;  1XVQ A;  5B6M A;  2PBJ A;  5FT3 A;  4JBB A;  4G10 A;  4PNG A;  4LMV A;  4K0G A;  4F0B A;  1URM A;  1YJ6 A;  3KTL A;  4KCE A;  4PUF C;  2HNL A;  2H6Y A;  1NHO A;  1SJZ A;  3LYK A;  3UEM A;  4N10 A;  3ZRE A;  3M9J A;  5G1L A;  3W8J A;  3C73 A;  1BG5 A;  2H6Z A;  5E4W A;  1Z6M A;  3P7X A;  1DSB A;  1SKR B;  1T1V A;  4X43 A;  5ECS A;  4EF0 A;  2B7K A;  2R3X A;  2IJY A;  1DE1 A;  1F6M C;  17GS A;  5CAX A;  2L4Q A;  3I43 A;  4EXJ A;  1M9A A;  4XRA A;  2VLV A;  2N5B A;  1YKA A;  5JWR B;  2LKU A;  1EGO A;  4WF5 A;  5ECQ B;  3M9K A;  1PQN A;  3ME7 A;  1T3B A;  2WJU A;  2DC5 A;  2M80 A;  5AN1 A;  1Q4J A;  4RQX A;  3BCK A;  4O5R A;  1GNW A;  3HKR A;  5KEJ A;  3C8E A;  3GKN A;  3WGX A;  4K1F A;  3MSZ A;  3TDG A;  2P5Q A;  4HI7 A;  1AQV A;  1Z7P A;  2VD0 A;  1A8L A;  2VCZ A;  2B7J A;  3GL3 A;  1FOV A;  2PER A;  3GA4 A;  2F8F A;  1TU7 A;  5DVB A;  2X8H A;  2YPM A;  3GFK A;  3LWA A;  5KOX A;  2FD3 A;  5ECI B;  1R4W A;  2MMO A;  2LUS A;  2YP6 A;  4KUN A;  1A23 A;  1FG4 A;  2ZUP A;  4PXO A;  1XW6 A;  2WRT A;  1GTU A;  2K18 A;  3TKS C;  4TN8 A;  4ZL8 A;  5ECR B;  1WIK A;  4GXZ A;  4BWQ A;  4YQU A;  2PMT A;  3CBU A;  3HA9 A;  4ID0 A;  1WE0 A;  3GKM A;  3DYR A;  3PR8 A;  1CQH A;  4I5Q A;  4OWY A;  4GQC A;  4IN0 A;  1ML6 A;  4Q5Q A;  4L8E A;  4O7H A;  1YF0 A;  4TKY A;  5HFG A;  1OAZ A;  1E6B A;  4ZXG A;  3EIN A;  3TJG A;  1SYX A;  3A2W A;  4MJB A;  1XW9 A;  2JAD A;  3HVS A;  3DXB A;  3P90 A;  4NAX A;  4ZL9 A;  3CSH A;  4BVY B;  1TTZ A;  3DVW A;  5CRG A;  1HD2 A;  1UA5 A;  3U6V A;  3MNG A;  2VUP A;  1TI3 A;  1GWC A;  3CSI A;  2GGT A;  2GQK A;  3VK9 A;  5B7C A;  4K2X A;  1R26 A;  5F05 A;  2OE1 A;  5IIZ A;  5G5F A;  4O32 A;  2LTK A;  2BMX A;  1J9B A;  1PKW A;  1ILO A;  5DAK B;  4BVY A;  1V57 A;  4POK A;  3IHG A;  5G31 A;  3LG6 A;  3GN3 A;  3FRC A;  3APS A;  4F0C A;  3DD3 A;  2A4V A;  3KCM A;  2QA1 A;  1OC8 A;  1WWJ A;  1M2A A;  4ZBA A;  1GP1 A;  5CRW A;  1U87 A;  4NPB A;  3HVX A;  2B1L A;  1THX A;  4F2I A;  1N2A A;  1B48 A;  2H74 A;  9GSS A;  5AIV A;  2VO4 A;  1V98 A;  3H4K A;  4L0W A;  3WD6 A;  3IC8 A;  4CHS A;  5DAK A;  8GSS A;  1B9Y C;  2AYT A;  5H5S A;  1DBY A;  2HE3 A;  4NXI A;  4ZL7 A;  3BJ5 A;  4GF0 A;  5ECL B;  3P2A A;  4EDY A;  2X4A A;  3ME8 A;  4KH7 A;  4NV2 A;  3VPT A;  4KDY A;  3EU4 A;  2XBI A;  2X8C A;  3KH7 A;  2OBI A;  3HVV A;  3KZQ A;  1EV4 A;  3A2X A;  4GWR A;  2X49 A;  1Z5Y E;  2R6K A;  4DVC A;  19GS A;  1PL1 A;  3IAS 2;  3QAW A;  1OE7 A;  3H8Q A;  1A2L A;  1TOF A;  2PWJ A;  1TKD B;  4LL1 B;  2JZT A;  4ACS A;  2GZZ A;  2LQQ A;  5AIX A;  3U5R E;  1PX6 A;  1GSF A;  4TR1 B;  1XOB A;  3GMF A;  5F07 A;  1LBK A;  2HSM A;  4KB3 A;  5EY6 A;  1YDK A;  1U6T A;  4MZW A;  2YJH A;  5CRE A;  4MDC A;  3CRT A;  3PPU A;  2V41 A;  1XVW A;  4Q5R A;  3EUR A;  2QKE A;  1AUC A;  3RDW A;  4V2L A;  2AB6 A;  3L4N A;  2EIR A;  3KXO A;  6GSY A;  2EIO A;  1UN2 A;  2QA2 A;  1M7T A;  1TK5 B;  3PGT A;  1A2J A;  3IAM 2;  1S3C A;  3E0U A;  5IMV A;  2JAC A;  4JZQ A;  3KM6 A;  1TRW A;  2HI7 A;  3LOR A;  1O6J A;  2DJ2 A;  3GX8 A;  2K8V A;  2FNO A;  5ID2 A;  5J3R A;  2G0F A;  5JCG A;  1JLW A;  3A3T A;  3GUS A;  3UVH A;  5C00 A;  2VL3 A;  4ML1 A;  1VRS D;  3QFA C;  2VCV A;  1YEP A;  1K0A A;  3C1R A;  1TRS A;  3D21 A;  1QXH A;  2A2S A;  1G7E A;  2PVO C;  2OAD A;  4JED A;  3TKQ A;  1FVJ A;  2EC4 A;  1ZYN A;  1V9W A;  3PIN A;  2OJL A;  5CP1 A;  4TR0 A;  3TGZ A;  5JCW A;  4K7N A;  3D0Z A;  4HZ2 A;  2YZU A;  5LD0 A;  1TP9 A;  2VL2 C;  5FHI A;  4WR5 A;  1HQO A;  1TXX A;  1OKD A;  3ZTL A;  6GSX A;  1AIU A;  3M0F A;  1JLV A;  4K5S A;  4TW5 A;  4MA9 A;  4CW9 A;  3VWW A;  5KN3 A;  2DSA A;  3KEB A;  5HR3 A;  3C1S A;  4JR4 A;  4X0X A;  2DJ3 A;  4I8B A;  3Q6O A;  3LJR A;  2L6C A;  2IIY A;  4G9H A;  2OE0 A;  5LCZ A;  1XXU A;  5ENU A;  3EVI A;  1K0D A;  1THO A;  2VCT A;  4HS1 A;  4LMW A;  4XRD A;  4EE0 A;  3TCO A;  2IPA A;  2LNT A;  3KTB A;  4GST A;  1XIY A;  3ZFL A;  2YJ7 A;  2K6V A;  2O85 A;  3F6D A;  1TRU A;  2H75 A;  5GSS A;  3F8U A;  4PUR A;  4N0V A;  3TB2 A;  3D6I A;  1ERW A;  2IMD A;  2B5E A;  1Z9H A;  5BRT A;  1TDI A;  3FK8 A;  1SK1 A;  1SL0 B;  1VGL A;  3L9V A;  3K8N A;  1RQM A;  1J0F A;  5BMU A;  3TJB A;  4PUA A;  2LRN A;  10GS A;  4V2N A;  2CVD A;  5AIS A;  4EKZ A;  2IFQ B;  2JSZ A;  2I4A A;  3UBK A;  3TRX A;  3GKK A;  4K9Z A;  5ECN B;  4MMM A;  2TIR A;  4ZBD A;  2I9H A;  3IHQ A;  3UJ1 A;  3D4T A;  1QK8 A;  2LQO A;  1Z7R A;  4JE1 A;  2ES7 A;  3BOA A;  1ZCP A;  1T00 A;  5DCH A;  4IJI A;  4FH8 A;  2FWE A;  1BYE A;  3LXZ A;  4MNN A;  4TOP A;  2H0I A;  3DKS A;  3KGK A;  1TK0 B;  1PRX A;  3DVX A;  2IFQ A;  4XS6 A;  3I6A A;  3VI5 A;  2YWI A;  1O7U A;  4OFN A;  3D4M A;  3IK9 A;  1K3Y A;  1TK8 B;  5IMD A;  1GSE A;  4LA1 A;  1EEM A;  3F9U A;  1A0F A;  3F3Q A;  1O81 A;  3ZYW A;  2G2Q A;  3HJM A;  2RII A;  5GST A;  1O73 A;  1T8E B;  2RM5 A;  2E2M A;  4KCA A;  1G6W A;  4K6X A;  4K8M A;  1M9B A;  3G7Y A;  4AJ7 A;  4TXO A;  4BL7 B;  4PQI A;  4FO5 A;  5ECM B;  3QOU A;  1LU4 A;  1PD2 1;  2B3S A;  1FOH A;  2WDU A;  2H66 A;  2YZH A;  4P3Y B;  2LJR A;  4K7O A;  4F03 A;  3FMW A;  1G6Y A;  2HLS A;  2JZR A;  2PN8 A;  1F37 A;  3DRN A;  3UOM A;  4CY8 A;  2KP2 A;  3IPZ A;  4EO3 A;  3ERF A;  5JWO B;  3HZ4 A;  2IWT A;  2KLX A;  1WPI A;  2X64 A;  2NPB A;  2PVQ A;  3FZ4 A;  4RI7 A;  4BL7 A;  3QFB C;  5ECK B;  3MYD A;  2LJK A;  4KA0 A;  5LNK e;  2HYX A;  4J2F A;  3HDC A;  3LQ7 A;  3QAG A;  1ZYP A;  4G0I A;  1PKZ A;  2FGX A;  2YWO A;  1AQW A;  2M46 A;  2H72 A;  1XPV A;  4KDX A;  1FO5 A;  2YAN A;  1MD3 A;  1VF2 A;  3G7J A;  4ILF A;  3H1N A;  1ZZY A;  3NOF A;  4Z2U A;  4ML6 A;  4LL4 B;  2IMF A;  4YKG A;  2CX4 A;  1ZOF A;  4QL7 A;  4WEY A;  4I2T A;  5HFK A;  4F82 A;  16GS A;  4KAE A;  4AF2 A;  2DJ1 A;  2WZ9 A;  2Z9S A;  4DSR A;  1GUK A;  1LJR A;  3US3 A;  4MJA A;  1U3I A;  2HRF A;  4TR3 A;  4XHM A;  2L57 A;  5F06 A;  1X9W B;  2H70 A;  2LNS A;  5DBQ A;  1C72 A;  2IMK A;  3WGE A;  1GSD A;  2HFD A;  4BVX B;  1A24 A;  2A2P A;  2QC7 A;  3EYT A;  2RUF A;  2H1G A;  1YF1 A;  1J08 A;  1JZR A;  3LFL A;  4EIP A;  1XWG A;  4MH2 A;  4ICY A;  1KNG A;  2KHP A;  3UMA A;  1SYR A;  5IOX A;  4OO4 A;  3P8W A;  4EUY A;  1E2Y A;  2GST A;  4MP4 A;  1NM3 A;  2VAF A;  4BVX A;  1GTA A;  4XCS A;  4MJE A;  5E59 A;  4EDZ A;  5CYY A;  3Q18 A;  2X99 A;  3VWV A;  2DJ0 A;  5IMF A;  1AXD A;  4GQF A;  4EL1 A;  1KEB A;  3DML A;  1MTC A;  2JZS A;  3M3M A;  3LEF A;  1TU8 A;  1BQ7 A;  2REM A;  1U3A A;  2CAI A;  2NBS A;  4GSS A;  2WFC A;  2HZE B;  2IN3 A;  1KBN A;  2A4H A;  1F9M A;  2WB9 A;  4G0L A;  3RHC A;  2FCH A;  3TOT A;  1XWK A;  3UBL A;  2NDO A;  3QD9 A;  4I2U A;  1XBS A;  5D9W A;  4IS0 A;  2HRA A;  1OE8 A;  3TUE A;  1G0T A;  2CAQ A;  5IPH A;  1YY7 A;  2ALB A;  2HSH A;  1HNA A;  2HZE A;  1XWA A;  3EC3 A;  3WYW A;  5D9T A;  5KN2 A;  4MF5 A;  3KJY A;  1SEN A;  5CO3 A;  4PTS A;  3L9S A;  1GRX A;  1GSQ A;  3ZRD A;  1GLP A;  4YKF A;  2AAW A;  1JZO A;  4PX1 A;  4XS4 A;  5J5N A;  3EMX A;  2F8A A;  5H5Q A;  1DE2 A;  1GTB A;  1M2B A;  3ZL5 A;  2OA7 A;  1JFU A;  1Z6N A;  2FWH A;  4PGT A;  3TRQ A;  4IJ3 A;  1OC9 B;  3EPT A;  3LW9 A;  2OAC A;  6GSU A;  5DQS A;  5ABR A;  3FW2 A;  1K3O A;  1Y6E A;  22GS A;  4KDU A;  5HFI A;  2AJQ B;  1AW9 A;  1FB6 A;  3KMN A;  3MDK A;  2HZF A;  4XTS A;  3PH9 A;  3ZVJ D;  1V2A A;  3F6F A;  4KSM A;  2UZ8 A;  2YWN A;  4FYC A;  2L59 A;  2P31 A;  4GRF A;  1FB0 A;  3UAP A;  1OC9 A;  1PGT A;  4FQU A;  3QCP A;  4HQS A;  6GSS A;  1PSQ A;  1K0N A;  3TKS A;  4NMU A;  5G30 A;  3L9U A;  3KD0 A;  4CDO A;  1UC7 A;  1USB A;  4IP1 A;  4FIW A;  2TRX A;  2O89 A;  4ECC A;  5ID2 B;  2H1A A;  2FA8 A;  5IMA A;  4EIQ A;  2JL4 A;  1SU9 A;  2R37 A;  13GS A;  3VWU A;  2GQL A;  3N9J A;  4WXT A;  1H75 A;  1XWB A;  5A4U A;  4K7I A;  2OKA A;  5D9V A;  4O5Q A;  3CTF A;  2NTO A;  3QMX A;  3CTG A;  3ZZX A;  20GS A;  3HD5 A;  1GTI A;  1OKT A;  2K8S A;  2LS5 A;  1W89 A;  2QGV A;  2C4J A;  4J56 E;  4HU9 A;  2IMI A;  2B5Y A;  2H30 A;  3A5W A;  3FZA A;  1JZW A;  1SK0 A;  1G7O A;  2DBC A;  2WS2 A;  1I9D A;  3TRP A;  1KTE A;  5A4W A;  1AC1 A;  3FY7 A;  2FLS A;  2H19 A;  4WBJ A;  5DAL B;  5B8B A;  1BED A;  3RPP A;  3QDN A;  3RBT A;  4TRX A;  3M1G A;  3ZLP A;  2VM2 A;  1FW1 A;  4PQH A;  2F3M A;  4RUV A;  2VCX A;  3SWL A;  2B1K A;  2GS3 A;  3GTU B;  4N30 A;  3MAK A;  2OE3 A;  4KW6 A;  1GH2 A;  4G19 A;  2GSQ A;  2H71 A;  1XCC A;  1X9M B;  5ECO B;  11GS A;  4V2M A;  4ZIL A;  2CVK A;  5DJL A;  5ELG A;  1ST9 A;  3I9V 2;  1VF1 A;  2H1D A;  4POM A;  3FEU A;  5DAL A;  3D22 A;  1MD4 A;  2H0H A;  2GDR A;  1Z3E A;  5HR2 A;  4YH2 A;  3QAV A;  3IXR A;  2P0G A;  2XBQ A;  3HZ8 A;  3TJJ A;  1F3B A;  4ZB6 A;  1X5C A;  3Q19 A;  3GTU A;  3LYP A;  4F9Z A;  1GLQ A;  1WRY A;  2H0G A;  2HT9 A;  3R2Q A;  2EIQ A;  4X4J A;  12GS A;  2VIM A;  3HY2 A;  1R5P A;  1VF3 A;  4XIH A;  2H01 A;  2PU9 C;  3V1W A;  2B6M A;  2MMN A;  3FZ5 A;  2LJA A;  4PNF A;  5G2Z A;  1K0M A;  5CRH A;  4IP6 A;  2DJK A;  2E0Q A;  4J57 E;  4NV5 A;  3M8N A;  1FHE A;  4DEJ A;  2GLR A;  1EOH A;  3CMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...