4K9ZA

Crystal structure of a putative thiol-disulfide oxidoreductase from bacteroides vulgatus (target nysgrc-011676), space group p6222
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
141
Chain Sequence
ASKLLPGQPAIDFEMLDVEGNVKHLADFKGKVIYIDLWATWCGPCIQESPAFEALGKKYVGKDIVFLPVSTDTTTKPWLRYLDGHKKELTQYHSNDVALKESWAIMYIPRFILIDKDFNIVNAYAPRPSSEEIGTLIDSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative thiol-disulfide oxidoreductase
publication title Crystal structure of a putative thiol-disulfide oxidoreductase from Bacteroides vulgatus (target NYSGRC-011676), space group P6222
rcsb
source organism Bacteroides vulgatus
total genus 35
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2013-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4k9zA00
4XS4A 20GSA 2FY6A 4IVFA 4MZBA 5GAPD 2GT5A 2E2GA 2H70A 4HU7A 1V2AA 3GTUA 3L9UA 5ECLB 3G7YA 3SWLA 2K18A 3FR9A 4V2NA 4NAXA 4OFMA 4DSSB 2CVKA 1HNBA 2H71A 4HEA2 4TR0A 2IMEA 2Z9SA 1U87A 5HFIA 1YKAA 2GQMA 4NV2A 1EEJA 1TP9A 1BYEA 5ECIB 4JU5A 3UARA 2V1MA 3ERFA 3M8NA 2VLVA 5KN2A 3JCML 1VF2A 4RQXA 4WETA 5JCUA 3GKXA 3L9SA 4OD7A 1M2AA 3QAGA 5IO0A 4GF0A 3DXBA 2K8VA 5G2ZA 4MABA 3DD3A 4IW9A 1K0OA 4ML6A 3HVSA 3TUEA 3MAKA 4NPBA 3MDKA 3ZIVA 2YWMA 2H1BA 5D93A 1B9YC 1QQ2A 2CT6A 4XS4B 2G2QA 3HXSA 5IMFA 2EC4A 4MZCA 3FZAA 2MMNA 3WD6A 1PX7A 3F4RA 3U5RE 4MJBA 5ECPB 4OO5A 3UMAA 4D73A 4BA7A 1ST9A 4MK3A 1EGRA 4V2MA 2B1KA 3KM6A 2H0HA 2B5EA 4GRFA 2XBQA 3KH7A 2H1DA 1K3YA 1JZWA 2VCZA 3FRCA 5A4WA 3KTBA 3L78A 5B8BA 2CQ9A 3VI7A 2PUKC 4WF5A 5AIXA 1GULA 5DQSA 4K0GA 1ERVA 3D6IA 4N0ZA 4DVCA 4QQ7A 2H19A 2CAQA 4KAEA 1RK4A 3FW2A 2YPMA 3DVWA 4FYCA 5IMCA 2YWIA 1O85A 4MDCA 5HR1A 4JR6A 2H0IA 1TRVA 3F6DA 2ON7A 4NHZA 2VCVA 1ABAA 2XHFA 4F82A 2LKUA 5IO2A 5IMAA 1TI3A 5IOWA 2F51A 2KP1A 3I69A 1SJZA 1YDKA 5DCHA 3DVXA 4X43A 3KEBA 3MSZA 3OR5A 1U88A 3IR4A 1F6MC 3IPZA 3BJ5A 2VCXA 2D2ZA 1W4VA 5D9VA 5F05A 1XZOA 3WT1A 1GTUA 2H1AA 2RUEA 2ALBA 4HQSA 4MH2A 4EF0A 1T00A 4GLTA 5ECKB 2V32A 4XIHA 1AQVA 2GTUA 5B7CA 3FZ5A 1PGTA 3UBLA 3LQ7A 2A4VA 3HVVA 3CXGA 3IXRA 3EWLA 1EZKA 4X0XA 1K3LA 4FIWA 4IQ1A 2IMIA 4PQIA 2GDRA 3UBKA 3G7IA 5D9TA 1Z9HA 2O89A 3IE3A 1PSQA 2YV7A 2HT9A 2MMAA 4TKYA 2R6KA 4IELA 5CRDA 4KH7A 2HSHA 1Z7PA 3FZ4A 3UL3A 4QL7A 1EOGA 1SK2A 4WEYA 4WKWA 1T8EB 4KDXA 4LL4B 1KTEA 2FLSA 5EVOA 3TOUA 1F9MA 2P31A 4YAPA 3FY7A 4I2TA 1JHBA 2F3MA 3QD9A 3M9KA 3CMIA 5ECSA 3H79A 2AV4A 5E59A 5AGYA 2F9SA 5CRGA 1VF4A 3VPQA 2VM2A 2HE3A 1ML6A 2IN3A 5E4WA 3FR3A 2QC7A 5DALA 4IJ3A 1A8YA 4LMVA 3LWAA 2OA7A 6GSUA 3IV4A 2ON5A 3FKFA 2YANA 4MZWA 1S3DA 1YQ1A 4OMVA 4P3YB 1X9MB 2LNTA 1TU8A 3KXOA 4GQFA 1PA3A 4EE0A 1WMJA 1EOHA 3HA9A 1EV4A 4J57E 1HD2A 4L8EA 3KP8A 2JZRA 4IP1A 2OE1A 4BVYA 2B7KA 3TJGA 3KJYA 1M99A 3M9JA 4LA1A 4AGSA 1PD21 1OC9A 3ZFBA 2C4JA 1YF0A 1G7EA 2L4QA 2CZ3A 2LUSA 2C0DA 3VWWA 4TW5A 1OKDA 1XXUA 1ERTA 1MDKA 1XBSA 1K0NA 1Q4JA 2GSTA 2L59A 4AJ7A 2CV4A 3ERWA 5AISA 5CYYA 4TXOA 2C1YA 3CSJA 3TJFA 1GL8A 5GAND 2H6YA 5J5NA 1O73A 2WS2A 1G6WA 3CTFA 4PUFC 3GNJA 4V2LA 4K9ZA 3H8QA 1NHYA 1NHOA 2B5XA 2H30A 1KNGA 4BVXA 1TW9A 2LQQA 1N2AA 3P7XA 3GV1A 1I5GA 2IL3A 1MEKA 2M72A 4F0BA 5ECMB 1SU9A 3TRQA 2PGTA 1B48A 2X99A 5F8BA 1SL0B 1GUHA 2O87A 2B1LA 5DCGA 1YKCA 1IYIA 4EVMA 3WYWA 2XBIA 4ECJA 1GSFA 1YJ6A 2JU5A 3VFIA 3PGTA 1OC8A 1OYJA 5A4UA 3CRTA 3ZVJD 2IMDA 1FHEA 5L71A 5ELGA 5B6MA 2JACA 2YNXA 2PU9C 3KTLA 2BMXA 1JLVA 1B9XC 1C72A 2LEGA 2OBIA 1SD9A 3E0UA 13GSA 8GSSA 2QKEA 2XPDA 5KN0A 5J4UA 2RIIA 2GZYA 2OADA 3FEUA 2FWEA 2C0EA 3APQA 3GL3A 4MJCA 2C3NA 1QFNA 1QUWA 1PMTA 4KUNA 3CBUA 5EY6A 2O8VB 1AAZA 4G2EA 3TB2A 5LCZA 2IWTA 2K6VA 5G5FA 4RUVA 2H01A 3R2QA 4ECIA 2O85A 4I8BA 5ECRB 5HR3A 4MP4A 3A2VA 3EE2A 1T4YA 2E0QA 7GSSA 5IQYA 4PQHA 2VCWA 1XWBA 3BBYA 3UVHA 1TKDB 5G30A 3D22A 1WIKA 3F8UA 3FR6A 4HZ2A 1Z6NA 1QMVA 4JR4A 4BWQA 2GS3A 2P5RA 4TR1B 1AC1A 4F03A 1GUMA 4KE3A 2E7PA 3IAS2 3TDGA 3VWXA 2L57A 1VGLA 1URMA 4GSNA 4WF4A 3UAPA 1SYXA 4NHWA 4N11A 2DJ3A 10GSA 2VLTA 3WGXA 4O92A 2DIZA 3LORA 2WB9A 3C1SA 1GTBA 3GKKA 4KCEA 2C3QA 5G31A 4V1Ap 4TOPA 5GZZB 4POMA 1E6BA 2H75A 3DMLA 4WR4A 1T4ZA 5D9WA 2FHEA 4TR4A 1K0DA 3KCMA 1KEBA 4HQZA 3P2AA 1SKSB 4MF6A 3L4NA 2OACA 3UOMA 3QDNA 16GSA 1OKTA 2C0FA 4BL7A 3NZNA 4DEJA 1X0RA 4Q5RA 3PINA 5KN1A 1EEMA 2L6DA 2GSRA 2VO4A 2LSTA 4BPYA 1RQMA 2CVBA 4HZ4A 2IJYA 1JZOA 4NWYA 2DMMA 1TRUA 2C80A 2MBTA 3HJMA 3D21A 5B8AA 2ZCTA 4OO4A 5ABRA 3LEFA 4L0WA 2YJHA 4POLA 3ZITA 2DMLA 1LJRA 1WJKA 2CAIA 2EIOA 3TJJA 5EPFA 2VM1A 3BOAA 4ZB9A 2GZPA 6GSXA 2FWHA 2LRNA 3GA4A 3IOSA 2AUVA 4K8MA 4TVEA 3RHCA 2B7JA 1THXA 2DBCA 3TCOA 2AJQB 2LRTA 2REMA 1WE0A 3HJPA 5IMVA 5GSTA 2DJ2A 3IHQA 4IN0A 5JWRB 2N5FA 4Q5QA 4QL9A 4YQMA 4IP6A 1M9BA 3ME7A 3F4TA 1MTCA 3U6VA 2VL9A 1FW1A 1HQOA 1A2LA 3TKQA 1J0FA 1XOAA 1X9SB 1O8WA 3GX0A 4ZL9A 2H73A 1A24A 3GKMA 5D9XA 2IMKA 3TOTA 3IAM2 4V1Ag 4GSTA 3EMXA 4JRRA 3EVIA 2FNOA 1Q98A 1B8XA 3KZQA 1ON4A 3CSHA 2VLUA 4EKZA 2OJLA 1G6YA 1TI1A 2F8FA 2CX4A 1X5CA 2YZUA 3EYTA 3GL5A 3ZIJA 4POKA 2JADA 3D4TA 2F8AA 18GSA 2B6MA 4WR5A 1A2JA 4E8EA 3LYPA 1N8JA 22GSA 5AN1A 2YJ7A 2VCTA 1TK5B 3BCKA 4MPGA 3ZRDA 3MWHA 2GQLA 1GSQA 2VIMA 2OBKA 3F0IA 2FA8A 1WOUA 2GLRA 1FVKA 3D4MA 3A2WA 3DKSA 3GFKA 1GRXA 2X64A 1F3BA 2GQKA 1A0RP 4BWSA 5IPHA 4CHSA 2A2RA 3TKSC 2WFCA 2R2JA 5HR2A 4I5QA 2K8SA 3VURA 3VWVA 3FYGA 3D0ZA 1FB6A 1XW5A 1CQHA 1F3AA 3O6TA 4CDOA 1V58A 1K0CA 3QPMA 3ZMLA 1TU7A 5KEJA 4IGJA 4ZB6A 4WXTA 3VWUA 2AYTA 1WPIA 4ML1A 4XS1A 1K0MA 2X8GA 3ZFLA 1DUGA 2H74A 2C0GA 1XWCA 4J2FA 2DLXA 4TN8A 1TRSA 4ISDA 2YP6A 2XC2A 2LS5A 1PKZA 1R4WA 4KDUA 2L4CA 1PRXA 4Z7XA 1PL2A 1BEDA 2WJUA 3EURA 4TR3A 3CRUA 2VD1A 3PH9A 2DJ0A 5G5EA 1R5PA 3GMFA 2I81A 2V6OA 1UN2A 3ERGA 1E2YA 4FYUA 4L5LA 1HNCA 2B3SA 1X9WB 5C00A 1GLQA 3RDWA 2BTOT 1TK0B 1OE8A 3GH9A 1AIUA 1G0TA 4WBJA 1GSUA 4MA9A 2C8UA 2K9FA 2X8CA 5ECNB 2PMTA 5DAKB 5DJMA 2FA4A 5H5SA 2EIRA 2HFDA 1K0AA 2EIQA 3CYNA 2HSYA 5ID2B 4O5RA 2RM6A 4GSSA 2RUFA 3DRNA 3E3EA 2IFQB 4JBBA 1ERUA 3EMPA 2V41A 3ZVJA 2VOCA 1USBA 4K1FA 1BJXA 2NBSA 4PQ1A 3W8JA 2YN1A 4ZIJA 1MD4A 1TOFA 2LV3A 1A2MA 1KBNA 4EC0A 3F6FA 3J7Yk 1SD8A 2LRCA 2H6ZA 4K6XA 1FO5A 5ECQB 3W6GA 1SJIA 3GSSA 5J41A 1JZRA 4YH2A 1VF3A 4LL1B 4TRXA 1UVZA 3IDVA 17GSA 1PKWA 1ACVA 1XCCA 1FG4A 4ZBBA 5F07A 2VL2C 3HCZA 3APOA 2H1GA 4OCEA 4KSOA 3VI5A 1XW6A 1XFLA 1H4OA 3H4KA 5CNWA 3TKSA 4RI6A 1V98A 5IOXA 3LG6A 4NMUA 3G9BA 4XCSA 1G7OA 2G0FA 2BJXA 2NTOA 2ZNMA 5DBQA 4PXOA 2PERA 3GSTA 1XIYA 2PPTA 2CA8A 1SL2B 3A5WA 1VRSD 3LFLA 4TR1A 1TTZA 2C3TA 2IPAA 5CP1A 3H1NA 5FHIA 1HYUA 1OC3A 3GYKA 1T7PB 3O76A 1MDJA 4EUYA 3KH9A 1AW9A 2LJKA 3LSZA 1J08A 1EWXA 4MCUA 5ELAA 3WT2A 1ILOA 1B4PA 1GSSA 4N0VA 2GVPA 1X5DA 4KX4A 4FYBA 2I1UA 3O3TA 2OKAA 4H86A 3QOUA 1K0BA 1X5EA 2HZEA 1OAZA 1H75A 4ULXA 4DSQA 4X1UA 3VLNA 3Q74A 2R4VA 1M2DA 1PL1A 3HHVA 3LXTA 5JCGA 1YY7A 3HD5A 5J9CA 4JZQA 3HVXA 1TK8B 1FOVA 1U6TA 4G9HA 3C7MA 5IIZA 1GH2A 2PWJA 4N30A 4GXZA 1M2BA 4ZILA 2ES7A 3KP9A 1Y6EA 4J56E 5ENUA 3TKSE 3F3RA 1DE2A 2YOIA 1PQNA 2KLXA 4YQUA 1MD3A 1B4QA 5JWQB 3N5OA 3C73A 3ZL5A 3K8NA 4IKHA 4PURA 4EO3A 3BD2A 3KMOA 1XWGA 2TRCP 4L0UA 4KNDA 2TRXA 1GSYA 3QMXA 5D96A 2DJJA 2GSSA 4Q5FA 2PN8A 1J9BA 5IPGA 4DSRA 3J7Yb 4OCFA 4MF7A 2MMOA 2HZEB 3UJ1A 5IM9A 1XW9A 4PX1A 2YWNA 2R3XA 2YV9A 1XWAA 3LXZA 5H5RA 2JL4A 5FWGA 2HZFA 3RBTA 14GSA 1EP8A 1LU4A 2E2MA 2YZHA 4ZBAA 1AXDA 2VL2A 4F9ZA 4EL1A 1O7UA 2FWFA 4GQCA 4K7IA 2J9HA 3C8EA 3PR8A 1Y25A 2CX3A 4LLRA 5H5QA 2H72A 4G19A 2H6XA 2JSYA 4ILFA 3IA1A 4XHMA 2GSQA 4PNFA 3KIJA 3KD0A 4IBPA 1GTAA 1U3AA 4GWRA 3C71A 1FVJA 3Q18A 2PVQA 5GSSA 4PUAA 2FGXA 3I43A 4IQAA 2X8HA 3QCPA 3DWVA 2LQOA 3QR6A 4IS0A 1GSDA 1QGVA 2J23A 4O7HA 1GWCA 3TGZA 3ZMKA 4KSMA 1A8LA 3F9UA 1JZDA 3W8SA 4PGTA 4OWYA 4ZL7A 2MBSA 5J9BA 4TXVA 1BG5A 2DJKA 1IYHA 3GTUB 3M3MA 2LTKA 1ZCPA 5CRHA 4K0NA 4KB3A 6GSVA 2RLIA 2KOKA 1ZL9A 2I9HA 1F37A 1WRYA 3I9V2 3NOFA 4KDYA 4O32A 3A3TA 2FUG2 1VF1A 2WDUA 3TJBA 1DSBA 3UVTA 1GNWA 1S3CA 4MMMA 4AF2A 3SBCA 3L0HA 4ACSA 3N9JA 3VPTA 2IIYA 4MF5A 1ZGNA 3IK7A 3G7JA 3L9VA 1OE7A 5LD0A 5HQPA 1SL1B 2PVOC 3ISOA 1AQXA 1DBYA 3GKNA 3US3A 4FH8A 1QXHA 3ZTLA 5JCWA 3RAZA 1XOBA 3CTGA 6GSWA 2R5GA 5COHA 2VD0A 1GLPA 4PNGA 3DIEA 1AQWA 2I3YA 5DQYA 2WCIA 1NM3A 1OVNA 5D8IA 4HUAA 3Q19A 4HS1A 4AJ6A 2H0GA 1SJ6A 6GSTA 5G1LA 3GHAA 1UA5A 4GCIA 3ZREA 5JWOB 4D73B 5CREA 3ZZXA 1Z7RA 3C1RA 1HNAA 2H8LA 4XTSA 5CO3A 1R5AA 3IRAA 1R7HA 3QAWA 4JEDA 4KCAA 5HFKA 4XRDA 1FB0A 1XPVA 1BX9A 2R37A 3GN3A 3MNGA 1XVWA 1TXXA 2B5YA 4HDEA 1WP0A 3WGEA 4ZBDA 5DAKA 3LGCA 5HR0A 2HNLA 3GH6A 5A5KA 5ID2A 1LBKA 3VK9A 5J3RA 4LMWA 4HJ2A 5EL8A 2IFQA 2MZCA 1Z5YE 4ECBA 1YEPA 1A0FA 1GNEA 1BQ7A 3H93A 4FO5A 1YEXA 6GSSA 1ZYEA 3HDCA 3A2XA 2L5LA 2CVDA 4KW6A 3UEMA 2H76A 3KGKA 1T3BA 5DVBA 5F0GA 4EDZA 3EC3A 2HRNA 2DSAA 2HRFA 3NIVA 4WBRD 3ED3A 1O8XA 1V9WA 2A2SA 2MYGA 2WZ9A 1QK8A 2JZTA 4XRAA 2I4AA 4CW9A 3HJOA 1EGOA 1YF1A 4I97A 2AB6A 9GSSA 5F06A 3IC4A 2V2GA 3F3QA 3ZLPA 3V1WA 1F2EA 3GIXA 3CSIA 3HKRA 3HZ4A 1M0UA 3F4SA 3EU3A 3DEXA 1UC7A 1BAYA 1XWKA 5INYA 1T1VA 2KHPA 3TJKA 4EDYA 4L5OA 1M7TA 2PBJA 3WGDA 2KUCA 2CZ2A 2HXKA 5D73A 3KMNA 4HU9A 4AJ8A 1TJDA 4XS6A 3QFBC 4ID0A 3TRPA 1V57A 2LJAA 4MH3A 3APSA 3FHKA 1NSWA 4ZL8A 5A4VA 1U3IA 2WRTA 1A23A 2LNSA 2NPBA 3IBHA 1I9DA 2O7KA 1XVQA 5B6NA 3DYRA 2WULA 2P5QA 2RM5A 2YCDA 4K7OA 2IMFA 3FK8A 2FD3A 4EXJA 3DGQA 1EP7A 1Z3EA 2ZUPA 5ECHB 4F2IA 5CRWA 3RHBA 2M46A 2KP2A 5DDLA 12GSA 3LYKA 5FT3A 5DALB 4I6XA 2FWGA 3BCIA 4ZB8A 2VCQA 3GURA 2L5OA 2OE0A 4YQVA 4NXIA 1SK1A 2H66A 3AY8A 1YZXA 11GSA 4Q5NA 2MMZA 2LJRA 1CQGA 5G1KA 6GSYA 3M1GA 4HJMA 3TKPA 2NVLA 4JE1A 3S9FA 1GUKA 2TIRA 3I6AA 2FCHA 4IHUA 4I2UA 4GTUA 1RW1A 4E8HA 2AAWA 5AIVA 2XPEA 2DC5A 3EINA 5ECOB 4POBA 1ZYQB 4RQRA 2P0GA 2M80A 1V40A 3GUSA 3P90A 2N5AA 1OC9B 5IMDA 5HFGA 3F63A 2JZSA 4K7NA 2GT6A 2GZZA 1O6JA 2VL3A 1GSEA 2L6CA 1THOA 3RPNA 2HYXA 2N5BA 3GX8A 2V6KA 4F0CA 1NW2A 1SK0A 1FAAA 5LNKe 1PN9A 3M0FA 4KA0A 3GRXA 1EV9A 3ZYWA 1ZZYA 3IK9A 4TXOB 3ME8A 1JLWA 1TRWA 4ZXGA 2NDOA 3EU4A 4NV5A 3QFAC 3P8WA 4N10A 2GGTA 5C04A 3TKRA 5DJLA 1DE1A 3Q6OA 3D5JA 2AHEA 4K2DA 3LJRA 4DSSA 1SKWB 3QAVA 1ZMAA 1SENA 2OE3A 4MJAA 1SYRA 2WGRA 1Z6MA 3HYPA 4G10A 1PX6A 1GTIA 2YWOA 2VAFA 1M9AA 3HY2A 1WWJA 5IMZA 3HZ8A 4MJEA 1GP1A 5CAXA 4OFNA 3E9JB 4IJIA 4HOJA 1AUCA 1SKRB 1O81A 4ECCA 1JFUA 4MPFA 1S3AA 2HLSA 2VUPA 4OFTA 2DIYA 3TRXA 4RI7A 1MDIA 1R26A 1K3OA 1W89A 2HI7A 2QGVA 4HI7A 4MLYA 3RPPA 4KGIA 1ERWA 4YAVA 2JSZA 2QSIA 3FZ9A 3UIWA 2DJ1A 19GSA 1TDIA 1ZOFA 5KN3A
chains in the Genus database with same CATH superfamily
4XS4A 20GSA 2FY6A 4IVFA 4MZBA 5GAPD 2GT5A 2E2GA 2H70A 4HU7A 1V2AA 3GTUA 3L9UA 5ECLB 3G7YA 3SWLA 2K18A 3FR9A 4V2NA 4NAXA 4OFMA 2QA2A 4DSSB 2CVKA 1HNBA 5BRTA 2H71A 4HEA2 4TR0A 2IMEA 2Z9SA 1U87A 5HFIA 1YKAA 2GQMA 4NV2A 1EEJA 1TP9A 1BYEA 5ECIB 4JU5A 3UARA 2V1MA 3FMWA 3ERFA 3M8NA 2VLVA 5KN2A 3JCML 1VF2A 4RQXA 4WETA 5JCUA 3GKXA 3L9SA 4OD7A 1M2AA 1PN0A 3QAGA 5IO0A 4GF0A 3DXBA 2K8VA 5G2ZA 4MABA 3DD3A 4IW9A 1K0OA 4ML6A 3HVSA 3TUEA 3MAKA 4NPBA 3MDKA 3ZIVA 2YWMA 2H1BA 5D93A 1B9YC 1QQ2A 2CT6A 4XS4B 2G2QA 3HXSA 5IMFA 2EC4A 4MZCA 3FZAA 2MMNA 3WD6A 1PX7A 3F4RA 3U5RE 4MJBA 5ECPB 4OO5A 3UMAA 4D73A 4BA7A 1ST9A 4MK3A 1EGRA 4V2MA 2B1KA 3KM6A 2H0HA 2B5EA 5BMUA 4GRFA 2XBQA 3KH7A 2H1DA 1K3YA 1JZWA 2VCZA 3FRCA 5A4WA 3KTBA 3L78A 5B8BA 2CQ9A 3VI7A 2PUKC 4WF5A 5AIXA 1GULA 5DQSA 4BL7B 4K0GA 1ERVA 3D6IA 4N0ZA 4DVCA 4QQ7A 2H19A 2CAQA 4KAEA 1RK4A 3FW2A 2YPMA 3DVWA 4FYCA 5IMCA 2YWIA 1O85A 4MDCA 5HR1A 4JR6A 2H0IA 1TRVA 3F6DA 2ON7A 4NHZA 2VCVA 1ABAA 2XHFA 4F82A 2LKUA 5IO2A 5IMAA 1TI3A 5IOWA 2F51A 2KP1A 3I69A 1SJZA 1YDKA 5DCHA 3DVXA 4X43A 3KEBA 3MSZA 3OR5A 1U88A 3IR4A 1F6MC 3IPZA 3BJ5A 2VCXA 2D2ZA 1W4VA 5D9VA 5F05A 1XZOA 4YKFA 3WT1A 5KOWA 1GTUA 2H1AA 2RUEA 2ALBA 2A4HA 4HQSA 4MH2A 4EF0A 1T00A 4GLTA 5ECKB 2V32A 4XIHA 1AQVA 2GTUA 5B7CA 3FZ5A 1PGTA 3UBLA 3LQ7A 2A4VA 3HVVA 3CXGA 3IXRA 3EWLA 1EZKA 4X0XA 1K3LA 4FIWA 4IQ1A 2IMIA 4PQIA 2GDRA 3UBKA 3G7IA 2R0CA 5D9TA 1Z9HA 2O89A 3IE3A 1PSQA 2YV7A 2HT9A 2MMAA 4TKYA 2R6KA 4IELA 5CRDA 4KH7A 2HSHA 1Z7PA 3FZ4A 3UL3A 4QL7A 1EOGA 1SK2A 4WEYA 4WKWA 1T8EB 4KDXA 4LL4B 1KTEA 2FLSA 5EVOA 3TOUA 1F9MA 2P31A 4YAPA 3FY7A 4I2TA 2UZ8A 1JHBA 2F3MA 3QD9A 3M9KA 3CMIA 5ECSA 3H79A 2AV4A 5E59A 5AGYA 2F9SA 5CRGA 1VF4A 3VPQA 2VM2A 2HE3A 1ML6A 2IN3A 5E4WA 3FR3A 2QC7A 5DALA 4IJ3A 1A8YA 4LMVA 1ZYPA 3LWAA 2OA7A 6GSUA 3IV4A 2ON5A 3FKFA 2YANA 4MZWA 1S3DA 1YQ1A 4CY8A 4OMVA 4P3YB 1X9MB 2LNTA 1TU8A 3KXOA 4K2XA 4GQFA 1PA3A 4EE0A 1WMJA 1EOHA 3HA9A 1EV4A 4J57E 1HD2A 4USSA 4L8EA 3KP8A 2JZRA 4IP1A 2OE1A 4BVYA 2B7KA 3TJGA 3KJYA 1M99A 3M9JA 4LA1A 4AGSA 1PD21 1OC9A 3ZFBA 2C4JA 1YF0A 1G7EA 2L4QA 2CZ3A 2LUSA 2C0DA 3VWWA 4TW5A 1OKDA 1XXUA 1ERTA 1MDKA 1XBSA 1K0NA 1Q4JA 2GSTA 2L59A 4AJ7A 2CV4A 3ERWA 5AISA 5CYYA 4TXOA 2C1YA 3CSJA 3TJFA 1GL8A 5GAND 2H6YA 5J5NA 1O73A 2WS2A 1G6WA 3CTFA 4PUFC 3GNJA 4V2LA 4K9ZA 3H8QA 1NHYA 1NHOA 2B5XA 2H30A 1KNGA 4BVXA 1TW9A 2LQQA 1N2AA 3P7XA 3GV1A 1I5GA 2IL3A 1MEKA 2M72A 4F0BA 5ECMB 1SU9A 3TRQA 2PGTA 1B48A 2X99A 5F8BA 4BVYB 1SL0B 1GUHA 2O87A 2B1LA 5DCGA 1YKCA 1IYIA 4EVMA 3WYWA 2XBIA 4ECJA 1GSFA 1YJ6A 2JU5A 3VFIA 3PGTA 1OC8A 1OYJA 5A4UA 3CRTA 3ZVJD 2IMDA 1FHEA 5L71A 5ELGA 5B6MA 2JACA 2YNXA 2PU9C 3KTLA 2BMXA 1JLVA 1B9XC 1C72A 2LEGA 2OBIA 1SD9A 4MNNA 2HRKA 3E0UA 13GSA 8GSSA 2QKEA 2XPDA 5KN0A 5J4UA 2RIIA 2GZYA 2OADA 3FEUA 2FWEA 2C0EA 4HSCX 4ICYA 3APQA 3GL3A 4MJCA 2C3NA 1QFNA 1QUWA 1PMTA 2DKIA 4KUNA 4FQUA 3CBUA 5EY6A 2O8VB 1AAZA 4G2EA 3TB2A 3A5IA 5LCZA 2IWTA 2K6VA 5G5FA 4RUVA 2H01A 3R2QA 4ECIA 2O85A 4I8BA 5ECRB 5HR3A 4MP4A 3A2VA 3EE2A 1T4YA 2E0QA 7GSSA 5IQYA 4PQHA 2VCWA 1XWBA 3BBYA 3UVHA 3HVNA 1TKDB 5G30A 3D22A 1WIKA 3F8UA 3FR6A 4HZ2A 1Z6NA 1QMVA 4JR4A 4BWQA 2GS3A 2P5RA 4TR1B 1AC1A 2R0GA 4F03A 1GUMA 4KE3A 2E7PA 3IAS2 3TDGA 3VWXA 2L57A 1VGLA 1URMA 4GSNA 4WF4A 3UAPA 1SYXA 4NHWA 4N11A 2DJ3A 10GSA 2VLTA 3WGXA 4O92A 2DIZA 3LORA 2WB9A 3C1SA 1GTBA 3GKKA 4KCEA 2C3QA 5G31A 4V1Ap 4TOPA 5GZZB 4POMA 1E6BA 2H75A 3DMLA 4WR4A 1T4ZA 5D9WA 2FHEA 4TR4A 1K0DA 3KCMA 1KEBA 4HQZA 3P2AA 1SKSB 4MF6A 3L4NA 2OACA 3UOMA 3QDNA 16GSA 1OKTA 2C0FA 4BL7A 3NZNA 4DEJA 1X0RA 4Q5RA 3PINA 5KN1A 1EEMA 2L6DA 2GSRA 2VO4A 2LSTA 4BPYA 1RQMA 2CVBA 4HZ4A 4KF9A 2IJYA 1JZOA 4NWYA 2DMMA 1TRUA 2C80A 2MBTA 3HJMA 3D21A 5B8AA 4EIPA 2ZCTA 4OO4A 5ABRA 3LEFA 4L0WA 2YJHA 4POLA 3ZITA 2DMLA 4K5SA 1LJRA 1WJKA 2CAIA 2EIOA 3TJJA 5EPFA 2VM1A 3BOAA 4ZB9A 2GZPA 6GSXA 2FWHA 2LRNA 3GA4A 3IOSA 2AUVA 4K8MA 4TVEA 3RHCA 2B7JA 1THXA 2DBCA 3TCOA 5KOXA 2AJQB 2LRTA 2REMA 1WE0A 3HJPA 5IMVA 5GSTA 2DJ2A 3IHQA 4IN0A 5JWRB 2N5FA 4Q5QA 4QL9A 4YQMA 4IP6A 1M9BA 3ME7A 3F4TA 1MTCA 3U6VA 2VL9A 1FW1A 1HQOA 1A2LA 3TKQA 1J0FA 1XOAA 1X9SB 1O8WA 3GX0A 4ZL9A 2H73A 1A24A 3GKMA 5D9XA 3LW9A 2IMKA 3TOTA 3IAM2 4V1Ag 4GSTA 3EMXA 4JRRA 3EVIA 2FNOA 1Q98A 1B8XA 3KZQA 1ON4A 3CSHA 2VLUA 3MIXA 4EKZA 2OJLA 1G6YA 1TI1A 2F8FA 2CX4A 1X5CA 2YZUA 3EYTA 2DKHA 3GL5A 3ZIJA 4POKA 2JADA 3D4TA 2F8AA 18GSA 2B6MA 4WR5A 1A2JA 4E8EA 3LYPA 1N8JA 22GSA 2YJ7A 5AN1A 2VCTA 1TK5B 3BCKA 4MPGA 3ZRDA 3MWHA 2GQLA 1GSQA 2VIMA 2OBKA 3F0IA 2FA8A 1WOUA 2GLRA 1FVKA 3D4MA 3A2WA 3DKSA 3GFKA 1GRXA 2X64A 1F3BA 2GQKA 1A0RP 4BWSA 5IPHA 4CHSA 2A2RA 3TKSC 2WFCA 2R2JA 5HR2A 4I5QA 2K8SA 3VURA 3VWVA 3FYGA 3D0ZA 1FB6A 1XW5A 1CQHA 1F3AA 3O6TA 4CDOA 1V58A 1K0CA 3QPMA 3ZMLA 1TU7A 5KEJA 4IGJA 4ZB6A 4WXTA 3VWUA 2AYTA 1WPIA 4ML1A 4XS1A 1K0MA 2X8GA 3ZFLA 1DUGA 2H74A 3R3EA 2C0GA 1XWCA 4J2FA 2DLXA 4TN8A 4PTSA 1TRSA 4ISDA 2YP6A 2XC2A 2LS5A 1PKZA 1R4WA 4KDUA 2L4CA 1PRXA 4Z7XA 1PL2A 1BEDA 2WJUA 3EURA 4TR3A 3CRUA 2VD1A 3PH9A 2DJ0A 5G5EA 1R5PA 3GMFA 2I81A 2V6OA 1UN2A 3ERGA 1E2YA 4FYUA 4L5LA 1HNCA 2B3SA 1X9WB 5C00A 1GLQA 3RDWA 2BTOT 1TK0B 1OE8A 3GH9A 1AIUA 1G0TA 4WBJA 1GSUA 4MA9A 2C8UA 2K9FA 2X8CA 5ECNB 2PMTA 5DAKB 5DJMA 2FA4A 5H5SA 2EIRA 2HFDA 1K0AA 2EIQA 3CYNA 2HSYA 5ID2B 4O5RA 2RM6A 4GSSA 2RUFA 3DRNA 3E3EA 2IFQB 4JBBA 1ERUA 3EMPA 2V41A 3ZVJA 2VOCA 4EIQA 1USBA 4K1FA 1BJXA 2NBSA 4PQ1A 3W8JA 2YN1A 4ZIJA 1MD4A 1TOFA 2LV3A 1A2MA 1KBNA 4EC0A 3F6FA 3J7Yk 1SD8A 2LRCA 2H6ZA 4K6XA 1FO5A 5ECQB 3W6GA 1SJIA 3GSSA 5J41A 1JZRA 4YH2A 1VF3A 4LL1B 4TRXA 1UVZA 3IDVA 17GSA 1PKWA 1ACVA 1XCCA 1FG4A 2HSMA 1XG8A 4ZBBA 5F07A 2VL2C 3HCZA 3APOA 2H1GA 4OCEA 4KSOA 3VI5A 1XW6A 1XFLA 1ZYNA 1H4OA 2X49A 3H4KA 5CNWA 3TKSA 4CY6A 4RI6A 1V98A 5IOXA 3LG6A 4NMUA 3G9BA 4XCSA 1G7OA 2G0FA 2BJXA 2NTOA 3IHGA 2ZNMA 5DBQA 4PXOA 2PERA 3GSTA 1XIYA 2PPTA 2CA8A 1SL2B 3A5WA 1VRSD 3LFLA 4TR1A 1TTZA 2C3TA 2IPAA 5CP1A 3H1NA 5FHIA 1HYUA 1OC3A 3GYKA 1T7PB 3O76A 1MDJA 4EUYA 3KH9A 1AW9A 2HRAA 2LJKA 1S3RA 3LSZA 1J08A 1EWXA 4MCUA 5ELAA 3WT2A 1ILOA 1B4PA 1GSSA 4N0VA 2GVPA 1X5DA 3IC8A 4KX4A 4FYBA 2I1UA 3O3TA 2OKAA 4H86A 3QOUA 1K0BA 1X5EA 2HZEA 1OAZA 1H75A 4ULXA 4DSQA 4X1UA 3VLNA 3Q74A 2R4VA 1M2DA 1PL1A 3HHVA 3LXTA 5JCGA 1YY7A 3HD5A 5J9CA 4JZQA 3HVXA 1TK8B 1FOVA 2QA1A 1U6TA 4G9HA 3C7MA 5IIZA 1GH2A 2PWJA 4N30A 4GXZA 1M2BA 4ZILA 2ES7A 3KP9A 4Z2RA 1Y6EA 4J56E 5ENUA 3TKSE 3F3RA 1DE2A 2YOIA 1PQNA 2KLXA 4YQUA 1MD3A 1B4QA 4G0KA 5JWQB 3N5OA 3C73A 3ZL5A 3K8NA 4IKHA 4PURA 4EO3A 3BD2A 3KMOA 1XWGA 2TRCP 4L0UA 4KNDA 2TRXA 1GSYA 3QMXA 5D96A 2DJJA 2GSSA 4Q5FA 2PN8A 1J9BA 5IPGA 4DSRA 3J7Yb 3EPTA 4OCFA 4MF7A 2MMOA 2HZEB 3UJ1A 5IM9A 1XW9A 4PX1A 2YWNA 2R3XA 2YV9A 1XWAA 3LXZA 5H5RA 2JL4A 5FWGA 2HZFA 3RBTA 14GSA 1EP8A 1LU4A 2E2MA 2YZHA 4ZBAA 1AXDA 2VL2A 4F9ZA 4EL1A 1O7UA 2FWFA 4GQCA 4K7IA 2J9HA 3C8EA 3PR8A 1Y25A 2CX3A 4LLRA 5H5QA 2H72A 4G19A 2H6XA 2JSYA 4ILFA 3IA1A 4XHMA 2GSQA 4PNFA 3KIJA 3KD0A 4IBPA 1GTAA 1U3AA 4GWRA 3C71A 1FVJA 3Q18A 2PVQA 5GSSA 4PUAA 2FGXA 3I43A 4IQAA 2X8HA 3QCPA 3DWVA 2LQOA 3QR6A 4IS0A 1GSDA 4BIKA 1QGVA 2J23A 2R0PA 4O7HA 1GWCA 3TGZA 3ZMKA 4KSMA 1A8LA 3F9UA 1JZDA 3W8SA 4PGTA 4OWYA 4ZL7A 2MBSA 5J9BA 4YKGA 4TXVA 1BG5A 2DJKA 1IYHA 3GTUB 3M3MA 2LTKA 1ZCPA 5CRHA 4K0NA 4KB3A 6GSVA 2RLIA 2KOKA 1ZL9A 2I9HA 1F37A 1WRYA 1PFOA 3I9V2 3NOFA 4KDYA 4O32A 3A3TA 2FUG2 1VF1A 2WDUA 3TJBA 1DSBA 3UVTA 1GNWA 1S3CA 4G0IA 4MMMA 4AF2A 3SBCA 3L0HA 4ACSA 3N9JA 3VPTA 2IIYA 4MF5A 1ZGNA 3IK7A 3G7JA 3PPUA 3L9VA 1OE7A 5LD0A 5HQPA 1SL1B 2PVOC 3ISOA 1AQXA 1DBYA 3GKNA 3US3A 4FH8A 1QXHA 3ZTLA 5JCWA 3RAZA 1XOBA 3CTGA 6GSWA 2R5GA 5COHA 2VD0A 1GLPA 4PNGA 3DIEA 1AQWA 2I3YA 5DQYA 2WCIA 1NM3A 1OVNA 5D8IA 4HUAA 3Q19A 4HS1A 4AJ6A 2H0GA 4O5QA 1SJ6A 6GSTA 5G1LA 3GHAA 1UA5A 4GCIA 3ZREA 5JWOB 4D73B 5CREA 3ZZXA 1Z7RA 3C1RA 4Z2UA 1HNAA 2H8LA 4XTSA 5CO3A 1R5AA 3IRAA 1R7HA 3QAWA 4JEDA 4KCAA 5HFKA 4XRDA 1FB0A 1XPVA 1BX9A 2R37A 3GN3A 3MNGA 1XVWA 1TXXA 2B5YA 4HDEA 1WP0A 2X4AA 3WGEA 4ZBDA 5DAKA 3LGCA 5HR0A 2HNLA 3GH6A 5A5KA 5ID2A 1LBKA 3VK9A 5J3RA 4LMWA 4HJ2A 5EL8A 2IFQA 2MZCA 1Z5YE 4ECBA 1YEPA 1A0FA 1GNEA 1BQ7A 3H93A 4FO5A 1YEXA 6GSSA 1ZYEA 3HDCA 3A2XA 2L5LA 2CVDA 1M3JA 4KW6A 3UEMA 2H76A 3KGKA 1T3BA 5DVBA 5F0GA 4EDZA 3EC3A 2HRNA 2DSAA 2HRFA 3NIVA 4WBRD 3ED3A 1O8XA 1V9WA 2A2SA 2MYGA 2WZ9A 1QK8A 4X4JA 2JZTA 4XRAA 2I4AA 4CW9A 3HJOA 1EGOA 1YF1A 4I97A 2AB6A 9GSSA 5F06A 3IC4A 2V2GA 3F3QA 4G0LA 3V1WA 3ZLPA 1F2EA 3GIXA 3CSIA 3HKRA 3HZ4A 1M0UA 3F4SA 3EU3A 3DEXA 1UC7A 1BAYA 1XWKA 5INYA 1T1VA 2KHPA 3TJKA 4EDYA 4L5OA 1M7TA 2PBJA 3WGDA 2KUCA 2CZ2A 2HXKA 5D73A 3KMNA 4HU9A 4AJ8A 1TJDA 4XS6A 3QFBC 4ID0A 3TRPA 1V57A 2LJAA 4MH3A 3APSA 3FHKA 1NSWA 4ZL8A 5A4VA 1U3IA 2WRTA 1A23A 3CQFA 2LNSA 2NPBA 3IBHA 4K5RA 1I9DA 2O7KA 1XVQA 5B6NA 3DYRA 2WULA 2P5QA 2RM5A 2YCDA 4K7OA 2IMFA 3FK8A 2FD3A 4EXJA 3DGQA 1EP7A 1Z3EA 2ZUPA 5ECHB 4F2IA 5CRWA 3RHBA 2M46A 2KP2A 5DDLA 12GSA 3LYKA 5FT3A 3MYDA 5DALB 4I6XA 2FWGA 3BCIA 4ZB8A 2VCQA 3GURA 2L5OA 2OE0A 4YQVA 4NXIA 1SK1A 2H66A 3AY8A 1YZXA 11GSA 4Q5NA 2MMZA 2LJRA 1CQGA 4Z2TA 5G1KA 6GSYA 3M1GA 4HJMA 3TKPA 2NVLA 4JE1A 3S9FA 1GUKA 2TIRA 3I6AA 2FCHA 4IHUA 4I2UA 4GTUA 1RW1A 4E8HA 2AAWA 5AIVA 2XPEA 2DC5A 3EINA 5ECOB 4POBA 1ZYQB 4RQRA 2P0GA 2M80A 1V40A 3GUSA 3P90A 1M3IA 2N5AA 1OC9B 5IMDA 5HFGA 3F63A 2JZSA 4K7NA 2GT6A 2GZZA 1O6JA 2VL3A 1GSEA 2L6CA 1THOA 3RPNA 2HYXA 2N5BA 3GX8A 2V6KA 4F0CA 1NW2A 1SK0A 1FAAA 5LNKe 1PN9A 3M0FA 4KA0A 3GRXA 1EV9A 3ZYWA 1ZZYA 3IK9A 4TXOB 3ME8A 1JLWA 1TRWA 4ZXGA 2NDOA 3EU4A 4NV5A 3QFAC 3P8WA 1FOHA 4N10A 2GGTA 5C04A 3TKRA 5DJLA 1DE1A 3Q6OA 3D5JA 2A2PA 2AHEA 4K2DA 3LJRA 4DSSA 1SKWB 3QAVA 4BVXB 1ZMAA 1SENA 2OE3A 4MJAA 1SYRA 2WGRA 1Z6MA 3HYPA 4G10A 1PX6A 1GTIA 2YWOA 2VAFA 4A5PA 1M9AA 4O5UA 3HY2A 1WWJA 5IMZA 3HZ8A 4MJEA 1GP1A 5CAXA 4OFNA 3E9JB 4IJIA 4HOJA 1AUCA 1SKRB 1O81A 4ECCA 1JFUA 4MPFA 1S3AA 2HLSA 2VUPA 4OFTA 2DIYA 3TRXA 4RI7A 1MDIA 1R26A 1K3OA 1W89A 2HI7A 2QGVA 4HI7A 4MLYA 3RPPA 4KGIA 1ERWA 4YAVA 2JSZA 2QSIA 3FZ9A 3UIWA 2DJ1A 19GSA 1TDIA 1ZOFA 5KN3A
chains in the Genus database with same CATH topology
4XS4A 20GSA 2FY6A 4IVFA 4MZBA 5GAPD 2GT5A 2E2GA 2H70A 4HU7A 1V2AA 3GTUA 3L9UA 5ECLB 3G7YA 3SWLA 2K18A 3FR9A 4V2NA 4NAXA 4OFMA 2QA2A 4DSSB 2CVKA 1HNBA 5BRTA 2H71A 4HEA2 4TR0A 2IMEA 2Z9SA 1U87A 5HFIA 1YKAA 2GQMA 4NV2A 1EEJA 1TP9A 1BYEA 5ECIB 4JU5A 3UARA 2V1MA 3FMWA 3ERFA 3M8NA 2VLVA 5KN2A 3JCML 1VF2A 4RQXA 4WETA 5JCUA 3GKXA 3L9SA 4OD7A 1M2AA 1PN0A 3QAGA 5IO0A 4GF0A 3DXBA 2K8VA 5G2ZA 4MABA 3DD3A 4IW9A 1K0OA 4ML6A 3HVSA 3TUEA 3MAKA 4NPBA 3MDKA 3ZIVA 2YWMA 2H1BA 5D93A 1B9YC 1QQ2A 2CT6A 4XS4B 2G2QA 3HXSA 5IMFA 2EC4A 4MZCA 3FZAA 2MMNA 3WD6A 1PX7A 3F4RA 3U5RE 4MJBA 5ECPB 4OO5A 3UMAA 4D73A 4BA7A 1ST9A 4MK3A 1EGRA 4V2MA 2B1KA 3KM6A 2H0HA 2B5EA 5BMUA 4GRFA 2XBQA 3KH7A 2H1DA 1K3YA 1JZWA 2VCZA 3FRCA 5A4WA 3KTBA 3L78A 5B8BA 2CQ9A 3VI7A 2PUKC 4WF5A 5AIXA 1GULA 5DQSA 4BL7B 4K0GA 1ERVA 3D6IA 4N0ZA 4DVCA 4QQ7A 2H19A 2CAQA 4KAEA 1RK4A 3FW2A 2YPMA 3DVWA 4FYCA 5IMCA 2YWIA 1O85A 4MDCA 5HR1A 4JR6A 2H0IA 1TRVA 3F6DA 2ON7A 4NHZA 2VCVA 1ABAA 2XHFA 4F82A 2LKUA 5IO2A 5IMAA 1TI3A 5IOWA 2F51A 2KP1A 3I69A 1SJZA 1YDKA 5DCHA 3DVXA 4X43A 3KEBA 3MSZA 3OR5A 1U88A 3IR4A 1F6MC 3IPZA 3BJ5A 2VCXA 2D2ZA 1W4VA 5D9VA 5F05A 1XZOA 4YKFA 3WT1A 5KOWA 1GTUA 2H1AA 2RUEA 2ALBA 2A4HA 4HQSA 4MH2A 4EF0A 1T00A 4GLTA 5ECKB 2V32A 4XIHA 1AQVA 2GTUA 5B7CA 3FZ5A 1PGTA 3UBLA 3LQ7A 2A4VA 3HVVA 3CXGA 3IXRA 3EWLA 1EZKA 4X0XA 1K3LA 4FIWA 4IQ1A 2IMIA 4PQIA 2GDRA 3UBKA 3G7IA 2R0CA 5D9TA 1Z9HA 2O89A 3IE3A 1PSQA 2YV7A 2HT9A 2MMAA 4TKYA 2R6KA 4IELA 5CRDA 4KH7A 2HSHA 1Z7PA 3FZ4A 3UL3A 4QL7A 1EOGA 1SK2A 4WEYA 4WKWA 1T8EB 4KDXA 4LL4B 1KTEA 2FLSA 5EVOA 3TOUA 1F9MA 2P31A 4YAPA 3FY7A 4I2TA 2UZ8A 1JHBA 2F3MA 3QD9A 3M9KA 3CMIA 5ECSA 3H79A 2AV4A 5E59A 5AGYA 2F9SA 5CRGA 1VF4A 3VPQA 2VM2A 2HE3A 1ML6A 2IN3A 5E4WA 3FR3A 2QC7A 5DALA 4IJ3A 1A8YA 4LMVA 1ZYPA 3LWAA 2OA7A 6GSUA 3IV4A 2ON5A 3FKFA 2YANA 4MZWA 1S3DA 1YQ1A 4CY8A 4OMVA 4P3YB 1X9MB 2LNTA 1TU8A 3KXOA 4K2XA 4GQFA 1PA3A 4EE0A 1WMJA 1EOHA 3HA9A 1EV4A 4J57E 1HD2A 4USSA 4L8EA 3KP8A 2JZRA 4IP1A 2OE1A 4BVYA 2B7KA 3TJGA 3KJYA 1M99A 3M9JA 4LA1A 4AGSA 1PD21 1OC9A 3ZFBA 2C4JA 1YF0A 1G7EA 2L4QA 2CZ3A 2LUSA 2C0DA 3VWWA 4TW5A 1OKDA 1XXUA 1ERTA 1MDKA 1XBSA 1K0NA 1Q4JA 2GSTA 2L59A 4AJ7A 2CV4A 3ERWA 5AISA 5CYYA 4TXOA 2C1YA 3CSJA 3TJFA 1GL8A 5GAND 2H6YA 5J5NA 1O73A 2WS2A 1G6WA 3CTFA 4PUFC 3GNJA 4V2LA 4K9ZA 3H8QA 1NHYA 1NHOA 2B5XA 2H30A 1KNGA 4BVXA 1TW9A 2LQQA 1N2AA 3P7XA 3GV1A 1I5GA 2IL3A 1MEKA 2M72A 4F0BA 5ECMB 1SU9A 3TRQA 2PGTA 1B48A 2X99A 5F8BA 4BVYB 1SL0B 1GUHA 2O87A 2B1LA 5DCGA 1YKCA 1IYIA 4EVMA 3WYWA 2XBIA 4ECJA 1GSFA 1YJ6A 2JU5A 3VFIA 3PGTA 1OC8A 1OYJA 5A4UA 3CRTA 3ZVJD 2IMDA 1FHEA 5L71A 5ELGA 5B6MA 2JACA 2YNXA 2PU9C 3KTLA 2BMXA 1JLVA 1B9XC 1C72A 2LEGA 2OBIA 1SD9A 4MNNA 2HRKA 3E0UA 13GSA 8GSSA 2QKEA 2XPDA 5KN0A 5J4UA 2RIIA 2GZYA 2OADA 3FEUA 2FWEA 2C0EA 4ICYA 3APQA 3GL3A 4MJCA 2C3NA 1QFNA 1QUWA 1PMTA 2DKIA 4KUNA 4FQUA 3CBUA 5EY6A 2O8VB 1AAZA 4G2EA 3TB2A 3A5IA 5LCZA 2IWTA 2K6VA 5G5FA 4RUVA 2H01A 3R2QA 4ECIA 2O85A 4I8BA 5ECRB 5HR3A 4MP4A 3A2VA 3EE2A 1T4YA 2E0QA 7GSSA 5IQYA 4PQHA 2VCWA 1XWBA 3BBYA 3UVHA 1TKDB 5G30A 3D22A 1WIKA 3F8UA 3FR6A 4HZ2A 1Z6NA 1QMVA 4JR4A 4BWQA 2GS3A 2P5RA 4TR1B 1AC1A 2R0GA 4F03A 1GUMA 4KE3A 2E7PA 3IAS2 3TDGA 3VWXA 2L57A 1VGLA 1URMA 4GSNA 4WF4A 3UAPA 1SYXA 4NHWA 4N11A 2DJ3A 10GSA 2VLTA 3WGXA 4O92A 2DIZA 3LORA 2WB9A 3C1SA 1GTBA 3GKKA 4KCEA 2C3QA 5G31A 4V1Ap 4TOPA 5GZZB 4POMA 1E6BA 2H75A 3DMLA 4WR4A 1T4ZA 5D9WA 2FHEA 4TR4A 1K0DA 3KCMA 1KEBA 4HQZA 3P2AA 1SKSB 4MF6A 3L4NA 2OACA 3UOMA 3QDNA 16GSA 1OKTA 2C0FA 4BL7A 3NZNA 4DEJA 1X0RA 4Q5RA 3PINA 5KN1A 1EEMA 2L6DA 2GSRA 2VO4A 2LSTA 4BPYA 1RQMA 2CVBA 4HZ4A 4KF9A 2IJYA 1JZOA 4NWYA 2DMMA 1TRUA 2C80A 2MBTA 3HJMA 3D21A 5B8AA 4EIPA 2ZCTA 4OO4A 5ABRA 3LEFA 4L0WA 2YJHA 4POLA 3ZITA 2DMLA 4K5SA 1LJRA 1WJKA 2CAIA 2EIOA 3TJJA 5EPFA 2VM1A 3BOAA 4ZB9A 2GZPA 6GSXA 2FWHA 2LRNA 3GA4A 3IOSA 2AUVA 4K8MA 4TVEA 3RHCA 2B7JA 1THXA 2DBCA 3TCOA 5KOXA 2AJQB 2LRTA 2REMA 1WE0A 3HJPA 5IMVA 5GSTA 2DJ2A 3IHQA 4IN0A 5JWRB 2N5FA 4Q5QA 4QL9A 4YQMA 4IP6A 1M9BA 3ME7A 3F4TA 1MTCA 3U6VA 2VL9A 1FW1A 1HQOA 1A2LA 3TKQA 1J0FA 1XOAA 1X9SB 1O8WA 3GX0A 4ZL9A 2H73A 1A24A 3GKMA 5D9XA 3LW9A 2IMKA 3TOTA 3IAM2 4V1Ag 4GSTA 3EMXA 4JRRA 3EVIA 2FNOA 1Q98A 1B8XA 3KZQA 1ON4A 3CSHA 2VLUA 3MIXA 4EKZA 2OJLA 1G6YA 1TI1A 2F8FA 2CX4A 1X5CA 2YZUA 3EYTA 2DKHA 3GL5A 3ZIJA 4POKA 2JADA 3D4TA 2F8AA 18GSA 2B6MA 4WR5A 1A2JA 4E8EA 3LYPA 1N8JA 22GSA 2YJ7A 5AN1A 2VCTA 1TK5B 3BCKA 4MPGA 3ZRDA 3MWHA 2GQLA 1GSQA 2VIMA 2OBKA 3F0IA 2FA8A 1WOUA 2GLRA 1FVKA 3D4MA 3A2WA 3DKSA 3GFKA 1GRXA 2X64A 1F3BA 2GQKA 1A0RP 4BWSA 5IPHA 4CHSA 2A2RA 3TKSC 2WFCA 2R2JA 5HR2A 4I5QA 2K8SA 3VURA 3VWVA 3FYGA 3D0ZA 1FB6A 1XW5A 1CQHA 1F3AA 3O6TA 4CDOA 1V58A 1K0CA 3QPMA 3ZMLA 1TU7A 5KEJA 4IGJA 4ZB6A 4WXTA 3VWUA 2AYTA 1WPIA 4ML1A 4XS1A 1K0MA 2X8GA 3ZFLA 1DUGA 2H74A 3R3EA 2C0GA 1XWCA 4J2FA 2DLXA 4TN8A 4PTSA 1TRSA 4ISDA 2YP6A 2XC2A 2LS5A 1PKZA 1R4WA 4KDUA 2L4CA 1PRXA 4Z7XA 1PL2A 1BEDA 2WJUA 3EURA 4TR3A 3CRUA 2VD1A 3PH9A 2DJ0A 5G5EA 1R5PA 3GMFA 2I81A 2V6OA 1UN2A 3ERGA 1E2YA 4FYUA 4L5LA 1HNCA 2B3SA 1X9WB 5C00A 1GLQA 3RDWA 2BTOT 1TK0B 1OE8A 3GH9A 1AIUA 1G0TA 4WBJA 1GSUA 4MA9A 2C8UA 2K9FA 2X8CA 5ECNB 2PMTA 5DAKB 5DJMA 2FA4A 5H5SA 2EIRA 2HFDA 1K0AA 2EIQA 3CYNA 2HSYA 5ID2B 4O5RA 2RM6A 4GSSA 2RUFA 3DRNA 3E3EA 2IFQB 4JBBA 1ERUA 3EMPA 2V41A 3ZVJA 2VOCA 4EIQA 1USBA 4K1FA 1BJXA 2NBSA 4PQ1A 3W8JA 2YN1A 4ZIJA 1MD4A 1TOFA 2LV3A 1A2MA 1KBNA 4EC0A 3F6FA 3J7Yk 1SD8A 2LRCA 2H6ZA 4K6XA 1FO5A 5ECQB 3W6GA 1SJIA 3GSSA 5J41A 1JZRA 4YH2A 1VF3A 4LL1B 4TRXA 1UVZA 3IDVA 17GSA 1PKWA 1ACVA 1XCCA 1FG4A 2HSMA 4ZBBA 5F07A 2VL2C 3HCZA 3APOA 2H1GA 4OCEA 4KSOA 3VI5A 1XW6A 1XFLA 1ZYNA 1H4OA 2X49A 3H4KA 5CNWA 3TKSA 4CY6A 4RI6A 1V98A 5IOXA 3LG6A 4NMUA 3G9BA 4XCSA 1G7OA 2G0FA 2BJXA 2NTOA 3IHGA 2ZNMA 5DBQA 4PXOA 2PERA 3GSTA 1XIYA 2PPTA 2CA8A 1SL2B 3A5WA 1VRSD 3LFLA 4TR1A 1TTZA 2C3TA 2IPAA 5CP1A 3H1NA 5FHIA 1HYUA 1OC3A 3GYKA 1T7PB 3O76A 1MDJA 4EUYA 3KH9A 1AW9A 2HRAA 2LJKA 3LSZA 1J08A 1EWXA 4MCUA 5ELAA 3WT2A 1ILOA 1B4PA 1GSSA 4N0VA 2GVPA 1X5DA 3IC8A 4KX4A 4FYBA 2I1UA 3O3TA 2OKAA 4H86A 3QOUA 1K0BA 1X5EA 2HZEA 1OAZA 1H75A 4ULXA 4DSQA 4X1UA 3VLNA 3Q74A 2R4VA 1M2DA 1PL1A 3HHVA 3LXTA 5JCGA 1YY7A 3HD5A 5J9CA 4JZQA 3HVXA 1TK8B 1FOVA 2QA1A 1U6TA 4G9HA 3C7MA 5IIZA 1GH2A 2PWJA 4N30A 4GXZA 1M2BA 4ZILA 2ES7A 3KP9A 4Z2RA 1Y6EA 4J56E 5ENUA 3TKSE 3F3RA 1DE2A 2YOIA 1PQNA 2KLXA 4YQUA 1MD3A 1B4QA 4G0KA 5JWQB 3N5OA 3C73A 3ZL5A 3K8NA 4IKHA 4PURA 4EO3A 3BD2A 3KMOA 1XWGA 2TRCP 4L0UA 4KNDA 2TRXA 1GSYA 3QMXA 5D96A 2DJJA 2GSSA 4Q5FA 2PN8A 1J9BA 5IPGA 4DSRA 3J7Yb 3EPTA 4OCFA 4MF7A 2MMOA 2HZEB 3UJ1A 5IM9A 1XW9A 4PX1A 2YWNA 2R3XA 2YV9A 1XWAA 3LXZA 5H5RA 2JL4A 5FWGA 2HZFA 3RBTA 14GSA 1EP8A 1LU4A 2E2MA 2YZHA 4ZBAA 1AXDA 2VL2A 4F9ZA 4EL1A 1O7UA 2FWFA 4GQCA 4K7IA 2J9HA 3C8EA 3PR8A 1Y25A 2CX3A 4LLRA 5H5QA 2H72A 4G19A 2H6XA 2JSYA 4ILFA 3IA1A 4XHMA 2GSQA 4PNFA 3KIJA 3KD0A 4IBPA 1GTAA 1U3AA 4GWRA 3C71A 1FVJA 3Q18A 2PVQA 5GSSA 4PUAA 2FGXA 3I43A 4IQAA 2X8HA 3QCPA 3DWVA 2LQOA 3QR6A 4IS0A 1GSDA 1QGVA 2J23A 2R0PA 4O7HA 1GWCA 3TGZA 3ZMKA 4KSMA 1A8LA 3F9UA 1JZDA 3W8SA 4PGTA 4OWYA 4ZL7A 2MBSA 5J9BA 4YKGA 4TXVA 1BG5A 2DJKA 1IYHA 3GTUB 3M3MA 2LTKA 1ZCPA 5CRHA 4K0NA 4KB3A 6GSVA 2RLIA 2KOKA 1ZL9A 2I9HA 1F37A 1WRYA 3I9V2 3NOFA 4KDYA 4O32A 3A3TA 2FUG2 1VF1A 2WDUA 3TJBA 1DSBA 3UVTA 1GNWA 1S3CA 4G0IA 4MMMA 4AF2A 3SBCA 3L0HA 4ACSA 3N9JA 3VPTA 2IIYA 4MF5A 1ZGNA 3IK7A 3G7JA 3PPUA 3L9VA 1OE7A 5LD0A 5HQPA 1SL1B 2PVOC 3ISOA 1AQXA 1DBYA 3GKNA 3US3A 4FH8A 1QXHA 3ZTLA 5JCWA 3RAZA 1XOBA 3CTGA 6GSWA 2R5GA 5COHA 2VD0A 1GLPA 4PNGA 3DIEA 1AQWA 2I3YA 5DQYA 2WCIA 1NM3A 1OVNA 5D8IA 4HUAA 3Q19A 4HS1A 4AJ6A 2H0GA 4O5QA 1SJ6A 6GSTA 5G1LA 3GHAA 1UA5A 4GCIA 3ZREA 5JWOB 4D73B 5CREA 3ZZXA 1Z7RA 3C1RA 4Z2UA 1HNAA 2H8LA 4XTSA 5CO3A 1R5AA 3IRAA 1R7HA 3QAWA 4JEDA 4KCAA 5HFKA 4XRDA 1FB0A 1XPVA 1BX9A 2R37A 3GN3A 3MNGA 1XVWA 1TXXA 2B5YA 4HDEA 1WP0A 2X4AA 3WGEA 4ZBDA 5DAKA 3LGCA 5HR0A 2HNLA 3GH6A 5A5KA 5ID2A 1LBKA 3VK9A 5J3RA 4LMWA 4HJ2A 5EL8A 2IFQA 2MZCA 1Z5YE 4ECBA 1YEPA 1A0FA 1GNEA 1BQ7A 3H93A 4FO5A 1YEXA 6GSSA 1ZYEA 3HDCA 3A2XA 2L5LA 2CVDA 4KW6A 3UEMA 2H76A 3KGKA 1T3BA 5DVBA 5F0GA 4EDZA 3EC3A 2HRNA 2DSAA 2HRFA 3NIVA 4WBRD 3ED3A 1O8XA 1V9WA 2A2SA 2MYGA 2WZ9A 1QK8A 4X4JA 2JZTA 4XRAA 2I4AA 4CW9A 3HJOA 1EGOA 1YF1A 4I97A 2AB6A 9GSSA 5F06A 3IC4A 2V2GA 3F3QA 4G0LA 3V1WA 3ZLPA 1F2EA 3GIXA 3CSIA 3HKRA 3HZ4A 1M0UA 3F4SA 3EU3A 3DEXA 1UC7A 1BAYA 1XWKA 5INYA 1T1VA 2KHPA 3TJKA 4EDYA 4L5OA 1M7TA 2PBJA 3WGDA 2KUCA 2CZ2A 2HXKA 5D73A 3KMNA 4HU9A 4AJ8A 1TJDA 4XS6A 3QFBC 4ID0A 3TRPA 1V57A 2LJAA 4MH3A 3APSA 3FHKA 1NSWA 4ZL8A 5A4VA 1U3IA 2WRTA 1A23A 2LNSA 2NPBA 3IBHA 4K5RA 1I9DA 2O7KA 1XVQA 5B6NA 3DYRA 2WULA 2P5QA 2RM5A 2YCDA 4K7OA 2IMFA 3FK8A 2FD3A 4EXJA 3DGQA 1EP7A 1Z3EA 2ZUPA 5ECHB 4F2IA 5CRWA 3RHBA 2M46A 2KP2A 5DDLA 12GSA 3LYKA 5FT3A 3MYDA 5DALB 4I6XA 2FWGA 3BCIA 4ZB8A 2VCQA 3GURA 2L5OA 2OE0A 4YQVA 4NXIA 1SK1A 2H66A 3AY8A 1YZXA 11GSA 4Q5NA 2MMZA 2LJRA 1CQGA 4Z2TA 5G1KA 6GSYA 3M1GA 4HJMA 3TKPA 2NVLA 4JE1A 3S9FA 1GUKA 2TIRA 3I6AA 2FCHA 4IHUA 4I2UA 4GTUA 1RW1A 4E8HA 2AAWA 5AIVA 2XPEA 2DC5A 3EINA 5ECOB 4POBA 1ZYQB 4RQRA 2P0GA 2M80A 1V40A 3GUSA 3P90A 2N5AA 1OC9B 5IMDA 5HFGA 3F63A 2JZSA 4K7NA 2GT6A 2GZZA 1O6JA 2VL3A 1GSEA 2L6CA 1THOA 3RPNA 2HYXA 2N5BA 3GX8A 2V6KA 4F0CA 1NW2A 1SK0A 1FAAA 5LNKe 1PN9A 3M0FA 4KA0A 3GRXA 1EV9A 3ZYWA 1ZZYA 3IK9A 4TXOB 3ME8A 1JLWA 1TRWA 4ZXGA 2NDOA 3EU4A 4NV5A 3QFAC 3P8WA 1FOHA 4N10A 2GGTA 5C04A 3TKRA 5DJLA 1DE1A 3Q6OA 3D5JA 2A2PA 2AHEA 4K2DA 3LJRA 4DSSA 1SKWB 3QAVA 4BVXB 1ZMAA 1SENA 2OE3A 4MJAA 1SYRA 2WGRA 1Z6MA 3HYPA 4G10A 1PX6A 1GTIA 2YWOA 2VAFA 4A5PA 1M9AA 4O5UA 3HY2A 1WWJA 5IMZA 3HZ8A 4MJEA 1GP1A 5CAXA 4OFNA 3E9JB 4IJIA 4HOJA 1AUCA 1SKRB 1O81A 4ECCA 1JFUA 4MPFA 1S3AA 2HLSA 2VUPA 4OFTA 2DIYA 3TRXA 4RI7A 1MDIA 1R26A 1K3OA 1W89A 2HI7A 2QGVA 4HI7A 4MLYA 3RPPA 4KGIA 1ERWA 4YAVA 2JSZA 2QSIA 3FZ9A 3UIWA 2DJ1A 19GSA 1TDIA 1ZOFA 5KN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XS4 A;  20GS A;  2FY6 A;  4IVF A;  4MZB A;  5GAP D;  2GT5 A;  2E2G A;  2H70 A;  4HU7 A;  1V2A A;  3GTU A;  3L9U A;  5ECL B;  3G7Y A;  3SWL A;  2K18 A;  3FR9 A;  4V2N A;  4NAX A;  4OFM A;  4DSS B;  2CVK A;  1HNB A;  2H71 A;  4HEA 2;  4TR0 A;  2IME A;  2Z9S A;  1U87 A;  5HFI A;  1YKA A;  2GQM A;  4NV2 A;  1EEJ A;  1TP9 A;  1BYE A;  5ECI B;  4JU5 A;  3UAR A;  2V1M A;  3ERF A;  3M8N A;  2VLV A;  5KN2 A;  3JCM L;  1VF2 A;  4RQX A;  4WET A;  5JCU A;  3GKX A;  3L9S A;  4OD7 A;  1M2A A;  3QAG A;  5IO0 A;  4GF0 A;  3DXB A;  2K8V A;  5G2Z A;  4MAB A;  3DD3 A;  4IW9 A;  1K0O A;  4ML6 A;  3HVS A;  3TUE A;  3MAK A;  4NPB A;  3MDK A;  3ZIV A;  2YWM A;  2H1B A;  5D93 A;  1B9Y C;  1QQ2 A;  2CT6 A;  4XS4 B;  2G2Q A;  3HXS A;  5IMF A;  2EC4 A;  4MZC A;  3FZA A;  2MMN A;  3WD6 A;  1PX7 A;  3F4R A;  3U5R E;  4MJB A;  5ECP B;  4OO5 A;  3UMA A;  4D73 A;  4BA7 A;  1ST9 A;  4MK3 A;  1EGR A;  4V2M A;  2B1K A;  3KM6 A;  2H0H A;  2B5E A;  4GRF A;  2XBQ A;  3KH7 A;  2H1D A;  1K3Y A;  1JZW A;  2VCZ A;  3FRC A;  5A4W A;  3KTB A;  3L78 A;  5B8B A;  2CQ9 A;  3VI7 A;  2PUK C;  4WF5 A;  5AIX A;  1GUL A;  5DQS A;  4K0G A;  1ERV A;  3D6I A;  4N0Z A;  4DVC A;  4QQ7 A;  2H19 A;  2CAQ A;  4KAE A;  1RK4 A;  3FW2 A;  2YPM A;  3DVW A;  4FYC A;  5IMC A;  2YWI A;  1O85 A;  4MDC A;  5HR1 A;  4JR6 A;  2H0I A;  1TRV A;  3F6D A;  2ON7 A;  4NHZ A;  2VCV A;  1ABA A;  2XHF A;  4F82 A;  2LKU A;  5IO2 A;  5IMA A;  1TI3 A;  5IOW A;  2F51 A;  2KP1 A;  3I69 A;  1SJZ A;  1YDK A;  5DCH A;  3DVX A;  4X43 A;  3KEB A;  3MSZ A;  3OR5 A;  1U88 A;  3IR4 A;  1F6M C;  3IPZ A;  3BJ5 A;  2VCX A;  2D2Z A;  1W4V A;  5D9V A;  5F05 A;  1XZO A;  3WT1 A;  1GTU A;  2H1A A;  2RUE A;  2ALB A;  4HQS A;  4MH2 A;  4EF0 A;  1T00 A;  4GLT A;  5ECK B;  2V32 A;  4XIH A;  1AQV A;  2GTU A;  5B7C A;  3FZ5 A;  1PGT A;  3UBL A;  3LQ7 A;  2A4V A;  3HVV A;  3CXG A;  3IXR A;  3EWL A;  1EZK A;  4X0X A;  1K3L A;  4FIW A;  4IQ1 A;  2IMI A;  4PQI A;  2GDR A;  3UBK A;  3G7I A;  5D9T A;  1Z9H A;  2O89 A;  3IE3 A;  1PSQ A;  2YV7 A;  2HT9 A;  2MMA A;  4TKY A;  2R6K A;  4IEL A;  5CRD A;  4KH7 A;  2HSH A;  1Z7P A;  3FZ4 A;  3UL3 A;  4QL7 A;  1EOG A;  1SK2 A;  4WEY A;  4WKW A;  1T8E B;  4KDX A;  4LL4 B;  1KTE A;  2FLS A;  5EVO A;  3TOU A;  1F9M A;  2P31 A;  4YAP A;  3FY7 A;  4I2T A;  1JHB A;  2F3M A;  3QD9 A;  3M9K A;  3CMI A;  5ECS A;  3H79 A;  2AV4 A;  5E59 A;  5AGY A;  2F9S A;  5CRG A;  1VF4 A;  3VPQ A;  2VM2 A;  2HE3 A;  1ML6 A;  2IN3 A;  5E4W A;  3FR3 A;  2QC7 A;  5DAL A;  4IJ3 A;  1A8Y A;  4LMV A;  3LWA A;  2OA7 A;  6GSU A;  3IV4 A;  2ON5 A;  3FKF A;  2YAN A;  4MZW A;  1S3D A;  1YQ1 A;  4OMV A;  4P3Y B;  1X9M B;  2LNT A;  1TU8 A;  3KXO A;  4GQF A;  1PA3 A;  4EE0 A;  1WMJ A;  1EOH A;  3HA9 A;  1EV4 A;  4J57 E;  1HD2 A;  4L8E A;  3KP8 A;  2JZR A;  4IP1 A;  2OE1 A;  4BVY A;  2B7K A;  3TJG A;  3KJY A;  1M99 A;  3M9J A;  4LA1 A;  4AGS A;  1PD2 1;  1OC9 A;  3ZFB A;  2C4J A;  1YF0 A;  1G7E A;  2L4Q A;  2CZ3 A;  2LUS A;  2C0D A;  3VWW A;  4TW5 A;  1OKD A;  1XXU A;  1ERT A;  1MDK A;  1XBS A;  1K0N A;  1Q4J A;  2GST A;  2L59 A;  4AJ7 A;  2CV4 A;  3ERW A;  5AIS A;  5CYY A;  4TXO A;  2C1Y A;  3CSJ A;  3TJF A;  1GL8 A;  5GAN D;  2H6Y A;  5J5N A;  1O73 A;  2WS2 A;  1G6W A;  3CTF A;  4PUF C;  3GNJ A;  4V2L A;  4K9Z A;  3H8Q A;  1NHY A;  1NHO A;  2B5X A;  2H30 A;  1KNG A;  4BVX A;  1TW9 A;  2LQQ A;  1N2A A;  3P7X A;  3GV1 A;  1I5G A;  2IL3 A;  1MEK A;  2M72 A;  4F0B A;  5ECM B;  1SU9 A;  3TRQ A;  2PGT A;  1B48 A;  2X99 A;  5F8B A;  1SL0 B;  1GUH A;  2O87 A;  2B1L A;  5DCG A;  1YKC A;  1IYI A;  4EVM A;  3WYW A;  2XBI A;  4ECJ A;  1GSF A;  1YJ6 A;  2JU5 A;  3VFI A;  3PGT A;  1OC8 A;  1OYJ A;  5A4U A;  3CRT A;  3ZVJ D;  2IMD A;  1FHE A;  5L71 A;  5ELG A;  5B6M A;  2JAC A;  2YNX A;  2PU9 C;  3KTL A;  2BMX A;  1JLV A;  1B9X C;  1C72 A;  2LEG A;  2OBI A;  1SD9 A;  3E0U A;  13GS A;  8GSS A;  2QKE A;  2XPD A;  5KN0 A;  5J4U A;  2RII A;  2GZY A;  2OAD A;  3FEU A;  2FWE A;  2C0E A;  3APQ A;  3GL3 A;  4MJC A;  2C3N A;  1QFN A;  1QUW A;  1PMT A;  4KUN A;  3CBU A;  5EY6 A;  2O8V B;  1AAZ A;  4G2E A;  3TB2 A;  5LCZ A;  2IWT A;  2K6V A;  5G5F A;  4RUV A;  2H01 A;  3R2Q A;  4ECI A;  2O85 A;  4I8B A;  5ECR B;  5HR3 A;  4MP4 A;  3A2V A;  3EE2 A;  1T4Y A;  2E0Q A;  7GSS A;  5IQY A;  4PQH A;  2VCW A;  1XWB A;  3BBY A;  3UVH A;  1TKD B;  5G30 A;  3D22 A;  1WIK A;  3F8U A;  3FR6 A;  4HZ2 A;  1Z6N A;  1QMV A;  4JR4 A;  4BWQ A;  2GS3 A;  2P5R A;  4TR1 B;  1AC1 A;  4F03 A;  1GUM A;  4KE3 A;  2E7P A;  3IAS 2;  3TDG A;  3VWX A;  2L57 A;  1VGL A;  1URM A;  4GSN A;  4WF4 A;  3UAP A;  1SYX A;  4NHW A;  4N11 A;  2DJ3 A;  10GS A;  2VLT A;  3WGX A;  4O92 A;  2DIZ A;  3LOR A;  2WB9 A;  3C1S A;  1GTB A;  3GKK A;  4KCE A;  2C3Q A;  5G31 A;  4V1A p;  4TOP A;  5GZZ B;  4POM A;  1E6B A;  2H75 A;  3DML A;  4WR4 A;  1T4Z A;  5D9W A;  2FHE A;  4TR4 A;  1K0D A;  3KCM A;  1KEB A;  4HQZ A;  3P2A A;  1SKS B;  4MF6 A;  3L4N A;  2OAC A;  3UOM A;  3QDN A;  16GS A;  1OKT A;  2C0F A;  4BL7 A;  3NZN A;  4DEJ A;  1X0R A;  4Q5R A;  3PIN A;  5KN1 A;  1EEM A;  2L6D A;  2GSR A;  2VO4 A;  2LST A;  4BPY A;  1RQM A;  2CVB A;  4HZ4 A;  2IJY A;  1JZO A;  4NWY A;  2DMM A;  1TRU A;  2C80 A;  2MBT A;  3HJM A;  3D21 A;  5B8A A;  2ZCT A;  4OO4 A;  5ABR A;  3LEF A;  4L0W A;  2YJH A;  4POL A;  3ZIT A;  2DML A;  1LJR A;  1WJK A;  2CAI A;  2EIO A;  3TJJ A;  5EPF A;  2VM1 A;  3BOA A;  4ZB9 A;  2GZP A;  6GSX A;  2FWH A;  2LRN A;  3GA4 A;  3IOS A;  2AUV A;  4K8M A;  4TVE A;  3RHC A;  2B7J A;  1THX A;  2DBC A;  3TCO A;  2AJQ B;  2LRT A;  2REM A;  1WE0 A;  3HJP A;  5IMV A;  5GST A;  2DJ2 A;  3IHQ A;  4IN0 A;  5JWR B;  2N5F A;  4Q5Q A;  4QL9 A;  4YQM A;  4IP6 A;  1M9B A;  3ME7 A;  3F4T A;  1MTC A;  3U6V A;  2VL9 A;  1FW1 A;  1HQO A;  1A2L A;  3TKQ A;  1J0F A;  1XOA A;  1X9S B;  1O8W A;  3GX0 A;  4ZL9 A;  2H73 A;  1A24 A;  3GKM A;  5D9X A;  2IMK A;  3TOT A;  3IAM 2;  4V1A g;  4GST A;  3EMX A;  4JRR A;  3EVI A;  2FNO A;  1Q98 A;  1B8X A;  3KZQ A;  1ON4 A;  3CSH A;  2VLU A;  4EKZ A;  2OJL A;  1G6Y A;  1TI1 A;  2F8F A;  2CX4 A;  1X5C A;  2YZU A;  3EYT A;  3GL5 A;  3ZIJ A;  4POK A;  2JAD A;  3D4T A;  2F8A A;  18GS A;  2B6M A;  4WR5 A;  1A2J A;  4E8E A;  3LYP A;  1N8J A;  22GS A;  5AN1 A;  2YJ7 A;  2VCT A;  1TK5 B;  3BCK A;  4MPG A;  3ZRD A;  3MWH A;  2GQL A;  1GSQ A;  2VIM A;  2OBK A;  3F0I A;  2FA8 A;  1WOU A;  2GLR A;  1FVK A;  3D4M A;  3A2W A;  3DKS A;  3GFK A;  1GRX A;  2X64 A;  1F3B A;  2GQK A;  1A0R P;  4BWS A;  5IPH A;  4CHS A;  2A2R A;  3TKS C;  2WFC A;  2R2J A;  5HR2 A;  4I5Q A;  2K8S A;  3VUR A;  3VWV A;  3FYG A;  3D0Z A;  1FB6 A;  1XW5 A;  1CQH A;  1F3A A;  3O6T A;  4CDO A;  1V58 A;  1K0C A;  3QPM A;  3ZML A;  1TU7 A;  5KEJ A;  4IGJ A;  4ZB6 A;  4WXT A;  3VWU A;  2AYT A;  1WPI A;  4ML1 A;  4XS1 A;  1K0M A;  2X8G A;  3ZFL A;  1DUG A;  2H74 A;  2C0G A;  1XWC A;  4J2F A;  2DLX A;  4TN8 A;  1TRS A;  4ISD A;  2YP6 A;  2XC2 A;  2LS5 A;  1PKZ A;  1R4W A;  4KDU A;  2L4C A;  1PRX A;  4Z7X A;  1PL2 A;  1BED A;  2WJU A;  3EUR A;  4TR3 A;  3CRU A;  2VD1 A;  3PH9 A;  2DJ0 A;  5G5E A;  1R5P A;  3GMF A;  2I81 A;  2V6O A;  1UN2 A;  3ERG A;  1E2Y A;  4FYU A;  4L5L A;  1HNC A;  2B3S A;  1X9W B;  5C00 A;  1GLQ A;  3RDW A;  2BTO T;  1TK0 B;  1OE8 A;  3GH9 A;  1AIU A;  1G0T A;  4WBJ A;  1GSU A;  4MA9 A;  2C8U A;  2K9F A;  2X8C A;  5ECN B;  2PMT A;  5DAK B;  5DJM A;  2FA4 A;  5H5S A;  2EIR A;  2HFD A;  1K0A A;  2EIQ A;  3CYN A;  2HSY A;  5ID2 B;  4O5R A;  2RM6 A;  4GSS A;  2RUF A;  3DRN A;  3E3E A;  2IFQ B;  4JBB A;  1ERU A;  3EMP A;  2V41 A;  3ZVJ A;  2VOC A;  1USB A;  4K1F A;  1BJX A;  2NBS A;  4PQ1 A;  3W8J A;  2YN1 A;  4ZIJ A;  1MD4 A;  1TOF A;  2LV3 A;  1A2M A;  1KBN A;  4EC0 A;  3F6F A;  3J7Y k;  1SD8 A;  2LRC A;  2H6Z A;  4K6X A;  1FO5 A;  5ECQ B;  3W6G A;  1SJI A;  3GSS A;  5J41 A;  1JZR A;  4YH2 A;  1VF3 A;  4LL1 B;  4TRX A;  1UVZ A;  3IDV A;  17GS A;  1PKW A;  1ACV A;  1XCC A;  1FG4 A;  4ZBB A;  5F07 A;  2VL2 C;  3HCZ A;  3APO A;  2H1G A;  4OCE A;  4KSO A;  3VI5 A;  1XW6 A;  1XFL A;  1H4O A;  3H4K A;  5CNW A;  3TKS A;  4RI6 A;  1V98 A;  5IOX A;  3LG6 A;  4NMU A;  3G9B A;  4XCS A;  1G7O A;  2G0F A;  2BJX A;  2NTO A;  2ZNM A;  5DBQ A;  4PXO A;  2PER A;  3GST A;  1XIY A;  2PPT A;  2CA8 A;  1SL2 B;  3A5W A;  1VRS D;  3LFL A;  4TR1 A;  1TTZ A;  2C3T A;  2IPA A;  5CP1 A;  3H1N A;  5FHI A;  1HYU A;  1OC3 A;  3GYK A;  1T7P B;  3O76 A;  1MDJ A;  4EUY A;  3KH9 A;  1AW9 A;  2LJK A;  3LSZ A;  1J08 A;  1EWX A;  4MCU A;  5ELA A;  3WT2 A;  1ILO A;  1B4P A;  1GSS A;  4N0V A;  2GVP A;  1X5D A;  4KX4 A;  4FYB A;  2I1U A;  3O3T A;  2OKA A;  4H86 A;  3QOU A;  1K0B A;  1X5E A;  2HZE A;  1OAZ A;  1H75 A;  4ULX A;  4DSQ A;  4X1U A;  3VLN A;  3Q74 A;  2R4V A;  1M2D A;  1PL1 A;  3HHV A;  3LXT A;  5JCG A;  1YY7 A;  3HD5 A;  5J9C A;  4JZQ A;  3HVX A;  1TK8 B;  1FOV A;  1U6T A;  4G9H A;  3C7M A;  5IIZ A;  1GH2 A;  2PWJ A;  4N30 A;  4GXZ A;  1M2B A;  4ZIL A;  2ES7 A;  3KP9 A;  1Y6E A;  4J56 E;  5ENU A;  3TKS E;  3F3R A;  1DE2 A;  2YOI A;  1PQN A;  2KLX A;  4YQU A;  1MD3 A;  1B4Q A;  5JWQ B;  3N5O A;  3C73 A;  3ZL5 A;  3K8N A;  4IKH A;  4PUR A;  4EO3 A;  3BD2 A;  3KMO A;  1XWG A;  2TRC P;  4L0U A;  4KND A;  2TRX A;  1GSY A;  3QMX A;  5D96 A;  2DJJ A;  2GSS A;  4Q5F A;  2PN8 A;  1J9B A;  5IPG A;  4DSR A;  3J7Y b;  4OCF A;  4MF7 A;  2MMO A;  2HZE B;  3UJ1 A;  5IM9 A;  1XW9 A;  4PX1 A;  2YWN A;  2R3X A;  2YV9 A;  1XWA A;  3LXZ A;  5H5R A;  2JL4 A;  5FWG A;  2HZF A;  3RBT A;  14GS A;  1EP8 A;  1LU4 A;  2E2M A;  2YZH A;  4ZBA A;  1AXD A;  2VL2 A;  4F9Z A;  4EL1 A;  1O7U A;  2FWF A;  4GQC A;  4K7I A;  2J9H A;  3C8E A;  3PR8 A;  1Y25 A;  2CX3 A;  4LLR A;  5H5Q A;  2H72 A;  4G19 A;  2H6X A;  2JSY A;  4ILF A;  3IA1 A;  4XHM A;  2GSQ A;  4PNF A;  3KIJ A;  3KD0 A;  4IBP A;  1GTA A;  1U3A A;  4GWR A;  3C71 A;  1FVJ A;  3Q18 A;  2PVQ A;  5GSS A;  4PUA A;  2FGX A;  3I43 A;  4IQA A;  2X8H A;  3QCP A;  3DWV A;  2LQO A;  3QR6 A;  4IS0 A;  1GSD A;  1QGV A;  2J23 A;  4O7H A;  1GWC A;  3TGZ A;  3ZMK A;  4KSM A;  1A8L A;  3F9U A;  1JZD A;  3W8S A;  4PGT A;  4OWY A;  4ZL7 A;  2MBS A;  5J9B A;  4TXV A;  1BG5 A;  2DJK A;  1IYH A;  3GTU B;  3M3M A;  2LTK A;  1ZCP A;  5CRH A;  4K0N A;  4KB3 A;  6GSV A;  2RLI A;  2KOK A;  1ZL9 A;  2I9H A;  1F37 A;  1WRY A;  3I9V 2;  3NOF A;  4KDY A;  4O32 A;  3A3T A;  2FUG 2;  1VF1 A;  2WDU A;  3TJB A;  1DSB A;  3UVT A;  1GNW A;  1S3C A;  4MMM A;  4AF2 A;  3SBC A;  3L0H A;  4ACS A;  3N9J A;  3VPT A;  2IIY A;  4MF5 A;  1ZGN A;  3IK7 A;  3G7J A;  3L9V A;  1OE7 A;  5LD0 A;  5HQP A;  1SL1 B;  2PVO C;  3ISO A;  1AQX A;  1DBY A;  3GKN A;  3US3 A;  4FH8 A;  1QXH A;  3ZTL A;  5JCW A;  3RAZ A;  1XOB A;  3CTG A;  6GSW A;  2R5G A;  5COH A;  2VD0 A;  1GLP A;  4PNG A;  3DIE A;  1AQW A;  2I3Y A;  5DQY A;  2WCI A;  1NM3 A;  1OVN A;  5D8I A;  4HUA A;  3Q19 A;  4HS1 A;  4AJ6 A;  2H0G A;  1SJ6 A;  6GST A;  5G1L A;  3GHA A;  1UA5 A;  4GCI A;  3ZRE A;  5JWO B;  4D73 B;  5CRE A;  3ZZX A;  1Z7R A;  3C1R A;  1HNA A;  2H8L A;  4XTS A;  5CO3 A;  1R5A A;  3IRA A;  1R7H A;  3QAW A;  4JED A;  4KCA A;  5HFK A;  4XRD A;  1FB0 A;  1XPV A;  1BX9 A;  2R37 A;  3GN3 A;  3MNG A;  1XVW A;  1TXX A;  2B5Y A;  4HDE A;  1WP0 A;  3WGE A;  4ZBD A;  5DAK A;  3LGC A;  5HR0 A;  2HNL A;  3GH6 A;  5A5K A;  5ID2 A;  1LBK A;  3VK9 A;  5J3R A;  4LMW A;  4HJ2 A;  5EL8 A;  2IFQ A;  2MZC A;  1Z5Y E;  4ECB A;  1YEP A;  1A0F A;  1GNE A;  1BQ7 A;  3H93 A;  4FO5 A;  1YEX A;  6GSS A;  1ZYE A;  3HDC A;  3A2X A;  2L5L A;  2CVD A;  4KW6 A;  3UEM A;  2H76 A;  3KGK A;  1T3B A;  5DVB A;  5F0G A;  4EDZ A;  3EC3 A;  2HRN A;  2DSA A;  2HRF A;  3NIV A;  4WBR D;  3ED3 A;  1O8X A;  1V9W A;  2A2S A;  2MYG A;  2WZ9 A;  1QK8 A;  2JZT A;  4XRA A;  2I4A A;  4CW9 A;  3HJO A;  1EGO A;  1YF1 A;  4I97 A;  2AB6 A;  9GSS A;  5F06 A;  3IC4 A;  2V2G A;  3F3Q A;  3ZLP A;  3V1W A;  1F2E A;  3GIX A;  3CSI A;  3HKR A;  3HZ4 A;  1M0U A;  3F4S A;  3EU3 A;  3DEX A;  1UC7 A;  1BAY A;  1XWK A;  5INY A;  1T1V A;  2KHP A;  3TJK A;  4EDY A;  4L5O A;  1M7T A;  2PBJ A;  3WGD A;  2KUC A;  2CZ2 A;  2HXK A;  5D73 A;  3KMN A;  4HU9 A;  4AJ8 A;  1TJD A;  4XS6 A;  3QFB C;  4ID0 A;  3TRP A;  1V57 A;  2LJA A;  4MH3 A;  3APS A;  3FHK A;  1NSW A;  4ZL8 A;  5A4V A;  1U3I A;  2WRT A;  1A23 A;  2LNS A;  2NPB A;  3IBH A;  1I9D A;  2O7K A;  1XVQ A;  5B6N A;  3DYR A;  2WUL A;  2P5Q A;  2RM5 A;  2YCD A;  4K7O A;  2IMF A;  3FK8 A;  2FD3 A;  4EXJ A;  3DGQ A;  1EP7 A;  1Z3E A;  2ZUP A;  5ECH B;  4F2I A;  5CRW A;  3RHB A;  2M46 A;  2KP2 A;  5DDL A;  12GS A;  3LYK A;  5FT3 A;  5DAL B;  4I6X A;  2FWG A;  3BCI A;  4ZB8 A;  2VCQ A;  3GUR A;  2L5O A;  2OE0 A;  4YQV A;  4NXI A;  1SK1 A;  2H66 A;  3AY8 A;  1YZX A;  11GS A;  4Q5N A;  2MMZ A;  2LJR A;  1CQG A;  5G1K A;  6GSY A;  3M1G A;  4HJM A;  3TKP A;  2NVL A;  4JE1 A;  3S9F A;  1GUK A;  2TIR A;  3I6A A;  2FCH A;  4IHU A;  4I2U A;  4GTU A;  1RW1 A;  4E8H A;  2AAW A;  5AIV A;  2XPE A;  2DC5 A;  3EIN A;  5ECO B;  4POB A;  1ZYQ B;  4RQR A;  2P0G A;  2M80 A;  1V40 A;  3GUS A;  3P90 A;  2N5A A;  1OC9 B;  5IMD A;  5HFG A;  3F63 A;  2JZS A;  4K7N A;  2GT6 A;  2GZZ A;  1O6J A;  2VL3 A;  1GSE A;  2L6C A;  1THO A;  3RPN A;  2HYX A;  2N5B A;  3GX8 A;  2V6K A;  4F0C A;  1NW2 A;  1SK0 A;  1FAA A;  5LNK e;  1PN9 A;  3M0F A;  4KA0 A;  3GRX A;  1EV9 A;  3ZYW A;  1ZZY A;  3IK9 A;  4TXO B;  3ME8 A;  1JLW A;  1TRW A;  4ZXG A;  2NDO A;  3EU4 A;  4NV5 A;  3QFA C;  3P8W A;  4N10 A;  2GGT A;  5C04 A;  3TKR A;  5DJL A;  1DE1 A;  3Q6O A;  3D5J A;  2AHE A;  4K2D A;  3LJR A;  4DSS A;  1SKW B;  3QAV A;  1ZMA A;  1SEN A;  2OE3 A;  4MJA A;  1SYR A;  2WGR A;  1Z6M A;  3HYP A;  4G10 A;  1PX6 A;  1GTI A;  2YWO A;  2VAF A;  1M9A A;  3HY2 A;  1WWJ A;  5IMZ A;  3HZ8 A;  4MJE A;  1GP1 A;  5CAX A;  4OFN A;  3E9J B;  4IJI A;  4HOJ A;  1AUC A;  1SKR B;  1O81 A;  4ECC A;  1JFU A;  4MPF A;  1S3A A;  2HLS A;  2VUP A;  4OFT A;  2DIY A;  3TRX A;  4RI7 A;  1MDI A;  1R26 A;  1K3O A;  1W89 A;  2HI7 A;  2QGV A;  4HI7 A;  4MLY A;  3RPP A;  4KGI A;  1ERW A;  4YAV A;  2JSZ A;  2QSI A;  3FZ9 A;  3UIW A;  2DJ1 A;  19GS A;  1TDI A;  1ZOF A;  5KN3 A; 
#chains in the Genus database with same CATH topology
 4XS4 A;  20GS A;  2FY6 A;  4IVF A;  4MZB A;  5GAP D;  2GT5 A;  2E2G A;  2H70 A;  4HU7 A;  1V2A A;  3GTU A;  3L9U A;  5ECL B;  3G7Y A;  3SWL A;  2K18 A;  3FR9 A;  4V2N A;  4NAX A;  4OFM A;  2QA2 A;  4DSS B;  2CVK A;  1HNB A;  5BRT A;  2H71 A;  4HEA 2;  4TR0 A;  2IME A;  2Z9S A;  1U87 A;  5HFI A;  1YKA A;  2GQM A;  4NV2 A;  1EEJ A;  1TP9 A;  1BYE A;  5ECI B;  4JU5 A;  3UAR A;  2V1M A;  3FMW A;  3ERF A;  3M8N A;  2VLV A;  5KN2 A;  3JCM L;  1VF2 A;  4RQX A;  4WET A;  5JCU A;  3GKX A;  3L9S A;  4OD7 A;  1M2A A;  1PN0 A;  3QAG A;  5IO0 A;  4GF0 A;  3DXB A;  2K8V A;  5G2Z A;  4MAB A;  3DD3 A;  4IW9 A;  1K0O A;  4ML6 A;  3HVS A;  3TUE A;  3MAK A;  4NPB A;  3MDK A;  3ZIV A;  2YWM A;  2H1B A;  5D93 A;  1B9Y C;  1QQ2 A;  2CT6 A;  4XS4 B;  2G2Q A;  3HXS A;  5IMF A;  2EC4 A;  4MZC A;  3FZA A;  2MMN A;  3WD6 A;  1PX7 A;  3F4R A;  3U5R E;  4MJB A;  5ECP B;  4OO5 A;  3UMA A;  4D73 A;  4BA7 A;  1ST9 A;  4MK3 A;  1EGR A;  4V2M A;  2B1K A;  3KM6 A;  2H0H A;  2B5E A;  5BMU A;  4GRF A;  2XBQ A;  3KH7 A;  2H1D A;  1K3Y A;  1JZW A;  2VCZ A;  3FRC A;  5A4W A;  3KTB A;  3L78 A;  5B8B A;  2CQ9 A;  3VI7 A;  2PUK C;  4WF5 A;  5AIX A;  1GUL A;  5DQS A;  4BL7 B;  4K0G A;  1ERV A;  3D6I A;  4N0Z A;  4DVC A;  4QQ7 A;  2H19 A;  2CAQ A;  4KAE A;  1RK4 A;  3FW2 A;  2YPM A;  3DVW A;  4FYC A;  5IMC A;  2YWI A;  1O85 A;  4MDC A;  5HR1 A;  4JR6 A;  2H0I A;  1TRV A;  3F6D A;  2ON7 A;  4NHZ A;  2VCV A;  1ABA A;  2XHF A;  4F82 A;  2LKU A;  5IO2 A;  5IMA A;  1TI3 A;  5IOW A;  2F51 A;  2KP1 A;  3I69 A;  1SJZ A;  1YDK A;  5DCH A;  3DVX A;  4X43 A;  3KEB A;  3MSZ A;  3OR5 A;  1U88 A;  3IR4 A;  1F6M C;  3IPZ A;  3BJ5 A;  2VCX A;  2D2Z A;  1W4V A;  5D9V A;  5F05 A;  1XZO A;  4YKF A;  3WT1 A;  5KOW A;  1GTU A;  2H1A A;  2RUE A;  2ALB A;  2A4H A;  4HQS A;  4MH2 A;  4EF0 A;  1T00 A;  4GLT A;  5ECK B;  2V32 A;  4XIH A;  1AQV A;  2GTU A;  5B7C A;  3FZ5 A;  1PGT A;  3UBL A;  3LQ7 A;  2A4V A;  3HVV A;  3CXG A;  3IXR A;  3EWL A;  1EZK A;  4X0X A;  1K3L A;  4FIW A;  4IQ1 A;  2IMI A;  4PQI A;  2GDR A;  3UBK A;  3G7I A;  2R0C A;  5D9T A;  1Z9H A;  2O89 A;  3IE3 A;  1PSQ A;  2YV7 A;  2HT9 A;  2MMA A;  4TKY A;  2R6K A;  4IEL A;  5CRD A;  4KH7 A;  2HSH A;  1Z7P A;  3FZ4 A;  3UL3 A;  4QL7 A;  1EOG A;  1SK2 A;  4WEY A;  4WKW A;  1T8E B;  4KDX A;  4LL4 B;  1KTE A;  2FLS A;  5EVO A;  3TOU A;  1F9M A;  2P31 A;  4YAP A;  3FY7 A;  4I2T A;  2UZ8 A;  1JHB A;  2F3M A;  3QD9 A;  3M9K A;  3CMI A;  5ECS A;  3H79 A;  2AV4 A;  5E59 A;  5AGY A;  2F9S A;  5CRG A;  1VF4 A;  3VPQ A;  2VM2 A;  2HE3 A;  1ML6 A;  2IN3 A;  5E4W A;  3FR3 A;  2QC7 A;  5DAL A;  4IJ3 A;  1A8Y A;  4LMV A;  1ZYP A;  3LWA A;  2OA7 A;  6GSU A;  3IV4 A;  2ON5 A;  3FKF A;  2YAN A;  4MZW A;  1S3D A;  1YQ1 A;  4CY8 A;  4OMV A;  4P3Y B;  1X9M B;  2LNT A;  1TU8 A;  3KXO A;  4K2X A;  4GQF A;  1PA3 A;  4EE0 A;  1WMJ A;  1EOH A;  3HA9 A;  1EV4 A;  4J57 E;  1HD2 A;  4USS A;  4L8E A;  3KP8 A;  2JZR A;  4IP1 A;  2OE1 A;  4BVY A;  2B7K A;  3TJG A;  3KJY A;  1M99 A;  3M9J A;  4LA1 A;  4AGS A;  1PD2 1;  1OC9 A;  3ZFB A;  2C4J A;  1YF0 A;  1G7E A;  2L4Q A;  2CZ3 A;  2LUS A;  2C0D A;  3VWW A;  4TW5 A;  1OKD A;  1XXU A;  1ERT A;  1MDK A;  1XBS A;  1K0N A;  1Q4J A;  2GST A;  2L59 A;  4AJ7 A;  2CV4 A;  3ERW A;  5AIS A;  5CYY A;  4TXO A;  2C1Y A;  3CSJ A;  3TJF A;  1GL8 A;  5GAN D;  2H6Y A;  5J5N A;  1O73 A;  2WS2 A;  1G6W A;  3CTF A;  4PUF C;  3GNJ A;  4V2L A;  4K9Z A;  3H8Q A;  1NHY A;  1NHO A;  2B5X A;  2H30 A;  1KNG A;  4BVX A;  1TW9 A;  2LQQ A;  1N2A A;  3P7X A;  3GV1 A;  1I5G A;  2IL3 A;  1MEK A;  2M72 A;  4F0B A;  5ECM B;  1SU9 A;  3TRQ A;  2PGT A;  1B48 A;  2X99 A;  5F8B A;  4BVY B;  1SL0 B;  1GUH A;  2O87 A;  2B1L A;  5DCG A;  1YKC A;  1IYI A;  4EVM A;  3WYW A;  2XBI A;  4ECJ A;  1GSF A;  1YJ6 A;  2JU5 A;  3VFI A;  3PGT A;  1OC8 A;  1OYJ A;  5A4U A;  3CRT A;  3ZVJ D;  2IMD A;  1FHE A;  5L71 A;  5ELG A;  5B6M A;  2JAC A;  2YNX A;  2PU9 C;  3KTL A;  2BMX A;  1JLV A;  1B9X C;  1C72 A;  2LEG A;  2OBI A;  1SD9 A;  4MNN A;  2HRK A;  3E0U A;  13GS A;  8GSS A;  2QKE A;  2XPD A;  5KN0 A;  5J4U A;  2RII A;  2GZY A;  2OAD A;  3FEU A;  2FWE A;  2C0E A;  4HSC X;  4ICY A;  3APQ A;  3GL3 A;  4MJC A;  2C3N A;  1QFN A;  1QUW A;  1PMT A;  2DKI A;  4KUN A;  4FQU A;  3CBU A;  5EY6 A;  2O8V B;  1AAZ A;  4G2E A;  3TB2 A;  3A5I A;  5LCZ A;  2IWT A;  2K6V A;  5G5F A;  4RUV A;  2H01 A;  3R2Q A;  4ECI A;  2O85 A;  4I8B A;  5ECR B;  5HR3 A;  4MP4 A;  3A2V A;  3EE2 A;  1T4Y A;  2E0Q A;  7GSS A;  5IQY A;  4PQH A;  2VCW A;  1XWB A;  3BBY A;  3UVH A;  3HVN A;  1TKD B;  5G30 A;  3D22 A;  1WIK A;  3F8U A;  3FR6 A;  4HZ2 A;  1Z6N A;  1QMV A;  4JR4 A;  4BWQ A;  2GS3 A;  2P5R A;  4TR1 B;  1AC1 A;  2R0G A;  4F03 A;  1GUM A;  4KE3 A;  2E7P A;  3IAS 2;  3TDG A;  3VWX A;  2L57 A;  1VGL A;  1URM A;  4GSN A;  4WF4 A;  3UAP A;  1SYX A;  4NHW A;  4N11 A;  2DJ3 A;  10GS A;  2VLT A;  3WGX A;  4O92 A;  2DIZ A;  3LOR A;  2WB9 A;  3C1S A;  1GTB A;  3GKK A;  4KCE A;  2C3Q A;  5G31 A;  4V1A p;  4TOP A;  5GZZ B;  4POM A;  1E6B A;  2H75 A;  3DML A;  4WR4 A;  1T4Z A;  5D9W A;  2FHE A;  4TR4 A;  1K0D A;  3KCM A;  1KEB A;  4HQZ A;  3P2A A;  1SKS B;  4MF6 A;  3L4N A;  2OAC A;  3UOM A;  3QDN A;  16GS A;  1OKT A;  2C0F A;  4BL7 A;  3NZN A;  4DEJ A;  1X0R A;  4Q5R A;  3PIN A;  5KN1 A;  1EEM A;  2L6D A;  2GSR A;  2VO4 A;  2LST A;  4BPY A;  1RQM A;  2CVB A;  4HZ4 A;  4KF9 A;  2IJY A;  1JZO A;  4NWY A;  2DMM A;  1TRU A;  2C80 A;  2MBT A;  3HJM A;  3D21 A;  5B8A A;  4EIP A;  2ZCT A;  4OO4 A;  5ABR A;  3LEF A;  4L0W A;  2YJH A;  4POL A;  3ZIT A;  2DML A;  4K5S A;  1LJR A;  1WJK A;  2CAI A;  2EIO A;  3TJJ A;  5EPF A;  2VM1 A;  3BOA A;  4ZB9 A;  2GZP A;  6GSX A;  2FWH A;  2LRN A;  3GA4 A;  3IOS A;  2AUV A;  4K8M A;  4TVE A;  3RHC A;  2B7J A;  1THX A;  2DBC A;  3TCO A;  5KOX A;  2AJQ B;  2LRT A;  2REM A;  1WE0 A;  3HJP A;  5IMV A;  5GST A;  2DJ2 A;  3IHQ A;  4IN0 A;  5JWR B;  2N5F A;  4Q5Q A;  4QL9 A;  4YQM A;  4IP6 A;  1M9B A;  3ME7 A;  3F4T A;  1MTC A;  3U6V A;  2VL9 A;  1FW1 A;  1HQO A;  1A2L A;  3TKQ A;  1J0F A;  1XOA A;  1X9S B;  1O8W A;  3GX0 A;  4ZL9 A;  2H73 A;  1A24 A;  3GKM A;  5D9X A;  3LW9 A;  2IMK A;  3TOT A;  3IAM 2;  4V1A g;  4GST A;  3EMX A;  4JRR A;  3EVI A;  2FNO A;  1Q98 A;  1B8X A;  3KZQ A;  1ON4 A;  3CSH A;  2VLU A;  3MIX A;  4EKZ A;  2OJL A;  1G6Y A;  1TI1 A;  2F8F A;  2CX4 A;  1X5C A;  2YZU A;  3EYT A;  2DKH A;  3GL5 A;  3ZIJ A;  4POK A;  2JAD A;  3D4T A;  2F8A A;  18GS A;  2B6M A;  4WR5 A;  1A2J A;  4E8E A;  3LYP A;  1N8J A;  22GS A;  2YJ7 A;  5AN1 A;  2VCT A;  1TK5 B;  3BCK A;  4MPG A;  3ZRD A;  3MWH A;  2GQL A;  1GSQ A;  2VIM A;  2OBK A;  3F0I A;  2FA8 A;  1WOU A;  2GLR A;  1FVK A;  3D4M A;  3A2W A;  3DKS A;  3GFK A;  1GRX A;  2X64 A;  1F3B A;  2GQK A;  1A0R P;  4BWS A;  5IPH A;  4CHS A;  2A2R A;  3TKS C;  2WFC A;  2R2J A;  5HR2 A;  4I5Q A;  2K8S A;  3VUR A;  3VWV A;  3FYG A;  3D0Z A;  1FB6 A;  1XW5 A;  1CQH A;  1F3A A;  3O6T A;  4CDO A;  1V58 A;  1K0C A;  3QPM A;  3ZML A;  1TU7 A;  5KEJ A;  4IGJ A;  4ZB6 A;  4WXT A;  3VWU A;  2AYT A;  1WPI A;  4ML1 A;  4XS1 A;  1K0M A;  2X8G A;  3ZFL A;  1DUG A;  2H74 A;  3R3E A;  2C0G A;  1XWC A;  4J2F A;  2DLX A;  4TN8 A;  4PTS A;  1TRS A;  4ISD A;  2YP6 A;  2XC2 A;  2LS5 A;  1PKZ A;  1R4W A;  4KDU A;  2L4C A;  1PRX A;  4Z7X A;  1PL2 A;  1BED A;  2WJU A;  3EUR A;  4TR3 A;  3CRU A;  2VD1 A;  3PH9 A;  2DJ0 A;  5G5E A;  1R5P A;  3GMF A;  2I81 A;  2V6O A;  1UN2 A;  3ERG A;  1E2Y A;  4FYU A;  4L5L A;  1HNC A;  2B3S A;  1X9W B;  5C00 A;  1GLQ A;  3RDW A;  2BTO T;  1TK0 B;  1OE8 A;  3GH9 A;  1AIU A;  1G0T A;  4WBJ A;  1GSU A;  4MA9 A;  2C8U A;  2K9F A;  2X8C A;  5ECN B;  2PMT A;  5DAK B;  5DJM A;  2FA4 A;  5H5S A;  2EIR A;  2HFD A;  1K0A A;  2EIQ A;  3CYN A;  2HSY A;  5ID2 B;  4O5R A;  2RM6 A;  4GSS A;  2RUF A;  3DRN A;  3E3E A;  2IFQ B;  4JBB A;  1ERU A;  3EMP A;  2V41 A;  3ZVJ A;  2VOC A;  4EIQ A;  1USB A;  4K1F A;  1BJX A;  2NBS A;  4PQ1 A;  3W8J A;  2YN1 A;  4ZIJ A;  1MD4 A;  1TOF A;  2LV3 A;  1A2M A;  1KBN A;  4EC0 A;  3F6F A;  3J7Y k;  1SD8 A;  2LRC A;  2H6Z A;  4K6X A;  1FO5 A;  5ECQ B;  3W6G A;  1SJI A;  3GSS A;  5J41 A;  1JZR A;  4YH2 A;  1VF3 A;  4LL1 B;  4TRX A;  1UVZ A;  3IDV A;  17GS A;  1PKW A;  1ACV A;  1XCC A;  1FG4 A;  2HSM A;  1XG8 A;  4ZBB A;  5F07 A;  2VL2 C;  3HCZ A;  3APO A;  2H1G A;  4OCE A;  4KSO A;  3VI5 A;  1XW6 A;  1XFL A;  1ZYN A;  1H4O A;  2X49 A;  3H4K A;  5CNW A;  3TKS A;  4CY6 A;  4RI6 A;  1V98 A;  5IOX A;  3LG6 A;  4NMU A;  3G9B A;  4XCS A;  1G7O A;  2G0F A;  2BJX A;  2NTO A;  3IHG A;  2ZNM A;  5DBQ A;  4PXO A;  2PER A;  3GST A;  1XIY A;  2PPT A;  2CA8 A;  1SL2 B;  3A5W A;  1VRS D;  3LFL A;  4TR1 A;  1TTZ A;  2C3T A;  2IPA A;  5CP1 A;  3H1N A;  5FHI A;  1HYU A;  1OC3 A;  3GYK A;  1T7P B;  3O76 A;  1MDJ A;  4EUY A;  3KH9 A;  1AW9 A;  2HRA A;  2LJK A;  1S3R A;  3LSZ A;  1J08 A;  1EWX A;  4MCU A;  5ELA A;  3WT2 A;  1ILO A;  1B4P A;  1GSS A;  4N0V A;  2GVP A;  1X5D A;  3IC8 A;  4KX4 A;  4FYB A;  2I1U A;  3O3T A;  2OKA A;  4H86 A;  3QOU A;  1K0B A;  1X5E A;  2HZE A;  1OAZ A;  1H75 A;  4ULX A;  4DSQ A;  4X1U A;  3VLN A;  3Q74 A;  2R4V A;  1M2D A;  1PL1 A;  3HHV A;  3LXT A;  5JCG A;  1YY7 A;  3HD5 A;  5J9C A;  4JZQ A;  3HVX A;  1TK8 B;  1FOV A;  2QA1 A;  1U6T A;  4G9H A;  3C7M A;  5IIZ A;  1GH2 A;  2PWJ A;  4N30 A;  4GXZ A;  1M2B A;  4ZIL A;  2ES7 A;  3KP9 A;  4Z2R A;  1Y6E A;  4J56 E;  5ENU A;  3TKS E;  3F3R A;  1DE2 A;  2YOI A;  1PQN A;  2KLX A;  4YQU A;  1MD3 A;  1B4Q A;  4G0K A;  5JWQ B;  3N5O A;  3C73 A;  3ZL5 A;  3K8N A;  4IKH A;  4PUR A;  4EO3 A;  3BD2 A;  3KMO A;  1XWG A;  2TRC P;  4L0U A;  4KND A;  2TRX A;  1GSY A;  3QMX A;  5D96 A;  2DJJ A;  2GSS A;  4Q5F A;  2PN8 A;  1J9B A;  5IPG A;  4DSR A;  3J7Y b;  3EPT A;  4OCF A;  4MF7 A;  2MMO A;  2HZE B;  3UJ1 A;  5IM9 A;  1XW9 A;  4PX1 A;  2YWN A;  2R3X A;  2YV9 A;  1XWA A;  3LXZ A;  5H5R A;  2JL4 A;  5FWG A;  2HZF A;  3RBT A;  14GS A;  1EP8 A;  1LU4 A;  2E2M A;  2YZH A;  4ZBA A;  1AXD A;  2VL2 A;  4F9Z A;  4EL1 A;  1O7U A;  2FWF A;  4GQC A;  4K7I A;  2J9H A;  3C8E A;  3PR8 A;  1Y25 A;  2CX3 A;  4LLR A;  5H5Q A;  2H72 A;  4G19 A;  2H6X A;  2JSY A;  4ILF A;  3IA1 A;  4XHM A;  2GSQ A;  4PNF A;  3KIJ A;  3KD0 A;  4IBP A;  1GTA A;  1U3A A;  4GWR A;  3C71 A;  1FVJ A;  3Q18 A;  2PVQ A;  5GSS A;  4PUA A;  2FGX A;  3I43 A;  4IQA A;  2X8H A;  3QCP A;  3DWV A;  2LQO A;  3QR6 A;  4IS0 A;  1GSD A;  4BIK A;  1QGV A;  2J23 A;  2R0P A;  4O7H A;  1GWC A;  3TGZ A;  3ZMK A;  4KSM A;  1A8L A;  3F9U A;  1JZD A;  3W8S A;  4PGT A;  4OWY A;  4ZL7 A;  2MBS A;  5J9B A;  4YKG A;  4TXV A;  1BG5 A;  2DJK A;  1IYH A;  3GTU B;  3M3M A;  2LTK A;  1ZCP A;  5CRH A;  4K0N A;  4KB3 A;  6GSV A;  2RLI A;  2KOK A;  1ZL9 A;  2I9H A;  1F37 A;  1WRY A;  1PFO A;  3I9V 2;  3NOF A;  4KDY A;  4O32 A;  3A3T A;  2FUG 2;  1VF1 A;  2WDU A;  3TJB A;  1DSB A;  3UVT A;  1GNW A;  1S3C A;  4G0I A;  4MMM A;  4AF2 A;  3SBC A;  3L0H A;  4ACS A;  3N9J A;  3VPT A;  2IIY A;  4MF5 A;  1ZGN A;  3IK7 A;  3G7J A;  3PPU A;  3L9V A;  1OE7 A;  5LD0 A;  5HQP A;  1SL1 B;  2PVO C;  3ISO A;  1AQX A;  1DBY A;  3GKN A;  3US3 A;  4FH8 A;  1QXH A;  3ZTL A;  5JCW A;  3RAZ A;  1XOB A;  3CTG A;  6GSW A;  2R5G A;  5COH A;  2VD0 A;  1GLP A;  4PNG A;  3DIE A;  1AQW A;  2I3Y A;  5DQY A;  2WCI A;  1NM3 A;  1OVN A;  5D8I A;  4HUA A;  3Q19 A;  4HS1 A;  4AJ6 A;  2H0G A;  4O5Q A;  1SJ6 A;  6GST A;  5G1L A;  3GHA A;  1UA5 A;  4GCI A;  3ZRE A;  5JWO B;  4D73 B;  5CRE A;  3ZZX A;  1Z7R A;  3C1R A;  4Z2U A;  1HNA A;  2H8L A;  4XTS A;  5CO3 A;  1R5A A;  3IRA A;  1R7H A;  3QAW A;  4JED A;  4KCA A;  5HFK A;  4XRD A;  1FB0 A;  1XPV A;  1BX9 A;  2R37 A;  3GN3 A;  3MNG A;  1XVW A;  1TXX A;  2B5Y A;  4HDE A;  1WP0 A;  2X4A A;  3WGE A;  4ZBD A;  5DAK A;  3LGC A;  5HR0 A;  2HNL A;  3GH6 A;  5A5K A;  5ID2 A;  1LBK A;  3VK9 A;  5J3R A;  4LMW A;  4HJ2 A;  5EL8 A;  2IFQ A;  2MZC A;  1Z5Y E;  4ECB A;  1YEP A;  1A0F A;  1GNE A;  1BQ7 A;  3H93 A;  4FO5 A;  1YEX A;  6GSS A;  1ZYE A;  3HDC A;  3A2X A;  2L5L A;  2CVD A;  1M3J A;  4KW6 A;  3UEM A;  2H76 A;  3KGK A;  1T3B A;  5DVB A;  5F0G A;  4EDZ A;  3EC3 A;  2HRN A;  2DSA A;  2HRF A;  3NIV A;  4WBR D;  3ED3 A;  1O8X A;  1V9W A;  2A2S A;  2MYG A;  2WZ9 A;  1QK8 A;  4X4J A;  2JZT A;  4XRA A;  2I4A A;  4CW9 A;  3HJO A;  1EGO A;  1YF1 A;  4I97 A;  2AB6 A;  9GSS A;  5F06 A;  3IC4 A;  2V2G A;  3F3Q A;  4G0L A;  3V1W A;  3ZLP A;  1F2E A;  3GIX A;  3CSI A;  3HKR A;  3HZ4 A;  1M0U A;  3F4S A;  3EU3 A;  3DEX A;  1UC7 A;  1BAY A;  1XWK A;  5INY A;  1T1V A;  2KHP A;  3TJK A;  4EDY A;  4L5O A;  1M7T A;  2PBJ A;  3WGD A;  2KUC A;  2CZ2 A;  2HXK A;  5D73 A;  3KMN A;  4HU9 A;  4AJ8 A;  1TJD A;  4XS6 A;  3QFB C;  4ID0 A;  3TRP A;  1V57 A;  2LJA A;  4MH3 A;  3APS A;  3FHK A;  1NSW A;  4ZL8 A;  5A4V A;  1U3I A;  2WRT A;  1A23 A;  3CQF A;  2LNS A;  2NPB A;  3IBH A;  4K5R A;  1I9D A;  2O7K A;  1XVQ A;  5B6N A;  3DYR A;  2WUL A;  2P5Q A;  2RM5 A;  2YCD A;  4K7O A;  2IMF A;  3FK8 A;  2FD3 A;  4EXJ A;  3DGQ A;  1EP7 A;  1Z3E A;  2ZUP A;  5ECH B;  4F2I A;  5CRW A;  3RHB A;  2M46 A;  2KP2 A;  5DDL A;  12GS A;  3LYK A;  5FT3 A;  3MYD A;  5DAL B;  4I6X A;  2FWG A;  3BCI A;  4ZB8 A;  2VCQ A;  3GUR A;  2L5O A;  2OE0 A;  4YQV A;  4NXI A;  1SK1 A;  2H66 A;  3AY8 A;  1YZX A;  11GS A;  4Q5N A;  2MMZ A;  2LJR A;  1CQG A;  4Z2T A;  5G1K A;  6GSY A;  3M1G A;  4HJM A;  3TKP A;  2NVL A;  4JE1 A;  3S9F A;  1GUK A;  2TIR A;  3I6A A;  2FCH A;  4IHU A;  4I2U A;  4GTU A;  1RW1 A;  4E8H A;  2AAW A;  5AIV A;  2XPE A;  2DC5 A;  3EIN A;  5ECO B;  4POB A;  1ZYQ B;  4RQR A;  2P0G A;  2M80 A;  1V40 A;  3GUS A;  3P90 A;  1M3I A;  2N5A A;  1OC9 B;  5IMD A;  5HFG A;  3F63 A;  2JZS A;  4K7N A;  2GT6 A;  2GZZ A;  1O6J A;  2VL3 A;  1GSE A;  2L6C A;  1THO A;  3RPN A;  2HYX A;  2N5B A;  3GX8 A;  2V6K A;  4F0C A;  1NW2 A;  1SK0 A;  1FAA A;  5LNK e;  1PN9 A;  3M0F A;  4KA0 A;  3GRX A;  1EV9 A;  3ZYW A;  1ZZY A;  3IK9 A;  4TXO B;  3ME8 A;  1JLW A;  1TRW A;  4ZXG A;  2NDO A;  3EU4 A;  4NV5 A;  3QFA C;  3P8W A;  1FOH A;  4N10 A;  2GGT A;  5C04 A;  3TKR A;  5DJL A;  1DE1 A;  3Q6O A;  3D5J A;  2A2P A;  2AHE A;  4K2D A;  3LJR A;  4DSS A;  1SKW B;  3QAV A;  4BVX B;  1ZMA A;  1SEN A;  2OE3 A;  4MJA A;  1SYR A;  2WGR A;  1Z6M A;  3HYP A;  4G10 A;  1PX6 A;  1GTI A;  2YWO A;  2VAF A;  4A5P A;  1M9A A;  4O5U A;  3HY2 A;  1WWJ A;  5IMZ A;  3HZ8 A;  4MJE A;  1GP1 A;  5CAX A;  4OFN A;  3E9J B;  4IJI A;  4HOJ A;  1AUC A;  1SKR B;  1O81 A;  4ECC A;  1JFU A;  4MPF A;  1S3A A;  2HLS A;  2VUP A;  4OFT A;  2DIY A;  3TRX A;  4RI7 A;  1MDI A;  1R26 A;  1K3O A;  1W89 A;  2HI7 A;  2QGV A;  4HI7 A;  4MLY A;  3RPP A;  4KGI A;  1ERW A;  4YAV A;  2JSZ A;  2QSI A;  3FZ9 A;  3UIW A;  2DJ1 A;  19GS A;  1TDI A;  1ZOF A;  5KN3 A; 
#chains in the Genus database with same CATH homology
 4XS4 A;  20GS A;  2FY6 A;  4IVF A;  4MZB A;  5GAP D;  2GT5 A;  2E2G A;  2H70 A;  4HU7 A;  1V2A A;  3GTU A;  3L9U A;  5ECL B;  3G7Y A;  3SWL A;  2K18 A;  3FR9 A;  4V2N A;  4NAX A;  4OFM A;  2QA2 A;  4DSS B;  2CVK A;  1HNB A;  5BRT A;  2H71 A;  4HEA 2;  4TR0 A;  2IME A;  2Z9S A;  1U87 A;  5HFI A;  1YKA A;  2GQM A;  4NV2 A;  1EEJ A;  1TP9 A;  1BYE A;  5ECI B;  4JU5 A;  3UAR A;  2V1M A;  3FMW A;  3ERF A;  3M8N A;  2VLV A;  5KN2 A;  3JCM L;  1VF2 A;  4RQX A;  4WET A;  5JCU A;  3GKX A;  3L9S A;  4OD7 A;  1M2A A;  1PN0 A;  3QAG A;  5IO0 A;  4GF0 A;  3DXB A;  2K8V A;  5G2Z A;  4MAB A;  3DD3 A;  4IW9 A;  1K0O A;  4ML6 A;  3HVS A;  3TUE A;  3MAK A;  4NPB A;  3MDK A;  3ZIV A;  2YWM A;  2H1B A;  5D93 A;  1B9Y C;  1QQ2 A;  2CT6 A;  4XS4 B;  2G2Q A;  3HXS A;  5IMF A;  2EC4 A;  4MZC A;  3FZA A;  2MMN A;  3WD6 A;  1PX7 A;  3F4R A;  3U5R E;  4MJB A;  5ECP B;  4OO5 A;  3UMA A;  4D73 A;  4BA7 A;  1ST9 A;  4MK3 A;  1EGR A;  4V2M A;  2B1K A;  3KM6 A;  2H0H A;  2B5E A;  5BMU A;  4GRF A;  2XBQ A;  3KH7 A;  2H1D A;  1K3Y A;  1JZW A;  2VCZ A;  3FRC A;  5A4W A;  3KTB A;  3L78 A;  5B8B A;  2CQ9 A;  3VI7 A;  2PUK C;  4WF5 A;  5AIX A;  1GUL A;  5DQS A;  4BL7 B;  4K0G A;  1ERV A;  3D6I A;  4N0Z A;  4DVC A;  4QQ7 A;  2H19 A;  2CAQ A;  4KAE A;  1RK4 A;  3FW2 A;  2YPM A;  3DVW A;  4FYC A;  5IMC A;  2YWI A;  1O85 A;  4MDC A;  5HR1 A;  4JR6 A;  2H0I A;  1TRV A;  3F6D A;  2ON7 A;  4NHZ A;  2VCV A;  1ABA A;  2XHF A;  4F82 A;  2LKU A;  5IO2 A;  5IMA A;  1TI3 A;  5IOW A;  2F51 A;  2KP1 A;  3I69 A;  1SJZ A;  1YDK A;  5DCH A;  3DVX A;  4X43 A;  3KEB A;  3MSZ A;  3OR5 A;  1U88 A;  3IR4 A;  1F6M C;  3IPZ A;  3BJ5 A;  2VCX A;  2D2Z A;  1W4V A;  5D9V A;  5F05 A;  1XZO A;  4YKF A;  3WT1 A;  5KOW A;  1GTU A;  2H1A A;  2RUE A;  2ALB A;  2A4H A;  4HQS A;  4MH2 A;  4EF0 A;  1T00 A;  4GLT A;  5ECK B;  2V32 A;  4XIH A;  1AQV A;  2GTU A;  5B7C A;  3FZ5 A;  1PGT A;  3UBL A;  3LQ7 A;  2A4V A;  3HVV A;  3CXG A;  3IXR A;  3EWL A;  1EZK A;  4X0X A;  1K3L A;  4FIW A;  4IQ1 A;  2IMI A;  4PQI A;  2GDR A;  3UBK A;  3G7I A;  2R0C A;  5D9T A;  1Z9H A;  2O89 A;  3IE3 A;  1PSQ A;  2YV7 A;  2HT9 A;  2MMA A;  4TKY A;  2R6K A;  4IEL A;  5CRD A;  4KH7 A;  2HSH A;  1Z7P A;  3FZ4 A;  3UL3 A;  4QL7 A;  1EOG A;  1SK2 A;  4WEY A;  4WKW A;  1T8E B;  4KDX A;  4LL4 B;  1KTE A;  2FLS A;  5EVO A;  3TOU A;  1F9M A;  2P31 A;  4YAP A;  3FY7 A;  4I2T A;  2UZ8 A;  1JHB A;  2F3M A;  3QD9 A;  3M9K A;  3CMI A;  5ECS A;  3H79 A;  2AV4 A;  5E59 A;  5AGY A;  2F9S A;  5CRG A;  1VF4 A;  3VPQ A;  2VM2 A;  2HE3 A;  1ML6 A;  2IN3 A;  5E4W A;  3FR3 A;  2QC7 A;  5DAL A;  4IJ3 A;  1A8Y A;  4LMV A;  1ZYP A;  3LWA A;  2OA7 A;  6GSU A;  3IV4 A;  2ON5 A;  3FKF A;  2YAN A;  4MZW A;  1S3D A;  1YQ1 A;  4CY8 A;  4OMV A;  4P3Y B;  1X9M B;  2LNT A;  1TU8 A;  3KXO A;  4K2X A;  4GQF A;  1PA3 A;  4EE0 A;  1WMJ A;  1EOH A;  3HA9 A;  1EV4 A;  4J57 E;  1HD2 A;  4USS A;  4L8E A;  3KP8 A;  2JZR A;  4IP1 A;  2OE1 A;  4BVY A;  2B7K A;  3TJG A;  3KJY A;  1M99 A;  3M9J A;  4LA1 A;  4AGS A;  1PD2 1;  1OC9 A;  3ZFB A;  2C4J A;  1YF0 A;  1G7E A;  2L4Q A;  2CZ3 A;  2LUS A;  2C0D A;  3VWW A;  4TW5 A;  1OKD A;  1XXU A;  1ERT A;  1MDK A;  1XBS A;  1K0N A;  1Q4J A;  2GST A;  2L59 A;  4AJ7 A;  2CV4 A;  3ERW A;  5AIS A;  5CYY A;  4TXO A;  2C1Y A;  3CSJ A;  3TJF A;  1GL8 A;  5GAN D;  2H6Y A;  5J5N A;  1O73 A;  2WS2 A;  1G6W A;  3CTF A;  4PUF C;  3GNJ A;  4V2L A;  4K9Z A;  3H8Q A;  1NHY A;  1NHO A;  2B5X A;  2H30 A;  1KNG A;  4BVX A;  1TW9 A;  2LQQ A;  1N2A A;  3P7X A;  3GV1 A;  1I5G A;  2IL3 A;  1MEK A;  2M72 A;  4F0B A;  5ECM B;  1SU9 A;  3TRQ A;  2PGT A;  1B48 A;  2X99 A;  5F8B A;  4BVY B;  1SL0 B;  1GUH A;  2O87 A;  2B1L A;  5DCG A;  1YKC A;  1IYI A;  4EVM A;  3WYW A;  2XBI A;  4ECJ A;  1GSF A;  1YJ6 A;  2JU5 A;  3VFI A;  3PGT A;  1OC8 A;  1OYJ A;  5A4U A;  3CRT A;  3ZVJ D;  2IMD A;  1FHE A;  5L71 A;  5ELG A;  5B6M A;  2JAC A;  2YNX A;  2PU9 C;  3KTL A;  2BMX A;  1JLV A;  1B9X C;  1C72 A;  2LEG A;  2OBI A;  1SD9 A;  4MNN A;  2HRK A;  3E0U A;  13GS A;  8GSS A;  2QKE A;  2XPD A;  5KN0 A;  5J4U A;  2RII A;  2GZY A;  2OAD A;  3FEU A;  2FWE A;  2C0E A;  4ICY A;  3APQ A;  3GL3 A;  4MJC A;  2C3N A;  1QFN A;  1QUW A;  1PMT A;  2DKI A;  4KUN A;  4FQU A;  3CBU A;  5EY6 A;  2O8V B;  1AAZ A;  4G2E A;  3TB2 A;  3A5I A;  5LCZ A;  2IWT A;  2K6V A;  5G5F A;  4RUV A;  2H01 A;  3R2Q A;  4ECI A;  2O85 A;  4I8B A;  5ECR B;  5HR3 A;  4MP4 A;  3A2V A;  3EE2 A;  1T4Y A;  2E0Q A;  7GSS A;  5IQY A;  4PQH A;  2VCW A;  1XWB A;  3BBY A;  3UVH A;  1TKD B;  5G30 A;  3D22 A;  1WIK A;  3F8U A;  3FR6 A;  4HZ2 A;  1Z6N A;  1QMV A;  4JR4 A;  4BWQ A;  2GS3 A;  2P5R A;  4TR1 B;  1AC1 A;  2R0G A;  4F03 A;  1GUM A;  4KE3 A;  2E7P A;  3IAS 2;  3TDG A;  3VWX A;  2L57 A;  1VGL A;  1URM A;  4GSN A;  4WF4 A;  3UAP A;  1SYX A;  4NHW A;  4N11 A;  2DJ3 A;  10GS A;  2VLT A;  3WGX A;  4O92 A;  2DIZ A;  3LOR A;  2WB9 A;  3C1S A;  1GTB A;  3GKK A;  4KCE A;  2C3Q A;  5G31 A;  4V1A p;  4TOP A;  5GZZ B;  4POM A;  1E6B A;  2H75 A;  3DML A;  4WR4 A;  1T4Z A;  5D9W A;  2FHE A;  4TR4 A;  1K0D A;  3KCM A;  1KEB A;  4HQZ A;  3P2A A;  1SKS B;  4MF6 A;  3L4N A;  2OAC A;  3UOM A;  3QDN A;  16GS A;  1OKT A;  2C0F A;  4BL7 A;  3NZN A;  4DEJ A;  1X0R A;  4Q5R A;  3PIN A;  5KN1 A;  1EEM A;  2L6D A;  2GSR A;  2VO4 A;  2LST A;  4BPY A;  1RQM A;  2CVB A;  4HZ4 A;  4KF9 A;  2IJY A;  1JZO A;  4NWY A;  2DMM A;  1TRU A;  2C80 A;  2MBT A;  3HJM A;  3D21 A;  5B8A A;  4EIP A;  2ZCT A;  4OO4 A;  5ABR A;  3LEF A;  4L0W A;  2YJH A;  4POL A;  3ZIT A;  2DML A;  4K5S A;  1LJR A;  1WJK A;  2CAI A;  2EIO A;  3TJJ A;  5EPF A;  2VM1 A;  3BOA A;  4ZB9 A;  2GZP A;  6GSX A;  2FWH A;  2LRN A;  3GA4 A;  3IOS A;  2AUV A;  4K8M A;  4TVE A;  3RHC A;  2B7J A;  1THX A;  2DBC A;  3TCO A;  5KOX A;  2AJQ B;  2LRT A;  2REM A;  1WE0 A;  3HJP A;  5IMV A;  5GST A;  2DJ2 A;  3IHQ A;  4IN0 A;  5JWR B;  2N5F A;  4Q5Q A;  4QL9 A;  4YQM A;  4IP6 A;  1M9B A;  3ME7 A;  3F4T A;  1MTC A;  3U6V A;  2VL9 A;  1FW1 A;  1HQO A;  1A2L A;  3TKQ A;  1J0F A;  1XOA A;  1X9S B;  1O8W A;  3GX0 A;  4ZL9 A;  2H73 A;  1A24 A;  3GKM A;  5D9X A;  3LW9 A;  2IMK A;  3TOT A;  3IAM 2;  4V1A g;  4GST A;  3EMX A;  4JRR A;  3EVI A;  2FNO A;  1Q98 A;  1B8X A;  3KZQ A;  1ON4 A;  3CSH A;  2VLU A;  3MIX A;  4EKZ A;  2OJL A;  1G6Y A;  1TI1 A;  2F8F A;  2CX4 A;  1X5C A;  2YZU A;  3EYT A;  2DKH A;  3GL5 A;  3ZIJ A;  4POK A;  2JAD A;  3D4T A;  2F8A A;  18GS A;  2B6M A;  4WR5 A;  1A2J A;  4E8E A;  3LYP A;  1N8J A;  22GS A;  2YJ7 A;  5AN1 A;  2VCT A;  1TK5 B;  3BCK A;  4MPG A;  3ZRD A;  3MWH A;  2GQL A;  1GSQ A;  2VIM A;  2OBK A;  3F0I A;  2FA8 A;  1WOU A;  2GLR A;  1FVK A;  3D4M A;  3A2W A;  3DKS A;  3GFK A;  1GRX A;  2X64 A;  1F3B A;  2GQK A;  1A0R P;  4BWS A;  5IPH A;  4CHS A;  2A2R A;  3TKS C;  2WFC A;  2R2J A;  5HR2 A;  4I5Q A;  2K8S A;  3VUR A;  3VWV A;  3FYG A;  3D0Z A;  1FB6 A;  1XW5 A;  1CQH A;  1F3A A;  3O6T A;  4CDO A;  1V58 A;  1K0C A;  3QPM A;  3ZML A;  1TU7 A;  5KEJ A;  4IGJ A;  4ZB6 A;  4WXT A;  3VWU A;  2AYT A;  1WPI A;  4ML1 A;  4XS1 A;  1K0M A;  2X8G A;  3ZFL A;  1DUG A;  2H74 A;  3R3E A;  2C0G A;  1XWC A;  4J2F A;  2DLX A;  4TN8 A;  4PTS A;  1TRS A;  4ISD A;  2YP6 A;  2XC2 A;  2LS5 A;  1PKZ A;  1R4W A;  4KDU A;  2L4C A;  1PRX A;  4Z7X A;  1PL2 A;  1BED A;  2WJU A;  3EUR A;  4TR3 A;  3CRU A;  2VD1 A;  3PH9 A;  2DJ0 A;  5G5E A;  1R5P A;  3GMF A;  2I81 A;  2V6O A;  1UN2 A;  3ERG A;  1E2Y A;  4FYU A;  4L5L A;  1HNC A;  2B3S A;  1X9W B;  5C00 A;  1GLQ A;  3RDW A;  2BTO T;  1TK0 B;  1OE8 A;  3GH9 A;  1AIU A;  1G0T A;  4WBJ A;  1GSU A;  4MA9 A;  2C8U A;  2K9F A;  2X8C A;  5ECN B;  2PMT A;  5DAK B;  5DJM A;  2FA4 A;  5H5S A;  2EIR A;  2HFD A;  1K0A A;  2EIQ A;  3CYN A;  2HSY A;  5ID2 B;  4O5R A;  2RM6 A;  4GSS A;  2RUF A;  3DRN A;  3E3E A;  2IFQ B;  4JBB A;  1ERU A;  3EMP A;  2V41 A;  3ZVJ A;  2VOC A;  4EIQ A;  1USB A;  4K1F A;  1BJX A;  2NBS A;  4PQ1 A;  3W8J A;  2YN1 A;  4ZIJ A;  1MD4 A;  1TOF A;  2LV3 A;  1A2M A;  1KBN A;  4EC0 A;  3F6F A;  3J7Y k;  1SD8 A;  2LRC A;  2H6Z A;  4K6X A;  1FO5 A;  5ECQ B;  3W6G A;  1SJI A;  3GSS A;  5J41 A;  1JZR A;  4YH2 A;  1VF3 A;  4LL1 B;  4TRX A;  1UVZ A;  3IDV A;  17GS A;  1PKW A;  1ACV A;  1XCC A;  1FG4 A;  2HSM A;  4ZBB A;  5F07 A;  2VL2 C;  3HCZ A;  3APO A;  2H1G A;  4OCE A;  4KSO A;  3VI5 A;  1XW6 A;  1XFL A;  1ZYN A;  1H4O A;  2X49 A;  3H4K A;  5CNW A;  3TKS A;  4CY6 A;  4RI6 A;  1V98 A;  5IOX A;  3LG6 A;  4NMU A;  3G9B A;  4XCS A;  1G7O A;  2G0F A;  2BJX A;  2NTO A;  3IHG A;  2ZNM A;  5DBQ A;  4PXO A;  2PER A;  3GST A;  1XIY A;  2PPT A;  2CA8 A;  1SL2 B;  3A5W A;  1VRS D;  3LFL A;  4TR1 A;  1TTZ A;  2C3T A;  2IPA A;  5CP1 A;  3H1N A;  5FHI A;  1HYU A;  1OC3 A;  3GYK A;  1T7P B;  3O76 A;  1MDJ A;  4EUY A;  3KH9 A;  1AW9 A;  2HRA A;  2LJK A;  3LSZ A;  1J08 A;  1EWX A;  4MCU A;  5ELA A;  3WT2 A;  1ILO A;  1B4P A;  1GSS A;  4N0V A;  2GVP A;  1X5D A;  3IC8 A;  4KX4 A;  4FYB A;  2I1U A;  3O3T A;  2OKA A;  4H86 A;  3QOU A;  1K0B A;  1X5E A;  2HZE A;  1OAZ A;  1H75 A;  4ULX A;  4DSQ A;  4X1U A;  3VLN A;  3Q74 A;  2R4V A;  1M2D A;  1PL1 A;  3HHV A;  3LXT A;  5JCG A;  1YY7 A;  3HD5 A;  5J9C A;  4JZQ A;  3HVX A;  1TK8 B;  1FOV A;  2QA1 A;  1U6T A;  4G9H A;  3C7M A;  5IIZ A;  1GH2 A;  2PWJ A;  4N30 A;  4GXZ A;  1M2B A;  4ZIL A;  2ES7 A;  3KP9 A;  4Z2R A;  1Y6E A;  4J56 E;  5ENU A;  3TKS E;  3F3R A;  1DE2 A;  2YOI A;  1PQN A;  2KLX A;  4YQU A;  1MD3 A;  1B4Q A;  4G0K A;  5JWQ B;  3N5O A;  3C73 A;  3ZL5 A;  3K8N A;  4IKH A;  4PUR A;  4EO3 A;  3BD2 A;  3KMO A;  1XWG A;  2TRC P;  4L0U A;  4KND A;  2TRX A;  1GSY A;  3QMX A;  5D96 A;  2DJJ A;  2GSS A;  4Q5F A;  2PN8 A;  1J9B A;  5IPG A;  4DSR A;  3J7Y b;  3EPT A;  4OCF A;  4MF7 A;  2MMO A;  2HZE B;  3UJ1 A;  5IM9 A;  1XW9 A;  4PX1 A;  2YWN A;  2R3X A;  2YV9 A;  1XWA A;  3LXZ A;  5H5R A;  2JL4 A;  5FWG A;  2HZF A;  3RBT A;  14GS A;  1EP8 A;  1LU4 A;  2E2M A;  2YZH A;  4ZBA A;  1AXD A;  2VL2 A;  4F9Z A;  4EL1 A;  1O7U A;  2FWF A;  4GQC A;  4K7I A;  2J9H A;  3C8E A;  3PR8 A;  1Y25 A;  2CX3 A;  4LLR A;  5H5Q A;  2H72 A;  4G19 A;  2H6X A;  2JSY A;  4ILF A;  3IA1 A;  4XHM A;  2GSQ A;  4PNF A;  3KIJ A;  3KD0 A;  4IBP A;  1GTA A;  1U3A A;  4GWR A;  3C71 A;  1FVJ A;  3Q18 A;  2PVQ A;  5GSS A;  4PUA A;  2FGX A;  3I43 A;  4IQA A;  2X8H A;  3QCP A;  3DWV A;  2LQO A;  3QR6 A;  4IS0 A;  1GSD A;  1QGV A;  2J23 A;  2R0P A;  4O7H A;  1GWC A;  3TGZ A;  3ZMK A;  4KSM A;  1A8L A;  3F9U A;  1JZD A;  3W8S A;  4PGT A;  4OWY A;  4ZL7 A;  2MBS A;  5J9B A;  4YKG A;  4TXV A;  1BG5 A;  2DJK A;  1IYH A;  3GTU B;  3M3M A;  2LTK A;  1ZCP A;  5CRH A;  4K0N A;  4KB3 A;  6GSV A;  2RLI A;  2KOK A;  1ZL9 A;  2I9H A;  1F37 A;  1WRY A;  3I9V 2;  3NOF A;  4KDY A;  4O32 A;  3A3T A;  2FUG 2;  1VF1 A;  2WDU A;  3TJB A;  1DSB A;  3UVT A;  1GNW A;  1S3C A;  4G0I A;  4MMM A;  4AF2 A;  3SBC A;  3L0H A;  4ACS A;  3N9J A;  3VPT A;  2IIY A;  4MF5 A;  1ZGN A;  3IK7 A;  3G7J A;  3PPU A;  3L9V A;  1OE7 A;  5LD0 A;  5HQP A;  1SL1 B;  2PVO C;  3ISO A;  1AQX A;  1DBY A;  3GKN A;  3US3 A;  4FH8 A;  1QXH A;  3ZTL A;  5JCW A;  3RAZ A;  1XOB A;  3CTG A;  6GSW A;  2R5G A;  5COH A;  2VD0 A;  1GLP A;  4PNG A;  3DIE A;  1AQW A;  2I3Y A;  5DQY A;  2WCI A;  1NM3 A;  1OVN A;  5D8I A;  4HUA A;  3Q19 A;  4HS1 A;  4AJ6 A;  2H0G A;  4O5Q A;  1SJ6 A;  6GST A;  5G1L A;  3GHA A;  1UA5 A;  4GCI A;  3ZRE A;  5JWO B;  4D73 B;  5CRE A;  3ZZX A;  1Z7R A;  3C1R A;  4Z2U A;  1HNA A;  2H8L A;  4XTS A;  5CO3 A;  1R5A A;  3IRA A;  1R7H A;  3QAW A;  4JED A;  4KCA A;  5HFK A;  4XRD A;  1FB0 A;  1XPV A;  1BX9 A;  2R37 A;  3GN3 A;  3MNG A;  1XVW A;  1TXX A;  2B5Y A;  4HDE A;  1WP0 A;  2X4A A;  3WGE A;  4ZBD A;  5DAK A;  3LGC A;  5HR0 A;  2HNL A;  3GH6 A;  5A5K A;  5ID2 A;  1LBK A;  3VK9 A;  5J3R A;  4LMW A;  4HJ2 A;  5EL8 A;  2IFQ A;  2MZC A;  1Z5Y E;  4ECB A;  1YEP A;  1A0F A;  1GNE A;  1BQ7 A;  3H93 A;  4FO5 A;  1YEX A;  6GSS A;  1ZYE A;  3HDC A;  3A2X A;  2L5L A;  2CVD A;  4KW6 A;  3UEM A;  2H76 A;  3KGK A;  1T3B A;  5DVB A;  5F0G A;  4EDZ A;  3EC3 A;  2HRN A;  2DSA A;  2HRF A;  3NIV A;  4WBR D;  3ED3 A;  1O8X A;  1V9W A;  2A2S A;  2MYG A;  2WZ9 A;  1QK8 A;  4X4J A;  2JZT A;  4XRA A;  2I4A A;  4CW9 A;  3HJO A;  1EGO A;  1YF1 A;  4I97 A;  2AB6 A;  9GSS A;  5F06 A;  3IC4 A;  2V2G A;  3F3Q A;  4G0L A;  3V1W A;  3ZLP A;  1F2E A;  3GIX A;  3CSI A;  3HKR A;  3HZ4 A;  1M0U A;  3F4S A;  3EU3 A;  3DEX A;  1UC7 A;  1BAY A;  1XWK A;  5INY A;  1T1V A;  2KHP A;  3TJK A;  4EDY A;  4L5O A;  1M7T A;  2PBJ A;  3WGD A;  2KUC A;  2CZ2 A;  2HXK A;  5D73 A;  3KMN A;  4HU9 A;  4AJ8 A;  1TJD A;  4XS6 A;  3QFB C;  4ID0 A;  3TRP A;  1V57 A;  2LJA A;  4MH3 A;  3APS A;  3FHK A;  1NSW A;  4ZL8 A;  5A4V A;  1U3I A;  2WRT A;  1A23 A;  2LNS A;  2NPB A;  3IBH A;  4K5R A;  1I9D A;  2O7K A;  1XVQ A;  5B6N A;  3DYR A;  2WUL A;  2P5Q A;  2RM5 A;  2YCD A;  4K7O A;  2IMF A;  3FK8 A;  2FD3 A;  4EXJ A;  3DGQ A;  1EP7 A;  1Z3E A;  2ZUP A;  5ECH B;  4F2I A;  5CRW A;  3RHB A;  2M46 A;  2KP2 A;  5DDL A;  12GS A;  3LYK A;  5FT3 A;  3MYD A;  5DAL B;  4I6X A;  2FWG A;  3BCI A;  4ZB8 A;  2VCQ A;  3GUR A;  2L5O A;  2OE0 A;  4YQV A;  4NXI A;  1SK1 A;  2H66 A;  3AY8 A;  1YZX A;  11GS A;  4Q5N A;  2MMZ A;  2LJR A;  1CQG A;  4Z2T A;  5G1K A;  6GSY A;  3M1G A;  4HJM A;  3TKP A;  2NVL A;  4JE1 A;  3S9F A;  1GUK A;  2TIR A;  3I6A A;  2FCH A;  4IHU A;  4I2U A;  4GTU A;  1RW1 A;  4E8H A;  2AAW A;  5AIV A;  2XPE A;  2DC5 A;  3EIN A;  5ECO B;  4POB A;  1ZYQ B;  4RQR A;  2P0G A;  2M80 A;  1V40 A;  3GUS A;  3P90 A;  2N5A A;  1OC9 B;  5IMD A;  5HFG A;  3F63 A;  2JZS A;  4K7N A;  2GT6 A;  2GZZ A;  1O6J A;  2VL3 A;  1GSE A;  2L6C A;  1THO A;  3RPN A;  2HYX A;  2N5B A;  3GX8 A;  2V6K A;  4F0C A;  1NW2 A;  1SK0 A;  1FAA A;  5LNK e;  1PN9 A;  3M0F A;  4KA0 A;  3GRX A;  1EV9 A;  3ZYW A;  1ZZY A;  3IK9 A;  4TXO B;  3ME8 A;  1JLW A;  1TRW A;  4ZXG A;  2NDO A;  3EU4 A;  4NV5 A;  3QFA C;  3P8W A;  1FOH A;  4N10 A;  2GGT A;  5C04 A;  3TKR A;  5DJL A;  1DE1 A;  3Q6O A;  3D5J A;  2A2P A;  2AHE A;  4K2D A;  3LJR A;  4DSS A;  1SKW B;  3QAV A;  4BVX B;  1ZMA A;  1SEN A;  2OE3 A;  4MJA A;  1SYR A;  2WGR A;  1Z6M A;  3HYP A;  4G10 A;  1PX6 A;  1GTI A;  2YWO A;  2VAF A;  4A5P A;  1M9A A;  4O5U A;  3HY2 A;  1WWJ A;  5IMZ A;  3HZ8 A;  4MJE A;  1GP1 A;  5CAX A;  4OFN A;  3E9J B;  4IJI A;  4HOJ A;  1AUC A;  1SKR B;  1O81 A;  4ECC A;  1JFU A;  4MPF A;  1S3A A;  2HLS A;  2VUP A;  4OFT A;  2DIY A;  3TRX A;  4RI7 A;  1MDI A;  1R26 A;  1K3O A;  1W89 A;  2HI7 A;  2QGV A;  4HI7 A;  4MLY A;  3RPP A;  4KGI A;  1ERW A;  4YAV A;  2JSZ A;  2QSI A;  3FZ9 A;  3UIW A;  2DJ1 A;  19GS A;  1TDI A;  1ZOF A;  5KN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...