4K9ZA

Crystal structure of a putative thiol-disulfide oxidoreductase from bacteroides vulgatus (target nysgrc-011676), space group p6222
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
141
Chain Sequence
ASKLLPGQPAIDFEMLDVEGNVKHLADFKGKVIYIDLWATWCGPCIQESPAFEALGKKYVGKDIVFLPVSTDTTTKPWLRYLDGHKKELTQYHSNDVALKESWAIMYIPRFILIDKDFNIVNAYAPRPSSEEIGTLIDSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thiol-disulfide oxidoreductase
publication title Crystal structure of a putative thiol-disulfide oxidoreductase from Bacteroides vulgatus (target NYSGRC-011676), space group P6222
rcsb
source organism Bacteroides vulgatus
molecule tags Oxidoreductase
total genus 35
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2013-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4k9zA00
1G6YA 2YZHA 4FO5A 2C0FA 4ML1A 2L59A 1V58A 2AHEA 2JSYA 2C8UA 14GSA 3RDWA 2PGTA 1A8YA 1TTZA 1QMVA 1R26A 2C4JA 5ECHB 4BA7A 1YEPA 3ZFLA 5CRDA 2R4VA 4V1Ag 3DKSA 2JACA 3GL5A 4ZB6A 2NVLA 5DCHA 3DYRA 1HNCA 1MDJA 5AIVA 3KTBA 1TJDA 2H1GA 2WJUA 1PD21 2F3MA 8GSSA 3UOMA 3N9JA 1RK4A 4YAVA 2PVOC 2AUVA 4V2MA 4KNDA 5ABRA 3IXRA 3SBCA 3ZLPA 3LYKA 4H86A 3E0UA 2ON5A 2GSTA 1EV4A 3VI7A 4O32A 4FYBA 3W6GA 1TXXA 2CVDA 4JZQA 5KEJA 3QPMA 1A0RP 6GSUA 4MH3A 4TVEA 2XBIA 4RUVA 1CQGA 5A4WA 4PNFA 2JSZA 5FT3A 2HE3A 2LEGA 2WULA 1TDIA 3KJYA 1K0CA 4MPFA 2LUSA 1OE7A 1R7HA 3GNJA 4NHWA 3F4SA 1XW6A 4GCIA 3ZTLA 2GVPA 1T4YA 4LL1B 2I3YA 1A8LA 5G5FA 3O3TA 1C72A 4IVFA 4PUFC 1M2AA 4MF5A 1GSEA 3TRPA 3ZL5A 1THXA 2ZNMA 3GKNA 9GSSA 3A2VA 1ABAA 2AJQB 5IO2A 3FZ9A 5A5KA 4YQVA 3TOTA 5HQPA 1OC9B 3WT1A 4Z7XA 2QC7A 1WRYA 5A4VA 1SKRB 4K1FA 5G2ZA 1V2AA 3VPTA 2OADA 4K6XA 1ON4A 2AB6A 4ILFA 4KCEA 1E2YA 4G9HA 1VF1A 3ZIJA 3KH9A 2CVBA 3P8WA 5LD0A 5CO3A 2IMEA 1THOA 4QQ7A 1W89A 1R4WA 3BBYA 5LCZA 5GAND 2K8VA 2CZ2A 5CRWA 1K0OA 4I2TA 3G7IA 4MF6A 4HQSA 2IMKA 2B6MA 1MDKA 1EOHA 1MDIA 2IPAA 4ZL7A 2XHFA 4L8EA 3LJRA 2E2MA 4XS6A 3ISOA 11GSA 2VOCA 1O7UA 2FWEA 3FW2A 4AJ7A 3M0FA 3UEMA 3G7JA 1K0DA 2O7KA 5ECPB 3PR8A 4O5RA 4J2FA 3IDVA 5F05A 3IAS2 2BTOT 4TXVA 4GRFA 4WBJA 3VI5A 2WCIA 2YNXA 4N0ZA 2A2SA 2A2RA 1EEJA 3RPPA 4LMWA 1H75A 1ERWA 1OC9A 1GNEA 3IK7A 2D2ZA 3KD0A 2YN1A 4Q5QA 1GRXA 3F3QA 4LLRA 4IS0A 5B6MA 2EIRA 2YV9A 2LRCA 5IIZA 4Q5FA 1A24A 1AQWA 2CAIA 3KH7A 3FR6A 3FR9A 1XWGA 3PINA 4N10A 4FYUA 3U6VA 1XOBA 1J9BA 1XW9A 4WF4A 1IYHA 5ECMB 4MLYA 1YDKA 3M9JA 3LXTA 1EP8A 2V6KA 5DBQA 4ZIJA 1T7PB 3FEUA 2C3NA 4ECCA 4FH8A 1Z9HA 13GSA 1O73A 2JZSA 3C73A 2YOIA 1XWBA 4XHMA 4ID0A 3CSIA 2ALBA 1KNGA 3D22A 1QQ2A 4N0VA 2VCZA 3D6IA 1V40A 2GTUA 3FYGA 4YQUA 2DC5A 3EWLA 2JZRA 3ED3A 3O76A 5J9CA 3Q19A 3AY8A 1XXUA 4JU5A 1VRSD 3FY7A 4RQXA 3C1SA 4KSOA 5EY6A 1ZZYA 4DSQA 1TW9A 3TCOA 4JEDA 2VL2A 1XWKA 2CT6A 3LYPA 3GKMA 1QK8A 1ZGNA 3UJ1A 4HEA2 4J56E 1ERVA 4RI7A 5D9WA 2L4CA 5J9BA 4XRDA 2P0GA 5ECNB 2N5AA 3BOAA 1JZRA 1AQXA 5COHA 1FO5A 3C1RA 3RBTA 3NZNA 2MMNA 4PGTA 4K0GA 3EMXA 4PNGA 3HDCA 2E0QA 2R37A 1EGOA 1Z7PA 1CQHA 1MEKA 3IRAA 1Q98A 1TKDB 3A2WA 2C1YA 3QAWA 3EYTA 2GSQA 1K3OA 1DSBA 1U6TA 1FG4A 5B8BA 2C3QA 1OAZA 3TJKA 4F03A 4EXJA 4BL7A 3EMPA 1RQMA 2B7KA 5LNKe 5HR3A 2H8LA 2FUG2 3QR6A 4MJAA 1Z6MA 2LJAA 2P5QA 5ENUA 1SKWB 6GSWA 4X43A 2YJHA 3HZ4A 2YWNA 4KDXA 4GF0A 2YWOA 1B48A 2F51A 1ERTA 4WKWA 5EPFA 3HJOA 1WJKA 3CRTA 1LU4A 2WS2A 1XFLA 4GQCA 1BJXA 5ECRB 1XIYA 3SWLA 4ZILA 5ECSA 5IMFA 4OD7A 2QKEA 2LTKA 3C8EA 2YP6A 3LGCA 1Z3EA 1O8WA 5CAXA 2PN8A 3HJPA 1A2JA 2XPEA 3UAPA 2O85A 4MJBA 3LWAA 1NW2A 2VO4A 4ECBA 1X5EA 4MA9A 2HLSA 1JLVA 1HNAA 1W4VA 2CVKA 2FY6A 1Q4JA 4JR4A 2F8AA 1FB0A 2HT9A 2DMMA 3HJMA 1KEBA 4IJIA 4EUYA 3M1GA 4EDYA 1G7EA 1OKTA 4I97A 2FCHA 4PURA 6GSVA 5JCGA 1FVKA 4K8MA 1O81A 3ZYWA 4EE0A 3HZ8A 1EEMA 1GSUA 2OBKA 5C00A 1FOVA 4BVYA 1PKZA 1XVQA 4K7NA 4KGIA 4XRAA 4MJEA 2B5YA 2V1MA 1PX6A 2EIQA 2I4AA 1JHBA 4K7OA 20GSA 4QL7A 4HQZA 1DE1A 3MDKA 4K2DA 1HD2A 4NMUA 1I5GA 5D73A 2RIIA 3VWUA 2I81A 2HXKA 2OBIA 6GSTA 3UL3A 2OKAA 4POKA 2M72A 2N5BA 4KH7A 4NV5A 3IE3A 1BAYA 2VL2C 1YKAA 2IIYA 4F0BA 1SYRA 2H75A 5J3RA 1N2AA 3P90A 3MAKA 4MP4A 3GYKA 1UA5A 4TKYA 2GQKA 3TKRA 5G1LA 2VCWA 3F9UA 1H4OA 4HJ2A 1XWAA 2WFCA 3KP9A 1SL2B 2HFDA 2WRTA 4TW5A 2VLTA 5DJMA 1AQVA 1GNWA 4I2UA 2DJ3A 3Q6OA 1WIKA 2FGXA 2H74A 4XS4A 1B4QA 2FNOA 3G9BA 3VPQA 3GIXA 1YQ1A 3L4NA 4BWQA 2GZYA 2TIRA 2FA4A 3L9SA 5JWOB 3UIWA 3LG6A 2PMTA 1PX7A 3QFAC 5DQYA 4BWSA 3QFBC 2TRCP 4KSMA 1GSQA 5IOWA 4NV2A 2XBQA 5JWRB 2AAWA 2M80A 4BVXA 4MF7A 3KM6A 4ZXGA 3HVVA 2A4VA 2LS5A 2H0GA 3WD6A 3MWHA 4O92A 2B1KA 5DJLA 3RPNA 4ML6A 3M9KA 1PN9A 4ACSA 6GSXA 1GSFA 3IBHA 2B5XA 2RLIA 2LNSA 7GSSA 3APQA 2N5FA 2FWFA 3I69A 3UBLA 3BD2A 3QAVA 4YAPA 1JZOA 3IR4A 1Y6EA 2VD0A 3ZMLA 4MK3A 1AC1A 4IJ3A 2H70A 5B8AA 2WGRA 5J4UA 2XC2A 4IP1A 4J57E 2ON7A 2DIZA 4KUNA 2PVQA 1GUMA 5KN2A 2KP2A 2VAFA 1IYIA 4AF2A 3VWVA 4P3YB 1QUWA 4BPYA 2QGVA 2YWMA 5D93A 3ERFA 3G7YA 4QL9A 4OCEA 3ZZXA 3HVSA 1OVNA 3U5RE 1QXHA 1GWCA 5JWQB 2R2JA 2O8VB 1PA3A 17GSA 2DIYA 2GLRA 4GLTA 3WGXA 2YANA 4DEJA 4GSTA 3F8UA 1ACVA 2YCDA 5ELAA 5HR2A 4XIHA 2L4QA 2C0EA 3LEFA 1OKDA 1LBKA 3TKPA 3D4MA 1PL2A 3ZITA 2DJJA 4ZL9A 4GSNA 2HZFA 2H19A 1S3CA 2GZPA 3A2XA 3KZQA 2JU5A 3CTFA 1JFUA 3IHQA 1BG5A 2XPDA 3GSTA 2DMLA 5D9TA 2V32A 4N30A 2P5RA 2R3XA 1X0RA 1DBYA 4V1Ap 1VF3A 4TR0A 1OYJA 2BJXA 1GSYA 4ZB8A 2B7JA 3VWXA 5D9VA 3DD3A 2IMFA 1PRXA 3IA1A 1TU7A 2QSIA 4KCAA 2IMIA 5HFKA 3M3MA 3EE2A 1K0NA 2IN3A 2TRXA 3DVWA 4KX4A 3GHAA 5HR0A 1EOGA 2M46A 1PKWA 5AISA 4MZBA 3DXBA 3GV1A 1GTUA 4ULXA 4X1UA 4PUAA 3TOUA 4EKZA 1Z6NA 2CX4A 2HRFA 4HZ4A 2GSRA 2H6YA 4POBA 5INYA 4RI6A 1NHOA 5HFGA 4TXOB 5HR1A 2X8HA 3CMIA 1TRUA 2H73A 3MSZA 4KW6A 2JL4A 3I9V2 4HU7A 4OFMA 2ES7A 4IHUA 5ECIB 1YF1A 2I1UA 1YY7A 1AIUA 3IPZA 3L78A 4FIWA 1AUCA 1F9MA 3QDNA 5L71A 5IMCA 1GUHA 3E9JB 2C3TA 3H4KA 4V2NA 1V98A 3ZREA 3P2AA 5IMVA 3KMOA 2VL3A 2VCQA 4OWYA 1EWXA 3ERWA 3DIEA 2H6ZA 4JR6A 4HOJA 2JADA 4F9ZA 3LQ7A 4JBBA 3FRCA 2LSTA 2KLXA 3W8SA 2VCXA 5IO0A 2H30A 4G19A 2VCTA 1ZOFA 4CHSA 3PGTA 4MMMA 1T4ZA 5H5QA 3RHCA 1XPVA 2F8FA 2Z9SA 3GUSA 2PWJA 1FVJA 1SD9A 4GQFA 5J5NA 3NIVA 1EGRA 3GL3A 4Q5RA 2ZUPA 2DLXA 2PUKC 1M0UA 2E2GA 3HY2A 1XVWA 4KDYA 4OCFA 4TXOA 4IN0A 1YKCA 2DJ1A 1ZYQB 4NPBA 2K8SA 4GSSA 1EZKA 4FYCA 3UVTA 1FAAA 3HCZA 1OC8A 3FHKA 2VCVA 3H8QA 2X99A 2HSYA 4K9ZA 2L6CA 2VD1A 1EV9A 4ZL8A 3ZMKA 1F3AA 3M8NA 1GP1A 2PBJA 1V9WA 3APOA 3EURA 1TI1A 1GUKA 1R5AA 2OJLA 3EC3A 4XCSA 3F3RA 1TRVA 3CSJA 2LNTA 2LJRA 4KA0A 1TOFA 3NOFA 1QFNA 3R2QA 4DSRA 2RM5A 5FWGA 1SYXA 2FWHA 4EVMA 2C0GA 1YZXA 5AGYA 1O85A 3ZVJD 4TR3A 3FKFA 2OACA 3KGKA 5CNWA 1X9WB 5CP1A 3TJFA 1UN2A 1SJ6A 2YWIA 3KEBA 3FK8A 2MMAA 3F4RA 2H01A 2KP1A 3HA9A 4XTSA 5AN1A 1A0FA 5DVBA 3RAZA 2H71A 1USBA 3H79A 4WF5A 1HYUA 1Z5YE 3EU3A 4ZB9A 4POMA 5DAKB 5G30A 1EP7A 2H66A 1ZYEA 3GN3A 1VF2A 4WR4A 2GDRA 4XS4B 1M7TA 4GWRA 3CTGA 3EU4A 3TKSA 3KCMA 3HXSA 1F3BA 1ERUA 3DRNA 1GTBA 2G2QA 2H1AA 2GT6A 2AYTA 1M2DA 3KP8A 1JZWA 2CZ3A 2MMOA 1BX9A 1U3AA 3IOSA 3FZ5A 4TR4A 5JCUA 3W8JA 1NHYA 4XS1A 16GSA 4YH2A 4POLA 3GA4A 3IV4A 1XWCA 4LL4B 2OE1A 1V57A 4ECJA 5D8IA 4G10A 4L5OA 1J0FA 3F6DA 5ID2B 4NWYA 5G1KA 1GSDA 2OE0A 3IK9A 1O8XA 2R6KA 2IMDA 1KBNA 2L57A 3C71A 5F07A 4HJMA 2NTOA 1B8XA 4D73B 4IGJA 3WT2A 1XW5A 4ECIA 1AW9A 3GTUB 2LQQA 2LQOA 3I6AA 3VWWA 1T3BA 1VGLA 10GSA 2GZZA 3GX0A 5DAKA 1Y25A 2LRNA 3GX8A 1MTCA 4K7IA 4WR5A 1AAZA 2L6DA 3DVXA 1VF4A 6GSSA 2K6VA 2H0HA 3QOUA 4ISDA 4K0NA 2V6OA 3TJGA 4IQ1A 3TRXA 1YF0A 1F2EA 4N11A 5IQYA 5GSTA 2CX3A 2WZ9A 3ERGA 1PSQA 2RUFA 5GSSA 3OR5A 2MZCA 4NXIA 2H6XA 2P31A 4EO3A 3ZRDA 6GSYA 2FA8A 1WE0A 2GGTA 3L9UA 1PQNA 1PMTA 3CBUA 3CXGA 3DEXA 5CRHA 3APSA 2R5GA 1GLQA 5EVOA 5E4WA 3F4TA 3VFIA 3BJ5A 2B1LA 5IMDA 3WYWA 3UVHA 1G0TA 1S3DA 3CRUA 2C0DA 4LA1A 5ID2A 3D4TA 2LJKA 3EINA 3IC4A 2HZEB 5ELGA 3D21A 3TJBA 1A23A 3LFLA 4LMVA 2FWGA 5C04A 1X9SB 4D73A 3J7Yk 3DWVA 2MBSA 3GTUA 3QMXA 1X9MB 2DJ2A 5ECKB 5CRGA 3BCKA 3HVXA 2H72A 2H1DA 4F0CA 2VIMA 5KN0A 2IFQB 2OE3A 1A2MA 3D0ZA 4MJCA 1NSWA 3I43A 3VURA 3GURA 2C80A 1K3YA 2NBSA 5ECLB 4CDOA 1TRWA 4Q5NA 2IJYA 2AV4A 3ME8A 1GULA 1T00A 5KN1A 1TK0B 4OMVA 1G6WA 1K0AA 2VLUA 5AIXA 5B7CA 1AXDA 4EC0A 4TRXA 4MZWA 2DBCA 2MBTA 3TKSC 1SJIA 4OFTA 4E8HA 1WMJA 3TKQA 1WOUA 5HFIA 2K9FA 2OA7A 3GMFA 4L0UA 3QAGA 3UMAA 4ZBBA 1BEDA 5E59A 5DQSA 4PQ1A 2H76A 1X5DA 2LKUA 5IPHA 5CYYA 4OO5A 3VK9A 1K0BA 1SL0B 2H1BA 18GSA 3A3TA 2HZEA 3L9VA 5D96A 3GKXA 3ZFBA 5IMZA 1OC3A 1F6MC 3TDGA 4MABA 3GRXA 1YJ6A 3DMLA 4AJ8A 4DSSB 3C7MA 2FD3A 3KTLA 3ZIVA 2PERA 4WXTA 1B9XC 2IWTA 4MZCA 3GH6A 1TU8A 4RQRA 1OE8A 2IFQA 2O87A 4PXOA 2DSAA 5GZZB 3GKKA 4CW9A 1R5PA 3RHBA 2DJ0A 3US3A 1GLPA 1JZDA 4OFNA 4WEYA 1SK2A 3LORA 1GSSA 2HRNA 2O89A 1DUGA 12GSA 4ZBDA 4EF0A 2GQMA 3A5WA 5F0GA 1SL1B 1LJRA 1GL8A 3J7Yb 2CAQA 2JZTA 3BCIA 1KTEA 2X8GA 1TRSA 3K8NA 2PU9C 5ECQB 5GAPD 4PQHA 1N8JA 2FHEA 4IQAA 1WP0A 1GTIA 4IKHA 1URMA 1Z7RA 1ILOA 3P7XA 2CV4A 1U88A 1HNBA 5DCGA 1K3LA 4AGSA 3F0IA 1MD4A 4HDEA 2L5LA 3TKSE 5B6NA 1SD8A 1HQOA 4E8EA 4KE3A 2G0FA 3F63A 3O6TA 3ZVJA 2RM6A 2HYXA 2VLVA 4WBRD 3KMNA 1RW1A 3H93A 2REMA 1U87A 4HI7A 3KXOA 5IMAA 2PPTA 4L5LA 4MCUA 5JCWA 5IOXA 3Q74A 4DSSA 1GTAA 2H0IA 2VL9A 2V2GA 3EVIA 2NDOA 2WB9A 2K18A 3L0HA 1WWJA 1ST9A 5DDLA 5IM9A 2YZUA 2F9SA 1DE2A 3FR3A 4I5QA 3CYNA 4F2IA 1SK0A 1XBSA 2X64A 1NM3A 3N5OA 1SK1A 2J9HA 3TB2A 3Q18A 2YPMA 2GS3A 1TI3A 1X5CA 2DJKA 1ZL9A 1FW1A 1SKSB 4NHZA 3VLNA 4KB3A 4JRRA 5J41A 1S3AA 4IBPA 4F82A 19GSA 4OO4A 2LRTA 2CQ9A 1F37A 3H1NA 1ZCPA 2J23A 5H5RA 4GTUA 3TUEA 4TR1B 4PX1A 2LV3A 3FZ4A 3WGEA 1GH2A 3PH9A 3GSSA 1TK5B 2VM1A 4TN8A 2YV7A 4MPGA 5FHIA 1WPIA 1BQ7A 4YQMA 1M2BA 1A2LA 3QD9A 5ECOB 3HKRA 1T8EB 5D9XA 2KHPA 2L5OA 4IP6A 1SJZA 4HZ2A 2RUEA 3HHVA 4JE1A 3E3EA 4MH2A 4GXZA 5G31A 5F8BA 2KOKA 3TGZA 2GQLA 2I9HA 3UARA 3F6FA 1B4PA 1MD3A 3IAM2 1ML6A 5DALB 3JCML 2GT5A 1U3IA 3LXZA 4IW9A 3FZAA 2YJ7A 1FB6A 2EIOA 22GSA 4KDUA 1XZOA 1PL1A 2EC4A 1QGVA 2E7PA 5G5EA 3HYPA 1O6JA 3WGDA 1M99A 1G7OA 3HD5A 1FHEA 1J08A 2VUPA 3QCPA 1M9BA 3LSZA 1K0MA 3V1WA 2NPBA 3ME7A 3UBKA 3KIJA 5CREA 1YEXA 1PGTA 4L0WA 5EL8A 1UVZA 2WDUA 4NAXA 2KUCA 3TJJA 3TRQA 2MYGA 2CA8A 4HU9A 2MMZA 4TR1A 2HNLA 2FLSA 1E6BA 2BMXA 3GFKA 1SENA 4PQIA 4KAEA 1SU9A 5A4UA 1UC7A 4AJ6A 2ZCTA 4TOPA 4O7HA 2V41A 5KN3A 4WETA 3S9FA 2HSHA 1ZMAA 3GH9A 1T1VA 4DVCA 5F06A 4MDCA 4EDZA 2GSSA 2X8CA 4X0XA 5H5SA 4V2LA 2IL3A 1M9AA 1JLWA 1XOAA 3D5JA 4HS1A 3MNGA 4I6XA 2VM2A 4I8BA 3CSHA 4EL1A 1TK8B 4HUAA 2B3SA 5DALA 1XCCA 3DGQA 4G2EA 2B5EA 1TP9A 4ZBAA 1I9DA 5IPGA 1BYEA 4IELA 1B9YC 2HI7A
chains in the Genus database with same CATH superfamily
3MYDA 1G6YA 2YZHA 4FO5A 2C0FA 4ML1A 2L59A 1V58A 2AHEA 2JSYA 2C8UA 14GSA 3RDWA 2PGTA 1A8YA 4ICYA 1TTZA 4USSA 1QMVA 1R26A 2C4JA 5ECHB 2HRAA 4BA7A 1YEPA 3ZFLA 5CRDA 2R4VA 4V1Ag 3DKSA 2JACA 3GL5A 4ZB6A 2NVLA 5DCHA 3DYRA 1HNCA 1MDJA 5AIVA 3KTBA 1TJDA 2H1GA 2WJUA 1PD21 2F3MA 8GSSA 3UOMA 3N9JA 1RK4A 4YAVA 2PVOC 2AUVA 4V2MA 4KNDA 5ABRA 3IXRA 3SBCA 3ZLPA 3LYKA 4H86A 3E0UA 2ON5A 2GSTA 1EV4A 3VI7A 4O32A 4FYBA 3W6GA 1TXXA 2CVDA 4JZQA 5KEJA 3QPMA 1A0RP 6GSUA 4FQUA 4MH3A 4TVEA 2XBIA 4RUVA 1CQGA 5A4WA 4PNFA 2JSZA 5FT3A 2HE3A 2LEGA 2WULA 1TDIA 3KJYA 1K0CA 4MPFA 2LUSA 1OE7A 1R7HA 3GNJA 4NHWA 3F4SA 1XW6A 4GCIA 3ZTLA 2GVPA 1T4YA 4LL1B 2I3YA 1A8LA 5G5FA 3O3TA 1C72A 4IVFA 4PUFC 1M2AA 3IC8A 4MF5A 1GSEA 3TRPA 3ZL5A 1THXA 2ZNMA 3GKNA 5KOWA 9GSSA 3R3EA 3A2VA 1ABAA 2AJQB 5IO2A 3FZ9A 5A5KA 4YQVA 3TOTA 5HQPA 1OC9B 3WT1A 4Z7XA 2QC7A 1WRYA 5A4VA 1SKRB 4K1FA 5G2ZA 1V2AA 2DKHA 3VPTA 2OADA 4K6XA 1ON4A 2AB6A 4ILFA 4KCEA 1E2YA 4G9HA 1VF1A 3ZIJA 3KH9A 2CVBA 3P8WA 5LD0A 5CO3A 2IMEA 1THOA 4QQ7A 1W89A 1R4WA 3BBYA 5LCZA 5GAND 2K8VA 2CZ2A 5CRWA 1K0OA 4I2TA 3G7IA 4MF6A 4HQSA 2IMKA 2B6MA 1MDKA 1EOHA 1MDIA 2IPAA 4ZL7A 2XHFA 4L8EA 3LJRA 2E2MA 4XS6A 3ISOA 11GSA 2VOCA 4O5UA 1O7UA 2FWEA 3FW2A 4AJ7A 3M0FA 3UEMA 3G7JA 1K0DA 2O7KA 5ECPB 3PR8A 4O5RA 4J2FA 3IDVA 5F05A 3IAS2 2BTOT 4TXVA 4GRFA 4WBJA 3VI5A 2WCIA 2YNXA 4N0ZA 2A2SA 2A2RA 1EEJA 3RPPA 4LMWA 1H75A 1ERWA 1OC9A 1GNEA 3IK7A 2D2ZA 3KD0A 2YN1A 4Q5QA 1GRXA 3F3QA 4LLRA 4IS0A 5B6MA 2EIRA 2YV9A 2LRCA 5IIZA 4Q5FA 1A24A 1AQWA 2CAIA 3KH7A 3FR6A 3FR9A 1XWGA 3PINA 2UZ8A 4N10A 4FYUA 3U6VA 1XOBA 1J9BA 1XW9A 4WF4A 1IYHA 5ECMB 4MLYA 1YDKA 3M9JA 3LXTA 1EP8A 2V6KA 5DBQA 4ZIJA 1T7PB 3FEUA 3IHGA 2C3NA 4ECCA 4FH8A 1Z9HA 13GSA 1O73A 2JZSA 3C73A 2YOIA 1XWBA 4XHMA 4ID0A 3CSIA 2ALBA 1KNGA 3D22A 1QQ2A 4N0VA 2VCZA 4BL7B 3D6IA 1V40A 2GTUA 3FYGA 4YQUA 2DC5A 3EWLA 2JZRA 3ED3A 3O76A 5J9CA 3Q19A 2A2PA 3AY8A 1XXUA 4JU5A 1VRSD 3FY7A 4RQXA 3C1SA 4KSOA 5EY6A 1ZZYA 4DSQA 1TW9A 3TCOA 4JEDA 2VL2A 1XWKA 2CT6A 3LYPA 3GKMA 1QK8A 1ZGNA 3UJ1A 4HEA2 4J56E 1ERVA 4RI7A 5D9WA 2L4CA 5J9BA 4XRDA 2P0GA 5ECNB 2N5AA 3BOAA 1JZRA 1AQXA 5COHA 1FO5A 3C1RA 3RBTA 3NZNA 2MMNA 4PGTA 4K0GA 3EMXA 4PNGA 3HDCA 2E0QA 2R37A 1EGOA 1FOHA 1Z7PA 1CQHA 1MEKA 3IRAA 1Q98A 1TKDB 3A2WA 2C1YA 3QAWA 3EYTA 2GSQA 1K3OA 1DSBA 1U6TA 1FG4A 5B8BA 2C3QA 1OAZA 3TJKA 4F03A 4EXJA 4BL7A 3EMPA 1RQMA 2B7KA 4YKFA 5LNKe 5HR3A 2H8LA 2FUG2 3QR6A 4MJAA 1Z6MA 2LJAA 2P5QA 5ENUA 1SKWB 6GSWA 4BVYB 4X43A 2YJHA 3HZ4A 2YWNA 4KDXA 4GF0A 2YWOA 1B48A 2F51A 1ERTA 4WKWA 5EPFA 3HJOA 1WJKA 3CRTA 1LU4A 2WS2A 1XFLA 4GQCA 1BJXA 5ECRB 1XIYA 3SWLA 4ZILA 5ECSA 5IMFA 4OD7A 2QKEA 2LTKA 3C8EA 2YP6A 3LGCA 1Z3EA 1O8WA 5CAXA 2PN8A 3HJPA 1A2JA 2XPEA 3UAPA 4Z2RA 2O85A 4MJBA 3LWAA 1NW2A 2VO4A 3PPUA 4ECBA 1X5EA 4MA9A 2HLSA 1JLVA 1HNAA 1W4VA 2CVKA 2FY6A 1Q4JA 4JR4A 2F8AA 1FB0A 2R0CA 2HT9A 2DMMA 3HJMA 1KEBA 4IJIA 4EUYA 3M1GA 4EDYA 1G7EA 1OKTA 4I97A 2FCHA 4PURA 6GSVA 5JCGA 4EIPA 1FVKA 4K8MA 1O81A 3ZYWA 4EE0A 3HZ8A 1EEMA 1GSUA 2OBKA 5C00A 1FOVA 2R0GA 4BVYA 1PKZA 1XVQA 4K7NA 4KGIA 4XRAA 4MJEA 2B5YA 2V1MA 1PX6A 2EIQA 2I4AA 1JHBA 4K7OA 20GSA 4QL7A 4HQZA 1DE1A 3MDKA 4BVXB 4K2DA 1HD2A 4NMUA 1I5GA 5D73A 2RIIA 3VWUA 2I81A 2HXKA 2OBIA 6GSTA 3UL3A 2OKAA 4POKA 2M72A 2N5BA 4KH7A 4NV5A 3IE3A 1BAYA 2VL2C 1YKAA 2IIYA 4F0BA 1SYRA 2H75A 5J3RA 1N2AA 3P90A 3MAKA 4MP4A 3GYKA 1UA5A 4TKYA 2GQKA 3TKRA 5G1LA 2VCWA 3F9UA 1H4OA 4HJ2A 1XWAA 2WFCA 3KP9A 1SL2B 2HFDA 2WRTA 4TW5A 2VLTA 5DJMA 1AQVA 1GNWA 4I2UA 2DJ3A 3Q6OA 1WIKA 2FGXA 2H74A 4XS4A 1B4QA 2FNOA 3G9BA 3VPQA 3GIXA 1YQ1A 3L4NA 4BWQA 2GZYA 2TIRA 2FA4A 3L9SA 5JWOB 3UIWA 3LG6A 2PMTA 1PFOA 1PX7A 3QFAC 5DQYA 4BWSA 3QFBC 2TRCP 4KSMA 4A5PA 1ZYNA 1GSQA 5IOWA 4NV2A 2XBQA 5JWRB 2AAWA 2M80A 4BVXA 4MF7A 3KM6A 4ZXGA 3HVVA 2A4VA 2LS5A 2H0GA 3WD6A 3MWHA 4O92A 2B1KA 5DJLA 3RPNA 4ML6A 3M9KA 1PN9A 4ACSA 6GSXA 1GSFA 3IBHA 2B5XA 2RLIA 2LNSA 7GSSA 3APQA 2N5FA 2FWFA 3I69A 3UBLA 3BD2A 3QAVA 4YAPA 1JZOA 3IR4A 1Y6EA 2VD0A 3ZMLA 4MK3A 1AC1A 4IJ3A 4X4JA 2H70A 5B8AA 2WGRA 5J4UA 2XC2A 4IP1A 4J57E 2ON7A 2DIZA 4KUNA 2PVQA 1GUMA 5KN2A 2KP2A 2VAFA 1IYIA 4AF2A 3VWVA 4P3YB 1QUWA 4BPYA 2QGVA 2YWMA 5D93A 3ERFA 3G7YA 2X49A 4QL9A 4OCEA 3ZZXA 3HVSA 3FMWA 1OVNA 3U5RE 1QXHA 1GWCA 5JWQB 2R2JA 2O8VB 1PA3A 17GSA 2DIYA 2GLRA 4GLTA 3WGXA 2YANA 4DEJA 4GSTA 3F8UA 1ACVA 2YCDA 5ELAA 5HR2A 4XIHA 2L4QA 2C0EA 3LEFA 1OKDA 1LBKA 3TKPA 3D4MA 1PL2A 3ZITA 2DJJA 4ZL9A 4GSNA 2HZFA 2H19A 1S3CA 2GZPA 3A2XA 3KZQA 2JU5A 3CTFA 1JFUA 3IHQA 1BG5A 2XPDA 3GSTA 2DMLA 5D9TA 2V32A 4N30A 2P5RA 4G0KA 2R3XA 1X0RA 1DBYA 4V1Ap 1VF3A 4TR0A 1OYJA 2BJXA 1GSYA 2R0PA 4ZB8A 2B7JA 3VWXA 5D9VA 3DD3A 2IMFA 1PRXA 3IA1A 1TU7A 2QSIA 4KCAA 2IMIA 5HFKA 3M3MA 3EE2A 1K0NA 2IN3A 2TRXA 3DVWA 4KX4A 3GHAA 5HR0A 1EOGA 2M46A 1PKWA 5AISA 4MZBA 3DXBA 3GV1A 1GTUA 4ULXA 4X1UA 4PUAA 3TOUA 4EKZA 1Z6NA 2CX4A 2HRFA 4HZ4A 2GSRA 2H6YA 4POBA 5INYA 4Z2TA 4RI6A 1NHOA 5HFGA 4TXOB 5HR1A 2X8HA 3CMIA 1TRUA 2H73A 3MSZA 4KW6A 2X4AA 2JL4A 3I9V2 4HU7A 4OFMA 4K5RA 2ES7A 4IHUA 5ECIB 1YF1A 2I1UA 1YY7A 1AIUA 3IPZA 3L78A 4FIWA 1AUCA 2QA2A 1F9MA 3QDNA 5L71A 5IMCA 1GUHA 3E9JB 2C3TA 3H4KA 4V2NA 1V98A 3ZREA 3CQFA 3P2AA 5IMVA 3KMOA 2VL3A 2VCQA 4OWYA 1EWXA 3ERWA 3DIEA 2H6ZA 4JR6A 4HOJA 2JADA 4F9ZA 3LQ7A 4JBBA 3FRCA 2LSTA 2KLXA 3W8SA 2VCXA 5IO0A 2H30A 4G19A 2VCTA 1ZOFA 4CHSA 3PGTA 4MMMA 1T4ZA 5H5QA 3RHCA 1XPVA 2F8FA 2Z9SA 3GUSA 2PWJA 1FVJA 1SD9A 4GQFA 5J5NA 3NIVA 1EGRA 3GL3A 4Q5RA 2ZUPA 2DLXA 2PUKC 1M0UA 2E2GA 3HY2A 1XVWA 4KDYA 4OCFA 4TXOA 4IN0A 1YKCA 2DJ1A 1ZYQB 4NPBA 2K8SA 4GSSA 1EZKA 4FYCA 3UVTA 1FAAA 3HCZA 1OC8A 3FHKA 2VCVA 3H8QA 5KOXA 2X99A 3LW9A 2HSYA 4K9ZA 2L6CA 2VD1A 1EV9A 4ZL8A 3ZMKA 1F3AA 3M8NA 1GP1A 2PBJA 1V9WA 4K5SA 3APOA 3EURA 1TI1A 1GUKA 1R5AA 2OJLA 3EC3A 4XCSA 4G0LA 3F3RA 1TRVA 3CSJA 1M3JA 2LNTA 2LJRA 4KA0A 1TOFA 3NOFA 1QFNA 3R2QA 4DSRA 2RM5A 5FWGA 1SYXA 2FWHA 4EVMA 2C0GA 1YZXA 5AGYA 1O85A 3ZVJD 4TR3A 3FKFA 2OACA 3KGKA 5CNWA 1X9WB 5CP1A 3TJFA 1UN2A 1SJ6A 2YWIA 3KEBA 3FK8A 2MMAA 3F4RA 2H01A 2KP1A 3HA9A 4XTSA 5AN1A 1A0FA 5DVBA 3RAZA 2H71A 1USBA 3H79A 4WF5A 1HYUA 1Z5YE 3EU3A 4ZB9A 4POMA 5DAKB 5G30A 1EP7A 2H66A 1ZYEA 3GN3A 1VF2A 4WR4A 2GDRA 4XS4B 1M7TA 4GWRA 3CTGA 3EU4A 3TKSA 3KCMA 3HXSA 1F3BA 1ERUA 3DRNA 1GTBA 2G2QA 2H1AA 2GT6A 2AYTA 1M2DA 3KP8A 1JZWA 2CZ3A 2MMOA 1BX9A 5BMUA 1U3AA 3IOSA 3FZ5A 4TR4A 5JCUA 3W8JA 1NHYA 4XS1A 1PN0A 16GSA 4YH2A 4POLA 3GA4A 3IV4A 1XWCA 4LL4B 2OE1A 1M3IA 1V57A 4ECJA 5D8IA 4G10A 4L5OA 1J0FA 3F6DA 5ID2B 4NWYA 5G1KA 1GSDA 2OE0A 3IK9A 1O8XA 2R6KA 2IMDA 1KBNA 2L57A 3C71A 5F07A 4HJMA 2NTOA 1B8XA 4D73B 4IGJA 3WT2A 1XW5A 4ECIA 1AW9A 3GTUB 1ZYPA 2LQQA 2LQOA 3I6AA 3VWWA 1T3BA 1VGLA 10GSA 2GZZA 3GX0A 5DAKA 1Y25A 2LRNA 3GX8A 1MTCA 4K7IA 4WR5A 1AAZA 2L6DA 4BIKA 3DVXA 1VF4A 6GSSA 2K6VA 2H0HA 3QOUA 4ISDA 4K0NA 2V6OA 3TJGA 4IQ1A 3TRXA 1YF0A 1F2EA 2HSMA 4N11A 5IQYA 5GSTA 2CX3A 2WZ9A 3ERGA 1PSQA 2RUFA 5GSSA 3OR5A 2MZCA 4NXIA 2H6XA 2P31A 4EO3A 3ZRDA 6GSYA 2FA8A 1WE0A 2GGTA 3L9UA 1PQNA 1PMTA 3CBUA 3CXGA 4Z2UA 3DEXA 5CRHA 3APSA 2R5GA 1GLQA 5BRTA 5EVOA 5E4WA 3F4TA 3VFIA 3BJ5A 2B1LA 5IMDA 4PTSA 3WYWA 3UVHA 1G0TA 1S3DA 3CRUA 2C0DA 4LA1A 5ID2A 3D4TA 2LJKA 3EINA 1XG8A 3IC4A 2HZEB 5ELGA 3D21A 3TJBA 1A23A 3LFLA 4LMVA 2FWGA 5C04A 1X9SB 4D73A 3J7Yk 3DWVA 2MBSA 3GTUA 3QMXA 1X9MB 2DJ2A 5ECKB 4CY8A 5CRGA 1S3RA 3BCKA 3HVXA 2H72A 2H1DA 4F0CA 2VIMA 5KN0A 2IFQB 2OE3A 3MIXA 1A2MA 3D0ZA 4MJCA 1NSWA 3I43A 3VURA 3GURA 2C80A 1K3YA 2NBSA 5ECLB 4CDOA 1TRWA 4Q5NA 2IJYA 2AV4A 3ME8A 1GULA 1T00A 5KN1A 1TK0B 4OMVA 1G6WA 1K0AA 2VLUA 5AIXA 5B7CA 1AXDA 4EC0A 4TRXA 4MZWA 2DBCA 2MBTA 3TKSC 1SJIA 4OFTA 4E8HA 1WMJA 3TKQA 1WOUA 5HFIA 2K9FA 2OA7A 3GMFA 4L0UA 3QAGA 3UMAA 4ZBBA 1BEDA 5E59A 5DQSA 2DKIA 4PQ1A 4HSCX 2H76A 1X5DA 2LKUA 5IPHA 5CYYA 4OO5A 3VK9A 1K0BA 3EPTA 1SL0B 2H1BA 18GSA 3A3TA 2HZEA 3L9VA 5D96A 3GKXA 3ZFBA 5IMZA 1OC3A 1F6MC 4O5QA 3TDGA 4MABA 3GRXA 1YJ6A 3DMLA 4AJ8A 4DSSB 3C7MA 2FD3A 3KTLA 3ZIVA 2PERA 4WXTA 1B9XC 2IWTA 4MNNA 4MZCA 3GH6A 1TU8A 4RQRA 1OE8A 2IFQA 2O87A 4PXOA 2DSAA 5GZZB 3GKKA 4CW9A 1R5PA 3RHBA 4EIQA 2DJ0A 3US3A 1GLPA 1JZDA 4CY6A 4OFNA 4WEYA 1SK2A 3LORA 1GSSA 3HVNA 2HRNA 2O89A 1DUGA 12GSA 4ZBDA 4EF0A 2GQMA 3A5WA 4KF9A 5F0GA 1SL1B 1LJRA 1GL8A 3J7Yb 2CAQA 2JZTA 3BCIA 1KTEA 2X8GA 1TRSA 3K8NA 2PU9C 5ECQB 5GAPD 4PQHA 1N8JA 2FHEA 4IQAA 4K2XA 1WP0A 1GTIA 4IKHA 1URMA 1Z7RA 1ILOA 3P7XA 2CV4A 1U88A 1HNBA 5DCGA 1K3LA 4AGSA 3F0IA 1MD4A 4HDEA 2L5LA 3TKSE 5B6NA 1SD8A 1HQOA 4E8EA 4KE3A 2G0FA 3F63A 3O6TA 3ZVJA 2RM6A 2HYXA 2VLVA 4WBRD 3KMNA 1RW1A 3H93A 2REMA 1U87A 4HI7A 3KXOA 5IMAA 2PPTA 4L5LA 4MCUA 5JCWA 5IOXA 3Q74A 4DSSA 1GTAA 2H0IA 2VL9A 2V2GA 3EVIA 2NDOA 2WB9A 2K18A 3L0HA 1WWJA 1ST9A 5DDLA 5IM9A 2YZUA 2F9SA 1DE2A 3FR3A 4I5QA 3CYNA 4F2IA 1SK0A 1XBSA 2X64A 1NM3A 3N5OA 1SK1A 2J9HA 3TB2A 3Q18A 2YPMA 2GS3A 1TI3A 1X5CA 2DJKA 1ZL9A 1FW1A 1SKSB 4NHZA 3VLNA 4KB3A 4JRRA 5J41A 1S3AA 4IBPA 4F82A 19GSA 4OO4A 2LRTA 2CQ9A 1F37A 3H1NA 1ZCPA 2J23A 5H5RA 4GTUA 3TUEA 4TR1B 4PX1A 2LV3A 3FZ4A 3WGEA 1GH2A 3PH9A 3GSSA 1TK5B 2VM1A 4TN8A 2YV7A 4MPGA 5FHIA 1WPIA 1BQ7A 4YQMA 1M2BA 1A2LA 3QD9A 5ECOB 3HKRA 1T8EB 5D9XA 2KHPA 2L5OA 4IP6A 1SJZA 4HZ2A 2RUEA 3HHVA 4JE1A 3E3EA 4MH2A 4GXZA 5G31A 5F8BA 2KOKA 3TGZA 2GQLA 2I9HA 3UARA 3F6FA 1B4PA 1MD3A 3IAM2 1ML6A 5DALB 3JCML 2GT5A 1U3IA 3LXZA 4IW9A 3FZAA 2YJ7A 1FB6A 2EIOA 22GSA 4KDUA 4G0IA 1XZOA 4YKGA 1PL1A 2EC4A 1QGVA 2E7PA 2HRKA 5G5EA 3HYPA 1O6JA 3WGDA 1M99A 1G7OA 3HD5A 1FHEA 1J08A 2VUPA 3QCPA 1M9BA 3LSZA 1K0MA 3V1WA 2NPBA 3ME7A 3UBKA 3KIJA 5CREA 1YEXA 1PGTA 4L0WA 5EL8A 1UVZA 2WDUA 4NAXA 2KUCA 3TJJA 3TRQA 2MYGA 2CA8A 4HU9A 2MMZA 4TR1A 2HNLA 2FLSA 1E6BA 2BMXA 3GFKA 1SENA 4PQIA 4KAEA 1SU9A 5A4UA 1UC7A 4AJ6A 2ZCTA 4TOPA 4O7HA 2V41A 5KN3A 4WETA 3S9FA 2HSHA 1ZMAA 3GH9A 1T1VA 4DVCA 5F06A 4MDCA 4EDZA 2GSSA 2X8CA 4X0XA 5H5SA 4V2LA 2IL3A 2A4HA 1M9AA 1JLWA 1XOAA 3D5JA 4HS1A 3MNGA 4I6XA 2VM2A 4I8BA 3CSHA 4EL1A 1TK8B 4HUAA 2B3SA 5DALA 1XCCA 3DGQA 4G2EA 2B5EA 2QA1A 1TP9A 4ZBAA 1I9DA 5IPGA 1BYEA 3A5IA 4IELA 1B9YC 2HI7A
chains in the Genus database with same CATH topology
3MYDA 1G6YA 2YZHA 4FO5A 2C0FA 4ML1A 2L59A 1V58A 2AHEA 2JSYA 2C8UA 14GSA 3RDWA 2PGTA 1A8YA 4ICYA 1TTZA 4USSA 1QMVA 1R26A 2C4JA 5ECHB 2HRAA 4BA7A 1YEPA 3ZFLA 5CRDA 2R4VA 4V1Ag 3DKSA 2JACA 3GL5A 4ZB6A 2NVLA 5DCHA 3DYRA 1HNCA 1MDJA 5AIVA 3KTBA 1TJDA 2H1GA 2WJUA 1PD21 2F3MA 8GSSA 3UOMA 3N9JA 1RK4A 4YAVA 2PVOC 2AUVA 4V2MA 4KNDA 5ABRA 3IXRA 3SBCA 3ZLPA 3LYKA 4H86A 3E0UA 2ON5A 2GSTA 1EV4A 3VI7A 4O32A 4FYBA 3W6GA 1TXXA 2CVDA 4JZQA 5KEJA 3QPMA 1A0RP 6GSUA 4FQUA 4MH3A 4TVEA 2XBIA 4RUVA 1CQGA 5A4WA 4PNFA 2JSZA 5FT3A 2HE3A 2LEGA 2WULA 1TDIA 3KJYA 1K0CA 4MPFA 2LUSA 1OE7A 1R7HA 3GNJA 4NHWA 3F4SA 1XW6A 4GCIA 3ZTLA 2GVPA 1T4YA 4LL1B 2I3YA 1A8LA 5G5FA 3O3TA 1C72A 4IVFA 4PUFC 1M2AA 3IC8A 4MF5A 1GSEA 3TRPA 3ZL5A 1THXA 2ZNMA 3GKNA 5KOWA 9GSSA 3R3EA 3A2VA 1ABAA 2AJQB 5IO2A 3FZ9A 5A5KA 4YQVA 3TOTA 5HQPA 1OC9B 3WT1A 4Z7XA 2QC7A 1WRYA 5A4VA 1SKRB 4K1FA 5G2ZA 1V2AA 2DKHA 3VPTA 2OADA 4K6XA 1ON4A 2AB6A 4ILFA 4KCEA 1E2YA 4G9HA 1VF1A 3ZIJA 3KH9A 2CVBA 3P8WA 5LD0A 5CO3A 2IMEA 1THOA 4QQ7A 1W89A 1R4WA 3BBYA 5LCZA 5GAND 2K8VA 2CZ2A 5CRWA 1K0OA 4I2TA 3G7IA 4MF6A 4HQSA 2IMKA 2B6MA 1MDKA 1EOHA 1MDIA 2IPAA 4ZL7A 2XHFA 4L8EA 3LJRA 2E2MA 4XS6A 3ISOA 11GSA 2VOCA 4O5UA 1O7UA 2FWEA 3FW2A 4AJ7A 3M0FA 3UEMA 3G7JA 1K0DA 2O7KA 5ECPB 3PR8A 4O5RA 4J2FA 3IDVA 5F05A 3IAS2 2BTOT 4TXVA 4GRFA 4WBJA 3VI5A 2WCIA 2YNXA 4N0ZA 2A2SA 2A2RA 1EEJA 3RPPA 4LMWA 1H75A 1ERWA 1OC9A 1GNEA 3IK7A 2D2ZA 3KD0A 2YN1A 4Q5QA 1GRXA 3F3QA 4LLRA 4IS0A 5B6MA 2EIRA 2YV9A 2LRCA 5IIZA 4Q5FA 1A24A 1AQWA 2CAIA 3KH7A 3FR6A 3FR9A 1XWGA 3PINA 2UZ8A 4N10A 4FYUA 3U6VA 1XOBA 1J9BA 1XW9A 4WF4A 1IYHA 5ECMB 4MLYA 1YDKA 3M9JA 3LXTA 1EP8A 2V6KA 5DBQA 4ZIJA 1T7PB 3FEUA 3IHGA 2C3NA 4ECCA 4FH8A 1Z9HA 13GSA 1O73A 2JZSA 3C73A 2YOIA 1XWBA 4XHMA 4ID0A 3CSIA 2ALBA 1KNGA 3D22A 1QQ2A 4N0VA 2VCZA 4BL7B 3D6IA 1V40A 2GTUA 3FYGA 4YQUA 2DC5A 3EWLA 2JZRA 3ED3A 3O76A 5J9CA 3Q19A 2A2PA 3AY8A 1XXUA 4JU5A 1VRSD 3FY7A 4RQXA 3C1SA 4KSOA 5EY6A 1ZZYA 4DSQA 1TW9A 3TCOA 4JEDA 2VL2A 1XWKA 2CT6A 3LYPA 3GKMA 1QK8A 1ZGNA 3UJ1A 4HEA2 4J56E 1ERVA 4RI7A 5D9WA 2L4CA 5J9BA 4XRDA 2P0GA 5ECNB 2N5AA 3BOAA 1JZRA 1AQXA 5COHA 1FO5A 3C1RA 3RBTA 3NZNA 2MMNA 4PGTA 4K0GA 3EMXA 4PNGA 3HDCA 2E0QA 2R37A 1EGOA 1FOHA 1Z7PA 1CQHA 1MEKA 3IRAA 1Q98A 1TKDB 3A2WA 2C1YA 3QAWA 3EYTA 2GSQA 1K3OA 1DSBA 1U6TA 1FG4A 5B8BA 2C3QA 1OAZA 3TJKA 4F03A 4EXJA 4BL7A 3EMPA 1RQMA 2B7KA 4YKFA 5LNKe 5HR3A 2H8LA 2FUG2 3QR6A 4MJAA 1Z6MA 2LJAA 2P5QA 5ENUA 1SKWB 6GSWA 4BVYB 4X43A 2YJHA 3HZ4A 2YWNA 4KDXA 4GF0A 2YWOA 1B48A 2F51A 1ERTA 4WKWA 5EPFA 3HJOA 1WJKA 3CRTA 1LU4A 2WS2A 1XFLA 4GQCA 1BJXA 5ECRB 1XIYA 3SWLA 4ZILA 5ECSA 5IMFA 4OD7A 2QKEA 2LTKA 3C8EA 2YP6A 3LGCA 1Z3EA 1O8WA 5CAXA 2PN8A 3HJPA 1A2JA 2XPEA 3UAPA 4Z2RA 2O85A 4MJBA 3LWAA 1NW2A 2VO4A 3PPUA 4ECBA 1X5EA 4MA9A 2HLSA 1JLVA 1HNAA 1W4VA 2CVKA 2FY6A 1Q4JA 4JR4A 2F8AA 1FB0A 2R0CA 2HT9A 2DMMA 3HJMA 1KEBA 4IJIA 4EUYA 3M1GA 4EDYA 1G7EA 1OKTA 4I97A 2FCHA 4PURA 6GSVA 5JCGA 4EIPA 1FVKA 4K8MA 1O81A 3ZYWA 4EE0A 3HZ8A 1EEMA 1GSUA 2OBKA 5C00A 1FOVA 2R0GA 4BVYA 1PKZA 1XVQA 4K7NA 4KGIA 4XRAA 4MJEA 2B5YA 2V1MA 1PX6A 2EIQA 2I4AA 1JHBA 4K7OA 20GSA 4QL7A 4HQZA 1DE1A 3MDKA 4BVXB 4K2DA 1HD2A 4NMUA 1I5GA 5D73A 2RIIA 3VWUA 2I81A 2HXKA 2OBIA 6GSTA 3UL3A 2OKAA 4POKA 2M72A 2N5BA 4KH7A 4NV5A 3IE3A 1BAYA 2VL2C 1YKAA 2IIYA 4F0BA 1SYRA 2H75A 5J3RA 1N2AA 3P90A 3MAKA 4MP4A 3GYKA 1UA5A 4TKYA 2GQKA 3TKRA 5G1LA 2VCWA 3F9UA 1H4OA 4HJ2A 1XWAA 2WFCA 3KP9A 1SL2B 2HFDA 2WRTA 4TW5A 2VLTA 5DJMA 1AQVA 1GNWA 4I2UA 2DJ3A 3Q6OA 1WIKA 2FGXA 2H74A 4XS4A 1B4QA 2FNOA 3G9BA 3VPQA 3GIXA 1YQ1A 3L4NA 4BWQA 2GZYA 2TIRA 2FA4A 3L9SA 5JWOB 3UIWA 3LG6A 2PMTA 1PX7A 3QFAC 5DQYA 4BWSA 3QFBC 2TRCP 4KSMA 4A5PA 1ZYNA 1GSQA 5IOWA 4NV2A 2XBQA 5JWRB 2AAWA 2M80A 4BVXA 4MF7A 3KM6A 4ZXGA 3HVVA 2A4VA 2LS5A 2H0GA 3WD6A 3MWHA 4O92A 2B1KA 5DJLA 3RPNA 4ML6A 3M9KA 1PN9A 4ACSA 6GSXA 1GSFA 3IBHA 2B5XA 2RLIA 2LNSA 7GSSA 3APQA 2N5FA 2FWFA 3I69A 3UBLA 3BD2A 3QAVA 4YAPA 1JZOA 3IR4A 1Y6EA 2VD0A 3ZMLA 4MK3A 1AC1A 4IJ3A 4X4JA 2H70A 5B8AA 2WGRA 5J4UA 2XC2A 4IP1A 4J57E 2ON7A 2DIZA 4KUNA 2PVQA 1GUMA 5KN2A 2KP2A 2VAFA 1IYIA 4AF2A 3VWVA 4P3YB 1QUWA 4BPYA 2QGVA 2YWMA 5D93A 3ERFA 3G7YA 2X49A 4QL9A 4OCEA 3ZZXA 3HVSA 3FMWA 1OVNA 3U5RE 1QXHA 1GWCA 5JWQB 2R2JA 2O8VB 1PA3A 17GSA 2DIYA 2GLRA 4GLTA 3WGXA 2YANA 4DEJA 4GSTA 3F8UA 1ACVA 2YCDA 5ELAA 5HR2A 4XIHA 2L4QA 2C0EA 3LEFA 1OKDA 1LBKA 3TKPA 3D4MA 1PL2A 3ZITA 2DJJA 4ZL9A 4GSNA 2HZFA 2H19A 1S3CA 2GZPA 3A2XA 3KZQA 2JU5A 3CTFA 1JFUA 3IHQA 1BG5A 2XPDA 3GSTA 2DMLA 5D9TA 2V32A 4N30A 2P5RA 4G0KA 2R3XA 1X0RA 1DBYA 4V1Ap 1VF3A 4TR0A 1OYJA 2BJXA 1GSYA 2R0PA 4ZB8A 2B7JA 3VWXA 5D9VA 3DD3A 2IMFA 1PRXA 3IA1A 1TU7A 2QSIA 4KCAA 2IMIA 5HFKA 3M3MA 3EE2A 1K0NA 2IN3A 2TRXA 3DVWA 4KX4A 3GHAA 5HR0A 1EOGA 2M46A 1PKWA 5AISA 4MZBA 3DXBA 3GV1A 1GTUA 4ULXA 4X1UA 4PUAA 3TOUA 4EKZA 1Z6NA 2CX4A 2HRFA 4HZ4A 2GSRA 2H6YA 4POBA 5INYA 4Z2TA 4RI6A 1NHOA 5HFGA 4TXOB 5HR1A 2X8HA 3CMIA 1TRUA 2H73A 3MSZA 4KW6A 2X4AA 2JL4A 3I9V2 4HU7A 4OFMA 4K5RA 2ES7A 4IHUA 5ECIB 1YF1A 2I1UA 1YY7A 1AIUA 3IPZA 3L78A 4FIWA 1AUCA 2QA2A 1F9MA 3QDNA 5L71A 5IMCA 1GUHA 3E9JB 2C3TA 3H4KA 4V2NA 1V98A 3ZREA 3P2AA 5IMVA 3KMOA 2VL3A 2VCQA 4OWYA 1EWXA 3ERWA 3DIEA 2H6ZA 4JR6A 4HOJA 2JADA 4F9ZA 3LQ7A 4JBBA 3FRCA 2LSTA 2KLXA 3W8SA 2VCXA 5IO0A 2H30A 4G19A 2VCTA 1ZOFA 4CHSA 3PGTA 4MMMA 1T4ZA 5H5QA 3RHCA 1XPVA 2F8FA 2Z9SA 3GUSA 2PWJA 1FVJA 1SD9A 4GQFA 5J5NA 3NIVA 1EGRA 3GL3A 4Q5RA 2ZUPA 2DLXA 2PUKC 1M0UA 2E2GA 3HY2A 1XVWA 4KDYA 4OCFA 4TXOA 4IN0A 1YKCA 2DJ1A 1ZYQB 4NPBA 2K8SA 4GSSA 1EZKA 4FYCA 3UVTA 1FAAA 3HCZA 1OC8A 3FHKA 2VCVA 3H8QA 5KOXA 2X99A 3LW9A 2HSYA 4K9ZA 2L6CA 2VD1A 1EV9A 4ZL8A 3ZMKA 1F3AA 3M8NA 1GP1A 2PBJA 1V9WA 4K5SA 3APOA 3EURA 1TI1A 1GUKA 1R5AA 2OJLA 3EC3A 4XCSA 4G0LA 3F3RA 1TRVA 3CSJA 2LNTA 2LJRA 4KA0A 1TOFA 3NOFA 1QFNA 3R2QA 4DSRA 2RM5A 5FWGA 1SYXA 2FWHA 4EVMA 2C0GA 1YZXA 5AGYA 1O85A 3ZVJD 4TR3A 3FKFA 2OACA 3KGKA 5CNWA 1X9WB 5CP1A 3TJFA 1UN2A 1SJ6A 2YWIA 3KEBA 3FK8A 2MMAA 3F4RA 2H01A 2KP1A 3HA9A 4XTSA 5AN1A 1A0FA 5DVBA 3RAZA 2H71A 1USBA 3H79A 4WF5A 1HYUA 1Z5YE 3EU3A 4ZB9A 4POMA 5DAKB 5G30A 1EP7A 2H66A 1ZYEA 3GN3A 1VF2A 4WR4A 2GDRA 4XS4B 1M7TA 4GWRA 3CTGA 3EU4A 3TKSA 3KCMA 3HXSA 1F3BA 1ERUA 3DRNA 1GTBA 2G2QA 2H1AA 2GT6A 2AYTA 1M2DA 3KP8A 1JZWA 2CZ3A 2MMOA 1BX9A 5BMUA 1U3AA 3IOSA 3FZ5A 4TR4A 5JCUA 3W8JA 1NHYA 4XS1A 1PN0A 16GSA 4YH2A 4POLA 3GA4A 3IV4A 1XWCA 4LL4B 2OE1A 1V57A 4ECJA 5D8IA 4G10A 4L5OA 1J0FA 3F6DA 5ID2B 4NWYA 5G1KA 1GSDA 2OE0A 3IK9A 1O8XA 2R6KA 2IMDA 1KBNA 2L57A 3C71A 5F07A 4HJMA 2NTOA 1B8XA 4D73B 4IGJA 3WT2A 1XW5A 4ECIA 1AW9A 3GTUB 1ZYPA 2LQQA 2LQOA 3I6AA 3VWWA 1T3BA 1VGLA 10GSA 2GZZA 3GX0A 5DAKA 1Y25A 2LRNA 3GX8A 1MTCA 4K7IA 4WR5A 1AAZA 2L6DA 3DVXA 1VF4A 6GSSA 2K6VA 2H0HA 3QOUA 4ISDA 4K0NA 2V6OA 3TJGA 4IQ1A 3TRXA 1YF0A 1F2EA 2HSMA 4N11A 5IQYA 5GSTA 2CX3A 2WZ9A 3ERGA 1PSQA 2RUFA 5GSSA 3OR5A 2MZCA 4NXIA 2H6XA 2P31A 4EO3A 3ZRDA 6GSYA 2FA8A 1WE0A 2GGTA 3L9UA 1PQNA 1PMTA 3CBUA 3CXGA 4Z2UA 3DEXA 5CRHA 3APSA 2R5GA 1GLQA 5BRTA 5EVOA 5E4WA 3F4TA 3VFIA 3BJ5A 2B1LA 5IMDA 4PTSA 3WYWA 3UVHA 1G0TA 1S3DA 3CRUA 2C0DA 4LA1A 5ID2A 3D4TA 2LJKA 3EINA 3IC4A 2HZEB 5ELGA 3D21A 3TJBA 1A23A 3LFLA 4LMVA 2FWGA 5C04A 1X9SB 4D73A 3J7Yk 3DWVA 2MBSA 3GTUA 3QMXA 1X9MB 2DJ2A 5ECKB 4CY8A 5CRGA 3BCKA 3HVXA 2H72A 2H1DA 4F0CA 2VIMA 5KN0A 2IFQB 2OE3A 3MIXA 1A2MA 3D0ZA 4MJCA 1NSWA 3I43A 3VURA 3GURA 2C80A 1K3YA 2NBSA 5ECLB 4CDOA 1TRWA 4Q5NA 2IJYA 2AV4A 3ME8A 1GULA 1T00A 5KN1A 1TK0B 4OMVA 1G6WA 1K0AA 2VLUA 5AIXA 5B7CA 1AXDA 4EC0A 4TRXA 4MZWA 2DBCA 2MBTA 3TKSC 1SJIA 4OFTA 4E8HA 1WMJA 3TKQA 1WOUA 5HFIA 2K9FA 2OA7A 3GMFA 4L0UA 3QAGA 3UMAA 4ZBBA 1BEDA 5E59A 5DQSA 2DKIA 4PQ1A 2H76A 1X5DA 2LKUA 5IPHA 5CYYA 4OO5A 3VK9A 1K0BA 3EPTA 1SL0B 2H1BA 18GSA 3A3TA 2HZEA 3L9VA 5D96A 3GKXA 3ZFBA 5IMZA 1OC3A 1F6MC 4O5QA 3TDGA 4MABA 3GRXA 1YJ6A 3DMLA 4AJ8A 4DSSB 3C7MA 2FD3A 3KTLA 3ZIVA 2PERA 4WXTA 1B9XC 2IWTA 4MNNA 4MZCA 3GH6A 1TU8A 4RQRA 1OE8A 2IFQA 2O87A 4PXOA 2DSAA 5GZZB 3GKKA 4CW9A 1R5PA 3RHBA 4EIQA 2DJ0A 3US3A 1GLPA 1JZDA 4CY6A 4OFNA 4WEYA 1SK2A 3LORA 1GSSA 2HRNA 2O89A 1DUGA 12GSA 4ZBDA 4EF0A 2GQMA 3A5WA 4KF9A 5F0GA 1SL1B 1LJRA 1GL8A 3J7Yb 2CAQA 2JZTA 3BCIA 1KTEA 2X8GA 1TRSA 3K8NA 2PU9C 5ECQB 5GAPD 4PQHA 1N8JA 2FHEA 4IQAA 4K2XA 1WP0A 1GTIA 4IKHA 1URMA 1Z7RA 1ILOA 3P7XA 2CV4A 1U88A 1HNBA 5DCGA 1K3LA 4AGSA 3F0IA 1MD4A 4HDEA 2L5LA 3TKSE 5B6NA 1SD8A 1HQOA 4E8EA 4KE3A 2G0FA 3F63A 3O6TA 3ZVJA 2RM6A 2HYXA 2VLVA 4WBRD 3KMNA 1RW1A 3H93A 2REMA 1U87A 4HI7A 3KXOA 5IMAA 2PPTA 4L5LA 4MCUA 5JCWA 5IOXA 3Q74A 4DSSA 1GTAA 2H0IA 2VL9A 2V2GA 3EVIA 2NDOA 2WB9A 2K18A 3L0HA 1WWJA 1ST9A 5DDLA 5IM9A 2YZUA 2F9SA 1DE2A 3FR3A 4I5QA 3CYNA 4F2IA 1SK0A 1XBSA 2X64A 1NM3A 3N5OA 1SK1A 2J9HA 3TB2A 3Q18A 2YPMA 2GS3A 1TI3A 1X5CA 2DJKA 1ZL9A 1FW1A 1SKSB 4NHZA 3VLNA 4KB3A 4JRRA 5J41A 1S3AA 4IBPA 4F82A 19GSA 4OO4A 2LRTA 2CQ9A 1F37A 3H1NA 1ZCPA 2J23A 5H5RA 4GTUA 3TUEA 4TR1B 4PX1A 2LV3A 3FZ4A 3WGEA 1GH2A 3PH9A 3GSSA 1TK5B 2VM1A 4TN8A 2YV7A 4MPGA 5FHIA 1WPIA 1BQ7A 4YQMA 1M2BA 1A2LA 3QD9A 5ECOB 3HKRA 1T8EB 5D9XA 2KHPA 2L5OA 4IP6A 1SJZA 4HZ2A 2RUEA 3HHVA 4JE1A 3E3EA 4MH2A 4GXZA 5G31A 5F8BA 2KOKA 3TGZA 2GQLA 2I9HA 3UARA 3F6FA 1B4PA 1MD3A 3IAM2 1ML6A 5DALB 3JCML 2GT5A 1U3IA 3LXZA 4IW9A 3FZAA 2YJ7A 1FB6A 2EIOA 22GSA 4KDUA 4G0IA 1XZOA 4YKGA 1PL1A 2EC4A 1QGVA 2E7PA 2HRKA 5G5EA 3HYPA 1O6JA 3WGDA 1M99A 1G7OA 3HD5A 1FHEA 1J08A 2VUPA 3QCPA 1M9BA 3LSZA 1K0MA 3V1WA 2NPBA 3ME7A 3UBKA 3KIJA 5CREA 1YEXA 1PGTA 4L0WA 5EL8A 1UVZA 2WDUA 4NAXA 2KUCA 3TJJA 3TRQA 2MYGA 2CA8A 4HU9A 2MMZA 4TR1A 2HNLA 2FLSA 1E6BA 2BMXA 3GFKA 1SENA 4PQIA 4KAEA 1SU9A 5A4UA 1UC7A 4AJ6A 2ZCTA 4TOPA 4O7HA 2V41A 5KN3A 4WETA 3S9FA 2HSHA 1ZMAA 3GH9A 1T1VA 4DVCA 5F06A 4MDCA 4EDZA 2GSSA 2X8CA 4X0XA 5H5SA 4V2LA 2IL3A 2A4HA 1M9AA 1JLWA 1XOAA 3D5JA 4HS1A 3MNGA 4I6XA 2VM2A 4I8BA 3CSHA 4EL1A 1TK8B 4HUAA 2B3SA 5DALA 1XCCA 3DGQA 4G2EA 2B5EA 2QA1A 1TP9A 4ZBAA 1I9DA 5IPGA 1BYEA 3A5IA 4IELA 1B9YC 2HI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G6Y A;  2YZH A;  4FO5 A;  2C0F A;  4ML1 A;  2L59 A;  1V58 A;  2AHE A;  2JSY A;  2C8U A;  14GS A;  3RDW A;  2PGT A;  1A8Y A;  1TTZ A;  1QMV A;  1R26 A;  2C4J A;  5ECH B;  4BA7 A;  1YEP A;  3ZFL A;  5CRD A;  2R4V A;  4V1A g;  3DKS A;  2JAC A;  3GL5 A;  4ZB6 A;  2NVL A;  5DCH A;  3DYR A;  1HNC A;  1MDJ A;  5AIV A;  3KTB A;  1TJD A;  2H1G A;  2WJU A;  1PD2 1;  2F3M A;  8GSS A;  3UOM A;  3N9J A;  1RK4 A;  4YAV A;  2PVO C;  2AUV A;  4V2M A;  4KND A;  5ABR A;  3IXR A;  3SBC A;  3ZLP A;  3LYK A;  4H86 A;  3E0U A;  2ON5 A;  2GST A;  1EV4 A;  3VI7 A;  4O32 A;  4FYB A;  3W6G A;  1TXX A;  2CVD A;  4JZQ A;  5KEJ A;  3QPM A;  1A0R P;  6GSU A;  4MH3 A;  4TVE A;  2XBI A;  4RUV A;  1CQG A;  5A4W A;  4PNF A;  2JSZ A;  5FT3 A;  2HE3 A;  2LEG A;  2WUL A;  1TDI A;  3KJY A;  1K0C A;  4MPF A;  2LUS A;  1OE7 A;  1R7H A;  3GNJ A;  4NHW A;  3F4S A;  1XW6 A;  4GCI A;  3ZTL A;  2GVP A;  1T4Y A;  4LL1 B;  2I3Y A;  1A8L A;  5G5F A;  3O3T A;  1C72 A;  4IVF A;  4PUF C;  1M2A A;  4MF5 A;  1GSE A;  3TRP A;  3ZL5 A;  1THX A;  2ZNM A;  3GKN A;  9GSS A;  3A2V A;  1ABA A;  2AJQ B;  5IO2 A;  3FZ9 A;  5A5K A;  4YQV A;  3TOT A;  5HQP A;  1OC9 B;  3WT1 A;  4Z7X A;  2QC7 A;  1WRY A;  5A4V A;  1SKR B;  4K1F A;  5G2Z A;  1V2A A;  3VPT A;  2OAD A;  4K6X A;  1ON4 A;  2AB6 A;  4ILF A;  4KCE A;  1E2Y A;  4G9H A;  1VF1 A;  3ZIJ A;  3KH9 A;  2CVB A;  3P8W A;  5LD0 A;  5CO3 A;  2IME A;  1THO A;  4QQ7 A;  1W89 A;  1R4W A;  3BBY A;  5LCZ A;  5GAN D;  2K8V A;  2CZ2 A;  5CRW A;  1K0O A;  4I2T A;  3G7I A;  4MF6 A;  4HQS A;  2IMK A;  2B6M A;  1MDK A;  1EOH A;  1MDI A;  2IPA A;  4ZL7 A;  2XHF A;  4L8E A;  3LJR A;  2E2M A;  4XS6 A;  3ISO A;  11GS A;  2VOC A;  1O7U A;  2FWE A;  3FW2 A;  4AJ7 A;  3M0F A;  3UEM A;  3G7J A;  1K0D A;  2O7K A;  5ECP B;  3PR8 A;  4O5R A;  4J2F A;  3IDV A;  5F05 A;  3IAS 2;  2BTO T;  4TXV A;  4GRF A;  4WBJ A;  3VI5 A;  2WCI A;  2YNX A;  4N0Z A;  2A2S A;  2A2R A;  1EEJ A;  3RPP A;  4LMW A;  1H75 A;  1ERW A;  1OC9 A;  1GNE A;  3IK7 A;  2D2Z A;  3KD0 A;  2YN1 A;  4Q5Q A;  1GRX A;  3F3Q A;  4LLR A;  4IS0 A;  5B6M A;  2EIR A;  2YV9 A;  2LRC A;  5IIZ A;  4Q5F A;  1A24 A;  1AQW A;  2CAI A;  3KH7 A;  3FR6 A;  3FR9 A;  1XWG A;  3PIN A;  4N10 A;  4FYU A;  3U6V A;  1XOB A;  1J9B A;  1XW9 A;  4WF4 A;  1IYH A;  5ECM B;  4MLY A;  1YDK A;  3M9J A;  3LXT A;  1EP8 A;  2V6K A;  5DBQ A;  4ZIJ A;  1T7P B;  3FEU A;  2C3N A;  4ECC A;  4FH8 A;  1Z9H A;  13GS A;  1O73 A;  2JZS A;  3C73 A;  2YOI A;  1XWB A;  4XHM A;  4ID0 A;  3CSI A;  2ALB A;  1KNG A;  3D22 A;  1QQ2 A;  4N0V A;  2VCZ A;  3D6I A;  1V40 A;  2GTU A;  3FYG A;  4YQU A;  2DC5 A;  3EWL A;  2JZR A;  3ED3 A;  3O76 A;  5J9C A;  3Q19 A;  3AY8 A;  1XXU A;  4JU5 A;  1VRS D;  3FY7 A;  4RQX A;  3C1S A;  4KSO A;  5EY6 A;  1ZZY A;  4DSQ A;  1TW9 A;  3TCO A;  4JED A;  2VL2 A;  1XWK A;  2CT6 A;  3LYP A;  3GKM A;  1QK8 A;  1ZGN A;  3UJ1 A;  4HEA 2;  4J56 E;  1ERV A;  4RI7 A;  5D9W A;  2L4C A;  5J9B A;  4XRD A;  2P0G A;  5ECN B;  2N5A A;  3BOA A;  1JZR A;  1AQX A;  5COH A;  1FO5 A;  3C1R A;  3RBT A;  3NZN A;  2MMN A;  4PGT A;  4K0G A;  3EMX A;  4PNG A;  3HDC A;  2E0Q A;  2R37 A;  1EGO A;  1Z7P A;  1CQH A;  1MEK A;  3IRA A;  1Q98 A;  1TKD B;  3A2W A;  2C1Y A;  3QAW A;  3EYT A;  2GSQ A;  1K3O A;  1DSB A;  1U6T A;  1FG4 A;  5B8B A;  2C3Q A;  1OAZ A;  3TJK A;  4F03 A;  4EXJ A;  4BL7 A;  3EMP A;  1RQM A;  2B7K A;  5LNK e;  5HR3 A;  2H8L A;  2FUG 2;  3QR6 A;  4MJA A;  1Z6M A;  2LJA A;  2P5Q A;  5ENU A;  1SKW B;  6GSW A;  4X43 A;  2YJH A;  3HZ4 A;  2YWN A;  4KDX A;  4GF0 A;  2YWO A;  1B48 A;  2F51 A;  1ERT A;  4WKW A;  5EPF A;  3HJO A;  1WJK A;  3CRT A;  1LU4 A;  2WS2 A;  1XFL A;  4GQC A;  1BJX A;  5ECR B;  1XIY A;  3SWL A;  4ZIL A;  5ECS A;  5IMF A;  4OD7 A;  2QKE A;  2LTK A;  3C8E A;  2YP6 A;  3LGC A;  1Z3E A;  1O8W A;  5CAX A;  2PN8 A;  3HJP A;  1A2J A;  2XPE A;  3UAP A;  2O85 A;  4MJB A;  3LWA A;  1NW2 A;  2VO4 A;  4ECB A;  1X5E A;  4MA9 A;  2HLS A;  1JLV A;  1HNA A;  1W4V A;  2CVK A;  2FY6 A;  1Q4J A;  4JR4 A;  2F8A A;  1FB0 A;  2HT9 A;  2DMM A;  3HJM A;  1KEB A;  4IJI A;  4EUY A;  3M1G A;  4EDY A;  1G7E A;  1OKT A;  4I97 A;  2FCH A;  4PUR A;  6GSV A;  5JCG A;  1FVK A;  4K8M A;  1O81 A;  3ZYW A;  4EE0 A;  3HZ8 A;  1EEM A;  1GSU A;  2OBK A;  5C00 A;  1FOV A;  4BVY A;  1PKZ A;  1XVQ A;  4K7N A;  4KGI A;  4XRA A;  4MJE A;  2B5Y A;  2V1M A;  1PX6 A;  2EIQ A;  2I4A A;  1JHB A;  4K7O A;  20GS A;  4QL7 A;  4HQZ A;  1DE1 A;  3MDK A;  4K2D A;  1HD2 A;  4NMU A;  1I5G A;  5D73 A;  2RII A;  3VWU A;  2I81 A;  2HXK A;  2OBI A;  6GST A;  3UL3 A;  2OKA A;  4POK A;  2M72 A;  2N5B A;  4KH7 A;  4NV5 A;  3IE3 A;  1BAY A;  2VL2 C;  1YKA A;  2IIY A;  4F0B A;  1SYR A;  2H75 A;  5J3R A;  1N2A A;  3P90 A;  3MAK A;  4MP4 A;  3GYK A;  1UA5 A;  4TKY A;  2GQK A;  3TKR A;  5G1L A;  2VCW A;  3F9U A;  1H4O A;  4HJ2 A;  1XWA A;  2WFC A;  3KP9 A;  1SL2 B;  2HFD A;  2WRT A;  4TW5 A;  2VLT A;  5DJM A;  1AQV A;  1GNW A;  4I2U A;  2DJ3 A;  3Q6O A;  1WIK A;  2FGX A;  2H74 A;  4XS4 A;  1B4Q A;  2FNO A;  3G9B A;  3VPQ A;  3GIX A;  1YQ1 A;  3L4N A;  4BWQ A;  2GZY A;  2TIR A;  2FA4 A;  3L9S A;  5JWO B;  3UIW A;  3LG6 A;  2PMT A;  1PX7 A;  3QFA C;  5DQY A;  4BWS A;  3QFB C;  2TRC P;  4KSM A;  1GSQ A;  5IOW A;  4NV2 A;  2XBQ A;  5JWR B;  2AAW A;  2M80 A;  4BVX A;  4MF7 A;  3KM6 A;  4ZXG A;  3HVV A;  2A4V A;  2LS5 A;  2H0G A;  3WD6 A;  3MWH A;  4O92 A;  2B1K A;  5DJL A;  3RPN A;  4ML6 A;  3M9K A;  1PN9 A;  4ACS A;  6GSX A;  1GSF A;  3IBH A;  2B5X A;  2RLI A;  2LNS A;  7GSS A;  3APQ A;  2N5F A;  2FWF A;  3I69 A;  3UBL A;  3BD2 A;  3QAV A;  4YAP A;  1JZO A;  3IR4 A;  1Y6E A;  2VD0 A;  3ZML A;  4MK3 A;  1AC1 A;  4IJ3 A;  2H70 A;  5B8A A;  2WGR A;  5J4U A;  2XC2 A;  4IP1 A;  4J57 E;  2ON7 A;  2DIZ A;  4KUN A;  2PVQ A;  1GUM A;  5KN2 A;  2KP2 A;  2VAF A;  1IYI A;  4AF2 A;  3VWV A;  4P3Y B;  1QUW A;  4BPY A;  2QGV A;  2YWM A;  5D93 A;  3ERF A;  3G7Y A;  4QL9 A;  4OCE A;  3ZZX A;  3HVS A;  1OVN A;  3U5R E;  1QXH A;  1GWC A;  5JWQ B;  2R2J A;  2O8V B;  1PA3 A;  17GS A;  2DIY A;  2GLR A;  4GLT A;  3WGX A;  2YAN A;  4DEJ A;  4GST A;  3F8U A;  1ACV A;  2YCD A;  5ELA A;  5HR2 A;  4XIH A;  2L4Q A;  2C0E A;  3LEF A;  1OKD A;  1LBK A;  3TKP A;  3D4M A;  1PL2 A;  3ZIT A;  2DJJ A;  4ZL9 A;  4GSN A;  2HZF A;  2H19 A;  1S3C A;  2GZP A;  3A2X A;  3KZQ A;  2JU5 A;  3CTF A;  1JFU A;  3IHQ A;  1BG5 A;  2XPD A;  3GST A;  2DML A;  5D9T A;  2V32 A;  4N30 A;  2P5R A;  2R3X A;  1X0R A;  1DBY A;  4V1A p;  1VF3 A;  4TR0 A;  1OYJ A;  2BJX A;  1GSY A;  4ZB8 A;  2B7J A;  3VWX A;  5D9V A;  3DD3 A;  2IMF A;  1PRX A;  3IA1 A;  1TU7 A;  2QSI A;  4KCA A;  2IMI A;  5HFK A;  3M3M A;  3EE2 A;  1K0N A;  2IN3 A;  2TRX A;  3DVW A;  4KX4 A;  3GHA A;  5HR0 A;  1EOG A;  2M46 A;  1PKW A;  5AIS A;  4MZB A;  3DXB A;  3GV1 A;  1GTU A;  4ULX A;  4X1U A;  4PUA A;  3TOU A;  4EKZ A;  1Z6N A;  2CX4 A;  2HRF A;  4HZ4 A;  2GSR A;  2H6Y A;  4POB A;  5INY A;  4RI6 A;  1NHO A;  5HFG A;  4TXO B;  5HR1 A;  2X8H A;  3CMI A;  1TRU A;  2H73 A;  3MSZ A;  4KW6 A;  2JL4 A;  3I9V 2;  4HU7 A;  4OFM A;  2ES7 A;  4IHU A;  5ECI B;  1YF1 A;  2I1U A;  1YY7 A;  1AIU A;  3IPZ A;  3L78 A;  4FIW A;  1AUC A;  1F9M A;  3QDN A;  5L71 A;  5IMC A;  1GUH A;  3E9J B;  2C3T A;  3H4K A;  4V2N A;  1V98 A;  3ZRE A;  3P2A A;  5IMV A;  3KMO A;  2VL3 A;  2VCQ A;  4OWY A;  1EWX A;  3ERW A;  3DIE A;  2H6Z A;  4JR6 A;  4HOJ A;  2JAD A;  4F9Z A;  3LQ7 A;  4JBB A;  3FRC A;  2LST A;  2KLX A;  3W8S A;  2VCX A;  5IO0 A;  2H30 A;  4G19 A;  2VCT A;  1ZOF A;  4CHS A;  3PGT A;  4MMM A;  1T4Z A;  5H5Q A;  3RHC A;  1XPV A;  2F8F A;  2Z9S A;  3GUS A;  2PWJ A;  1FVJ A;  1SD9 A;  4GQF A;  5J5N A;  3NIV A;  1EGR A;  3GL3 A;  4Q5R A;  2ZUP A;  2DLX A;  2PUK C;  1M0U A;  2E2G A;  3HY2 A;  1XVW A;  4KDY A;  4OCF A;  4TXO A;  4IN0 A;  1YKC A;  2DJ1 A;  1ZYQ B;  4NPB A;  2K8S A;  4GSS A;  1EZK A;  4FYC A;  3UVT A;  1FAA A;  3HCZ A;  1OC8 A;  3FHK A;  2VCV A;  3H8Q A;  2X99 A;  2HSY A;  4K9Z A;  2L6C A;  2VD1 A;  1EV9 A;  4ZL8 A;  3ZMK A;  1F3A A;  3M8N A;  1GP1 A;  2PBJ A;  1V9W A;  3APO A;  3EUR A;  1TI1 A;  1GUK A;  1R5A A;  2OJL A;  3EC3 A;  4XCS A;  3F3R A;  1TRV A;  3CSJ A;  2LNT A;  2LJR A;  4KA0 A;  1TOF A;  3NOF A;  1QFN A;  3R2Q A;  4DSR A;  2RM5 A;  5FWG A;  1SYX A;  2FWH A;  4EVM A;  2C0G A;  1YZX A;  5AGY A;  1O85 A;  3ZVJ D;  4TR3 A;  3FKF A;  2OAC A;  3KGK A;  5CNW A;  1X9W B;  5CP1 A;  3TJF A;  1UN2 A;  1SJ6 A;  2YWI A;  3KEB A;  3FK8 A;  2MMA A;  3F4R A;  2H01 A;  2KP1 A;  3HA9 A;  4XTS A;  5AN1 A;  1A0F A;  5DVB A;  3RAZ A;  2H71 A;  1USB A;  3H79 A;  4WF5 A;  1HYU A;  1Z5Y E;  3EU3 A;  4ZB9 A;  4POM A;  5DAK B;  5G30 A;  1EP7 A;  2H66 A;  1ZYE A;  3GN3 A;  1VF2 A;  4WR4 A;  2GDR A;  4XS4 B;  1M7T A;  4GWR A;  3CTG A;  3EU4 A;  3TKS A;  3KCM A;  3HXS A;  1F3B A;  1ERU A;  3DRN A;  1GTB A;  2G2Q A;  2H1A A;  2GT6 A;  2AYT A;  1M2D A;  3KP8 A;  1JZW A;  2CZ3 A;  2MMO A;  1BX9 A;  1U3A A;  3IOS A;  3FZ5 A;  4TR4 A;  5JCU A;  3W8J A;  1NHY A;  4XS1 A;  16GS A;  4YH2 A;  4POL A;  3GA4 A;  3IV4 A;  1XWC A;  4LL4 B;  2OE1 A;  1V57 A;  4ECJ A;  5D8I A;  4G10 A;  4L5O A;  1J0F A;  3F6D A;  5ID2 B;  4NWY A;  5G1K A;  1GSD A;  2OE0 A;  3IK9 A;  1O8X A;  2R6K A;  2IMD A;  1KBN A;  2L57 A;  3C71 A;  5F07 A;  4HJM A;  2NTO A;  1B8X A;  4D73 B;  4IGJ A;  3WT2 A;  1XW5 A;  4ECI A;  1AW9 A;  3GTU B;  2LQQ A;  2LQO A;  3I6A A;  3VWW A;  1T3B A;  1VGL A;  10GS A;  2GZZ A;  3GX0 A;  5DAK A;  1Y25 A;  2LRN A;  3GX8 A;  1MTC A;  4K7I A;  4WR5 A;  1AAZ A;  2L6D A;  3DVX A;  1VF4 A;  6GSS A;  2K6V A;  2H0H A;  3QOU A;  4ISD A;  4K0N A;  2V6O A;  3TJG A;  4IQ1 A;  3TRX A;  1YF0 A;  1F2E A;  4N11 A;  5IQY A;  5GST A;  2CX3 A;  2WZ9 A;  3ERG A;  1PSQ A;  2RUF A;  5GSS A;  3OR5 A;  2MZC A;  4NXI A;  2H6X A;  2P31 A;  4EO3 A;  3ZRD A;  6GSY A;  2FA8 A;  1WE0 A;  2GGT A;  3L9U A;  1PQN A;  1PMT A;  3CBU A;  3CXG A;  3DEX A;  5CRH A;  3APS A;  2R5G A;  1GLQ A;  5EVO A;  5E4W A;  3F4T A;  3VFI A;  3BJ5 A;  2B1L A;  5IMD A;  3WYW A;  3UVH A;  1G0T A;  1S3D A;  3CRU A;  2C0D A;  4LA1 A;  5ID2 A;  3D4T A;  2LJK A;  3EIN A;  3IC4 A;  2HZE B;  5ELG A;  3D21 A;  3TJB A;  1A23 A;  3LFL A;  4LMV A;  2FWG A;  5C04 A;  1X9S B;  4D73 A;  3J7Y k;  3DWV A;  2MBS A;  3GTU A;  3QMX A;  1X9M B;  2DJ2 A;  5ECK B;  5CRG A;  3BCK A;  3HVX A;  2H72 A;  2H1D A;  4F0C A;  2VIM A;  5KN0 A;  2IFQ B;  2OE3 A;  1A2M A;  3D0Z A;  4MJC A;  1NSW A;  3I43 A;  3VUR A;  3GUR A;  2C80 A;  1K3Y A;  2NBS A;  5ECL B;  4CDO A;  1TRW A;  4Q5N A;  2IJY A;  2AV4 A;  3ME8 A;  1GUL A;  1T00 A;  5KN1 A;  1TK0 B;  4OMV A;  1G6W A;  1K0A A;  2VLU A;  5AIX A;  5B7C A;  1AXD A;  4EC0 A;  4TRX A;  4MZW A;  2DBC A;  2MBT A;  3TKS C;  1SJI A;  4OFT A;  4E8H A;  1WMJ A;  3TKQ A;  1WOU A;  5HFI A;  2K9F A;  2OA7 A;  3GMF A;  4L0U A;  3QAG A;  3UMA A;  4ZBB A;  1BED A;  5E59 A;  5DQS A;  4PQ1 A;  2H76 A;  1X5D A;  2LKU A;  5IPH A;  5CYY A;  4OO5 A;  3VK9 A;  1K0B A;  1SL0 B;  2H1B A;  18GS A;  3A3T A;  2HZE A;  3L9V A;  5D96 A;  3GKX A;  3ZFB A;  5IMZ A;  1OC3 A;  1F6M C;  3TDG A;  4MAB A;  3GRX A;  1YJ6 A;  3DML A;  4AJ8 A;  4DSS B;  3C7M A;  2FD3 A;  3KTL A;  3ZIV A;  2PER A;  4WXT A;  1B9X C;  2IWT A;  4MZC A;  3GH6 A;  1TU8 A;  4RQR A;  1OE8 A;  2IFQ A;  2O87 A;  4PXO A;  2DSA A;  5GZZ B;  3GKK A;  4CW9 A;  1R5P A;  3RHB A;  2DJ0 A;  3US3 A;  1GLP A;  1JZD A;  4OFN A;  4WEY A;  1SK2 A;  3LOR A;  1GSS A;  2HRN A;  2O89 A;  1DUG A;  12GS A;  4ZBD A;  4EF0 A;  2GQM A;  3A5W A;  5F0G A;  1SL1 B;  1LJR A;  1GL8 A;  3J7Y b;  2CAQ A;  2JZT A;  3BCI A;  1KTE A;  2X8G A;  1TRS A;  3K8N A;  2PU9 C;  5ECQ B;  5GAP D;  4PQH A;  1N8J A;  2FHE A;  4IQA A;  1WP0 A;  1GTI A;  4IKH A;  1URM A;  1Z7R A;  1ILO A;  3P7X A;  2CV4 A;  1U88 A;  1HNB A;  5DCG A;  1K3L A;  4AGS A;  3F0I A;  1MD4 A;  4HDE A;  2L5L A;  3TKS E;  5B6N A;  1SD8 A;  1HQO A;  4E8E A;  4KE3 A;  2G0F A;  3F63 A;  3O6T A;  3ZVJ A;  2RM6 A;  2HYX A;  2VLV A;  4WBR D;  3KMN A;  1RW1 A;  3H93 A;  2REM A;  1U87 A;  4HI7 A;  3KXO A;  5IMA A;  2PPT A;  4L5L A;  4MCU A;  5JCW A;  5IOX A;  3Q74 A;  4DSS A;  1GTA A;  2H0I A;  2VL9 A;  2V2G A;  3EVI A;  2NDO A;  2WB9 A;  2K18 A;  3L0H A;  1WWJ A;  1ST9 A;  5DDL A;  5IM9 A;  2YZU A;  2F9S A;  1DE2 A;  3FR3 A;  4I5Q A;  3CYN A;  4F2I A;  1SK0 A;  1XBS A;  2X64 A;  1NM3 A;  3N5O A;  1SK1 A;  2J9H A;  3TB2 A;  3Q18 A;  2YPM A;  2GS3 A;  1TI3 A;  1X5C A;  2DJK A;  1ZL9 A;  1FW1 A;  1SKS B;  4NHZ A;  3VLN A;  4KB3 A;  4JRR A;  5J41 A;  1S3A A;  4IBP A;  4F82 A;  19GS A;  4OO4 A;  2LRT A;  2CQ9 A;  1F37 A;  3H1N A;  1ZCP A;  2J23 A;  5H5R A;  4GTU A;  3TUE A;  4TR1 B;  4PX1 A;  2LV3 A;  3FZ4 A;  3WGE A;  1GH2 A;  3PH9 A;  3GSS A;  1TK5 B;  2VM1 A;  4TN8 A;  2YV7 A;  4MPG A;  5FHI A;  1WPI A;  1BQ7 A;  4YQM A;  1M2B A;  1A2L A;  3QD9 A;  5ECO B;  3HKR A;  1T8E B;  5D9X A;  2KHP A;  2L5O A;  4IP6 A;  1SJZ A;  4HZ2 A;  2RUE A;  3HHV A;  4JE1 A;  3E3E A;  4MH2 A;  4GXZ A;  5G31 A;  5F8B A;  2KOK A;  3TGZ A;  2GQL A;  2I9H A;  3UAR A;  3F6F A;  1B4P A;  1MD3 A;  3IAM 2;  1ML6 A;  5DAL B;  3JCM L;  2GT5 A;  1U3I A;  3LXZ A;  4IW9 A;  3FZA A;  2YJ7 A;  1FB6 A;  2EIO A;  22GS A;  4KDU A;  1XZO A;  1PL1 A;  2EC4 A;  1QGV A;  2E7P A;  5G5E A;  3HYP A;  1O6J A;  3WGD A;  1M99 A;  1G7O A;  3HD5 A;  1FHE A;  1J08 A;  2VUP A;  3QCP A;  1M9B A;  3LSZ A;  1K0M A;  3V1W A;  2NPB A;  3ME7 A;  3UBK A;  3KIJ A;  5CRE A;  1YEX A;  1PGT A;  4L0W A;  5EL8 A;  1UVZ A;  2WDU A;  4NAX A;  2KUC A;  3TJJ A;  3TRQ A;  2MYG A;  2CA8 A;  4HU9 A;  2MMZ A;  4TR1 A;  2HNL A;  2FLS A;  1E6B A;  2BMX A;  3GFK A;  1SEN A;  4PQI A;  4KAE A;  1SU9 A;  5A4U A;  1UC7 A;  4AJ6 A;  2ZCT A;  4TOP A;  4O7H A;  2V41 A;  5KN3 A;  4WET A;  3S9F A;  2HSH A;  1ZMA A;  3GH9 A;  1T1V A;  4DVC A;  5F06 A;  4MDC A;  4EDZ A;  2GSS A;  2X8C A;  4X0X A;  5H5S A;  4V2L A;  2IL3 A;  1M9A A;  1JLW A;  1XOA A;  3D5J A;  4HS1 A;  3MNG A;  4I6X A;  2VM2 A;  4I8B A;  3CSH A;  4EL1 A;  1TK8 B;  4HUA A;  2B3S A;  5DAL A;  1XCC A;  3DGQ A;  4G2E A;  2B5E A;  1TP9 A;  4ZBA A;  1I9D A;  5IPG A;  1BYE A;  4IEL A;  1B9Y C;  2HI7 A; 
#chains in the Genus database with same CATH topology
 3MYD A;  1G6Y A;  2YZH A;  4FO5 A;  2C0F A;  4ML1 A;  2L59 A;  1V58 A;  2AHE A;  2JSY A;  2C8U A;  14GS A;  3RDW A;  2PGT A;  1A8Y A;  4ICY A;  1TTZ A;  4USS A;  1QMV A;  1R26 A;  2C4J A;  5ECH B;  2HRA A;  4BA7 A;  1YEP A;  3ZFL A;  5CRD A;  2R4V A;  4V1A g;  3DKS A;  2JAC A;  3GL5 A;  4ZB6 A;  2NVL A;  5DCH A;  3DYR A;  1HNC A;  1MDJ A;  5AIV A;  3KTB A;  1TJD A;  2H1G A;  2WJU A;  1PD2 1;  2F3M A;  8GSS A;  3UOM A;  3N9J A;  1RK4 A;  4YAV A;  2PVO C;  2AUV A;  4V2M A;  4KND A;  5ABR A;  3IXR A;  3SBC A;  3ZLP A;  3LYK A;  4H86 A;  3E0U A;  2ON5 A;  2GST A;  1EV4 A;  3VI7 A;  4O32 A;  4FYB A;  3W6G A;  1TXX A;  2CVD A;  4JZQ A;  5KEJ A;  3QPM A;  1A0R P;  6GSU A;  4FQU A;  4MH3 A;  4TVE A;  2XBI A;  4RUV A;  1CQG A;  5A4W A;  4PNF A;  2JSZ A;  5FT3 A;  2HE3 A;  2LEG A;  2WUL A;  1TDI A;  3KJY A;  1K0C A;  4MPF A;  2LUS A;  1OE7 A;  1R7H A;  3GNJ A;  4NHW A;  3F4S A;  1XW6 A;  4GCI A;  3ZTL A;  2GVP A;  1T4Y A;  4LL1 B;  2I3Y A;  1A8L A;  5G5F A;  3O3T A;  1C72 A;  4IVF A;  4PUF C;  1M2A A;  3IC8 A;  4MF5 A;  1GSE A;  3TRP A;  3ZL5 A;  1THX A;  2ZNM A;  3GKN A;  5KOW A;  9GSS A;  3R3E A;  3A2V A;  1ABA A;  2AJQ B;  5IO2 A;  3FZ9 A;  5A5K A;  4YQV A;  3TOT A;  5HQP A;  1OC9 B;  3WT1 A;  4Z7X A;  2QC7 A;  1WRY A;  5A4V A;  1SKR B;  4K1F A;  5G2Z A;  1V2A A;  2DKH A;  3VPT A;  2OAD A;  4K6X A;  1ON4 A;  2AB6 A;  4ILF A;  4KCE A;  1E2Y A;  4G9H A;  1VF1 A;  3ZIJ A;  3KH9 A;  2CVB A;  3P8W A;  5LD0 A;  5CO3 A;  2IME A;  1THO A;  4QQ7 A;  1W89 A;  1R4W A;  3BBY A;  5LCZ A;  5GAN D;  2K8V A;  2CZ2 A;  5CRW A;  1K0O A;  4I2T A;  3G7I A;  4MF6 A;  4HQS A;  2IMK A;  2B6M A;  1MDK A;  1EOH A;  1MDI A;  2IPA A;  4ZL7 A;  2XHF A;  4L8E A;  3LJR A;  2E2M A;  4XS6 A;  3ISO A;  11GS A;  2VOC A;  4O5U A;  1O7U A;  2FWE A;  3FW2 A;  4AJ7 A;  3M0F A;  3UEM A;  3G7J A;  1K0D A;  2O7K A;  5ECP B;  3PR8 A;  4O5R A;  4J2F A;  3IDV A;  5F05 A;  3IAS 2;  2BTO T;  4TXV A;  4GRF A;  4WBJ A;  3VI5 A;  2WCI A;  2YNX A;  4N0Z A;  2A2S A;  2A2R A;  1EEJ A;  3RPP A;  4LMW A;  1H75 A;  1ERW A;  1OC9 A;  1GNE A;  3IK7 A;  2D2Z A;  3KD0 A;  2YN1 A;  4Q5Q A;  1GRX A;  3F3Q A;  4LLR A;  4IS0 A;  5B6M A;  2EIR A;  2YV9 A;  2LRC A;  5IIZ A;  4Q5F A;  1A24 A;  1AQW A;  2CAI A;  3KH7 A;  3FR6 A;  3FR9 A;  1XWG A;  3PIN A;  2UZ8 A;  4N10 A;  4FYU A;  3U6V A;  1XOB A;  1J9B A;  1XW9 A;  4WF4 A;  1IYH A;  5ECM B;  4MLY A;  1YDK A;  3M9J A;  3LXT A;  1EP8 A;  2V6K A;  5DBQ A;  4ZIJ A;  1T7P B;  3FEU A;  3IHG A;  2C3N A;  4ECC A;  4FH8 A;  1Z9H A;  13GS A;  1O73 A;  2JZS A;  3C73 A;  2YOI A;  1XWB A;  4XHM A;  4ID0 A;  3CSI A;  2ALB A;  1KNG A;  3D22 A;  1QQ2 A;  4N0V A;  2VCZ A;  4BL7 B;  3D6I A;  1V40 A;  2GTU A;  3FYG A;  4YQU A;  2DC5 A;  3EWL A;  2JZR A;  3ED3 A;  3O76 A;  5J9C A;  3Q19 A;  2A2P A;  3AY8 A;  1XXU A;  4JU5 A;  1VRS D;  3FY7 A;  4RQX A;  3C1S A;  4KSO A;  5EY6 A;  1ZZY A;  4DSQ A;  1TW9 A;  3TCO A;  4JED A;  2VL2 A;  1XWK A;  2CT6 A;  3LYP A;  3GKM A;  1QK8 A;  1ZGN A;  3UJ1 A;  4HEA 2;  4J56 E;  1ERV A;  4RI7 A;  5D9W A;  2L4C A;  5J9B A;  4XRD A;  2P0G A;  5ECN B;  2N5A A;  3BOA A;  1JZR A;  1AQX A;  5COH A;  1FO5 A;  3C1R A;  3RBT A;  3NZN A;  2MMN A;  4PGT A;  4K0G A;  3EMX A;  4PNG A;  3HDC A;  2E0Q A;  2R37 A;  1EGO A;  1FOH A;  1Z7P A;  1CQH A;  1MEK A;  3IRA A;  1Q98 A;  1TKD B;  3A2W A;  2C1Y A;  3QAW A;  3EYT A;  2GSQ A;  1K3O A;  1DSB A;  1U6T A;  1FG4 A;  5B8B A;  2C3Q A;  1OAZ A;  3TJK A;  4F03 A;  4EXJ A;  4BL7 A;  3EMP A;  1RQM A;  2B7K A;  4YKF A;  5LNK e;  5HR3 A;  2H8L A;  2FUG 2;  3QR6 A;  4MJA A;  1Z6M A;  2LJA A;  2P5Q A;  5ENU A;  1SKW B;  6GSW A;  4BVY B;  4X43 A;  2YJH A;  3HZ4 A;  2YWN A;  4KDX A;  4GF0 A;  2YWO A;  1B48 A;  2F51 A;  1ERT A;  4WKW A;  5EPF A;  3HJO A;  1WJK A;  3CRT A;  1LU4 A;  2WS2 A;  1XFL A;  4GQC A;  1BJX A;  5ECR B;  1XIY A;  3SWL A;  4ZIL A;  5ECS A;  5IMF A;  4OD7 A;  2QKE A;  2LTK A;  3C8E A;  2YP6 A;  3LGC A;  1Z3E A;  1O8W A;  5CAX A;  2PN8 A;  3HJP A;  1A2J A;  2XPE A;  3UAP A;  4Z2R A;  2O85 A;  4MJB A;  3LWA A;  1NW2 A;  2VO4 A;  3PPU A;  4ECB A;  1X5E A;  4MA9 A;  2HLS A;  1JLV A;  1HNA A;  1W4V A;  2CVK A;  2FY6 A;  1Q4J A;  4JR4 A;  2F8A A;  1FB0 A;  2R0C A;  2HT9 A;  2DMM A;  3HJM A;  1KEB A;  4IJI A;  4EUY A;  3M1G A;  4EDY A;  1G7E A;  1OKT A;  4I97 A;  2FCH A;  4PUR A;  6GSV A;  5JCG A;  4EIP A;  1FVK A;  4K8M A;  1O81 A;  3ZYW A;  4EE0 A;  3HZ8 A;  1EEM A;  1GSU A;  2OBK A;  5C00 A;  1FOV A;  2R0G A;  4BVY A;  1PKZ A;  1XVQ A;  4K7N A;  4KGI A;  4XRA A;  4MJE A;  2B5Y A;  2V1M A;  1PX6 A;  2EIQ A;  2I4A A;  1JHB A;  4K7O A;  20GS A;  4QL7 A;  4HQZ A;  1DE1 A;  3MDK A;  4BVX B;  4K2D A;  1HD2 A;  4NMU A;  1I5G A;  5D73 A;  2RII A;  3VWU A;  2I81 A;  2HXK A;  2OBI A;  6GST A;  3UL3 A;  2OKA A;  4POK A;  2M72 A;  2N5B A;  4KH7 A;  4NV5 A;  3IE3 A;  1BAY A;  2VL2 C;  1YKA A;  2IIY A;  4F0B A;  1SYR A;  2H75 A;  5J3R A;  1N2A A;  3P90 A;  3MAK A;  4MP4 A;  3GYK A;  1UA5 A;  4TKY A;  2GQK A;  3TKR A;  5G1L A;  2VCW A;  3F9U A;  1H4O A;  4HJ2 A;  1XWA A;  2WFC A;  3KP9 A;  1SL2 B;  2HFD A;  2WRT A;  4TW5 A;  2VLT A;  5DJM A;  1AQV A;  1GNW A;  4I2U A;  2DJ3 A;  3Q6O A;  1WIK A;  2FGX A;  2H74 A;  4XS4 A;  1B4Q A;  2FNO A;  3G9B A;  3VPQ A;  3GIX A;  1YQ1 A;  3L4N A;  4BWQ A;  2GZY A;  2TIR A;  2FA4 A;  3L9S A;  5JWO B;  3UIW A;  3LG6 A;  2PMT A;  1PFO A;  1PX7 A;  3QFA C;  5DQY A;  4BWS A;  3QFB C;  2TRC P;  4KSM A;  4A5P A;  1ZYN A;  1GSQ A;  5IOW A;  4NV2 A;  2XBQ A;  5JWR B;  2AAW A;  2M80 A;  4BVX A;  4MF7 A;  3KM6 A;  4ZXG A;  3HVV A;  2A4V A;  2LS5 A;  2H0G A;  3WD6 A;  3MWH A;  4O92 A;  2B1K A;  5DJL A;  3RPN A;  4ML6 A;  3M9K A;  1PN9 A;  4ACS A;  6GSX A;  1GSF A;  3IBH A;  2B5X A;  2RLI A;  2LNS A;  7GSS A;  3APQ A;  2N5F A;  2FWF A;  3I69 A;  3UBL A;  3BD2 A;  3QAV A;  4YAP A;  1JZO A;  3IR4 A;  1Y6E A;  2VD0 A;  3ZML A;  4MK3 A;  1AC1 A;  4IJ3 A;  4X4J A;  2H70 A;  5B8A A;  2WGR A;  5J4U A;  2XC2 A;  4IP1 A;  4J57 E;  2ON7 A;  2DIZ A;  4KUN A;  2PVQ A;  1GUM A;  5KN2 A;  2KP2 A;  2VAF A;  1IYI A;  4AF2 A;  3VWV A;  4P3Y B;  1QUW A;  4BPY A;  2QGV A;  2YWM A;  5D93 A;  3ERF A;  3G7Y A;  2X49 A;  4QL9 A;  4OCE A;  3ZZX A;  3HVS A;  3FMW A;  1OVN A;  3U5R E;  1QXH A;  1GWC A;  5JWQ B;  2R2J A;  2O8V B;  1PA3 A;  17GS A;  2DIY A;  2GLR A;  4GLT A;  3WGX A;  2YAN A;  4DEJ A;  4GST A;  3F8U A;  1ACV A;  2YCD A;  5ELA A;  5HR2 A;  4XIH A;  2L4Q A;  2C0E A;  3LEF A;  1OKD A;  1LBK A;  3TKP A;  3D4M A;  1PL2 A;  3ZIT A;  2DJJ A;  4ZL9 A;  4GSN A;  2HZF A;  2H19 A;  1S3C A;  2GZP A;  3A2X A;  3KZQ A;  2JU5 A;  3CTF A;  1JFU A;  3IHQ A;  1BG5 A;  2XPD A;  3GST A;  2DML A;  5D9T A;  2V32 A;  4N30 A;  2P5R A;  4G0K A;  2R3X A;  1X0R A;  1DBY A;  4V1A p;  1VF3 A;  4TR0 A;  1OYJ A;  2BJX A;  1GSY A;  2R0P A;  4ZB8 A;  2B7J A;  3VWX A;  5D9V A;  3DD3 A;  2IMF A;  1PRX A;  3IA1 A;  1TU7 A;  2QSI A;  4KCA A;  2IMI A;  5HFK A;  3M3M A;  3EE2 A;  1K0N A;  2IN3 A;  2TRX A;  3DVW A;  4KX4 A;  3GHA A;  5HR0 A;  1EOG A;  2M46 A;  1PKW A;  5AIS A;  4MZB A;  3DXB A;  3GV1 A;  1GTU A;  4ULX A;  4X1U A;  4PUA A;  3TOU A;  4EKZ A;  1Z6N A;  2CX4 A;  2HRF A;  4HZ4 A;  2GSR A;  2H6Y A;  4POB A;  5INY A;  4Z2T A;  4RI6 A;  1NHO A;  5HFG A;  4TXO B;  5HR1 A;  2X8H A;  3CMI A;  1TRU A;  2H73 A;  3MSZ A;  4KW6 A;  2X4A A;  2JL4 A;  3I9V 2;  4HU7 A;  4OFM A;  4K5R A;  2ES7 A;  4IHU A;  5ECI B;  1YF1 A;  2I1U A;  1YY7 A;  1AIU A;  3IPZ A;  3L78 A;  4FIW A;  1AUC A;  2QA2 A;  1F9M A;  3QDN A;  5L71 A;  5IMC A;  1GUH A;  3E9J B;  2C3T A;  3H4K A;  4V2N A;  1V98 A;  3ZRE A;  3CQF A;  3P2A A;  5IMV A;  3KMO A;  2VL3 A;  2VCQ A;  4OWY A;  1EWX A;  3ERW A;  3DIE A;  2H6Z A;  4JR6 A;  4HOJ A;  2JAD A;  4F9Z A;  3LQ7 A;  4JBB A;  3FRC A;  2LST A;  2KLX A;  3W8S A;  2VCX A;  5IO0 A;  2H30 A;  4G19 A;  2VCT A;  1ZOF A;  4CHS A;  3PGT A;  4MMM A;  1T4Z A;  5H5Q A;  3RHC A;  1XPV A;  2F8F A;  2Z9S A;  3GUS A;  2PWJ A;  1FVJ A;  1SD9 A;  4GQF A;  5J5N A;  3NIV A;  1EGR A;  3GL3 A;  4Q5R A;  2ZUP A;  2DLX A;  2PUK C;  1M0U A;  2E2G A;  3HY2 A;  1XVW A;  4KDY A;  4OCF A;  4TXO A;  4IN0 A;  1YKC A;  2DJ1 A;  1ZYQ B;  4NPB A;  2K8S A;  4GSS A;  1EZK A;  4FYC A;  3UVT A;  1FAA A;  3HCZ A;  1OC8 A;  3FHK A;  2VCV A;  3H8Q A;  5KOX A;  2X99 A;  3LW9 A;  2HSY A;  4K9Z A;  2L6C A;  2VD1 A;  1EV9 A;  4ZL8 A;  3ZMK A;  1F3A A;  3M8N A;  1GP1 A;  2PBJ A;  1V9W A;  4K5S A;  3APO A;  3EUR A;  1TI1 A;  1GUK A;  1R5A A;  2OJL A;  3EC3 A;  4XCS A;  4G0L A;  3F3R A;  1TRV A;  3CSJ A;  1M3J A;  2LNT A;  2LJR A;  4KA0 A;  1TOF A;  3NOF A;  1QFN A;  3R2Q A;  4DSR A;  2RM5 A;  5FWG A;  1SYX A;  2FWH A;  4EVM A;  2C0G A;  1YZX A;  5AGY A;  1O85 A;  3ZVJ D;  4TR3 A;  3FKF A;  2OAC A;  3KGK A;  5CNW A;  1X9W B;  5CP1 A;  3TJF A;  1UN2 A;  1SJ6 A;  2YWI A;  3KEB A;  3FK8 A;  2MMA A;  3F4R A;  2H01 A;  2KP1 A;  3HA9 A;  4XTS A;  5AN1 A;  1A0F A;  5DVB A;  3RAZ A;  2H71 A;  1USB A;  3H79 A;  4WF5 A;  1HYU A;  1Z5Y E;  3EU3 A;  4ZB9 A;  4POM A;  5DAK B;  5G30 A;  1EP7 A;  2H66 A;  1ZYE A;  3GN3 A;  1VF2 A;  4WR4 A;  2GDR A;  4XS4 B;  1M7T A;  4GWR A;  3CTG A;  3EU4 A;  3TKS A;  3KCM A;  3HXS A;  1F3B A;  1ERU A;  3DRN A;  1GTB A;  2G2Q A;  2H1A A;  2GT6 A;  2AYT A;  1M2D A;  3KP8 A;  1JZW A;  2CZ3 A;  2MMO A;  1BX9 A;  5BMU A;  1U3A A;  3IOS A;  3FZ5 A;  4TR4 A;  5JCU A;  3W8J A;  1NHY A;  4XS1 A;  1PN0 A;  16GS A;  4YH2 A;  4POL A;  3GA4 A;  3IV4 A;  1XWC A;  4LL4 B;  2OE1 A;  1M3I A;  1V57 A;  4ECJ A;  5D8I A;  4G10 A;  4L5O A;  1J0F A;  3F6D A;  5ID2 B;  4NWY A;  5G1K A;  1GSD A;  2OE0 A;  3IK9 A;  1O8X A;  2R6K A;  2IMD A;  1KBN A;  2L57 A;  3C71 A;  5F07 A;  4HJM A;  2NTO A;  1B8X A;  4D73 B;  4IGJ A;  3WT2 A;  1XW5 A;  4ECI A;  1AW9 A;  3GTU B;  1ZYP A;  2LQQ A;  2LQO A;  3I6A A;  3VWW A;  1T3B A;  1VGL A;  10GS A;  2GZZ A;  3GX0 A;  5DAK A;  1Y25 A;  2LRN A;  3GX8 A;  1MTC A;  4K7I A;  4WR5 A;  1AAZ A;  2L6D A;  4BIK A;  3DVX A;  1VF4 A;  6GSS A;  2K6V A;  2H0H A;  3QOU A;  4ISD A;  4K0N A;  2V6O A;  3TJG A;  4IQ1 A;  3TRX A;  1YF0 A;  1F2E A;  2HSM A;  4N11 A;  5IQY A;  5GST A;  2CX3 A;  2WZ9 A;  3ERG A;  1PSQ A;  2RUF A;  5GSS A;  3OR5 A;  2MZC A;  4NXI A;  2H6X A;  2P31 A;  4EO3 A;  3ZRD A;  6GSY A;  2FA8 A;  1WE0 A;  2GGT A;  3L9U A;  1PQN A;  1PMT A;  3CBU A;  3CXG A;  4Z2U A;  3DEX A;  5CRH A;  3APS A;  2R5G A;  1GLQ A;  5BRT A;  5EVO A;  5E4W A;  3F4T A;  3VFI A;  3BJ5 A;  2B1L A;  5IMD A;  4PTS A;  3WYW A;  3UVH A;  1G0T A;  1S3D A;  3CRU A;  2C0D A;  4LA1 A;  5ID2 A;  3D4T A;  2LJK A;  3EIN A;  1XG8 A;  3IC4 A;  2HZE B;  5ELG A;  3D21 A;  3TJB A;  1A23 A;  3LFL A;  4LMV A;  2FWG A;  5C04 A;  1X9S B;  4D73 A;  3J7Y k;  3DWV A;  2MBS A;  3GTU A;  3QMX A;  1X9M B;  2DJ2 A;  5ECK B;  4CY8 A;  5CRG A;  1S3R A;  3BCK A;  3HVX A;  2H72 A;  2H1D A;  4F0C A;  2VIM A;  5KN0 A;  2IFQ B;  2OE3 A;  3MIX A;  1A2M A;  3D0Z A;  4MJC A;  1NSW A;  3I43 A;  3VUR A;  3GUR A;  2C80 A;  1K3Y A;  2NBS A;  5ECL B;  4CDO A;  1TRW A;  4Q5N A;  2IJY A;  2AV4 A;  3ME8 A;  1GUL A;  1T00 A;  5KN1 A;  1TK0 B;  4OMV A;  1G6W A;  1K0A A;  2VLU A;  5AIX A;  5B7C A;  1AXD A;  4EC0 A;  4TRX A;  4MZW A;  2DBC A;  2MBT A;  3TKS C;  1SJI A;  4OFT A;  4E8H A;  1WMJ A;  3TKQ A;  1WOU A;  5HFI A;  2K9F A;  2OA7 A;  3GMF A;  4L0U A;  3QAG A;  3UMA A;  4ZBB A;  1BED A;  5E59 A;  5DQS A;  2DKI A;  4PQ1 A;  4HSC X;  2H76 A;  1X5D A;  2LKU A;  5IPH A;  5CYY A;  4OO5 A;  3VK9 A;  1K0B A;  3EPT A;  1SL0 B;  2H1B A;  18GS A;  3A3T A;  2HZE A;  3L9V A;  5D96 A;  3GKX A;  3ZFB A;  5IMZ A;  1OC3 A;  1F6M C;  4O5Q A;  3TDG A;  4MAB A;  3GRX A;  1YJ6 A;  3DML A;  4AJ8 A;  4DSS B;  3C7M A;  2FD3 A;  3KTL A;  3ZIV A;  2PER A;  4WXT A;  1B9X C;  2IWT A;  4MNN A;  4MZC A;  3GH6 A;  1TU8 A;  4RQR A;  1OE8 A;  2IFQ A;  2O87 A;  4PXO A;  2DSA A;  5GZZ B;  3GKK A;  4CW9 A;  1R5P A;  3RHB A;  4EIQ A;  2DJ0 A;  3US3 A;  1GLP A;  1JZD A;  4CY6 A;  4OFN A;  4WEY A;  1SK2 A;  3LOR A;  1GSS A;  3HVN A;  2HRN A;  2O89 A;  1DUG A;  12GS A;  4ZBD A;  4EF0 A;  2GQM A;  3A5W A;  4KF9 A;  5F0G A;  1SL1 B;  1LJR A;  1GL8 A;  3J7Y b;  2CAQ A;  2JZT A;  3BCI A;  1KTE A;  2X8G A;  1TRS A;  3K8N A;  2PU9 C;  5ECQ B;  5GAP D;  4PQH A;  1N8J A;  2FHE A;  4IQA A;  4K2X A;  1WP0 A;  1GTI A;  4IKH A;  1URM A;  1Z7R A;  1ILO A;  3P7X A;  2CV4 A;  1U88 A;  1HNB A;  5DCG A;  1K3L A;  4AGS A;  3F0I A;  1MD4 A;  4HDE A;  2L5L A;  3TKS E;  5B6N A;  1SD8 A;  1HQO A;  4E8E A;  4KE3 A;  2G0F A;  3F63 A;  3O6T A;  3ZVJ A;  2RM6 A;  2HYX A;  2VLV A;  4WBR D;  3KMN A;  1RW1 A;  3H93 A;  2REM A;  1U87 A;  4HI7 A;  3KXO A;  5IMA A;  2PPT A;  4L5L A;  4MCU A;  5JCW A;  5IOX A;  3Q74 A;  4DSS A;  1GTA A;  2H0I A;  2VL9 A;  2V2G A;  3EVI A;  2NDO A;  2WB9 A;  2K18 A;  3L0H A;  1WWJ A;  1ST9 A;  5DDL A;  5IM9 A;  2YZU A;  2F9S A;  1DE2 A;  3FR3 A;  4I5Q A;  3CYN A;  4F2I A;  1SK0 A;  1XBS A;  2X64 A;  1NM3 A;  3N5O A;  1SK1 A;  2J9H A;  3TB2 A;  3Q18 A;  2YPM A;  2GS3 A;  1TI3 A;  1X5C A;  2DJK A;  1ZL9 A;  1FW1 A;  1SKS B;  4NHZ A;  3VLN A;  4KB3 A;  4JRR A;  5J41 A;  1S3A A;  4IBP A;  4F82 A;  19GS A;  4OO4 A;  2LRT A;  2CQ9 A;  1F37 A;  3H1N A;  1ZCP A;  2J23 A;  5H5R A;  4GTU A;  3TUE A;  4TR1 B;  4PX1 A;  2LV3 A;  3FZ4 A;  3WGE A;  1GH2 A;  3PH9 A;  3GSS A;  1TK5 B;  2VM1 A;  4TN8 A;  2YV7 A;  4MPG A;  5FHI A;  1WPI A;  1BQ7 A;  4YQM A;  1M2B A;  1A2L A;  3QD9 A;  5ECO B;  3HKR A;  1T8E B;  5D9X A;  2KHP A;  2L5O A;  4IP6 A;  1SJZ A;  4HZ2 A;  2RUE A;  3HHV A;  4JE1 A;  3E3E A;  4MH2 A;  4GXZ A;  5G31 A;  5F8B A;  2KOK A;  3TGZ A;  2GQL A;  2I9H A;  3UAR A;  3F6F A;  1B4P A;  1MD3 A;  3IAM 2;  1ML6 A;  5DAL B;  3JCM L;  2GT5 A;  1U3I A;  3LXZ A;  4IW9 A;  3FZA A;  2YJ7 A;  1FB6 A;  2EIO A;  22GS A;  4KDU A;  4G0I A;  1XZO A;  4YKG A;  1PL1 A;  2EC4 A;  1QGV A;  2E7P A;  2HRK A;  5G5E A;  3HYP A;  1O6J A;  3WGD A;  1M99 A;  1G7O A;  3HD5 A;  1FHE A;  1J08 A;  2VUP A;  3QCP A;  1M9B A;  3LSZ A;  1K0M A;  3V1W A;  2NPB A;  3ME7 A;  3UBK A;  3KIJ A;  5CRE A;  1YEX A;  1PGT A;  4L0W A;  5EL8 A;  1UVZ A;  2WDU A;  4NAX A;  2KUC A;  3TJJ A;  3TRQ A;  2MYG A;  2CA8 A;  4HU9 A;  2MMZ A;  4TR1 A;  2HNL A;  2FLS A;  1E6B A;  2BMX A;  3GFK A;  1SEN A;  4PQI A;  4KAE A;  1SU9 A;  5A4U A;  1UC7 A;  4AJ6 A;  2ZCT A;  4TOP A;  4O7H A;  2V41 A;  5KN3 A;  4WET A;  3S9F A;  2HSH A;  1ZMA A;  3GH9 A;  1T1V A;  4DVC A;  5F06 A;  4MDC A;  4EDZ A;  2GSS A;  2X8C A;  4X0X A;  5H5S A;  4V2L A;  2IL3 A;  2A4H A;  1M9A A;  1JLW A;  1XOA A;  3D5J A;  4HS1 A;  3MNG A;  4I6X A;  2VM2 A;  4I8B A;  3CSH A;  4EL1 A;  1TK8 B;  4HUA A;  2B3S A;  5DAL A;  1XCC A;  3DGQ A;  4G2E A;  2B5E A;  2QA1 A;  1TP9 A;  4ZBA A;  1I9D A;  5IPG A;  1BYE A;  3A5I A;  4IEL A;  1B9Y C;  2HI7 A; 
#chains in the Genus database with same CATH homology
 3MYD A;  1G6Y A;  2YZH A;  4FO5 A;  2C0F A;  4ML1 A;  2L59 A;  1V58 A;  2AHE A;  2JSY A;  2C8U A;  14GS A;  3RDW A;  2PGT A;  1A8Y A;  4ICY A;  1TTZ A;  4USS A;  1QMV A;  1R26 A;  2C4J A;  5ECH B;  2HRA A;  4BA7 A;  1YEP A;  3ZFL A;  5CRD A;  2R4V A;  4V1A g;  3DKS A;  2JAC A;  3GL5 A;  4ZB6 A;  2NVL A;  5DCH A;  3DYR A;  1HNC A;  1MDJ A;  5AIV A;  3KTB A;  1TJD A;  2H1G A;  2WJU A;  1PD2 1;  2F3M A;  8GSS A;  3UOM A;  3N9J A;  1RK4 A;  4YAV A;  2PVO C;  2AUV A;  4V2M A;  4KND A;  5ABR A;  3IXR A;  3SBC A;  3ZLP A;  3LYK A;  4H86 A;  3E0U A;  2ON5 A;  2GST A;  1EV4 A;  3VI7 A;  4O32 A;  4FYB A;  3W6G A;  1TXX A;  2CVD A;  4JZQ A;  5KEJ A;  3QPM A;  1A0R P;  6GSU A;  4FQU A;  4MH3 A;  4TVE A;  2XBI A;  4RUV A;  1CQG A;  5A4W A;  4PNF A;  2JSZ A;  5FT3 A;  2HE3 A;  2LEG A;  2WUL A;  1TDI A;  3KJY A;  1K0C A;  4MPF A;  2LUS A;  1OE7 A;  1R7H A;  3GNJ A;  4NHW A;  3F4S A;  1XW6 A;  4GCI A;  3ZTL A;  2GVP A;  1T4Y A;  4LL1 B;  2I3Y A;  1A8L A;  5G5F A;  3O3T A;  1C72 A;  4IVF A;  4PUF C;  1M2A A;  3IC8 A;  4MF5 A;  1GSE A;  3TRP A;  3ZL5 A;  1THX A;  2ZNM A;  3GKN A;  5KOW A;  9GSS A;  3R3E A;  3A2V A;  1ABA A;  2AJQ B;  5IO2 A;  3FZ9 A;  5A5K A;  4YQV A;  3TOT A;  5HQP A;  1OC9 B;  3WT1 A;  4Z7X A;  2QC7 A;  1WRY A;  5A4V A;  1SKR B;  4K1F A;  5G2Z A;  1V2A A;  2DKH A;  3VPT A;  2OAD A;  4K6X A;  1ON4 A;  2AB6 A;  4ILF A;  4KCE A;  1E2Y A;  4G9H A;  1VF1 A;  3ZIJ A;  3KH9 A;  2CVB A;  3P8W A;  5LD0 A;  5CO3 A;  2IME A;  1THO A;  4QQ7 A;  1W89 A;  1R4W A;  3BBY A;  5LCZ A;  5GAN D;  2K8V A;  2CZ2 A;  5CRW A;  1K0O A;  4I2T A;  3G7I A;  4MF6 A;  4HQS A;  2IMK A;  2B6M A;  1MDK A;  1EOH A;  1MDI A;  2IPA A;  4ZL7 A;  2XHF A;  4L8E A;  3LJR A;  2E2M A;  4XS6 A;  3ISO A;  11GS A;  2VOC A;  4O5U A;  1O7U A;  2FWE A;  3FW2 A;  4AJ7 A;  3M0F A;  3UEM A;  3G7J A;  1K0D A;  2O7K A;  5ECP B;  3PR8 A;  4O5R A;  4J2F A;  3IDV A;  5F05 A;  3IAS 2;  2BTO T;  4TXV A;  4GRF A;  4WBJ A;  3VI5 A;  2WCI A;  2YNX A;  4N0Z A;  2A2S A;  2A2R A;  1EEJ A;  3RPP A;  4LMW A;  1H75 A;  1ERW A;  1OC9 A;  1GNE A;  3IK7 A;  2D2Z A;  3KD0 A;  2YN1 A;  4Q5Q A;  1GRX A;  3F3Q A;  4LLR A;  4IS0 A;  5B6M A;  2EIR A;  2YV9 A;  2LRC A;  5IIZ A;  4Q5F A;  1A24 A;  1AQW A;  2CAI A;  3KH7 A;  3FR6 A;  3FR9 A;  1XWG A;  3PIN A;  2UZ8 A;  4N10 A;  4FYU A;  3U6V A;  1XOB A;  1J9B A;  1XW9 A;  4WF4 A;  1IYH A;  5ECM B;  4MLY A;  1YDK A;  3M9J A;  3LXT A;  1EP8 A;  2V6K A;  5DBQ A;  4ZIJ A;  1T7P B;  3FEU A;  3IHG A;  2C3N A;  4ECC A;  4FH8 A;  1Z9H A;  13GS A;  1O73 A;  2JZS A;  3C73 A;  2YOI A;  1XWB A;  4XHM A;  4ID0 A;  3CSI A;  2ALB A;  1KNG A;  3D22 A;  1QQ2 A;  4N0V A;  2VCZ A;  4BL7 B;  3D6I A;  1V40 A;  2GTU A;  3FYG A;  4YQU A;  2DC5 A;  3EWL A;  2JZR A;  3ED3 A;  3O76 A;  5J9C A;  3Q19 A;  2A2P A;  3AY8 A;  1XXU A;  4JU5 A;  1VRS D;  3FY7 A;  4RQX A;  3C1S A;  4KSO A;  5EY6 A;  1ZZY A;  4DSQ A;  1TW9 A;  3TCO A;  4JED A;  2VL2 A;  1XWK A;  2CT6 A;  3LYP A;  3GKM A;  1QK8 A;  1ZGN A;  3UJ1 A;  4HEA 2;  4J56 E;  1ERV A;  4RI7 A;  5D9W A;  2L4C A;  5J9B A;  4XRD A;  2P0G A;  5ECN B;  2N5A A;  3BOA A;  1JZR A;  1AQX A;  5COH A;  1FO5 A;  3C1R A;  3RBT A;  3NZN A;  2MMN A;  4PGT A;  4K0G A;  3EMX A;  4PNG A;  3HDC A;  2E0Q A;  2R37 A;  1EGO A;  1FOH A;  1Z7P A;  1CQH A;  1MEK A;  3IRA A;  1Q98 A;  1TKD B;  3A2W A;  2C1Y A;  3QAW A;  3EYT A;  2GSQ A;  1K3O A;  1DSB A;  1U6T A;  1FG4 A;  5B8B A;  2C3Q A;  1OAZ A;  3TJK A;  4F03 A;  4EXJ A;  4BL7 A;  3EMP A;  1RQM A;  2B7K A;  4YKF A;  5LNK e;  5HR3 A;  2H8L A;  2FUG 2;  3QR6 A;  4MJA A;  1Z6M A;  2LJA A;  2P5Q A;  5ENU A;  1SKW B;  6GSW A;  4BVY B;  4X43 A;  2YJH A;  3HZ4 A;  2YWN A;  4KDX A;  4GF0 A;  2YWO A;  1B48 A;  2F51 A;  1ERT A;  4WKW A;  5EPF A;  3HJO A;  1WJK A;  3CRT A;  1LU4 A;  2WS2 A;  1XFL A;  4GQC A;  1BJX A;  5ECR B;  1XIY A;  3SWL A;  4ZIL A;  5ECS A;  5IMF A;  4OD7 A;  2QKE A;  2LTK A;  3C8E A;  2YP6 A;  3LGC A;  1Z3E A;  1O8W A;  5CAX A;  2PN8 A;  3HJP A;  1A2J A;  2XPE A;  3UAP A;  4Z2R A;  2O85 A;  4MJB A;  3LWA A;  1NW2 A;  2VO4 A;  3PPU A;  4ECB A;  1X5E A;  4MA9 A;  2HLS A;  1JLV A;  1HNA A;  1W4V A;  2CVK A;  2FY6 A;  1Q4J A;  4JR4 A;  2F8A A;  1FB0 A;  2R0C A;  2HT9 A;  2DMM A;  3HJM A;  1KEB A;  4IJI A;  4EUY A;  3M1G A;  4EDY A;  1G7E A;  1OKT A;  4I97 A;  2FCH A;  4PUR A;  6GSV A;  5JCG A;  4EIP A;  1FVK A;  4K8M A;  1O81 A;  3ZYW A;  4EE0 A;  3HZ8 A;  1EEM A;  1GSU A;  2OBK A;  5C00 A;  1FOV A;  2R0G A;  4BVY A;  1PKZ A;  1XVQ A;  4K7N A;  4KGI A;  4XRA A;  4MJE A;  2B5Y A;  2V1M A;  1PX6 A;  2EIQ A;  2I4A A;  1JHB A;  4K7O A;  20GS A;  4QL7 A;  4HQZ A;  1DE1 A;  3MDK A;  4BVX B;  4K2D A;  1HD2 A;  4NMU A;  1I5G A;  5D73 A;  2RII A;  3VWU A;  2I81 A;  2HXK A;  2OBI A;  6GST A;  3UL3 A;  2OKA A;  4POK A;  2M72 A;  2N5B A;  4KH7 A;  4NV5 A;  3IE3 A;  1BAY A;  2VL2 C;  1YKA A;  2IIY A;  4F0B A;  1SYR A;  2H75 A;  5J3R A;  1N2A A;  3P90 A;  3MAK A;  4MP4 A;  3GYK A;  1UA5 A;  4TKY A;  2GQK A;  3TKR A;  5G1L A;  2VCW A;  3F9U A;  1H4O A;  4HJ2 A;  1XWA A;  2WFC A;  3KP9 A;  1SL2 B;  2HFD A;  2WRT A;  4TW5 A;  2VLT A;  5DJM A;  1AQV A;  1GNW A;  4I2U A;  2DJ3 A;  3Q6O A;  1WIK A;  2FGX A;  2H74 A;  4XS4 A;  1B4Q A;  2FNO A;  3G9B A;  3VPQ A;  3GIX A;  1YQ1 A;  3L4N A;  4BWQ A;  2GZY A;  2TIR A;  2FA4 A;  3L9S A;  5JWO B;  3UIW A;  3LG6 A;  2PMT A;  1PX7 A;  3QFA C;  5DQY A;  4BWS A;  3QFB C;  2TRC P;  4KSM A;  4A5P A;  1ZYN A;  1GSQ A;  5IOW A;  4NV2 A;  2XBQ A;  5JWR B;  2AAW A;  2M80 A;  4BVX A;  4MF7 A;  3KM6 A;  4ZXG A;  3HVV A;  2A4V A;  2LS5 A;  2H0G A;  3WD6 A;  3MWH A;  4O92 A;  2B1K A;  5DJL A;  3RPN A;  4ML6 A;  3M9K A;  1PN9 A;  4ACS A;  6GSX A;  1GSF A;  3IBH A;  2B5X A;  2RLI A;  2LNS A;  7GSS A;  3APQ A;  2N5F A;  2FWF A;  3I69 A;  3UBL A;  3BD2 A;  3QAV A;  4YAP A;  1JZO A;  3IR4 A;  1Y6E A;  2VD0 A;  3ZML A;  4MK3 A;  1AC1 A;  4IJ3 A;  4X4J A;  2H70 A;  5B8A A;  2WGR A;  5J4U A;  2XC2 A;  4IP1 A;  4J57 E;  2ON7 A;  2DIZ A;  4KUN A;  2PVQ A;  1GUM A;  5KN2 A;  2KP2 A;  2VAF A;  1IYI A;  4AF2 A;  3VWV A;  4P3Y B;  1QUW A;  4BPY A;  2QGV A;  2YWM A;  5D93 A;  3ERF A;  3G7Y A;  2X49 A;  4QL9 A;  4OCE A;  3ZZX A;  3HVS A;  3FMW A;  1OVN A;  3U5R E;  1QXH A;  1GWC A;  5JWQ B;  2R2J A;  2O8V B;  1PA3 A;  17GS A;  2DIY A;  2GLR A;  4GLT A;  3WGX A;  2YAN A;  4DEJ A;  4GST A;  3F8U A;  1ACV A;  2YCD A;  5ELA A;  5HR2 A;  4XIH A;  2L4Q A;  2C0E A;  3LEF A;  1OKD A;  1LBK A;  3TKP A;  3D4M A;  1PL2 A;  3ZIT A;  2DJJ A;  4ZL9 A;  4GSN A;  2HZF A;  2H19 A;  1S3C A;  2GZP A;  3A2X A;  3KZQ A;  2JU5 A;  3CTF A;  1JFU A;  3IHQ A;  1BG5 A;  2XPD A;  3GST A;  2DML A;  5D9T A;  2V32 A;  4N30 A;  2P5R A;  4G0K A;  2R3X A;  1X0R A;  1DBY A;  4V1A p;  1VF3 A;  4TR0 A;  1OYJ A;  2BJX A;  1GSY A;  2R0P A;  4ZB8 A;  2B7J A;  3VWX A;  5D9V A;  3DD3 A;  2IMF A;  1PRX A;  3IA1 A;  1TU7 A;  2QSI A;  4KCA A;  2IMI A;  5HFK A;  3M3M A;  3EE2 A;  1K0N A;  2IN3 A;  2TRX A;  3DVW A;  4KX4 A;  3GHA A;  5HR0 A;  1EOG A;  2M46 A;  1PKW A;  5AIS A;  4MZB A;  3DXB A;  3GV1 A;  1GTU A;  4ULX A;  4X1U A;  4PUA A;  3TOU A;  4EKZ A;  1Z6N A;  2CX4 A;  2HRF A;  4HZ4 A;  2GSR A;  2H6Y A;  4POB A;  5INY A;  4Z2T A;  4RI6 A;  1NHO A;  5HFG A;  4TXO B;  5HR1 A;  2X8H A;  3CMI A;  1TRU A;  2H73 A;  3MSZ A;  4KW6 A;  2X4A A;  2JL4 A;  3I9V 2;  4HU7 A;  4OFM A;  4K5R A;  2ES7 A;  4IHU A;  5ECI B;  1YF1 A;  2I1U A;  1YY7 A;  1AIU A;  3IPZ A;  3L78 A;  4FIW A;  1AUC A;  2QA2 A;  1F9M A;  3QDN A;  5L71 A;  5IMC A;  1GUH A;  3E9J B;  2C3T A;  3H4K A;  4V2N A;  1V98 A;  3ZRE A;  3P2A A;  5IMV A;  3KMO A;  2VL3 A;  2VCQ A;  4OWY A;  1EWX A;  3ERW A;  3DIE A;  2H6Z A;  4JR6 A;  4HOJ A;  2JAD A;  4F9Z A;  3LQ7 A;  4JBB A;  3FRC A;  2LST A;  2KLX A;  3W8S A;  2VCX A;  5IO0 A;  2H30 A;  4G19 A;  2VCT A;  1ZOF A;  4CHS A;  3PGT A;  4MMM A;  1T4Z A;  5H5Q A;  3RHC A;  1XPV A;  2F8F A;  2Z9S A;  3GUS A;  2PWJ A;  1FVJ A;  1SD9 A;  4GQF A;  5J5N A;  3NIV A;  1EGR A;  3GL3 A;  4Q5R A;  2ZUP A;  2DLX A;  2PUK C;  1M0U A;  2E2G A;  3HY2 A;  1XVW A;  4KDY A;  4OCF A;  4TXO A;  4IN0 A;  1YKC A;  2DJ1 A;  1ZYQ B;  4NPB A;  2K8S A;  4GSS A;  1EZK A;  4FYC A;  3UVT A;  1FAA A;  3HCZ A;  1OC8 A;  3FHK A;  2VCV A;  3H8Q A;  5KOX A;  2X99 A;  3LW9 A;  2HSY A;  4K9Z A;  2L6C A;  2VD1 A;  1EV9 A;  4ZL8 A;  3ZMK A;  1F3A A;  3M8N A;  1GP1 A;  2PBJ A;  1V9W A;  4K5S A;  3APO A;  3EUR A;  1TI1 A;  1GUK A;  1R5A A;  2OJL A;  3EC3 A;  4XCS A;  4G0L A;  3F3R A;  1TRV A;  3CSJ A;  2LNT A;  2LJR A;  4KA0 A;  1TOF A;  3NOF A;  1QFN A;  3R2Q A;  4DSR A;  2RM5 A;  5FWG A;  1SYX A;  2FWH A;  4EVM A;  2C0G A;  1YZX A;  5AGY A;  1O85 A;  3ZVJ D;  4TR3 A;  3FKF A;  2OAC A;  3KGK A;  5CNW A;  1X9W B;  5CP1 A;  3TJF A;  1UN2 A;  1SJ6 A;  2YWI A;  3KEB A;  3FK8 A;  2MMA A;  3F4R A;  2H01 A;  2KP1 A;  3HA9 A;  4XTS A;  5AN1 A;  1A0F A;  5DVB A;  3RAZ A;  2H71 A;  1USB A;  3H79 A;  4WF5 A;  1HYU A;  1Z5Y E;  3EU3 A;  4ZB9 A;  4POM A;  5DAK B;  5G30 A;  1EP7 A;  2H66 A;  1ZYE A;  3GN3 A;  1VF2 A;  4WR4 A;  2GDR A;  4XS4 B;  1M7T A;  4GWR A;  3CTG A;  3EU4 A;  3TKS A;  3KCM A;  3HXS A;  1F3B A;  1ERU A;  3DRN A;  1GTB A;  2G2Q A;  2H1A A;  2GT6 A;  2AYT A;  1M2D A;  3KP8 A;  1JZW A;  2CZ3 A;  2MMO A;  1BX9 A;  5BMU A;  1U3A A;  3IOS A;  3FZ5 A;  4TR4 A;  5JCU A;  3W8J A;  1NHY A;  4XS1 A;  1PN0 A;  16GS A;  4YH2 A;  4POL A;  3GA4 A;  3IV4 A;  1XWC A;  4LL4 B;  2OE1 A;  1V57 A;  4ECJ A;  5D8I A;  4G10 A;  4L5O A;  1J0F A;  3F6D A;  5ID2 B;  4NWY A;  5G1K A;  1GSD A;  2OE0 A;  3IK9 A;  1O8X A;  2R6K A;  2IMD A;  1KBN A;  2L57 A;  3C71 A;  5F07 A;  4HJM A;  2NTO A;  1B8X A;  4D73 B;  4IGJ A;  3WT2 A;  1XW5 A;  4ECI A;  1AW9 A;  3GTU B;  1ZYP A;  2LQQ A;  2LQO A;  3I6A A;  3VWW A;  1T3B A;  1VGL A;  10GS A;  2GZZ A;  3GX0 A;  5DAK A;  1Y25 A;  2LRN A;  3GX8 A;  1MTC A;  4K7I A;  4WR5 A;  1AAZ A;  2L6D A;  3DVX A;  1VF4 A;  6GSS A;  2K6V A;  2H0H A;  3QOU A;  4ISD A;  4K0N A;  2V6O A;  3TJG A;  4IQ1 A;  3TRX A;  1YF0 A;  1F2E A;  2HSM A;  4N11 A;  5IQY A;  5GST A;  2CX3 A;  2WZ9 A;  3ERG A;  1PSQ A;  2RUF A;  5GSS A;  3OR5 A;  2MZC A;  4NXI A;  2H6X A;  2P31 A;  4EO3 A;  3ZRD A;  6GSY A;  2FA8 A;  1WE0 A;  2GGT A;  3L9U A;  1PQN A;  1PMT A;  3CBU A;  3CXG A;  4Z2U A;  3DEX A;  5CRH A;  3APS A;  2R5G A;  1GLQ A;  5BRT A;  5EVO A;  5E4W A;  3F4T A;  3VFI A;  3BJ5 A;  2B1L A;  5IMD A;  4PTS A;  3WYW A;  3UVH A;  1G0T A;  1S3D A;  3CRU A;  2C0D A;  4LA1 A;  5ID2 A;  3D4T A;  2LJK A;  3EIN A;  3IC4 A;  2HZE B;  5ELG A;  3D21 A;  3TJB A;  1A23 A;  3LFL A;  4LMV A;  2FWG A;  5C04 A;  1X9S B;  4D73 A;  3J7Y k;  3DWV A;  2MBS A;  3GTU A;  3QMX A;  1X9M B;  2DJ2 A;  5ECK B;  4CY8 A;  5CRG A;  3BCK A;  3HVX A;  2H72 A;  2H1D A;  4F0C A;  2VIM A;  5KN0 A;  2IFQ B;  2OE3 A;  3MIX A;  1A2M A;  3D0Z A;  4MJC A;  1NSW A;  3I43 A;  3VUR A;  3GUR A;  2C80 A;  1K3Y A;  2NBS A;  5ECL B;  4CDO A;  1TRW A;  4Q5N A;  2IJY A;  2AV4 A;  3ME8 A;  1GUL A;  1T00 A;  5KN1 A;  1TK0 B;  4OMV A;  1G6W A;  1K0A A;  2VLU A;  5AIX A;  5B7C A;  1AXD A;  4EC0 A;  4TRX A;  4MZW A;  2DBC A;  2MBT A;  3TKS C;  1SJI A;  4OFT A;  4E8H A;  1WMJ A;  3TKQ A;  1WOU A;  5HFI A;  2K9F A;  2OA7 A;  3GMF A;  4L0U A;  3QAG A;  3UMA A;  4ZBB A;  1BED A;  5E59 A;  5DQS A;  2DKI A;  4PQ1 A;  2H76 A;  1X5D A;  2LKU A;  5IPH A;  5CYY A;  4OO5 A;  3VK9 A;  1K0B A;  3EPT A;  1SL0 B;  2H1B A;  18GS A;  3A3T A;  2HZE A;  3L9V A;  5D96 A;  3GKX A;  3ZFB A;  5IMZ A;  1OC3 A;  1F6M C;  4O5Q A;  3TDG A;  4MAB A;  3GRX A;  1YJ6 A;  3DML A;  4AJ8 A;  4DSS B;  3C7M A;  2FD3 A;  3KTL A;  3ZIV A;  2PER A;  4WXT A;  1B9X C;  2IWT A;  4MNN A;  4MZC A;  3GH6 A;  1TU8 A;  4RQR A;  1OE8 A;  2IFQ A;  2O87 A;  4PXO A;  2DSA A;  5GZZ B;  3GKK A;  4CW9 A;  1R5P A;  3RHB A;  4EIQ A;  2DJ0 A;  3US3 A;  1GLP A;  1JZD A;  4CY6 A;  4OFN A;  4WEY A;  1SK2 A;  3LOR A;  1GSS A;  2HRN A;  2O89 A;  1DUG A;  12GS A;  4ZBD A;  4EF0 A;  2GQM A;  3A5W A;  4KF9 A;  5F0G A;  1SL1 B;  1LJR A;  1GL8 A;  3J7Y b;  2CAQ A;  2JZT A;  3BCI A;  1KTE A;  2X8G A;  1TRS A;  3K8N A;  2PU9 C;  5ECQ B;  5GAP D;  4PQH A;  1N8J A;  2FHE A;  4IQA A;  4K2X A;  1WP0 A;  1GTI A;  4IKH A;  1URM A;  1Z7R A;  1ILO A;  3P7X A;  2CV4 A;  1U88 A;  1HNB A;  5DCG A;  1K3L A;  4AGS A;  3F0I A;  1MD4 A;  4HDE A;  2L5L A;  3TKS E;  5B6N A;  1SD8 A;  1HQO A;  4E8E A;  4KE3 A;  2G0F A;  3F63 A;  3O6T A;  3ZVJ A;  2RM6 A;  2HYX A;  2VLV A;  4WBR D;  3KMN A;  1RW1 A;  3H93 A;  2REM A;  1U87 A;  4HI7 A;  3KXO A;  5IMA A;  2PPT A;  4L5L A;  4MCU A;  5JCW A;  5IOX A;  3Q74 A;  4DSS A;  1GTA A;  2H0I A;  2VL9 A;  2V2G A;  3EVI A;  2NDO A;  2WB9 A;  2K18 A;  3L0H A;  1WWJ A;  1ST9 A;  5DDL A;  5IM9 A;  2YZU A;  2F9S A;  1DE2 A;  3FR3 A;  4I5Q A;  3CYN A;  4F2I A;  1SK0 A;  1XBS A;  2X64 A;  1NM3 A;  3N5O A;  1SK1 A;  2J9H A;  3TB2 A;  3Q18 A;  2YPM A;  2GS3 A;  1TI3 A;  1X5C A;  2DJK A;  1ZL9 A;  1FW1 A;  1SKS B;  4NHZ A;  3VLN A;  4KB3 A;  4JRR A;  5J41 A;  1S3A A;  4IBP A;  4F82 A;  19GS A;  4OO4 A;  2LRT A;  2CQ9 A;  1F37 A;  3H1N A;  1ZCP A;  2J23 A;  5H5R A;  4GTU A;  3TUE A;  4TR1 B;  4PX1 A;  2LV3 A;  3FZ4 A;  3WGE A;  1GH2 A;  3PH9 A;  3GSS A;  1TK5 B;  2VM1 A;  4TN8 A;  2YV7 A;  4MPG A;  5FHI A;  1WPI A;  1BQ7 A;  4YQM A;  1M2B A;  1A2L A;  3QD9 A;  5ECO B;  3HKR A;  1T8E B;  5D9X A;  2KHP A;  2L5O A;  4IP6 A;  1SJZ A;  4HZ2 A;  2RUE A;  3HHV A;  4JE1 A;  3E3E A;  4MH2 A;  4GXZ A;  5G31 A;  5F8B A;  2KOK A;  3TGZ A;  2GQL A;  2I9H A;  3UAR A;  3F6F A;  1B4P A;  1MD3 A;  3IAM 2;  1ML6 A;  5DAL B;  3JCM L;  2GT5 A;  1U3I A;  3LXZ A;  4IW9 A;  3FZA A;  2YJ7 A;  1FB6 A;  2EIO A;  22GS A;  4KDU A;  4G0I A;  1XZO A;  4YKG A;  1PL1 A;  2EC4 A;  1QGV A;  2E7P A;  2HRK A;  5G5E A;  3HYP A;  1O6J A;  3WGD A;  1M99 A;  1G7O A;  3HD5 A;  1FHE A;  1J08 A;  2VUP A;  3QCP A;  1M9B A;  3LSZ A;  1K0M A;  3V1W A;  2NPB A;  3ME7 A;  3UBK A;  3KIJ A;  5CRE A;  1YEX A;  1PGT A;  4L0W A;  5EL8 A;  1UVZ A;  2WDU A;  4NAX A;  2KUC A;  3TJJ A;  3TRQ A;  2MYG A;  2CA8 A;  4HU9 A;  2MMZ A;  4TR1 A;  2HNL A;  2FLS A;  1E6B A;  2BMX A;  3GFK A;  1SEN A;  4PQI A;  4KAE A;  1SU9 A;  5A4U A;  1UC7 A;  4AJ6 A;  2ZCT A;  4TOP A;  4O7H A;  2V41 A;  5KN3 A;  4WET A;  3S9F A;  2HSH A;  1ZMA A;  3GH9 A;  1T1V A;  4DVC A;  5F06 A;  4MDC A;  4EDZ A;  2GSS A;  2X8C A;  4X0X A;  5H5S A;  4V2L A;  2IL3 A;  2A4H A;  1M9A A;  1JLW A;  1XOA A;  3D5J A;  4HS1 A;  3MNG A;  4I6X A;  2VM2 A;  4I8B A;  3CSH A;  4EL1 A;  1TK8 B;  4HUA A;  2B3S A;  5DAL A;  1XCC A;  3DGQ A;  4G2E A;  2B5E A;  2QA1 A;  1TP9 A;  4ZBA A;  1I9D A;  5IPG A;  1BYE A;  3A5I A;  4IEL A;  1B9Y C;  2HI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...