1OC3A

Human peroxiredoxin 5
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
SAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXIREDOXIN 5
publication title Crystal Structure of a Dimeric Oxidized Form of Human Peroxiredoxin 5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 47
structure length 162
sequence length 162
chains with identical sequence B, C
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1oc3A00
3I9V2 1WJKA 1OKTA 3KD0A 2CZ2A 3J7Yb 2JU5A 1MDKA 1YF1A 3KP9A 2K9FA 1J9BA 4POKA 1GSSA 4WR4A 3EMPA 2JACA 1EOGA 2L5LA 2VCXA 3CTFA 2CX4A 5DQYA 3J7Yk 2L4CA 1OC9A 1SJIA 3HXSA 2WJUA 3EE2A 2PPTA 3CMIA 4POMA 1SYRA 3ZVJD 1A0FA 3GURA 4WETA 4BPYA 4RI6A 3U5RE 3C8EA 2YANA 5G31A 1GSYA 3V1WA 3WGDA 3U6VA 3FY7A 3C1SA 2L4QA 4KDXA 4ZL8A 2GZPA 1XW5A 3GUSA 4IHUA 3TJGA 3QAWA 2HSHA 5IIZA 1GL8A 5HR2A 3TOTA 3HVSA 4Q5NA 1U87A 4PUAA 4X0XA 4KUNA 2DMLA 1UVZA 4PURA 3A2VA 2ZUPA 1A2LA 2O89A 5KN2A 3F9UA 2KHPA 4OO5A 1FO5A 4OWYA 4YAVA 2MZCA 4POBA 1JLVA 1FVKA 2J23A 1GLQA 3GX0A 4WF4A 1GSQA 4FO5A 4K6XA 3IK7A 1ERTA 5INYA 4HZ4A 1TXXA 2P31A 1OAZA 4IQAA 1N2AA 1T4YA 5A4UA 4WF5A 4TXVA 2ZCTA 1GULA 2L5OA 3MWHA 4MPFA 2HZEB 2YPMA 4MZCA 1EEMA 1MD3A 3RAZA 1WPIA 2RUFA 1F6MC 1XBSA 4PNFA 3FR3A 5D93A 2H0IA 4YAPA 4I5QA 2JL4A 2YNXA 1SJ6A 3GL5A 6GSUA 3ZIJA 3GA4A 4ZB9A 4JEDA 2DIYA 5LNKe 5JCUA 1HD2A 2GGTA 5DVBA 4IGJA 2X99A 1ABAA 2BJXA 3L78A 2NVLA 1M2AA 1GUKA 2JADA 5C00A 4LLRA 2YWMA 4ISDA 5B6MA 5CNWA 2V1MA 1GLPA 5IOXA 2CVDA 5G5FA 3FW2A 3LJRA 3BD2A 4KCAA 4V1Ap 2OE0A 1B4QA 2KLXA 1ZYEA 4ULXA 4KW6A 2N5AA 4N0VA 4J2FA 4MK3A 1I5GA 1XWBA 1EP8A 3F3QA 4WKWA 2X64A 2GSRA 1T4ZA 2CV4A 1GTAA 2KP1A 2IPAA 2OADA 3UEMA 3VI7A 4TKYA 1WMJA 2NDOA 3E0UA 2BTOT 1USBA 2B5EA 1O73A 1Y25A 4DVCA 4PX1A 4KDUA 5KN1A 4AF2A 4LMVA 5DBQA 1R5AA 3ERFA 3WT2A 1XWKA 2OA7A 3ZTLA 3F3RA 6GSXA 2HE3A 4V2MA 2C0FA 4NWYA 1N8JA 5F07A 3IC4A 5J5NA 1QFNA 4O7HA 5KN3A 3EURA 3LORA 3VLNA 1A8YA 2PVQA 1T1VA 3ZVJA 1WP0A 4K9ZA 3CYNA 3TUEA 1OC9B 3G7IA 3LYPA 5CREA 11GSA 3M9KA 1WIKA 2XBQA 3W8JA 2B3SA 2DJJA 4AGSA 1SKSB 3HVXA 4ECCA 1O8XA 5G1LA 3QDNA 3GSTA 2H1DA 4MJAA 1X5EA 12GSA 2B6MA 4IKHA 2ALBA 4BWQA 1F3BA 1BEDA 5G30A 3KIJA 20GSA 4NXIA 2H71A 3A2WA 3KH7A 2LRTA 2FD3A 2YOIA 1TRSA 5AIVA 1TTZA 1ZZYA 2LUSA 2VLTA 4K0GA 3CTGA 5KEJA 3F4TA 3D5JA 1A23A 4IN0A 2VO4A 1JHBA 2A4VA 5IMVA 2WGRA 2HXKA 1J08A 5IOWA 2YV7A 3GRXA 1AUCA 1T00A 4KDYA 2GZYA 2NBSA 3JCML 4MF6A 1K0CA 6GSWA 4MCUA 4JBBA 2H19A 4Z7XA 3IRAA 5FWGA 1MTCA 2CAIA 2CVKA 2VCTA 3UAPA 2MYGA 1V58A 1ZYQB 1TK8B 1ERVA 4RI7A 4F0BA 5AISA 1X5CA 5ECSA 4EKZA 2FLSA 3AY8A 2D2ZA 2L59A 1O81A 2H01A 2P0GA 3BCIA 2J9HA 1TW9A 5ECQB 1ZL9A 1EZKA 3H79A 2EIRA 4ZL7A 1A0RP 1XZOA 4ML1A 2CT6A 3TKRA 4IP6A 1ST9A 3APSA 3TJBA 1UN2A 5ECHB 3QOUA 2VL9A 4L5OA 3GH9A 2DMMA 3RBTA 2E0QA 1M0UA 1F37A 1VF2A 1R7HA 3TRQA 5DCHA 3HZ8A 3TKSC 2DJ0A 3QAVA 2LEGA 4HUAA 1NM3A 1F3AA 1GRXA 1EOHA 3F6DA 1V40A 3ZFBA 4K7IA 4L0UA 4OFTA 19GSA 3UARA 3FZ5A 3N9JA 4QL9A 2FNOA 1FHEA 5LD0A 1U6TA 4AJ7A 1JLWA 3EWLA 2TRCP 2VL2A 4ZBBA 1YKAA 2C8UA 4MA9A 2PMTA 3ZRDA 3PH9A 14GSA 3K8NA 4YQUA 3ED3A 2F51A 1X9MB 4I2TA 2GSQA 3CBUA 3DKSA 3KGKA 3DGQA 4MMMA 4AJ8A 2KOKA 4MH2A 2CAQA 4HU7A 1XIYA 2RUEA 2MMNA 2H72A 1VF3A 4EXJA 1OYJA 3VWWA 3APOA 3LXTA 4OO4A 3HJMA 5J4UA 3LWAA 1PQNA 1B9YC 5F06A 3KJYA 3O6TA 1FAAA 5F8BA 2DLXA 3UBKA 2FWHA 2PU9C 2VCVA 3TJKA 3TKSA 1GP1A 4ECBA 1K0OA 4EDZA 4ZBAA 2ON5A 3TCOA 3RPNA 1F2EA 5A4VA 1UC7A 2WULA 3ZZXA 1G0TA 1Q4JA 3DRNA 4F0CA 4ECJA 1VF4A 5B7CA 2QSIA 1IYHA 3TRXA 1CQGA 1V9WA 4PNGA 1O7UA 4EL1A 2LTKA 3Q74A 2PVOC 5JCWA 3GMFA 3LXZA 4F2IA 4POLA 2N5FA 2IL3A 1TI1A 1JZWA 5DAKA 1U88A 2EIQA 1FB0A 5AN1A 5ENUA 2FA4A 1ML6A 3DXBA 4ZIJA 1AIUA 2I9HA 3QD9A 3ZITA 4F82A 3RHCA 2B5XA 3FRCA 4K1FA 5ID2A 3CSJA 1V57A 1F9MA 3D4TA 3Q18A 2M72A 4HJ2A 4V2NA 2MMAA 3H1NA 4NHWA 3C1RA 1AC1A 3F6FA 5D9VA 1OVNA 1NHYA 3SWLA 3WT1A 3WYWA 3US3A 1SKRB 2XBIA 3F4SA 1EP7A 5ELAA 1Z3EA 4GLTA 2OE1A 1WWJA 2RLIA 5ECNB 2FHEA 3IPZA 2O7KA 4XIHA 22GSA 5GZZB 4GQFA 3EU3A 2RM5A 1HNBA 3IK9A 2LNSA 3GTUA 1T8EB 1QK8A 3PGTA 1YEXA 1XVQA 3O76A 4DSSA 4OFNA 1KNGA 1TP9A 3M8NA 1TJDA 2C4JA 3GX8A 3CSHA 4ZILA 2I1UA 3VWXA 1TRUA 2C0GA 2VCQA 2IMEA 2R4VA 3L4NA 2C0EA 4EF0A 4HI7A 1EGOA 1TK0B 9GSSA 4YQVA 2YWNA 3QFAC 1NHOA 2VUPA 2IIYA 2E2MA 4HS1A 1QQ2A 2DJ2A 5DALA 2H73A 1QXHA 3F63A 3A5WA 5DCGA 5GAPD 2C3QA 3GIXA 3D0ZA 3DVXA 3CRUA 1K3YA 2KP2A 4XS4A 3P8WA 1Z6MA 4GSSA 1Y6EA 4JZQA 3FR6A 4TR0A 4EE0A 3RDWA 3GH6A 1T3BA 1XOAA 3DD3A 3EINA 1URMA 2VLVA 1BG5A 1DUGA 2YZUA 3E3EA 2G2QA 1K0NA 5CRGA 2H1BA 4N10A 5GSTA 1E6BA 2PN8A 2FCHA 3GKNA 1AXDA 2AAWA 4KGIA 5E59A 3ZFLA 3EMXA 3M1GA 1YY7A 2GDRA 5ECKB 1VF1A 3D22A 1K3LA 2CVBA 2YJHA 4I2UA 3UVTA 1X9WB 2CZ3A 2B5YA 3FYGA 3HY2A 4G9HA 1BYEA 1VRSD 4F03A 3VPQA 6GSVA 2JZSA 4NV5A 3H4KA 4N11A 3UJ1A 1OKDA 1GUMA 4TR4A 2H1AA 3PR8A 2XPDA 4MP4A 3FHKA 5COHA 4HEA2 2IN3A 2P5QA 3I6AA 3ZMLA 2B7JA 5L71A 4FYCA 2VCWA 4NPBA 5A4WA 1SL1B 2LJKA 4CW9A 4DSQA 1SYXA 4GRFA 2QKEA 4GCIA 3LFLA 1TI3A 1ZMAA 2KUCA 4L8EA 4YQMA 4ZB8A 5DAKB 4ZBDA 2C1YA 1Z9HA 2O85A 1RQMA 5IQYA 3OR5A 4KNDA 4MLYA 1B4PA 5JCGA 5E4WA 3FKFA 4TXOB 2H75A 3DIEA 1NSWA 1RW1A 2F8FA 2H66A 3GFKA 4MJEA 5ECLB 1FW1A 1XFLA 4OCFA 2WCIA 2C3NA 1GWCA 4PQHA 3TKSE 1SL0B 3VFIA 2JZRA 5DJLA 3QR6A 3KEBA 1W4VA 3IE3A 4K8MA 3UBLA 2FUG2 5ID2B 3I43A 5CRWA 1O85A 4HOJA 1DE1A 4KSOA 3MAKA 1U3IA 4JE1A 5CYYA 5EL8A 2O87A 1OE7A 4PQIA 5F0GA 3KM6A 2ZNMA 2VIMA 4FH8A 4HQZA 1HNAA 3LYKA 4DEJA 4WBRD 1KEBA 3VPTA 5JWRB 1GNWA 2V41A 4RUVA 3LEFA 2AHEA 2H0HA 1K0MA 2PGTA 2WZ9A 1SK1A 5HR0A 4Q5FA 3S9FA 3G7YA 2QGVA 5IMDA 1C72A 3GTUB 3WGXA 3HA9A 4DSSB 5JWQB 1VGLA 3G7JA 3UVHA 3MSZA 2B7KA 2IWTA 4MF5A 1PX6A 3GN3A 1PRXA 1XWGA 4MJCA 2QC7A 2VL2C 4XHMA 4TOPA 4WEYA 5DALB 2OKAA 3KMNA 2RIIA 3R2QA 2HZFA 2I4AA 3P7XA 3KXOA 4MZWA 5ECOB 2F8AA 3ME7A 2LKUA 5FHIA 4TR1A 3QCPA 5IM9A 4IQ1A 4XS4B 3KP8A 1YJ6A 4KE3A 5ECRB 1FVJA 2FA8A 3NIVA 1HQOA 4BL7A 5J41A 4TR3A 1J0FA 3IOSA 4K7OA 1Z6NA 2K8VA 4XCSA 2FGXA 2R2JA 3HVVA 1EV4A 5CRHA 2F3MA 1GTIA 2GSTA 4NV2A 1K0DA 1TK5B 4BWSA 2R3XA 2NTOA 2H6XA 2LNTA 1YEPA 2B1KA 2H8LA 2VCZA 2P5RA 5D9TA 2VOCA 3QMXA 1OE8A 5ECIB 3UIWA 5LCZA 1XVWA 2X8GA 3IDVA 4CHSA 3GKKA 1GSEA 4BA7A 7GSSA 1YF0A 3H8QA 1A24A 4N30A 3RHBA 3EU4A 2OACA 1FG4A 3L9SA 1M9AA 3QFBC 5IMCA 2GT6A 3DYRA 4HJMA 2IMFA 3LSZA 2IMKA 2M80A 3Q19A 4PXOA 1EWXA 2IMIA 4JR4A 5HR3A 2XPEA 1O8WA 2JSZA 3TDGA 5G1KA 4OCEA 4KA0A 5IPHA 4FIWA 1XW6A 4MABA 3FZAA 2GLRA 4MPGA 1V98A 3ZREA 5EY6A 1Q98A 3L9UA 2YWIA 2V32A 4AJ6A 1HYUA 4ZXGA 3N5OA 4KSMA 1TU8A 4X1UA 1H75A 1ERWA 2DSAA 4GSNA 2TIRA 1XOBA 3EYTA 3VURA 2AJQB 3CSIA 1UA5A 5DQSA 1K3OA 1YZXA 3A3TA 2CX3A 2XC2A 4NMUA 5AGYA 1MDIA 4LL4B 1B8XA 10GSA 4XRAA 2DJ3A 3UOMA 2HFDA 1GSDA 5EPFA 1A2JA 4MJBA 3HKRA 4E8HA 2YV9A 1THXA 1AAZA 4BVXA 2HYXA 4NHZA 1QGVA 4PUFC 3D6IA 3ISOA 2E7PA 3IBHA 2O8VB 2IFQA 5DDLA 3IHQA 2V2GA 4L0WA 5D96A 3CRTA 3LG6A 2X8CA 1G7EA 5IMZA 2JSYA 1TRWA 3BCKA 4IJIA 4HZ2A 2GQLA 6GSYA 4GWRA 1ERUA 1GTUA 3P2AA 4V2LA 5IPGA 3BBYA 1R26A 4GF0A 1LBKA 1PMTA 1XPVA 1YQ1A 2BMXA 4TXOA 3DVWA 3GL3A 1QMVA 3ZLPA 1R4WA 1SJZA 3TGZA 4EC0A 1TOFA 1Z5YE 3DMLA 2NPBA 4K0NA 4TW5A 1LJRA 3FZ9A 2VAFA 1PKWA 4O92A 3MNGA 1V2AA 3VWVA 2V6KA 4WXTA 2FWGA 4FYBA 3EC3A 1K0BA 3HD5A 4D73A 5J3RA 2L6DA 1WOUA 4DSRA 1Z7RA 2HI7A 1GSFA 4MDCA 2H6YA 4PGTA 4CDOA 2LQOA 2YN1A 3I69A 2DBCA 1ILOA 3HCZA 3P90A 3EVIA 2XHFA 3MDKA 1ACVA 2IMDA 1M99A 4TR1B 4K2DA 2VD0A 1TRVA 3TKQA 2I81A 1ON4A 3KZQA 1LU4A 4Q5QA 5CP1A 2AYTA 2FWFA 3KTLA 4OFMA 1W89A 5IMFA 1M2BA 4TRXA 3FZ4A 3NZNA 1A2MA 2R37A 1WRYA 1OC8A 4X43A 2JZTA 4RQXA 3FK8A 3E9JB 4ZL9A 2C0DA 1XWAA 2VLUA 1XCCA 3GV1A 4ML6A 3TKPA 3IAS2 1BJXA 5H5SA 1PN9A 1B9XC 1YKCA 1PKZA 1SU9A 4K7NA 1G7OA 2MMOA 1EV9A 2TRXA 3VI5A 4ACSA 3ZYWA 3IXRA 4JRRA 5CAXA 3QPMA 2DC5A 5H5QA 5A5KA 2LV3A 1X0RA 3CXGA 3SBCA 3GSSA 3A2XA 5D9XA 1JZOA 3VWUA 1O6JA 4ECIA 2DIZA 4E8EA 4Q5RA 1GTBA 4J57E 2WS2A 6GSTA 2H74A 1KTEA 1X5DA 2PUKC 4P3YB 4F9ZA 4ZB6A 2AUVA 2FY6A 2MBTA 4J56E 5D8IA 3F0IA 1TU7A 1HNCA 2F9SA 3VK9A 3L9VA 5AIXA 2GQKA 4G2EA 3WGEA 2YJ7A 1YDKA 3IR4A 3M9JA 2C3TA 4HDEA 5HR1A 4I6XA 2R5GA 4LMWA 3LQ7A 5GAND 5J9CA 3ERWA 5G2ZA 2PERA 2AB6A 4GSTA 3GKXA 2YCDA 1H4OA 2GZZA 1BAYA 1MDJA 3UL3A 1SK0A 4XS1A 1NW2A 3KTBA 2AV4A 1PL2A 1PGTA 3TJJA 5IO0A 1TKDB 2IFQB 4ID0A 3DWVA 2GS3A 2N5BA 4NAXA 4HQSA 3F8UA 5C04A 2YP6A 1Z7PA 4IJ3A 5FT3A 2L6CA 3HJOA 2H1GA 2L57A 2H0GA 4IS0A 2LSTA 3W8SA 4MF7A 5IO2A 1G6WA 4QL7A 2K8SA 4MH3A 2RM6A 2K6VA 2LQQA 2WRTA 3TB2A 1DBYA 4KH7A 3TJFA 2GT5A 3W6GA 1G6YA 5JWOB 3HJPA 1XXUA 3APQA 1FOVA 3HYPA 2YZHA 1XW9A 4D73B 5HFGA 2E2GA 1AW9A 1GH2A 1GUHA 2K18A 3TRPA 3F4RA 2DJ1A 1DE2A 2HT9A 2H76A 5CO3A 1SK2A 4TN8A 2IJYA 1FB6A 1PL1A 4N0ZA 3O3TA 1EGRA 4MZBA 1OC3A 4I8BA 3G9BA 1MD4A 16GSA 4KCEA 1R5PA 4O5RA 4O32A 2GQMA 5ECMB 6GSSA 2MBSA 4GQCA 2LJRA 2PBJA 5GSSA 1SKWB 3KMOA 2X8HA 2CA8A 3D21A 2PWJA 2LS5A 4LL1B 2LRCA 4YH2A 1SL2B 3C7MA 2GSSA 1PA3A 4EUYA 3GHAA 2CQ9A 4XRDA 2VL3A 1PSQA 1M7TA 1BX9A 2OJLA 2LJAA 2B1LA 4WBJA 2HLSA 4HU9A 2M46A 2LRNA 3ERGA 5B8BA 1GSUA 2EC4A 3PINA 3ZIVA 3TOUA 2R6KA 2H30A 2GTUA 1CQHA 4LA1A 1I9DA 3ZMKA 5B8AA 1THOA 2Z9SA 1KBNA 2GVPA 3ME8A 4L5LA 1PD21 5G5EA 1QUWA 1JFUA 1E2YA 5F05A 5D9WA 4G10A 5B6NA 3KCMA 2HSYA 4FYUA 3Q6OA 4I97A 4IW9A 4JR6A 2VD1A 1X9SB 4ILFA 4V1Ag 1IYIA 1S3AA 4IBPA 1T7PB 4JU5A 3FR9A 1AQXA 2OBIA 2WB9A 2V6OA 5KN0A 1ZGNA 1PX7A 4XS6A 3C73A 3IAM2 2DJKA 2ON7A 5D73A 2G0FA 1DSBA 4KB3A 2FWEA 3IA1A 3HZ4A 1JZRA 4IVFA 4IELA 5ELGA 3C71A 2OE3A 2HZEA 2MMZA 1SD8A 1AQWA 4BVYA 5DJMA 5HFIA 4EO3A 5CRDA 2HNLA 2WDUA 3QAGA 1M2DA 5HFKA 1ZCPA 3D4MA 3LGCA 2REMA 5H5RA 1SENA 5ECPB 4IP1A 1K0AA 5ABRA 4H86A 3GKMA 1WE0A 1AQVA 3GYKA 1MEKA 4KAEA 2HRNA 2OBKA 3BOAA 1U3AA 3FEUA 3H93A 2C80A 5EVOA 1ZOFA 2H6ZA 4GXZA 1TDIA 1GNEA 2VM1A 4RQRA 3UMAA 2WFCA 3HDCA 3M3MA 3L0HA 4OD7A 4EDYA 1JZDA 3DEXA 4QQ7A 1S3CA 4KX4A 5IMAA 2EIOA 1BQ7A 13GSA 2A2SA 4WR5A 3KH9A 5HQPA 2I3YA 2H70A 2A2RA 17GSA 2ES7A 4EVMA 1A8LA 4PQ1A 2HRFA 1EEJA 1RK4A 4G19A 3HHVA 1B48A 5J9BA 4XTSA 1M9BA 3GNJA 2VM2A 3BJ5A 3WD6A 4OMVA 3IV4A 1S3DA 3NOFA 4GTUA 18GSA 4TVEA 3M0FA 1SD9A 1XWCA 3RPPA 8GSSA 3ZL5A 2YWOA
chains in the Genus database with same CATH superfamily
3I9V2 1WJKA 1OKTA 3KD0A 2CZ2A 3J7Yb 2JU5A 1MDKA 1YF1A 3KP9A 2K9FA 1J9BA 4POKA 1GSSA 4WR4A 3EMPA 2JACA 1EOGA 2L5LA 2VCXA 3CTFA 2CX4A 5DQYA 3J7Yk 3IC8A 2L4CA 1OC9A 1SJIA 3HXSA 2WJUA 3EE2A 2PPTA 3CMIA 4POMA 1SYRA 3ZVJD 1A0FA 3GURA 4WETA 4BPYA 4RI6A 3U5RE 3C8EA 2YANA 5G31A 1GSYA 3V1WA 3WGDA 3U6VA 3FY7A 3C1SA 2L4QA 4KDXA 4ZL8A 2GZPA 1XW5A 3IHGA 2R0PA 3GUSA 4IHUA 3TJGA 3QAWA 2HSHA 5IIZA 1GL8A 5HR2A 3TOTA 3HVSA 4Q5NA 1U87A 4PUAA 4X0XA 4KUNA 2DMLA 1UVZA 4PURA 4MNNA 3A2VA 2ZUPA 1A2LA 2O89A 2A4HA 5KN2A 3F9UA 2KHPA 4OO5A 1FO5A 4OWYA 4YAVA 2MZCA 4POBA 3EPTA 1JLVA 1FVKA 2J23A 1GLQA 3GX0A 4Z2RA 4WF4A 1GSQA 4FO5A 4K6XA 3IK7A 1ERTA 5INYA 4HZ4A 1TXXA 2P31A 1OAZA 4IQAA 1N2AA 4YKGA 1T4YA 5A4UA 4WF5A 4TXVA 2ZCTA 1GULA 2L5OA 3MWHA 4MPFA 2HZEB 2YPMA 4FQUA 4MZCA 1EEMA 1MD3A 3RAZA 1WPIA 4BVYB 2RUFA 1F6MC 1XBSA 2R0CA 4PNFA 3FR3A 5D93A 2H0IA 4YAPA 4I5QA 2JL4A 2YNXA 1SJ6A 3GL5A 6GSUA 3ZIJA 3GA4A 4ZB9A 4JEDA 2DIYA 5LNKe 5JCUA 1HD2A 2GGTA 5DVBA 4IGJA 2X99A 1ABAA 2BJXA 3L78A 2NVLA 1M2AA 1GUKA 2JADA 5C00A 4LLRA 2YWMA 4ISDA 5B6MA 5CNWA 2V1MA 1GLPA 5IOXA 2CVDA 5G5FA 3FW2A 3LJRA 3BD2A 4KCAA 4V1Ap 2OE0A 1B4QA 2KLXA 1ZYEA 2HRKA 4ULXA 4KW6A 2N5AA 4N0VA 4J2FA 4MK3A 1I5GA 1XWBA 1EP8A 3F3QA 4WKWA 2X64A 2GSRA 1T4ZA 2CV4A 1GTAA 2KP1A 2IPAA 2OADA 3UEMA 3VI7A 4TKYA 1WMJA 2NDOA 3E0UA 2HRAA 2BTOT 1USBA 2B5EA 1O73A 1Y25A 4DVCA 4PX1A 4KDUA 5KN1A 4AF2A 4LMVA 5DBQA 1R5AA 3ERFA 3WT2A 1XWKA 2OA7A 3ZTLA 3F3RA 6GSXA 2HE3A 4V2MA 2C0FA 4NWYA 1N8JA 5F07A 3IC4A 5J5NA 1QFNA 4O7HA 5KN3A 3EURA 3LORA 3VLNA 1A8YA 2PVQA 1T1VA 3ZVJA 1WP0A 1ZYPA 4K9ZA 3CYNA 3TUEA 1OC9B 3G7IA 3LYPA 5CREA 11GSA 3M9KA 1WIKA 2XBQA 3W8JA 2B3SA 2DJJA 4AGSA 1SKSB 3HVXA 4ECCA 1O8XA 5G1LA 3QDNA 3GSTA 2H1DA 4MJAA 1X5EA 12GSA 2HSMA 2B6MA 4IKHA 2ALBA 4BWQA 1F3BA 1BEDA 5G30A 3KIJA 20GSA 4NXIA 2H71A 3A2WA 3KH7A 2LRTA 2FD3A 2YOIA 1TRSA 5AIVA 1TTZA 1ZZYA 2LUSA 2VLTA 2R0GA 4K0GA 3CTGA 5KEJA 4ICYA 3F4TA 3D5JA 1A23A 4IN0A 2VO4A 1JHBA 2A4VA 5IMVA 2WGRA 2HXKA 1J08A 5IOWA 2YV7A 3GRXA 1AUCA 1T00A 4KDYA 2GZYA 2NBSA 3JCML 4MF6A 1K0CA 6GSWA 4MCUA 4JBBA 3R3EA 2H19A 4Z7XA 3IRAA 5FWGA 1MTCA 2CAIA 2CVKA 2VCTA 3UAPA 2MYGA 1V58A 1ZYQB 1TK8B 1ERVA 4RI7A 4F0BA 5AISA 1X5CA 5ECSA 4EKZA 2FLSA 3AY8A 2D2ZA 2L59A 1O81A 2H01A 2P0GA 3BCIA 2J9HA 1TW9A 5ECQB 1ZL9A 1EZKA 3H79A 2EIRA 4ZL7A 1A0RP 1XZOA 4ML1A 2CT6A 3TKRA 4IP6A 1ST9A 3APSA 3TJBA 1UN2A 5ECHB 3QOUA 2VL9A 4L5OA 3GH9A 2DMMA 3RBTA 2E0QA 1M0UA 1F37A 1VF2A 1PFOA 1R7HA 3TRQA 5DCHA 3HZ8A 3TKSC 2DJ0A 3QAVA 2LEGA 4HUAA 1NM3A 1F3AA 1GRXA 3FMWA 1EOHA 3F6DA 1V40A 3ZFBA 4K7IA 4L0UA 4OFTA 19GSA 3UARA 3FZ5A 3N9JA 4QL9A 2FNOA 1FHEA 5LD0A 1U6TA 4AJ7A 4EIQA 1JLWA 3EWLA 2TRCP 4G0IA 2VL2A 4ZBBA 1YKAA 2C8UA 4MA9A 2PMTA 3ZRDA 3PH9A 14GSA 3K8NA 4YQUA 3HVNA 3ED3A 2F51A 1X9MB 4I2TA 2GSQA 3CBUA 3DKSA 3KGKA 3DGQA 4MMMA 4AJ8A 2KOKA 4MH2A 2CAQA 4HU7A 1XIYA 2RUEA 2MMNA 2H72A 1VF3A 4EXJA 1OYJA 3VWWA 3APOA 3LXTA 4OO4A 3HJMA 5J4UA 3LWAA 1PQNA 1B9YC 5F06A 3KJYA 3O6TA 1FAAA 5F8BA 2DLXA 3UBKA 2FWHA 2PU9C 2VCVA 3TJKA 3TKSA 1GP1A 4ECBA 1K0OA 4EDZA 4ZBAA 2ON5A 3TCOA 3RPNA 1F2EA 5A4VA 1UC7A 2WULA 3ZZXA 1G0TA 1Q4JA 3DRNA 4F0CA 4ECJA 1VF4A 5B7CA 2QSIA 1IYHA 3TRXA 1CQGA 1V9WA 4PNGA 1O7UA 4EL1A 2LTKA 3Q74A 2PVOC 5JCWA 3GMFA 3LXZA 4F2IA 4POLA 2N5FA 2IL3A 1TI1A 1JZWA 5DAKA 1U88A 2EIQA 1FB0A 5AN1A 5ENUA 2FA4A 1ML6A 3DXBA 4ZIJA 1AIUA 2I9HA 3QD9A 3ZITA 4F82A 3RHCA 2B5XA 3FRCA 4K1FA 5ID2A 3CSJA 1V57A 1F9MA 3D4TA 3Q18A 2M72A 4HJ2A 4V2NA 2MMAA 3H1NA 4NHWA 3C1RA 1AC1A 3F6FA 5D9VA 1OVNA 1NHYA 3SWLA 3WT1A 3WYWA 3US3A 1SKRB 2XBIA 3F4SA 1EP7A 5ELAA 1Z3EA 4GLTA 2OE1A 1WWJA 2RLIA 1M3JA 5ECNB 2DKIA 2FHEA 3IPZA 2O7KA 4XIHA 22GSA 5GZZB 4GQFA 3EU3A 2RM5A 1HNBA 3IK9A 4HSCX 2LNSA 3GTUA 1T8EB 1QK8A 3PGTA 1YEXA 1XVQA 3O76A 4DSSA 4OFNA 1KNGA 1TP9A 3M8NA 1TJDA 2C4JA 3GX8A 3CSHA 4ZILA 2I1UA 3VWXA 1TRUA 2C0GA 2VCQA 2IMEA 2R4VA 3L4NA 2C0EA 4EF0A 4HI7A 1EGOA 1TK0B 9GSSA 4YQVA 2YWNA 3QFAC 1NHOA 2VUPA 2IIYA 2E2MA 4HS1A 1QQ2A 4O5QA 2DJ2A 5DALA 2H73A 1QXHA 3F63A 3A5WA 5DCGA 5GAPD 2C3QA 3GIXA 3D0ZA 3DVXA 3CRUA 1K3YA 2KP2A 4XS4A 3P8WA 1Z6MA 4GSSA 1Y6EA 4JZQA 3FR6A 4TR0A 4EE0A 3RDWA 3GH6A 1T3BA 5BMUA 1XOAA 3DD3A 3EINA 1URMA 2VLVA 1BG5A 1DUGA 2YZUA 3E3EA 2G2QA 1K0NA 5CRGA 2H1BA 4N10A 5GSTA 1E6BA 2PN8A 4X4JA 2FCHA 3GKNA 1AXDA 2AAWA 4KGIA 5E59A 3ZFLA 3EMXA 3M1GA 4BIKA 1YY7A 2GDRA 5ECKB 1VF1A 3D22A 1K3LA 2CVBA 2YJHA 4I2UA 3UVTA 1X9WB 2CZ3A 2B5YA 3FYGA 3HY2A 4G9HA 1BYEA 1VRSD 3CQFA 4F03A 3VPQA 6GSVA 2JZSA 4NV5A 3H4KA 5KOXA 4N11A 3UJ1A 1OKDA 1GUMA 4TR4A 2H1AA 3PR8A 2XPDA 4MP4A 3FHKA 5COHA 4HEA2 2IN3A 2P5QA 3I6AA 3ZMLA 2B7JA 5L71A 4FYCA 2VCWA 4NPBA 5A4WA 1SL1B 2LJKA 4CW9A 4DSQA 1SYXA 4GRFA 2QKEA 4GCIA 3LFLA 1TI3A 1ZMAA 2KUCA 4L8EA 4YQMA 4ZB8A 5DAKB 4ZBDA 2C1YA 1Z9HA 2O85A 1RQMA 5IQYA 3OR5A 4KF9A 4KNDA 4MLYA 1B4PA 5JCGA 5E4WA 3FKFA 4TXOB 2H75A 3DIEA 1NSWA 1RW1A 2F8FA 2H66A 3GFKA 4MJEA 5ECLB 1FW1A 3LW9A 1XFLA 4OCFA 2WCIA 2C3NA 1GWCA 4PQHA 3TKSE 1SL0B 3VFIA 2JZRA 5DJLA 3QR6A 3KEBA 1W4VA 3IE3A 4K8MA 3UBLA 2FUG2 5ID2B 3I43A 4PTSA 5CRWA 1O85A 4HOJA 1DE1A 4KSOA 3MAKA 1U3IA 4JE1A 5CYYA 5EL8A 2O87A 1OE7A 4PQIA 5F0GA 3KM6A 2ZNMA 2VIMA 1XG8A 4FH8A 4HQZA 1HNAA 3LYKA 4DEJA 4WBRD 1KEBA 3VPTA 5JWRB 1GNWA 2V41A 4RUVA 3LEFA 2AHEA 4YKFA 2H0HA 1K0MA 2PGTA 2WZ9A 1SK1A 5HR0A 4Q5FA 3S9FA 3G7YA 2QGVA 5IMDA 1C72A 3GTUB 3WGXA 3HA9A 4G0LA 4DSSB 5JWQB 1VGLA 3G7JA 3UVHA 3MSZA 1PN0A 2B7KA 2IWTA 4MF5A 1PX6A 3GN3A 1PRXA 1XWGA 4MJCA 2QC7A 2VL2C 4XHMA 4TOPA 4WEYA 5DALB 2OKAA 3KMNA 2RIIA 3R2QA 2HZFA 2I4AA 3P7XA 3KXOA 4MZWA 5ECOB 2F8AA 3ME7A 2LKUA 5FHIA 4TR1A 3QCPA 5IM9A 4IQ1A 4XS4B 3KP8A 1YJ6A 4KE3A 5ECRB 1FVJA 2FA8A 3NIVA 1HQOA 4BL7A 5J41A 4TR3A 1J0FA 3IOSA 4K7OA 1Z6NA 2K8VA 4XCSA 2FGXA 2R2JA 3HVVA 1EV4A 5CRHA 2F3MA 1GTIA 2GSTA 4NV2A 1K0DA 1TK5B 4BWSA 2R3XA 2NTOA 2H6XA 2LNTA 1YEPA 2B1KA 2H8LA 2VCZA 2P5RA 5D9TA 2VOCA 3QMXA 1OE8A 5ECIB 3UIWA 5LCZA 1XVWA 2X8GA 3IDVA 4CHSA 3GKKA 1GSEA 4BA7A 7GSSA 1YF0A 3H8QA 1A24A 4N30A 3RHBA 3EU4A 2OACA 1FG4A 3L9SA 1M9AA 3QFBC 5IMCA 2QA2A 2GT6A 3DYRA 4HJMA 2IMFA 3LSZA 2IMKA 2M80A 3Q19A 4PXOA 1EWXA 2IMIA 4JR4A 5HR3A 2XPEA 1O8WA 2JSZA 3TDGA 5G1KA 4OCEA 4KA0A 5IPHA 4FIWA 1XW6A 4MABA 3FZAA 2GLRA 4MPGA 1V98A 3ZREA 5EY6A 1Q98A 3L9UA 2YWIA 2V32A 4AJ6A 1HYUA 4ZXGA 3N5OA 4KSMA 1TU8A 4X1UA 1H75A 1ERWA 2DSAA 4GSNA 2TIRA 1XOBA 3PPUA 3EYTA 3VURA 2AJQB 3CSIA 1UA5A 5DQSA 1K3OA 1YZXA 3A3TA 2CX3A 2XC2A 4NMUA 5AGYA 1MDIA 4LL4B 1B8XA 10GSA 4XRAA 2DJ3A 3UOMA 2HFDA 1GSDA 5EPFA 1A2JA 4MJBA 3HKRA 4E8HA 2YV9A 1THXA 1AAZA 4BVXA 2HYXA 4NHZA 1QGVA 4PUFC 3D6IA 3ISOA 2E7PA 3IBHA 2O8VB 2IFQA 5DDLA 3IHQA 2V2GA 4L0WA 5D96A 3CRTA 2UZ8A 3LG6A 2X8CA 1G7EA 5IMZA 2JSYA 1TRWA 3BCKA 4IJIA 4HZ2A 2GQLA 6GSYA 4GWRA 1ERUA 1GTUA 3P2AA 4V2LA 5IPGA 3BBYA 1R26A 4GF0A 5KOWA 1LBKA 1PMTA 1XPVA 1YQ1A 2BMXA 4TXOA 3DVWA 3GL3A 1QMVA 3ZLPA 1R4WA 1SJZA 3TGZA 4EC0A 1TOFA 1Z5YE 3DMLA 2NPBA 4K0NA 4TW5A 1LJRA 3FZ9A 2VAFA 1PKWA 4O92A 3MNGA 1V2AA 3VWVA 2V6KA 4WXTA 2FWGA 4FYBA 3EC3A 1S3RA 1K0BA 3HD5A 4D73A 5J3RA 2L6DA 4O5UA 3MIXA 1WOUA 4DSRA 1Z7RA 2HI7A 1GSFA 4MDCA 2H6YA 4PGTA 4CDOA 2LQOA 2YN1A 2DKHA 3I69A 2DBCA 1ILOA 3HCZA 3P90A 3EVIA 2XHFA 3MDKA 4Z2TA 1ACVA 2IMDA 1M99A 4TR1B 4K2DA 2VD0A 1TRVA 3TKQA 2I81A 1ON4A 3KZQA 1LU4A 4Q5QA 5CP1A 4A5PA 2AYTA 2FWFA 3KTLA 4OFMA 1W89A 5IMFA 1M2BA 4BL7B 4TRXA 3FZ4A 3NZNA 1A2MA 2R37A 1WRYA 1OC8A 4X43A 2JZTA 4RQXA 3FK8A 3E9JB 4ZL9A 2C0DA 1XWAA 2VLUA 1XCCA 3GV1A 4ML6A 3TKPA 3IAS2 1BJXA 5H5SA 1PN9A 1B9XC 1YKCA 1PKZA 1SU9A 4K7NA 1G7OA 2MMOA 1EV9A 2TRXA 3VI5A 4Z2UA 4ACSA 3ZYWA 3IXRA 4JRRA 5CAXA 3QPMA 2DC5A 5H5QA 5A5KA 2LV3A 1X0RA 3CXGA 3SBCA 3GSSA 3A2XA 5D9XA 1JZOA 3VWUA 4G0KA 1O6JA 4ECIA 2DIZA 4E8EA 4Q5RA 1GTBA 4J57E 2WS2A 1M3IA 6GSTA 2H74A 1KTEA 1X5DA 2PUKC 4P3YB 4F9ZA 4ZB6A 2AUVA 2FY6A 2MBTA 4J56E 5D8IA 3F0IA 1TU7A 1HNCA 2F9SA 3VK9A 3L9VA 5AIXA 2GQKA 4G2EA 3WGEA 2YJ7A 1YDKA 3IR4A 3M9JA 2C3TA 4HDEA 5HR1A 4I6XA 2R5GA 4LMWA 2A2PA 3LQ7A 5GAND 5J9CA 3ERWA 5G2ZA 2PERA 4EIPA 2AB6A 4GSTA 2X4AA 3GKXA 2YCDA 1H4OA 2GZZA 1BAYA 1MDJA 3UL3A 1SK0A 4XS1A 4BVXB 1NW2A 3KTBA 2AV4A 1PL2A 1PGTA 3TJJA 4K2XA 5IO0A 1TKDB 2IFQB 4ID0A 3DWVA 2GS3A 2N5BA 4NAXA 4HQSA 3F8UA 5C04A 2YP6A 1Z7PA 4IJ3A 5FT3A 2L6CA 3HJOA 2H1GA 2L57A 2H0GA 4IS0A 2LSTA 3W8SA 4MF7A 5IO2A 1G6WA 4QL7A 2K8SA 4MH3A 2RM6A 2K6VA 2LQQA 2WRTA 3TB2A 1DBYA 4KH7A 3TJFA 2GT5A 1ZYNA 3W6GA 1G6YA 4CY6A 5JWOB 3HJPA 1XXUA 3APQA 1FOVA 3HYPA 2YZHA 1XW9A 4D73B 5HFGA 2E2GA 1AW9A 1GH2A 1GUHA 2K18A 3TRPA 3F4RA 2DJ1A 1DE2A 2HT9A 2H76A 5CO3A 3A5IA 1SK2A 4TN8A 2IJYA 1FB6A 1PL1A 4N0ZA 3O3TA 1EGRA 4MZBA 1OC3A 4I8BA 3G9BA 1MD4A 16GSA 4KCEA 1R5PA 4O5RA 4O32A 4K5SA 2GQMA 5ECMB 6GSSA 2MBSA 4GQCA 2LJRA 2PBJA 5GSSA 1SKWB 3KMOA 2X8HA 2CA8A 3D21A 2PWJA 2LS5A 4LL1B 2LRCA 4YH2A 1SL2B 3C7MA 2GSSA 1PA3A 4EUYA 3GHAA 2CQ9A 4XRDA 2VL3A 1PSQA 1M7TA 1BX9A 2OJLA 2LJAA 2B1LA 4WBJA 2HLSA 4HU9A 2M46A 2LRNA 3ERGA 5B8BA 4K5RA 4CY8A 1GSUA 2EC4A 3PINA 3ZIVA 3TOUA 2R6KA 2H30A 4USSA 2GTUA 1CQHA 4LA1A 1I9DA 3ZMKA 5B8AA 1THOA 2Z9SA 1KBNA 5BRTA 2GVPA 3ME8A 4L5LA 1PD21 5G5EA 1QUWA 1JFUA 1E2YA 2X49A 5F05A 5D9WA 4G10A 5B6NA 3KCMA 2HSYA 4FYUA 3Q6OA 4I97A 4IW9A 4JR6A 2VD1A 1X9SB 3MYDA 4ILFA 4V1Ag 1IYIA 1S3AA 4IBPA 1T7PB 4JU5A 3FR9A 1AQXA 2OBIA 2WB9A 2V6OA 5KN0A 1ZGNA 1PX7A 4XS6A 3C73A 3IAM2 2DJKA 2ON7A 5D73A 2G0FA 1DSBA 4KB3A 2FWEA 3IA1A 3HZ4A 1JZRA 4IVFA 4IELA 5ELGA 3C71A 2OE3A 2HZEA 2MMZA 1SD8A 1AQWA 4BVYA 5DJMA 5HFIA 4EO3A 5CRDA 2HNLA 2WDUA 3QAGA 1M2DA 5HFKA 1ZCPA 3D4MA 3LGCA 2REMA 5H5RA 1SENA 5ECPB 4IP1A 1K0AA 5ABRA 4H86A 3GKMA 1WE0A 1AQVA 3GYKA 1MEKA 4KAEA 1FOHA 2HRNA 2OBKA 3BOAA 1U3AA 3FEUA 3H93A 2C80A 5EVOA 1ZOFA 2H6ZA 4GXZA 1TDIA 1GNEA 2VM1A 4RQRA 3UMAA 2WFCA 3HDCA 3M3MA 3L0HA 4OD7A 4EDYA 1JZDA 3DEXA 4QQ7A 1S3CA 4KX4A 5IMAA 2EIOA 1BQ7A 13GSA 2A2SA 4WR5A 3KH9A 5HQPA 2I3YA 2H70A 2QA1A 2A2RA 17GSA 2ES7A 4EVMA 1A8LA 4PQ1A 2HRFA 1EEJA 1RK4A 4G19A 3HHVA 1B48A 5J9BA 4XTSA 1M9BA 3GNJA 2VM2A 3BJ5A 3WD6A 4OMVA 3IV4A 1S3DA 3NOFA 4GTUA 18GSA 4TVEA 3M0FA 1SD9A 1XWCA 3RPPA 8GSSA 3ZL5A 2YWOA
chains in the Genus database with same CATH topology
3I9V2 1WJKA 1OKTA 3KD0A 2CZ2A 3J7Yb 2JU5A 1MDKA 1YF1A 3KP9A 2K9FA 1J9BA 4POKA 1GSSA 4WR4A 3EMPA 2JACA 1EOGA 2L5LA 2VCXA 3CTFA 2CX4A 5DQYA 3J7Yk 3IC8A 2L4CA 1OC9A 1SJIA 3HXSA 2WJUA 3EE2A 2PPTA 3CMIA 4POMA 1SYRA 3ZVJD 1A0FA 3GURA 4WETA 4BPYA 4RI6A 3U5RE 3C8EA 2YANA 5G31A 1GSYA 3V1WA 3WGDA 3U6VA 3FY7A 3C1SA 2L4QA 4KDXA 4ZL8A 2GZPA 1XW5A 3IHGA 2R0PA 3GUSA 4IHUA 3TJGA 3QAWA 2HSHA 5IIZA 1GL8A 5HR2A 3TOTA 3HVSA 4Q5NA 1U87A 4PUAA 4X0XA 4KUNA 2DMLA 1UVZA 4PURA 4MNNA 3A2VA 2ZUPA 1A2LA 2O89A 2A4HA 5KN2A 3F9UA 2KHPA 4OO5A 1FO5A 4OWYA 4YAVA 2MZCA 4POBA 3EPTA 1JLVA 1FVKA 2J23A 1GLQA 3GX0A 4Z2RA 4WF4A 1GSQA 4FO5A 4K6XA 3IK7A 1ERTA 5INYA 4HZ4A 1TXXA 2P31A 1OAZA 4IQAA 1N2AA 4YKGA 1T4YA 5A4UA 4WF5A 4TXVA 2ZCTA 1GULA 2L5OA 3MWHA 4MPFA 2HZEB 2YPMA 4FQUA 4MZCA 1EEMA 1MD3A 3RAZA 1WPIA 4BVYB 2RUFA 1F6MC 1XBSA 2R0CA 4PNFA 3FR3A 5D93A 2H0IA 4YAPA 4I5QA 2JL4A 2YNXA 1SJ6A 3GL5A 6GSUA 3ZIJA 3GA4A 4ZB9A 4JEDA 2DIYA 5LNKe 5JCUA 1HD2A 2GGTA 5DVBA 4IGJA 2X99A 1ABAA 2BJXA 3L78A 2NVLA 1M2AA 1GUKA 2JADA 5C00A 4LLRA 2YWMA 4ISDA 5B6MA 5CNWA 2V1MA 1GLPA 5IOXA 2CVDA 5G5FA 3FW2A 3LJRA 3BD2A 4KCAA 4V1Ap 2OE0A 1B4QA 2KLXA 1ZYEA 2HRKA 4ULXA 4KW6A 2N5AA 4N0VA 4J2FA 4MK3A 1I5GA 1XWBA 1EP8A 3F3QA 4WKWA 2X64A 2GSRA 1T4ZA 2CV4A 1GTAA 2KP1A 2IPAA 2OADA 3UEMA 3VI7A 4TKYA 1WMJA 2NDOA 3E0UA 2HRAA 2BTOT 1USBA 2B5EA 1O73A 1Y25A 4DVCA 4PX1A 4KDUA 5KN1A 4AF2A 4LMVA 5DBQA 1R5AA 3ERFA 3WT2A 1XWKA 2OA7A 3ZTLA 3F3RA 6GSXA 2HE3A 4V2MA 2C0FA 4NWYA 1N8JA 5F07A 3IC4A 5J5NA 1QFNA 4O7HA 5KN3A 3EURA 3LORA 3VLNA 1A8YA 2PVQA 1T1VA 3ZVJA 1WP0A 1ZYPA 4K9ZA 3CYNA 3TUEA 1OC9B 3G7IA 3LYPA 5CREA 11GSA 3M9KA 1WIKA 2XBQA 3W8JA 2B3SA 2DJJA 4AGSA 1SKSB 3HVXA 4ECCA 1O8XA 5G1LA 3QDNA 3GSTA 2H1DA 4MJAA 1X5EA 12GSA 2HSMA 2B6MA 4IKHA 2ALBA 4BWQA 1F3BA 1BEDA 5G30A 3KIJA 20GSA 4NXIA 2H71A 3A2WA 3KH7A 2LRTA 2FD3A 2YOIA 1TRSA 5AIVA 1TTZA 1ZZYA 2LUSA 2VLTA 2R0GA 4K0GA 3CTGA 5KEJA 4ICYA 3F4TA 3D5JA 1A23A 4IN0A 2VO4A 1JHBA 2A4VA 5IMVA 2WGRA 2HXKA 1J08A 5IOWA 2YV7A 3GRXA 1AUCA 1T00A 4KDYA 2GZYA 2NBSA 3JCML 4MF6A 1K0CA 6GSWA 4MCUA 4JBBA 3R3EA 2H19A 4Z7XA 3IRAA 5FWGA 1MTCA 2CAIA 2CVKA 2VCTA 3UAPA 2MYGA 1V58A 1ZYQB 1TK8B 1ERVA 4RI7A 4F0BA 5AISA 1X5CA 5ECSA 4EKZA 2FLSA 3AY8A 2D2ZA 2L59A 1O81A 2H01A 2P0GA 3BCIA 2J9HA 1TW9A 5ECQB 1ZL9A 1EZKA 3H79A 2EIRA 4ZL7A 1A0RP 1XZOA 4ML1A 2CT6A 3TKRA 4IP6A 1ST9A 3APSA 3TJBA 1UN2A 5ECHB 3QOUA 2VL9A 4L5OA 3GH9A 2DMMA 3RBTA 2E0QA 1M0UA 1F37A 1VF2A 1R7HA 3TRQA 5DCHA 3HZ8A 3TKSC 2DJ0A 3QAVA 2LEGA 4HUAA 1NM3A 1F3AA 1GRXA 3FMWA 1EOHA 3F6DA 1V40A 3ZFBA 4K7IA 4L0UA 4OFTA 19GSA 3UARA 3FZ5A 3N9JA 4QL9A 2FNOA 1FHEA 5LD0A 1U6TA 4AJ7A 4EIQA 1JLWA 3EWLA 2TRCP 4G0IA 2VL2A 4ZBBA 1YKAA 2C8UA 4MA9A 2PMTA 3ZRDA 3PH9A 14GSA 3K8NA 4YQUA 3ED3A 2F51A 1X9MB 4I2TA 2GSQA 3CBUA 3DKSA 3KGKA 3DGQA 4MMMA 4AJ8A 2KOKA 4MH2A 2CAQA 4HU7A 1XIYA 2RUEA 2MMNA 2H72A 1VF3A 4EXJA 1OYJA 3VWWA 3APOA 3LXTA 4OO4A 3HJMA 5J4UA 3LWAA 1PQNA 1B9YC 5F06A 3KJYA 3O6TA 1FAAA 5F8BA 2DLXA 3UBKA 2FWHA 2PU9C 2VCVA 3TJKA 3TKSA 1GP1A 4ECBA 1K0OA 4EDZA 4ZBAA 2ON5A 3TCOA 3RPNA 1F2EA 5A4VA 1UC7A 2WULA 3ZZXA 1G0TA 1Q4JA 3DRNA 4F0CA 4ECJA 1VF4A 5B7CA 2QSIA 1IYHA 3TRXA 1CQGA 1V9WA 4PNGA 1O7UA 4EL1A 2LTKA 3Q74A 2PVOC 5JCWA 3GMFA 3LXZA 4F2IA 4POLA 2N5FA 2IL3A 1TI1A 1JZWA 5DAKA 1U88A 2EIQA 1FB0A 5AN1A 5ENUA 2FA4A 1ML6A 3DXBA 4ZIJA 1AIUA 2I9HA 3QD9A 3ZITA 4F82A 3RHCA 2B5XA 3FRCA 4K1FA 5ID2A 3CSJA 1V57A 1F9MA 3D4TA 3Q18A 2M72A 4HJ2A 4V2NA 2MMAA 3H1NA 4NHWA 3C1RA 1AC1A 3F6FA 5D9VA 1OVNA 1NHYA 3SWLA 3WT1A 3WYWA 3US3A 1SKRB 2XBIA 3F4SA 1EP7A 5ELAA 1Z3EA 4GLTA 2OE1A 1WWJA 2RLIA 5ECNB 2DKIA 2FHEA 3IPZA 2O7KA 4XIHA 22GSA 5GZZB 4GQFA 3EU3A 2RM5A 1HNBA 3IK9A 2LNSA 3GTUA 1T8EB 1QK8A 3PGTA 1YEXA 1XVQA 3O76A 4DSSA 4OFNA 1KNGA 1TP9A 3M8NA 1TJDA 2C4JA 3GX8A 3CSHA 4ZILA 2I1UA 3VWXA 1TRUA 2C0GA 2VCQA 2IMEA 2R4VA 3L4NA 2C0EA 4EF0A 4HI7A 1EGOA 1TK0B 9GSSA 4YQVA 2YWNA 3QFAC 1NHOA 2VUPA 2IIYA 2E2MA 4HS1A 1QQ2A 4O5QA 2DJ2A 5DALA 2H73A 1QXHA 3F63A 3A5WA 5DCGA 5GAPD 2C3QA 3GIXA 3D0ZA 3DVXA 3CRUA 1K3YA 2KP2A 4XS4A 3P8WA 1Z6MA 4GSSA 1Y6EA 4JZQA 3FR6A 4TR0A 4EE0A 3RDWA 3GH6A 1T3BA 5BMUA 1XOAA 3DD3A 3EINA 1URMA 2VLVA 1BG5A 1DUGA 2YZUA 3E3EA 2G2QA 1K0NA 5CRGA 2H1BA 4N10A 5GSTA 1E6BA 2PN8A 4X4JA 2FCHA 3GKNA 1AXDA 2AAWA 4KGIA 5E59A 3ZFLA 3EMXA 3M1GA 1YY7A 2GDRA 5ECKB 1VF1A 3D22A 1K3LA 2CVBA 2YJHA 4I2UA 3UVTA 1X9WB 2CZ3A 2B5YA 3FYGA 3HY2A 4G9HA 1BYEA 1VRSD 4F03A 3VPQA 6GSVA 2JZSA 4NV5A 3H4KA 5KOXA 4N11A 3UJ1A 1OKDA 1GUMA 4TR4A 2H1AA 3PR8A 2XPDA 4MP4A 3FHKA 5COHA 4HEA2 2IN3A 2P5QA 3I6AA 3ZMLA 2B7JA 5L71A 4FYCA 2VCWA 4NPBA 5A4WA 1SL1B 2LJKA 4CW9A 4DSQA 1SYXA 4GRFA 2QKEA 4GCIA 3LFLA 1TI3A 1ZMAA 2KUCA 4L8EA 4YQMA 4ZB8A 5DAKB 4ZBDA 2C1YA 1Z9HA 2O85A 1RQMA 5IQYA 3OR5A 4KF9A 4KNDA 4MLYA 1B4PA 5JCGA 5E4WA 3FKFA 4TXOB 2H75A 3DIEA 1NSWA 1RW1A 2F8FA 2H66A 3GFKA 4MJEA 5ECLB 1FW1A 3LW9A 1XFLA 4OCFA 2WCIA 2C3NA 1GWCA 4PQHA 3TKSE 1SL0B 3VFIA 2JZRA 5DJLA 3QR6A 3KEBA 1W4VA 3IE3A 4K8MA 3UBLA 2FUG2 5ID2B 3I43A 4PTSA 5CRWA 1O85A 4HOJA 1DE1A 4KSOA 3MAKA 1U3IA 4JE1A 5CYYA 5EL8A 2O87A 1OE7A 4PQIA 5F0GA 3KM6A 2ZNMA 2VIMA 4FH8A 4HQZA 1HNAA 3LYKA 4DEJA 4WBRD 1KEBA 3VPTA 5JWRB 1GNWA 2V41A 4RUVA 3LEFA 2AHEA 4YKFA 2H0HA 1K0MA 2PGTA 2WZ9A 1SK1A 5HR0A 4Q5FA 3S9FA 3G7YA 2QGVA 5IMDA 1C72A 3GTUB 3WGXA 3HA9A 4G0LA 4DSSB 5JWQB 1VGLA 3G7JA 3UVHA 3MSZA 1PN0A 2B7KA 2IWTA 4MF5A 1PX6A 3GN3A 1PRXA 1XWGA 4MJCA 2QC7A 2VL2C 4XHMA 4TOPA 4WEYA 5DALB 2OKAA 3KMNA 2RIIA 3R2QA 2HZFA 2I4AA 3P7XA 3KXOA 4MZWA 5ECOB 2F8AA 3ME7A 2LKUA 5FHIA 4TR1A 3QCPA 5IM9A 4IQ1A 4XS4B 3KP8A 1YJ6A 4KE3A 5ECRB 1FVJA 2FA8A 3NIVA 1HQOA 4BL7A 5J41A 4TR3A 1J0FA 3IOSA 4K7OA 1Z6NA 2K8VA 4XCSA 2FGXA 2R2JA 3HVVA 1EV4A 5CRHA 2F3MA 1GTIA 2GSTA 4NV2A 1K0DA 1TK5B 4BWSA 2R3XA 2NTOA 2H6XA 2LNTA 1YEPA 2B1KA 2H8LA 2VCZA 2P5RA 5D9TA 2VOCA 3QMXA 1OE8A 5ECIB 3UIWA 5LCZA 1XVWA 2X8GA 3IDVA 4CHSA 3GKKA 1GSEA 4BA7A 7GSSA 1YF0A 3H8QA 1A24A 4N30A 3RHBA 3EU4A 2OACA 1FG4A 3L9SA 1M9AA 3QFBC 5IMCA 2QA2A 2GT6A 3DYRA 4HJMA 2IMFA 3LSZA 2IMKA 2M80A 3Q19A 4PXOA 1EWXA 2IMIA 4JR4A 5HR3A 2XPEA 1O8WA 2JSZA 3TDGA 5G1KA 4OCEA 4KA0A 5IPHA 4FIWA 1XW6A 4MABA 3FZAA 2GLRA 4MPGA 1V98A 3ZREA 5EY6A 1Q98A 3L9UA 2YWIA 2V32A 4AJ6A 1HYUA 4ZXGA 3N5OA 4KSMA 1TU8A 4X1UA 1H75A 1ERWA 2DSAA 4GSNA 2TIRA 1XOBA 3PPUA 3EYTA 3VURA 2AJQB 3CSIA 1UA5A 5DQSA 1K3OA 1YZXA 3A3TA 2CX3A 2XC2A 4NMUA 5AGYA 1MDIA 4LL4B 1B8XA 10GSA 4XRAA 2DJ3A 3UOMA 2HFDA 1GSDA 5EPFA 1A2JA 4MJBA 3HKRA 4E8HA 2YV9A 1THXA 1AAZA 4BVXA 2HYXA 4NHZA 1QGVA 4PUFC 3D6IA 3ISOA 2E7PA 3IBHA 2O8VB 2IFQA 5DDLA 3IHQA 2V2GA 4L0WA 5D96A 3CRTA 2UZ8A 3LG6A 2X8CA 1G7EA 5IMZA 2JSYA 1TRWA 3BCKA 4IJIA 4HZ2A 2GQLA 6GSYA 4GWRA 1ERUA 1GTUA 3P2AA 4V2LA 5IPGA 3BBYA 1R26A 4GF0A 5KOWA 1LBKA 1PMTA 1XPVA 1YQ1A 2BMXA 4TXOA 3DVWA 3GL3A 1QMVA 3ZLPA 1R4WA 1SJZA 3TGZA 4EC0A 1TOFA 1Z5YE 3DMLA 2NPBA 4K0NA 4TW5A 1LJRA 3FZ9A 2VAFA 1PKWA 4O92A 3MNGA 1V2AA 3VWVA 2V6KA 4WXTA 2FWGA 4FYBA 3EC3A 1K0BA 3HD5A 4D73A 5J3RA 2L6DA 4O5UA 3MIXA 1WOUA 4DSRA 1Z7RA 2HI7A 1GSFA 4MDCA 2H6YA 4PGTA 4CDOA 2LQOA 2YN1A 2DKHA 3I69A 2DBCA 1ILOA 3HCZA 3P90A 3EVIA 2XHFA 3MDKA 4Z2TA 1ACVA 2IMDA 1M99A 4TR1B 4K2DA 2VD0A 1TRVA 3TKQA 2I81A 1ON4A 3KZQA 1LU4A 4Q5QA 5CP1A 4A5PA 2AYTA 2FWFA 3KTLA 4OFMA 1W89A 5IMFA 1M2BA 4BL7B 4TRXA 3FZ4A 3NZNA 1A2MA 2R37A 1WRYA 1OC8A 4X43A 2JZTA 4RQXA 3FK8A 3E9JB 4ZL9A 2C0DA 1XWAA 2VLUA 1XCCA 3GV1A 4ML6A 3TKPA 3IAS2 1BJXA 5H5SA 1PN9A 1B9XC 1YKCA 1PKZA 1SU9A 4K7NA 1G7OA 2MMOA 1EV9A 2TRXA 3VI5A 4Z2UA 4ACSA 3ZYWA 3IXRA 4JRRA 5CAXA 3QPMA 2DC5A 5H5QA 5A5KA 2LV3A 1X0RA 3CXGA 3SBCA 3GSSA 3A2XA 5D9XA 1JZOA 3VWUA 4G0KA 1O6JA 4ECIA 2DIZA 4E8EA 4Q5RA 1GTBA 4J57E 2WS2A 6GSTA 2H74A 1KTEA 1X5DA 2PUKC 4P3YB 4F9ZA 4ZB6A 2AUVA 2FY6A 2MBTA 4J56E 5D8IA 3F0IA 1TU7A 1HNCA 2F9SA 3VK9A 3L9VA 5AIXA 2GQKA 4G2EA 3WGEA 2YJ7A 1YDKA 3IR4A 3M9JA 2C3TA 4HDEA 5HR1A 4I6XA 2R5GA 4LMWA 2A2PA 3LQ7A 5GAND 5J9CA 3ERWA 5G2ZA 2PERA 4EIPA 2AB6A 4GSTA 2X4AA 3GKXA 2YCDA 1H4OA 2GZZA 1BAYA 1MDJA 3UL3A 1SK0A 4XS1A 4BVXB 1NW2A 3KTBA 2AV4A 1PL2A 1PGTA 3TJJA 4K2XA 5IO0A 1TKDB 2IFQB 4ID0A 3DWVA 2GS3A 2N5BA 4NAXA 4HQSA 3F8UA 5C04A 2YP6A 1Z7PA 4IJ3A 5FT3A 2L6CA 3HJOA 2H1GA 2L57A 2H0GA 4IS0A 2LSTA 3W8SA 4MF7A 5IO2A 1G6WA 4QL7A 2K8SA 4MH3A 2RM6A 2K6VA 2LQQA 2WRTA 3TB2A 1DBYA 4KH7A 3TJFA 2GT5A 1ZYNA 3W6GA 1G6YA 4CY6A 5JWOB 3HJPA 1XXUA 3APQA 1FOVA 3HYPA 2YZHA 1XW9A 4D73B 5HFGA 2E2GA 1AW9A 1GH2A 1GUHA 2K18A 3TRPA 3F4RA 2DJ1A 1DE2A 2HT9A 2H76A 5CO3A 3A5IA 1SK2A 4TN8A 2IJYA 1FB6A 1PL1A 4N0ZA 3O3TA 1EGRA 4MZBA 1OC3A 4I8BA 3G9BA 1MD4A 16GSA 4KCEA 1R5PA 4O5RA 4O32A 4K5SA 2GQMA 5ECMB 6GSSA 2MBSA 4GQCA 2LJRA 2PBJA 5GSSA 1SKWB 3KMOA 2X8HA 2CA8A 3D21A 2PWJA 2LS5A 4LL1B 2LRCA 4YH2A 1SL2B 3C7MA 2GSSA 1PA3A 4EUYA 3GHAA 2CQ9A 4XRDA 2VL3A 1PSQA 1M7TA 1BX9A 2OJLA 2LJAA 2B1LA 4WBJA 2HLSA 4HU9A 2M46A 2LRNA 3ERGA 5B8BA 4K5RA 4CY8A 1GSUA 2EC4A 3PINA 3ZIVA 3TOUA 2R6KA 2H30A 4USSA 2GTUA 1CQHA 4LA1A 1I9DA 3ZMKA 5B8AA 1THOA 2Z9SA 1KBNA 5BRTA 2GVPA 3ME8A 4L5LA 1PD21 5G5EA 1QUWA 1JFUA 1E2YA 2X49A 5F05A 5D9WA 4G10A 5B6NA 3KCMA 2HSYA 4FYUA 3Q6OA 4I97A 4IW9A 4JR6A 2VD1A 1X9SB 3MYDA 4ILFA 4V1Ag 1IYIA 1S3AA 4IBPA 1T7PB 4JU5A 3FR9A 1AQXA 2OBIA 2WB9A 2V6OA 5KN0A 1ZGNA 1PX7A 4XS6A 3C73A 3IAM2 2DJKA 2ON7A 5D73A 2G0FA 1DSBA 4KB3A 2FWEA 3IA1A 3HZ4A 1JZRA 4IVFA 4IELA 5ELGA 3C71A 2OE3A 2HZEA 2MMZA 1SD8A 1AQWA 4BVYA 5DJMA 5HFIA 4EO3A 5CRDA 2HNLA 2WDUA 3QAGA 1M2DA 5HFKA 1ZCPA 3D4MA 3LGCA 2REMA 5H5RA 1SENA 5ECPB 4IP1A 1K0AA 5ABRA 4H86A 3GKMA 1WE0A 1AQVA 3GYKA 1MEKA 4KAEA 1FOHA 2HRNA 2OBKA 3BOAA 1U3AA 3FEUA 3H93A 2C80A 5EVOA 1ZOFA 2H6ZA 4GXZA 1TDIA 1GNEA 2VM1A 4RQRA 3UMAA 2WFCA 3HDCA 3M3MA 3L0HA 4OD7A 4EDYA 1JZDA 3DEXA 4QQ7A 1S3CA 4KX4A 5IMAA 2EIOA 1BQ7A 13GSA 2A2SA 4WR5A 3KH9A 5HQPA 2I3YA 2H70A 2QA1A 2A2RA 17GSA 2ES7A 4EVMA 1A8LA 4PQ1A 2HRFA 1EEJA 1RK4A 4G19A 3HHVA 1B48A 5J9BA 4XTSA 1M9BA 3GNJA 2VM2A 3BJ5A 3WD6A 4OMVA 3IV4A 1S3DA 3NOFA 4GTUA 18GSA 4TVEA 3M0FA 1SD9A 1XWCA 3RPPA 8GSSA 3ZL5A 2YWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I9V 2;  1WJK A;  1OKT A;  3KD0 A;  2CZ2 A;  3J7Y b;  2JU5 A;  1MDK A;  1YF1 A;  3KP9 A;  2K9F A;  1J9B A;  4POK A;  1GSS A;  4WR4 A;  3EMP A;  2JAC A;  1EOG A;  2L5L A;  2VCX A;  3CTF A;  2CX4 A;  5DQY A;  3J7Y k;  2L4C A;  1OC9 A;  1SJI A;  3HXS A;  2WJU A;  3EE2 A;  2PPT A;  3CMI A;  4POM A;  1SYR A;  3ZVJ D;  1A0F A;  3GUR A;  4WET A;  4BPY A;  4RI6 A;  3U5R E;  3C8E A;  2YAN A;  5G31 A;  1GSY A;  3V1W A;  3WGD A;  3U6V A;  3FY7 A;  3C1S A;  2L4Q A;  4KDX A;  4ZL8 A;  2GZP A;  1XW5 A;  3GUS A;  4IHU A;  3TJG A;  3QAW A;  2HSH A;  5IIZ A;  1GL8 A;  5HR2 A;  3TOT A;  3HVS A;  4Q5N A;  1U87 A;  4PUA A;  4X0X A;  4KUN A;  2DML A;  1UVZ A;  4PUR A;  3A2V A;  2ZUP A;  1A2L A;  2O89 A;  5KN2 A;  3F9U A;  2KHP A;  4OO5 A;  1FO5 A;  4OWY A;  4YAV A;  2MZC A;  4POB A;  1JLV A;  1FVK A;  2J23 A;  1GLQ A;  3GX0 A;  4WF4 A;  1GSQ A;  4FO5 A;  4K6X A;  3IK7 A;  1ERT A;  5INY A;  4HZ4 A;  1TXX A;  2P31 A;  1OAZ A;  4IQA A;  1N2A A;  1T4Y A;  5A4U A;  4WF5 A;  4TXV A;  2ZCT A;  1GUL A;  2L5O A;  3MWH A;  4MPF A;  2HZE B;  2YPM A;  4MZC A;  1EEM A;  1MD3 A;  3RAZ A;  1WPI A;  2RUF A;  1F6M C;  1XBS A;  4PNF A;  3FR3 A;  5D93 A;  2H0I A;  4YAP A;  4I5Q A;  2JL4 A;  2YNX A;  1SJ6 A;  3GL5 A;  6GSU A;  3ZIJ A;  3GA4 A;  4ZB9 A;  4JED A;  2DIY A;  5LNK e;  5JCU A;  1HD2 A;  2GGT A;  5DVB A;  4IGJ A;  2X99 A;  1ABA A;  2BJX A;  3L78 A;  2NVL A;  1M2A A;  1GUK A;  2JAD A;  5C00 A;  4LLR A;  2YWM A;  4ISD A;  5B6M A;  5CNW A;  2V1M A;  1GLP A;  5IOX A;  2CVD A;  5G5F A;  3FW2 A;  3LJR A;  3BD2 A;  4KCA A;  4V1A p;  2OE0 A;  1B4Q A;  2KLX A;  1ZYE A;  4ULX A;  4KW6 A;  2N5A A;  4N0V A;  4J2F A;  4MK3 A;  1I5G A;  1XWB A;  1EP8 A;  3F3Q A;  4WKW A;  2X64 A;  2GSR A;  1T4Z A;  2CV4 A;  1GTA A;  2KP1 A;  2IPA A;  2OAD A;  3UEM A;  3VI7 A;  4TKY A;  1WMJ A;  2NDO A;  3E0U A;  2BTO T;  1USB A;  2B5E A;  1O73 A;  1Y25 A;  4DVC A;  4PX1 A;  4KDU A;  5KN1 A;  4AF2 A;  4LMV A;  5DBQ A;  1R5A A;  3ERF A;  3WT2 A;  1XWK A;  2OA7 A;  3ZTL A;  3F3R A;  6GSX A;  2HE3 A;  4V2M A;  2C0F A;  4NWY A;  1N8J A;  5F07 A;  3IC4 A;  5J5N A;  1QFN A;  4O7H A;  5KN3 A;  3EUR A;  3LOR A;  3VLN A;  1A8Y A;  2PVQ A;  1T1V A;  3ZVJ A;  1WP0 A;  4K9Z A;  3CYN A;  3TUE A;  1OC9 B;  3G7I A;  3LYP A;  5CRE A;  11GS A;  3M9K A;  1WIK A;  2XBQ A;  3W8J A;  2B3S A;  2DJJ A;  4AGS A;  1SKS B;  3HVX A;  4ECC A;  1O8X A;  5G1L A;  3QDN A;  3GST A;  2H1D A;  4MJA A;  1X5E A;  12GS A;  2B6M A;  4IKH A;  2ALB A;  4BWQ A;  1F3B A;  1BED A;  5G30 A;  3KIJ A;  20GS A;  4NXI A;  2H71 A;  3A2W A;  3KH7 A;  2LRT A;  2FD3 A;  2YOI A;  1TRS A;  5AIV A;  1TTZ A;  1ZZY A;  2LUS A;  2VLT A;  4K0G A;  3CTG A;  5KEJ A;  3F4T A;  3D5J A;  1A23 A;  4IN0 A;  2VO4 A;  1JHB A;  2A4V A;  5IMV A;  2WGR A;  2HXK A;  1J08 A;  5IOW A;  2YV7 A;  3GRX A;  1AUC A;  1T00 A;  4KDY A;  2GZY A;  2NBS A;  3JCM L;  4MF6 A;  1K0C A;  6GSW A;  4MCU A;  4JBB A;  2H19 A;  4Z7X A;  3IRA A;  5FWG A;  1MTC A;  2CAI A;  2CVK A;  2VCT A;  3UAP A;  2MYG A;  1V58 A;  1ZYQ B;  1TK8 B;  1ERV A;  4RI7 A;  4F0B A;  5AIS A;  1X5C A;  5ECS A;  4EKZ A;  2FLS A;  3AY8 A;  2D2Z A;  2L59 A;  1O81 A;  2H01 A;  2P0G A;  3BCI A;  2J9H A;  1TW9 A;  5ECQ B;  1ZL9 A;  1EZK A;  3H79 A;  2EIR A;  4ZL7 A;  1A0R P;  1XZO A;  4ML1 A;  2CT6 A;  3TKR A;  4IP6 A;  1ST9 A;  3APS A;  3TJB A;  1UN2 A;  5ECH B;  3QOU A;  2VL9 A;  4L5O A;  3GH9 A;  2DMM A;  3RBT A;  2E0Q A;  1M0U A;  1F37 A;  1VF2 A;  1R7H A;  3TRQ A;  5DCH A;  3HZ8 A;  3TKS C;  2DJ0 A;  3QAV A;  2LEG A;  4HUA A;  1NM3 A;  1F3A A;  1GRX A;  1EOH A;  3F6D A;  1V40 A;  3ZFB A;  4K7I A;  4L0U A;  4OFT A;  19GS A;  3UAR A;  3FZ5 A;  3N9J A;  4QL9 A;  2FNO A;  1FHE A;  5LD0 A;  1U6T A;  4AJ7 A;  1JLW A;  3EWL A;  2TRC P;  2VL2 A;  4ZBB A;  1YKA A;  2C8U A;  4MA9 A;  2PMT A;  3ZRD A;  3PH9 A;  14GS A;  3K8N A;  4YQU A;  3ED3 A;  2F51 A;  1X9M B;  4I2T A;  2GSQ A;  3CBU A;  3DKS A;  3KGK A;  3DGQ A;  4MMM A;  4AJ8 A;  2KOK A;  4MH2 A;  2CAQ A;  4HU7 A;  1XIY A;  2RUE A;  2MMN A;  2H72 A;  1VF3 A;  4EXJ A;  1OYJ A;  3VWW A;  3APO A;  3LXT A;  4OO4 A;  3HJM A;  5J4U A;  3LWA A;  1PQN A;  1B9Y C;  5F06 A;  3KJY A;  3O6T A;  1FAA A;  5F8B A;  2DLX A;  3UBK A;  2FWH A;  2PU9 C;  2VCV A;  3TJK A;  3TKS A;  1GP1 A;  4ECB A;  1K0O A;  4EDZ A;  4ZBA A;  2ON5 A;  3TCO A;  3RPN A;  1F2E A;  5A4V A;  1UC7 A;  2WUL A;  3ZZX A;  1G0T A;  1Q4J A;  3DRN A;  4F0C A;  4ECJ A;  1VF4 A;  5B7C A;  2QSI A;  1IYH A;  3TRX A;  1CQG A;  1V9W A;  4PNG A;  1O7U A;  4EL1 A;  2LTK A;  3Q74 A;  2PVO C;  5JCW A;  3GMF A;  3LXZ A;  4F2I A;  4POL A;  2N5F A;  2IL3 A;  1TI1 A;  1JZW A;  5DAK A;  1U88 A;  2EIQ A;  1FB0 A;  5AN1 A;  5ENU A;  2FA4 A;  1ML6 A;  3DXB A;  4ZIJ A;  1AIU A;  2I9H A;  3QD9 A;  3ZIT A;  4F82 A;  3RHC A;  2B5X A;  3FRC A;  4K1F A;  5ID2 A;  3CSJ A;  1V57 A;  1F9M A;  3D4T A;  3Q18 A;  2M72 A;  4HJ2 A;  4V2N A;  2MMA A;  3H1N A;  4NHW A;  3C1R A;  1AC1 A;  3F6F A;  5D9V A;  1OVN A;  1NHY A;  3SWL A;  3WT1 A;  3WYW A;  3US3 A;  1SKR B;  2XBI A;  3F4S A;  1EP7 A;  5ELA A;  1Z3E A;  4GLT A;  2OE1 A;  1WWJ A;  2RLI A;  5ECN B;  2FHE A;  3IPZ A;  2O7K A;  4XIH A;  22GS A;  5GZZ B;  4GQF A;  3EU3 A;  2RM5 A;  1HNB A;  3IK9 A;  2LNS A;  3GTU A;  1T8E B;  1QK8 A;  3PGT A;  1YEX A;  1XVQ A;  3O76 A;  4DSS A;  4OFN A;  1KNG A;  1TP9 A;  3M8N A;  1TJD A;  2C4J A;  3GX8 A;  3CSH A;  4ZIL A;  2I1U A;  3VWX A;  1TRU A;  2C0G A;  2VCQ A;  2IME A;  2R4V A;  3L4N A;  2C0E A;  4EF0 A;  4HI7 A;  1EGO A;  1TK0 B;  9GSS A;  4YQV A;  2YWN A;  3QFA C;  1NHO A;  2VUP A;  2IIY A;  2E2M A;  4HS1 A;  1QQ2 A;  2DJ2 A;  5DAL A;  2H73 A;  1QXH A;  3F63 A;  3A5W A;  5DCG A;  5GAP D;  2C3Q A;  3GIX A;  3D0Z A;  3DVX A;  3CRU A;  1K3Y A;  2KP2 A;  4XS4 A;  3P8W A;  1Z6M A;  4GSS A;  1Y6E A;  4JZQ A;  3FR6 A;  4TR0 A;  4EE0 A;  3RDW A;  3GH6 A;  1T3B A;  1XOA A;  3DD3 A;  3EIN A;  1URM A;  2VLV A;  1BG5 A;  1DUG A;  2YZU A;  3E3E A;  2G2Q A;  1K0N A;  5CRG A;  2H1B A;  4N10 A;  5GST A;  1E6B A;  2PN8 A;  2FCH A;  3GKN A;  1AXD A;  2AAW A;  4KGI A;  5E59 A;  3ZFL A;  3EMX A;  3M1G A;  1YY7 A;  2GDR A;  5ECK B;  1VF1 A;  3D22 A;  1K3L A;  2CVB A;  2YJH A;  4I2U A;  3UVT A;  1X9W B;  2CZ3 A;  2B5Y A;  3FYG A;  3HY2 A;  4G9H A;  1BYE A;  1VRS D;  4F03 A;  3VPQ A;  6GSV A;  2JZS A;  4NV5 A;  3H4K A;  4N11 A;  3UJ1 A;  1OKD A;  1GUM A;  4TR4 A;  2H1A A;  3PR8 A;  2XPD A;  4MP4 A;  3FHK A;  5COH A;  4HEA 2;  2IN3 A;  2P5Q A;  3I6A A;  3ZML A;  2B7J A;  5L71 A;  4FYC A;  2VCW A;  4NPB A;  5A4W A;  1SL1 B;  2LJK A;  4CW9 A;  4DSQ A;  1SYX A;  4GRF A;  2QKE A;  4GCI A;  3LFL A;  1TI3 A;  1ZMA A;  2KUC A;  4L8E A;  4YQM A;  4ZB8 A;  5DAK B;  4ZBD A;  2C1Y A;  1Z9H A;  2O85 A;  1RQM A;  5IQY A;  3OR5 A;  4KND A;  4MLY A;  1B4P A;  5JCG A;  5E4W A;  3FKF A;  4TXO B;  2H75 A;  3DIE A;  1NSW A;  1RW1 A;  2F8F A;  2H66 A;  3GFK A;  4MJE A;  5ECL B;  1FW1 A;  1XFL A;  4OCF A;  2WCI A;  2C3N A;  1GWC A;  4PQH A;  3TKS E;  1SL0 B;  3VFI A;  2JZR A;  5DJL A;  3QR6 A;  3KEB A;  1W4V A;  3IE3 A;  4K8M A;  3UBL A;  2FUG 2;  5ID2 B;  3I43 A;  5CRW A;  1O85 A;  4HOJ A;  1DE1 A;  4KSO A;  3MAK A;  1U3I A;  4JE1 A;  5CYY A;  5EL8 A;  2O87 A;  1OE7 A;  4PQI A;  5F0G A;  3KM6 A;  2ZNM A;  2VIM A;  4FH8 A;  4HQZ A;  1HNA A;  3LYK A;  4DEJ A;  4WBR D;  1KEB A;  3VPT A;  5JWR B;  1GNW A;  2V41 A;  4RUV A;  3LEF A;  2AHE A;  2H0H A;  1K0M A;  2PGT A;  2WZ9 A;  1SK1 A;  5HR0 A;  4Q5F A;  3S9F A;  3G7Y A;  2QGV A;  5IMD A;  1C72 A;  3GTU B;  3WGX A;  3HA9 A;  4DSS B;  5JWQ B;  1VGL A;  3G7J A;  3UVH A;  3MSZ A;  2B7K A;  2IWT A;  4MF5 A;  1PX6 A;  3GN3 A;  1PRX A;  1XWG A;  4MJC A;  2QC7 A;  2VL2 C;  4XHM A;  4TOP A;  4WEY A;  5DAL B;  2OKA A;  3KMN A;  2RII A;  3R2Q A;  2HZF A;  2I4A A;  3P7X A;  3KXO A;  4MZW A;  5ECO B;  2F8A A;  3ME7 A;  2LKU A;  5FHI A;  4TR1 A;  3QCP A;  5IM9 A;  4IQ1 A;  4XS4 B;  3KP8 A;  1YJ6 A;  4KE3 A;  5ECR B;  1FVJ A;  2FA8 A;  3NIV A;  1HQO A;  4BL7 A;  5J41 A;  4TR3 A;  1J0F A;  3IOS A;  4K7O A;  1Z6N A;  2K8V A;  4XCS A;  2FGX A;  2R2J A;  3HVV A;  1EV4 A;  5CRH A;  2F3M A;  1GTI A;  2GST A;  4NV2 A;  1K0D A;  1TK5 B;  4BWS A;  2R3X A;  2NTO A;  2H6X A;  2LNT A;  1YEP A;  2B1K A;  2H8L A;  2VCZ A;  2P5R A;  5D9T A;  2VOC A;  3QMX A;  1OE8 A;  5ECI B;  3UIW A;  5LCZ A;  1XVW A;  2X8G A;  3IDV A;  4CHS A;  3GKK A;  1GSE A;  4BA7 A;  7GSS A;  1YF0 A;  3H8Q A;  1A24 A;  4N30 A;  3RHB A;  3EU4 A;  2OAC A;  1FG4 A;  3L9S A;  1M9A A;  3QFB C;  5IMC A;  2GT6 A;  3DYR A;  4HJM A;  2IMF A;  3LSZ A;  2IMK A;  2M80 A;  3Q19 A;  4PXO A;  1EWX A;  2IMI A;  4JR4 A;  5HR3 A;  2XPE A;  1O8W A;  2JSZ A;  3TDG A;  5G1K A;  4OCE A;  4KA0 A;  5IPH A;  4FIW A;  1XW6 A;  4MAB A;  3FZA A;  2GLR A;  4MPG A;  1V98 A;  3ZRE A;  5EY6 A;  1Q98 A;  3L9U A;  2YWI A;  2V32 A;  4AJ6 A;  1HYU A;  4ZXG A;  3N5O A;  4KSM A;  1TU8 A;  4X1U A;  1H75 A;  1ERW A;  2DSA A;  4GSN A;  2TIR A;  1XOB A;  3EYT A;  3VUR A;  2AJQ B;  3CSI A;  1UA5 A;  5DQS A;  1K3O A;  1YZX A;  3A3T A;  2CX3 A;  2XC2 A;  4NMU A;  5AGY A;  1MDI A;  4LL4 B;  1B8X A;  10GS A;  4XRA A;  2DJ3 A;  3UOM A;  2HFD A;  1GSD A;  5EPF A;  1A2J A;  4MJB A;  3HKR A;  4E8H A;  2YV9 A;  1THX A;  1AAZ A;  4BVX A;  2HYX A;  4NHZ A;  1QGV A;  4PUF C;  3D6I A;  3ISO A;  2E7P A;  3IBH A;  2O8V B;  2IFQ A;  5DDL A;  3IHQ A;  2V2G A;  4L0W A;  5D96 A;  3CRT A;  3LG6 A;  2X8C A;  1G7E A;  5IMZ A;  2JSY A;  1TRW A;  3BCK A;  4IJI A;  4HZ2 A;  2GQL A;  6GSY A;  4GWR A;  1ERU A;  1GTU A;  3P2A A;  4V2L A;  5IPG A;  3BBY A;  1R26 A;  4GF0 A;  1LBK A;  1PMT A;  1XPV A;  1YQ1 A;  2BMX A;  4TXO A;  3DVW A;  3GL3 A;  1QMV A;  3ZLP A;  1R4W A;  1SJZ A;  3TGZ A;  4EC0 A;  1TOF A;  1Z5Y E;  3DML A;  2NPB A;  4K0N A;  4TW5 A;  1LJR A;  3FZ9 A;  2VAF A;  1PKW A;  4O92 A;  3MNG A;  1V2A A;  3VWV A;  2V6K A;  4WXT A;  2FWG A;  4FYB A;  3EC3 A;  1K0B A;  3HD5 A;  4D73 A;  5J3R A;  2L6D A;  1WOU A;  4DSR A;  1Z7R A;  2HI7 A;  1GSF A;  4MDC A;  2H6Y A;  4PGT A;  4CDO A;  2LQO A;  2YN1 A;  3I69 A;  2DBC A;  1ILO A;  3HCZ A;  3P90 A;  3EVI A;  2XHF A;  3MDK A;  1ACV A;  2IMD A;  1M99 A;  4TR1 B;  4K2D A;  2VD0 A;  1TRV A;  3TKQ A;  2I81 A;  1ON4 A;  3KZQ A;  1LU4 A;  4Q5Q A;  5CP1 A;  2AYT A;  2FWF A;  3KTL A;  4OFM A;  1W89 A;  5IMF A;  1M2B A;  4TRX A;  3FZ4 A;  3NZN A;  1A2M A;  2R37 A;  1WRY A;  1OC8 A;  4X43 A;  2JZT A;  4RQX A;  3FK8 A;  3E9J B;  4ZL9 A;  2C0D A;  1XWA A;  2VLU A;  1XCC A;  3GV1 A;  4ML6 A;  3TKP A;  3IAS 2;  1BJX A;  5H5S A;  1PN9 A;  1B9X C;  1YKC A;  1PKZ A;  1SU9 A;  4K7N A;  1G7O A;  2MMO A;  1EV9 A;  2TRX A;  3VI5 A;  4ACS A;  3ZYW A;  3IXR A;  4JRR A;  5CAX A;  3QPM A;  2DC5 A;  5H5Q A;  5A5K A;  2LV3 A;  1X0R A;  3CXG A;  3SBC A;  3GSS A;  3A2X A;  5D9X A;  1JZO A;  3VWU A;  1O6J A;  4ECI A;  2DIZ A;  4E8E A;  4Q5R A;  1GTB A;  4J57 E;  2WS2 A;  6GST A;  2H74 A;  1KTE A;  1X5D A;  2PUK C;  4P3Y B;  4F9Z A;  4ZB6 A;  2AUV A;  2FY6 A;  2MBT A;  4J56 E;  5D8I A;  3F0I A;  1TU7 A;  1HNC A;  2F9S A;  3VK9 A;  3L9V A;  5AIX A;  2GQK A;  4G2E A;  3WGE A;  2YJ7 A;  1YDK A;  3IR4 A;  3M9J A;  2C3T A;  4HDE A;  5HR1 A;  4I6X A;  2R5G A;  4LMW A;  3LQ7 A;  5GAN D;  5J9C A;  3ERW A;  5G2Z A;  2PER A;  2AB6 A;  4GST A;  3GKX A;  2YCD A;  1H4O A;  2GZZ A;  1BAY A;  1MDJ A;  3UL3 A;  1SK0 A;  4XS1 A;  1NW2 A;  3KTB A;  2AV4 A;  1PL2 A;  1PGT A;  3TJJ A;  5IO0 A;  1TKD B;  2IFQ B;  4ID0 A;  3DWV A;  2GS3 A;  2N5B A;  4NAX A;  4HQS A;  3F8U A;  5C04 A;  2YP6 A;  1Z7P A;  4IJ3 A;  5FT3 A;  2L6C A;  3HJO A;  2H1G A;  2L57 A;  2H0G A;  4IS0 A;  2LST A;  3W8S A;  4MF7 A;  5IO2 A;  1G6W A;  4QL7 A;  2K8S A;  4MH3 A;  2RM6 A;  2K6V A;  2LQQ A;  2WRT A;  3TB2 A;  1DBY A;  4KH7 A;  3TJF A;  2GT5 A;  3W6G A;  1G6Y A;  5JWO B;  3HJP A;  1XXU A;  3APQ A;  1FOV A;  3HYP A;  2YZH A;  1XW9 A;  4D73 B;  5HFG A;  2E2G A;  1AW9 A;  1GH2 A;  1GUH A;  2K18 A;  3TRP A;  3F4R A;  2DJ1 A;  1DE2 A;  2HT9 A;  2H76 A;  5CO3 A;  1SK2 A;  4TN8 A;  2IJY A;  1FB6 A;  1PL1 A;  4N0Z A;  3O3T A;  1EGR A;  4MZB A;  1OC3 A;  4I8B A;  3G9B A;  1MD4 A;  16GS A;  4KCE A;  1R5P A;  4O5R A;  4O32 A;  2GQM A;  5ECM B;  6GSS A;  2MBS A;  4GQC A;  2LJR A;  2PBJ A;  5GSS A;  1SKW B;  3KMO A;  2X8H A;  2CA8 A;  3D21 A;  2PWJ A;  2LS5 A;  4LL1 B;  2LRC A;  4YH2 A;  1SL2 B;  3C7M A;  2GSS A;  1PA3 A;  4EUY A;  3GHA A;  2CQ9 A;  4XRD A;  2VL3 A;  1PSQ A;  1M7T A;  1BX9 A;  2OJL A;  2LJA A;  2B1L A;  4WBJ A;  2HLS A;  4HU9 A;  2M46 A;  2LRN A;  3ERG A;  5B8B A;  1GSU A;  2EC4 A;  3PIN A;  3ZIV A;  3TOU A;  2R6K A;  2H30 A;  2GTU A;  1CQH A;  4LA1 A;  1I9D A;  3ZMK A;  5B8A A;  1THO A;  2Z9S A;  1KBN A;  2GVP A;  3ME8 A;  4L5L A;  1PD2 1;  5G5E A;  1QUW A;  1JFU A;  1E2Y A;  5F05 A;  5D9W A;  4G10 A;  5B6N A;  3KCM A;  2HSY A;  4FYU A;  3Q6O A;  4I97 A;  4IW9 A;  4JR6 A;  2VD1 A;  1X9S B;  4ILF A;  4V1A g;  1IYI A;  1S3A A;  4IBP A;  1T7P B;  4JU5 A;  3FR9 A;  1AQX A;  2OBI A;  2WB9 A;  2V6O A;  5KN0 A;  1ZGN A;  1PX7 A;  4XS6 A;  3C73 A;  3IAM 2;  2DJK A;  2ON7 A;  5D73 A;  2G0F A;  1DSB A;  4KB3 A;  2FWE A;  3IA1 A;  3HZ4 A;  1JZR A;  4IVF A;  4IEL A;  5ELG A;  3C71 A;  2OE3 A;  2HZE A;  2MMZ A;  1SD8 A;  1AQW A;  4BVY A;  5DJM A;  5HFI A;  4EO3 A;  5CRD A;  2HNL A;  2WDU A;  3QAG A;  1M2D A;  5HFK A;  1ZCP A;  3D4M A;  3LGC A;  2REM A;  5H5R A;  1SEN A;  5ECP B;  4IP1 A;  1K0A A;  5ABR A;  4H86 A;  3GKM A;  1WE0 A;  1AQV A;  3GYK A;  1MEK A;  4KAE A;  2HRN A;  2OBK A;  3BOA A;  1U3A A;  3FEU A;  3H93 A;  2C80 A;  5EVO A;  1ZOF A;  2H6Z A;  4GXZ A;  1TDI A;  1GNE A;  2VM1 A;  4RQR A;  3UMA A;  2WFC A;  3HDC A;  3M3M A;  3L0H A;  4OD7 A;  4EDY A;  1JZD A;  3DEX A;  4QQ7 A;  1S3C A;  4KX4 A;  5IMA A;  2EIO A;  1BQ7 A;  13GS A;  2A2S A;  4WR5 A;  3KH9 A;  5HQP A;  2I3Y A;  2H70 A;  2A2R A;  17GS A;  2ES7 A;  4EVM A;  1A8L A;  4PQ1 A;  2HRF A;  1EEJ A;  1RK4 A;  4G19 A;  3HHV A;  1B48 A;  5J9B A;  4XTS A;  1M9B A;  3GNJ A;  2VM2 A;  3BJ5 A;  3WD6 A;  4OMV A;  3IV4 A;  1S3D A;  3NOF A;  4GTU A;  18GS A;  4TVE A;  3M0F A;  1SD9 A;  1XWC A;  3RPP A;  8GSS A;  3ZL5 A;  2YWO A; 
#chains in the Genus database with same CATH topology
 3I9V 2;  1WJK A;  1OKT A;  3KD0 A;  2CZ2 A;  3J7Y b;  2JU5 A;  1MDK A;  1YF1 A;  3KP9 A;  2K9F A;  1J9B A;  4POK A;  1GSS A;  4WR4 A;  3EMP A;  2JAC A;  1EOG A;  2L5L A;  2VCX A;  3CTF A;  2CX4 A;  5DQY A;  3J7Y k;  3IC8 A;  2L4C A;  1OC9 A;  1SJI A;  3HXS A;  2WJU A;  3EE2 A;  2PPT A;  3CMI A;  4POM A;  1SYR A;  3ZVJ D;  1A0F A;  3GUR A;  4WET A;  4BPY A;  4RI6 A;  3U5R E;  3C8E A;  2YAN A;  5G31 A;  1GSY A;  3V1W A;  3WGD A;  3U6V A;  3FY7 A;  3C1S A;  2L4Q A;  4KDX A;  4ZL8 A;  2GZP A;  1XW5 A;  3IHG A;  2R0P A;  3GUS A;  4IHU A;  3TJG A;  3QAW A;  2HSH A;  5IIZ A;  1GL8 A;  5HR2 A;  3TOT A;  3HVS A;  4Q5N A;  1U87 A;  4PUA A;  4X0X A;  4KUN A;  2DML A;  1UVZ A;  4PUR A;  4MNN A;  3A2V A;  2ZUP A;  1A2L A;  2O89 A;  2A4H A;  5KN2 A;  3F9U A;  2KHP A;  4OO5 A;  1FO5 A;  4OWY A;  4YAV A;  2MZC A;  4POB A;  3EPT A;  1JLV A;  1FVK A;  2J23 A;  1GLQ A;  3GX0 A;  4Z2R A;  4WF4 A;  1GSQ A;  4FO5 A;  4K6X A;  3IK7 A;  1ERT A;  5INY A;  4HZ4 A;  1TXX A;  2P31 A;  1OAZ A;  4IQA A;  1N2A A;  4YKG A;  1T4Y A;  5A4U A;  4WF5 A;  4TXV A;  2ZCT A;  1GUL A;  2L5O A;  3MWH A;  4MPF A;  2HZE B;  2YPM A;  4FQU A;  4MZC A;  1EEM A;  1MD3 A;  3RAZ A;  1WPI A;  4BVY B;  2RUF A;  1F6M C;  1XBS A;  2R0C A;  4PNF A;  3FR3 A;  5D93 A;  2H0I A;  4YAP A;  4I5Q A;  2JL4 A;  2YNX A;  1SJ6 A;  3GL5 A;  6GSU A;  3ZIJ A;  3GA4 A;  4ZB9 A;  4JED A;  2DIY A;  5LNK e;  5JCU A;  1HD2 A;  2GGT A;  5DVB A;  4IGJ A;  2X99 A;  1ABA A;  2BJX A;  3L78 A;  2NVL A;  1M2A A;  1GUK A;  2JAD A;  5C00 A;  4LLR A;  2YWM A;  4ISD A;  5B6M A;  5CNW A;  2V1M A;  1GLP A;  5IOX A;  2CVD A;  5G5F A;  3FW2 A;  3LJR A;  3BD2 A;  4KCA A;  4V1A p;  2OE0 A;  1B4Q A;  2KLX A;  1ZYE A;  2HRK A;  4ULX A;  4KW6 A;  2N5A A;  4N0V A;  4J2F A;  4MK3 A;  1I5G A;  1XWB A;  1EP8 A;  3F3Q A;  4WKW A;  2X64 A;  2GSR A;  1T4Z A;  2CV4 A;  1GTA A;  2KP1 A;  2IPA A;  2OAD A;  3UEM A;  3VI7 A;  4TKY A;  1WMJ A;  2NDO A;  3E0U A;  2HRA A;  2BTO T;  1USB A;  2B5E A;  1O73 A;  1Y25 A;  4DVC A;  4PX1 A;  4KDU A;  5KN1 A;  4AF2 A;  4LMV A;  5DBQ A;  1R5A A;  3ERF A;  3WT2 A;  1XWK A;  2OA7 A;  3ZTL A;  3F3R A;  6GSX A;  2HE3 A;  4V2M A;  2C0F A;  4NWY A;  1N8J A;  5F07 A;  3IC4 A;  5J5N A;  1QFN A;  4O7H A;  5KN3 A;  3EUR A;  3LOR A;  3VLN A;  1A8Y A;  2PVQ A;  1T1V A;  3ZVJ A;  1WP0 A;  1ZYP A;  4K9Z A;  3CYN A;  3TUE A;  1OC9 B;  3G7I A;  3LYP A;  5CRE A;  11GS A;  3M9K A;  1WIK A;  2XBQ A;  3W8J A;  2B3S A;  2DJJ A;  4AGS A;  1SKS B;  3HVX A;  4ECC A;  1O8X A;  5G1L A;  3QDN A;  3GST A;  2H1D A;  4MJA A;  1X5E A;  12GS A;  2HSM A;  2B6M A;  4IKH A;  2ALB A;  4BWQ A;  1F3B A;  1BED A;  5G30 A;  3KIJ A;  20GS A;  4NXI A;  2H71 A;  3A2W A;  3KH7 A;  2LRT A;  2FD3 A;  2YOI A;  1TRS A;  5AIV A;  1TTZ A;  1ZZY A;  2LUS A;  2VLT A;  2R0G A;  4K0G A;  3CTG A;  5KEJ A;  4ICY A;  3F4T A;  3D5J A;  1A23 A;  4IN0 A;  2VO4 A;  1JHB A;  2A4V A;  5IMV A;  2WGR A;  2HXK A;  1J08 A;  5IOW A;  2YV7 A;  3GRX A;  1AUC A;  1T00 A;  4KDY A;  2GZY A;  2NBS A;  3JCM L;  4MF6 A;  1K0C A;  6GSW A;  4MCU A;  4JBB A;  3R3E A;  2H19 A;  4Z7X A;  3IRA A;  5FWG A;  1MTC A;  2CAI A;  2CVK A;  2VCT A;  3UAP A;  2MYG A;  1V58 A;  1ZYQ B;  1TK8 B;  1ERV A;  4RI7 A;  4F0B A;  5AIS A;  1X5C A;  5ECS A;  4EKZ A;  2FLS A;  3AY8 A;  2D2Z A;  2L59 A;  1O81 A;  2H01 A;  2P0G A;  3BCI A;  2J9H A;  1TW9 A;  5ECQ B;  1ZL9 A;  1EZK A;  3H79 A;  2EIR A;  4ZL7 A;  1A0R P;  1XZO A;  4ML1 A;  2CT6 A;  3TKR A;  4IP6 A;  1ST9 A;  3APS A;  3TJB A;  1UN2 A;  5ECH B;  3QOU A;  2VL9 A;  4L5O A;  3GH9 A;  2DMM A;  3RBT A;  2E0Q A;  1M0U A;  1F37 A;  1VF2 A;  1PFO A;  1R7H A;  3TRQ A;  5DCH A;  3HZ8 A;  3TKS C;  2DJ0 A;  3QAV A;  2LEG A;  4HUA A;  1NM3 A;  1F3A A;  1GRX A;  3FMW A;  1EOH A;  3F6D A;  1V40 A;  3ZFB A;  4K7I A;  4L0U A;  4OFT A;  19GS A;  3UAR A;  3FZ5 A;  3N9J A;  4QL9 A;  2FNO A;  1FHE A;  5LD0 A;  1U6T A;  4AJ7 A;  4EIQ A;  1JLW A;  3EWL A;  2TRC P;  4G0I A;  2VL2 A;  4ZBB A;  1YKA A;  2C8U A;  4MA9 A;  2PMT A;  3ZRD A;  3PH9 A;  14GS A;  3K8N A;  4YQU A;  3HVN A;  3ED3 A;  2F51 A;  1X9M B;  4I2T A;  2GSQ A;  3CBU A;  3DKS A;  3KGK A;  3DGQ A;  4MMM A;  4AJ8 A;  2KOK A;  4MH2 A;  2CAQ A;  4HU7 A;  1XIY A;  2RUE A;  2MMN A;  2H72 A;  1VF3 A;  4EXJ A;  1OYJ A;  3VWW A;  3APO A;  3LXT A;  4OO4 A;  3HJM A;  5J4U A;  3LWA A;  1PQN A;  1B9Y C;  5F06 A;  3KJY A;  3O6T A;  1FAA A;  5F8B A;  2DLX A;  3UBK A;  2FWH A;  2PU9 C;  2VCV A;  3TJK A;  3TKS A;  1GP1 A;  4ECB A;  1K0O A;  4EDZ A;  4ZBA A;  2ON5 A;  3TCO A;  3RPN A;  1F2E A;  5A4V A;  1UC7 A;  2WUL A;  3ZZX A;  1G0T A;  1Q4J A;  3DRN A;  4F0C A;  4ECJ A;  1VF4 A;  5B7C A;  2QSI A;  1IYH A;  3TRX A;  1CQG A;  1V9W A;  4PNG A;  1O7U A;  4EL1 A;  2LTK A;  3Q74 A;  2PVO C;  5JCW A;  3GMF A;  3LXZ A;  4F2I A;  4POL A;  2N5F A;  2IL3 A;  1TI1 A;  1JZW A;  5DAK A;  1U88 A;  2EIQ A;  1FB0 A;  5AN1 A;  5ENU A;  2FA4 A;  1ML6 A;  3DXB A;  4ZIJ A;  1AIU A;  2I9H A;  3QD9 A;  3ZIT A;  4F82 A;  3RHC A;  2B5X A;  3FRC A;  4K1F A;  5ID2 A;  3CSJ A;  1V57 A;  1F9M A;  3D4T A;  3Q18 A;  2M72 A;  4HJ2 A;  4V2N A;  2MMA A;  3H1N A;  4NHW A;  3C1R A;  1AC1 A;  3F6F A;  5D9V A;  1OVN A;  1NHY A;  3SWL A;  3WT1 A;  3WYW A;  3US3 A;  1SKR B;  2XBI A;  3F4S A;  1EP7 A;  5ELA A;  1Z3E A;  4GLT A;  2OE1 A;  1WWJ A;  2RLI A;  1M3J A;  5ECN B;  2DKI A;  2FHE A;  3IPZ A;  2O7K A;  4XIH A;  22GS A;  5GZZ B;  4GQF A;  3EU3 A;  2RM5 A;  1HNB A;  3IK9 A;  4HSC X;  2LNS A;  3GTU A;  1T8E B;  1QK8 A;  3PGT A;  1YEX A;  1XVQ A;  3O76 A;  4DSS A;  4OFN A;  1KNG A;  1TP9 A;  3M8N A;  1TJD A;  2C4J A;  3GX8 A;  3CSH A;  4ZIL A;  2I1U A;  3VWX A;  1TRU A;  2C0G A;  2VCQ A;  2IME A;  2R4V A;  3L4N A;  2C0E A;  4EF0 A;  4HI7 A;  1EGO A;  1TK0 B;  9GSS A;  4YQV A;  2YWN A;  3QFA C;  1NHO A;  2VUP A;  2IIY A;  2E2M A;  4HS1 A;  1QQ2 A;  4O5Q A;  2DJ2 A;  5DAL A;  2H73 A;  1QXH A;  3F63 A;  3A5W A;  5DCG A;  5GAP D;  2C3Q A;  3GIX A;  3D0Z A;  3DVX A;  3CRU A;  1K3Y A;  2KP2 A;  4XS4 A;  3P8W A;  1Z6M A;  4GSS A;  1Y6E A;  4JZQ A;  3FR6 A;  4TR0 A;  4EE0 A;  3RDW A;  3GH6 A;  1T3B A;  5BMU A;  1XOA A;  3DD3 A;  3EIN A;  1URM A;  2VLV A;  1BG5 A;  1DUG A;  2YZU A;  3E3E A;  2G2Q A;  1K0N A;  5CRG A;  2H1B A;  4N10 A;  5GST A;  1E6B A;  2PN8 A;  4X4J A;  2FCH A;  3GKN A;  1AXD A;  2AAW A;  4KGI A;  5E59 A;  3ZFL A;  3EMX A;  3M1G A;  4BIK A;  1YY7 A;  2GDR A;  5ECK B;  1VF1 A;  3D22 A;  1K3L A;  2CVB A;  2YJH A;  4I2U A;  3UVT A;  1X9W B;  2CZ3 A;  2B5Y A;  3FYG A;  3HY2 A;  4G9H A;  1BYE A;  1VRS D;  3CQF A;  4F03 A;  3VPQ A;  6GSV A;  2JZS A;  4NV5 A;  3H4K A;  5KOX A;  4N11 A;  3UJ1 A;  1OKD A;  1GUM A;  4TR4 A;  2H1A A;  3PR8 A;  2XPD A;  4MP4 A;  3FHK A;  5COH A;  4HEA 2;  2IN3 A;  2P5Q A;  3I6A A;  3ZML A;  2B7J A;  5L71 A;  4FYC A;  2VCW A;  4NPB A;  5A4W A;  1SL1 B;  2LJK A;  4CW9 A;  4DSQ A;  1SYX A;  4GRF A;  2QKE A;  4GCI A;  3LFL A;  1TI3 A;  1ZMA A;  2KUC A;  4L8E A;  4YQM A;  4ZB8 A;  5DAK B;  4ZBD A;  2C1Y A;  1Z9H A;  2O85 A;  1RQM A;  5IQY A;  3OR5 A;  4KF9 A;  4KND A;  4MLY A;  1B4P A;  5JCG A;  5E4W A;  3FKF A;  4TXO B;  2H75 A;  3DIE A;  1NSW A;  1RW1 A;  2F8F A;  2H66 A;  3GFK A;  4MJE A;  5ECL B;  1FW1 A;  3LW9 A;  1XFL A;  4OCF A;  2WCI A;  2C3N A;  1GWC A;  4PQH A;  3TKS E;  1SL0 B;  3VFI A;  2JZR A;  5DJL A;  3QR6 A;  3KEB A;  1W4V A;  3IE3 A;  4K8M A;  3UBL A;  2FUG 2;  5ID2 B;  3I43 A;  4PTS A;  5CRW A;  1O85 A;  4HOJ A;  1DE1 A;  4KSO A;  3MAK A;  1U3I A;  4JE1 A;  5CYY A;  5EL8 A;  2O87 A;  1OE7 A;  4PQI A;  5F0G A;  3KM6 A;  2ZNM A;  2VIM A;  1XG8 A;  4FH8 A;  4HQZ A;  1HNA A;  3LYK A;  4DEJ A;  4WBR D;  1KEB A;  3VPT A;  5JWR B;  1GNW A;  2V41 A;  4RUV A;  3LEF A;  2AHE A;  4YKF A;  2H0H A;  1K0M A;  2PGT A;  2WZ9 A;  1SK1 A;  5HR0 A;  4Q5F A;  3S9F A;  3G7Y A;  2QGV A;  5IMD A;  1C72 A;  3GTU B;  3WGX A;  3HA9 A;  4G0L A;  4DSS B;  5JWQ B;  1VGL A;  3G7J A;  3UVH A;  3MSZ A;  1PN0 A;  2B7K A;  2IWT A;  4MF5 A;  1PX6 A;  3GN3 A;  1PRX A;  1XWG A;  4MJC A;  2QC7 A;  2VL2 C;  4XHM A;  4TOP A;  4WEY A;  5DAL B;  2OKA A;  3KMN A;  2RII A;  3R2Q A;  2HZF A;  2I4A A;  3P7X A;  3KXO A;  4MZW A;  5ECO B;  2F8A A;  3ME7 A;  2LKU A;  5FHI A;  4TR1 A;  3QCP A;  5IM9 A;  4IQ1 A;  4XS4 B;  3KP8 A;  1YJ6 A;  4KE3 A;  5ECR B;  1FVJ A;  2FA8 A;  3NIV A;  1HQO A;  4BL7 A;  5J41 A;  4TR3 A;  1J0F A;  3IOS A;  4K7O A;  1Z6N A;  2K8V A;  4XCS A;  2FGX A;  2R2J A;  3HVV A;  1EV4 A;  5CRH A;  2F3M A;  1GTI A;  2GST A;  4NV2 A;  1K0D A;  1TK5 B;  4BWS A;  2R3X A;  2NTO A;  2H6X A;  2LNT A;  1YEP A;  2B1K A;  2H8L A;  2VCZ A;  2P5R A;  5D9T A;  2VOC A;  3QMX A;  1OE8 A;  5ECI B;  3UIW A;  5LCZ A;  1XVW A;  2X8G A;  3IDV A;  4CHS A;  3GKK A;  1GSE A;  4BA7 A;  7GSS A;  1YF0 A;  3H8Q A;  1A24 A;  4N30 A;  3RHB A;  3EU4 A;  2OAC A;  1FG4 A;  3L9S A;  1M9A A;  3QFB C;  5IMC A;  2QA2 A;  2GT6 A;  3DYR A;  4HJM A;  2IMF A;  3LSZ A;  2IMK A;  2M80 A;  3Q19 A;  4PXO A;  1EWX A;  2IMI A;  4JR4 A;  5HR3 A;  2XPE A;  1O8W A;  2JSZ A;  3TDG A;  5G1K A;  4OCE A;  4KA0 A;  5IPH A;  4FIW A;  1XW6 A;  4MAB A;  3FZA A;  2GLR A;  4MPG A;  1V98 A;  3ZRE A;  5EY6 A;  1Q98 A;  3L9U A;  2YWI A;  2V32 A;  4AJ6 A;  1HYU A;  4ZXG A;  3N5O A;  4KSM A;  1TU8 A;  4X1U A;  1H75 A;  1ERW A;  2DSA A;  4GSN A;  2TIR A;  1XOB A;  3PPU A;  3EYT A;  3VUR A;  2AJQ B;  3CSI A;  1UA5 A;  5DQS A;  1K3O A;  1YZX A;  3A3T A;  2CX3 A;  2XC2 A;  4NMU A;  5AGY A;  1MDI A;  4LL4 B;  1B8X A;  10GS A;  4XRA A;  2DJ3 A;  3UOM A;  2HFD A;  1GSD A;  5EPF A;  1A2J A;  4MJB A;  3HKR A;  4E8H A;  2YV9 A;  1THX A;  1AAZ A;  4BVX A;  2HYX A;  4NHZ A;  1QGV A;  4PUF C;  3D6I A;  3ISO A;  2E7P A;  3IBH A;  2O8V B;  2IFQ A;  5DDL A;  3IHQ A;  2V2G A;  4L0W A;  5D96 A;  3CRT A;  2UZ8 A;  3LG6 A;  2X8C A;  1G7E A;  5IMZ A;  2JSY A;  1TRW A;  3BCK A;  4IJI A;  4HZ2 A;  2GQL A;  6GSY A;  4GWR A;  1ERU A;  1GTU A;  3P2A A;  4V2L A;  5IPG A;  3BBY A;  1R26 A;  4GF0 A;  5KOW A;  1LBK A;  1PMT A;  1XPV A;  1YQ1 A;  2BMX A;  4TXO A;  3DVW A;  3GL3 A;  1QMV A;  3ZLP A;  1R4W A;  1SJZ A;  3TGZ A;  4EC0 A;  1TOF A;  1Z5Y E;  3DML A;  2NPB A;  4K0N A;  4TW5 A;  1LJR A;  3FZ9 A;  2VAF A;  1PKW A;  4O92 A;  3MNG A;  1V2A A;  3VWV A;  2V6K A;  4WXT A;  2FWG A;  4FYB A;  3EC3 A;  1S3R A;  1K0B A;  3HD5 A;  4D73 A;  5J3R A;  2L6D A;  4O5U A;  3MIX A;  1WOU A;  4DSR A;  1Z7R A;  2HI7 A;  1GSF A;  4MDC A;  2H6Y A;  4PGT A;  4CDO A;  2LQO A;  2YN1 A;  2DKH A;  3I69 A;  2DBC A;  1ILO A;  3HCZ A;  3P90 A;  3EVI A;  2XHF A;  3MDK A;  4Z2T A;  1ACV A;  2IMD A;  1M99 A;  4TR1 B;  4K2D A;  2VD0 A;  1TRV A;  3TKQ A;  2I81 A;  1ON4 A;  3KZQ A;  1LU4 A;  4Q5Q A;  5CP1 A;  4A5P A;  2AYT A;  2FWF A;  3KTL A;  4OFM A;  1W89 A;  5IMF A;  1M2B A;  4BL7 B;  4TRX A;  3FZ4 A;  3NZN A;  1A2M A;  2R37 A;  1WRY A;  1OC8 A;  4X43 A;  2JZT A;  4RQX A;  3FK8 A;  3E9J B;  4ZL9 A;  2C0D A;  1XWA A;  2VLU A;  1XCC A;  3GV1 A;  4ML6 A;  3TKP A;  3IAS 2;  1BJX A;  5H5S A;  1PN9 A;  1B9X C;  1YKC A;  1PKZ A;  1SU9 A;  4K7N A;  1G7O A;  2MMO A;  1EV9 A;  2TRX A;  3VI5 A;  4Z2U A;  4ACS A;  3ZYW A;  3IXR A;  4JRR A;  5CAX A;  3QPM A;  2DC5 A;  5H5Q A;  5A5K A;  2LV3 A;  1X0R A;  3CXG A;  3SBC A;  3GSS A;  3A2X A;  5D9X A;  1JZO A;  3VWU A;  4G0K A;  1O6J A;  4ECI A;  2DIZ A;  4E8E A;  4Q5R A;  1GTB A;  4J57 E;  2WS2 A;  1M3I A;  6GST A;  2H74 A;  1KTE A;  1X5D A;  2PUK C;  4P3Y B;  4F9Z A;  4ZB6 A;  2AUV A;  2FY6 A;  2MBT A;  4J56 E;  5D8I A;  3F0I A;  1TU7 A;  1HNC A;  2F9S A;  3VK9 A;  3L9V A;  5AIX A;  2GQK A;  4G2E A;  3WGE A;  2YJ7 A;  1YDK A;  3IR4 A;  3M9J A;  2C3T A;  4HDE A;  5HR1 A;  4I6X A;  2R5G A;  4LMW A;  2A2P A;  3LQ7 A;  5GAN D;  5J9C A;  3ERW A;  5G2Z A;  2PER A;  4EIP A;  2AB6 A;  4GST A;  2X4A A;  3GKX A;  2YCD A;  1H4O A;  2GZZ A;  1BAY A;  1MDJ A;  3UL3 A;  1SK0 A;  4XS1 A;  4BVX B;  1NW2 A;  3KTB A;  2AV4 A;  1PL2 A;  1PGT A;  3TJJ A;  4K2X A;  5IO0 A;  1TKD B;  2IFQ B;  4ID0 A;  3DWV A;  2GS3 A;  2N5B A;  4NAX A;  4HQS A;  3F8U A;  5C04 A;  2YP6 A;  1Z7P A;  4IJ3 A;  5FT3 A;  2L6C A;  3HJO A;  2H1G A;  2L57 A;  2H0G A;  4IS0 A;  2LST A;  3W8S A;  4MF7 A;  5IO2 A;  1G6W A;  4QL7 A;  2K8S A;  4MH3 A;  2RM6 A;  2K6V A;  2LQQ A;  2WRT A;  3TB2 A;  1DBY A;  4KH7 A;  3TJF A;  2GT5 A;  1ZYN A;  3W6G A;  1G6Y A;  4CY6 A;  5JWO B;  3HJP A;  1XXU A;  3APQ A;  1FOV A;  3HYP A;  2YZH A;  1XW9 A;  4D73 B;  5HFG A;  2E2G A;  1AW9 A;  1GH2 A;  1GUH A;  2K18 A;  3TRP A;  3F4R A;  2DJ1 A;  1DE2 A;  2HT9 A;  2H76 A;  5CO3 A;  3A5I A;  1SK2 A;  4TN8 A;  2IJY A;  1FB6 A;  1PL1 A;  4N0Z A;  3O3T A;  1EGR A;  4MZB A;  1OC3 A;  4I8B A;  3G9B A;  1MD4 A;  16GS A;  4KCE A;  1R5P A;  4O5R A;  4O32 A;  4K5S A;  2GQM A;  5ECM B;  6GSS A;  2MBS A;  4GQC A;  2LJR A;  2PBJ A;  5GSS A;  1SKW B;  3KMO A;  2X8H A;  2CA8 A;  3D21 A;  2PWJ A;  2LS5 A;  4LL1 B;  2LRC A;  4YH2 A;  1SL2 B;  3C7M A;  2GSS A;  1PA3 A;  4EUY A;  3GHA A;  2CQ9 A;  4XRD A;  2VL3 A;  1PSQ A;  1M7T A;  1BX9 A;  2OJL A;  2LJA A;  2B1L A;  4WBJ A;  2HLS A;  4HU9 A;  2M46 A;  2LRN A;  3ERG A;  5B8B A;  4K5R A;  4CY8 A;  1GSU A;  2EC4 A;  3PIN A;  3ZIV A;  3TOU A;  2R6K A;  2H30 A;  4USS A;  2GTU A;  1CQH A;  4LA1 A;  1I9D A;  3ZMK A;  5B8A A;  1THO A;  2Z9S A;  1KBN A;  5BRT A;  2GVP A;  3ME8 A;  4L5L A;  1PD2 1;  5G5E A;  1QUW A;  1JFU A;  1E2Y A;  2X49 A;  5F05 A;  5D9W A;  4G10 A;  5B6N A;  3KCM A;  2HSY A;  4FYU A;  3Q6O A;  4I97 A;  4IW9 A;  4JR6 A;  2VD1 A;  1X9S B;  3MYD A;  4ILF A;  4V1A g;  1IYI A;  1S3A A;  4IBP A;  1T7P B;  4JU5 A;  3FR9 A;  1AQX A;  2OBI A;  2WB9 A;  2V6O A;  5KN0 A;  1ZGN A;  1PX7 A;  4XS6 A;  3C73 A;  3IAM 2;  2DJK A;  2ON7 A;  5D73 A;  2G0F A;  1DSB A;  4KB3 A;  2FWE A;  3IA1 A;  3HZ4 A;  1JZR A;  4IVF A;  4IEL A;  5ELG A;  3C71 A;  2OE3 A;  2HZE A;  2MMZ A;  1SD8 A;  1AQW A;  4BVY A;  5DJM A;  5HFI A;  4EO3 A;  5CRD A;  2HNL A;  2WDU A;  3QAG A;  1M2D A;  5HFK A;  1ZCP A;  3D4M A;  3LGC A;  2REM A;  5H5R A;  1SEN A;  5ECP B;  4IP1 A;  1K0A A;  5ABR A;  4H86 A;  3GKM A;  1WE0 A;  1AQV A;  3GYK A;  1MEK A;  4KAE A;  1FOH A;  2HRN A;  2OBK A;  3BOA A;  1U3A A;  3FEU A;  3H93 A;  2C80 A;  5EVO A;  1ZOF A;  2H6Z A;  4GXZ A;  1TDI A;  1GNE A;  2VM1 A;  4RQR A;  3UMA A;  2WFC A;  3HDC A;  3M3M A;  3L0H A;  4OD7 A;  4EDY A;  1JZD A;  3DEX A;  4QQ7 A;  1S3C A;  4KX4 A;  5IMA A;  2EIO A;  1BQ7 A;  13GS A;  2A2S A;  4WR5 A;  3KH9 A;  5HQP A;  2I3Y A;  2H70 A;  2QA1 A;  2A2R A;  17GS A;  2ES7 A;  4EVM A;  1A8L A;  4PQ1 A;  2HRF A;  1EEJ A;  1RK4 A;  4G19 A;  3HHV A;  1B48 A;  5J9B A;  4XTS A;  1M9B A;  3GNJ A;  2VM2 A;  3BJ5 A;  3WD6 A;  4OMV A;  3IV4 A;  1S3D A;  3NOF A;  4GTU A;  18GS A;  4TVE A;  3M0F A;  1SD9 A;  1XWC A;  3RPP A;  8GSS A;  3ZL5 A;  2YWO A; 
#chains in the Genus database with same CATH homology
 3I9V 2;  1WJK A;  1OKT A;  3KD0 A;  2CZ2 A;  3J7Y b;  2JU5 A;  1MDK A;  1YF1 A;  3KP9 A;  2K9F A;  1J9B A;  4POK A;  1GSS A;  4WR4 A;  3EMP A;  2JAC A;  1EOG A;  2L5L A;  2VCX A;  3CTF A;  2CX4 A;  5DQY A;  3J7Y k;  3IC8 A;  2L4C A;  1OC9 A;  1SJI A;  3HXS A;  2WJU A;  3EE2 A;  2PPT A;  3CMI A;  4POM A;  1SYR A;  3ZVJ D;  1A0F A;  3GUR A;  4WET A;  4BPY A;  4RI6 A;  3U5R E;  3C8E A;  2YAN A;  5G31 A;  1GSY A;  3V1W A;  3WGD A;  3U6V A;  3FY7 A;  3C1S A;  2L4Q A;  4KDX A;  4ZL8 A;  2GZP A;  1XW5 A;  3IHG A;  2R0P A;  3GUS A;  4IHU A;  3TJG A;  3QAW A;  2HSH A;  5IIZ A;  1GL8 A;  5HR2 A;  3TOT A;  3HVS A;  4Q5N A;  1U87 A;  4PUA A;  4X0X A;  4KUN A;  2DML A;  1UVZ A;  4PUR A;  4MNN A;  3A2V A;  2ZUP A;  1A2L A;  2O89 A;  2A4H A;  5KN2 A;  3F9U A;  2KHP A;  4OO5 A;  1FO5 A;  4OWY A;  4YAV A;  2MZC A;  4POB A;  3EPT A;  1JLV A;  1FVK A;  2J23 A;  1GLQ A;  3GX0 A;  4Z2R A;  4WF4 A;  1GSQ A;  4FO5 A;  4K6X A;  3IK7 A;  1ERT A;  5INY A;  4HZ4 A;  1TXX A;  2P31 A;  1OAZ A;  4IQA A;  1N2A A;  4YKG A;  1T4Y A;  5A4U A;  4WF5 A;  4TXV A;  2ZCT A;  1GUL A;  2L5O A;  3MWH A;  4MPF A;  2HZE B;  2YPM A;  4FQU A;  4MZC A;  1EEM A;  1MD3 A;  3RAZ A;  1WPI A;  4BVY B;  2RUF A;  1F6M C;  1XBS A;  2R0C A;  4PNF A;  3FR3 A;  5D93 A;  2H0I A;  4YAP A;  4I5Q A;  2JL4 A;  2YNX A;  1SJ6 A;  3GL5 A;  6GSU A;  3ZIJ A;  3GA4 A;  4ZB9 A;  4JED A;  2DIY A;  5LNK e;  5JCU A;  1HD2 A;  2GGT A;  5DVB A;  4IGJ A;  2X99 A;  1ABA A;  2BJX A;  3L78 A;  2NVL A;  1M2A A;  1GUK A;  2JAD A;  5C00 A;  4LLR A;  2YWM A;  4ISD A;  5B6M A;  5CNW A;  2V1M A;  1GLP A;  5IOX A;  2CVD A;  5G5F A;  3FW2 A;  3LJR A;  3BD2 A;  4KCA A;  4V1A p;  2OE0 A;  1B4Q A;  2KLX A;  1ZYE A;  2HRK A;  4ULX A;  4KW6 A;  2N5A A;  4N0V A;  4J2F A;  4MK3 A;  1I5G A;  1XWB A;  1EP8 A;  3F3Q A;  4WKW A;  2X64 A;  2GSR A;  1T4Z A;  2CV4 A;  1GTA A;  2KP1 A;  2IPA A;  2OAD A;  3UEM A;  3VI7 A;  4TKY A;  1WMJ A;  2NDO A;  3E0U A;  2HRA A;  2BTO T;  1USB A;  2B5E A;  1O73 A;  1Y25 A;  4DVC A;  4PX1 A;  4KDU A;  5KN1 A;  4AF2 A;  4LMV A;  5DBQ A;  1R5A A;  3ERF A;  3WT2 A;  1XWK A;  2OA7 A;  3ZTL A;  3F3R A;  6GSX A;  2HE3 A;  4V2M A;  2C0F A;  4NWY A;  1N8J A;  5F07 A;  3IC4 A;  5J5N A;  1QFN A;  4O7H A;  5KN3 A;  3EUR A;  3LOR A;  3VLN A;  1A8Y A;  2PVQ A;  1T1V A;  3ZVJ A;  1WP0 A;  1ZYP A;  4K9Z A;  3CYN A;  3TUE A;  1OC9 B;  3G7I A;  3LYP A;  5CRE A;  11GS A;  3M9K A;  1WIK A;  2XBQ A;  3W8J A;  2B3S A;  2DJJ A;  4AGS A;  1SKS B;  3HVX A;  4ECC A;  1O8X A;  5G1L A;  3QDN A;  3GST A;  2H1D A;  4MJA A;  1X5E A;  12GS A;  2HSM A;  2B6M A;  4IKH A;  2ALB A;  4BWQ A;  1F3B A;  1BED A;  5G30 A;  3KIJ A;  20GS A;  4NXI A;  2H71 A;  3A2W A;  3KH7 A;  2LRT A;  2FD3 A;  2YOI A;  1TRS A;  5AIV A;  1TTZ A;  1ZZY A;  2LUS A;  2VLT A;  2R0G A;  4K0G A;  3CTG A;  5KEJ A;  4ICY A;  3F4T A;  3D5J A;  1A23 A;  4IN0 A;  2VO4 A;  1JHB A;  2A4V A;  5IMV A;  2WGR A;  2HXK A;  1J08 A;  5IOW A;  2YV7 A;  3GRX A;  1AUC A;  1T00 A;  4KDY A;  2GZY A;  2NBS A;  3JCM L;  4MF6 A;  1K0C A;  6GSW A;  4MCU A;  4JBB A;  3R3E A;  2H19 A;  4Z7X A;  3IRA A;  5FWG A;  1MTC A;  2CAI A;  2CVK A;  2VCT A;  3UAP A;  2MYG A;  1V58 A;  1ZYQ B;  1TK8 B;  1ERV A;  4RI7 A;  4F0B A;  5AIS A;  1X5C A;  5ECS A;  4EKZ A;  2FLS A;  3AY8 A;  2D2Z A;  2L59 A;  1O81 A;  2H01 A;  2P0G A;  3BCI A;  2J9H A;  1TW9 A;  5ECQ B;  1ZL9 A;  1EZK A;  3H79 A;  2EIR A;  4ZL7 A;  1A0R P;  1XZO A;  4ML1 A;  2CT6 A;  3TKR A;  4IP6 A;  1ST9 A;  3APS A;  3TJB A;  1UN2 A;  5ECH B;  3QOU A;  2VL9 A;  4L5O A;  3GH9 A;  2DMM A;  3RBT A;  2E0Q A;  1M0U A;  1F37 A;  1VF2 A;  1R7H A;  3TRQ A;  5DCH A;  3HZ8 A;  3TKS C;  2DJ0 A;  3QAV A;  2LEG A;  4HUA A;  1NM3 A;  1F3A A;  1GRX A;  3FMW A;  1EOH A;  3F6D A;  1V40 A;  3ZFB A;  4K7I A;  4L0U A;  4OFT A;  19GS A;  3UAR A;  3FZ5 A;  3N9J A;  4QL9 A;  2FNO A;  1FHE A;  5LD0 A;  1U6T A;  4AJ7 A;  4EIQ A;  1JLW A;  3EWL A;  2TRC P;  4G0I A;  2VL2 A;  4ZBB A;  1YKA A;  2C8U A;  4MA9 A;  2PMT A;  3ZRD A;  3PH9 A;  14GS A;  3K8N A;  4YQU A;  3ED3 A;  2F51 A;  1X9M B;  4I2T A;  2GSQ A;  3CBU A;  3DKS A;  3KGK A;  3DGQ A;  4MMM A;  4AJ8 A;  2KOK A;  4MH2 A;  2CAQ A;  4HU7 A;  1XIY A;  2RUE A;  2MMN A;  2H72 A;  1VF3 A;  4EXJ A;  1OYJ A;  3VWW A;  3APO A;  3LXT A;  4OO4 A;  3HJM A;  5J4U A;  3LWA A;  1PQN A;  1B9Y C;  5F06 A;  3KJY A;  3O6T A;  1FAA A;  5F8B A;  2DLX A;  3UBK A;  2FWH A;  2PU9 C;  2VCV A;  3TJK A;  3TKS A;  1GP1 A;  4ECB A;  1K0O A;  4EDZ A;  4ZBA A;  2ON5 A;  3TCO A;  3RPN A;  1F2E A;  5A4V A;  1UC7 A;  2WUL A;  3ZZX A;  1G0T A;  1Q4J A;  3DRN A;  4F0C A;  4ECJ A;  1VF4 A;  5B7C A;  2QSI A;  1IYH A;  3TRX A;  1CQG A;  1V9W A;  4PNG A;  1O7U A;  4EL1 A;  2LTK A;  3Q74 A;  2PVO C;  5JCW A;  3GMF A;  3LXZ A;  4F2I A;  4POL A;  2N5F A;  2IL3 A;  1TI1 A;  1JZW A;  5DAK A;  1U88 A;  2EIQ A;  1FB0 A;  5AN1 A;  5ENU A;  2FA4 A;  1ML6 A;  3DXB A;  4ZIJ A;  1AIU A;  2I9H A;  3QD9 A;  3ZIT A;  4F82 A;  3RHC A;  2B5X A;  3FRC A;  4K1F A;  5ID2 A;  3CSJ A;  1V57 A;  1F9M A;  3D4T A;  3Q18 A;  2M72 A;  4HJ2 A;  4V2N A;  2MMA A;  3H1N A;  4NHW A;  3C1R A;  1AC1 A;  3F6F A;  5D9V A;  1OVN A;  1NHY A;  3SWL A;  3WT1 A;  3WYW A;  3US3 A;  1SKR B;  2XBI A;  3F4S A;  1EP7 A;  5ELA A;  1Z3E A;  4GLT A;  2OE1 A;  1WWJ A;  2RLI A;  5ECN B;  2DKI A;  2FHE A;  3IPZ A;  2O7K A;  4XIH A;  22GS A;  5GZZ B;  4GQF A;  3EU3 A;  2RM5 A;  1HNB A;  3IK9 A;  2LNS A;  3GTU A;  1T8E B;  1QK8 A;  3PGT A;  1YEX A;  1XVQ A;  3O76 A;  4DSS A;  4OFN A;  1KNG A;  1TP9 A;  3M8N A;  1TJD A;  2C4J A;  3GX8 A;  3CSH A;  4ZIL A;  2I1U A;  3VWX A;  1TRU A;  2C0G A;  2VCQ A;  2IME A;  2R4V A;  3L4N A;  2C0E A;  4EF0 A;  4HI7 A;  1EGO A;  1TK0 B;  9GSS A;  4YQV A;  2YWN A;  3QFA C;  1NHO A;  2VUP A;  2IIY A;  2E2M A;  4HS1 A;  1QQ2 A;  4O5Q A;  2DJ2 A;  5DAL A;  2H73 A;  1QXH A;  3F63 A;  3A5W A;  5DCG A;  5GAP D;  2C3Q A;  3GIX A;  3D0Z A;  3DVX A;  3CRU A;  1K3Y A;  2KP2 A;  4XS4 A;  3P8W A;  1Z6M A;  4GSS A;  1Y6E A;  4JZQ A;  3FR6 A;  4TR0 A;  4EE0 A;  3RDW A;  3GH6 A;  1T3B A;  5BMU A;  1XOA A;  3DD3 A;  3EIN A;  1URM A;  2VLV A;  1BG5 A;  1DUG A;  2YZU A;  3E3E A;  2G2Q A;  1K0N A;  5CRG A;  2H1B A;  4N10 A;  5GST A;  1E6B A;  2PN8 A;  4X4J A;  2FCH A;  3GKN A;  1AXD A;  2AAW A;  4KGI A;  5E59 A;  3ZFL A;  3EMX A;  3M1G A;  1YY7 A;  2GDR A;  5ECK B;  1VF1 A;  3D22 A;  1K3L A;  2CVB A;  2YJH A;  4I2U A;  3UVT A;  1X9W B;  2CZ3 A;  2B5Y A;  3FYG A;  3HY2 A;  4G9H A;  1BYE A;  1VRS D;  4F03 A;  3VPQ A;  6GSV A;  2JZS A;  4NV5 A;  3H4K A;  5KOX A;  4N11 A;  3UJ1 A;  1OKD A;  1GUM A;  4TR4 A;  2H1A A;  3PR8 A;  2XPD A;  4MP4 A;  3FHK A;  5COH A;  4HEA 2;  2IN3 A;  2P5Q A;  3I6A A;  3ZML A;  2B7J A;  5L71 A;  4FYC A;  2VCW A;  4NPB A;  5A4W A;  1SL1 B;  2LJK A;  4CW9 A;  4DSQ A;  1SYX A;  4GRF A;  2QKE A;  4GCI A;  3LFL A;  1TI3 A;  1ZMA A;  2KUC A;  4L8E A;  4YQM A;  4ZB8 A;  5DAK B;  4ZBD A;  2C1Y A;  1Z9H A;  2O85 A;  1RQM A;  5IQY A;  3OR5 A;  4KF9 A;  4KND A;  4MLY A;  1B4P A;  5JCG A;  5E4W A;  3FKF A;  4TXO B;  2H75 A;  3DIE A;  1NSW A;  1RW1 A;  2F8F A;  2H66 A;  3GFK A;  4MJE A;  5ECL B;  1FW1 A;  3LW9 A;  1XFL A;  4OCF A;  2WCI A;  2C3N A;  1GWC A;  4PQH A;  3TKS E;  1SL0 B;  3VFI A;  2JZR A;  5DJL A;  3QR6 A;  3KEB A;  1W4V A;  3IE3 A;  4K8M A;  3UBL A;  2FUG 2;  5ID2 B;  3I43 A;  4PTS A;  5CRW A;  1O85 A;  4HOJ A;  1DE1 A;  4KSO A;  3MAK A;  1U3I A;  4JE1 A;  5CYY A;  5EL8 A;  2O87 A;  1OE7 A;  4PQI A;  5F0G A;  3KM6 A;  2ZNM A;  2VIM A;  4FH8 A;  4HQZ A;  1HNA A;  3LYK A;  4DEJ A;  4WBR D;  1KEB A;  3VPT A;  5JWR B;  1GNW A;  2V41 A;  4RUV A;  3LEF A;  2AHE A;  4YKF A;  2H0H A;  1K0M A;  2PGT A;  2WZ9 A;  1SK1 A;  5HR0 A;  4Q5F A;  3S9F A;  3G7Y A;  2QGV A;  5IMD A;  1C72 A;  3GTU B;  3WGX A;  3HA9 A;  4G0L A;  4DSS B;  5JWQ B;  1VGL A;  3G7J A;  3UVH A;  3MSZ A;  1PN0 A;  2B7K A;  2IWT A;  4MF5 A;  1PX6 A;  3GN3 A;  1PRX A;  1XWG A;  4MJC A;  2QC7 A;  2VL2 C;  4XHM A;  4TOP A;  4WEY A;  5DAL B;  2OKA A;  3KMN A;  2RII A;  3R2Q A;  2HZF A;  2I4A A;  3P7X A;  3KXO A;  4MZW A;  5ECO B;  2F8A A;  3ME7 A;  2LKU A;  5FHI A;  4TR1 A;  3QCP A;  5IM9 A;  4IQ1 A;  4XS4 B;  3KP8 A;  1YJ6 A;  4KE3 A;  5ECR B;  1FVJ A;  2FA8 A;  3NIV A;  1HQO A;  4BL7 A;  5J41 A;  4TR3 A;  1J0F A;  3IOS A;  4K7O A;  1Z6N A;  2K8V A;  4XCS A;  2FGX A;  2R2J A;  3HVV A;  1EV4 A;  5CRH A;  2F3M A;  1GTI A;  2GST A;  4NV2 A;  1K0D A;  1TK5 B;  4BWS A;  2R3X A;  2NTO A;  2H6X A;  2LNT A;  1YEP A;  2B1K A;  2H8L A;  2VCZ A;  2P5R A;  5D9T A;  2VOC A;  3QMX A;  1OE8 A;  5ECI B;  3UIW A;  5LCZ A;  1XVW A;  2X8G A;  3IDV A;  4CHS A;  3GKK A;  1GSE A;  4BA7 A;  7GSS A;  1YF0 A;  3H8Q A;  1A24 A;  4N30 A;  3RHB A;  3EU4 A;  2OAC A;  1FG4 A;  3L9S A;  1M9A A;  3QFB C;  5IMC A;  2QA2 A;  2GT6 A;  3DYR A;  4HJM A;  2IMF A;  3LSZ A;  2IMK A;  2M80 A;  3Q19 A;  4PXO A;  1EWX A;  2IMI A;  4JR4 A;  5HR3 A;  2XPE A;  1O8W A;  2JSZ A;  3TDG A;  5G1K A;  4OCE A;  4KA0 A;  5IPH A;  4FIW A;  1XW6 A;  4MAB A;  3FZA A;  2GLR A;  4MPG A;  1V98 A;  3ZRE A;  5EY6 A;  1Q98 A;  3L9U A;  2YWI A;  2V32 A;  4AJ6 A;  1HYU A;  4ZXG A;  3N5O A;  4KSM A;  1TU8 A;  4X1U A;  1H75 A;  1ERW A;  2DSA A;  4GSN A;  2TIR A;  1XOB A;  3PPU A;  3EYT A;  3VUR A;  2AJQ B;  3CSI A;  1UA5 A;  5DQS A;  1K3O A;  1YZX A;  3A3T A;  2CX3 A;  2XC2 A;  4NMU A;  5AGY A;  1MDI A;  4LL4 B;  1B8X A;  10GS A;  4XRA A;  2DJ3 A;  3UOM A;  2HFD A;  1GSD A;  5EPF A;  1A2J A;  4MJB A;  3HKR A;  4E8H A;  2YV9 A;  1THX A;  1AAZ A;  4BVX A;  2HYX A;  4NHZ A;  1QGV A;  4PUF C;  3D6I A;  3ISO A;  2E7P A;  3IBH A;  2O8V B;  2IFQ A;  5DDL A;  3IHQ A;  2V2G A;  4L0W A;  5D96 A;  3CRT A;  2UZ8 A;  3LG6 A;  2X8C A;  1G7E A;  5IMZ A;  2JSY A;  1TRW A;  3BCK A;  4IJI A;  4HZ2 A;  2GQL A;  6GSY A;  4GWR A;  1ERU A;  1GTU A;  3P2A A;  4V2L A;  5IPG A;  3BBY A;  1R26 A;  4GF0 A;  5KOW A;  1LBK A;  1PMT A;  1XPV A;  1YQ1 A;  2BMX A;  4TXO A;  3DVW A;  3GL3 A;  1QMV A;  3ZLP A;  1R4W A;  1SJZ A;  3TGZ A;  4EC0 A;  1TOF A;  1Z5Y E;  3DML A;  2NPB A;  4K0N A;  4TW5 A;  1LJR A;  3FZ9 A;  2VAF A;  1PKW A;  4O92 A;  3MNG A;  1V2A A;  3VWV A;  2V6K A;  4WXT A;  2FWG A;  4FYB A;  3EC3 A;  1K0B A;  3HD5 A;  4D73 A;  5J3R A;  2L6D A;  4O5U A;  3MIX A;  1WOU A;  4DSR A;  1Z7R A;  2HI7 A;  1GSF A;  4MDC A;  2H6Y A;  4PGT A;  4CDO A;  2LQO A;  2YN1 A;  2DKH A;  3I69 A;  2DBC A;  1ILO A;  3HCZ A;  3P90 A;  3EVI A;  2XHF A;  3MDK A;  4Z2T A;  1ACV A;  2IMD A;  1M99 A;  4TR1 B;  4K2D A;  2VD0 A;  1TRV A;  3TKQ A;  2I81 A;  1ON4 A;  3KZQ A;  1LU4 A;  4Q5Q A;  5CP1 A;  4A5P A;  2AYT A;  2FWF A;  3KTL A;  4OFM A;  1W89 A;  5IMF A;  1M2B A;  4BL7 B;  4TRX A;  3FZ4 A;  3NZN A;  1A2M A;  2R37 A;  1WRY A;  1OC8 A;  4X43 A;  2JZT A;  4RQX A;  3FK8 A;  3E9J B;  4ZL9 A;  2C0D A;  1XWA A;  2VLU A;  1XCC A;  3GV1 A;  4ML6 A;  3TKP A;  3IAS 2;  1BJX A;  5H5S A;  1PN9 A;  1B9X C;  1YKC A;  1PKZ A;  1SU9 A;  4K7N A;  1G7O A;  2MMO A;  1EV9 A;  2TRX A;  3VI5 A;  4Z2U A;  4ACS A;  3ZYW A;  3IXR A;  4JRR A;  5CAX A;  3QPM A;  2DC5 A;  5H5Q A;  5A5K A;  2LV3 A;  1X0R A;  3CXG A;  3SBC A;  3GSS A;  3A2X A;  5D9X A;  1JZO A;  3VWU A;  4G0K A;  1O6J A;  4ECI A;  2DIZ A;  4E8E A;  4Q5R A;  1GTB A;  4J57 E;  2WS2 A;  6GST A;  2H74 A;  1KTE A;  1X5D A;  2PUK C;  4P3Y B;  4F9Z A;  4ZB6 A;  2AUV A;  2FY6 A;  2MBT A;  4J56 E;  5D8I A;  3F0I A;  1TU7 A;  1HNC A;  2F9S A;  3VK9 A;  3L9V A;  5AIX A;  2GQK A;  4G2E A;  3WGE A;  2YJ7 A;  1YDK A;  3IR4 A;  3M9J A;  2C3T A;  4HDE A;  5HR1 A;  4I6X A;  2R5G A;  4LMW A;  2A2P A;  3LQ7 A;  5GAN D;  5J9C A;  3ERW A;  5G2Z A;  2PER A;  4EIP A;  2AB6 A;  4GST A;  2X4A A;  3GKX A;  2YCD A;  1H4O A;  2GZZ A;  1BAY A;  1MDJ A;  3UL3 A;  1SK0 A;  4XS1 A;  4BVX B;  1NW2 A;  3KTB A;  2AV4 A;  1PL2 A;  1PGT A;  3TJJ A;  4K2X A;  5IO0 A;  1TKD B;  2IFQ B;  4ID0 A;  3DWV A;  2GS3 A;  2N5B A;  4NAX A;  4HQS A;  3F8U A;  5C04 A;  2YP6 A;  1Z7P A;  4IJ3 A;  5FT3 A;  2L6C A;  3HJO A;  2H1G A;  2L57 A;  2H0G A;  4IS0 A;  2LST A;  3W8S A;  4MF7 A;  5IO2 A;  1G6W A;  4QL7 A;  2K8S A;  4MH3 A;  2RM6 A;  2K6V A;  2LQQ A;  2WRT A;  3TB2 A;  1DBY A;  4KH7 A;  3TJF A;  2GT5 A;  1ZYN A;  3W6G A;  1G6Y A;  4CY6 A;  5JWO B;  3HJP A;  1XXU A;  3APQ A;  1FOV A;  3HYP A;  2YZH A;  1XW9 A;  4D73 B;  5HFG A;  2E2G A;  1AW9 A;  1GH2 A;  1GUH A;  2K18 A;  3TRP A;  3F4R A;  2DJ1 A;  1DE2 A;  2HT9 A;  2H76 A;  5CO3 A;  3A5I A;  1SK2 A;  4TN8 A;  2IJY A;  1FB6 A;  1PL1 A;  4N0Z A;  3O3T A;  1EGR A;  4MZB A;  1OC3 A;  4I8B A;  3G9B A;  1MD4 A;  16GS A;  4KCE A;  1R5P A;  4O5R A;  4O32 A;  4K5S A;  2GQM A;  5ECM B;  6GSS A;  2MBS A;  4GQC A;  2LJR A;  2PBJ A;  5GSS A;  1SKW B;  3KMO A;  2X8H A;  2CA8 A;  3D21 A;  2PWJ A;  2LS5 A;  4LL1 B;  2LRC A;  4YH2 A;  1SL2 B;  3C7M A;  2GSS A;  1PA3 A;  4EUY A;  3GHA A;  2CQ9 A;  4XRD A;  2VL3 A;  1PSQ A;  1M7T A;  1BX9 A;  2OJL A;  2LJA A;  2B1L A;  4WBJ A;  2HLS A;  4HU9 A;  2M46 A;  2LRN A;  3ERG A;  5B8B A;  4K5R A;  4CY8 A;  1GSU A;  2EC4 A;  3PIN A;  3ZIV A;  3TOU A;  2R6K A;  2H30 A;  4USS A;  2GTU A;  1CQH A;  4LA1 A;  1I9D A;  3ZMK A;  5B8A A;  1THO A;  2Z9S A;  1KBN A;  5BRT A;  2GVP A;  3ME8 A;  4L5L A;  1PD2 1;  5G5E A;  1QUW A;  1JFU A;  1E2Y A;  2X49 A;  5F05 A;  5D9W A;  4G10 A;  5B6N A;  3KCM A;  2HSY A;  4FYU A;  3Q6O A;  4I97 A;  4IW9 A;  4JR6 A;  2VD1 A;  1X9S B;  3MYD A;  4ILF A;  4V1A g;  1IYI A;  1S3A A;  4IBP A;  1T7P B;  4JU5 A;  3FR9 A;  1AQX A;  2OBI A;  2WB9 A;  2V6O A;  5KN0 A;  1ZGN A;  1PX7 A;  4XS6 A;  3C73 A;  3IAM 2;  2DJK A;  2ON7 A;  5D73 A;  2G0F A;  1DSB A;  4KB3 A;  2FWE A;  3IA1 A;  3HZ4 A;  1JZR A;  4IVF A;  4IEL A;  5ELG A;  3C71 A;  2OE3 A;  2HZE A;  2MMZ A;  1SD8 A;  1AQW A;  4BVY A;  5DJM A;  5HFI A;  4EO3 A;  5CRD A;  2HNL A;  2WDU A;  3QAG A;  1M2D A;  5HFK A;  1ZCP A;  3D4M A;  3LGC A;  2REM A;  5H5R A;  1SEN A;  5ECP B;  4IP1 A;  1K0A A;  5ABR A;  4H86 A;  3GKM A;  1WE0 A;  1AQV A;  3GYK A;  1MEK A;  4KAE A;  1FOH A;  2HRN A;  2OBK A;  3BOA A;  1U3A A;  3FEU A;  3H93 A;  2C80 A;  5EVO A;  1ZOF A;  2H6Z A;  4GXZ A;  1TDI A;  1GNE A;  2VM1 A;  4RQR A;  3UMA A;  2WFC A;  3HDC A;  3M3M A;  3L0H A;  4OD7 A;  4EDY A;  1JZD A;  3DEX A;  4QQ7 A;  1S3C A;  4KX4 A;  5IMA A;  2EIO A;  1BQ7 A;  13GS A;  2A2S A;  4WR5 A;  3KH9 A;  5HQP A;  2I3Y A;  2H70 A;  2QA1 A;  2A2R A;  17GS A;  2ES7 A;  4EVM A;  1A8L A;  4PQ1 A;  2HRF A;  1EEJ A;  1RK4 A;  4G19 A;  3HHV A;  1B48 A;  5J9B A;  4XTS A;  1M9B A;  3GNJ A;  2VM2 A;  3BJ5 A;  3WD6 A;  4OMV A;  3IV4 A;  1S3D A;  3NOF A;  4GTU A;  18GS A;  4TVE A;  3M0F A;  1SD9 A;  1XWC A;  3RPP A;  8GSS A;  3ZL5 A;  2YWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...