1OC3A

Human peroxiredoxin 5
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
SAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PEROXIREDOXIN 5
publication title Crystal Structure of a Dimeric Oxidized Form of Human Peroxiredoxin 5
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 162
sequence length 162
chains with identical sequence B, C
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1oc3A00
4YAPA 1X5DA 3ZRDA 2HRNA 1TRUA 2HRFA 3L9SA 2JZSA 2I3YA 1M99A 3H93A 3HA9A 4MPFA 1GUMA 3HVSA 4NHZA 1VGLA 2H0GA 1EWXA 2O89A 4MZWA 3W6GA 3VWVA 3EMXA 2QSIA 4G9HA 5H5SA 5H5QA 4Q5NA 4DSSA 3DVXA 3IAS2 5KN0A 4IN0A 3GKXA 3S9FA 2WRTA 3UEMA 3TRXA 4GXZA 1X9WB 2KLXA 2A4VA 2OE1A 2JZTA 1XXUA 5J3RA 3EWLA 3QPMA 4XRDA 3U6VA 2IMIA 1GSFA 2XHFA 1FG4A 3UVHA 6GSUA 3QFBC 1B8XA 1GL8A 1XWAA 3DYRA 4CDOA 5CNWA 1RW1A 2O87A 1PA3A 3GH9A 2I81A 1K3OA 2DJ1A 4MH3A 4WXTA 2CAIA 5JWRB 4JE1A 2EIOA 5A4WA 4MZCA 4KAEA 1OVNA 4MCUA 2IMDA 1FHEA 20GSA 2GSTA 2FCHA 3IBHA 3KCMA 1JZOA 1SK0A 3HJMA 5B6MA 5HR3A 5J9BA 1GWCA 2I4AA 4K0NA 1V57A 3N5OA 1U3AA 4L0UA 5IO0A 2C3NA 1O6JA 2GLRA 2GTUA 2XBIA 3GH6A 3ZREA 3VURA 1H75A 5ECKB 1XVWA 3A2WA 3TRQA 1OAZA 2YZUA 1SKRB 3GV1A 1HNBA 4EE0A 3ZVJD 1PQNA 3HHVA 1URMA 4YQMA 1B9YC 4F0CA 2V32A 4XIHA 11GSA 4HS1A 4LA1A 5COHA 1V9WA 1GLQA 1IYHA 4TW5A 1WE0A 2V41A 4K1FA 5GZZB 1EP7A 2RLIA 1H4OA 2OJLA 1GRXA 1R26A 1FVJA 5IMZA 3VFIA 4GSTA 2LUSA 1CQHA 2H1AA 1K3LA 4V2LA 1ERVA 1W89A 3O6TA 3J7Yk 2XPDA 2HFDA 1A8YA 1SD9A 1PRXA 5ECIB 3FHKA 2BJXA 1Z9HA 1A0FA 1WRYA 5A4VA 3MNGA 3KP8A 2H1GA 1THXA 3ZYWA 1WP0A 1E6BA 1SKSB 1Q4JA 1VF2A 4WF5A 3CSHA 3ZTLA 4O5RA 2P5RA 3RBTA 4TR3A 3DWVA 1TJDA 4QL9A 8GSSA 2H76A 3O3TA 1JZRA 5CO3A 4KCAA 6GSSA 2X64A 2VAFA 5AIXA 4LLRA 3Q19A 3UIWA 2E7PA 1YJ6A 4WETA 2B7KA 2PPTA 3ZFLA 4F2IA 3HZ8A 3TJBA 4AJ8A 2E0QA 2ALBA 5HR0A 2M80A 18GSA 4EO3A 4OCFA 3LXZA 4TR1B 2R3XA 5DQSA 3APQA 2O8VB 2ES7A 3FKFA 1IYIA 2H1BA 5A5KA 2GT6A 5DCHA 2KHPA 6GSVA 3BJ5A 4K8MA 2IIYA 3KH7A 2YWOA 5FWGA 2PUKC 1QUWA 1G6YA 1X0RA 1XW9A 3MAKA 2WDUA 4ECJA 1AIUA 3BBYA 2HZEB 3P90A 5B8BA 4K7OA 4TR1A 3A2XA 2VO4A 5G31A 2CVBA 1XZOA 5F07A 2H73A 1F3BA 2HT9A 1OKTA 3AY8A 5D96A 2IMFA 1J0FA 2WJUA 4NPBA 3TUEA 5CRDA 2GSRA 5D8IA 2IWTA 2DJKA 3VWUA 4DVCA 5G30A 3I43A 2H6XA 4XS4B 4MPGA 1QQ2A 2ZUPA 4ZBAA 1Z5YE 1GSQA 1YEPA 2MMNA 3ZL5A 1I5GA 13GSA 4I2UA 3BCKA 1XWKA 2FWGA 4L5LA 3A2VA 3FZAA 1SJZA 2HZEA 4ZXGA 2QKEA 2FY6A 4RUVA 4MJCA 3KGKA 3SBCA 1WPIA 2BMXA 3GX8A 2D2ZA 3FYGA 1XWCA 3QDNA 2VIMA 1Z6MA 2K6VA 1QMVA 2E2GA 2LKUA 5J9CA 4MH2A 1Q98A 4PQ1A 2PGTA 5AIVA 1T1VA 2YNXA 4XS4A 2FGXA 4X0XA 4GQFA 3CXGA 2K8SA 3FZ9A 1N8JA 3GA4A 1PX6A 5ECQB 5CRGA 2GDRA 2A2RA 3EE2A 2GVPA 4I8BA 4O32A 4MJBA 1U87A 4G2EA 1QGVA 1TP9A 2ZNMA 3I6AA 4GRFA 3ZZXA 2OACA 1O7UA 1S3CA 1MDIA 4ILFA 1JLVA 4TR0A 1YKCA 4KDUA 1O85A 1XW6A 1V58A 2DIZA 2DJ3A 3LJRA 2MBSA 4GSNA 3SWLA 3DRNA 2RM5A 1EZKA 1V40A 1TK8B 2C8UA 3UBKA 1PKZA 5DBQA 3CSIA 3DKSA 2YPMA 3QFAC 3Q18A 1GTAA 4MF6A 4TXVA 4TRXA 2WB9A 3TKPA 3R2QA 4V1Ag 1JFUA 5D9XA 1R5PA 1ZCPA 3VI7A 1B48A 4LMWA 2B5YA 1S3DA 3HYPA 1GP1A 4OCEA 3UARA 2MYGA 2CAQA 4FH8A 3ERGA 4ZIJA 2G2QA 5IMVA 3D6IA 1OC8A 1TDIA 2WGRA 5G5FA 3KZQA 2E2MA 2CVKA 2IFQB 4X43A 1T3BA 2CZ3A 2JZRA 4MZBA 4F0BA 4WEYA 2I9HA 4RQRA 1OC3A 1EGRA 2VLVA 4O92A 3CRTA 2C80A 3KM6A 4HJMA 5LCZA 1ZMAA 4ZBBA 5DJLA 22GSA 4OFTA 3QAGA 3H1NA 3EC3A 1FB6A 5CAXA 3IR4A 2H0IA 1G7EA 2Z9SA 7GSSA 1FVKA 5GAND 1A2LA 4PXOA 4K9ZA 2F3MA 2L59A 3RHCA 3EU4A 2H8LA 3A5WA 4ZL7A 2IFQA 1U3IA 1K0NA 1PKWA 3HY2A 1X9SB 3UL3A 4GTUA 3WD6A 2DC5A 5ECNB 5G1LA 2FA8A 4PNGA 4MA9A 1GSSA 2C1YA 4AF2A 3KXOA 3LORA 1LBKA 2K18A 2RUFA 3KP9A 1DSBA 1KTEA 2WULA 1MD3A 1M7TA 4G19A 4ZL9A 2AV4A 2M72A 4D73B 3EYTA 4QL7A 6GSXA 4WF4A 1ABAA 1GUKA 1TI1A 1YF0A 2CQ9A 5AN1A 1SYXA 3APOA 1XIYA 3TJGA 1ZOFA 1GNWA 1DBYA 1XW5A 3DXBA 3GNJA 1F3AA 2FNOA 2DLXA 4KGIA 4AJ7A 5KN3A 2X8HA 4IBPA 5HR2A 2MMOA 4GCIA 4J2FA 3TKRA 4G10A 2IMEA 2HNLA 4PUFC 1WJKA 4HEA2 3F4RA 3GKKA 2I1UA 4JU5A 4EF0A 2IL3A 4D73A 3IOSA 5KN1A 1A23A 4WKWA 1UA5A 1SYRA 4V1Ap 1QXHA 3ZMKA 2PN8A 1QFNA 4XS6A 4L8EA 2L4CA 2IMKA 3I69A 5FT3A 1YZXA 3NIVA 3F63A 2OADA 3EURA 2QC7A 4KNDA 1K0CA 4IW9A 2V6KA 3ME7A 3F3RA 1TW9A 4K7IA 3H8QA 1RK4A 3ZITA 4F82A 2OA7A 4ML6A 4I5QA 4KDXA 5ELAA 3GN3A 5F0GA 2TRXA 3Q6OA 1AQWA 4E8EA 5HFKA 3D0ZA 1R4WA 5INYA 4MMMA 4XCSA 2YWIA 3F3QA 2L6DA 4POLA 3QR6A 2YV9A 3APSA 3F6DA 2LTKA 2L57A 5DAKB 3WT1A 4KH7A 3G7JA 4HUAA 2HE3A 4ULXA 3VWXA 4XTSA 1AW9A 1X5EA 4HZ4A 5CRWA 4IP6A 4FYCA 4NWYA 4KW6A 3LEFA 3GUSA 5H5RA 5ENUA 2RM6A 2PBJA 2HSYA 2H70A 2C0GA 2H75A 3D4TA 1XPVA 1VF4A 3ERFA 1UN2A 4ISDA 2YZHA 3CMIA 3F4TA 5DAKA 4K7NA 3TKSA 2LNSA 5IMFA 2WS2A 5CP1A 1Z7PA 1V98A 3C7MA 17GSA 1VF3A 4PURA 2RUEA 4MP4A 4FIWA 4FO5A 2GZYA 4HJ2A 2LS5A 3D4MA 3TGZA 1PX7A 3RPPA 1EEMA 3JCML 3UOMA 2F51A 4POBA 2DSAA 2FD3A 6GSYA 3L9UA 2NTOA 3HCZA 1FB0A 1FAAA 3CTGA 4J56E 3QAVA 1B4PA 1T00A 3ZIVA 1XOBA 2H1DA 4GQCA 1B4QA 1T4YA 4BPYA 3ZFBA 2PMTA 5GSSA 4AJ6A 4JRRA 4LL4B 1KNGA 5EL8A 2X8CA 5LNKe 5ID2B 1YY7A 3HKRA 3RPNA 5FHIA 3P8WA 1OE8A 5ABRA 1EEJA 1F37A 4I6XA 5AISA 3KMNA 2AAWA 3KMOA 2VL2A 1BYEA 1AQXA 3QOUA 3GIXA 3TJKA 4IP1A 2VCVA 1BQ7A 5JCWA 4HZ2A 2OE3A 5DQYA 1F9MA 1MD4A 3FR3A 4ECBA 1K0BA 3DIEA 5G1KA 3NZNA 2R4VA 1DE1A 4EDYA 3QCPA 3TKSE 5ID2A 2O7KA 1EV4A 5ECLB 4JEDA 3UBLA 4Q5RA 3UAPA 5IPHA 2R5GA 2LSTA 3ZVJA 3LSZA 5B6NA 2ON7A 3W8SA 1SKWB 4GLTA 10GSA 1AUCA 1GSDA 3PGTA 1FW1A 1G6WA 1FOVA 1Y25A 1TRSA 3IXRA 1XOAA 2HZFA 5IMAA 5D9WA 4MJAA 4ZBDA 1B9XC 3WGEA 3TB2A 1M2BA 2RIIA 3GURA 3US3A 1SL2B 2H01A 3BD2A 3G9BA 4HU9A 4JZQA 5J4UA 1TK5B 1A2MA 1PD21 4V2MA 4EL1A 3C1RA 1K0AA 2GZZA 3QMXA 4DEJA 1DE2A 3HVXA 4IGJA 2R6KA 3DVWA 4MK3A 3WYWA 4KA0A 1GUHA 2HI7A 1N2AA 2OKAA 2GZPA 4EKZA 2WZ9A 3IK9A 1PGTA 1AAZA 4OD7A 4IHUA 1GNEA 5L71A 4IELA 2V1MA 2EC4A 2XPEA 3IV4A 1SL1B 3LGCA 2H6ZA 1ZYQB 3LYPA 5DCGA 5IOXA 1K0MA 1OE7A 2C4JA 1J9BA 3IRAA 5F05A 1M0UA 4DSRA 1F2EA 4ID0A 2AYTA 5ECPB 3MWHA 3F4SA 1K0OA 3GL3A 1O8XA 4N0VA 5J41A 1Z6NA 2B1LA 2PU9C 2LJAA 4RI6A 3C8EA 2HYXA 1ST9A 2DJJA 4MJEA 1O81A 4ZILA 1FO5A 2MMAA 2R2JA 4WBJA 5JCGA 1USBA 3WT2A 4KX4A 2XBQA 3GSTA 1NHYA 5DVBA 3IPZA 9GSSA 3ZIJA 3KEBA 2FWHA 2VD0A 4HU7A 1BX9A 3HD5A 1SK2A 1AQVA 4IJIA 2VCTA 1T4ZA 5ECSA 3UMAA 4CHSA 3CBUA 2LV3A 2LJKA 2REMA 3G7IA 2LQQA 1EP8A 4YQUA 2A2SA 3GRXA 5CYYA 3C73A 4BL7A 2JL4A 2OBIA 4NV5A 1O73A 2O85A 3ISOA 4NHWA 4P3YB 1TRVA 3KJYA 2GQKA 4V2NA 3TRPA 4GWRA 2AB6A 5KEJA 1A24A 4MLYA 1XVQA 4I2TA 5IIZA 2IJYA 1YKAA 3M3MA 2VD1A 2NDOA 2ON5A 1XBSA 2CX4A 2DMMA 5IMDA 2X8GA 5ECMB 2LEGA 3E3EA 4N30A 3RAZA 5D73A 1GTIA 3TJJA 4MDCA 3TKQA 1GSUA 1TK0B 2VCZA 3NOFA 4HI7A 1BJXA 4DSQA 5ECRB 2ZCTA 2DIYA 4PNFA 1WOUA 4Z7XA 2LRNA 4PQHA 5DJMA 1A0RP 2DBCA 2G0FA 1R5AA 1SJIA 3GYKA 5F06A 1WWJA 5B7CA 5JCUA 1NM3A 2L4QA 3LG6A 4HOJA 3I9V2 2EIQA 3IK7A 4OO4A 4F03A 2GQLA 5EPFA 2VM2A 2VUPA 2YJHA 4KUNA 2K9FA 3W8JA 3BOAA 4TR4A 2HLSA 1TI3A 2VLTA 2L5OA 3LXTA 3KTBA 2YWNA 4LMVA 1ILOA 4Q5FA 1NSWA 3D5JA 3FRCA 4FYBA 4BA7A 3QD9A 1TKDB 2J9HA 5D9TA 1R7HA 2GT5A 3M0FA 2LQOA 1SK1A 4K0GA 5HFIA 4KB3A 5IQYA 1YF1A 14GSA 4EUYA 2N5FA 1UVZA 1HYUA 1K0DA 2H71A 3H79A 2CA8A 3TOUA 2CZ2A 3ED3A 3D22A 5IO2A 2H0HA 5JWOB 2FWEA 5A4UA 4YQVA 3PINA 3J7Yb 5JWQB 3KD0A 1HNCA 3GKNA 4L5OA 4XHMA 2H72A 4IKHA 3VPQA 4POKA 2LJRA 4PGTA 5CRHA 4RQXA 3IA1A 2FLSA 5IOWA 2WFCA 1RQMA 3LQ7A 4PUAA 4X1UA 5C04A 1THOA 4TKYA 3GKMA 3C1SA 2XC2A 3WGXA 1ERTA 3E9JB 1YDKA 4L0WA 3HDCA 2MMZA 1WIKA 3N9JA 5E4WA 3DD3A 1DUGA 2H74A 2DMLA 4J57E 3DGQA 5GSTA 3HJOA 4KSMA 2C0EA 1ERUA 3F6FA 5DDLA 3FZ4A 2FUG2 4TOPA 2IN3A 3FW2A 3VI5A 3TOTA 3KTLA 4EDZA 3VLNA 2HXKA 3KH9A 2FHEA 3LWAA 1M9AA 3OR5A 2H66A 4RI7A 3IC4A 4JBBA 3GSSA 3L78A 3MDKA 3EU3A 2YANA 2YWMA 4ZB8A 3VPTA 1PL1A 4HQSA 3FZ5A 1U6TA 5D93A 1ON4A 1U88A 3GL5A 4XS1A 1JZDA 2FA4A 2PERA 3KIJA 4FYUA 4ML1A 3V1WA 1OYJA 2C3TA 1OKDA 1HQOA 2TRCP 3WGDA 4EXJA 1YEXA 2R37A 3HJPA 2GS3A 4BVYA 1MDKA 1NHOA 5ELGA 1TXXA 1GTUA 1G0TA 5ECOB 5J5NA 3F9UA 4TN8A 2GQMA 1M9BA 3D21A 1SJ6A 4MF5A 3GX0A 1VRSD 1X9MB 5DALB 4E8HA 12GSA 2VLUA 3IE3A 2P5QA 3FY7A 1T7PB 1NW2A 4WBRD 3DEXA 3C71A 2GGTA 1M2DA 2F9SA 1LJRA 1TTZA 3GHAA 2LRTA 1ML6A 5HR1A 4MF7A 3EVIA 3HVVA 4AGSA 5EY6A 3E0UA 1GSEA 3P2AA 4IQAA 5DALA 2FWFA 1PMTA 4I97A 1TOFA 1OC9B 2EIRA 1JZWA 1GLPA 4N11A 4IJ3A 1EOHA 1XCCA 2M46A 4OWYA 2C3QA 2P31A 2F8FA 3O76A 4OFMA 2B1KA 4GSSA 3MSZA 1JHBA 4F9ZA 1VF1A 1WMJA 4TXOB 2CV4A 1PSQA 3QAWA 4Q5QA 2H30A 2N5BA 1I9DA 2JACA 3CYNA 4NV2A 2VL3A 1KBNA 4KDYA 1OC9A 4K2DA 1MEKA 3A3TA 3L4NA 3PH9A 3F0IA 3FEUA 2VL9A 3M9KA 4N0ZA 4NAXA 3TJFA 3DMLA 2OE0A 6GSTA 4NXIA 2DJ2A 2MZCA 3L9VA 2GSSA 1UC7A 2P0GA 3VK9A 1ZYEA 4JR4A 4TVEA 2AUVA 3G7YA 4NMUA 2LNTA 4YAVA 4TXOA 3UJ1A 3U5RE 4H86A 4QQ7A 4WR4A 3RDWA 4EC0A 1YQ1A 3ME8A 1HNAA 2B5EA 4BWSA 4CW9A 3HXSA 2H6YA 3F8UA 1JLWA 1BAYA 2KUCA 2JSYA 5KN2A 1K3YA 2VCWA 4GF0A 2TIRA 2YOIA 3LYKA 5CREA 1C72A 2PVQA 5LD0A 1TU8A 4ZL8A 2YP6A 1Y6EA 2GSQA 4WR5A 3UVTA 1GSYA 4N10A 2KP2A 16GSA 1T8EB 2V6OA 1A8LA 2CX3A 1PN9A 3FR9A 5D9VA 4ECIA 2V2GA 4KE3A 5EVOA 2VOCA 1W4VA 4YH2A 2JU5A 1E2YA 1QK8A 2H19A 1GULA 2N5AA 2VCXA 1A2JA 1M2AA 4POMA 3IHQA 5AGYA 2C0DA 2PWJA 2AJQB 4BWQA 1ZZYA 3EMPA 5C00A 1AC1A 1SD8A 1XWBA 1Z7RA 4XRAA 1MTCA 4BVXA 1TU7A 1EGOA 3PR8A 5IPGA 4ECCA 5B8AA 1PL2A 3GTUB 4HDEA 2B7JA 2YN1A 3TKSC 1ZL9A 5GAPD 4KCEA 3M1GA 3M8NA 2OBKA 3ZLPA 1ACVA 2DJ0A 1X5CA 4IVFA 4KSOA 2L5LA 1GTBA 1EOGA 4ACSA 1ZGNA 4K6XA 3H4KA 3FR6A 3BCIA 1KEBA 2IPAA 5G2ZA 3M9JA 2KOKA 2JADA 1MDJA 3IDVA 4OO5A 4IQ1A 1AXDA 3K8NA 1G7OA 4OFNA 3GTUA 5E59A 3ERWA 2KP1A 2F8AA 3CSJA 1ERWA 1XFLA 1F6MC 1LU4A 3Q74A 2MBTA 5ECHB 2LRCA 3IAM2 5HQPA 2YV7A 4ZB6A 4ZB9A 5IMCA 3VWWA 1TRWA 3LFLA 2B5XA 1Z3EA 2NBSA 1S3AA 5F8BA 4HQZA 1O8WA 3CTFA 3GMFA 4OMVA 3TCOA 3HZ4A 4PQIA 2VL2C 3TDGA 4LL1B 2X99A 1J08A 6GSWA 2NPBA 3EINA 1V2AA 1HD2A 2YCDA 2VCQA 2WCIA 1SU9A 2BTOT 1XWGA 2JSZA 3CRUA 2L6CA 2B3SA 1BEDA 1EV9A 5HFGA 5G5EA 5IM9A 4MABA 4JR6A 19GSA 3ZMLA 3P7XA 1BG5A 3GFKA 1CQGA 4EVMA 2YJ7A 2HSHA 4DSSB 1SENA 2NVLA 2QGVA 1GH2A 2CVDA 2K8VA 4PX1A 2AHEA 1SL0B 2PVOC 4O7HA 2CT6A 3RHBA 2C0FA 4IS0A 2J23A 2VM1A 3L0HA 2B6MA 3FK8A
chains in the Genus database with same CATH superfamily
4YAPA 1X5DA 3ZRDA 2HRNA 1TRUA 2HRFA 3L9SA 4BIKA 2JZSA 2I3YA 1M99A 3H93A 3HA9A 4MPFA 1GUMA 3HVSA 4NHZA 1VGLA 2H0GA 1EWXA 2O89A 4MZWA 3W6GA 3VWVA 3EMXA 2QSIA 4G9HA 3R3EA 5H5SA 5H5QA 4Q5NA 4DSSA 3DVXA 3IAS2 5KN0A 4IN0A 3GKXA 3S9FA 2WRTA 3UEMA 3TRXA 4GXZA 1X9WB 2KLXA 2A4VA 2OE1A 2JZTA 2A2PA 1XXUA 5J3RA 3EWLA 3QPMA 4XRDA 3U6VA 2IMIA 1GSFA 2XHFA 1FG4A 3UVHA 6GSUA 3QFBC 1B8XA 1GL8A 1XWAA 3DYRA 4CDOA 5CNWA 1RW1A 2O87A 1PA3A 3GH9A 2I81A 2R0PA 2UZ8A 1K3OA 2DJ1A 4MH3A 4WXTA 2CAIA 5JWRB 4JE1A 2EIOA 5A4WA 4MZCA 4KAEA 1OVNA 4MCUA 2IMDA 1FHEA 20GSA 2GSTA 2FCHA 3IBHA 3KCMA 1PFOA 1JZOA 1SK0A 3HJMA 5B6MA 5HR3A 5J9BA 1GWCA 4G0KA 2I4AA 4K0NA 1V57A 3N5OA 1U3AA 4L0UA 5IO0A 2C3NA 1O6JA 2GLRA 2GTUA 2XBIA 3GH6A 3ZREA 4K2XA 3VURA 1H75A 3MYDA 5ECKB 1XVWA 3A2WA 3TRQA 1OAZA 2YZUA 1SKRB 3GV1A 4K5SA 1HNBA 4EE0A 3ZVJD 1PQNA 3HHVA 4K5RA 1URMA 4YQMA 1B9YC 4F0CA 2V32A 4XIHA 11GSA 4HS1A 4LA1A 5COHA 1V9WA 1GLQA 1ZYPA 3MIXA 1IYHA 4TW5A 1WE0A 2V41A 4K1FA 5GZZB 1EP7A 2RLIA 1H4OA 2OJLA 1GRXA 1R26A 1FVJA 5IMZA 3VFIA 4GSTA 2LUSA 1CQHA 2H1AA 1K3LA 4V2LA 1ERVA 1W89A 3O6TA 3J7Yk 2XPDA 2HFDA 1A8YA 1SD9A 1PRXA 5ECIB 3FHKA 2BJXA 1Z9HA 1A0FA 1WRYA 5A4VA 3MNGA 3KP8A 2H1GA 1THXA 3ZYWA 1WP0A 1E6BA 1SKSB 1Q4JA 1VF2A 4WF5A 3CSHA 3ZTLA 4O5RA 2P5RA 3RBTA 4TR3A 3DWVA 1TJDA 4QL9A 8GSSA 5KOWA 2H76A 3O3TA 1JZRA 5CO3A 4KCAA 6GSSA 2X64A 2VAFA 5AIXA 4LLRA 3Q19A 3UIWA 2E7PA 1YJ6A 4WETA 2B7KA 2PPTA 4Z2RA 3ZFLA 4F2IA 3HZ8A 3TJBA 4AJ8A 2E0QA 2ALBA 5HR0A 2M80A 18GSA 4EO3A 4OCFA 3LXZA 4TR1B 2R3XA 5DQSA 3APQA 2O8VB 3IC8A 2ES7A 3FKFA 4FQUA 1IYIA 2H1BA 5A5KA 2GT6A 5DCHA 2KHPA 6GSVA 3BJ5A 4K8MA 2IIYA 3KH7A 3LW9A 2YWOA 5FWGA 2PUKC 1QUWA 1G6YA 1X0RA 1XW9A 3MAKA 2WDUA 4ECJA 1AIUA 3BBYA 2HZEB 3P90A 5B8BA 4K7OA 4TR1A 3A2XA 2VO4A 5G31A 2CVBA 1XZOA 5F07A 2H73A 1F3BA 2HT9A 1OKTA 3AY8A 5D96A 2IMFA 1J0FA 2WJUA 4NPBA 3TUEA 5CRDA 2GSRA 5D8IA 2IWTA 2DJKA 3VWUA 4DVCA 5G30A 3I43A 2H6XA 4XS4B 4MPGA 1QQ2A 2ZUPA 4ZBAA 1Z5YE 1GSQA 1YEPA 2MMNA 3ZL5A 1I5GA 4PTSA 13GSA 4I2UA 3BCKA 1XWKA 2FWGA 4L5LA 3A2VA 3FZAA 1SJZA 2HZEA 4ZXGA 2QKEA 2FY6A 4RUVA 4MJCA 3KGKA 3SBCA 1WPIA 2BMXA 3GX8A 2D2ZA 3FYGA 1XWCA 3QDNA 2VIMA 1Z6MA 2K6VA 3CQFA 1QMVA 2E2GA 2LKUA 5J9CA 4MH2A 1Q98A 4PQ1A 2PGTA 5AIVA 1T1VA 2YNXA 4XS4A 2FGXA 4X0XA 4GQFA 3CXGA 2K8SA 3FZ9A 1N8JA 3GA4A 1PX6A 5ECQB 5CRGA 2GDRA 2A2RA 3EE2A 2HRKA 2GVPA 4I8BA 4O32A 4MJBA 1U87A 4USSA 4G2EA 1QGVA 1TP9A 2ZNMA 3I6AA 4GRFA 3ZZXA 2OACA 1O7UA 1S3CA 1MDIA 4ILFA 1JLVA 4TR0A 1YKCA 4KDUA 1O85A 1XW6A 1V58A 2DIZA 2DJ3A 3LJRA 2MBSA 4GSNA 3SWLA 3DRNA 2RM5A 1EZKA 1V40A 1TK8B 2C8UA 3UBKA 1PKZA 5DBQA 3CSIA 3DKSA 4A5PA 2YPMA 3QFAC 3Q18A 1GTAA 4MF6A 4TXVA 4TRXA 2WB9A 3TKPA 1FOHA 3R2QA 4V1Ag 1JFUA 5D9XA 1R5PA 1ZCPA 3VI7A 1B48A 4LMWA 2B5YA 1S3DA 3HYPA 1GP1A 4OCEA 3UARA 2MYGA 2CAQA 4FH8A 3ERGA 4ZIJA 2G2QA 5IMVA 3D6IA 1OC8A 1TDIA 4Z2UA 2WGRA 5G5FA 3KZQA 2E2MA 2CVKA 2IFQB 4X43A 1T3BA 2CZ3A 2JZRA 4MZBA 4F0BA 4WEYA 2I9HA 4EIQA 4RQRA 1OC3A 1EGRA 2VLVA 4O92A 3CRTA 2C80A 3KM6A 4HJMA 5LCZA 1ZMAA 4ZBBA 5DJLA 22GSA 4OFTA 3QAGA 3H1NA 3EC3A 1FB6A 5CAXA 3IR4A 2H0IA 1G7EA 2Z9SA 7GSSA 1FVKA 5GAND 1A2LA 4PXOA 4K9ZA 2F3MA 4G0IA 2L59A 3RHCA 3EU4A 2H8LA 3A5WA 4ZL7A 2IFQA 1U3IA 1K0NA 1PKWA 3HY2A 1X9SB 3UL3A 4GTUA 3WD6A 2DC5A 5ECNB 5G1LA 2FA8A 4PNGA 4MA9A 1GSSA 2C1YA 4AF2A 3KXOA 3LORA 1LBKA 2K18A 2RUFA 3KP9A 1DSBA 1KTEA 5BMUA 2WULA 1MD3A 1M7TA 4G19A 4ZL9A 2AV4A 4O5UA 2M72A 4D73B 3EYTA 4QL7A 6GSXA 4WF4A 1ABAA 1GUKA 1TI1A 1YF0A 2CQ9A 4YKFA 5AN1A 1SYXA 3APOA 1XIYA 3TJGA 1ZOFA 1GNWA 1DBYA 1XW5A 3DXBA 3GNJA 1F3AA 2FNOA 2DLXA 4KGIA 4AJ7A 5KN3A 2X8HA 4IBPA 5HR2A 2MMOA 4GCIA 4J2FA 3TKRA 4G10A 2IMEA 2HNLA 4PUFC 1WJKA 4HEA2 3F4RA 3GKKA 2I1UA 4JU5A 4EF0A 2IL3A 4D73A 3IOSA 5KN1A 1A23A 4WKWA 1UA5A 1SYRA 4V1Ap 1QXHA 3ZMKA 2PN8A 1QFNA 4XS6A 4L8EA 2L4CA 2IMKA 3I69A 5FT3A 4X4JA 1YZXA 3NIVA 3F63A 2OADA 3EURA 2QC7A 4KNDA 1K0CA 4IW9A 2V6KA 3ME7A 3F3RA 1TW9A 4K7IA 3H8QA 3A5IA 1RK4A 3ZITA 4F82A 5BRTA 2OA7A 4ML6A 4I5QA 4KDXA 4ICYA 5ELAA 3GN3A 5F0GA 2TRXA 3Q6OA 1AQWA 4E8EA 5HFKA 3D0ZA 1R4WA 5INYA 4MMMA 4XCSA 2YWIA 3F3QA 2L6DA 4POLA 3QR6A 2YV9A 3APSA 3F6DA 2LTKA 2L57A 5DAKB 3WT1A 4KH7A 3G7JA 4HUAA 2HE3A 4ULXA 3VWXA 4XTSA 1AW9A 1X5EA 4HZ4A 5CRWA 4IP6A 4FYCA 4NWYA 4KW6A 3LEFA 3GUSA 5H5RA 5ENUA 2RM6A 2DKHA 2PBJA 2HSYA 2H70A 2C0GA 2H75A 3D4TA 1XPVA 1VF4A 3ERFA 1UN2A 4ISDA 2YZHA 3CMIA 3F4TA 3FMWA 5DAKA 4K7NA 3TKSA 2LNSA 5IMFA 2WS2A 5CP1A 1Z7PA 1V98A 3C7MA 17GSA 1VF3A 4Z2TA 4PURA 2RUEA 4CY6A 2R0CA 4MP4A 4FIWA 4FO5A 2GZYA 4HJ2A 2LS5A 3D4MA 3TGZA 1PX7A 3RPPA 1EEMA 3JCML 3UOMA 2F51A 4POBA 2DSAA 2FD3A 6GSYA 3PPUA 3L9UA 2NTOA 3HCZA 1FB0A 1FAAA 3CTGA 4J56E 3QAVA 1B4PA 1T00A 3ZIVA 1XOBA 2H1DA 4GQCA 1B4QA 1T4YA 4BPYA 3ZFBA 2PMTA 5GSSA 4AJ6A 4JRRA 4LL4B 1KNGA 5EL8A 5KOXA 2X8CA 5LNKe 5ID2B 1YY7A 3HKRA 3RPNA 5FHIA 3P8WA 2R0GA 1OE8A 5ABRA 1EEJA 1F37A 2X4AA 4I6XA 5AISA 3KMNA 2AAWA 3KMOA 2VL2A 1BYEA 1AQXA 3QOUA 3GIXA 3TJKA 4IP1A 2VCVA 1BQ7A 5JCWA 4HZ2A 2OE3A 5DQYA 1F9MA 1MD4A 3FR3A 4ECBA 1K0BA 3DIEA 5G1KA 4KF9A 3NZNA 2R4VA 1DE1A 4EDYA 3QCPA 3TKSE 5ID2A 2O7KA 1EV4A 5ECLB 4JEDA 3UBLA 4MNNA 4Q5RA 3UAPA 5IPHA 2R5GA 2LSTA 3ZVJA 3LSZA 5B6NA 2ON7A 3W8SA 1SKWB 4GLTA 10GSA 1AUCA 1GSDA 3PGTA 1FW1A 1G6WA 1FOVA 1Y25A 1TRSA 3IXRA 1XOAA 2HZFA 5IMAA 5D9WA 4MJAA 4ZBDA 1B9XC 3WGEA 3TB2A 1M2BA 2RIIA 3GURA 3US3A 1SL2B 2H01A 3BD2A 2QA1A 3G9BA 4HU9A 4JZQA 5J4UA 1TK5B 1A2MA 1PD21 4V2MA 4EL1A 3C1RA 1K0AA 2GZZA 3QMXA 4DEJA 1DE2A 3HVXA 1PN0A 4IGJA 2R6KA 3DVWA 4MK3A 3WYWA 4KA0A 1GUHA 2HI7A 1N2AA 2OKAA 2GZPA 4EKZA 2WZ9A 3IK9A 1PGTA 1AAZA 4OD7A 4IHUA 1GNEA 5L71A 4IELA 2V1MA 2EC4A 2XPEA 4YKGA 3IV4A 1SL1B 3LGCA 2H6ZA 1ZYQB 3LYPA 5DCGA 5IOXA 4HSCX 1K0MA 1OE7A 2C4JA 1J9BA 3IRAA 5F05A 1M0UA 4DSRA 1F2EA 4ID0A 2AYTA 5ECPB 3MWHA 3F4SA 1K0OA 3GL3A 1O8XA 4N0VA 5J41A 1Z6NA 2B1LA 2PU9C 2LJAA 4RI6A 3C8EA 2HYXA 1ST9A 2DJJA 4MJEA 1O81A 4ZILA 1FO5A 2MMAA 2R2JA 4WBJA 4BL7B 5JCGA 1USBA 3WT2A 4KX4A 2XBQA 3GSTA 1NHYA 5DVBA 3IPZA 9GSSA 3ZIJA 3KEBA 2FWHA 2VD0A 4HU7A 1BX9A 3HD5A 1SK2A 1AQVA 4IJIA 2VCTA 1T4ZA 5ECSA 3UMAA 4CHSA 3CBUA 2LV3A 2LJKA 2REMA 3G7IA 2LQQA 1EP8A 3HVNA 4YQUA 2A2SA 3GRXA 5CYYA 3C73A 4BL7A 2JL4A 2OBIA 4NV5A 1O73A 2O85A 3ISOA 4NHWA 4P3YB 1TRVA 3KJYA 2GQKA 4V2NA 3TRPA 4GWRA 2AB6A 5KEJA 2X49A 1A24A 4MLYA 1XVQA 4I2TA 5IIZA 2IJYA 1YKAA 3M3MA 2VD1A 2NDOA 4EIPA 2ON5A 1XBSA 2CX4A 2DMMA 5IMDA 2X8GA 5ECMB 2LEGA 3E3EA 4N30A 3RAZA 5D73A 1GTIA 2A4HA 3TJJA 4MDCA 3TKQA 1GSUA 1TK0B 2VCZA 3NOFA 4HI7A 1BJXA 4DSQA 5ECRB 2ZCTA 2DIYA 4PNFA 1WOUA 4Z7XA 2LRNA 4PQHA 5DJMA 1A0RP 2DBCA 2G0FA 1R5AA 1SJIA 3GYKA 5F06A 1WWJA 5B7CA 5JCUA 1NM3A 2L4QA 3LG6A 4HOJA 3I9V2 2EIQA 3IK7A 4OO4A 4F03A 2GQLA 5EPFA 2VM2A 2VUPA 2YJHA 4KUNA 2K9FA 3W8JA 3BOAA 4TR4A 2HLSA 1TI3A 2VLTA 2L5OA 3LXTA 3KTBA 2YWNA 4LMVA 1ILOA 4Q5FA 1NSWA 3D5JA 3FRCA 4FYBA 4BA7A 3QD9A 1TKDB 2J9HA 5D9TA 1R7HA 2GT5A 3M0FA 2LQOA 1SK1A 4K0GA 5HFIA 4KB3A 5IQYA 1YF1A 14GSA 4EUYA 2N5FA 1UVZA 1HYUA 1K0DA 2H71A 3H79A 4CY8A 2CA8A 3TOUA 2CZ2A 3ED3A 3D22A 5IO2A 2H0HA 5JWOB 2FWEA 5A4UA 4YQVA 3PINA 3J7Yb 5JWQB 3KD0A 1HNCA 3GKNA 4L5OA 4XHMA 2H72A 4IKHA 3VPQA 4POKA 2LJRA 4PGTA 5CRHA 4RQXA 3IA1A 2FLSA 5IOWA 2WFCA 1RQMA 3LQ7A 4PUAA 4X1UA 5C04A 1THOA 4TKYA 3GKMA 3C1SA 2XC2A 3WGXA 1ERTA 3E9JB 1YDKA 4L0WA 3HDCA 2MMZA 1WIKA 3N9JA 5E4WA 3DD3A 1DUGA 2H74A 2DMLA 1S3RA 4J57E 3DGQA 5GSTA 3HJOA 4KSMA 2C0EA 1ERUA 3F6FA 2QA2A 5DDLA 3FZ4A 2FUG2 4TOPA 2IN3A 3FW2A 3VI5A 3TOTA 3KTLA 4EDZA 3VLNA 2HXKA 3KH9A 2FHEA 3LWAA 4BVYB 1M9AA 3OR5A 2H66A 4RI7A 3IC4A 4JBBA 3GSSA 3L78A 3MDKA 3EU3A 2YANA 2YWMA 4ZB8A 3VPTA 1PL1A 4HQSA 3FZ5A 1ZYNA 1U6TA 5D93A 1ON4A 1U88A 3GL5A 4XS1A 1JZDA 2FA4A 2PERA 3KIJA 4FYUA 4ML1A 3V1WA 1OYJA 2C3TA 1OKDA 1HQOA 2TRCP 3WGDA 4EXJA 1YEXA 2R37A 3HJPA 2GS3A 4BVYA 1MDKA 1NHOA 5ELGA 1TXXA 1GTUA 1G0TA 5ECOB 5J5NA 3F9UA 4TN8A 2GQMA 1M9BA 3D21A 1SJ6A 4MF5A 3GX0A 1VRSD 1X9MB 5DALB 4E8HA 12GSA 2VLUA 3IE3A 2P5QA 3FY7A 1T7PB 1NW2A 4WBRD 3DEXA 3C71A 2GGTA 1M2DA 2F9SA 1LJRA 1TTZA 3GHAA 2LRTA 1ML6A 5HR1A 4MF7A 3EVIA 3HVVA 4AGSA 1M3IA 5EY6A 3E0UA 1GSEA 3P2AA 4IQAA 5DALA 2FWFA 1PMTA 4I97A 1TOFA 1OC9B 2EIRA 1JZWA 1GLPA 4N11A 4IJ3A 1EOHA 1XCCA 2M46A 4OWYA 2C3QA 2P31A 2F8FA 3O76A 4OFMA 2B1KA 4GSSA 3MSZA 1JHBA 4F9ZA 1VF1A 1WMJA 4TXOB 2CV4A 1PSQA 3QAWA 4Q5QA 2H30A 2N5BA 1I9DA 2JACA 3CYNA 4NV2A 2VL3A 1KBNA 4KDYA 2DKIA 1OC9A 4K2DA 1MEKA 3EPTA 3A3TA 3L4NA 3PH9A 3F0IA 3FEUA 2VL9A 3M9KA 4N0ZA 4NAXA 3TJFA 3DMLA 2OE0A 6GSTA 4NXIA 2DJ2A 2MZCA 3L9VA 2GSSA 1UC7A 2P0GA 3VK9A 1XG8A 1ZYEA 4JR4A 4TVEA 2AUVA 3G7YA 4NMUA 2LNTA 4YAVA 4TXOA 3UJ1A 3U5RE 4H86A 4QQ7A 4WR4A 3RDWA 4EC0A 1YQ1A 4O5QA 3ME8A 1HNAA 2B5EA 4BWSA 4CW9A 3HXSA 2H6YA 3F8UA 1JLWA 1BAYA 2KUCA 2JSYA 5KN2A 1K3YA 2VCWA 4GF0A 2TIRA 2YOIA 3LYKA 5CREA 1C72A 2PVQA 5LD0A 1TU8A 4ZL8A 2YP6A 1Y6EA 2GSQA 4WR5A 3UVTA 1GSYA 4N10A 2KP2A 16GSA 4BVXB 1T8EB 2V6OA 1A8LA 2CX3A 1PN9A 3FR9A 5D9VA 1M3JA 4ECIA 2V2GA 4KE3A 5EVOA 2VOCA 1W4VA 4YH2A 2JU5A 1E2YA 1QK8A 2H19A 1GULA 2N5AA 2VCXA 1A2JA 1M2AA 4POMA 3IHQA 5AGYA 2C0DA 2PWJA 2AJQB 4BWQA 1ZZYA 3EMPA 5C00A 1AC1A 1SD8A 1XWBA 1Z7RA 4XRAA 1MTCA 4BVXA 1TU7A 1EGOA 3PR8A 5IPGA 4ECCA 5B8AA 1PL2A 3GTUB 2HRAA 4HDEA 2B7JA 2YN1A 3TKSC 1ZL9A 5GAPD 4KCEA 3M1GA 3M8NA 2OBKA 3ZLPA 1ACVA 2DJ0A 1X5CA 4IVFA 4KSOA 2L5LA 1GTBA 1EOGA 4ACSA 1ZGNA 3IHGA 4K6XA 3H4KA 2HSMA 3FR6A 3BCIA 1KEBA 2IPAA 5G2ZA 3M9JA 2KOKA 2JADA 1MDJA 3IDVA 4OO5A 4IQ1A 1AXDA 3K8NA 1G7OA 4OFNA 3GTUA 5E59A 3ERWA 2KP1A 2F8AA 3CSJA 1ERWA 1XFLA 1F6MC 1LU4A 3Q74A 2MBTA 5ECHB 2LRCA 3IAM2 5HQPA 2YV7A 4ZB6A 4ZB9A 5IMCA 3VWWA 1TRWA 3LFLA 2B5XA 1Z3EA 2NBSA 1S3AA 5F8BA 4HQZA 1O8WA 3CTFA 3GMFA 4OMVA 3TCOA 3HZ4A 4G0LA 4PQIA 2VL2C 3TDGA 4LL1B 2X99A 1J08A 6GSWA 2NPBA 3EINA 1V2AA 1HD2A 2YCDA 2VCQA 2WCIA 1SU9A 2BTOT 1XWGA 2JSZA 3CRUA 2L6CA 2B3SA 1BEDA 1EV9A 5HFGA 5G5EA 5IM9A 4MABA 4JR6A 19GSA 3ZMLA 3P7XA 1BG5A 3GFKA 1CQGA 4EVMA 2YJ7A 2HSHA 4DSSB 1SENA 2NVLA 2QGVA 1GH2A 2CVDA 2K8VA 4PX1A 2AHEA 1SL0B 2PVOC 4O7HA 2CT6A 3RHBA 2C0FA 4IS0A 2J23A 2VM1A 3L0HA 2B6MA 3FK8A
chains in the Genus database with same CATH topology
4YAPA 1X5DA 3ZRDA 2HRNA 1TRUA 2HRFA 3L9SA 2JZSA 2I3YA 1M99A 3H93A 3HA9A 4MPFA 1GUMA 3HVSA 4NHZA 1VGLA 2H0GA 1EWXA 2O89A 4MZWA 3W6GA 3VWVA 3EMXA 2QSIA 4G9HA 3R3EA 5H5SA 5H5QA 4Q5NA 4DSSA 3DVXA 3IAS2 5KN0A 4IN0A 3GKXA 3S9FA 2WRTA 3UEMA 3TRXA 4GXZA 1X9WB 2KLXA 2A4VA 2OE1A 2JZTA 2A2PA 1XXUA 5J3RA 3EWLA 3QPMA 4XRDA 3U6VA 2IMIA 1GSFA 2XHFA 1FG4A 3UVHA 6GSUA 3QFBC 1B8XA 1GL8A 1XWAA 3DYRA 4CDOA 5CNWA 1RW1A 2O87A 1PA3A 3GH9A 2I81A 2R0PA 2UZ8A 1K3OA 2DJ1A 4MH3A 4WXTA 2CAIA 5JWRB 4JE1A 2EIOA 5A4WA 4MZCA 4KAEA 1OVNA 4MCUA 2IMDA 1FHEA 20GSA 2GSTA 2FCHA 3IBHA 3KCMA 1JZOA 1SK0A 3HJMA 5B6MA 5HR3A 5J9BA 1GWCA 4G0KA 2I4AA 4K0NA 1V57A 3N5OA 1U3AA 4L0UA 5IO0A 2C3NA 1O6JA 2GLRA 2GTUA 2XBIA 3GH6A 3ZREA 4K2XA 3VURA 1H75A 3MYDA 5ECKB 1XVWA 3A2WA 3TRQA 1OAZA 2YZUA 1SKRB 3GV1A 4K5SA 1HNBA 4EE0A 3ZVJD 1PQNA 3HHVA 4K5RA 1URMA 4YQMA 1B9YC 4F0CA 2V32A 4XIHA 11GSA 4HS1A 4LA1A 5COHA 1V9WA 1GLQA 1ZYPA 3MIXA 1IYHA 4TW5A 1WE0A 2V41A 4K1FA 5GZZB 1EP7A 2RLIA 1H4OA 2OJLA 1GRXA 1R26A 1FVJA 5IMZA 3VFIA 4GSTA 2LUSA 1CQHA 2H1AA 1K3LA 4V2LA 1ERVA 1W89A 3O6TA 3J7Yk 2XPDA 2HFDA 1A8YA 1SD9A 1PRXA 5ECIB 3FHKA 2BJXA 1Z9HA 1A0FA 1WRYA 5A4VA 3MNGA 3KP8A 2H1GA 1THXA 3ZYWA 1WP0A 1E6BA 1SKSB 1Q4JA 1VF2A 4WF5A 3CSHA 3ZTLA 4O5RA 2P5RA 3RBTA 4TR3A 3DWVA 1TJDA 4QL9A 8GSSA 5KOWA 2H76A 3O3TA 1JZRA 5CO3A 4KCAA 6GSSA 2X64A 2VAFA 5AIXA 4LLRA 3Q19A 3UIWA 2E7PA 1YJ6A 4WETA 2B7KA 2PPTA 4Z2RA 3ZFLA 4F2IA 3HZ8A 3TJBA 4AJ8A 2E0QA 2ALBA 5HR0A 2M80A 18GSA 4EO3A 4OCFA 3LXZA 4TR1B 2R3XA 5DQSA 3APQA 2O8VB 3IC8A 2ES7A 3FKFA 4FQUA 1IYIA 2H1BA 5A5KA 2GT6A 5DCHA 2KHPA 6GSVA 3BJ5A 4K8MA 2IIYA 3KH7A 3LW9A 2YWOA 5FWGA 2PUKC 1QUWA 1G6YA 1X0RA 1XW9A 3MAKA 2WDUA 4ECJA 1AIUA 3BBYA 2HZEB 3P90A 5B8BA 4K7OA 4TR1A 3A2XA 2VO4A 5G31A 2CVBA 1XZOA 5F07A 2H73A 1F3BA 2HT9A 1OKTA 3AY8A 5D96A 2IMFA 1J0FA 2WJUA 4NPBA 3TUEA 5CRDA 2GSRA 5D8IA 2IWTA 2DJKA 3VWUA 4DVCA 5G30A 3I43A 2H6XA 4XS4B 4MPGA 1QQ2A 2ZUPA 4ZBAA 1Z5YE 1GSQA 1YEPA 2MMNA 3ZL5A 1I5GA 4PTSA 13GSA 4I2UA 3BCKA 1XWKA 2FWGA 4L5LA 3A2VA 3FZAA 1SJZA 2HZEA 4ZXGA 2QKEA 2FY6A 4RUVA 4MJCA 3KGKA 3SBCA 1WPIA 2BMXA 3GX8A 2D2ZA 3FYGA 1XWCA 3QDNA 2VIMA 1Z6MA 2K6VA 1QMVA 2E2GA 2LKUA 5J9CA 4MH2A 1Q98A 4PQ1A 2PGTA 5AIVA 1T1VA 2YNXA 4XS4A 2FGXA 4X0XA 4GQFA 3CXGA 2K8SA 3FZ9A 1N8JA 3GA4A 1PX6A 5ECQB 5CRGA 2GDRA 2A2RA 3EE2A 2HRKA 2GVPA 4I8BA 4O32A 4MJBA 1U87A 4USSA 4G2EA 1QGVA 1TP9A 2ZNMA 3I6AA 4GRFA 3ZZXA 2OACA 1O7UA 1S3CA 1MDIA 4ILFA 1JLVA 4TR0A 1YKCA 4KDUA 1O85A 1XW6A 1V58A 2DIZA 2DJ3A 3LJRA 2MBSA 4GSNA 3SWLA 3DRNA 2RM5A 1EZKA 1V40A 1TK8B 2C8UA 3UBKA 1PKZA 5DBQA 3CSIA 3DKSA 4A5PA 2YPMA 3QFAC 3Q18A 1GTAA 4MF6A 4TXVA 4TRXA 2WB9A 3TKPA 1FOHA 3R2QA 4V1Ag 1JFUA 5D9XA 1R5PA 1ZCPA 3VI7A 1B48A 4LMWA 2B5YA 1S3DA 3HYPA 1GP1A 4OCEA 3UARA 2MYGA 2CAQA 4FH8A 3ERGA 4ZIJA 2G2QA 5IMVA 3D6IA 1OC8A 1TDIA 4Z2UA 2WGRA 5G5FA 3KZQA 2E2MA 2CVKA 2IFQB 4X43A 1T3BA 2CZ3A 2JZRA 4MZBA 4F0BA 4WEYA 2I9HA 4EIQA 4RQRA 1OC3A 1EGRA 2VLVA 4O92A 3CRTA 2C80A 3KM6A 4HJMA 5LCZA 1ZMAA 4ZBBA 5DJLA 22GSA 4OFTA 3QAGA 3H1NA 3EC3A 1FB6A 5CAXA 3IR4A 2H0IA 1G7EA 2Z9SA 7GSSA 1FVKA 5GAND 1A2LA 4PXOA 4K9ZA 2F3MA 4G0IA 2L59A 3RHCA 3EU4A 2H8LA 3A5WA 4ZL7A 2IFQA 1U3IA 1K0NA 1PKWA 3HY2A 1X9SB 3UL3A 4GTUA 3WD6A 2DC5A 5ECNB 5G1LA 2FA8A 4PNGA 4MA9A 1GSSA 2C1YA 4AF2A 3KXOA 3LORA 1LBKA 2K18A 2RUFA 3KP9A 1DSBA 1KTEA 5BMUA 2WULA 1MD3A 1M7TA 4G19A 4ZL9A 2AV4A 4O5UA 2M72A 4D73B 3EYTA 4QL7A 6GSXA 4WF4A 1ABAA 1GUKA 1TI1A 1YF0A 2CQ9A 4YKFA 5AN1A 1SYXA 3APOA 1XIYA 3TJGA 1ZOFA 1GNWA 1DBYA 1XW5A 3DXBA 3GNJA 1F3AA 2FNOA 2DLXA 4KGIA 4AJ7A 5KN3A 2X8HA 4IBPA 5HR2A 2MMOA 4GCIA 4J2FA 3TKRA 4G10A 2IMEA 2HNLA 4PUFC 1WJKA 4HEA2 3F4RA 3GKKA 2I1UA 4JU5A 4EF0A 2IL3A 4D73A 3IOSA 5KN1A 1A23A 4WKWA 1UA5A 1SYRA 4V1Ap 1QXHA 3ZMKA 2PN8A 1QFNA 4XS6A 4L8EA 2L4CA 2IMKA 3I69A 5FT3A 4X4JA 1YZXA 3NIVA 3F63A 2OADA 3EURA 2QC7A 4KNDA 1K0CA 4IW9A 2V6KA 3ME7A 3F3RA 1TW9A 4K7IA 3H8QA 3A5IA 1RK4A 3ZITA 4F82A 5BRTA 2OA7A 4ML6A 4I5QA 4KDXA 4ICYA 5ELAA 3GN3A 5F0GA 2TRXA 3Q6OA 1AQWA 4E8EA 5HFKA 3D0ZA 1R4WA 5INYA 4MMMA 4XCSA 2YWIA 3F3QA 2L6DA 4POLA 3QR6A 2YV9A 3APSA 3F6DA 2LTKA 2L57A 5DAKB 3WT1A 4KH7A 3G7JA 4HUAA 2HE3A 4ULXA 3VWXA 4XTSA 1AW9A 1X5EA 4HZ4A 5CRWA 4IP6A 4FYCA 4NWYA 4KW6A 3LEFA 3GUSA 5H5RA 5ENUA 2RM6A 2DKHA 2PBJA 2HSYA 2H70A 2C0GA 2H75A 3D4TA 1XPVA 1VF4A 3ERFA 1UN2A 4ISDA 2YZHA 3CMIA 3F4TA 3FMWA 5DAKA 4K7NA 3TKSA 2LNSA 5IMFA 2WS2A 5CP1A 1Z7PA 1V98A 3C7MA 17GSA 1VF3A 4Z2TA 4PURA 2RUEA 4CY6A 2R0CA 4MP4A 4FIWA 4FO5A 2GZYA 4HJ2A 2LS5A 3D4MA 3TGZA 1PX7A 3RPPA 1EEMA 3JCML 3UOMA 2F51A 4POBA 2DSAA 2FD3A 6GSYA 3PPUA 3L9UA 2NTOA 3HCZA 1FB0A 1FAAA 3CTGA 4J56E 3QAVA 1B4PA 1T00A 3ZIVA 1XOBA 2H1DA 4GQCA 1B4QA 1T4YA 4BPYA 3ZFBA 2PMTA 5GSSA 4AJ6A 4JRRA 4LL4B 1KNGA 5EL8A 5KOXA 2X8CA 5LNKe 5ID2B 1YY7A 3HKRA 3RPNA 5FHIA 3P8WA 2R0GA 1OE8A 5ABRA 1EEJA 1F37A 2X4AA 4I6XA 5AISA 3KMNA 2AAWA 3KMOA 2VL2A 1BYEA 1AQXA 3QOUA 3GIXA 3TJKA 4IP1A 2VCVA 1BQ7A 5JCWA 4HZ2A 2OE3A 5DQYA 1F9MA 1MD4A 3FR3A 4ECBA 1K0BA 3DIEA 5G1KA 4KF9A 3NZNA 2R4VA 1DE1A 4EDYA 3QCPA 3TKSE 5ID2A 2O7KA 1EV4A 5ECLB 4JEDA 3UBLA 4MNNA 4Q5RA 3UAPA 5IPHA 2R5GA 2LSTA 3ZVJA 3LSZA 5B6NA 2ON7A 3W8SA 1SKWB 4GLTA 10GSA 1AUCA 1GSDA 3PGTA 1FW1A 1G6WA 1FOVA 1Y25A 1TRSA 3IXRA 1XOAA 2HZFA 5IMAA 5D9WA 4MJAA 4ZBDA 1B9XC 3WGEA 3TB2A 1M2BA 2RIIA 3GURA 3US3A 1SL2B 2H01A 3BD2A 2QA1A 3G9BA 4HU9A 4JZQA 5J4UA 1TK5B 1A2MA 1PD21 4V2MA 4EL1A 3C1RA 1K0AA 2GZZA 3QMXA 4DEJA 1DE2A 3HVXA 1PN0A 4IGJA 2R6KA 3DVWA 4MK3A 3WYWA 4KA0A 1GUHA 2HI7A 1N2AA 2OKAA 2GZPA 4EKZA 2WZ9A 3IK9A 1PGTA 1AAZA 4OD7A 4IHUA 1GNEA 5L71A 4IELA 2V1MA 2EC4A 2XPEA 4YKGA 3IV4A 1SL1B 3LGCA 2H6ZA 1ZYQB 3LYPA 5DCGA 5IOXA 1K0MA 1OE7A 2C4JA 1J9BA 3IRAA 5F05A 1M0UA 4DSRA 1F2EA 4ID0A 2AYTA 5ECPB 3MWHA 3F4SA 1K0OA 3GL3A 1O8XA 4N0VA 5J41A 1Z6NA 2B1LA 2PU9C 2LJAA 4RI6A 3C8EA 2HYXA 1ST9A 2DJJA 4MJEA 1O81A 4ZILA 1FO5A 2MMAA 2R2JA 4WBJA 4BL7B 5JCGA 1USBA 3WT2A 4KX4A 2XBQA 3GSTA 1NHYA 5DVBA 3IPZA 9GSSA 3ZIJA 3KEBA 2FWHA 2VD0A 4HU7A 1BX9A 3HD5A 1SK2A 1AQVA 4IJIA 2VCTA 1T4ZA 5ECSA 3UMAA 4CHSA 3CBUA 2LV3A 2LJKA 2REMA 3G7IA 2LQQA 1EP8A 4YQUA 2A2SA 3GRXA 5CYYA 3C73A 4BL7A 2JL4A 2OBIA 4NV5A 1O73A 2O85A 3ISOA 4NHWA 4P3YB 1TRVA 3KJYA 2GQKA 4V2NA 3TRPA 4GWRA 2AB6A 5KEJA 2X49A 1A24A 4MLYA 1XVQA 4I2TA 5IIZA 2IJYA 1YKAA 3M3MA 2VD1A 2NDOA 4EIPA 2ON5A 1XBSA 2CX4A 2DMMA 5IMDA 2X8GA 5ECMB 2LEGA 3E3EA 4N30A 3RAZA 5D73A 1GTIA 2A4HA 3TJJA 4MDCA 3TKQA 1GSUA 1TK0B 2VCZA 3NOFA 4HI7A 1BJXA 4DSQA 5ECRB 2ZCTA 2DIYA 4PNFA 1WOUA 4Z7XA 2LRNA 4PQHA 5DJMA 1A0RP 2DBCA 2G0FA 1R5AA 1SJIA 3GYKA 5F06A 1WWJA 5B7CA 5JCUA 1NM3A 2L4QA 3LG6A 4HOJA 3I9V2 2EIQA 3IK7A 4OO4A 4F03A 2GQLA 5EPFA 2VM2A 2VUPA 2YJHA 4KUNA 2K9FA 3W8JA 3BOAA 4TR4A 2HLSA 1TI3A 2VLTA 2L5OA 3LXTA 3KTBA 2YWNA 4LMVA 1ILOA 4Q5FA 1NSWA 3D5JA 3FRCA 4FYBA 4BA7A 3QD9A 1TKDB 2J9HA 5D9TA 1R7HA 2GT5A 3M0FA 2LQOA 1SK1A 4K0GA 5HFIA 4KB3A 5IQYA 1YF1A 14GSA 4EUYA 2N5FA 1UVZA 1HYUA 1K0DA 2H71A 3H79A 4CY8A 2CA8A 3TOUA 2CZ2A 3ED3A 3D22A 5IO2A 2H0HA 5JWOB 2FWEA 5A4UA 4YQVA 3PINA 3J7Yb 5JWQB 3KD0A 1HNCA 3GKNA 4L5OA 4XHMA 2H72A 4IKHA 3VPQA 4POKA 2LJRA 4PGTA 5CRHA 4RQXA 3IA1A 2FLSA 5IOWA 2WFCA 1RQMA 3LQ7A 4PUAA 4X1UA 5C04A 1THOA 4TKYA 3GKMA 3C1SA 2XC2A 3WGXA 1ERTA 3E9JB 1YDKA 4L0WA 3HDCA 2MMZA 1WIKA 3N9JA 5E4WA 3DD3A 1DUGA 2H74A 2DMLA 4J57E 3DGQA 5GSTA 3HJOA 4KSMA 2C0EA 1ERUA 3F6FA 2QA2A 5DDLA 3FZ4A 2FUG2 4TOPA 2IN3A 3FW2A 3VI5A 3TOTA 3KTLA 4EDZA 3VLNA 2HXKA 3KH9A 2FHEA 3LWAA 4BVYB 1M9AA 3OR5A 2H66A 4RI7A 3IC4A 4JBBA 3GSSA 3L78A 3MDKA 3EU3A 2YANA 2YWMA 4ZB8A 3VPTA 1PL1A 4HQSA 3FZ5A 1ZYNA 1U6TA 5D93A 1ON4A 1U88A 3GL5A 4XS1A 1JZDA 2FA4A 2PERA 3KIJA 4FYUA 4ML1A 3V1WA 1OYJA 2C3TA 1OKDA 1HQOA 2TRCP 3WGDA 4EXJA 1YEXA 2R37A 3HJPA 2GS3A 4BVYA 1MDKA 1NHOA 5ELGA 1TXXA 1GTUA 1G0TA 5ECOB 5J5NA 3F9UA 4TN8A 2GQMA 1M9BA 3D21A 1SJ6A 4MF5A 3GX0A 1VRSD 1X9MB 5DALB 4E8HA 12GSA 2VLUA 3IE3A 2P5QA 3FY7A 1T7PB 1NW2A 4WBRD 3DEXA 3C71A 2GGTA 1M2DA 2F9SA 1LJRA 1TTZA 3GHAA 2LRTA 1ML6A 5HR1A 4MF7A 3EVIA 3HVVA 4AGSA 5EY6A 3E0UA 1GSEA 3P2AA 4IQAA 5DALA 2FWFA 1PMTA 4I97A 1TOFA 1OC9B 2EIRA 1JZWA 1GLPA 4N11A 4IJ3A 1EOHA 1XCCA 2M46A 4OWYA 2C3QA 2P31A 2F8FA 3O76A 4OFMA 2B1KA 4GSSA 3MSZA 1JHBA 4F9ZA 1VF1A 1WMJA 4TXOB 2CV4A 1PSQA 3QAWA 4Q5QA 2H30A 2N5BA 1I9DA 2JACA 3CYNA 4NV2A 2VL3A 1KBNA 4KDYA 2DKIA 1OC9A 4K2DA 1MEKA 3EPTA 3A3TA 3L4NA 3PH9A 3F0IA 3FEUA 2VL9A 3M9KA 4N0ZA 4NAXA 3TJFA 3DMLA 2OE0A 6GSTA 4NXIA 2DJ2A 2MZCA 3L9VA 2GSSA 1UC7A 2P0GA 3VK9A 1ZYEA 4JR4A 4TVEA 2AUVA 3G7YA 4NMUA 2LNTA 4YAVA 4TXOA 3UJ1A 3U5RE 4H86A 4QQ7A 4WR4A 3RDWA 4EC0A 1YQ1A 4O5QA 3ME8A 1HNAA 2B5EA 4BWSA 4CW9A 3HXSA 2H6YA 3F8UA 1JLWA 1BAYA 2KUCA 2JSYA 5KN2A 1K3YA 2VCWA 4GF0A 2TIRA 2YOIA 3LYKA 5CREA 1C72A 2PVQA 5LD0A 1TU8A 4ZL8A 2YP6A 1Y6EA 2GSQA 4WR5A 3UVTA 1GSYA 4N10A 2KP2A 16GSA 4BVXB 1T8EB 2V6OA 1A8LA 2CX3A 1PN9A 3FR9A 5D9VA 4ECIA 2V2GA 4KE3A 5EVOA 2VOCA 1W4VA 4YH2A 2JU5A 1E2YA 1QK8A 2H19A 1GULA 2N5AA 2VCXA 1A2JA 1M2AA 4POMA 3IHQA 5AGYA 2C0DA 2PWJA 2AJQB 4BWQA 1ZZYA 3EMPA 5C00A 1AC1A 1SD8A 1XWBA 1Z7RA 4XRAA 1MTCA 4BVXA 1TU7A 1EGOA 3PR8A 5IPGA 4ECCA 5B8AA 1PL2A 3GTUB 2HRAA 4HDEA 2B7JA 2YN1A 3TKSC 1ZL9A 5GAPD 4KCEA 3M1GA 3M8NA 2OBKA 3ZLPA 1ACVA 2DJ0A 1X5CA 4IVFA 4KSOA 2L5LA 1GTBA 1EOGA 4ACSA 1ZGNA 3IHGA 4K6XA 3H4KA 2HSMA 3FR6A 3BCIA 1KEBA 2IPAA 5G2ZA 3M9JA 2KOKA 2JADA 1MDJA 3IDVA 4OO5A 4IQ1A 1AXDA 3K8NA 1G7OA 4OFNA 3GTUA 5E59A 3ERWA 2KP1A 2F8AA 3CSJA 1ERWA 1XFLA 1F6MC 1LU4A 3Q74A 2MBTA 5ECHB 2LRCA 3IAM2 5HQPA 2YV7A 4ZB6A 4ZB9A 5IMCA 3VWWA 1TRWA 3LFLA 2B5XA 1Z3EA 2NBSA 1S3AA 5F8BA 4HQZA 1O8WA 3CTFA 3GMFA 4OMVA 3TCOA 3HZ4A 4G0LA 4PQIA 2VL2C 3TDGA 4LL1B 2X99A 1J08A 6GSWA 2NPBA 3EINA 1V2AA 1HD2A 2YCDA 2VCQA 2WCIA 1SU9A 2BTOT 1XWGA 2JSZA 3CRUA 2L6CA 2B3SA 1BEDA 1EV9A 5HFGA 5G5EA 5IM9A 4MABA 4JR6A 19GSA 3ZMLA 3P7XA 1BG5A 3GFKA 1CQGA 4EVMA 2YJ7A 2HSHA 4DSSB 1SENA 2NVLA 2QGVA 1GH2A 2CVDA 2K8VA 4PX1A 2AHEA 1SL0B 2PVOC 4O7HA 2CT6A 3RHBA 2C0FA 4IS0A 2J23A 2VM1A 3L0HA 2B6MA 3FK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAP A;  1X5D A;  3ZRD A;  2HRN A;  1TRU A;  2HRF A;  3L9S A;  2JZS A;  2I3Y A;  1M99 A;  3H93 A;  3HA9 A;  4MPF A;  1GUM A;  3HVS A;  4NHZ A;  1VGL A;  2H0G A;  1EWX A;  2O89 A;  4MZW A;  3W6G A;  3VWV A;  3EMX A;  2QSI A;  4G9H A;  5H5S A;  5H5Q A;  4Q5N A;  4DSS A;  3DVX A;  3IAS 2;  5KN0 A;  4IN0 A;  3GKX A;  3S9F A;  2WRT A;  3UEM A;  3TRX A;  4GXZ A;  1X9W B;  2KLX A;  2A4V A;  2OE1 A;  2JZT A;  1XXU A;  5J3R A;  3EWL A;  3QPM A;  4XRD A;  3U6V A;  2IMI A;  1GSF A;  2XHF A;  1FG4 A;  3UVH A;  6GSU A;  3QFB C;  1B8X A;  1GL8 A;  1XWA A;  3DYR A;  4CDO A;  5CNW A;  1RW1 A;  2O87 A;  1PA3 A;  3GH9 A;  2I81 A;  1K3O A;  2DJ1 A;  4MH3 A;  4WXT A;  2CAI A;  5JWR B;  4JE1 A;  2EIO A;  5A4W A;  4MZC A;  4KAE A;  1OVN A;  4MCU A;  2IMD A;  1FHE A;  20GS A;  2GST A;  2FCH A;  3IBH A;  3KCM A;  1JZO A;  1SK0 A;  3HJM A;  5B6M A;  5HR3 A;  5J9B A;  1GWC A;  2I4A A;  4K0N A;  1V57 A;  3N5O A;  1U3A A;  4L0U A;  5IO0 A;  2C3N A;  1O6J A;  2GLR A;  2GTU A;  2XBI A;  3GH6 A;  3ZRE A;  3VUR A;  1H75 A;  5ECK B;  1XVW A;  3A2W A;  3TRQ A;  1OAZ A;  2YZU A;  1SKR B;  3GV1 A;  1HNB A;  4EE0 A;  3ZVJ D;  1PQN A;  3HHV A;  1URM A;  4YQM A;  1B9Y C;  4F0C A;  2V32 A;  4XIH A;  11GS A;  4HS1 A;  4LA1 A;  5COH A;  1V9W A;  1GLQ A;  1IYH A;  4TW5 A;  1WE0 A;  2V41 A;  4K1F A;  5GZZ B;  1EP7 A;  2RLI A;  1H4O A;  2OJL A;  1GRX A;  1R26 A;  1FVJ A;  5IMZ A;  3VFI A;  4GST A;  2LUS A;  1CQH A;  2H1A A;  1K3L A;  4V2L A;  1ERV A;  1W89 A;  3O6T A;  3J7Y k;  2XPD A;  2HFD A;  1A8Y A;  1SD9 A;  1PRX A;  5ECI B;  3FHK A;  2BJX A;  1Z9H A;  1A0F A;  1WRY A;  5A4V A;  3MNG A;  3KP8 A;  2H1G A;  1THX A;  3ZYW A;  1WP0 A;  1E6B A;  1SKS B;  1Q4J A;  1VF2 A;  4WF5 A;  3CSH A;  3ZTL A;  4O5R A;  2P5R A;  3RBT A;  4TR3 A;  3DWV A;  1TJD A;  4QL9 A;  8GSS A;  2H76 A;  3O3T A;  1JZR A;  5CO3 A;  4KCA A;  6GSS A;  2X64 A;  2VAF A;  5AIX A;  4LLR A;  3Q19 A;  3UIW A;  2E7P A;  1YJ6 A;  4WET A;  2B7K A;  2PPT A;  3ZFL A;  4F2I A;  3HZ8 A;  3TJB A;  4AJ8 A;  2E0Q A;  2ALB A;  5HR0 A;  2M80 A;  18GS A;  4EO3 A;  4OCF A;  3LXZ A;  4TR1 B;  2R3X A;  5DQS A;  3APQ A;  2O8V B;  2ES7 A;  3FKF A;  1IYI A;  2H1B A;  5A5K A;  2GT6 A;  5DCH A;  2KHP A;  6GSV A;  3BJ5 A;  4K8M A;  2IIY A;  3KH7 A;  2YWO A;  5FWG A;  2PUK C;  1QUW A;  1G6Y A;  1X0R A;  1XW9 A;  3MAK A;  2WDU A;  4ECJ A;  1AIU A;  3BBY A;  2HZE B;  3P90 A;  5B8B A;  4K7O A;  4TR1 A;  3A2X A;  2VO4 A;  5G31 A;  2CVB A;  1XZO A;  5F07 A;  2H73 A;  1F3B A;  2HT9 A;  1OKT A;  3AY8 A;  5D96 A;  2IMF A;  1J0F A;  2WJU A;  4NPB A;  3TUE A;  5CRD A;  2GSR A;  5D8I A;  2IWT A;  2DJK A;  3VWU A;  4DVC A;  5G30 A;  3I43 A;  2H6X A;  4XS4 B;  4MPG A;  1QQ2 A;  2ZUP A;  4ZBA A;  1Z5Y E;  1GSQ A;  1YEP A;  2MMN A;  3ZL5 A;  1I5G A;  13GS A;  4I2U A;  3BCK A;  1XWK A;  2FWG A;  4L5L A;  3A2V A;  3FZA A;  1SJZ A;  2HZE A;  4ZXG A;  2QKE A;  2FY6 A;  4RUV A;  4MJC A;  3KGK A;  3SBC A;  1WPI A;  2BMX A;  3GX8 A;  2D2Z A;  3FYG A;  1XWC A;  3QDN A;  2VIM A;  1Z6M A;  2K6V A;  1QMV A;  2E2G A;  2LKU A;  5J9C A;  4MH2 A;  1Q98 A;  4PQ1 A;  2PGT A;  5AIV A;  1T1V A;  2YNX A;  4XS4 A;  2FGX A;  4X0X A;  4GQF A;  3CXG A;  2K8S A;  3FZ9 A;  1N8J A;  3GA4 A;  1PX6 A;  5ECQ B;  5CRG A;  2GDR A;  2A2R A;  3EE2 A;  2GVP A;  4I8B A;  4O32 A;  4MJB A;  1U87 A;  4G2E A;  1QGV A;  1TP9 A;  2ZNM A;  3I6A A;  4GRF A;  3ZZX A;  2OAC A;  1O7U A;  1S3C A;  1MDI A;  4ILF A;  1JLV A;  4TR0 A;  1YKC A;  4KDU A;  1O85 A;  1XW6 A;  1V58 A;  2DIZ A;  2DJ3 A;  3LJR A;  2MBS A;  4GSN A;  3SWL A;  3DRN A;  2RM5 A;  1EZK A;  1V40 A;  1TK8 B;  2C8U A;  3UBK A;  1PKZ A;  5DBQ A;  3CSI A;  3DKS A;  2YPM A;  3QFA C;  3Q18 A;  1GTA A;  4MF6 A;  4TXV A;  4TRX A;  2WB9 A;  3TKP A;  3R2Q A;  4V1A g;  1JFU A;  5D9X A;  1R5P A;  1ZCP A;  3VI7 A;  1B48 A;  4LMW A;  2B5Y A;  1S3D A;  3HYP A;  1GP1 A;  4OCE A;  3UAR A;  2MYG A;  2CAQ A;  4FH8 A;  3ERG A;  4ZIJ A;  2G2Q A;  5IMV A;  3D6I A;  1OC8 A;  1TDI A;  2WGR A;  5G5F A;  3KZQ A;  2E2M A;  2CVK A;  2IFQ B;  4X43 A;  1T3B A;  2CZ3 A;  2JZR A;  4MZB A;  4F0B A;  4WEY A;  2I9H A;  4RQR A;  1OC3 A;  1EGR A;  2VLV A;  4O92 A;  3CRT A;  2C80 A;  3KM6 A;  4HJM A;  5LCZ A;  1ZMA A;  4ZBB A;  5DJL A;  22GS A;  4OFT A;  3QAG A;  3H1N A;  3EC3 A;  1FB6 A;  5CAX A;  3IR4 A;  2H0I A;  1G7E A;  2Z9S A;  7GSS A;  1FVK A;  5GAN D;  1A2L A;  4PXO A;  4K9Z A;  2F3M A;  2L59 A;  3RHC A;  3EU4 A;  2H8L A;  3A5W A;  4ZL7 A;  2IFQ A;  1U3I A;  1K0N A;  1PKW A;  3HY2 A;  1X9S B;  3UL3 A;  4GTU A;  3WD6 A;  2DC5 A;  5ECN B;  5G1L A;  2FA8 A;  4PNG A;  4MA9 A;  1GSS A;  2C1Y A;  4AF2 A;  3KXO A;  3LOR A;  1LBK A;  2K18 A;  2RUF A;  3KP9 A;  1DSB A;  1KTE A;  2WUL A;  1MD3 A;  1M7T A;  4G19 A;  4ZL9 A;  2AV4 A;  2M72 A;  4D73 B;  3EYT A;  4QL7 A;  6GSX A;  4WF4 A;  1ABA A;  1GUK A;  1TI1 A;  1YF0 A;  2CQ9 A;  5AN1 A;  1SYX A;  3APO A;  1XIY A;  3TJG A;  1ZOF A;  1GNW A;  1DBY A;  1XW5 A;  3DXB A;  3GNJ A;  1F3A A;  2FNO A;  2DLX A;  4KGI A;  4AJ7 A;  5KN3 A;  2X8H A;  4IBP A;  5HR2 A;  2MMO A;  4GCI A;  4J2F A;  3TKR A;  4G10 A;  2IME A;  2HNL A;  4PUF C;  1WJK A;  4HEA 2;  3F4R A;  3GKK A;  2I1U A;  4JU5 A;  4EF0 A;  2IL3 A;  4D73 A;  3IOS A;  5KN1 A;  1A23 A;  4WKW A;  1UA5 A;  1SYR A;  4V1A p;  1QXH A;  3ZMK A;  2PN8 A;  1QFN A;  4XS6 A;  4L8E A;  2L4C A;  2IMK A;  3I69 A;  5FT3 A;  1YZX A;  3NIV A;  3F63 A;  2OAD A;  3EUR A;  2QC7 A;  4KND A;  1K0C A;  4IW9 A;  2V6K A;  3ME7 A;  3F3R A;  1TW9 A;  4K7I A;  3H8Q A;  1RK4 A;  3ZIT A;  4F82 A;  2OA7 A;  4ML6 A;  4I5Q A;  4KDX A;  5ELA A;  3GN3 A;  5F0G A;  2TRX A;  3Q6O A;  1AQW A;  4E8E A;  5HFK A;  3D0Z A;  1R4W A;  5INY A;  4MMM A;  4XCS A;  2YWI A;  3F3Q A;  2L6D A;  4POL A;  3QR6 A;  2YV9 A;  3APS A;  3F6D A;  2LTK A;  2L57 A;  5DAK B;  3WT1 A;  4KH7 A;  3G7J A;  4HUA A;  2HE3 A;  4ULX A;  3VWX A;  4XTS A;  1AW9 A;  1X5E A;  4HZ4 A;  5CRW A;  4IP6 A;  4FYC A;  4NWY A;  4KW6 A;  3LEF A;  3GUS A;  5H5R A;  5ENU A;  2RM6 A;  2PBJ A;  2HSY A;  2H70 A;  2C0G A;  2H75 A;  3D4T A;  1XPV A;  1VF4 A;  3ERF A;  1UN2 A;  4ISD A;  2YZH A;  3CMI A;  3F4T A;  5DAK A;  4K7N A;  3TKS A;  2LNS A;  5IMF A;  2WS2 A;  5CP1 A;  1Z7P A;  1V98 A;  3C7M A;  17GS A;  1VF3 A;  4PUR A;  2RUE A;  4MP4 A;  4FIW A;  4FO5 A;  2GZY A;  4HJ2 A;  2LS5 A;  3D4M A;  3TGZ A;  1PX7 A;  3RPP A;  1EEM A;  3JCM L;  3UOM A;  2F51 A;  4POB A;  2DSA A;  2FD3 A;  6GSY A;  3L9U A;  2NTO A;  3HCZ A;  1FB0 A;  1FAA A;  3CTG A;  4J56 E;  3QAV A;  1B4P A;  1T00 A;  3ZIV A;  1XOB A;  2H1D A;  4GQC A;  1B4Q A;  1T4Y A;  4BPY A;  3ZFB A;  2PMT A;  5GSS A;  4AJ6 A;  4JRR A;  4LL4 B;  1KNG A;  5EL8 A;  2X8C A;  5LNK e;  5ID2 B;  1YY7 A;  3HKR A;  3RPN A;  5FHI A;  3P8W A;  1OE8 A;  5ABR A;  1EEJ A;  1F37 A;  4I6X A;  5AIS A;  3KMN A;  2AAW A;  3KMO A;  2VL2 A;  1BYE A;  1AQX A;  3QOU A;  3GIX A;  3TJK A;  4IP1 A;  2VCV A;  1BQ7 A;  5JCW A;  4HZ2 A;  2OE3 A;  5DQY A;  1F9M A;  1MD4 A;  3FR3 A;  4ECB A;  1K0B A;  3DIE A;  5G1K A;  3NZN A;  2R4V A;  1DE1 A;  4EDY A;  3QCP A;  3TKS E;  5ID2 A;  2O7K A;  1EV4 A;  5ECL B;  4JED A;  3UBL A;  4Q5R A;  3UAP A;  5IPH A;  2R5G A;  2LST A;  3ZVJ A;  3LSZ A;  5B6N A;  2ON7 A;  3W8S A;  1SKW B;  4GLT A;  10GS A;  1AUC A;  1GSD A;  3PGT A;  1FW1 A;  1G6W A;  1FOV A;  1Y25 A;  1TRS A;  3IXR A;  1XOA A;  2HZF A;  5IMA A;  5D9W A;  4MJA A;  4ZBD A;  1B9X C;  3WGE A;  3TB2 A;  1M2B A;  2RII A;  3GUR A;  3US3 A;  1SL2 B;  2H01 A;  3BD2 A;  3G9B A;  4HU9 A;  4JZQ A;  5J4U A;  1TK5 B;  1A2M A;  1PD2 1;  4V2M A;  4EL1 A;  3C1R A;  1K0A A;  2GZZ A;  3QMX A;  4DEJ A;  1DE2 A;  3HVX A;  4IGJ A;  2R6K A;  3DVW A;  4MK3 A;  3WYW A;  4KA0 A;  1GUH A;  2HI7 A;  1N2A A;  2OKA A;  2GZP A;  4EKZ A;  2WZ9 A;  3IK9 A;  1PGT A;  1AAZ A;  4OD7 A;  4IHU A;  1GNE A;  5L71 A;  4IEL A;  2V1M A;  2EC4 A;  2XPE A;  3IV4 A;  1SL1 B;  3LGC A;  2H6Z A;  1ZYQ B;  3LYP A;  5DCG A;  5IOX A;  1K0M A;  1OE7 A;  2C4J A;  1J9B A;  3IRA A;  5F05 A;  1M0U A;  4DSR A;  1F2E A;  4ID0 A;  2AYT A;  5ECP B;  3MWH A;  3F4S A;  1K0O A;  3GL3 A;  1O8X A;  4N0V A;  5J41 A;  1Z6N A;  2B1L A;  2PU9 C;  2LJA A;  4RI6 A;  3C8E A;  2HYX A;  1ST9 A;  2DJJ A;  4MJE A;  1O81 A;  4ZIL A;  1FO5 A;  2MMA A;  2R2J A;  4WBJ A;  5JCG A;  1USB A;  3WT2 A;  4KX4 A;  2XBQ A;  3GST A;  1NHY A;  5DVB A;  3IPZ A;  9GSS A;  3ZIJ A;  3KEB A;  2FWH A;  2VD0 A;  4HU7 A;  1BX9 A;  3HD5 A;  1SK2 A;  1AQV A;  4IJI A;  2VCT A;  1T4Z A;  5ECS A;  3UMA A;  4CHS A;  3CBU A;  2LV3 A;  2LJK A;  2REM A;  3G7I A;  2LQQ A;  1EP8 A;  4YQU A;  2A2S A;  3GRX A;  5CYY A;  3C73 A;  4BL7 A;  2JL4 A;  2OBI A;  4NV5 A;  1O73 A;  2O85 A;  3ISO A;  4NHW A;  4P3Y B;  1TRV A;  3KJY A;  2GQK A;  4V2N A;  3TRP A;  4GWR A;  2AB6 A;  5KEJ A;  1A24 A;  4MLY A;  1XVQ A;  4I2T A;  5IIZ A;  2IJY A;  1YKA A;  3M3M A;  2VD1 A;  2NDO A;  2ON5 A;  1XBS A;  2CX4 A;  2DMM A;  5IMD A;  2X8G A;  5ECM B;  2LEG A;  3E3E A;  4N30 A;  3RAZ A;  5D73 A;  1GTI A;  3TJJ A;  4MDC A;  3TKQ A;  1GSU A;  1TK0 B;  2VCZ A;  3NOF A;  4HI7 A;  1BJX A;  4DSQ A;  5ECR B;  2ZCT A;  2DIY A;  4PNF A;  1WOU A;  4Z7X A;  2LRN A;  4PQH A;  5DJM A;  1A0R P;  2DBC A;  2G0F A;  1R5A A;  1SJI A;  3GYK A;  5F06 A;  1WWJ A;  5B7C A;  5JCU A;  1NM3 A;  2L4Q A;  3LG6 A;  4HOJ A;  3I9V 2;  2EIQ A;  3IK7 A;  4OO4 A;  4F03 A;  2GQL A;  5EPF A;  2VM2 A;  2VUP A;  2YJH A;  4KUN A;  2K9F A;  3W8J A;  3BOA A;  4TR4 A;  2HLS A;  1TI3 A;  2VLT A;  2L5O A;  3LXT A;  3KTB A;  2YWN A;  4LMV A;  1ILO A;  4Q5F A;  1NSW A;  3D5J A;  3FRC A;  4FYB A;  4BA7 A;  3QD9 A;  1TKD B;  2J9H A;  5D9T A;  1R7H A;  2GT5 A;  3M0F A;  2LQO A;  1SK1 A;  4K0G A;  5HFI A;  4KB3 A;  5IQY A;  1YF1 A;  14GS A;  4EUY A;  2N5F A;  1UVZ A;  1HYU A;  1K0D A;  2H71 A;  3H79 A;  2CA8 A;  3TOU A;  2CZ2 A;  3ED3 A;  3D22 A;  5IO2 A;  2H0H A;  5JWO B;  2FWE A;  5A4U A;  4YQV A;  3PIN A;  3J7Y b;  5JWQ B;  3KD0 A;  1HNC A;  3GKN A;  4L5O A;  4XHM A;  2H72 A;  4IKH A;  3VPQ A;  4POK A;  2LJR A;  4PGT A;  5CRH A;  4RQX A;  3IA1 A;  2FLS A;  5IOW A;  2WFC A;  1RQM A;  3LQ7 A;  4PUA A;  4X1U A;  5C04 A;  1THO A;  4TKY A;  3GKM A;  3C1S A;  2XC2 A;  3WGX A;  1ERT A;  3E9J B;  1YDK A;  4L0W A;  3HDC A;  2MMZ A;  1WIK A;  3N9J A;  5E4W A;  3DD3 A;  1DUG A;  2H74 A;  2DML A;  4J57 E;  3DGQ A;  5GST A;  3HJO A;  4KSM A;  2C0E A;  1ERU A;  3F6F A;  5DDL A;  3FZ4 A;  2FUG 2;  4TOP A;  2IN3 A;  3FW2 A;  3VI5 A;  3TOT A;  3KTL A;  4EDZ A;  3VLN A;  2HXK A;  3KH9 A;  2FHE A;  3LWA A;  1M9A A;  3OR5 A;  2H66 A;  4RI7 A;  3IC4 A;  4JBB A;  3GSS A;  3L78 A;  3MDK A;  3EU3 A;  2YAN A;  2YWM A;  4ZB8 A;  3VPT A;  1PL1 A;  4HQS A;  3FZ5 A;  1U6T A;  5D93 A;  1ON4 A;  1U88 A;  3GL5 A;  4XS1 A;  1JZD A;  2FA4 A;  2PER A;  3KIJ A;  4FYU A;  4ML1 A;  3V1W A;  1OYJ A;  2C3T A;  1OKD A;  1HQO A;  2TRC P;  3WGD A;  4EXJ A;  1YEX A;  2R37 A;  3HJP A;  2GS3 A;  4BVY A;  1MDK A;  1NHO A;  5ELG A;  1TXX A;  1GTU A;  1G0T A;  5ECO B;  5J5N A;  3F9U A;  4TN8 A;  2GQM A;  1M9B A;  3D21 A;  1SJ6 A;  4MF5 A;  3GX0 A;  1VRS D;  1X9M B;  5DAL B;  4E8H A;  12GS A;  2VLU A;  3IE3 A;  2P5Q A;  3FY7 A;  1T7P B;  1NW2 A;  4WBR D;  3DEX A;  3C71 A;  2GGT A;  1M2D A;  2F9S A;  1LJR A;  1TTZ A;  3GHA A;  2LRT A;  1ML6 A;  5HR1 A;  4MF7 A;  3EVI A;  3HVV A;  4AGS A;  5EY6 A;  3E0U A;  1GSE A;  3P2A A;  4IQA A;  5DAL A;  2FWF A;  1PMT A;  4I97 A;  1TOF A;  1OC9 B;  2EIR A;  1JZW A;  1GLP A;  4N11 A;  4IJ3 A;  1EOH A;  1XCC A;  2M46 A;  4OWY A;  2C3Q A;  2P31 A;  2F8F A;  3O76 A;  4OFM A;  2B1K A;  4GSS A;  3MSZ A;  1JHB A;  4F9Z A;  1VF1 A;  1WMJ A;  4TXO B;  2CV4 A;  1PSQ A;  3QAW A;  4Q5Q A;  2H30 A;  2N5B A;  1I9D A;  2JAC A;  3CYN A;  4NV2 A;  2VL3 A;  1KBN A;  4KDY A;  1OC9 A;  4K2D A;  1MEK A;  3A3T A;  3L4N A;  3PH9 A;  3F0I A;  3FEU A;  2VL9 A;  3M9K A;  4N0Z A;  4NAX A;  3TJF A;  3DML A;  2OE0 A;  6GST A;  4NXI A;  2DJ2 A;  2MZC A;  3L9V A;  2GSS A;  1UC7 A;  2P0G A;  3VK9 A;  1ZYE A;  4JR4 A;  4TVE A;  2AUV A;  3G7Y A;  4NMU A;  2LNT A;  4YAV A;  4TXO A;  3UJ1 A;  3U5R E;  4H86 A;  4QQ7 A;  4WR4 A;  3RDW A;  4EC0 A;  1YQ1 A;  3ME8 A;  1HNA A;  2B5E A;  4BWS A;  4CW9 A;  3HXS A;  2H6Y A;  3F8U A;  1JLW A;  1BAY A;  2KUC A;  2JSY A;  5KN2 A;  1K3Y A;  2VCW A;  4GF0 A;  2TIR A;  2YOI A;  3LYK A;  5CRE A;  1C72 A;  2PVQ A;  5LD0 A;  1TU8 A;  4ZL8 A;  2YP6 A;  1Y6E A;  2GSQ A;  4WR5 A;  3UVT A;  1GSY A;  4N10 A;  2KP2 A;  16GS A;  1T8E B;  2V6O A;  1A8L A;  2CX3 A;  1PN9 A;  3FR9 A;  5D9V A;  4ECI A;  2V2G A;  4KE3 A;  5EVO A;  2VOC A;  1W4V A;  4YH2 A;  2JU5 A;  1E2Y A;  1QK8 A;  2H19 A;  1GUL A;  2N5A A;  2VCX A;  1A2J A;  1M2A A;  4POM A;  3IHQ A;  5AGY A;  2C0D A;  2PWJ A;  2AJQ B;  4BWQ A;  1ZZY A;  3EMP A;  5C00 A;  1AC1 A;  1SD8 A;  1XWB A;  1Z7R A;  4XRA A;  1MTC A;  4BVX A;  1TU7 A;  1EGO A;  3PR8 A;  5IPG A;  4ECC A;  5B8A A;  1PL2 A;  3GTU B;  4HDE A;  2B7J A;  2YN1 A;  3TKS C;  1ZL9 A;  5GAP D;  4KCE A;  3M1G A;  3M8N A;  2OBK A;  3ZLP A;  1ACV A;  2DJ0 A;  1X5C A;  4IVF A;  4KSO A;  2L5L A;  1GTB A;  1EOG A;  4ACS A;  1ZGN A;  4K6X A;  3H4K A;  3FR6 A;  3BCI A;  1KEB A;  2IPA A;  5G2Z A;  3M9J A;  2KOK A;  2JAD A;  1MDJ A;  3IDV A;  4OO5 A;  4IQ1 A;  1AXD A;  3K8N A;  1G7O A;  4OFN A;  3GTU A;  5E59 A;  3ERW A;  2KP1 A;  2F8A A;  3CSJ A;  1ERW A;  1XFL A;  1F6M C;  1LU4 A;  3Q74 A;  2MBT A;  5ECH B;  2LRC A;  3IAM 2;  5HQP A;  2YV7 A;  4ZB6 A;  4ZB9 A;  5IMC A;  3VWW A;  1TRW A;  3LFL A;  2B5X A;  1Z3E A;  2NBS A;  1S3A A;  5F8B A;  4HQZ A;  1O8W A;  3CTF A;  3GMF A;  4OMV A;  3TCO A;  3HZ4 A;  4PQI A;  2VL2 C;  3TDG A;  4LL1 B;  2X99 A;  1J08 A;  6GSW A;  2NPB A;  3EIN A;  1V2A A;  1HD2 A;  2YCD A;  2VCQ A;  2WCI A;  1SU9 A;  2BTO T;  1XWG A;  2JSZ A;  3CRU A;  2L6C A;  2B3S A;  1BED A;  1EV9 A;  5HFG A;  5G5E A;  5IM9 A;  4MAB A;  4JR6 A;  19GS A;  3ZML A;  3P7X A;  1BG5 A;  3GFK A;  1CQG A;  4EVM A;  2YJ7 A;  2HSH A;  4DSS B;  1SEN A;  2NVL A;  2QGV A;  1GH2 A;  2CVD A;  2K8V A;  4PX1 A;  2AHE A;  1SL0 B;  2PVO C;  4O7H A;  2CT6 A;  3RHB A;  2C0F A;  4IS0 A;  2J23 A;  2VM1 A;  3L0H A;  2B6M A;  3FK8 A; 
#chains in the Genus database with same CATH topology
 4YAP A;  1X5D A;  3ZRD A;  2HRN A;  1TRU A;  2HRF A;  3L9S A;  4BIK A;  2JZS A;  2I3Y A;  1M99 A;  3H93 A;  3HA9 A;  4MPF A;  1GUM A;  3HVS A;  4NHZ A;  1VGL A;  2H0G A;  1EWX A;  2O89 A;  4MZW A;  3W6G A;  3VWV A;  3EMX A;  2QSI A;  4G9H A;  3R3E A;  5H5S A;  5H5Q A;  4Q5N A;  4DSS A;  3DVX A;  3IAS 2;  5KN0 A;  4IN0 A;  3GKX A;  3S9F A;  2WRT A;  3UEM A;  3TRX A;  4GXZ A;  1X9W B;  2KLX A;  2A4V A;  2OE1 A;  2JZT A;  2A2P A;  1XXU A;  5J3R A;  3EWL A;  3QPM A;  4XRD A;  3U6V A;  2IMI A;  1GSF A;  2XHF A;  1FG4 A;  3UVH A;  6GSU A;  3QFB C;  1B8X A;  1GL8 A;  1XWA A;  3DYR A;  4CDO A;  5CNW A;  1RW1 A;  2O87 A;  1PA3 A;  3GH9 A;  2I81 A;  2R0P A;  2UZ8 A;  1K3O A;  2DJ1 A;  4MH3 A;  4WXT A;  2CAI A;  5JWR B;  4JE1 A;  2EIO A;  5A4W A;  4MZC A;  4KAE A;  1OVN A;  4MCU A;  2IMD A;  1FHE A;  20GS A;  2GST A;  2FCH A;  3IBH A;  3KCM A;  1PFO A;  1JZO A;  1SK0 A;  3HJM A;  5B6M A;  5HR3 A;  5J9B A;  1GWC A;  4G0K A;  2I4A A;  4K0N A;  1V57 A;  3N5O A;  1U3A A;  4L0U A;  5IO0 A;  2C3N A;  1O6J A;  2GLR A;  2GTU A;  2XBI A;  3GH6 A;  3ZRE A;  4K2X A;  3VUR A;  1H75 A;  3MYD A;  5ECK B;  1XVW A;  3A2W A;  3TRQ A;  1OAZ A;  2YZU A;  1SKR B;  3GV1 A;  4K5S A;  1HNB A;  4EE0 A;  3ZVJ D;  1PQN A;  3HHV A;  4K5R A;  1URM A;  4YQM A;  1B9Y C;  4F0C A;  2V32 A;  4XIH A;  11GS A;  4HS1 A;  4LA1 A;  5COH A;  1V9W A;  1GLQ A;  1ZYP A;  3MIX A;  1IYH A;  4TW5 A;  1WE0 A;  2V41 A;  4K1F A;  5GZZ B;  1EP7 A;  2RLI A;  1H4O A;  2OJL A;  1GRX A;  1R26 A;  1FVJ A;  5IMZ A;  3VFI A;  4GST A;  2LUS A;  1CQH A;  2H1A A;  1K3L A;  4V2L A;  1ERV A;  1W89 A;  3O6T A;  3J7Y k;  2XPD A;  2HFD A;  1A8Y A;  1SD9 A;  1PRX A;  5ECI B;  3FHK A;  2BJX A;  1Z9H A;  1A0F A;  1WRY A;  5A4V A;  3MNG A;  3KP8 A;  2H1G A;  1THX A;  3ZYW A;  1WP0 A;  1E6B A;  1SKS B;  1Q4J A;  1VF2 A;  4WF5 A;  3CSH A;  3ZTL A;  4O5R A;  2P5R A;  3RBT A;  4TR3 A;  3DWV A;  1TJD A;  4QL9 A;  8GSS A;  5KOW A;  2H76 A;  3O3T A;  1JZR A;  5CO3 A;  4KCA A;  6GSS A;  2X64 A;  2VAF A;  5AIX A;  4LLR A;  3Q19 A;  3UIW A;  2E7P A;  1YJ6 A;  4WET A;  2B7K A;  2PPT A;  4Z2R A;  3ZFL A;  4F2I A;  3HZ8 A;  3TJB A;  4AJ8 A;  2E0Q A;  2ALB A;  5HR0 A;  2M80 A;  18GS A;  4EO3 A;  4OCF A;  3LXZ A;  4TR1 B;  2R3X A;  5DQS A;  3APQ A;  2O8V B;  3IC8 A;  2ES7 A;  3FKF A;  4FQU A;  1IYI A;  2H1B A;  5A5K A;  2GT6 A;  5DCH A;  2KHP A;  6GSV A;  3BJ5 A;  4K8M A;  2IIY A;  3KH7 A;  3LW9 A;  2YWO A;  5FWG A;  2PUK C;  1QUW A;  1G6Y A;  1X0R A;  1XW9 A;  3MAK A;  2WDU A;  4ECJ A;  1AIU A;  3BBY A;  2HZE B;  3P90 A;  5B8B A;  4K7O A;  4TR1 A;  3A2X A;  2VO4 A;  5G31 A;  2CVB A;  1XZO A;  5F07 A;  2H73 A;  1F3B A;  2HT9 A;  1OKT A;  3AY8 A;  5D96 A;  2IMF A;  1J0F A;  2WJU A;  4NPB A;  3TUE A;  5CRD A;  2GSR A;  5D8I A;  2IWT A;  2DJK A;  3VWU A;  4DVC A;  5G30 A;  3I43 A;  2H6X A;  4XS4 B;  4MPG A;  1QQ2 A;  2ZUP A;  4ZBA A;  1Z5Y E;  1GSQ A;  1YEP A;  2MMN A;  3ZL5 A;  1I5G A;  4PTS A;  13GS A;  4I2U A;  3BCK A;  1XWK A;  2FWG A;  4L5L A;  3A2V A;  3FZA A;  1SJZ A;  2HZE A;  4ZXG A;  2QKE A;  2FY6 A;  4RUV A;  4MJC A;  3KGK A;  3SBC A;  1WPI A;  2BMX A;  3GX8 A;  2D2Z A;  3FYG A;  1XWC A;  3QDN A;  2VIM A;  1Z6M A;  2K6V A;  3CQF A;  1QMV A;  2E2G A;  2LKU A;  5J9C A;  4MH2 A;  1Q98 A;  4PQ1 A;  2PGT A;  5AIV A;  1T1V A;  2YNX A;  4XS4 A;  2FGX A;  4X0X A;  4GQF A;  3CXG A;  2K8S A;  3FZ9 A;  1N8J A;  3GA4 A;  1PX6 A;  5ECQ B;  5CRG A;  2GDR A;  2A2R A;  3EE2 A;  2HRK A;  2GVP A;  4I8B A;  4O32 A;  4MJB A;  1U87 A;  4USS A;  4G2E A;  1QGV A;  1TP9 A;  2ZNM A;  3I6A A;  4GRF A;  3ZZX A;  2OAC A;  1O7U A;  1S3C A;  1MDI A;  4ILF A;  1JLV A;  4TR0 A;  1YKC A;  4KDU A;  1O85 A;  1XW6 A;  1V58 A;  2DIZ A;  2DJ3 A;  3LJR A;  2MBS A;  4GSN A;  3SWL A;  3DRN A;  2RM5 A;  1EZK A;  1V40 A;  1TK8 B;  2C8U A;  3UBK A;  1PKZ A;  5DBQ A;  3CSI A;  3DKS A;  4A5P A;  2YPM A;  3QFA C;  3Q18 A;  1GTA A;  4MF6 A;  4TXV A;  4TRX A;  2WB9 A;  3TKP A;  1FOH A;  3R2Q A;  4V1A g;  1JFU A;  5D9X A;  1R5P A;  1ZCP A;  3VI7 A;  1B48 A;  4LMW A;  2B5Y A;  1S3D A;  3HYP A;  1GP1 A;  4OCE A;  3UAR A;  2MYG A;  2CAQ A;  4FH8 A;  3ERG A;  4ZIJ A;  2G2Q A;  5IMV A;  3D6I A;  1OC8 A;  1TDI A;  4Z2U A;  2WGR A;  5G5F A;  3KZQ A;  2E2M A;  2CVK A;  2IFQ B;  4X43 A;  1T3B A;  2CZ3 A;  2JZR A;  4MZB A;  4F0B A;  4WEY A;  2I9H A;  4EIQ A;  4RQR A;  1OC3 A;  1EGR A;  2VLV A;  4O92 A;  3CRT A;  2C80 A;  3KM6 A;  4HJM A;  5LCZ A;  1ZMA A;  4ZBB A;  5DJL A;  22GS A;  4OFT A;  3QAG A;  3H1N A;  3EC3 A;  1FB6 A;  5CAX A;  3IR4 A;  2H0I A;  1G7E A;  2Z9S A;  7GSS A;  1FVK A;  5GAN D;  1A2L A;  4PXO A;  4K9Z A;  2F3M A;  4G0I A;  2L59 A;  3RHC A;  3EU4 A;  2H8L A;  3A5W A;  4ZL7 A;  2IFQ A;  1U3I A;  1K0N A;  1PKW A;  3HY2 A;  1X9S B;  3UL3 A;  4GTU A;  3WD6 A;  2DC5 A;  5ECN B;  5G1L A;  2FA8 A;  4PNG A;  4MA9 A;  1GSS A;  2C1Y A;  4AF2 A;  3KXO A;  3LOR A;  1LBK A;  2K18 A;  2RUF A;  3KP9 A;  1DSB A;  1KTE A;  5BMU A;  2WUL A;  1MD3 A;  1M7T A;  4G19 A;  4ZL9 A;  2AV4 A;  4O5U A;  2M72 A;  4D73 B;  3EYT A;  4QL7 A;  6GSX A;  4WF4 A;  1ABA A;  1GUK A;  1TI1 A;  1YF0 A;  2CQ9 A;  4YKF A;  5AN1 A;  1SYX A;  3APO A;  1XIY A;  3TJG A;  1ZOF A;  1GNW A;  1DBY A;  1XW5 A;  3DXB A;  3GNJ A;  1F3A A;  2FNO A;  2DLX A;  4KGI A;  4AJ7 A;  5KN3 A;  2X8H A;  4IBP A;  5HR2 A;  2MMO A;  4GCI A;  4J2F A;  3TKR A;  4G10 A;  2IME A;  2HNL A;  4PUF C;  1WJK A;  4HEA 2;  3F4R A;  3GKK A;  2I1U A;  4JU5 A;  4EF0 A;  2IL3 A;  4D73 A;  3IOS A;  5KN1 A;  1A23 A;  4WKW A;  1UA5 A;  1SYR A;  4V1A p;  1QXH A;  3ZMK A;  2PN8 A;  1QFN A;  4XS6 A;  4L8E A;  2L4C A;  2IMK A;  3I69 A;  5FT3 A;  4X4J A;  1YZX A;  3NIV A;  3F63 A;  2OAD A;  3EUR A;  2QC7 A;  4KND A;  1K0C A;  4IW9 A;  2V6K A;  3ME7 A;  3F3R A;  1TW9 A;  4K7I A;  3H8Q A;  3A5I A;  1RK4 A;  3ZIT A;  4F82 A;  5BRT A;  2OA7 A;  4ML6 A;  4I5Q A;  4KDX A;  4ICY A;  5ELA A;  3GN3 A;  5F0G A;  2TRX A;  3Q6O A;  1AQW A;  4E8E A;  5HFK A;  3D0Z A;  1R4W A;  5INY A;  4MMM A;  4XCS A;  2YWI A;  3F3Q A;  2L6D A;  4POL A;  3QR6 A;  2YV9 A;  3APS A;  3F6D A;  2LTK A;  2L57 A;  5DAK B;  3WT1 A;  4KH7 A;  3G7J A;  4HUA A;  2HE3 A;  4ULX A;  3VWX A;  4XTS A;  1AW9 A;  1X5E A;  4HZ4 A;  5CRW A;  4IP6 A;  4FYC A;  4NWY A;  4KW6 A;  3LEF A;  3GUS A;  5H5R A;  5ENU A;  2RM6 A;  2DKH A;  2PBJ A;  2HSY A;  2H70 A;  2C0G A;  2H75 A;  3D4T A;  1XPV A;  1VF4 A;  3ERF A;  1UN2 A;  4ISD A;  2YZH A;  3CMI A;  3F4T A;  3FMW A;  5DAK A;  4K7N A;  3TKS A;  2LNS A;  5IMF A;  2WS2 A;  5CP1 A;  1Z7P A;  1V98 A;  3C7M A;  17GS A;  1VF3 A;  4Z2T A;  4PUR A;  2RUE A;  4CY6 A;  2R0C A;  4MP4 A;  4FIW A;  4FO5 A;  2GZY A;  4HJ2 A;  2LS5 A;  3D4M A;  3TGZ A;  1PX7 A;  3RPP A;  1EEM A;  3JCM L;  3UOM A;  2F51 A;  4POB A;  2DSA A;  2FD3 A;  6GSY A;  3PPU A;  3L9U A;  2NTO A;  3HCZ A;  1FB0 A;  1FAA A;  3CTG A;  4J56 E;  3QAV A;  1B4P A;  1T00 A;  3ZIV A;  1XOB A;  2H1D A;  4GQC A;  1B4Q A;  1T4Y A;  4BPY A;  3ZFB A;  2PMT A;  5GSS A;  4AJ6 A;  4JRR A;  4LL4 B;  1KNG A;  5EL8 A;  5KOX A;  2X8C A;  5LNK e;  5ID2 B;  1YY7 A;  3HKR A;  3RPN A;  5FHI A;  3P8W A;  2R0G A;  1OE8 A;  5ABR A;  1EEJ A;  1F37 A;  2X4A A;  4I6X A;  5AIS A;  3KMN A;  2AAW A;  3KMO A;  2VL2 A;  1BYE A;  1AQX A;  3QOU A;  3GIX A;  3TJK A;  4IP1 A;  2VCV A;  1BQ7 A;  5JCW A;  4HZ2 A;  2OE3 A;  5DQY A;  1F9M A;  1MD4 A;  3FR3 A;  4ECB A;  1K0B A;  3DIE A;  5G1K A;  4KF9 A;  3NZN A;  2R4V A;  1DE1 A;  4EDY A;  3QCP A;  3TKS E;  5ID2 A;  2O7K A;  1EV4 A;  5ECL B;  4JED A;  3UBL A;  4MNN A;  4Q5R A;  3UAP A;  5IPH A;  2R5G A;  2LST A;  3ZVJ A;  3LSZ A;  5B6N A;  2ON7 A;  3W8S A;  1SKW B;  4GLT A;  10GS A;  1AUC A;  1GSD A;  3PGT A;  1FW1 A;  1G6W A;  1FOV A;  1Y25 A;  1TRS A;  3IXR A;  1XOA A;  2HZF A;  5IMA A;  5D9W A;  4MJA A;  4ZBD A;  1B9X C;  3WGE A;  3TB2 A;  1M2B A;  2RII A;  3GUR A;  3US3 A;  1SL2 B;  2H01 A;  3BD2 A;  2QA1 A;  3G9B A;  4HU9 A;  4JZQ A;  5J4U A;  1TK5 B;  1A2M A;  1PD2 1;  4V2M A;  4EL1 A;  3C1R A;  1K0A A;  2GZZ A;  3QMX A;  4DEJ A;  1DE2 A;  3HVX A;  1PN0 A;  4IGJ A;  2R6K A;  3DVW A;  4MK3 A;  3WYW A;  4KA0 A;  1GUH A;  2HI7 A;  1N2A A;  2OKA A;  2GZP A;  4EKZ A;  2WZ9 A;  3IK9 A;  1PGT A;  1AAZ A;  4OD7 A;  4IHU A;  1GNE A;  5L71 A;  4IEL A;  2V1M A;  2EC4 A;  2XPE A;  4YKG A;  3IV4 A;  1SL1 B;  3LGC A;  2H6Z A;  1ZYQ B;  3LYP A;  5DCG A;  5IOX A;  4HSC X;  1K0M A;  1OE7 A;  2C4J A;  1J9B A;  3IRA A;  5F05 A;  1M0U A;  4DSR A;  1F2E A;  4ID0 A;  2AYT A;  5ECP B;  3MWH A;  3F4S A;  1K0O A;  3GL3 A;  1O8X A;  4N0V A;  5J41 A;  1Z6N A;  2B1L A;  2PU9 C;  2LJA A;  4RI6 A;  3C8E A;  2HYX A;  1ST9 A;  2DJJ A;  4MJE A;  1O81 A;  4ZIL A;  1FO5 A;  2MMA A;  2R2J A;  4WBJ A;  4BL7 B;  5JCG A;  1USB A;  3WT2 A;  4KX4 A;  2XBQ A;  3GST A;  1NHY A;  5DVB A;  3IPZ A;  9GSS A;  3ZIJ A;  3KEB A;  2FWH A;  2VD0 A;  4HU7 A;  1BX9 A;  3HD5 A;  1SK2 A;  1AQV A;  4IJI A;  2VCT A;  1T4Z A;  5ECS A;  3UMA A;  4CHS A;  3CBU A;  2LV3 A;  2LJK A;  2REM A;  3G7I A;  2LQQ A;  1EP8 A;  3HVN A;  4YQU A;  2A2S A;  3GRX A;  5CYY A;  3C73 A;  4BL7 A;  2JL4 A;  2OBI A;  4NV5 A;  1O73 A;  2O85 A;  3ISO A;  4NHW A;  4P3Y B;  1TRV A;  3KJY A;  2GQK A;  4V2N A;  3TRP A;  4GWR A;  2AB6 A;  5KEJ A;  2X49 A;  1A24 A;  4MLY A;  1XVQ A;  4I2T A;  5IIZ A;  2IJY A;  1YKA A;  3M3M A;  2VD1 A;  2NDO A;  4EIP A;  2ON5 A;  1XBS A;  2CX4 A;  2DMM A;  5IMD A;  2X8G A;  5ECM B;  2LEG A;  3E3E A;  4N30 A;  3RAZ A;  5D73 A;  1GTI A;  2A4H A;  3TJJ A;  4MDC A;  3TKQ A;  1GSU A;  1TK0 B;  2VCZ A;  3NOF A;  4HI7 A;  1BJX A;  4DSQ A;  5ECR B;  2ZCT A;  2DIY A;  4PNF A;  1WOU A;  4Z7X A;  2LRN A;  4PQH A;  5DJM A;  1A0R P;  2DBC A;  2G0F A;  1R5A A;  1SJI A;  3GYK A;  5F06 A;  1WWJ A;  5B7C A;  5JCU A;  1NM3 A;  2L4Q A;  3LG6 A;  4HOJ A;  3I9V 2;  2EIQ A;  3IK7 A;  4OO4 A;  4F03 A;  2GQL A;  5EPF A;  2VM2 A;  2VUP A;  2YJH A;  4KUN A;  2K9F A;  3W8J A;  3BOA A;  4TR4 A;  2HLS A;  1TI3 A;  2VLT A;  2L5O A;  3LXT A;  3KTB A;  2YWN A;  4LMV A;  1ILO A;  4Q5F A;  1NSW A;  3D5J A;  3FRC A;  4FYB A;  4BA7 A;  3QD9 A;  1TKD B;  2J9H A;  5D9T A;  1R7H A;  2GT5 A;  3M0F A;  2LQO A;  1SK1 A;  4K0G A;  5HFI A;  4KB3 A;  5IQY A;  1YF1 A;  14GS A;  4EUY A;  2N5F A;  1UVZ A;  1HYU A;  1K0D A;  2H71 A;  3H79 A;  4CY8 A;  2CA8 A;  3TOU A;  2CZ2 A;  3ED3 A;  3D22 A;  5IO2 A;  2H0H A;  5JWO B;  2FWE A;  5A4U A;  4YQV A;  3PIN A;  3J7Y b;  5JWQ B;  3KD0 A;  1HNC A;  3GKN A;  4L5O A;  4XHM A;  2H72 A;  4IKH A;  3VPQ A;  4POK A;  2LJR A;  4PGT A;  5CRH A;  4RQX A;  3IA1 A;  2FLS A;  5IOW A;  2WFC A;  1RQM A;  3LQ7 A;  4PUA A;  4X1U A;  5C04 A;  1THO A;  4TKY A;  3GKM A;  3C1S A;  2XC2 A;  3WGX A;  1ERT A;  3E9J B;  1YDK A;  4L0W A;  3HDC A;  2MMZ A;  1WIK A;  3N9J A;  5E4W A;  3DD3 A;  1DUG A;  2H74 A;  2DML A;  1S3R A;  4J57 E;  3DGQ A;  5GST A;  3HJO A;  4KSM A;  2C0E A;  1ERU A;  3F6F A;  2QA2 A;  5DDL A;  3FZ4 A;  2FUG 2;  4TOP A;  2IN3 A;  3FW2 A;  3VI5 A;  3TOT A;  3KTL A;  4EDZ A;  3VLN A;  2HXK A;  3KH9 A;  2FHE A;  3LWA A;  4BVY B;  1M9A A;  3OR5 A;  2H66 A;  4RI7 A;  3IC4 A;  4JBB A;  3GSS A;  3L78 A;  3MDK A;  3EU3 A;  2YAN A;  2YWM A;  4ZB8 A;  3VPT A;  1PL1 A;  4HQS A;  3FZ5 A;  1ZYN A;  1U6T A;  5D93 A;  1ON4 A;  1U88 A;  3GL5 A;  4XS1 A;  1JZD A;  2FA4 A;  2PER A;  3KIJ A;  4FYU A;  4ML1 A;  3V1W A;  1OYJ A;  2C3T A;  1OKD A;  1HQO A;  2TRC P;  3WGD A;  4EXJ A;  1YEX A;  2R37 A;  3HJP A;  2GS3 A;  4BVY A;  1MDK A;  1NHO A;  5ELG A;  1TXX A;  1GTU A;  1G0T A;  5ECO B;  5J5N A;  3F9U A;  4TN8 A;  2GQM A;  1M9B A;  3D21 A;  1SJ6 A;  4MF5 A;  3GX0 A;  1VRS D;  1X9M B;  5DAL B;  4E8H A;  12GS A;  2VLU A;  3IE3 A;  2P5Q A;  3FY7 A;  1T7P B;  1NW2 A;  4WBR D;  3DEX A;  3C71 A;  2GGT A;  1M2D A;  2F9S A;  1LJR A;  1TTZ A;  3GHA A;  2LRT A;  1ML6 A;  5HR1 A;  4MF7 A;  3EVI A;  3HVV A;  4AGS A;  1M3I A;  5EY6 A;  3E0U A;  1GSE A;  3P2A A;  4IQA A;  5DAL A;  2FWF A;  1PMT A;  4I97 A;  1TOF A;  1OC9 B;  2EIR A;  1JZW A;  1GLP A;  4N11 A;  4IJ3 A;  1EOH A;  1XCC A;  2M46 A;  4OWY A;  2C3Q A;  2P31 A;  2F8F A;  3O76 A;  4OFM A;  2B1K A;  4GSS A;  3MSZ A;  1JHB A;  4F9Z A;  1VF1 A;  1WMJ A;  4TXO B;  2CV4 A;  1PSQ A;  3QAW A;  4Q5Q A;  2H30 A;  2N5B A;  1I9D A;  2JAC A;  3CYN A;  4NV2 A;  2VL3 A;  1KBN A;  4KDY A;  2DKI A;  1OC9 A;  4K2D A;  1MEK A;  3EPT A;  3A3T A;  3L4N A;  3PH9 A;  3F0I A;  3FEU A;  2VL9 A;  3M9K A;  4N0Z A;  4NAX A;  3TJF A;  3DML A;  2OE0 A;  6GST A;  4NXI A;  2DJ2 A;  2MZC A;  3L9V A;  2GSS A;  1UC7 A;  2P0G A;  3VK9 A;  1XG8 A;  1ZYE A;  4JR4 A;  4TVE A;  2AUV A;  3G7Y A;  4NMU A;  2LNT A;  4YAV A;  4TXO A;  3UJ1 A;  3U5R E;  4H86 A;  4QQ7 A;  4WR4 A;  3RDW A;  4EC0 A;  1YQ1 A;  4O5Q A;  3ME8 A;  1HNA A;  2B5E A;  4BWS A;  4CW9 A;  3HXS A;  2H6Y A;  3F8U A;  1JLW A;  1BAY A;  2KUC A;  2JSY A;  5KN2 A;  1K3Y A;  2VCW A;  4GF0 A;  2TIR A;  2YOI A;  3LYK A;  5CRE A;  1C72 A;  2PVQ A;  5LD0 A;  1TU8 A;  4ZL8 A;  2YP6 A;  1Y6E A;  2GSQ A;  4WR5 A;  3UVT A;  1GSY A;  4N10 A;  2KP2 A;  16GS A;  4BVX B;  1T8E B;  2V6O A;  1A8L A;  2CX3 A;  1PN9 A;  3FR9 A;  5D9V A;  1M3J A;  4ECI A;  2V2G A;  4KE3 A;  5EVO A;  2VOC A;  1W4V A;  4YH2 A;  2JU5 A;  1E2Y A;  1QK8 A;  2H19 A;  1GUL A;  2N5A A;  2VCX A;  1A2J A;  1M2A A;  4POM A;  3IHQ A;  5AGY A;  2C0D A;  2PWJ A;  2AJQ B;  4BWQ A;  1ZZY A;  3EMP A;  5C00 A;  1AC1 A;  1SD8 A;  1XWB A;  1Z7R A;  4XRA A;  1MTC A;  4BVX A;  1TU7 A;  1EGO A;  3PR8 A;  5IPG A;  4ECC A;  5B8A A;  1PL2 A;  3GTU B;  2HRA A;  4HDE A;  2B7J A;  2YN1 A;  3TKS C;  1ZL9 A;  5GAP D;  4KCE A;  3M1G A;  3M8N A;  2OBK A;  3ZLP A;  1ACV A;  2DJ0 A;  1X5C A;  4IVF A;  4KSO A;  2L5L A;  1GTB A;  1EOG A;  4ACS A;  1ZGN A;  3IHG A;  4K6X A;  3H4K A;  2HSM A;  3FR6 A;  3BCI A;  1KEB A;  2IPA A;  5G2Z A;  3M9J A;  2KOK A;  2JAD A;  1MDJ A;  3IDV A;  4OO5 A;  4IQ1 A;  1AXD A;  3K8N A;  1G7O A;  4OFN A;  3GTU A;  5E59 A;  3ERW A;  2KP1 A;  2F8A A;  3CSJ A;  1ERW A;  1XFL A;  1F6M C;  1LU4 A;  3Q74 A;  2MBT A;  5ECH B;  2LRC A;  3IAM 2;  5HQP A;  2YV7 A;  4ZB6 A;  4ZB9 A;  5IMC A;  3VWW A;  1TRW A;  3LFL A;  2B5X A;  1Z3E A;  2NBS A;  1S3A A;  5F8B A;  4HQZ A;  1O8W A;  3CTF A;  3GMF A;  4OMV A;  3TCO A;  3HZ4 A;  4G0L A;  4PQI A;  2VL2 C;  3TDG A;  4LL1 B;  2X99 A;  1J08 A;  6GSW A;  2NPB A;  3EIN A;  1V2A A;  1HD2 A;  2YCD A;  2VCQ A;  2WCI A;  1SU9 A;  2BTO T;  1XWG A;  2JSZ A;  3CRU A;  2L6C A;  2B3S A;  1BED A;  1EV9 A;  5HFG A;  5G5E A;  5IM9 A;  4MAB A;  4JR6 A;  19GS A;  3ZML A;  3P7X A;  1BG5 A;  3GFK A;  1CQG A;  4EVM A;  2YJ7 A;  2HSH A;  4DSS B;  1SEN A;  2NVL A;  2QGV A;  1GH2 A;  2CVD A;  2K8V A;  4PX1 A;  2AHE A;  1SL0 B;  2PVO C;  4O7H A;  2CT6 A;  3RHB A;  2C0F A;  4IS0 A;  2J23 A;  2VM1 A;  3L0H A;  2B6M A;  3FK8 A; 
#chains in the Genus database with same CATH homology
 4YAP A;  1X5D A;  3ZRD A;  2HRN A;  1TRU A;  2HRF A;  3L9S A;  2JZS A;  2I3Y A;  1M99 A;  3H93 A;  3HA9 A;  4MPF A;  1GUM A;  3HVS A;  4NHZ A;  1VGL A;  2H0G A;  1EWX A;  2O89 A;  4MZW A;  3W6G A;  3VWV A;  3EMX A;  2QSI A;  4G9H A;  3R3E A;  5H5S A;  5H5Q A;  4Q5N A;  4DSS A;  3DVX A;  3IAS 2;  5KN0 A;  4IN0 A;  3GKX A;  3S9F A;  2WRT A;  3UEM A;  3TRX A;  4GXZ A;  1X9W B;  2KLX A;  2A4V A;  2OE1 A;  2JZT A;  2A2P A;  1XXU A;  5J3R A;  3EWL A;  3QPM A;  4XRD A;  3U6V A;  2IMI A;  1GSF A;  2XHF A;  1FG4 A;  3UVH A;  6GSU A;  3QFB C;  1B8X A;  1GL8 A;  1XWA A;  3DYR A;  4CDO A;  5CNW A;  1RW1 A;  2O87 A;  1PA3 A;  3GH9 A;  2I81 A;  2R0P A;  2UZ8 A;  1K3O A;  2DJ1 A;  4MH3 A;  4WXT A;  2CAI A;  5JWR B;  4JE1 A;  2EIO A;  5A4W A;  4MZC A;  4KAE A;  1OVN A;  4MCU A;  2IMD A;  1FHE A;  20GS A;  2GST A;  2FCH A;  3IBH A;  3KCM A;  1JZO A;  1SK0 A;  3HJM A;  5B6M A;  5HR3 A;  5J9B A;  1GWC A;  4G0K A;  2I4A A;  4K0N A;  1V57 A;  3N5O A;  1U3A A;  4L0U A;  5IO0 A;  2C3N A;  1O6J A;  2GLR A;  2GTU A;  2XBI A;  3GH6 A;  3ZRE A;  4K2X A;  3VUR A;  1H75 A;  3MYD A;  5ECK B;  1XVW A;  3A2W A;  3TRQ A;  1OAZ A;  2YZU A;  1SKR B;  3GV1 A;  4K5S A;  1HNB A;  4EE0 A;  3ZVJ D;  1PQN A;  3HHV A;  4K5R A;  1URM A;  4YQM A;  1B9Y C;  4F0C A;  2V32 A;  4XIH A;  11GS A;  4HS1 A;  4LA1 A;  5COH A;  1V9W A;  1GLQ A;  1ZYP A;  3MIX A;  1IYH A;  4TW5 A;  1WE0 A;  2V41 A;  4K1F A;  5GZZ B;  1EP7 A;  2RLI A;  1H4O A;  2OJL A;  1GRX A;  1R26 A;  1FVJ A;  5IMZ A;  3VFI A;  4GST A;  2LUS A;  1CQH A;  2H1A A;  1K3L A;  4V2L A;  1ERV A;  1W89 A;  3O6T A;  3J7Y k;  2XPD A;  2HFD A;  1A8Y A;  1SD9 A;  1PRX A;  5ECI B;  3FHK A;  2BJX A;  1Z9H A;  1A0F A;  1WRY A;  5A4V A;  3MNG A;  3KP8 A;  2H1G A;  1THX A;  3ZYW A;  1WP0 A;  1E6B A;  1SKS B;  1Q4J A;  1VF2 A;  4WF5 A;  3CSH A;  3ZTL A;  4O5R A;  2P5R A;  3RBT A;  4TR3 A;  3DWV A;  1TJD A;  4QL9 A;  8GSS A;  5KOW A;  2H76 A;  3O3T A;  1JZR A;  5CO3 A;  4KCA A;  6GSS A;  2X64 A;  2VAF A;  5AIX A;  4LLR A;  3Q19 A;  3UIW A;  2E7P A;  1YJ6 A;  4WET A;  2B7K A;  2PPT A;  4Z2R A;  3ZFL A;  4F2I A;  3HZ8 A;  3TJB A;  4AJ8 A;  2E0Q A;  2ALB A;  5HR0 A;  2M80 A;  18GS A;  4EO3 A;  4OCF A;  3LXZ A;  4TR1 B;  2R3X A;  5DQS A;  3APQ A;  2O8V B;  3IC8 A;  2ES7 A;  3FKF A;  4FQU A;  1IYI A;  2H1B A;  5A5K A;  2GT6 A;  5DCH A;  2KHP A;  6GSV A;  3BJ5 A;  4K8M A;  2IIY A;  3KH7 A;  3LW9 A;  2YWO A;  5FWG A;  2PUK C;  1QUW A;  1G6Y A;  1X0R A;  1XW9 A;  3MAK A;  2WDU A;  4ECJ A;  1AIU A;  3BBY A;  2HZE B;  3P90 A;  5B8B A;  4K7O A;  4TR1 A;  3A2X A;  2VO4 A;  5G31 A;  2CVB A;  1XZO A;  5F07 A;  2H73 A;  1F3B A;  2HT9 A;  1OKT A;  3AY8 A;  5D96 A;  2IMF A;  1J0F A;  2WJU A;  4NPB A;  3TUE A;  5CRD A;  2GSR A;  5D8I A;  2IWT A;  2DJK A;  3VWU A;  4DVC A;  5G30 A;  3I43 A;  2H6X A;  4XS4 B;  4MPG A;  1QQ2 A;  2ZUP A;  4ZBA A;  1Z5Y E;  1GSQ A;  1YEP A;  2MMN A;  3ZL5 A;  1I5G A;  4PTS A;  13GS A;  4I2U A;  3BCK A;  1XWK A;  2FWG A;  4L5L A;  3A2V A;  3FZA A;  1SJZ A;  2HZE A;  4ZXG A;  2QKE A;  2FY6 A;  4RUV A;  4MJC A;  3KGK A;  3SBC A;  1WPI A;  2BMX A;  3GX8 A;  2D2Z A;  3FYG A;  1XWC A;  3QDN A;  2VIM A;  1Z6M A;  2K6V A;  1QMV A;  2E2G A;  2LKU A;  5J9C A;  4MH2 A;  1Q98 A;  4PQ1 A;  2PGT A;  5AIV A;  1T1V A;  2YNX A;  4XS4 A;  2FGX A;  4X0X A;  4GQF A;  3CXG A;  2K8S A;  3FZ9 A;  1N8J A;  3GA4 A;  1PX6 A;  5ECQ B;  5CRG A;  2GDR A;  2A2R A;  3EE2 A;  2HRK A;  2GVP A;  4I8B A;  4O32 A;  4MJB A;  1U87 A;  4USS A;  4G2E A;  1QGV A;  1TP9 A;  2ZNM A;  3I6A A;  4GRF A;  3ZZX A;  2OAC A;  1O7U A;  1S3C A;  1MDI A;  4ILF A;  1JLV A;  4TR0 A;  1YKC A;  4KDU A;  1O85 A;  1XW6 A;  1V58 A;  2DIZ A;  2DJ3 A;  3LJR A;  2MBS A;  4GSN A;  3SWL A;  3DRN A;  2RM5 A;  1EZK A;  1V40 A;  1TK8 B;  2C8U A;  3UBK A;  1PKZ A;  5DBQ A;  3CSI A;  3DKS A;  4A5P A;  2YPM A;  3QFA C;  3Q18 A;  1GTA A;  4MF6 A;  4TXV A;  4TRX A;  2WB9 A;  3TKP A;  1FOH A;  3R2Q A;  4V1A g;  1JFU A;  5D9X A;  1R5P A;  1ZCP A;  3VI7 A;  1B48 A;  4LMW A;  2B5Y A;  1S3D A;  3HYP A;  1GP1 A;  4OCE A;  3UAR A;  2MYG A;  2CAQ A;  4FH8 A;  3ERG A;  4ZIJ A;  2G2Q A;  5IMV A;  3D6I A;  1OC8 A;  1TDI A;  4Z2U A;  2WGR A;  5G5F A;  3KZQ A;  2E2M A;  2CVK A;  2IFQ B;  4X43 A;  1T3B A;  2CZ3 A;  2JZR A;  4MZB A;  4F0B A;  4WEY A;  2I9H A;  4EIQ A;  4RQR A;  1OC3 A;  1EGR A;  2VLV A;  4O92 A;  3CRT A;  2C80 A;  3KM6 A;  4HJM A;  5LCZ A;  1ZMA A;  4ZBB A;  5DJL A;  22GS A;  4OFT A;  3QAG A;  3H1N A;  3EC3 A;  1FB6 A;  5CAX A;  3IR4 A;  2H0I A;  1G7E A;  2Z9S A;  7GSS A;  1FVK A;  5GAN D;  1A2L A;  4PXO A;  4K9Z A;  2F3M A;  4G0I A;  2L59 A;  3RHC A;  3EU4 A;  2H8L A;  3A5W A;  4ZL7 A;  2IFQ A;  1U3I A;  1K0N A;  1PKW A;  3HY2 A;  1X9S B;  3UL3 A;  4GTU A;  3WD6 A;  2DC5 A;  5ECN B;  5G1L A;  2FA8 A;  4PNG A;  4MA9 A;  1GSS A;  2C1Y A;  4AF2 A;  3KXO A;  3LOR A;  1LBK A;  2K18 A;  2RUF A;  3KP9 A;  1DSB A;  1KTE A;  5BMU A;  2WUL A;  1MD3 A;  1M7T A;  4G19 A;  4ZL9 A;  2AV4 A;  4O5U A;  2M72 A;  4D73 B;  3EYT A;  4QL7 A;  6GSX A;  4WF4 A;  1ABA A;  1GUK A;  1TI1 A;  1YF0 A;  2CQ9 A;  4YKF A;  5AN1 A;  1SYX A;  3APO A;  1XIY A;  3TJG A;  1ZOF A;  1GNW A;  1DBY A;  1XW5 A;  3DXB A;  3GNJ A;  1F3A A;  2FNO A;  2DLX A;  4KGI A;  4AJ7 A;  5KN3 A;  2X8H A;  4IBP A;  5HR2 A;  2MMO A;  4GCI A;  4J2F A;  3TKR A;  4G10 A;  2IME A;  2HNL A;  4PUF C;  1WJK A;  4HEA 2;  3F4R A;  3GKK A;  2I1U A;  4JU5 A;  4EF0 A;  2IL3 A;  4D73 A;  3IOS A;  5KN1 A;  1A23 A;  4WKW A;  1UA5 A;  1SYR A;  4V1A p;  1QXH A;  3ZMK A;  2PN8 A;  1QFN A;  4XS6 A;  4L8E A;  2L4C A;  2IMK A;  3I69 A;  5FT3 A;  4X4J A;  1YZX A;  3NIV A;  3F63 A;  2OAD A;  3EUR A;  2QC7 A;  4KND A;  1K0C A;  4IW9 A;  2V6K A;  3ME7 A;  3F3R A;  1TW9 A;  4K7I A;  3H8Q A;  3A5I A;  1RK4 A;  3ZIT A;  4F82 A;  5BRT A;  2OA7 A;  4ML6 A;  4I5Q A;  4KDX A;  4ICY A;  5ELA A;  3GN3 A;  5F0G A;  2TRX A;  3Q6O A;  1AQW A;  4E8E A;  5HFK A;  3D0Z A;  1R4W A;  5INY A;  4MMM A;  4XCS A;  2YWI A;  3F3Q A;  2L6D A;  4POL A;  3QR6 A;  2YV9 A;  3APS A;  3F6D A;  2LTK A;  2L57 A;  5DAK B;  3WT1 A;  4KH7 A;  3G7J A;  4HUA A;  2HE3 A;  4ULX A;  3VWX A;  4XTS A;  1AW9 A;  1X5E A;  4HZ4 A;  5CRW A;  4IP6 A;  4FYC A;  4NWY A;  4KW6 A;  3LEF A;  3GUS A;  5H5R A;  5ENU A;  2RM6 A;  2DKH A;  2PBJ A;  2HSY A;  2H70 A;  2C0G A;  2H75 A;  3D4T A;  1XPV A;  1VF4 A;  3ERF A;  1UN2 A;  4ISD A;  2YZH A;  3CMI A;  3F4T A;  3FMW A;  5DAK A;  4K7N A;  3TKS A;  2LNS A;  5IMF A;  2WS2 A;  5CP1 A;  1Z7P A;  1V98 A;  3C7M A;  17GS A;  1VF3 A;  4Z2T A;  4PUR A;  2RUE A;  4CY6 A;  2R0C A;  4MP4 A;  4FIW A;  4FO5 A;  2GZY A;  4HJ2 A;  2LS5 A;  3D4M A;  3TGZ A;  1PX7 A;  3RPP A;  1EEM A;  3JCM L;  3UOM A;  2F51 A;  4POB A;  2DSA A;  2FD3 A;  6GSY A;  3PPU A;  3L9U A;  2NTO A;  3HCZ A;  1FB0 A;  1FAA A;  3CTG A;  4J56 E;  3QAV A;  1B4P A;  1T00 A;  3ZIV A;  1XOB A;  2H1D A;  4GQC A;  1B4Q A;  1T4Y A;  4BPY A;  3ZFB A;  2PMT A;  5GSS A;  4AJ6 A;  4JRR A;  4LL4 B;  1KNG A;  5EL8 A;  5KOX A;  2X8C A;  5LNK e;  5ID2 B;  1YY7 A;  3HKR A;  3RPN A;  5FHI A;  3P8W A;  2R0G A;  1OE8 A;  5ABR A;  1EEJ A;  1F37 A;  2X4A A;  4I6X A;  5AIS A;  3KMN A;  2AAW A;  3KMO A;  2VL2 A;  1BYE A;  1AQX A;  3QOU A;  3GIX A;  3TJK A;  4IP1 A;  2VCV A;  1BQ7 A;  5JCW A;  4HZ2 A;  2OE3 A;  5DQY A;  1F9M A;  1MD4 A;  3FR3 A;  4ECB A;  1K0B A;  3DIE A;  5G1K A;  4KF9 A;  3NZN A;  2R4V A;  1DE1 A;  4EDY A;  3QCP A;  3TKS E;  5ID2 A;  2O7K A;  1EV4 A;  5ECL B;  4JED A;  3UBL A;  4MNN A;  4Q5R A;  3UAP A;  5IPH A;  2R5G A;  2LST A;  3ZVJ A;  3LSZ A;  5B6N A;  2ON7 A;  3W8S A;  1SKW B;  4GLT A;  10GS A;  1AUC A;  1GSD A;  3PGT A;  1FW1 A;  1G6W A;  1FOV A;  1Y25 A;  1TRS A;  3IXR A;  1XOA A;  2HZF A;  5IMA A;  5D9W A;  4MJA A;  4ZBD A;  1B9X C;  3WGE A;  3TB2 A;  1M2B A;  2RII A;  3GUR A;  3US3 A;  1SL2 B;  2H01 A;  3BD2 A;  2QA1 A;  3G9B A;  4HU9 A;  4JZQ A;  5J4U A;  1TK5 B;  1A2M A;  1PD2 1;  4V2M A;  4EL1 A;  3C1R A;  1K0A A;  2GZZ A;  3QMX A;  4DEJ A;  1DE2 A;  3HVX A;  1PN0 A;  4IGJ A;  2R6K A;  3DVW A;  4MK3 A;  3WYW A;  4KA0 A;  1GUH A;  2HI7 A;  1N2A A;  2OKA A;  2GZP A;  4EKZ A;  2WZ9 A;  3IK9 A;  1PGT A;  1AAZ A;  4OD7 A;  4IHU A;  1GNE A;  5L71 A;  4IEL A;  2V1M A;  2EC4 A;  2XPE A;  4YKG A;  3IV4 A;  1SL1 B;  3LGC A;  2H6Z A;  1ZYQ B;  3LYP A;  5DCG A;  5IOX A;  1K0M A;  1OE7 A;  2C4J A;  1J9B A;  3IRA A;  5F05 A;  1M0U A;  4DSR A;  1F2E A;  4ID0 A;  2AYT A;  5ECP B;  3MWH A;  3F4S A;  1K0O A;  3GL3 A;  1O8X A;  4N0V A;  5J41 A;  1Z6N A;  2B1L A;  2PU9 C;  2LJA A;  4RI6 A;  3C8E A;  2HYX A;  1ST9 A;  2DJJ A;  4MJE A;  1O81 A;  4ZIL A;  1FO5 A;  2MMA A;  2R2J A;  4WBJ A;  4BL7 B;  5JCG A;  1USB A;  3WT2 A;  4KX4 A;  2XBQ A;  3GST A;  1NHY A;  5DVB A;  3IPZ A;  9GSS A;  3ZIJ A;  3KEB A;  2FWH A;  2VD0 A;  4HU7 A;  1BX9 A;  3HD5 A;  1SK2 A;  1AQV A;  4IJI A;  2VCT A;  1T4Z A;  5ECS A;  3UMA A;  4CHS A;  3CBU A;  2LV3 A;  2LJK A;  2REM A;  3G7I A;  2LQQ A;  1EP8 A;  4YQU A;  2A2S A;  3GRX A;  5CYY A;  3C73 A;  4BL7 A;  2JL4 A;  2OBI A;  4NV5 A;  1O73 A;  2O85 A;  3ISO A;  4NHW A;  4P3Y B;  1TRV A;  3KJY A;  2GQK A;  4V2N A;  3TRP A;  4GWR A;  2AB6 A;  5KEJ A;  2X49 A;  1A24 A;  4MLY A;  1XVQ A;  4I2T A;  5IIZ A;  2IJY A;  1YKA A;  3M3M A;  2VD1 A;  2NDO A;  4EIP A;  2ON5 A;  1XBS A;  2CX4 A;  2DMM A;  5IMD A;  2X8G A;  5ECM B;  2LEG A;  3E3E A;  4N30 A;  3RAZ A;  5D73 A;  1GTI A;  2A4H A;  3TJJ A;  4MDC A;  3TKQ A;  1GSU A;  1TK0 B;  2VCZ A;  3NOF A;  4HI7 A;  1BJX A;  4DSQ A;  5ECR B;  2ZCT A;  2DIY A;  4PNF A;  1WOU A;  4Z7X A;  2LRN A;  4PQH A;  5DJM A;  1A0R P;  2DBC A;  2G0F A;  1R5A A;  1SJI A;  3GYK A;  5F06 A;  1WWJ A;  5B7C A;  5JCU A;  1NM3 A;  2L4Q A;  3LG6 A;  4HOJ A;  3I9V 2;  2EIQ A;  3IK7 A;  4OO4 A;  4F03 A;  2GQL A;  5EPF A;  2VM2 A;  2VUP A;  2YJH A;  4KUN A;  2K9F A;  3W8J A;  3BOA A;  4TR4 A;  2HLS A;  1TI3 A;  2VLT A;  2L5O A;  3LXT A;  3KTB A;  2YWN A;  4LMV A;  1ILO A;  4Q5F A;  1NSW A;  3D5J A;  3FRC A;  4FYB A;  4BA7 A;  3QD9 A;  1TKD B;  2J9H A;  5D9T A;  1R7H A;  2GT5 A;  3M0F A;  2LQO A;  1SK1 A;  4K0G A;  5HFI A;  4KB3 A;  5IQY A;  1YF1 A;  14GS A;  4EUY A;  2N5F A;  1UVZ A;  1HYU A;  1K0D A;  2H71 A;  3H79 A;  4CY8 A;  2CA8 A;  3TOU A;  2CZ2 A;  3ED3 A;  3D22 A;  5IO2 A;  2H0H A;  5JWO B;  2FWE A;  5A4U A;  4YQV A;  3PIN A;  3J7Y b;  5JWQ B;  3KD0 A;  1HNC A;  3GKN A;  4L5O A;  4XHM A;  2H72 A;  4IKH A;  3VPQ A;  4POK A;  2LJR A;  4PGT A;  5CRH A;  4RQX A;  3IA1 A;  2FLS A;  5IOW A;  2WFC A;  1RQM A;  3LQ7 A;  4PUA A;  4X1U A;  5C04 A;  1THO A;  4TKY A;  3GKM A;  3C1S A;  2XC2 A;  3WGX A;  1ERT A;  3E9J B;  1YDK A;  4L0W A;  3HDC A;  2MMZ A;  1WIK A;  3N9J A;  5E4W A;  3DD3 A;  1DUG A;  2H74 A;  2DML A;  4J57 E;  3DGQ A;  5GST A;  3HJO A;  4KSM A;  2C0E A;  1ERU A;  3F6F A;  2QA2 A;  5DDL A;  3FZ4 A;  2FUG 2;  4TOP A;  2IN3 A;  3FW2 A;  3VI5 A;  3TOT A;  3KTL A;  4EDZ A;  3VLN A;  2HXK A;  3KH9 A;  2FHE A;  3LWA A;  4BVY B;  1M9A A;  3OR5 A;  2H66 A;  4RI7 A;  3IC4 A;  4JBB A;  3GSS A;  3L78 A;  3MDK A;  3EU3 A;  2YAN A;  2YWM A;  4ZB8 A;  3VPT A;  1PL1 A;  4HQS A;  3FZ5 A;  1ZYN A;  1U6T A;  5D93 A;  1ON4 A;  1U88 A;  3GL5 A;  4XS1 A;  1JZD A;  2FA4 A;  2PER A;  3KIJ A;  4FYU A;  4ML1 A;  3V1W A;  1OYJ A;  2C3T A;  1OKD A;  1HQO A;  2TRC P;  3WGD A;  4EXJ A;  1YEX A;  2R37 A;  3HJP A;  2GS3 A;  4BVY A;  1MDK A;  1NHO A;  5ELG A;  1TXX A;  1GTU A;  1G0T A;  5ECO B;  5J5N A;  3F9U A;  4TN8 A;  2GQM A;  1M9B A;  3D21 A;  1SJ6 A;  4MF5 A;  3GX0 A;  1VRS D;  1X9M B;  5DAL B;  4E8H A;  12GS A;  2VLU A;  3IE3 A;  2P5Q A;  3FY7 A;  1T7P B;  1NW2 A;  4WBR D;  3DEX A;  3C71 A;  2GGT A;  1M2D A;  2F9S A;  1LJR A;  1TTZ A;  3GHA A;  2LRT A;  1ML6 A;  5HR1 A;  4MF7 A;  3EVI A;  3HVV A;  4AGS A;  5EY6 A;  3E0U A;  1GSE A;  3P2A A;  4IQA A;  5DAL A;  2FWF A;  1PMT A;  4I97 A;  1TOF A;  1OC9 B;  2EIR A;  1JZW A;  1GLP A;  4N11 A;  4IJ3 A;  1EOH A;  1XCC A;  2M46 A;  4OWY A;  2C3Q A;  2P31 A;  2F8F A;  3O76 A;  4OFM A;  2B1K A;  4GSS A;  3MSZ A;  1JHB A;  4F9Z A;  1VF1 A;  1WMJ A;  4TXO B;  2CV4 A;  1PSQ A;  3QAW A;  4Q5Q A;  2H30 A;  2N5B A;  1I9D A;  2JAC A;  3CYN A;  4NV2 A;  2VL3 A;  1KBN A;  4KDY A;  2DKI A;  1OC9 A;  4K2D A;  1MEK A;  3EPT A;  3A3T A;  3L4N A;  3PH9 A;  3F0I A;  3FEU A;  2VL9 A;  3M9K A;  4N0Z A;  4NAX A;  3TJF A;  3DML A;  2OE0 A;  6GST A;  4NXI A;  2DJ2 A;  2MZC A;  3L9V A;  2GSS A;  1UC7 A;  2P0G A;  3VK9 A;  1ZYE A;  4JR4 A;  4TVE A;  2AUV A;  3G7Y A;  4NMU A;  2LNT A;  4YAV A;  4TXO A;  3UJ1 A;  3U5R E;  4H86 A;  4QQ7 A;  4WR4 A;  3RDW A;  4EC0 A;  1YQ1 A;  4O5Q A;  3ME8 A;  1HNA A;  2B5E A;  4BWS A;  4CW9 A;  3HXS A;  2H6Y A;  3F8U A;  1JLW A;  1BAY A;  2KUC A;  2JSY A;  5KN2 A;  1K3Y A;  2VCW A;  4GF0 A;  2TIR A;  2YOI A;  3LYK A;  5CRE A;  1C72 A;  2PVQ A;  5LD0 A;  1TU8 A;  4ZL8 A;  2YP6 A;  1Y6E A;  2GSQ A;  4WR5 A;  3UVT A;  1GSY A;  4N10 A;  2KP2 A;  16GS A;  4BVX B;  1T8E B;  2V6O A;  1A8L A;  2CX3 A;  1PN9 A;  3FR9 A;  5D9V A;  4ECI A;  2V2G A;  4KE3 A;  5EVO A;  2VOC A;  1W4V A;  4YH2 A;  2JU5 A;  1E2Y A;  1QK8 A;  2H19 A;  1GUL A;  2N5A A;  2VCX A;  1A2J A;  1M2A A;  4POM A;  3IHQ A;  5AGY A;  2C0D A;  2PWJ A;  2AJQ B;  4BWQ A;  1ZZY A;  3EMP A;  5C00 A;  1AC1 A;  1SD8 A;  1XWB A;  1Z7R A;  4XRA A;  1MTC A;  4BVX A;  1TU7 A;  1EGO A;  3PR8 A;  5IPG A;  4ECC A;  5B8A A;  1PL2 A;  3GTU B;  2HRA A;  4HDE A;  2B7J A;  2YN1 A;  3TKS C;  1ZL9 A;  5GAP D;  4KCE A;  3M1G A;  3M8N A;  2OBK A;  3ZLP A;  1ACV A;  2DJ0 A;  1X5C A;  4IVF A;  4KSO A;  2L5L A;  1GTB A;  1EOG A;  4ACS A;  1ZGN A;  3IHG A;  4K6X A;  3H4K A;  2HSM A;  3FR6 A;  3BCI A;  1KEB A;  2IPA A;  5G2Z A;  3M9J A;  2KOK A;  2JAD A;  1MDJ A;  3IDV A;  4OO5 A;  4IQ1 A;  1AXD A;  3K8N A;  1G7O A;  4OFN A;  3GTU A;  5E59 A;  3ERW A;  2KP1 A;  2F8A A;  3CSJ A;  1ERW A;  1XFL A;  1F6M C;  1LU4 A;  3Q74 A;  2MBT A;  5ECH B;  2LRC A;  3IAM 2;  5HQP A;  2YV7 A;  4ZB6 A;  4ZB9 A;  5IMC A;  3VWW A;  1TRW A;  3LFL A;  2B5X A;  1Z3E A;  2NBS A;  1S3A A;  5F8B A;  4HQZ A;  1O8W A;  3CTF A;  3GMF A;  4OMV A;  3TCO A;  3HZ4 A;  4G0L A;  4PQI A;  2VL2 C;  3TDG A;  4LL1 B;  2X99 A;  1J08 A;  6GSW A;  2NPB A;  3EIN A;  1V2A A;  1HD2 A;  2YCD A;  2VCQ A;  2WCI A;  1SU9 A;  2BTO T;  1XWG A;  2JSZ A;  3CRU A;  2L6C A;  2B3S A;  1BED A;  1EV9 A;  5HFG A;  5G5E A;  5IM9 A;  4MAB A;  4JR6 A;  19GS A;  3ZML A;  3P7X A;  1BG5 A;  3GFK A;  1CQG A;  4EVM A;  2YJ7 A;  2HSH A;  4DSS B;  1SEN A;  2NVL A;  2QGV A;  1GH2 A;  2CVD A;  2K8V A;  4PX1 A;  2AHE A;  1SL0 B;  2PVO C;  4O7H A;  2CT6 A;  3RHB A;  2C0F A;  4IS0 A;  2J23 A;  2VM1 A;  3L0H A;  2B6M A;  3FK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...