1ERUA

Human thioredoxin (oxidized form)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN
publication title Crystal structures of reduced, oxidized, and mutated human thioredoxins: evidence for a regulatory homodimer.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1eruA00
1O6JA 3ERGA 1ERUA 3Q74A 3UIWA 5DDLA 4EUYA 1F6MC 4KDXA 4HUAA 4ZB9A 2KHPA 3FR9A 3V1WA 5HFGA 1K0OA 1KNGA 2VM1A 4Z7XA 3HVXA 5CRGA 2K8VA 2LNSA 4NV5A 1TKDB 4ACSA 4GTUA 1X9WB 2VCVA 3E0UA 2JADA 2IL3A 2KLXA 3HDCA 2DIYA 4LL4B 4I8BA 3QPMA 4EKZA 2GVPA 1O7UA 2DJ1A 1TK0B 2GDRA 3HYPA 1ML6A 2AHEA 4NHWA 2GSSA 4ZXGA 1GSYA 3MAKA 2GT6A 3ZMKA 1OAZA 3J7Yk 3BCIA 3KP8A 2C80A 4TN8A 5F07A 2B1LA 1YEPA 2GS3A 1QK8A 4ZB6A 2H0IA 2H71A 3ZFLA 2K9FA 2PPTA 5D9XA 2CA8A 2WDUA 1THXA 3GURA 1PMTA 9GSSA 2EIOA 2OE0A 5JCGA 5GAND 1VF2A 1HQOA 2HE3A 4ECIA 1U6TA 5G2ZA 1J0FA 2VD0A 3FEUA 2PVQA 3TKSA 4KNDA 4K0GA 5ECMB 4EE0A 2GZPA 2JU5A 4IJ3A 2H73A 5ECIB 3R2QA 1GSFA 3GH9A 4D73B 3MWHA 2LJRA 1N2AA 1ERWA 4L0WA 2WZ9A 5DALB 1N8JA 3A2WA 1SK1A 3G7JA 2M72A 2GZYA 3TRQA 1GUMA 2IIYA 2H66A 4PQHA 4NV2A 3H93A 3C1RA 5IMZA 4F03A 3CYNA 3UARA 1WPIA 3P2AA 1PQNA 3VURA 3IK9A 1NHYA 1XW9A 2MBSA 1ERVA 1EZKA 4WBJA 5H5SA 2TRCP 2HRFA 3RBTA 3D22A 2V41A 3M9JA 3F0IA 1EP7A 5ECLB 2OKAA 3J7Yb 1SJ6A 1V57A 2CVDA 4HDEA 3TJGA 3EVIA 2VL2A 4ZB8A 1K3OA 7GSSA 4GCIA 1G7EA 1GUKA 4NPBA 1SKRB 2B1KA 2VM2A 2P0GA 2RM5A 4IGJA 1TDIA 2L57A 2ZUPA 3GKXA 2FUG2 2VIMA 4LMVA 1OYJA 1BAYA 4I5QA 3TOUA 4TR1A 3UVTA 2YZUA 1PSQA 3TCOA 3LEFA 4MF7A 4KSMA 5CRWA 4POBA 1QGVA 1AC1A 1RQMA 3TDGA 3N9JA 2OBKA 1TRWA 2DIZA 1GLQA 5INYA 2E2MA 2YJ7A 2QSIA 1SK2A 4BVXA 2CT6A 2OE3A 3WGEA 4OO5A 4WF5A 1T8EB 3GKMA 4J2FA 3FZ5A 4YAPA 1YDKA 3LGCA 2BTOT 4O5RA 3H8QA 3RAZA 2R37A 5AN1A 3F9UA 3TJBA 2H75A 2OE1A 1OKTA 2VCWA 3GL3A 1YF0A 1WP0A 3VPTA 4HS1A 4K8MA 3P7XA 1VF4A 3LQ7A 1ZOFA 4MF5A 2WS2A 4O32A 3GUSA 3DD3A 4ECBA 1LU4A 1B9XC 2LJAA 1BG5A 2L6CA 3HJOA 3PR8A 1QXHA 1V9WA 2P5RA 4HQSA 5LD0A 2G2QA 1XZOA 1FHEA 1U3IA 2YV7A 1SKSB 1GLPA 2IMFA 5EL8A 4DSQA 3U6VA 2I4AA 3CSHA 4KCEA 2YV9A 2PBJA 2HZEA 3ISOA 4GQFA 4N30A 2GT5A 2IMKA 1GSEA 1FVKA 3EURA 1T4ZA 3PGTA 2X8HA 4DSRA 1FAAA 2PMTA 2LS5A 2VCQA 1F3BA 2J9HA 2GTUA 2F8FA 4AGSA 2O8VB 3A3TA 4F0BA 4KDYA 1GP1A 3GTUA 2NBSA 2RIIA 3HJPA 3ZITA 5HR2A 4JR6A 3EE2A 3LXTA 1WIKA 3KTLA 1W89A 3APQA 4WBRD 2FWEA 3IXRA 1XWCA 3DVWA 1XCCA 5ELAA 1MDJA 3CSIA 4I97A 3IAM2 3GKNA 1K0BA 1PKWA 1K0CA 2FWFA 2YWOA 1GNEA 5D9TA 5C04A 3VI5A 4I6XA 3GN3A 4WR4A 3MNGA 5J9CA 2C3QA 3QR6A 2BMXA 3EMPA 1K0MA 3ZVJD 20GSA 3RPPA 4E8HA 1Z5YE 5A4UA 4MJEA 2K18A 3HY2A 2NVLA 13GSA 4MMMA 4HQZA 2IMEA 4OWYA 4G19A 2AJQB 1O8WA 4KDUA 5JWOB 2IPAA 2VL9A 5F0GA 3W8SA 1EEMA 1Z6MA 1USBA 3VWWA 3ZRDA 3Q19A 1GULA 4MJAA 3IOSA 4K7NA 1M7TA 2B5EA 2YN1A 2A2RA 1T00A 4TXOA 3L0HA 1DE1A 4NXIA 1MDKA 1IYIA 1GSUA 2C4JA 1KEBA 3GH6A 1TU8A 1U3AA 1JLWA 2K6VA 3UJ1A 3ERWA 1Z7RA 4TXVA 3ME8A 4CDOA 2L4CA 2XHFA 1TK5B 5HFIA 3QFAC 3IV4A 4ML1A 1WRYA 4MP4A 1BQ7A 5IMVA 4JRRA 1A23A 4XS4A 2JZSA 3H79A 5DCGA 5G31A 1TJDA 5J41A 4K1FA 1PKZA 3F6DA 3WGXA 2H19A 3I69A 4AJ8A 1T3BA 1K3YA 2FWGA 5E4WA 5CRDA 1UVZA 4LLRA 1K0AA 1XOAA 4OCFA 3GHAA 5D96A 3VK9A 3HVSA 3KD0A 4ILFA 1SJIA 2YWNA 3VPQA 4FYUA 1SL1B 4MJCA 4KA0A 3EYTA 4JBBA 3TRXA 1B4QA 3GFKA 3DMLA 1I5GA 5EVOA 3TKQA 5DJLA 3M0FA 2NPBA 2H1DA 4YQUA 2GLRA 2V6OA 1ERTA 4I2UA 5ECPB 4MH2A 5AIXA 5ID2A 3GRXA 1R5PA 1CQGA 5CO3A 4V2LA 3LSZA 4IJIA 4OFNA 2Z9SA 4JEDA 2XPDA 19GSA 2HFDA 3IR4A 2F3MA 1ZZYA 3JCML 3P8WA 3G9BA 3APSA 1TTZA 1HD2A 2DLXA 2GZZA 3DGQA 4WEYA 1H4OA 1SKWB 1H75A 1S3AA 1Y25A 2REMA 4DSSA 2DJKA 1SL2B 4BWSA 5LNKe 11GSA 1A0FA 2LRTA 1SD9A 2H6XA 1XW5A 5ELGA 4HJ2A 5IMCA 2HI7A 1AW9A 5D8IA 1PL1A 2QGVA 10GSA 4Q5RA 1GSQA 2V1MA 3CRUA 1S3DA 1K0NA 2O89A 5IPGA 4IKHA 1A2JA 3ED3A 3DEXA 1SK0A 1JLVA 4KGIA 3CXGA 3BOAA 1JZWA 2PU9C 2CZ3A 3NOFA 4G2EA 4ULXA 5G1LA 2YANA 3RPNA 2CVKA 1PX7A 3UVHA 1WOUA 1BYEA 3O76A 4AJ7A 4HU9A 4EXJA 3FW2A 2LQQA 5G1KA 2R2JA 3KIJA 3KXOA 4AJ6A 1EGRA 1XXUA 4KAEA 3DWVA 4O92A 2WFCA 2F9SA 3ZFBA 4TR3A 4MA9A 2AUVA 4WR5A 2I3YA 1I9DA 2DJ2A 2LKUA 2AV4A 5GZZB 1EEJA 4POMA 3TKPA 1AAZA 3TGZA 2EIQA 2H76A 2FY6A 5B6MA 2ALBA 3GV1A 1XOBA 2LV3A 2GQKA 3RHCA 4BPYA 3IHQA 5KN3A 1FG4A 5C00A 4IQAA 1EV9A 3LWAA 4PUFC 1DBYA 2F8AA 2KP1A 1AQVA 2X8GA 2ES7A 2HSYA 4YQVA 4XS1A 4XRDA 2C8UA 3GIXA 3VWVA 2B7JA 2H1GA 1BX9A 2EC4A 1XVWA 1B8XA 1J08A 4EF0A 1TP9A 3VFIA 1BJXA 1GUHA 3L9VA 2IMIA 2XC2A 3C1SA 3FR6A 4BL7A 3HZ4A 4JE1A 4OFTA 4RI7A 2KP2A 5GAPD 4KX4A 2L59A 4GXZA 5KEJA 4TR0A 3UBLA 1THOA 5IMFA 1TU7A 3VWXA 2H1BA 5FHIA 4MZCA 5DAKB 3TJFA 2MMOA 2IFQB 4LMWA 1JZOA 2YWIA 3C71A 4XIHA 1O73A 1TRUA 2N5AA 4IBPA 4J56E 2PGTA 14GSA 3D4MA 4HU7A 3NIVA 5JWRB 5E59A 1MD4A 2OBIA 3BCKA 1ZMAA 1HNBA 4KE3A 3GL5A 2CVBA 3CRTA 2FNOA 1B4PA 4MK3A 5G5FA 2CAIA 2GQLA 4WF4A 3L9SA 1MTCA 1DUGA 1M0UA 3TUEA 3KEBA 4X0XA 2PERA 4KB3A 1HNAA 2WRTA 4MPGA 5ECQB 3DYRA 4MZWA 2P5QA 4KCAA 3CTFA 3G7YA 1QUWA 1F3AA 3GYKA 1O81A 4MDCA 3UMAA 12GSA 2GGTA 5IIZA 1AXDA 1S3CA 4XRAA 5F06A 4ZBAA 3HJMA 1VF1A 2VCZA 1FB6A 1GH2A 4POLA 1RW1A 1VGLA 4PGTA 3TJKA 3UOMA 5J5NA 1B48A 1BEDA 4I2TA 4MH3A 2CX3A 4HOJA 3WYWA 5F05A 1JHBA 1V58A 3D5JA 3DRNA 3HKRA 1ACVA 1Z7PA 5CNWA 4D73A 4EVMA 4F82A 2IMDA 1JFUA 2RM6A 4J57E 5J3RA 2VOCA 4KH7A 4L5OA 5DALA 1XWGA 4N0VA 5CREA 4Q5FA 3LORA 5B6NA 4WXTA 2CAQA 1B9YC 2TRXA 2H6ZA 2MBTA 1O85A 3K8NA 4QL9A 4EDYA 1VRSD 1ILOA 2H74A 2YWMA 4GQCA 2JZRA 4N10A 3D21A 2H0GA 5FWGA 2C3NA 3IPZA 1OC9B 1XIYA 3C7MA 3KMNA 3KJYA 3PINA 3GX0A 4TR4A 2VUPA 4ECCA 3GA4A 4JR4A 5HR3A 1GTAA 1ON4A 2MYGA 1E2YA 4OFMA 1AQXA 4ML6A 5HR0A 3ZZXA 2H72A 1URMA 1KTEA 2B5YA 4BVYA 5DBQA 5F8BA 1A24A 1XBSA 2RUFA 1WMJA 5JWQB 1SL0B 2H6YA 2F51A 4ZBBA 1WWJA 4DEJA 1YF1A 1A0RP 2LTKA 3CTGA 3UAPA 5B7CA 2B3SA 1QQ2A 4DVCA 2JSYA 3CBUA 5JCWA 1OE8A 2X64A 4RQRA 1TXXA 2DJJA 3G7IA 3GSSA 3O3TA 6GSYA 1IYHA 4V2MA 3BBYA 3A5WA 3IAS2 4K2DA 1MDIA 3H1NA 5J9BA 1A8LA 3L78A 1DE2A 4IHUA 3BJ5A 1XPVA 3EU3A 1YKCA 1T1VA 5HQPA 4GLTA 4MJBA 6GSUA 4EO3A 3IA1A 5CAXA 3HHVA 3IC4A 2VLVA 5DJMA 1XWBA 4G10A 3IDVA 4HZ2A 1GTUA 4IP6A 5A4WA 5ECNB 3SWLA 1RK4A 1NHOA 3QMXA 1JZRA 1ST9A 2QKEA 5ECOB 1PX6A 4HZ4A 2ZNMA 2FD3A 4ISDA 2C0GA 1M2DA 2DC5A 4XHMA 4AF2A 3D6IA 5GSTA 8GSSA 2G0FA 4PX1A 1G6WA 3M1GA 1EV4A 5GSSA 1PGTA 5IOWA 2WGRA 3ZTLA 3QCPA 3F3QA 5DQYA 3FYGA 2YJHA 3MSZA 5AIVA 2WULA 5IO2A 4K7IA 4K9ZA 3TKRA 4PQIA 4TOPA 3SBCA 3L9UA 4OD7A 3N5OA 1ZYEA 3FRCA 2JSZA 5B8BA 5G5EA 3WD6A 4XS6A 2HRNA 1HYUA 3DKSA 4IW9A 4GRFA 4ZBDA 4X43A 5EY6A 4IP1A 2C1YA 5DCHA 4MABA 2IN3A 1O8XA 1PRXA 3DIEA 4ECJA 2EIRA 1GSSA 2FCHA 3LXZA 5JCUA 4TVEA 5D9WA 1OC3A 2OJLA 2WCIA 2GQMA 1NM3A 1M99A 2H0HA 3H4KA 3U5RE 3I43A 4ID0A 1F2EA 4TR1B 1PN9A 2L5OA 1C72A 4PUAA 2VLTA 1YKAA 3W8JA 2R5GA 2O85A 3QDNA 3FY7A 3ZREA 2TIRA 2VO4A 3ME7A 4K6XA 4NAXA 3HD5A 2B6MA 1GNWA 2FA8A 3FHKA 2YOIA 2KUCA 3APOA 1XWKA 2V32A 4ZL8A 1AUCA 1GTBA 3ZIJA 3KCMA 2YPMA 5CYYA 3ERFA 4KSOA 1A2LA 2YP6A 2VD1A 3KH9A 5AISA 2K8SA 3HA9A 2QC7A 3LYKA 3ZYWA 2NDOA 3IBHA 4FYBA 1LJRA 3KM6A 6GSVA 4X1UA 3L4NA 3M9KA 1V40A 1GWCA 1XVQA 2FWHA 1TOFA 4RI6A 3ZL5A 17GSA 3EINA 2I9HA 3HCZA 3LFLA 4TRXA 4FYCA 2XBIA 2AAWA 2P31A 1ABAA 4Q5QA 4EC0A 5A5KA 5DVBA 3A2XA 1CQHA 3CSJA 1QMVA 4YAVA 2DBCA 3ZIVA 1AQWA 4XTSA 3FR3A 1SU9A 3F4TA 4CW9A 2HZEB 3IK7A 4IQ1A 3TJJA 5AGYA 3GX8A 2LRNA 5B8AA 1X9SB 2L5LA 1Q4JA 3E3EA 4IELA 2MMNA 1G0TA 1SYRA 6GSTA 2FGXA 3GTUB 3MDKA 4JU5A 4OMVA 5G30A 1SYXA 4PQ1A 2O87A 3QOUA 3C73A 3P90A 1GTIA 3TRPA 4GSSA 2HXKA 1X5DA 1T4YA 1OC8A 2J23A 4K7OA 3EMXA 3FK8A 6GSXA 5IMAA 4N11A 2R3XA 1XW6A 1UN2A 3US3A 1UC7A 4GSNA 1Z9HA 1TW9A 1FVJA 4HI7A 1SENA 4WETA 3F63A 3FZAA 4L8EA 3M3MA 1EP8A 2PUKC 2C0FA 2LRCA 4IVFA 3UEMA 2DJ0A 2HZFA 5ECHB 1ZCPA 1J9BA 2OADA 4NHZA 3O6TA 5A4VA 4KUNA 1YQ1A 5IMDA 3EU4A 1HNCA 1T7PB 2C3TA 2OA7A 3FZ4A 3QD9A 3GNJA 4IS0A 1EGOA 3IRAA 2VLUA 6GSWA 2DSAA 1ZL9A 3HVVA 2NTOA 1R7HA 1M9AA 1DSBA 2I1UA 2KOKA 3TB2A 3TOTA 2IJYA 3UBKA 2B5XA 4MLYA 2VL3A 3EWLA 2XBQA 2H30A 4MF6A 5IO0A 1X0RA 4BA7A 4MCUA 1W4VA 2X99A 5IPHA 1FO5A 4TXOB 3KTBA 1Z6NA 1YJ6A 2V6KA 4PNFA 1K0DA 3LG6A 4MPFA 4BWQA 2MZCA 3RHBA 5HR1A 2B7KA 3VWUA 2CX4A 2M46A 2VAFA 3C8EA 3WT2A 4PNGA 4NMUA 5CP1A 2GSRA 2D2ZA 2N5FA 4XS4B 1XWAA 3F6FA 3QAGA 4CHSA 3GMFA 5ECSA 2FA4A 1X5EA 3GKKA 4PXOA 1UA5A 2RUEA 1M2BA 2AB6A 2ZCTA 2V2GA 4H86A 4LL1B 4YH2A 2CQ9A 1G6YA 22GSA 3PH9A 2R6KA 2R4VA 2PVOC 4FO5A 1EOHA 1NW2A 1R4WA 2X8CA 4TKYA 5ECKB 1PL2A 5J4UA 3F4SA 1PD21 3TKSC 1U87A 2RLIA 3ZLPA 1MEKA 3OR5A 1OVNA 5CRHA 5L71A 1EWXA 1A2MA 4WKWA 2DMLA 2H01A 3HXSA 2JL4A 1A8YA 4K0NA 1K3LA 4L0UA 4V1Ag 2LJKA 3KP9A 4HEA2 2FLSA 1GSDA 4GWRA 1G7OA 1F37A 4POKA 4V2NA 3D0ZA 3DXBA 1AIUA 5ECRB 1R5AA 2PWJA 3HZ8A 2JACA 3Q18A 5ID2B 1ZGNA 1V2AA 3ZVJA 3F4RA 4NWYA 3W6GA 2JZTA 2HSHA 2BJXA 2DJ3A 1TK8B 1WJKA 2O7KA 2H70A 5COHA 2LQOA 2A4VA 1EOGA 2C0EA 2YCDA 2LUSA 3FKFA 4N0ZA 2YNXA 3F3RA 2VL2C 3QAWA 1FB0A 5IQYA 3NZNA 1YEXA 5H5RA 2MMAA 2PN8A 3VLNA 3CMIA 3QFBC 5IM9A 2L4QA 2ON5A 2CZ2A 1TRSA 2CV4A 1LBKA 4ZL9A 4F9ZA 4DSSB 2HLSA 2E7PA 4ZILA 4Q5NA 4RUVA 1PA3A 1SD8A 5DAKA 4YQMA 2IWTA 4JZQA 2IFQA 3KMOA 4V1Ap 1ZYQB 2E2GA 3TKSE 1FW1A 1TI3A 5EPFA 2MMZA 4MZBA 3WGDA 3LJRA 1NSWA 3RDWA 4FH8A 1OKDA 1X9MB 3EC3A 3I9V2 1Z3EA 2E0QA 3F8UA 3UL3A 4P3YB 5HFKA 1QFNA 4LA1A 3E9JB 1SJZA 4F2IA 2ON7A 2GSQA 4G9HA 3WT1A 3FZ9A 2A2SA 1OE7A 2OACA 1U88A 1VF3A 4KW6A 1JZDA 2WB9A 4OCEA 5ENUA 5ABRA 3KGKA 1R26A 3M8NA 4QL7A 3I6AA 3VI7A 2FHEA 1Y6EA 2WJUA 5KN2A 3A2VA 4QQ7A 2XPEA 1TRVA 4RQXA 2M80A 1XFLA 2GSTA 5FT3A 5KN1A 3D4TA 4E8EA 2L6DA 2HT9A 5IOXA 3BD2A 4ZL7A 2HNLA 2H8LA 4EDZA 1FOVA 2LSTA 4XCSA 3GSTA 3KZQA 3LYPA 4F0CA 3Q6OA 1KBNA 3DVXA 2C0DA 3QAVA 1X5CA 5LCZA 1Q98A 2VCXA 2HYXA 2LEGA 3S9FA 2YZHA 4FIWA 4EL1A 3KH7A 1E6BA 2LNTA 4HJMA 2H1AA 1TI1A 3AY8A 5D73A 4IN0A 1MD3A 4ZIJA 16GSA 1YY7A 18GSA 2N5BA 6GSSA 5D93A 1M2AA 5KN0A 1YZXA 3IE3A 1GL8A 4PURA 3ZMLA 1F9MA 4OO4A 5DQSA 1OC9A 2VCTA 4GSTA 4GF0A 4O7HA 1M9BA 5D9VA 2I81A 4TW5A 4L5LA 5H5QA 1GRXA 2AYTA 1V98A 1WE0A 2DMMA
chains in the Genus database with same CATH superfamily
1O6JA 3ERGA 1ERUA 3Q74A 3UIWA 5DDLA 4EUYA 1F6MC 4KDXA 4HUAA 4ZB9A 2KHPA 3FR9A 3V1WA 5HFGA 1K0OA 1KNGA 2VM1A 4Z7XA 3HVXA 5CRGA 2K8VA 2LNSA 4NV5A 1TKDB 4EIQA 4ACSA 4GTUA 1X9WB 2VCVA 3E0UA 2JADA 2IL3A 2KLXA 3HDCA 2DIYA 4LL4B 4I8BA 3QPMA 4EKZA 2GVPA 1O7UA 2DJ1A 1TK0B 2GDRA 3HYPA 1ML6A 2AHEA 4NHWA 2GSSA 4ZXGA 1GSYA 3MAKA 2GT6A 3ZMKA 1OAZA 3J7Yk 2A2PA 3BCIA 3KP8A 2C80A 4TN8A 5F07A 2B1LA 1YEPA 2GS3A 1QK8A 4CY8A 4ZB6A 2H0IA 2H71A 3ZFLA 2K9FA 2PPTA 5D9XA 2CA8A 2WDUA 1THXA 3GURA 1PMTA 9GSSA 2EIOA 3R3EA 2OE0A 5JCGA 5GAND 1VF2A 1HQOA 2HE3A 4ECIA 1U6TA 5G2ZA 1J0FA 2VD0A 3FEUA 2PVQA 3TKSA 4KNDA 4K0GA 5ECMB 4EE0A 2GZPA 2JU5A 4IJ3A 2H73A 5ECIB 3R2QA 1GSFA 3GH9A 4D73B 3MWHA 2LJRA 1N2AA 1ERWA 4L0WA 2WZ9A 5DALB 1N8JA 3A2WA 1SK1A 3G7JA 2M72A 2GZYA 3TRQA 1GUMA 2IIYA 2H66A 4PQHA 4NV2A 3H93A 3C1RA 5IMZA 4F03A 3CYNA 3UARA 1WPIA 3P2AA 1PQNA 3VURA 3IK9A 1NHYA 1XW9A 2MBSA 1ERVA 1EZKA 4WBJA 5H5SA 2TRCP 2HRFA 3RBTA 3D22A 2V41A 3M9JA 3F0IA 1EP7A 5ECLB 2OKAA 3J7Yb 5BRTA 1SJ6A 1V57A 2CVDA 4HDEA 3TJGA 3EVIA 2VL2A 4ZB8A 1K3OA 7GSSA 4GCIA 1G7EA 1GUKA 4NPBA 1SKRB 2B1KA 2VM2A 2P0GA 2RM5A 4IGJA 1TDIA 2L57A 2ZUPA 3GKXA 2FUG2 4BVYB 2VIMA 4LMVA 1OYJA 1BAYA 4I5QA 3TOUA 4TR1A 3UVTA 2YZUA 1PSQA 3TCOA 3LEFA 4MF7A 4KSMA 5CRWA 4POBA 1QGVA 1AC1A 1RQMA 3TDGA 3N9JA 2OBKA 1TRWA 2DIZA 1GLQA 5INYA 2E2MA 2YJ7A 2QSIA 1SK2A 4BVXA 2CT6A 2OE3A 3WGEA 4OO5A 4WF5A 1T8EB 3GKMA 4J2FA 3FZ5A 4YAPA 1YDKA 3LGCA 2BTOT 4O5RA 3H8QA 3RAZA 2R37A 5AN1A 3F9UA 4G0LA 2H75A 3TJBA 2OE1A 1OKTA 2VCWA 3GL3A 1YF0A 1WP0A 3VPTA 4HS1A 4K8MA 3P7XA 1VF4A 2R0GA 3LQ7A 1ZOFA 4MF5A 2WS2A 4O32A 4O5UA 3GUSA 3DD3A 4ECBA 1LU4A 1B9XC 2LJAA 1BG5A 5KOXA 2L6CA 3HJOA 3PR8A 1QXHA 1V9WA 2P5RA 4HQSA 5LD0A 2G2QA 1XZOA 1FHEA 1U3IA 2YV7A 1SKSB 1GLPA 2IMFA 5EL8A 4DSQA 3U6VA 2I4AA 3CSHA 4KCEA 2YV9A 2PBJA 2HZEA 3ISOA 3EPTA 4GQFA 4N30A 2GT5A 2IMKA 1GSEA 1FVKA 3EURA 1T4ZA 3PGTA 2X8HA 4DSRA 1FAAA 2PMTA 2LS5A 2VCQA 1F3BA 2J9HA 2GTUA 2F8FA 4AGSA 2O8VB 3A3TA 4F0BA 4KDYA 1GP1A 3GTUA 2NBSA 2RIIA 3HJPA 3ZITA 5HR2A 4JR6A 3EE2A 3LXTA 1WIKA 3KTLA 1W89A 3APQA 4WBRD 2FWEA 3IXRA 1XWCA 3DVWA 1XCCA 1MDJA 5ELAA 3CSIA 4I97A 3IAM2 3GKNA 1K0BA 4BIKA 1PKWA 1K0CA 2FWFA 2YWOA 1GNEA 5D9TA 5C04A 3VI5A 4I6XA 3GN3A 4WR4A 3MNGA 5J9CA 2C3QA 3QR6A 2BMXA 3EMPA 1K0MA 4PTSA 3ZVJD 20GSA 3RPPA 4E8HA 1Z5YE 5A4UA 4MJEA 2K18A 3HY2A 2NVLA 13GSA 4MMMA 4HSCX 4HQZA 2IMEA 4OWYA 4G19A 2AJQB 1O8WA 4KDUA 5JWOB 1ZYNA 2IPAA 2VL9A 5F0GA 3W8SA 3PPUA 1EEMA 1Z6MA 1ZYPA 1USBA 3VWWA 3ZRDA 3Q19A 1GULA 4MJAA 3IOSA 3MIXA 4K7NA 1M7TA 2B5EA 2YN1A 2A2RA 1T00A 4TXOA 3L0HA 1DE1A 4NXIA 1MDKA 4O5QA 1IYIA 1GSUA 2C4JA 1KEBA 4G0KA 3GH6A 1TU8A 1U3AA 1JLWA 2K6VA 3UJ1A 3ERWA 1Z7RA 4TXVA 3ME8A 4CDOA 2L4CA 2XHFA 1TK5B 5HFIA 3QFAC 3IV4A 4ML1A 1WRYA 4MP4A 1BQ7A 5IMVA 4JRRA 1A23A 4XS4A 2JZSA 3H79A 5DCGA 4CY6A 5G31A 1TJDA 5J41A 4K1FA 1PKZA 5KOWA 3F6DA 3WGXA 2H19A 3I69A 4AJ8A 1T3BA 1K3YA 2FWGA 5E4WA 5CRDA 1UVZA 4LLRA 1K0AA 1XOAA 4OCFA 3GHAA 5D96A 3VK9A 3HVSA 3KD0A 4ILFA 1SJIA 2YWNA 3VPQA 4FYUA 1SL1B 4MJCA 4KA0A 3EYTA 4JBBA 3TRXA 1B4QA 3GFKA 3DMLA 1I5GA 5EVOA 3TKQA 5DJLA 3M0FA 2NPBA 2H1DA 4YQUA 3IC8A 2GLRA 2V6OA 1ERTA 4I2UA 5ECPB 4MH2A 5AIXA 5ID2A 3GRXA 1R5PA 1CQGA 4Z2UA 5CO3A 4V2LA 3LSZA 4IJIA 4OFNA 2Z9SA 4JEDA 2XPDA 19GSA 2HFDA 3IR4A 2F3MA 1ZZYA 3JCML 3P8WA 3G9BA 3APSA 1TTZA 1HD2A 2DLXA 2GZZA 3DGQA 4WEYA 1H4OA 1SKWB 1H75A 1S3AA 1Y25A 2REMA 4DSSA 2DJKA 1SL2B 4BWSA 5LNKe 11GSA 1A0FA 2LRTA 1SD9A 2H6XA 1XW5A 5ELGA 4HJ2A 5IMCA 2HI7A 1AW9A 5D8IA 1PL1A 2QGVA 10GSA 4Q5RA 1GSQA 2V1MA 3CRUA 1S3DA 1K0NA 2O89A 5IPGA 4IKHA 2X4AA 1A2JA 3ED3A 3DEXA 1SK0A 1JLVA 4KGIA 3CXGA 3BOAA 1JZWA 2PU9C 2CZ3A 3NOFA 4G2EA 4ULXA 5G1LA 2YANA 3RPNA 2CVKA 1PX7A 3UVHA 1WOUA 1BYEA 3O76A 4AJ7A 4HU9A 4EXJA 3FW2A 2LQQA 5G1KA 2R2JA 3KIJA 3KXOA 4AJ6A 1EGRA 4EIPA 1XXUA 4KAEA 3DWVA 4O92A 2WFCA 2F9SA 3ZFBA 4TR3A 4MA9A 2AUVA 4WR5A 2I3YA 1I9DA 2DJ2A 2LKUA 2AV4A 5GZZB 1EEJA 4POMA 4USSA 3TKPA 3IHGA 1AAZA 3TGZA 2EIQA 2H76A 2FY6A 5B6MA 2ALBA 3GV1A 1XOBA 2LV3A 2GQKA 3RHCA 4YKFA 4BPYA 3IHQA 5KN3A 1FG4A 5C00A 4IQAA 1EV9A 3LWAA 4PUFC 1DBYA 2F8AA 2KP1A 1AQVA 2X8GA 2ES7A 2HSYA 4YQVA 4XS1A 4XRDA 2C8UA 3GIXA 3VWVA 2B7JA 2H1GA 1BX9A 2EC4A 1XVWA 1B8XA 1J08A 4EF0A 1TP9A 3VFIA 1BJXA 1GUHA 3L9VA 2IMIA 2XC2A 3C1SA 3FR6A 4BL7A 3HZ4A 4JE1A 4OFTA 4RI7A 2KP2A 5GAPD 4KX4A 2L59A 4GXZA 5KEJA 4TR0A 3UBLA 1THOA 5IMFA 1TU7A 1S3RA 3VWXA 2H1BA 5FHIA 4MZCA 5DAKB 3TJFA 2MMOA 2IFQB 4LMWA 1JZOA 2YWIA 3C71A 4XIHA 1O73A 1TRUA 2N5AA 2QA1A 4IBPA 4J56E 2PGTA 14GSA 3D4MA 4HU7A 3NIVA 5JWRB 5E59A 1MD4A 2OBIA 3BCKA 1ZMAA 1HNBA 4KE3A 3GL5A 2CVBA 3CRTA 2FNOA 4ICYA 1B4PA 4MK3A 3MYDA 5G5FA 2CAIA 2GQLA 4WF4A 3L9SA 1MTCA 1DUGA 1M0UA 3TUEA 2HRAA 3KEBA 4X0XA 2PERA 4KB3A 1HNAA 2WRTA 4MPGA 5ECQB 3DYRA 4MZWA 2P5QA 4KCAA 3CTFA 3G7YA 1QUWA 1F3AA 3GYKA 1O81A 4MDCA 3UMAA 12GSA 2GGTA 5IIZA 1AXDA 1S3CA 4XRAA 5F06A 4ZBAA 3HJMA 1VF1A 2VCZA 1FB6A 1GH2A 4POLA 1RW1A 1VGLA 4PGTA 3TJKA 3UOMA 5J5NA 1B48A 1BEDA 4I2TA 4MH3A 2CX3A 4HOJA 3WYWA 5F05A 1JHBA 1V58A 3D5JA 3DRNA 3HKRA 1ACVA 1Z7PA 5CNWA 4D73A 4EVMA 4F82A 2IMDA 1JFUA 2RM6A 4J57E 5J3RA 2VOCA 4KH7A 4L5OA 5DALA 1XWGA 4N0VA 5CREA 4Q5FA 3LORA 5B6NA 4WXTA 1M3JA 2CAQA 1B9YC 2TRXA 2H6ZA 2MBTA 1O85A 3K8NA 4QL9A 4EDYA 1VRSD 1ILOA 2H74A 2YWMA 4GQCA 2JZRA 4N10A 3D21A 2H0GA 5FWGA 2C3NA 3IPZA 1OC9B 1XIYA 3C7MA 1PFOA 3KMNA 3KJYA 3PINA 3GX0A 4TR4A 2VUPA 4ECCA 3GA4A 4JR4A 5HR3A 1GTAA 1ON4A 2MYGA 1E2YA 4OFMA 1M3IA 1AQXA 4ML6A 5HR0A 3ZZXA 4MNNA 2H72A 2A4HA 1URMA 4K2XA 1KTEA 2B5YA 4BVYA 5DBQA 5F8BA 1A24A 1XBSA 2RUFA 1WMJA 5JWQB 1SL0B 3LW9A 2H6YA 2F51A 4ZBBA 1WWJA 4DEJA 1YF1A 1A0RP 2LTKA 3CTGA 3UAPA 5B7CA 2B3SA 1QQ2A 4DVCA 2JSYA 3CBUA 5JCWA 4Z2RA 1OE8A 2X64A 4RQRA 1TXXA 2DJJA 3G7IA 3GSSA 3O3TA 6GSYA 1IYHA 4V2MA 3BBYA 3A5WA 3IAS2 4K2DA 1MDIA 3H1NA 5J9BA 1A8LA 3L78A 1DE2A 4IHUA 3BJ5A 1XPVA 3EU3A 1YKCA 1T1VA 5HQPA 4GLTA 4MJBA 5BMUA 6GSUA 4EO3A 3IA1A 5CAXA 3HHVA 3IC4A 2VLVA 5DJMA 1XWBA 4G10A 3IDVA 4HZ2A 1GTUA 4IP6A 5A4WA 5ECNB 3SWLA 1RK4A 1NHOA 3QMXA 1JZRA 1ST9A 2QKEA 5ECOB 1PX6A 4HZ4A 4G0IA 2ZNMA 2FD3A 4ISDA 2C0GA 1M2DA 2DC5A 4XHMA 4AF2A 3D6IA 5GSTA 8GSSA 2G0FA 4PX1A 1G6WA 3M1GA 1EV4A 5GSSA 1PGTA 5IOWA 2WGRA 3ZTLA 3QCPA 3F3QA 5DQYA 3FYGA 2YJHA 4A5PA 3MSZA 3FMWA 5AIVA 2WULA 5IO2A 4K7IA 4K9ZA 3TKRA 4PQIA 4TOPA 3HVNA 3SBCA 3L9UA 4OD7A 3N5OA 1ZYEA 3FRCA 2JSZA 5B8BA 5G5EA 3WD6A 4XS6A 2HRNA 1HYUA 3DKSA 4IW9A 4GRFA 4ZBDA 4X43A 5EY6A 4IP1A 2C1YA 5DCHA 4MABA 2IN3A 1O8XA 1PRXA 3DIEA 4ECJA 2EIRA 1GSSA 4Z2TA 2FCHA 3LXZA 5JCUA 4TVEA 5D9WA 1OC3A 2OJLA 2WCIA 2GQMA 1NM3A 1M99A 2H0HA 3H4KA 3U5RE 3I43A 4ID0A 1F2EA 4TR1B 1PN9A 2L5OA 1C72A 4PUAA 2VLTA 1YKAA 3W8JA 2R5GA 2O85A 3QDNA 3FY7A 3ZREA 2TIRA 2VO4A 3ME7A 4K6XA 4NAXA 3HD5A 2B6MA 1GNWA 2FA8A 3FHKA 2YOIA 2KUCA 3APOA 4BVXB 1XWKA 2V32A 4ZL8A 1AUCA 1GTBA 3ZIJA 3KCMA 2YPMA 5CYYA 3ERFA 2DKIA 4KSOA 1A2LA 2YP6A 2VD1A 3KH9A 5AISA 2K8SA 3HA9A 2QC7A 3LYKA 3ZYWA 2NDOA 2DKHA 3IBHA 4FYBA 3CQFA 1LJRA 3KM6A 6GSVA 4X1UA 3L4NA 3M9KA 1V40A 1GWCA 1XVQA 2FWHA 1TOFA 4RI6A 3ZL5A 2QA2A 17GSA 3EINA 2I9HA 3HCZA 3LFLA 4TRXA 4FYCA 2XBIA 2AAWA 1FOHA 2P31A 1ABAA 2UZ8A 4Q5QA 4EC0A 5A5KA 5DVBA 3A2XA 1CQHA 3CSJA 1QMVA 4KF9A 4YAVA 2DBCA 3ZIVA 1AQWA 4XTSA 3FR3A 1SU9A 3F4TA 4CW9A 2HZEB 3IK7A 4IQ1A 4YKGA 3TJJA 5AGYA 3GX8A 2LRNA 5B8AA 1X9SB 2L5LA 1Q4JA 3E3EA 4IELA 2MMNA 1G0TA 1SYRA 6GSTA 2FGXA 3GTUB 3MDKA 4JU5A 4OMVA 5G30A 1SYXA 4PQ1A 2O87A 3QOUA 3C73A 3P90A 1GTIA 3TRPA 4GSSA 2HXKA 1X5DA 1T4YA 1OC8A 2J23A 4K7OA 3EMXA 3FK8A 6GSXA 5IMAA 4K5SA 4N11A 2R3XA 1XW6A 1UN2A 3US3A 1UC7A 4GSNA 1Z9HA 1TW9A 1FVJA 4HI7A 1SENA 4WETA 3F63A 3FZAA 4L8EA 2HSMA 3M3MA 1EP8A 2PUKC 2C0FA 2LRCA 4IVFA 3UEMA 2DJ0A 2HZFA 5ECHB 1ZCPA 1J9BA 2OADA 4NHZA 3O6TA 5A4VA 4KUNA 1YQ1A 5IMDA 3EU4A 1HNCA 1T7PB 2C3TA 2OA7A 3FZ4A 3QD9A 3GNJA 4IS0A 1EGOA 3IRAA 2VLUA 1PN0A 6GSWA 2DSAA 1ZL9A 2HRKA 3HVVA 2NTOA 1R7HA 1M9AA 1DSBA 2I1UA 2KOKA 3TB2A 3TOTA 2IJYA 3UBKA 2B5XA 4MLYA 2VL3A 3EWLA 2XBQA 2H30A 4MF6A 5IO0A 1X0RA 4BA7A 4MCUA 1W4VA 2X99A 5IPHA 1FO5A 4TXOB 3KTBA 1Z6NA 1YJ6A 2V6KA 4PNFA 1K0DA 3LG6A 4MPFA 4BWQA 2MZCA 3RHBA 5HR1A 2B7KA 3VWUA 2X49A 2CX4A 2M46A 2VAFA 3C8EA 3WT2A 4PNGA 4NMUA 5CP1A 2GSRA 2D2ZA 2N5FA 4XS4B 1XWAA 3F6FA 3QAGA 4CHSA 3GMFA 5ECSA 2FA4A 1X5EA 3GKKA 4PXOA 1UA5A 2RUEA 1M2BA 2AB6A 2ZCTA 2V2GA 4H86A 4LL1B 4YH2A 4X4JA 2CQ9A 1G6YA 22GSA 3PH9A 2R6KA 2R4VA 2PVOC 4FO5A 1EOHA 1NW2A 1R4WA 2X8CA 4TKYA 5ECKB 1PL2A 5J4UA 3F4SA 1PD21 3TKSC 1U87A 2RLIA 3ZLPA 1MEKA 3OR5A 1OVNA 5CRHA 5L71A 2R0PA 1EWXA 1A2MA 4WKWA 2DMLA 2H01A 3HXSA 2JL4A 1A8YA 1XG8A 4K0NA 1K3LA 4L0UA 4V1Ag 2LJKA 3KP9A 4HEA2 2FLSA 1GSDA 4GWRA 1G7OA 1F37A 4POKA 4V2NA 3D0ZA 3DXBA 1AIUA 5ECRB 1R5AA 2PWJA 3HZ8A 2JACA 3Q18A 5ID2B 1ZGNA 1V2AA 3ZVJA 3F4RA 4NWYA 3W6GA 2JZTA 2HSHA 2BJXA 2DJ3A 1TK8B 1WJKA 2O7KA 2H70A 5COHA 2LQOA 2A4VA 1EOGA 2C0EA 2YCDA 2LUSA 3FKFA 4N0ZA 2YNXA 3F3RA 2R0CA 2VL2C 3QAWA 1FB0A 5IQYA 3NZNA 1YEXA 5H5RA 2MMAA 2PN8A 3VLNA 3CMIA 3QFBC 5IM9A 2L4QA 2ON5A 2CZ2A 1TRSA 2CV4A 1LBKA 4ZL9A 4F9ZA 4DSSB 2HLSA 2E7PA 4FQUA 4ZILA 4Q5NA 4RUVA 1PA3A 1SD8A 5DAKA 4YQMA 2IWTA 4JZQA 2IFQA 3KMOA 4V1Ap 1ZYQB 2E2GA 3TKSE 1FW1A 1TI3A 5EPFA 2MMZA 4MZBA 3WGDA 3LJRA 1NSWA 3RDWA 4FH8A 1OKDA 1X9MB 3EC3A 3I9V2 1Z3EA 2E0QA 3F8UA 3UL3A 4P3YB 5HFKA 1QFNA 4LA1A 3E9JB 1SJZA 4F2IA 2ON7A 2GSQA 4G9HA 3WT1A 3FZ9A 2A2SA 1OE7A 2OACA 1U88A 1VF3A 4KW6A 1JZDA 2WB9A 4OCEA 5ENUA 5ABRA 3KGKA 1R26A 3M8NA 4QL7A 3I6AA 3VI7A 2FHEA 1Y6EA 2WJUA 5KN2A 3A2VA 4QQ7A 2XPEA 1TRVA 4RQXA 2M80A 1XFLA 2GSTA 5FT3A 5KN1A 3D4TA 4E8EA 2L6DA 2HT9A 5IOXA 3BD2A 4ZL7A 2HNLA 2H8LA 4EDZA 1FOVA 2LSTA 4XCSA 3GSTA 3KZQA 3LYPA 4F0CA 3Q6OA 1KBNA 3DVXA 2C0DA 3QAVA 1X5CA 5LCZA 1Q98A 2VCXA 2HYXA 2LEGA 3S9FA 4K5RA 2YZHA 4FIWA 4EL1A 3KH7A 1E6BA 2LNTA 3A5IA 4HJMA 2H1AA 1TI1A 3AY8A 5D73A 4IN0A 1MD3A 4ZIJA 16GSA 1YY7A 18GSA 2N5BA 6GSSA 5D93A 1M2AA 5KN0A 1YZXA 3IE3A 1GL8A 4PURA 3ZMLA 1F9MA 4OO4A 5DQSA 1OC9A 2VCTA 4GSTA 4GF0A 4O7HA 4BL7B 1M9BA 5D9VA 2I81A 4TW5A 4L5LA 5H5QA 1GRXA 2AYTA 1V98A 1WE0A 2DMMA
chains in the Genus database with same CATH topology
1O6JA 3ERGA 1ERUA 3Q74A 3UIWA 5DDLA 4EUYA 1F6MC 4KDXA 4HUAA 4ZB9A 2KHPA 3FR9A 3V1WA 5HFGA 1K0OA 1KNGA 2VM1A 4Z7XA 3HVXA 5CRGA 2K8VA 2LNSA 4NV5A 1TKDB 4EIQA 4ACSA 4GTUA 1X9WB 2VCVA 3E0UA 2JADA 2IL3A 2KLXA 3HDCA 2DIYA 4LL4B 4I8BA 3QPMA 4EKZA 2GVPA 1O7UA 2DJ1A 1TK0B 2GDRA 3HYPA 1ML6A 2AHEA 4NHWA 2GSSA 4ZXGA 1GSYA 3MAKA 2GT6A 3ZMKA 1OAZA 3J7Yk 2A2PA 3BCIA 3KP8A 2C80A 4TN8A 5F07A 2B1LA 1YEPA 2GS3A 1QK8A 4CY8A 4ZB6A 2H0IA 2H71A 3ZFLA 2K9FA 2PPTA 5D9XA 2CA8A 2WDUA 1THXA 3GURA 1PMTA 9GSSA 2EIOA 3R3EA 2OE0A 5JCGA 5GAND 1VF2A 1HQOA 2HE3A 4ECIA 1U6TA 5G2ZA 1J0FA 2VD0A 3FEUA 2PVQA 3TKSA 4KNDA 4K0GA 5ECMB 4EE0A 2GZPA 2JU5A 4IJ3A 2H73A 5ECIB 3R2QA 1GSFA 3GH9A 4D73B 3MWHA 2LJRA 1N2AA 1ERWA 4L0WA 2WZ9A 5DALB 1N8JA 3A2WA 1SK1A 3G7JA 2M72A 2GZYA 3TRQA 1GUMA 2IIYA 2H66A 4PQHA 4NV2A 3H93A 3C1RA 5IMZA 4F03A 3CYNA 3UARA 1WPIA 3P2AA 1PQNA 3VURA 3IK9A 1NHYA 1XW9A 2MBSA 1ERVA 1EZKA 4WBJA 5H5SA 2TRCP 2HRFA 3RBTA 3D22A 2V41A 3M9JA 3F0IA 1EP7A 5ECLB 2OKAA 3J7Yb 5BRTA 1SJ6A 1V57A 2CVDA 4HDEA 3TJGA 3EVIA 2VL2A 4ZB8A 1K3OA 7GSSA 4GCIA 1G7EA 1GUKA 4NPBA 1SKRB 2B1KA 2VM2A 2P0GA 2RM5A 4IGJA 1TDIA 2L57A 2ZUPA 3GKXA 2FUG2 4BVYB 2VIMA 4LMVA 1OYJA 1BAYA 4I5QA 3TOUA 4TR1A 3UVTA 2YZUA 1PSQA 3TCOA 3LEFA 4MF7A 4KSMA 5CRWA 4POBA 1QGVA 1AC1A 1RQMA 3TDGA 3N9JA 2OBKA 1TRWA 2DIZA 1GLQA 5INYA 2E2MA 2YJ7A 2QSIA 1SK2A 4BVXA 2CT6A 2OE3A 3WGEA 4OO5A 4WF5A 1T8EB 3GKMA 4J2FA 3FZ5A 4YAPA 1YDKA 3LGCA 2BTOT 4O5RA 3H8QA 3RAZA 2R37A 5AN1A 3F9UA 4G0LA 2H75A 3TJBA 2OE1A 1OKTA 2VCWA 3GL3A 1YF0A 1WP0A 3VPTA 4HS1A 4K8MA 3P7XA 1VF4A 2R0GA 3LQ7A 1ZOFA 4MF5A 2WS2A 4O32A 4O5UA 3GUSA 3DD3A 4ECBA 1LU4A 1B9XC 2LJAA 1BG5A 5KOXA 2L6CA 3HJOA 3PR8A 1QXHA 1V9WA 2P5RA 4HQSA 5LD0A 2G2QA 1XZOA 1FHEA 1U3IA 2YV7A 1SKSB 1GLPA 2IMFA 5EL8A 4DSQA 3U6VA 2I4AA 3CSHA 4KCEA 2YV9A 2PBJA 2HZEA 3ISOA 3EPTA 4GQFA 4N30A 2GT5A 2IMKA 1GSEA 1FVKA 3EURA 1T4ZA 3PGTA 2X8HA 4DSRA 1FAAA 2PMTA 2LS5A 2VCQA 1F3BA 2J9HA 2GTUA 2F8FA 4AGSA 2O8VB 3A3TA 4F0BA 4KDYA 1GP1A 3GTUA 2NBSA 2RIIA 3HJPA 3ZITA 5HR2A 4JR6A 3EE2A 3LXTA 1WIKA 3KTLA 1W89A 3APQA 4WBRD 2FWEA 3IXRA 1XWCA 3DVWA 1XCCA 1MDJA 5ELAA 3CSIA 4I97A 3IAM2 3GKNA 1K0BA 1PKWA 1K0CA 2FWFA 2YWOA 1GNEA 5D9TA 5C04A 3VI5A 4I6XA 3GN3A 4WR4A 3MNGA 5J9CA 2C3QA 3QR6A 2BMXA 3EMPA 1K0MA 4PTSA 3ZVJD 20GSA 3RPPA 4E8HA 1Z5YE 5A4UA 4MJEA 2K18A 3HY2A 2NVLA 13GSA 4MMMA 4HQZA 2IMEA 4OWYA 4G19A 2AJQB 1O8WA 4KDUA 5JWOB 1ZYNA 2IPAA 2VL9A 5F0GA 3W8SA 3PPUA 1EEMA 1Z6MA 1ZYPA 1USBA 3VWWA 3ZRDA 3Q19A 1GULA 4MJAA 3IOSA 3MIXA 4K7NA 1M7TA 2B5EA 2YN1A 2A2RA 1T00A 4TXOA 3L0HA 1DE1A 4NXIA 1MDKA 4O5QA 1IYIA 1GSUA 2C4JA 1KEBA 4G0KA 3GH6A 1TU8A 1U3AA 1JLWA 2K6VA 3UJ1A 3ERWA 1Z7RA 4TXVA 3ME8A 4CDOA 2L4CA 2XHFA 1TK5B 5HFIA 3QFAC 3IV4A 4ML1A 1WRYA 4MP4A 1BQ7A 5IMVA 4JRRA 1A23A 4XS4A 2JZSA 3H79A 5DCGA 4CY6A 5G31A 1TJDA 5J41A 4K1FA 1PKZA 5KOWA 3F6DA 3WGXA 2H19A 3I69A 4AJ8A 1T3BA 1K3YA 2FWGA 5E4WA 5CRDA 1UVZA 4LLRA 1K0AA 1XOAA 4OCFA 3GHAA 5D96A 3VK9A 3HVSA 3KD0A 4ILFA 1SJIA 2YWNA 3VPQA 4FYUA 1SL1B 4MJCA 4KA0A 3EYTA 4JBBA 3TRXA 1B4QA 3GFKA 3DMLA 1I5GA 5EVOA 3TKQA 5DJLA 3M0FA 2NPBA 2H1DA 4YQUA 3IC8A 2GLRA 2V6OA 1ERTA 4I2UA 5ECPB 4MH2A 5AIXA 5ID2A 3GRXA 1R5PA 1CQGA 4Z2UA 5CO3A 4V2LA 3LSZA 4IJIA 4OFNA 2Z9SA 4JEDA 2XPDA 19GSA 2HFDA 3IR4A 2F3MA 1ZZYA 3JCML 3P8WA 3G9BA 3APSA 1TTZA 1HD2A 2DLXA 2GZZA 3DGQA 4WEYA 1H4OA 1SKWB 1H75A 1S3AA 1Y25A 2REMA 4DSSA 2DJKA 1SL2B 4BWSA 5LNKe 11GSA 1A0FA 2LRTA 1SD9A 2H6XA 1XW5A 5ELGA 4HJ2A 5IMCA 2HI7A 1AW9A 5D8IA 1PL1A 2QGVA 10GSA 4Q5RA 1GSQA 2V1MA 3CRUA 1S3DA 1K0NA 2O89A 5IPGA 4IKHA 2X4AA 1A2JA 3ED3A 3DEXA 1SK0A 1JLVA 4KGIA 3CXGA 3BOAA 1JZWA 2PU9C 2CZ3A 3NOFA 4G2EA 4ULXA 5G1LA 2YANA 3RPNA 2CVKA 1PX7A 3UVHA 1WOUA 1BYEA 3O76A 4AJ7A 4HU9A 4EXJA 3FW2A 2LQQA 5G1KA 2R2JA 3KIJA 3KXOA 4AJ6A 1EGRA 4EIPA 1XXUA 4KAEA 3DWVA 4O92A 2WFCA 2F9SA 3ZFBA 4TR3A 4MA9A 2AUVA 4WR5A 2I3YA 1I9DA 2DJ2A 2LKUA 2AV4A 5GZZB 1EEJA 4POMA 4USSA 3TKPA 3IHGA 1AAZA 3TGZA 2EIQA 2H76A 2FY6A 5B6MA 2ALBA 3GV1A 1XOBA 2LV3A 2GQKA 3RHCA 4YKFA 4BPYA 3IHQA 5KN3A 1FG4A 5C00A 4IQAA 1EV9A 3LWAA 4PUFC 1DBYA 2F8AA 2KP1A 1AQVA 2X8GA 2ES7A 2HSYA 4YQVA 4XS1A 4XRDA 2C8UA 3GIXA 3VWVA 2B7JA 2H1GA 1BX9A 2EC4A 1XVWA 1B8XA 1J08A 4EF0A 1TP9A 3VFIA 1BJXA 1GUHA 3L9VA 2IMIA 2XC2A 3C1SA 3FR6A 4BL7A 3HZ4A 4JE1A 4OFTA 4RI7A 2KP2A 5GAPD 4KX4A 2L59A 4GXZA 5KEJA 4TR0A 3UBLA 1THOA 5IMFA 1TU7A 3VWXA 2H1BA 5FHIA 4MZCA 5DAKB 3TJFA 2MMOA 2IFQB 4LMWA 1JZOA 2YWIA 3C71A 4XIHA 1O73A 1TRUA 2N5AA 2QA1A 4IBPA 4J56E 2PGTA 14GSA 3D4MA 4HU7A 3NIVA 5JWRB 5E59A 1MD4A 2OBIA 3BCKA 1ZMAA 1HNBA 4KE3A 3GL5A 2CVBA 3CRTA 2FNOA 4ICYA 1B4PA 4MK3A 3MYDA 5G5FA 2CAIA 2GQLA 4WF4A 3L9SA 1MTCA 1DUGA 1M0UA 3TUEA 2HRAA 3KEBA 4X0XA 2PERA 4KB3A 1HNAA 2WRTA 4MPGA 5ECQB 3DYRA 4MZWA 2P5QA 4KCAA 3CTFA 3G7YA 1QUWA 1F3AA 3GYKA 1O81A 4MDCA 3UMAA 12GSA 2GGTA 5IIZA 1AXDA 1S3CA 4XRAA 5F06A 4ZBAA 3HJMA 1VF1A 2VCZA 1FB6A 1GH2A 4POLA 1RW1A 1VGLA 4PGTA 3TJKA 3UOMA 5J5NA 1B48A 1BEDA 4I2TA 4MH3A 2CX3A 4HOJA 3WYWA 5F05A 1JHBA 1V58A 3D5JA 3DRNA 3HKRA 1ACVA 1Z7PA 5CNWA 4D73A 4EVMA 4F82A 2IMDA 1JFUA 2RM6A 4J57E 5J3RA 2VOCA 4KH7A 4L5OA 5DALA 1XWGA 4N0VA 5CREA 4Q5FA 3LORA 5B6NA 4WXTA 2CAQA 1B9YC 2TRXA 2H6ZA 2MBTA 1O85A 3K8NA 4QL9A 4EDYA 1VRSD 1ILOA 2H74A 2YWMA 4GQCA 2JZRA 4N10A 3D21A 2H0GA 5FWGA 2C3NA 3IPZA 1OC9B 1XIYA 3C7MA 3KMNA 3KJYA 3PINA 3GX0A 4TR4A 2VUPA 4ECCA 3GA4A 4JR4A 5HR3A 1GTAA 1ON4A 2MYGA 1E2YA 4OFMA 1AQXA 4ML6A 5HR0A 3ZZXA 4MNNA 2H72A 2A4HA 1URMA 4K2XA 1KTEA 2B5YA 4BVYA 5DBQA 5F8BA 1A24A 1XBSA 2RUFA 1WMJA 5JWQB 1SL0B 3LW9A 2H6YA 2F51A 4ZBBA 1WWJA 4DEJA 1YF1A 1A0RP 2LTKA 3CTGA 3UAPA 5B7CA 2B3SA 1QQ2A 4DVCA 2JSYA 3CBUA 5JCWA 4Z2RA 1OE8A 2X64A 4RQRA 1TXXA 2DJJA 3G7IA 3GSSA 3O3TA 6GSYA 1IYHA 4V2MA 3BBYA 3A5WA 3IAS2 4K2DA 1MDIA 3H1NA 5J9BA 1A8LA 3L78A 1DE2A 4IHUA 3BJ5A 1XPVA 3EU3A 1YKCA 1T1VA 5HQPA 4GLTA 4MJBA 5BMUA 6GSUA 4EO3A 3IA1A 5CAXA 3HHVA 3IC4A 2VLVA 5DJMA 1XWBA 4G10A 3IDVA 4HZ2A 1GTUA 4IP6A 5A4WA 5ECNB 3SWLA 1RK4A 1NHOA 3QMXA 1JZRA 1ST9A 2QKEA 5ECOB 1PX6A 4HZ4A 4G0IA 2ZNMA 2FD3A 4ISDA 2C0GA 1M2DA 2DC5A 4XHMA 4AF2A 3D6IA 5GSTA 8GSSA 2G0FA 4PX1A 1G6WA 3M1GA 1EV4A 5GSSA 1PGTA 5IOWA 2WGRA 3ZTLA 3QCPA 3F3QA 5DQYA 3FYGA 2YJHA 4A5PA 3MSZA 3FMWA 5AIVA 2WULA 5IO2A 4K7IA 4K9ZA 3TKRA 4PQIA 4TOPA 3SBCA 3L9UA 4OD7A 3N5OA 1ZYEA 3FRCA 2JSZA 5B8BA 5G5EA 3WD6A 4XS6A 2HRNA 1HYUA 3DKSA 4IW9A 4GRFA 4ZBDA 4X43A 5EY6A 4IP1A 2C1YA 5DCHA 4MABA 2IN3A 1O8XA 1PRXA 3DIEA 4ECJA 2EIRA 1GSSA 4Z2TA 2FCHA 3LXZA 5JCUA 4TVEA 5D9WA 1OC3A 2OJLA 2WCIA 2GQMA 1NM3A 1M99A 2H0HA 3H4KA 3U5RE 3I43A 4ID0A 1F2EA 4TR1B 1PN9A 2L5OA 1C72A 4PUAA 2VLTA 1YKAA 3W8JA 2R5GA 2O85A 3QDNA 3FY7A 3ZREA 2TIRA 2VO4A 3ME7A 4K6XA 4NAXA 3HD5A 2B6MA 1GNWA 2FA8A 3FHKA 2YOIA 2KUCA 3APOA 4BVXB 1XWKA 2V32A 4ZL8A 1AUCA 1GTBA 3ZIJA 3KCMA 2YPMA 5CYYA 3ERFA 2DKIA 4KSOA 1A2LA 2YP6A 2VD1A 3KH9A 5AISA 2K8SA 3HA9A 2QC7A 3LYKA 3ZYWA 2NDOA 2DKHA 3IBHA 4FYBA 1LJRA 3KM6A 6GSVA 4X1UA 3L4NA 3M9KA 1V40A 1GWCA 1XVQA 2FWHA 1TOFA 4RI6A 3ZL5A 2QA2A 17GSA 3EINA 2I9HA 3HCZA 3LFLA 4TRXA 4FYCA 2XBIA 2AAWA 1FOHA 2P31A 1ABAA 2UZ8A 4Q5QA 4EC0A 5A5KA 5DVBA 3A2XA 1CQHA 3CSJA 1QMVA 4KF9A 4YAVA 2DBCA 3ZIVA 1AQWA 4XTSA 3FR3A 1SU9A 3F4TA 4CW9A 2HZEB 3IK7A 4IQ1A 4YKGA 3TJJA 5AGYA 3GX8A 2LRNA 5B8AA 1X9SB 2L5LA 1Q4JA 3E3EA 4IELA 2MMNA 1G0TA 1SYRA 6GSTA 2FGXA 3GTUB 3MDKA 4JU5A 4OMVA 5G30A 1SYXA 4PQ1A 2O87A 3QOUA 3C73A 3P90A 1GTIA 3TRPA 4GSSA 2HXKA 1X5DA 1T4YA 1OC8A 2J23A 4K7OA 3EMXA 3FK8A 6GSXA 5IMAA 4K5SA 4N11A 2R3XA 1XW6A 1UN2A 3US3A 1UC7A 4GSNA 1Z9HA 1TW9A 1FVJA 4HI7A 1SENA 4WETA 3F63A 3FZAA 4L8EA 2HSMA 3M3MA 1EP8A 2PUKC 2C0FA 2LRCA 4IVFA 3UEMA 2DJ0A 2HZFA 5ECHB 1ZCPA 1J9BA 2OADA 4NHZA 3O6TA 5A4VA 4KUNA 1YQ1A 5IMDA 3EU4A 1HNCA 1T7PB 2C3TA 2OA7A 3FZ4A 3QD9A 3GNJA 4IS0A 1EGOA 3IRAA 2VLUA 1PN0A 6GSWA 2DSAA 1ZL9A 2HRKA 3HVVA 2NTOA 1R7HA 1M9AA 1DSBA 2I1UA 2KOKA 3TB2A 3TOTA 2IJYA 3UBKA 2B5XA 4MLYA 2VL3A 3EWLA 2XBQA 2H30A 4MF6A 5IO0A 1X0RA 4BA7A 4MCUA 1W4VA 2X99A 5IPHA 1FO5A 4TXOB 3KTBA 1Z6NA 1YJ6A 2V6KA 4PNFA 1K0DA 3LG6A 4MPFA 4BWQA 2MZCA 3RHBA 5HR1A 2B7KA 3VWUA 2X49A 2CX4A 2M46A 2VAFA 3C8EA 3WT2A 4PNGA 4NMUA 5CP1A 2GSRA 2D2ZA 2N5FA 4XS4B 1XWAA 3F6FA 3QAGA 4CHSA 3GMFA 5ECSA 2FA4A 1X5EA 3GKKA 4PXOA 1UA5A 2RUEA 1M2BA 2AB6A 2ZCTA 2V2GA 4H86A 4LL1B 4YH2A 4X4JA 2CQ9A 1G6YA 22GSA 3PH9A 2R6KA 2R4VA 2PVOC 4FO5A 1EOHA 1NW2A 1R4WA 2X8CA 4TKYA 5ECKB 1PL2A 5J4UA 3F4SA 1PD21 3TKSC 1U87A 2RLIA 3ZLPA 1MEKA 3OR5A 1OVNA 5CRHA 5L71A 2R0PA 1EWXA 1A2MA 4WKWA 2DMLA 2H01A 3HXSA 2JL4A 1A8YA 4K0NA 1K3LA 4L0UA 4V1Ag 2LJKA 3KP9A 4HEA2 2FLSA 1GSDA 4GWRA 1G7OA 1F37A 4POKA 4V2NA 3D0ZA 3DXBA 1AIUA 5ECRB 1R5AA 2PWJA 3HZ8A 2JACA 3Q18A 5ID2B 1ZGNA 1V2AA 3ZVJA 3F4RA 4NWYA 3W6GA 2JZTA 2HSHA 2BJXA 2DJ3A 1TK8B 1WJKA 2O7KA 2H70A 5COHA 2LQOA 2A4VA 1EOGA 2C0EA 2YCDA 2LUSA 3FKFA 4N0ZA 2YNXA 3F3RA 2R0CA 2VL2C 3QAWA 1FB0A 5IQYA 3NZNA 1YEXA 5H5RA 2MMAA 2PN8A 3VLNA 3CMIA 3QFBC 5IM9A 2L4QA 2ON5A 2CZ2A 1TRSA 2CV4A 1LBKA 4ZL9A 4F9ZA 4DSSB 2HLSA 2E7PA 4FQUA 4ZILA 4Q5NA 4RUVA 1PA3A 1SD8A 5DAKA 4YQMA 2IWTA 4JZQA 2IFQA 3KMOA 4V1Ap 1ZYQB 2E2GA 3TKSE 1FW1A 1TI3A 5EPFA 2MMZA 4MZBA 3WGDA 3LJRA 1NSWA 3RDWA 4FH8A 1OKDA 1X9MB 3EC3A 3I9V2 1Z3EA 2E0QA 3F8UA 3UL3A 4P3YB 5HFKA 1QFNA 4LA1A 3E9JB 1SJZA 4F2IA 2ON7A 2GSQA 4G9HA 3WT1A 3FZ9A 2A2SA 1OE7A 2OACA 1U88A 1VF3A 4KW6A 1JZDA 2WB9A 4OCEA 5ENUA 5ABRA 3KGKA 1R26A 3M8NA 4QL7A 3I6AA 3VI7A 2FHEA 1Y6EA 2WJUA 5KN2A 3A2VA 4QQ7A 2XPEA 1TRVA 4RQXA 2M80A 1XFLA 2GSTA 5FT3A 5KN1A 3D4TA 4E8EA 2L6DA 2HT9A 5IOXA 3BD2A 4ZL7A 2HNLA 2H8LA 4EDZA 1FOVA 2LSTA 4XCSA 3GSTA 3KZQA 3LYPA 4F0CA 3Q6OA 1KBNA 3DVXA 2C0DA 3QAVA 1X5CA 5LCZA 1Q98A 2VCXA 2HYXA 2LEGA 3S9FA 4K5RA 2YZHA 4FIWA 4EL1A 3KH7A 1E6BA 2LNTA 3A5IA 4HJMA 2H1AA 1TI1A 3AY8A 5D73A 4IN0A 1MD3A 4ZIJA 16GSA 1YY7A 18GSA 2N5BA 6GSSA 5D93A 1M2AA 5KN0A 1YZXA 3IE3A 1GL8A 4PURA 3ZMLA 1F9MA 4OO4A 5DQSA 1OC9A 2VCTA 4GSTA 4GF0A 4O7HA 4BL7B 1M9BA 5D9VA 2I81A 4TW5A 4L5LA 5H5QA 1GRXA 2AYTA 1V98A 1WE0A 2DMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O6J A;  3ERG A;  1ERU A;  3Q74 A;  3UIW A;  5DDL A;  4EUY A;  1F6M C;  4KDX A;  4HUA A;  4ZB9 A;  2KHP A;  3FR9 A;  3V1W A;  5HFG A;  1K0O A;  1KNG A;  2VM1 A;  4Z7X A;  3HVX A;  5CRG A;  2K8V A;  2LNS A;  4NV5 A;  1TKD B;  4ACS A;  4GTU A;  1X9W B;  2VCV A;  3E0U A;  2JAD A;  2IL3 A;  2KLX A;  3HDC A;  2DIY A;  4LL4 B;  4I8B A;  3QPM A;  4EKZ A;  2GVP A;  1O7U A;  2DJ1 A;  1TK0 B;  2GDR A;  3HYP A;  1ML6 A;  2AHE A;  4NHW A;  2GSS A;  4ZXG A;  1GSY A;  3MAK A;  2GT6 A;  3ZMK A;  1OAZ A;  3J7Y k;  3BCI A;  3KP8 A;  2C80 A;  4TN8 A;  5F07 A;  2B1L A;  1YEP A;  2GS3 A;  1QK8 A;  4ZB6 A;  2H0I A;  2H71 A;  3ZFL A;  2K9F A;  2PPT A;  5D9X A;  2CA8 A;  2WDU A;  1THX A;  3GUR A;  1PMT A;  9GSS A;  2EIO A;  2OE0 A;  5JCG A;  5GAN D;  1VF2 A;  1HQO A;  2HE3 A;  4ECI A;  1U6T A;  5G2Z A;  1J0F A;  2VD0 A;  3FEU A;  2PVQ A;  3TKS A;  4KND A;  4K0G A;  5ECM B;  4EE0 A;  2GZP A;  2JU5 A;  4IJ3 A;  2H73 A;  5ECI B;  3R2Q A;  1GSF A;  3GH9 A;  4D73 B;  3MWH A;  2LJR A;  1N2A A;  1ERW A;  4L0W A;  2WZ9 A;  5DAL B;  1N8J A;  3A2W A;  1SK1 A;  3G7J A;  2M72 A;  2GZY A;  3TRQ A;  1GUM A;  2IIY A;  2H66 A;  4PQH A;  4NV2 A;  3H93 A;  3C1R A;  5IMZ A;  4F03 A;  3CYN A;  3UAR A;  1WPI A;  3P2A A;  1PQN A;  3VUR A;  3IK9 A;  1NHY A;  1XW9 A;  2MBS A;  1ERV A;  1EZK A;  4WBJ A;  5H5S A;  2TRC P;  2HRF A;  3RBT A;  3D22 A;  2V41 A;  3M9J A;  3F0I A;  1EP7 A;  5ECL B;  2OKA A;  3J7Y b;  1SJ6 A;  1V57 A;  2CVD A;  4HDE A;  3TJG A;  3EVI A;  2VL2 A;  4ZB8 A;  1K3O A;  7GSS A;  4GCI A;  1G7E A;  1GUK A;  4NPB A;  1SKR B;  2B1K A;  2VM2 A;  2P0G A;  2RM5 A;  4IGJ A;  1TDI A;  2L57 A;  2ZUP A;  3GKX A;  2FUG 2;  2VIM A;  4LMV A;  1OYJ A;  1BAY A;  4I5Q A;  3TOU A;  4TR1 A;  3UVT A;  2YZU A;  1PSQ A;  3TCO A;  3LEF A;  4MF7 A;  4KSM A;  5CRW A;  4POB A;  1QGV A;  1AC1 A;  1RQM A;  3TDG A;  3N9J A;  2OBK A;  1TRW A;  2DIZ A;  1GLQ A;  5INY A;  2E2M A;  2YJ7 A;  2QSI A;  1SK2 A;  4BVX A;  2CT6 A;  2OE3 A;  3WGE A;  4OO5 A;  4WF5 A;  1T8E B;  3GKM A;  4J2F A;  3FZ5 A;  4YAP A;  1YDK A;  3LGC A;  2BTO T;  4O5R A;  3H8Q A;  3RAZ A;  2R37 A;  5AN1 A;  3F9U A;  3TJB A;  2H75 A;  2OE1 A;  1OKT A;  2VCW A;  3GL3 A;  1YF0 A;  1WP0 A;  3VPT A;  4HS1 A;  4K8M A;  3P7X A;  1VF4 A;  3LQ7 A;  1ZOF A;  4MF5 A;  2WS2 A;  4O32 A;  3GUS A;  3DD3 A;  4ECB A;  1LU4 A;  1B9X C;  2LJA A;  1BG5 A;  2L6C A;  3HJO A;  3PR8 A;  1QXH A;  1V9W A;  2P5R A;  4HQS A;  5LD0 A;  2G2Q A;  1XZO A;  1FHE A;  1U3I A;  2YV7 A;  1SKS B;  1GLP A;  2IMF A;  5EL8 A;  4DSQ A;  3U6V A;  2I4A A;  3CSH A;  4KCE A;  2YV9 A;  2PBJ A;  2HZE A;  3ISO A;  4GQF A;  4N30 A;  2GT5 A;  2IMK A;  1GSE A;  1FVK A;  3EUR A;  1T4Z A;  3PGT A;  2X8H A;  4DSR A;  1FAA A;  2PMT A;  2LS5 A;  2VCQ A;  1F3B A;  2J9H A;  2GTU A;  2F8F A;  4AGS A;  2O8V B;  3A3T A;  4F0B A;  4KDY A;  1GP1 A;  3GTU A;  2NBS A;  2RII A;  3HJP A;  3ZIT A;  5HR2 A;  4JR6 A;  3EE2 A;  3LXT A;  1WIK A;  3KTL A;  1W89 A;  3APQ A;  4WBR D;  2FWE A;  3IXR A;  1XWC A;  3DVW A;  1XCC A;  5ELA A;  1MDJ A;  3CSI A;  4I97 A;  3IAM 2;  3GKN A;  1K0B A;  1PKW A;  1K0C A;  2FWF A;  2YWO A;  1GNE A;  5D9T A;  5C04 A;  3VI5 A;  4I6X A;  3GN3 A;  4WR4 A;  3MNG A;  5J9C A;  2C3Q A;  3QR6 A;  2BMX A;  3EMP A;  1K0M A;  3ZVJ D;  20GS A;  3RPP A;  4E8H A;  1Z5Y E;  5A4U A;  4MJE A;  2K18 A;  3HY2 A;  2NVL A;  13GS A;  4MMM A;  4HQZ A;  2IME A;  4OWY A;  4G19 A;  2AJQ B;  1O8W A;  4KDU A;  5JWO B;  2IPA A;  2VL9 A;  5F0G A;  3W8S A;  1EEM A;  1Z6M A;  1USB A;  3VWW A;  3ZRD A;  3Q19 A;  1GUL A;  4MJA A;  3IOS A;  4K7N A;  1M7T A;  2B5E A;  2YN1 A;  2A2R A;  1T00 A;  4TXO A;  3L0H A;  1DE1 A;  4NXI A;  1MDK A;  1IYI A;  1GSU A;  2C4J A;  1KEB A;  3GH6 A;  1TU8 A;  1U3A A;  1JLW A;  2K6V A;  3UJ1 A;  3ERW A;  1Z7R A;  4TXV A;  3ME8 A;  4CDO A;  2L4C A;  2XHF A;  1TK5 B;  5HFI A;  3QFA C;  3IV4 A;  4ML1 A;  1WRY A;  4MP4 A;  1BQ7 A;  5IMV A;  4JRR A;  1A23 A;  4XS4 A;  2JZS A;  3H79 A;  5DCG A;  5G31 A;  1TJD A;  5J41 A;  4K1F A;  1PKZ A;  3F6D A;  3WGX A;  2H19 A;  3I69 A;  4AJ8 A;  1T3B A;  1K3Y A;  2FWG A;  5E4W A;  5CRD A;  1UVZ A;  4LLR A;  1K0A A;  1XOA A;  4OCF A;  3GHA A;  5D96 A;  3VK9 A;  3HVS A;  3KD0 A;  4ILF A;  1SJI A;  2YWN A;  3VPQ A;  4FYU A;  1SL1 B;  4MJC A;  4KA0 A;  3EYT A;  4JBB A;  3TRX A;  1B4Q A;  3GFK A;  3DML A;  1I5G A;  5EVO A;  3TKQ A;  5DJL A;  3M0F A;  2NPB A;  2H1D A;  4YQU A;  2GLR A;  2V6O A;  1ERT A;  4I2U A;  5ECP B;  4MH2 A;  5AIX A;  5ID2 A;  3GRX A;  1R5P A;  1CQG A;  5CO3 A;  4V2L A;  3LSZ A;  4IJI A;  4OFN A;  2Z9S A;  4JED A;  2XPD A;  19GS A;  2HFD A;  3IR4 A;  2F3M A;  1ZZY A;  3JCM L;  3P8W A;  3G9B A;  3APS A;  1TTZ A;  1HD2 A;  2DLX A;  2GZZ A;  3DGQ A;  4WEY A;  1H4O A;  1SKW B;  1H75 A;  1S3A A;  1Y25 A;  2REM A;  4DSS A;  2DJK A;  1SL2 B;  4BWS A;  5LNK e;  11GS A;  1A0F A;  2LRT A;  1SD9 A;  2H6X A;  1XW5 A;  5ELG A;  4HJ2 A;  5IMC A;  2HI7 A;  1AW9 A;  5D8I A;  1PL1 A;  2QGV A;  10GS A;  4Q5R A;  1GSQ A;  2V1M A;  3CRU A;  1S3D A;  1K0N A;  2O89 A;  5IPG A;  4IKH A;  1A2J A;  3ED3 A;  3DEX A;  1SK0 A;  1JLV A;  4KGI A;  3CXG A;  3BOA A;  1JZW A;  2PU9 C;  2CZ3 A;  3NOF A;  4G2E A;  4ULX A;  5G1L A;  2YAN A;  3RPN A;  2CVK A;  1PX7 A;  3UVH A;  1WOU A;  1BYE A;  3O76 A;  4AJ7 A;  4HU9 A;  4EXJ A;  3FW2 A;  2LQQ A;  5G1K A;  2R2J A;  3KIJ A;  3KXO A;  4AJ6 A;  1EGR A;  1XXU A;  4KAE A;  3DWV A;  4O92 A;  2WFC A;  2F9S A;  3ZFB A;  4TR3 A;  4MA9 A;  2AUV A;  4WR5 A;  2I3Y A;  1I9D A;  2DJ2 A;  2LKU A;  2AV4 A;  5GZZ B;  1EEJ A;  4POM A;  3TKP A;  1AAZ A;  3TGZ A;  2EIQ A;  2H76 A;  2FY6 A;  5B6M A;  2ALB A;  3GV1 A;  1XOB A;  2LV3 A;  2GQK A;  3RHC A;  4BPY A;  3IHQ A;  5KN3 A;  1FG4 A;  5C00 A;  4IQA A;  1EV9 A;  3LWA A;  4PUF C;  1DBY A;  2F8A A;  2KP1 A;  1AQV A;  2X8G A;  2ES7 A;  2HSY A;  4YQV A;  4XS1 A;  4XRD A;  2C8U A;  3GIX A;  3VWV A;  2B7J A;  2H1G A;  1BX9 A;  2EC4 A;  1XVW A;  1B8X A;  1J08 A;  4EF0 A;  1TP9 A;  3VFI A;  1BJX A;  1GUH A;  3L9V A;  2IMI A;  2XC2 A;  3C1S A;  3FR6 A;  4BL7 A;  3HZ4 A;  4JE1 A;  4OFT A;  4RI7 A;  2KP2 A;  5GAP D;  4KX4 A;  2L59 A;  4GXZ A;  5KEJ A;  4TR0 A;  3UBL A;  1THO A;  5IMF A;  1TU7 A;  3VWX A;  2H1B A;  5FHI A;  4MZC A;  5DAK B;  3TJF A;  2MMO A;  2IFQ B;  4LMW A;  1JZO A;  2YWI A;  3C71 A;  4XIH A;  1O73 A;  1TRU A;  2N5A A;  4IBP A;  4J56 E;  2PGT A;  14GS A;  3D4M A;  4HU7 A;  3NIV A;  5JWR B;  5E59 A;  1MD4 A;  2OBI A;  3BCK A;  1ZMA A;  1HNB A;  4KE3 A;  3GL5 A;  2CVB A;  3CRT A;  2FNO A;  1B4P A;  4MK3 A;  5G5F A;  2CAI A;  2GQL A;  4WF4 A;  3L9S A;  1MTC A;  1DUG A;  1M0U A;  3TUE A;  3KEB A;  4X0X A;  2PER A;  4KB3 A;  1HNA A;  2WRT A;  4MPG A;  5ECQ B;  3DYR A;  4MZW A;  2P5Q A;  4KCA A;  3CTF A;  3G7Y A;  1QUW A;  1F3A A;  3GYK A;  1O81 A;  4MDC A;  3UMA A;  12GS A;  2GGT A;  5IIZ A;  1AXD A;  1S3C A;  4XRA A;  5F06 A;  4ZBA A;  3HJM A;  1VF1 A;  2VCZ A;  1FB6 A;  1GH2 A;  4POL A;  1RW1 A;  1VGL A;  4PGT A;  3TJK A;  3UOM A;  5J5N A;  1B48 A;  1BED A;  4I2T A;  4MH3 A;  2CX3 A;  4HOJ A;  3WYW A;  5F05 A;  1JHB A;  1V58 A;  3D5J A;  3DRN A;  3HKR A;  1ACV A;  1Z7P A;  5CNW A;  4D73 A;  4EVM A;  4F82 A;  2IMD A;  1JFU A;  2RM6 A;  4J57 E;  5J3R A;  2VOC A;  4KH7 A;  4L5O A;  5DAL A;  1XWG A;  4N0V A;  5CRE A;  4Q5F A;  3LOR A;  5B6N A;  4WXT A;  2CAQ A;  1B9Y C;  2TRX A;  2H6Z A;  2MBT A;  1O85 A;  3K8N A;  4QL9 A;  4EDY A;  1VRS D;  1ILO A;  2H74 A;  2YWM A;  4GQC A;  2JZR A;  4N10 A;  3D21 A;  2H0G A;  5FWG A;  2C3N A;  3IPZ A;  1OC9 B;  1XIY A;  3C7M A;  3KMN A;  3KJY A;  3PIN A;  3GX0 A;  4TR4 A;  2VUP A;  4ECC A;  3GA4 A;  4JR4 A;  5HR3 A;  1GTA A;  1ON4 A;  2MYG A;  1E2Y A;  4OFM A;  1AQX A;  4ML6 A;  5HR0 A;  3ZZX A;  2H72 A;  1URM A;  1KTE A;  2B5Y A;  4BVY A;  5DBQ A;  5F8B A;  1A24 A;  1XBS A;  2RUF A;  1WMJ A;  5JWQ B;  1SL0 B;  2H6Y A;  2F51 A;  4ZBB A;  1WWJ A;  4DEJ A;  1YF1 A;  1A0R P;  2LTK A;  3CTG A;  3UAP A;  5B7C A;  2B3S A;  1QQ2 A;  4DVC A;  2JSY A;  3CBU A;  5JCW A;  1OE8 A;  2X64 A;  4RQR A;  1TXX A;  2DJJ A;  3G7I A;  3GSS A;  3O3T A;  6GSY A;  1IYH A;  4V2M A;  3BBY A;  3A5W A;  3IAS 2;  4K2D A;  1MDI A;  3H1N A;  5J9B A;  1A8L A;  3L78 A;  1DE2 A;  4IHU A;  3BJ5 A;  1XPV A;  3EU3 A;  1YKC A;  1T1V A;  5HQP A;  4GLT A;  4MJB A;  6GSU A;  4EO3 A;  3IA1 A;  5CAX A;  3HHV A;  3IC4 A;  2VLV A;  5DJM A;  1XWB A;  4G10 A;  3IDV A;  4HZ2 A;  1GTU A;  4IP6 A;  5A4W A;  5ECN B;  3SWL A;  1RK4 A;  1NHO A;  3QMX A;  1JZR A;  1ST9 A;  2QKE A;  5ECO B;  1PX6 A;  4HZ4 A;  2ZNM A;  2FD3 A;  4ISD A;  2C0G A;  1M2D A;  2DC5 A;  4XHM A;  4AF2 A;  3D6I A;  5GST A;  8GSS A;  2G0F A;  4PX1 A;  1G6W A;  3M1G A;  1EV4 A;  5GSS A;  1PGT A;  5IOW A;  2WGR A;  3ZTL A;  3QCP A;  3F3Q A;  5DQY A;  3FYG A;  2YJH A;  3MSZ A;  5AIV A;  2WUL A;  5IO2 A;  4K7I A;  4K9Z A;  3TKR A;  4PQI A;  4TOP A;  3SBC A;  3L9U A;  4OD7 A;  3N5O A;  1ZYE A;  3FRC A;  2JSZ A;  5B8B A;  5G5E A;  3WD6 A;  4XS6 A;  2HRN A;  1HYU A;  3DKS A;  4IW9 A;  4GRF A;  4ZBD A;  4X43 A;  5EY6 A;  4IP1 A;  2C1Y A;  5DCH A;  4MAB A;  2IN3 A;  1O8X A;  1PRX A;  3DIE A;  4ECJ A;  2EIR A;  1GSS A;  2FCH A;  3LXZ A;  5JCU A;  4TVE A;  5D9W A;  1OC3 A;  2OJL A;  2WCI A;  2GQM A;  1NM3 A;  1M99 A;  2H0H A;  3H4K A;  3U5R E;  3I43 A;  4ID0 A;  1F2E A;  4TR1 B;  1PN9 A;  2L5O A;  1C72 A;  4PUA A;  2VLT A;  1YKA A;  3W8J A;  2R5G A;  2O85 A;  3QDN A;  3FY7 A;  3ZRE A;  2TIR A;  2VO4 A;  3ME7 A;  4K6X A;  4NAX A;  3HD5 A;  2B6M A;  1GNW A;  2FA8 A;  3FHK A;  2YOI A;  2KUC A;  3APO A;  1XWK A;  2V32 A;  4ZL8 A;  1AUC A;  1GTB A;  3ZIJ A;  3KCM A;  2YPM A;  5CYY A;  3ERF A;  4KSO A;  1A2L A;  2YP6 A;  2VD1 A;  3KH9 A;  5AIS A;  2K8S A;  3HA9 A;  2QC7 A;  3LYK A;  3ZYW A;  2NDO A;  3IBH A;  4FYB A;  1LJR A;  3KM6 A;  6GSV A;  4X1U A;  3L4N A;  3M9K A;  1V40 A;  1GWC A;  1XVQ A;  2FWH A;  1TOF A;  4RI6 A;  3ZL5 A;  17GS A;  3EIN A;  2I9H A;  3HCZ A;  3LFL A;  4TRX A;  4FYC A;  2XBI A;  2AAW A;  2P31 A;  1ABA A;  4Q5Q A;  4EC0 A;  5A5K A;  5DVB A;  3A2X A;  1CQH A;  3CSJ A;  1QMV A;  4YAV A;  2DBC A;  3ZIV A;  1AQW A;  4XTS A;  3FR3 A;  1SU9 A;  3F4T A;  4CW9 A;  2HZE B;  3IK7 A;  4IQ1 A;  3TJJ A;  5AGY A;  3GX8 A;  2LRN A;  5B8A A;  1X9S B;  2L5L A;  1Q4J A;  3E3E A;  4IEL A;  2MMN A;  1G0T A;  1SYR A;  6GST A;  2FGX A;  3GTU B;  3MDK A;  4JU5 A;  4OMV A;  5G30 A;  1SYX A;  4PQ1 A;  2O87 A;  3QOU A;  3C73 A;  3P90 A;  1GTI A;  3TRP A;  4GSS A;  2HXK A;  1X5D A;  1T4Y A;  1OC8 A;  2J23 A;  4K7O A;  3EMX A;  3FK8 A;  6GSX A;  5IMA A;  4N11 A;  2R3X A;  1XW6 A;  1UN2 A;  3US3 A;  1UC7 A;  4GSN A;  1Z9H A;  1TW9 A;  1FVJ A;  4HI7 A;  1SEN A;  4WET A;  3F63 A;  3FZA A;  4L8E A;  3M3M A;  1EP8 A;  2PUK C;  2C0F A;  2LRC A;  4IVF A;  3UEM A;  2DJ0 A;  2HZF A;  5ECH B;  1ZCP A;  1J9B A;  2OAD A;  4NHZ A;  3O6T A;  5A4V A;  4KUN A;  1YQ1 A;  5IMD A;  3EU4 A;  1HNC A;  1T7P B;  2C3T A;  2OA7 A;  3FZ4 A;  3QD9 A;  3GNJ A;  4IS0 A;  1EGO A;  3IRA A;  2VLU A;  6GSW A;  2DSA A;  1ZL9 A;  3HVV A;  2NTO A;  1R7H A;  1M9A A;  1DSB A;  2I1U A;  2KOK A;  3TB2 A;  3TOT A;  2IJY A;  3UBK A;  2B5X A;  4MLY A;  2VL3 A;  3EWL A;  2XBQ A;  2H30 A;  4MF6 A;  5IO0 A;  1X0R A;  4BA7 A;  4MCU A;  1W4V A;  2X99 A;  5IPH A;  1FO5 A;  4TXO B;  3KTB A;  1Z6N A;  1YJ6 A;  2V6K A;  4PNF A;  1K0D A;  3LG6 A;  4MPF A;  4BWQ A;  2MZC A;  3RHB A;  5HR1 A;  2B7K A;  3VWU A;  2CX4 A;  2M46 A;  2VAF A;  3C8E A;  3WT2 A;  4PNG A;  4NMU A;  5CP1 A;  2GSR A;  2D2Z A;  2N5F A;  4XS4 B;  1XWA A;  3F6F A;  3QAG A;  4CHS A;  3GMF A;  5ECS A;  2FA4 A;  1X5E A;  3GKK A;  4PXO A;  1UA5 A;  2RUE A;  1M2B A;  2AB6 A;  2ZCT A;  2V2G A;  4H86 A;  4LL1 B;  4YH2 A;  2CQ9 A;  1G6Y A;  22GS A;  3PH9 A;  2R6K A;  2R4V A;  2PVO C;  4FO5 A;  1EOH A;  1NW2 A;  1R4W A;  2X8C A;  4TKY A;  5ECK B;  1PL2 A;  5J4U A;  3F4S A;  1PD2 1;  3TKS C;  1U87 A;  2RLI A;  3ZLP A;  1MEK A;  3OR5 A;  1OVN A;  5CRH A;  5L71 A;  1EWX A;  1A2M A;  4WKW A;  2DML A;  2H01 A;  3HXS A;  2JL4 A;  1A8Y A;  4K0N A;  1K3L A;  4L0U A;  4V1A g;  2LJK A;  3KP9 A;  4HEA 2;  2FLS A;  1GSD A;  4GWR A;  1G7O A;  1F37 A;  4POK A;  4V2N A;  3D0Z A;  3DXB A;  1AIU A;  5ECR B;  1R5A A;  2PWJ A;  3HZ8 A;  2JAC A;  3Q18 A;  5ID2 B;  1ZGN A;  1V2A A;  3ZVJ A;  3F4R A;  4NWY A;  3W6G A;  2JZT A;  2HSH A;  2BJX A;  2DJ3 A;  1TK8 B;  1WJK A;  2O7K A;  2H70 A;  5COH A;  2LQO A;  2A4V A;  1EOG A;  2C0E A;  2YCD A;  2LUS A;  3FKF A;  4N0Z A;  2YNX A;  3F3R A;  2VL2 C;  3QAW A;  1FB0 A;  5IQY A;  3NZN A;  1YEX A;  5H5R A;  2MMA A;  2PN8 A;  3VLN A;  3CMI A;  3QFB C;  5IM9 A;  2L4Q A;  2ON5 A;  2CZ2 A;  1TRS A;  2CV4 A;  1LBK A;  4ZL9 A;  4F9Z A;  4DSS B;  2HLS A;  2E7P A;  4ZIL A;  4Q5N A;  4RUV A;  1PA3 A;  1SD8 A;  5DAK A;  4YQM A;  2IWT A;  4JZQ A;  2IFQ A;  3KMO A;  4V1A p;  1ZYQ B;  2E2G A;  3TKS E;  1FW1 A;  1TI3 A;  5EPF A;  2MMZ A;  4MZB A;  3WGD A;  3LJR A;  1NSW A;  3RDW A;  4FH8 A;  1OKD A;  1X9M B;  3EC3 A;  3I9V 2;  1Z3E A;  2E0Q A;  3F8U A;  3UL3 A;  4P3Y B;  5HFK A;  1QFN A;  4LA1 A;  3E9J B;  1SJZ A;  4F2I A;  2ON7 A;  2GSQ A;  4G9H A;  3WT1 A;  3FZ9 A;  2A2S A;  1OE7 A;  2OAC A;  1U88 A;  1VF3 A;  4KW6 A;  1JZD A;  2WB9 A;  4OCE A;  5ENU A;  5ABR A;  3KGK A;  1R26 A;  3M8N A;  4QL7 A;  3I6A A;  3VI7 A;  2FHE A;  1Y6E A;  2WJU A;  5KN2 A;  3A2V A;  4QQ7 A;  2XPE A;  1TRV A;  4RQX A;  2M80 A;  1XFL A;  2GST A;  5FT3 A;  5KN1 A;  3D4T A;  4E8E A;  2L6D A;  2HT9 A;  5IOX A;  3BD2 A;  4ZL7 A;  2HNL A;  2H8L A;  4EDZ A;  1FOV A;  2LST A;  4XCS A;  3GST A;  3KZQ A;  3LYP A;  4F0C A;  3Q6O A;  1KBN A;  3DVX A;  2C0D A;  3QAV A;  1X5C A;  5LCZ A;  1Q98 A;  2VCX A;  2HYX A;  2LEG A;  3S9F A;  2YZH A;  4FIW A;  4EL1 A;  3KH7 A;  1E6B A;  2LNT A;  4HJM A;  2H1A A;  1TI1 A;  3AY8 A;  5D73 A;  4IN0 A;  1MD3 A;  4ZIJ A;  16GS A;  1YY7 A;  18GS A;  2N5B A;  6GSS A;  5D93 A;  1M2A A;  5KN0 A;  1YZX A;  3IE3 A;  1GL8 A;  4PUR A;  3ZML A;  1F9M A;  4OO4 A;  5DQS A;  1OC9 A;  2VCT A;  4GST A;  4GF0 A;  4O7H A;  1M9B A;  5D9V A;  2I81 A;  4TW5 A;  4L5L A;  5H5Q A;  1GRX A;  2AYT A;  1V98 A;  1WE0 A;  2DMM A; 
#chains in the Genus database with same CATH topology
 1O6J A;  3ERG A;  1ERU A;  3Q74 A;  3UIW A;  5DDL A;  4EUY A;  1F6M C;  4KDX A;  4HUA A;  4ZB9 A;  2KHP A;  3FR9 A;  3V1W A;  5HFG A;  1K0O A;  1KNG A;  2VM1 A;  4Z7X A;  3HVX A;  5CRG A;  2K8V A;  2LNS A;  4NV5 A;  1TKD B;  4EIQ A;  4ACS A;  4GTU A;  1X9W B;  2VCV A;  3E0U A;  2JAD A;  2IL3 A;  2KLX A;  3HDC A;  2DIY A;  4LL4 B;  4I8B A;  3QPM A;  4EKZ A;  2GVP A;  1O7U A;  2DJ1 A;  1TK0 B;  2GDR A;  3HYP A;  1ML6 A;  2AHE A;  4NHW A;  2GSS A;  4ZXG A;  1GSY A;  3MAK A;  2GT6 A;  3ZMK A;  1OAZ A;  3J7Y k;  2A2P A;  3BCI A;  3KP8 A;  2C80 A;  4TN8 A;  5F07 A;  2B1L A;  1YEP A;  2GS3 A;  1QK8 A;  4CY8 A;  4ZB6 A;  2H0I A;  2H71 A;  3ZFL A;  2K9F A;  2PPT A;  5D9X A;  2CA8 A;  2WDU A;  1THX A;  3GUR A;  1PMT A;  9GSS A;  2EIO A;  3R3E A;  2OE0 A;  5JCG A;  5GAN D;  1VF2 A;  1HQO A;  2HE3 A;  4ECI A;  1U6T A;  5G2Z A;  1J0F A;  2VD0 A;  3FEU A;  2PVQ A;  3TKS A;  4KND A;  4K0G A;  5ECM B;  4EE0 A;  2GZP A;  2JU5 A;  4IJ3 A;  2H73 A;  5ECI B;  3R2Q A;  1GSF A;  3GH9 A;  4D73 B;  3MWH A;  2LJR A;  1N2A A;  1ERW A;  4L0W A;  2WZ9 A;  5DAL B;  1N8J A;  3A2W A;  1SK1 A;  3G7J A;  2M72 A;  2GZY A;  3TRQ A;  1GUM A;  2IIY A;  2H66 A;  4PQH A;  4NV2 A;  3H93 A;  3C1R A;  5IMZ A;  4F03 A;  3CYN A;  3UAR A;  1WPI A;  3P2A A;  1PQN A;  3VUR A;  3IK9 A;  1NHY A;  1XW9 A;  2MBS A;  1ERV A;  1EZK A;  4WBJ A;  5H5S A;  2TRC P;  2HRF A;  3RBT A;  3D22 A;  2V41 A;  3M9J A;  3F0I A;  1EP7 A;  5ECL B;  2OKA A;  3J7Y b;  5BRT A;  1SJ6 A;  1V57 A;  2CVD A;  4HDE A;  3TJG A;  3EVI A;  2VL2 A;  4ZB8 A;  1K3O A;  7GSS A;  4GCI A;  1G7E A;  1GUK A;  4NPB A;  1SKR B;  2B1K A;  2VM2 A;  2P0G A;  2RM5 A;  4IGJ A;  1TDI A;  2L57 A;  2ZUP A;  3GKX A;  2FUG 2;  4BVY B;  2VIM A;  4LMV A;  1OYJ A;  1BAY A;  4I5Q A;  3TOU A;  4TR1 A;  3UVT A;  2YZU A;  1PSQ A;  3TCO A;  3LEF A;  4MF7 A;  4KSM A;  5CRW A;  4POB A;  1QGV A;  1AC1 A;  1RQM A;  3TDG A;  3N9J A;  2OBK A;  1TRW A;  2DIZ A;  1GLQ A;  5INY A;  2E2M A;  2YJ7 A;  2QSI A;  1SK2 A;  4BVX A;  2CT6 A;  2OE3 A;  3WGE A;  4OO5 A;  4WF5 A;  1T8E B;  3GKM A;  4J2F A;  3FZ5 A;  4YAP A;  1YDK A;  3LGC A;  2BTO T;  4O5R A;  3H8Q A;  3RAZ A;  2R37 A;  5AN1 A;  3F9U A;  4G0L A;  2H75 A;  3TJB A;  2OE1 A;  1OKT A;  2VCW A;  3GL3 A;  1YF0 A;  1WP0 A;  3VPT A;  4HS1 A;  4K8M A;  3P7X A;  1VF4 A;  2R0G A;  3LQ7 A;  1ZOF A;  4MF5 A;  2WS2 A;  4O32 A;  4O5U A;  3GUS A;  3DD3 A;  4ECB A;  1LU4 A;  1B9X C;  2LJA A;  1BG5 A;  5KOX A;  2L6C A;  3HJO A;  3PR8 A;  1QXH A;  1V9W A;  2P5R A;  4HQS A;  5LD0 A;  2G2Q A;  1XZO A;  1FHE A;  1U3I A;  2YV7 A;  1SKS B;  1GLP A;  2IMF A;  5EL8 A;  4DSQ A;  3U6V A;  2I4A A;  3CSH A;  4KCE A;  2YV9 A;  2PBJ A;  2HZE A;  3ISO A;  3EPT A;  4GQF A;  4N30 A;  2GT5 A;  2IMK A;  1GSE A;  1FVK A;  3EUR A;  1T4Z A;  3PGT A;  2X8H A;  4DSR A;  1FAA A;  2PMT A;  2LS5 A;  2VCQ A;  1F3B A;  2J9H A;  2GTU A;  2F8F A;  4AGS A;  2O8V B;  3A3T A;  4F0B A;  4KDY A;  1GP1 A;  3GTU A;  2NBS A;  2RII A;  3HJP A;  3ZIT A;  5HR2 A;  4JR6 A;  3EE2 A;  3LXT A;  1WIK A;  3KTL A;  1W89 A;  3APQ A;  4WBR D;  2FWE A;  3IXR A;  1XWC A;  3DVW A;  1XCC A;  1MDJ A;  5ELA A;  3CSI A;  4I97 A;  3IAM 2;  3GKN A;  1K0B A;  4BIK A;  1PKW A;  1K0C A;  2FWF A;  2YWO A;  1GNE A;  5D9T A;  5C04 A;  3VI5 A;  4I6X A;  3GN3 A;  4WR4 A;  3MNG A;  5J9C A;  2C3Q A;  3QR6 A;  2BMX A;  3EMP A;  1K0M A;  4PTS A;  3ZVJ D;  20GS A;  3RPP A;  4E8H A;  1Z5Y E;  5A4U A;  4MJE A;  2K18 A;  3HY2 A;  2NVL A;  13GS A;  4MMM A;  4HSC X;  4HQZ A;  2IME A;  4OWY A;  4G19 A;  2AJQ B;  1O8W A;  4KDU A;  5JWO B;  1ZYN A;  2IPA A;  2VL9 A;  5F0G A;  3W8S A;  3PPU A;  1EEM A;  1Z6M A;  1ZYP A;  1USB A;  3VWW A;  3ZRD A;  3Q19 A;  1GUL A;  4MJA A;  3IOS A;  3MIX A;  4K7N A;  1M7T A;  2B5E A;  2YN1 A;  2A2R A;  1T00 A;  4TXO A;  3L0H A;  1DE1 A;  4NXI A;  1MDK A;  4O5Q A;  1IYI A;  1GSU A;  2C4J A;  1KEB A;  4G0K A;  3GH6 A;  1TU8 A;  1U3A A;  1JLW A;  2K6V A;  3UJ1 A;  3ERW A;  1Z7R A;  4TXV A;  3ME8 A;  4CDO A;  2L4C A;  2XHF A;  1TK5 B;  5HFI A;  3QFA C;  3IV4 A;  4ML1 A;  1WRY A;  4MP4 A;  1BQ7 A;  5IMV A;  4JRR A;  1A23 A;  4XS4 A;  2JZS A;  3H79 A;  5DCG A;  4CY6 A;  5G31 A;  1TJD A;  5J41 A;  4K1F A;  1PKZ A;  5KOW A;  3F6D A;  3WGX A;  2H19 A;  3I69 A;  4AJ8 A;  1T3B A;  1K3Y A;  2FWG A;  5E4W A;  5CRD A;  1UVZ A;  4LLR A;  1K0A A;  1XOA A;  4OCF A;  3GHA A;  5D96 A;  3VK9 A;  3HVS A;  3KD0 A;  4ILF A;  1SJI A;  2YWN A;  3VPQ A;  4FYU A;  1SL1 B;  4MJC A;  4KA0 A;  3EYT A;  4JBB A;  3TRX A;  1B4Q A;  3GFK A;  3DML A;  1I5G A;  5EVO A;  3TKQ A;  5DJL A;  3M0F A;  2NPB A;  2H1D A;  4YQU A;  3IC8 A;  2GLR A;  2V6O A;  1ERT A;  4I2U A;  5ECP B;  4MH2 A;  5AIX A;  5ID2 A;  3GRX A;  1R5P A;  1CQG A;  4Z2U A;  5CO3 A;  4V2L A;  3LSZ A;  4IJI A;  4OFN A;  2Z9S A;  4JED A;  2XPD A;  19GS A;  2HFD A;  3IR4 A;  2F3M A;  1ZZY A;  3JCM L;  3P8W A;  3G9B A;  3APS A;  1TTZ A;  1HD2 A;  2DLX A;  2GZZ A;  3DGQ A;  4WEY A;  1H4O A;  1SKW B;  1H75 A;  1S3A A;  1Y25 A;  2REM A;  4DSS A;  2DJK A;  1SL2 B;  4BWS A;  5LNK e;  11GS A;  1A0F A;  2LRT A;  1SD9 A;  2H6X A;  1XW5 A;  5ELG A;  4HJ2 A;  5IMC A;  2HI7 A;  1AW9 A;  5D8I A;  1PL1 A;  2QGV A;  10GS A;  4Q5R A;  1GSQ A;  2V1M A;  3CRU A;  1S3D A;  1K0N A;  2O89 A;  5IPG A;  4IKH A;  2X4A A;  1A2J A;  3ED3 A;  3DEX A;  1SK0 A;  1JLV A;  4KGI A;  3CXG A;  3BOA A;  1JZW A;  2PU9 C;  2CZ3 A;  3NOF A;  4G2E A;  4ULX A;  5G1L A;  2YAN A;  3RPN A;  2CVK A;  1PX7 A;  3UVH A;  1WOU A;  1BYE A;  3O76 A;  4AJ7 A;  4HU9 A;  4EXJ A;  3FW2 A;  2LQQ A;  5G1K A;  2R2J A;  3KIJ A;  3KXO A;  4AJ6 A;  1EGR A;  4EIP A;  1XXU A;  4KAE A;  3DWV A;  4O92 A;  2WFC A;  2F9S A;  3ZFB A;  4TR3 A;  4MA9 A;  2AUV A;  4WR5 A;  2I3Y A;  1I9D A;  2DJ2 A;  2LKU A;  2AV4 A;  5GZZ B;  1EEJ A;  4POM A;  4USS A;  3TKP A;  3IHG A;  1AAZ A;  3TGZ A;  2EIQ A;  2H76 A;  2FY6 A;  5B6M A;  2ALB A;  3GV1 A;  1XOB A;  2LV3 A;  2GQK A;  3RHC A;  4YKF A;  4BPY A;  3IHQ A;  5KN3 A;  1FG4 A;  5C00 A;  4IQA A;  1EV9 A;  3LWA A;  4PUF C;  1DBY A;  2F8A A;  2KP1 A;  1AQV A;  2X8G A;  2ES7 A;  2HSY A;  4YQV A;  4XS1 A;  4XRD A;  2C8U A;  3GIX A;  3VWV A;  2B7J A;  2H1G A;  1BX9 A;  2EC4 A;  1XVW A;  1B8X A;  1J08 A;  4EF0 A;  1TP9 A;  3VFI A;  1BJX A;  1GUH A;  3L9V A;  2IMI A;  2XC2 A;  3C1S A;  3FR6 A;  4BL7 A;  3HZ4 A;  4JE1 A;  4OFT A;  4RI7 A;  2KP2 A;  5GAP D;  4KX4 A;  2L59 A;  4GXZ A;  5KEJ A;  4TR0 A;  3UBL A;  1THO A;  5IMF A;  1TU7 A;  1S3R A;  3VWX A;  2H1B A;  5FHI A;  4MZC A;  5DAK B;  3TJF A;  2MMO A;  2IFQ B;  4LMW A;  1JZO A;  2YWI A;  3C71 A;  4XIH A;  1O73 A;  1TRU A;  2N5A A;  2QA1 A;  4IBP A;  4J56 E;  2PGT A;  14GS A;  3D4M A;  4HU7 A;  3NIV A;  5JWR B;  5E59 A;  1MD4 A;  2OBI A;  3BCK A;  1ZMA A;  1HNB A;  4KE3 A;  3GL5 A;  2CVB A;  3CRT A;  2FNO A;  4ICY A;  1B4P A;  4MK3 A;  3MYD A;  5G5F A;  2CAI A;  2GQL A;  4WF4 A;  3L9S A;  1MTC A;  1DUG A;  1M0U A;  3TUE A;  2HRA A;  3KEB A;  4X0X A;  2PER A;  4KB3 A;  1HNA A;  2WRT A;  4MPG A;  5ECQ B;  3DYR A;  4MZW A;  2P5Q A;  4KCA A;  3CTF A;  3G7Y A;  1QUW A;  1F3A A;  3GYK A;  1O81 A;  4MDC A;  3UMA A;  12GS A;  2GGT A;  5IIZ A;  1AXD A;  1S3C A;  4XRA A;  5F06 A;  4ZBA A;  3HJM A;  1VF1 A;  2VCZ A;  1FB6 A;  1GH2 A;  4POL A;  1RW1 A;  1VGL A;  4PGT A;  3TJK A;  3UOM A;  5J5N A;  1B48 A;  1BED A;  4I2T A;  4MH3 A;  2CX3 A;  4HOJ A;  3WYW A;  5F05 A;  1JHB A;  1V58 A;  3D5J A;  3DRN A;  3HKR A;  1ACV A;  1Z7P A;  5CNW A;  4D73 A;  4EVM A;  4F82 A;  2IMD A;  1JFU A;  2RM6 A;  4J57 E;  5J3R A;  2VOC A;  4KH7 A;  4L5O A;  5DAL A;  1XWG A;  4N0V A;  5CRE A;  4Q5F A;  3LOR A;  5B6N A;  4WXT A;  1M3J A;  2CAQ A;  1B9Y C;  2TRX A;  2H6Z A;  2MBT A;  1O85 A;  3K8N A;  4QL9 A;  4EDY A;  1VRS D;  1ILO A;  2H74 A;  2YWM A;  4GQC A;  2JZR A;  4N10 A;  3D21 A;  2H0G A;  5FWG A;  2C3N A;  3IPZ A;  1OC9 B;  1XIY A;  3C7M A;  1PFO A;  3KMN A;  3KJY A;  3PIN A;  3GX0 A;  4TR4 A;  2VUP A;  4ECC A;  3GA4 A;  4JR4 A;  5HR3 A;  1GTA A;  1ON4 A;  2MYG A;  1E2Y A;  4OFM A;  1M3I A;  1AQX A;  4ML6 A;  5HR0 A;  3ZZX A;  4MNN A;  2H72 A;  2A4H A;  1URM A;  4K2X A;  1KTE A;  2B5Y A;  4BVY A;  5DBQ A;  5F8B A;  1A24 A;  1XBS A;  2RUF A;  1WMJ A;  5JWQ B;  1SL0 B;  3LW9 A;  2H6Y A;  2F51 A;  4ZBB A;  1WWJ A;  4DEJ A;  1YF1 A;  1A0R P;  2LTK A;  3CTG A;  3UAP A;  5B7C A;  2B3S A;  1QQ2 A;  4DVC A;  2JSY A;  3CBU A;  5JCW A;  4Z2R A;  1OE8 A;  2X64 A;  4RQR A;  1TXX A;  2DJJ A;  3G7I A;  3GSS A;  3O3T A;  6GSY A;  1IYH A;  4V2M A;  3BBY A;  3A5W A;  3IAS 2;  4K2D A;  1MDI A;  3H1N A;  5J9B A;  1A8L A;  3L78 A;  1DE2 A;  4IHU A;  3BJ5 A;  1XPV A;  3EU3 A;  1YKC A;  1T1V A;  5HQP A;  4GLT A;  4MJB A;  5BMU A;  6GSU A;  4EO3 A;  3IA1 A;  5CAX A;  3HHV A;  3IC4 A;  2VLV A;  5DJM A;  1XWB A;  4G10 A;  3IDV A;  4HZ2 A;  1GTU A;  4IP6 A;  5A4W A;  5ECN B;  3SWL A;  1RK4 A;  1NHO A;  3QMX A;  1JZR A;  1ST9 A;  2QKE A;  5ECO B;  1PX6 A;  4HZ4 A;  4G0I A;  2ZNM A;  2FD3 A;  4ISD A;  2C0G A;  1M2D A;  2DC5 A;  4XHM A;  4AF2 A;  3D6I A;  5GST A;  8GSS A;  2G0F A;  4PX1 A;  1G6W A;  3M1G A;  1EV4 A;  5GSS A;  1PGT A;  5IOW A;  2WGR A;  3ZTL A;  3QCP A;  3F3Q A;  5DQY A;  3FYG A;  2YJH A;  4A5P A;  3MSZ A;  3FMW A;  5AIV A;  2WUL A;  5IO2 A;  4K7I A;  4K9Z A;  3TKR A;  4PQI A;  4TOP A;  3HVN A;  3SBC A;  3L9U A;  4OD7 A;  3N5O A;  1ZYE A;  3FRC A;  2JSZ A;  5B8B A;  5G5E A;  3WD6 A;  4XS6 A;  2HRN A;  1HYU A;  3DKS A;  4IW9 A;  4GRF A;  4ZBD A;  4X43 A;  5EY6 A;  4IP1 A;  2C1Y A;  5DCH A;  4MAB A;  2IN3 A;  1O8X A;  1PRX A;  3DIE A;  4ECJ A;  2EIR A;  1GSS A;  4Z2T A;  2FCH A;  3LXZ A;  5JCU A;  4TVE A;  5D9W A;  1OC3 A;  2OJL A;  2WCI A;  2GQM A;  1NM3 A;  1M99 A;  2H0H A;  3H4K A;  3U5R E;  3I43 A;  4ID0 A;  1F2E A;  4TR1 B;  1PN9 A;  2L5O A;  1C72 A;  4PUA A;  2VLT A;  1YKA A;  3W8J A;  2R5G A;  2O85 A;  3QDN A;  3FY7 A;  3ZRE A;  2TIR A;  2VO4 A;  3ME7 A;  4K6X A;  4NAX A;  3HD5 A;  2B6M A;  1GNW A;  2FA8 A;  3FHK A;  2YOI A;  2KUC A;  3APO A;  4BVX B;  1XWK A;  2V32 A;  4ZL8 A;  1AUC A;  1GTB A;  3ZIJ A;  3KCM A;  2YPM A;  5CYY A;  3ERF A;  2DKI A;  4KSO A;  1A2L A;  2YP6 A;  2VD1 A;  3KH9 A;  5AIS A;  2K8S A;  3HA9 A;  2QC7 A;  3LYK A;  3ZYW A;  2NDO A;  2DKH A;  3IBH A;  4FYB A;  3CQF A;  1LJR A;  3KM6 A;  6GSV A;  4X1U A;  3L4N A;  3M9K A;  1V40 A;  1GWC A;  1XVQ A;  2FWH A;  1TOF A;  4RI6 A;  3ZL5 A;  2QA2 A;  17GS A;  3EIN A;  2I9H A;  3HCZ A;  3LFL A;  4TRX A;  4FYC A;  2XBI A;  2AAW A;  1FOH A;  2P31 A;  1ABA A;  2UZ8 A;  4Q5Q A;  4EC0 A;  5A5K A;  5DVB A;  3A2X A;  1CQH A;  3CSJ A;  1QMV A;  4KF9 A;  4YAV A;  2DBC A;  3ZIV A;  1AQW A;  4XTS A;  3FR3 A;  1SU9 A;  3F4T A;  4CW9 A;  2HZE B;  3IK7 A;  4IQ1 A;  4YKG A;  3TJJ A;  5AGY A;  3GX8 A;  2LRN A;  5B8A A;  1X9S B;  2L5L A;  1Q4J A;  3E3E A;  4IEL A;  2MMN A;  1G0T A;  1SYR A;  6GST A;  2FGX A;  3GTU B;  3MDK A;  4JU5 A;  4OMV A;  5G30 A;  1SYX A;  4PQ1 A;  2O87 A;  3QOU A;  3C73 A;  3P90 A;  1GTI A;  3TRP A;  4GSS A;  2HXK A;  1X5D A;  1T4Y A;  1OC8 A;  2J23 A;  4K7O A;  3EMX A;  3FK8 A;  6GSX A;  5IMA A;  4K5S A;  4N11 A;  2R3X A;  1XW6 A;  1UN2 A;  3US3 A;  1UC7 A;  4GSN A;  1Z9H A;  1TW9 A;  1FVJ A;  4HI7 A;  1SEN A;  4WET A;  3F63 A;  3FZA A;  4L8E A;  2HSM A;  3M3M A;  1EP8 A;  2PUK C;  2C0F A;  2LRC A;  4IVF A;  3UEM A;  2DJ0 A;  2HZF A;  5ECH B;  1ZCP A;  1J9B A;  2OAD A;  4NHZ A;  3O6T A;  5A4V A;  4KUN A;  1YQ1 A;  5IMD A;  3EU4 A;  1HNC A;  1T7P B;  2C3T A;  2OA7 A;  3FZ4 A;  3QD9 A;  3GNJ A;  4IS0 A;  1EGO A;  3IRA A;  2VLU A;  1PN0 A;  6GSW A;  2DSA A;  1ZL9 A;  2HRK A;  3HVV A;  2NTO A;  1R7H A;  1M9A A;  1DSB A;  2I1U A;  2KOK A;  3TB2 A;  3TOT A;  2IJY A;  3UBK A;  2B5X A;  4MLY A;  2VL3 A;  3EWL A;  2XBQ A;  2H30 A;  4MF6 A;  5IO0 A;  1X0R A;  4BA7 A;  4MCU A;  1W4V A;  2X99 A;  5IPH A;  1FO5 A;  4TXO B;  3KTB A;  1Z6N A;  1YJ6 A;  2V6K A;  4PNF A;  1K0D A;  3LG6 A;  4MPF A;  4BWQ A;  2MZC A;  3RHB A;  5HR1 A;  2B7K A;  3VWU A;  2X49 A;  2CX4 A;  2M46 A;  2VAF A;  3C8E A;  3WT2 A;  4PNG A;  4NMU A;  5CP1 A;  2GSR A;  2D2Z A;  2N5F A;  4XS4 B;  1XWA A;  3F6F A;  3QAG A;  4CHS A;  3GMF A;  5ECS A;  2FA4 A;  1X5E A;  3GKK A;  4PXO A;  1UA5 A;  2RUE A;  1M2B A;  2AB6 A;  2ZCT A;  2V2G A;  4H86 A;  4LL1 B;  4YH2 A;  4X4J A;  2CQ9 A;  1G6Y A;  22GS A;  3PH9 A;  2R6K A;  2R4V A;  2PVO C;  4FO5 A;  1EOH A;  1NW2 A;  1R4W A;  2X8C A;  4TKY A;  5ECK B;  1PL2 A;  5J4U A;  3F4S A;  1PD2 1;  3TKS C;  1U87 A;  2RLI A;  3ZLP A;  1MEK A;  3OR5 A;  1OVN A;  5CRH A;  5L71 A;  2R0P A;  1EWX A;  1A2M A;  4WKW A;  2DML A;  2H01 A;  3HXS A;  2JL4 A;  1A8Y A;  1XG8 A;  4K0N A;  1K3L A;  4L0U A;  4V1A g;  2LJK A;  3KP9 A;  4HEA 2;  2FLS A;  1GSD A;  4GWR A;  1G7O A;  1F37 A;  4POK A;  4V2N A;  3D0Z A;  3DXB A;  1AIU A;  5ECR B;  1R5A A;  2PWJ A;  3HZ8 A;  2JAC A;  3Q18 A;  5ID2 B;  1ZGN A;  1V2A A;  3ZVJ A;  3F4R A;  4NWY A;  3W6G A;  2JZT A;  2HSH A;  2BJX A;  2DJ3 A;  1TK8 B;  1WJK A;  2O7K A;  2H70 A;  5COH A;  2LQO A;  2A4V A;  1EOG A;  2C0E A;  2YCD A;  2LUS A;  3FKF A;  4N0Z A;  2YNX A;  3F3R A;  2R0C A;  2VL2 C;  3QAW A;  1FB0 A;  5IQY A;  3NZN A;  1YEX A;  5H5R A;  2MMA A;  2PN8 A;  3VLN A;  3CMI A;  3QFB C;  5IM9 A;  2L4Q A;  2ON5 A;  2CZ2 A;  1TRS A;  2CV4 A;  1LBK A;  4ZL9 A;  4F9Z A;  4DSS B;  2HLS A;  2E7P A;  4FQU A;  4ZIL A;  4Q5N A;  4RUV A;  1PA3 A;  1SD8 A;  5DAK A;  4YQM A;  2IWT A;  4JZQ A;  2IFQ A;  3KMO A;  4V1A p;  1ZYQ B;  2E2G A;  3TKS E;  1FW1 A;  1TI3 A;  5EPF A;  2MMZ A;  4MZB A;  3WGD A;  3LJR A;  1NSW A;  3RDW A;  4FH8 A;  1OKD A;  1X9M B;  3EC3 A;  3I9V 2;  1Z3E A;  2E0Q A;  3F8U A;  3UL3 A;  4P3Y B;  5HFK A;  1QFN A;  4LA1 A;  3E9J B;  1SJZ A;  4F2I A;  2ON7 A;  2GSQ A;  4G9H A;  3WT1 A;  3FZ9 A;  2A2S A;  1OE7 A;  2OAC A;  1U88 A;  1VF3 A;  4KW6 A;  1JZD A;  2WB9 A;  4OCE A;  5ENU A;  5ABR A;  3KGK A;  1R26 A;  3M8N A;  4QL7 A;  3I6A A;  3VI7 A;  2FHE A;  1Y6E A;  2WJU A;  5KN2 A;  3A2V A;  4QQ7 A;  2XPE A;  1TRV A;  4RQX A;  2M80 A;  1XFL A;  2GST A;  5FT3 A;  5KN1 A;  3D4T A;  4E8E A;  2L6D A;  2HT9 A;  5IOX A;  3BD2 A;  4ZL7 A;  2HNL A;  2H8L A;  4EDZ A;  1FOV A;  2LST A;  4XCS A;  3GST A;  3KZQ A;  3LYP A;  4F0C A;  3Q6O A;  1KBN A;  3DVX A;  2C0D A;  3QAV A;  1X5C A;  5LCZ A;  1Q98 A;  2VCX A;  2HYX A;  2LEG A;  3S9F A;  4K5R A;  2YZH A;  4FIW A;  4EL1 A;  3KH7 A;  1E6B A;  2LNT A;  3A5I A;  4HJM A;  2H1A A;  1TI1 A;  3AY8 A;  5D73 A;  4IN0 A;  1MD3 A;  4ZIJ A;  16GS A;  1YY7 A;  18GS A;  2N5B A;  6GSS A;  5D93 A;  1M2A A;  5KN0 A;  1YZX A;  3IE3 A;  1GL8 A;  4PUR A;  3ZML A;  1F9M A;  4OO4 A;  5DQS A;  1OC9 A;  2VCT A;  4GST A;  4GF0 A;  4O7H A;  4BL7 B;  1M9B A;  5D9V A;  2I81 A;  4TW5 A;  4L5L A;  5H5Q A;  1GRX A;  2AYT A;  1V98 A;  1WE0 A;  2DMM A; 
#chains in the Genus database with same CATH homology
 1O6J A;  3ERG A;  1ERU A;  3Q74 A;  3UIW A;  5DDL A;  4EUY A;  1F6M C;  4KDX A;  4HUA A;  4ZB9 A;  2KHP A;  3FR9 A;  3V1W A;  5HFG A;  1K0O A;  1KNG A;  2VM1 A;  4Z7X A;  3HVX A;  5CRG A;  2K8V A;  2LNS A;  4NV5 A;  1TKD B;  4EIQ A;  4ACS A;  4GTU A;  1X9W B;  2VCV A;  3E0U A;  2JAD A;  2IL3 A;  2KLX A;  3HDC A;  2DIY A;  4LL4 B;  4I8B A;  3QPM A;  4EKZ A;  2GVP A;  1O7U A;  2DJ1 A;  1TK0 B;  2GDR A;  3HYP A;  1ML6 A;  2AHE A;  4NHW A;  2GSS A;  4ZXG A;  1GSY A;  3MAK A;  2GT6 A;  3ZMK A;  1OAZ A;  3J7Y k;  2A2P A;  3BCI A;  3KP8 A;  2C80 A;  4TN8 A;  5F07 A;  2B1L A;  1YEP A;  2GS3 A;  1QK8 A;  4CY8 A;  4ZB6 A;  2H0I A;  2H71 A;  3ZFL A;  2K9F A;  2PPT A;  5D9X A;  2CA8 A;  2WDU A;  1THX A;  3GUR A;  1PMT A;  9GSS A;  2EIO A;  3R3E A;  2OE0 A;  5JCG A;  5GAN D;  1VF2 A;  1HQO A;  2HE3 A;  4ECI A;  1U6T A;  5G2Z A;  1J0F A;  2VD0 A;  3FEU A;  2PVQ A;  3TKS A;  4KND A;  4K0G A;  5ECM B;  4EE0 A;  2GZP A;  2JU5 A;  4IJ3 A;  2H73 A;  5ECI B;  3R2Q A;  1GSF A;  3GH9 A;  4D73 B;  3MWH A;  2LJR A;  1N2A A;  1ERW A;  4L0W A;  2WZ9 A;  5DAL B;  1N8J A;  3A2W A;  1SK1 A;  3G7J A;  2M72 A;  2GZY A;  3TRQ A;  1GUM A;  2IIY A;  2H66 A;  4PQH A;  4NV2 A;  3H93 A;  3C1R A;  5IMZ A;  4F03 A;  3CYN A;  3UAR A;  1WPI A;  3P2A A;  1PQN A;  3VUR A;  3IK9 A;  1NHY A;  1XW9 A;  2MBS A;  1ERV A;  1EZK A;  4WBJ A;  5H5S A;  2TRC P;  2HRF A;  3RBT A;  3D22 A;  2V41 A;  3M9J A;  3F0I A;  1EP7 A;  5ECL B;  2OKA A;  3J7Y b;  5BRT A;  1SJ6 A;  1V57 A;  2CVD A;  4HDE A;  3TJG A;  3EVI A;  2VL2 A;  4ZB8 A;  1K3O A;  7GSS A;  4GCI A;  1G7E A;  1GUK A;  4NPB A;  1SKR B;  2B1K A;  2VM2 A;  2P0G A;  2RM5 A;  4IGJ A;  1TDI A;  2L57 A;  2ZUP A;  3GKX A;  2FUG 2;  4BVY B;  2VIM A;  4LMV A;  1OYJ A;  1BAY A;  4I5Q A;  3TOU A;  4TR1 A;  3UVT A;  2YZU A;  1PSQ A;  3TCO A;  3LEF A;  4MF7 A;  4KSM A;  5CRW A;  4POB A;  1QGV A;  1AC1 A;  1RQM A;  3TDG A;  3N9J A;  2OBK A;  1TRW A;  2DIZ A;  1GLQ A;  5INY A;  2E2M A;  2YJ7 A;  2QSI A;  1SK2 A;  4BVX A;  2CT6 A;  2OE3 A;  3WGE A;  4OO5 A;  4WF5 A;  1T8E B;  3GKM A;  4J2F A;  3FZ5 A;  4YAP A;  1YDK A;  3LGC A;  2BTO T;  4O5R A;  3H8Q A;  3RAZ A;  2R37 A;  5AN1 A;  3F9U A;  4G0L A;  2H75 A;  3TJB A;  2OE1 A;  1OKT A;  2VCW A;  3GL3 A;  1YF0 A;  1WP0 A;  3VPT A;  4HS1 A;  4K8M A;  3P7X A;  1VF4 A;  2R0G A;  3LQ7 A;  1ZOF A;  4MF5 A;  2WS2 A;  4O32 A;  4O5U A;  3GUS A;  3DD3 A;  4ECB A;  1LU4 A;  1B9X C;  2LJA A;  1BG5 A;  5KOX A;  2L6C A;  3HJO A;  3PR8 A;  1QXH A;  1V9W A;  2P5R A;  4HQS A;  5LD0 A;  2G2Q A;  1XZO A;  1FHE A;  1U3I A;  2YV7 A;  1SKS B;  1GLP A;  2IMF A;  5EL8 A;  4DSQ A;  3U6V A;  2I4A A;  3CSH A;  4KCE A;  2YV9 A;  2PBJ A;  2HZE A;  3ISO A;  3EPT A;  4GQF A;  4N30 A;  2GT5 A;  2IMK A;  1GSE A;  1FVK A;  3EUR A;  1T4Z A;  3PGT A;  2X8H A;  4DSR A;  1FAA A;  2PMT A;  2LS5 A;  2VCQ A;  1F3B A;  2J9H A;  2GTU A;  2F8F A;  4AGS A;  2O8V B;  3A3T A;  4F0B A;  4KDY A;  1GP1 A;  3GTU A;  2NBS A;  2RII A;  3HJP A;  3ZIT A;  5HR2 A;  4JR6 A;  3EE2 A;  3LXT A;  1WIK A;  3KTL A;  1W89 A;  3APQ A;  4WBR D;  2FWE A;  3IXR A;  1XWC A;  3DVW A;  1XCC A;  1MDJ A;  5ELA A;  3CSI A;  4I97 A;  3IAM 2;  3GKN A;  1K0B A;  1PKW A;  1K0C A;  2FWF A;  2YWO A;  1GNE A;  5D9T A;  5C04 A;  3VI5 A;  4I6X A;  3GN3 A;  4WR4 A;  3MNG A;  5J9C A;  2C3Q A;  3QR6 A;  2BMX A;  3EMP A;  1K0M A;  4PTS A;  3ZVJ D;  20GS A;  3RPP A;  4E8H A;  1Z5Y E;  5A4U A;  4MJE A;  2K18 A;  3HY2 A;  2NVL A;  13GS A;  4MMM A;  4HQZ A;  2IME A;  4OWY A;  4G19 A;  2AJQ B;  1O8W A;  4KDU A;  5JWO B;  1ZYN A;  2IPA A;  2VL9 A;  5F0G A;  3W8S A;  3PPU A;  1EEM A;  1Z6M A;  1ZYP A;  1USB A;  3VWW A;  3ZRD A;  3Q19 A;  1GUL A;  4MJA A;  3IOS A;  3MIX A;  4K7N A;  1M7T A;  2B5E A;  2YN1 A;  2A2R A;  1T00 A;  4TXO A;  3L0H A;  1DE1 A;  4NXI A;  1MDK A;  4O5Q A;  1IYI A;  1GSU A;  2C4J A;  1KEB A;  4G0K A;  3GH6 A;  1TU8 A;  1U3A A;  1JLW A;  2K6V A;  3UJ1 A;  3ERW A;  1Z7R A;  4TXV A;  3ME8 A;  4CDO A;  2L4C A;  2XHF A;  1TK5 B;  5HFI A;  3QFA C;  3IV4 A;  4ML1 A;  1WRY A;  4MP4 A;  1BQ7 A;  5IMV A;  4JRR A;  1A23 A;  4XS4 A;  2JZS A;  3H79 A;  5DCG A;  4CY6 A;  5G31 A;  1TJD A;  5J41 A;  4K1F A;  1PKZ A;  5KOW A;  3F6D A;  3WGX A;  2H19 A;  3I69 A;  4AJ8 A;  1T3B A;  1K3Y A;  2FWG A;  5E4W A;  5CRD A;  1UVZ A;  4LLR A;  1K0A A;  1XOA A;  4OCF A;  3GHA A;  5D96 A;  3VK9 A;  3HVS A;  3KD0 A;  4ILF A;  1SJI A;  2YWN A;  3VPQ A;  4FYU A;  1SL1 B;  4MJC A;  4KA0 A;  3EYT A;  4JBB A;  3TRX A;  1B4Q A;  3GFK A;  3DML A;  1I5G A;  5EVO A;  3TKQ A;  5DJL A;  3M0F A;  2NPB A;  2H1D A;  4YQU A;  3IC8 A;  2GLR A;  2V6O A;  1ERT A;  4I2U A;  5ECP B;  4MH2 A;  5AIX A;  5ID2 A;  3GRX A;  1R5P A;  1CQG A;  4Z2U A;  5CO3 A;  4V2L A;  3LSZ A;  4IJI A;  4OFN A;  2Z9S A;  4JED A;  2XPD A;  19GS A;  2HFD A;  3IR4 A;  2F3M A;  1ZZY A;  3JCM L;  3P8W A;  3G9B A;  3APS A;  1TTZ A;  1HD2 A;  2DLX A;  2GZZ A;  3DGQ A;  4WEY A;  1H4O A;  1SKW B;  1H75 A;  1S3A A;  1Y25 A;  2REM A;  4DSS A;  2DJK A;  1SL2 B;  4BWS A;  5LNK e;  11GS A;  1A0F A;  2LRT A;  1SD9 A;  2H6X A;  1XW5 A;  5ELG A;  4HJ2 A;  5IMC A;  2HI7 A;  1AW9 A;  5D8I A;  1PL1 A;  2QGV A;  10GS A;  4Q5R A;  1GSQ A;  2V1M A;  3CRU A;  1S3D A;  1K0N A;  2O89 A;  5IPG A;  4IKH A;  2X4A A;  1A2J A;  3ED3 A;  3DEX A;  1SK0 A;  1JLV A;  4KGI A;  3CXG A;  3BOA A;  1JZW A;  2PU9 C;  2CZ3 A;  3NOF A;  4G2E A;  4ULX A;  5G1L A;  2YAN A;  3RPN A;  2CVK A;  1PX7 A;  3UVH A;  1WOU A;  1BYE A;  3O76 A;  4AJ7 A;  4HU9 A;  4EXJ A;  3FW2 A;  2LQQ A;  5G1K A;  2R2J A;  3KIJ A;  3KXO A;  4AJ6 A;  1EGR A;  4EIP A;  1XXU A;  4KAE A;  3DWV A;  4O92 A;  2WFC A;  2F9S A;  3ZFB A;  4TR3 A;  4MA9 A;  2AUV A;  4WR5 A;  2I3Y A;  1I9D A;  2DJ2 A;  2LKU A;  2AV4 A;  5GZZ B;  1EEJ A;  4POM A;  4USS A;  3TKP A;  3IHG A;  1AAZ A;  3TGZ A;  2EIQ A;  2H76 A;  2FY6 A;  5B6M A;  2ALB A;  3GV1 A;  1XOB A;  2LV3 A;  2GQK A;  3RHC A;  4YKF A;  4BPY A;  3IHQ A;  5KN3 A;  1FG4 A;  5C00 A;  4IQA A;  1EV9 A;  3LWA A;  4PUF C;  1DBY A;  2F8A A;  2KP1 A;  1AQV A;  2X8G A;  2ES7 A;  2HSY A;  4YQV A;  4XS1 A;  4XRD A;  2C8U A;  3GIX A;  3VWV A;  2B7J A;  2H1G A;  1BX9 A;  2EC4 A;  1XVW A;  1B8X A;  1J08 A;  4EF0 A;  1TP9 A;  3VFI A;  1BJX A;  1GUH A;  3L9V A;  2IMI A;  2XC2 A;  3C1S A;  3FR6 A;  4BL7 A;  3HZ4 A;  4JE1 A;  4OFT A;  4RI7 A;  2KP2 A;  5GAP D;  4KX4 A;  2L59 A;  4GXZ A;  5KEJ A;  4TR0 A;  3UBL A;  1THO A;  5IMF A;  1TU7 A;  3VWX A;  2H1B A;  5FHI A;  4MZC A;  5DAK B;  3TJF A;  2MMO A;  2IFQ B;  4LMW A;  1JZO A;  2YWI A;  3C71 A;  4XIH A;  1O73 A;  1TRU A;  2N5A A;  2QA1 A;  4IBP A;  4J56 E;  2PGT A;  14GS A;  3D4M A;  4HU7 A;  3NIV A;  5JWR B;  5E59 A;  1MD4 A;  2OBI A;  3BCK A;  1ZMA A;  1HNB A;  4KE3 A;  3GL5 A;  2CVB A;  3CRT A;  2FNO A;  4ICY A;  1B4P A;  4MK3 A;  3MYD A;  5G5F A;  2CAI A;  2GQL A;  4WF4 A;  3L9S A;  1MTC A;  1DUG A;  1M0U A;  3TUE A;  2HRA A;  3KEB A;  4X0X A;  2PER A;  4KB3 A;  1HNA A;  2WRT A;  4MPG A;  5ECQ B;  3DYR A;  4MZW A;  2P5Q A;  4KCA A;  3CTF A;  3G7Y A;  1QUW A;  1F3A A;  3GYK A;  1O81 A;  4MDC A;  3UMA A;  12GS A;  2GGT A;  5IIZ A;  1AXD A;  1S3C A;  4XRA A;  5F06 A;  4ZBA A;  3HJM A;  1VF1 A;  2VCZ A;  1FB6 A;  1GH2 A;  4POL A;  1RW1 A;  1VGL A;  4PGT A;  3TJK A;  3UOM A;  5J5N A;  1B48 A;  1BED A;  4I2T A;  4MH3 A;  2CX3 A;  4HOJ A;  3WYW A;  5F05 A;  1JHB A;  1V58 A;  3D5J A;  3DRN A;  3HKR A;  1ACV A;  1Z7P A;  5CNW A;  4D73 A;  4EVM A;  4F82 A;  2IMD A;  1JFU A;  2RM6 A;  4J57 E;  5J3R A;  2VOC A;  4KH7 A;  4L5O A;  5DAL A;  1XWG A;  4N0V A;  5CRE A;  4Q5F A;  3LOR A;  5B6N A;  4WXT A;  2CAQ A;  1B9Y C;  2TRX A;  2H6Z A;  2MBT A;  1O85 A;  3K8N A;  4QL9 A;  4EDY A;  1VRS D;  1ILO A;  2H74 A;  2YWM A;  4GQC A;  2JZR A;  4N10 A;  3D21 A;  2H0G A;  5FWG A;  2C3N A;  3IPZ A;  1OC9 B;  1XIY A;  3C7M A;  3KMN A;  3KJY A;  3PIN A;  3GX0 A;  4TR4 A;  2VUP A;  4ECC A;  3GA4 A;  4JR4 A;  5HR3 A;  1GTA A;  1ON4 A;  2MYG A;  1E2Y A;  4OFM A;  1AQX A;  4ML6 A;  5HR0 A;  3ZZX A;  4MNN A;  2H72 A;  2A4H A;  1URM A;  4K2X A;  1KTE A;  2B5Y A;  4BVY A;  5DBQ A;  5F8B A;  1A24 A;  1XBS A;  2RUF A;  1WMJ A;  5JWQ B;  1SL0 B;  3LW9 A;  2H6Y A;  2F51 A;  4ZBB A;  1WWJ A;  4DEJ A;  1YF1 A;  1A0R P;  2LTK A;  3CTG A;  3UAP A;  5B7C A;  2B3S A;  1QQ2 A;  4DVC A;  2JSY A;  3CBU A;  5JCW A;  4Z2R A;  1OE8 A;  2X64 A;  4RQR A;  1TXX A;  2DJJ A;  3G7I A;  3GSS A;  3O3T A;  6GSY A;  1IYH A;  4V2M A;  3BBY A;  3A5W A;  3IAS 2;  4K2D A;  1MDI A;  3H1N A;  5J9B A;  1A8L A;  3L78 A;  1DE2 A;  4IHU A;  3BJ5 A;  1XPV A;  3EU3 A;  1YKC A;  1T1V A;  5HQP A;  4GLT A;  4MJB A;  5BMU A;  6GSU A;  4EO3 A;  3IA1 A;  5CAX A;  3HHV A;  3IC4 A;  2VLV A;  5DJM A;  1XWB A;  4G10 A;  3IDV A;  4HZ2 A;  1GTU A;  4IP6 A;  5A4W A;  5ECN B;  3SWL A;  1RK4 A;  1NHO A;  3QMX A;  1JZR A;  1ST9 A;  2QKE A;  5ECO B;  1PX6 A;  4HZ4 A;  4G0I A;  2ZNM A;  2FD3 A;  4ISD A;  2C0G A;  1M2D A;  2DC5 A;  4XHM A;  4AF2 A;  3D6I A;  5GST A;  8GSS A;  2G0F A;  4PX1 A;  1G6W A;  3M1G A;  1EV4 A;  5GSS A;  1PGT A;  5IOW A;  2WGR A;  3ZTL A;  3QCP A;  3F3Q A;  5DQY A;  3FYG A;  2YJH A;  4A5P A;  3MSZ A;  3FMW A;  5AIV A;  2WUL A;  5IO2 A;  4K7I A;  4K9Z A;  3TKR A;  4PQI A;  4TOP A;  3SBC A;  3L9U A;  4OD7 A;  3N5O A;  1ZYE A;  3FRC A;  2JSZ A;  5B8B A;  5G5E A;  3WD6 A;  4XS6 A;  2HRN A;  1HYU A;  3DKS A;  4IW9 A;  4GRF A;  4ZBD A;  4X43 A;  5EY6 A;  4IP1 A;  2C1Y A;  5DCH A;  4MAB A;  2IN3 A;  1O8X A;  1PRX A;  3DIE A;  4ECJ A;  2EIR A;  1GSS A;  4Z2T A;  2FCH A;  3LXZ A;  5JCU A;  4TVE A;  5D9W A;  1OC3 A;  2OJL A;  2WCI A;  2GQM A;  1NM3 A;  1M99 A;  2H0H A;  3H4K A;  3U5R E;  3I43 A;  4ID0 A;  1F2E A;  4TR1 B;  1PN9 A;  2L5O A;  1C72 A;  4PUA A;  2VLT A;  1YKA A;  3W8J A;  2R5G A;  2O85 A;  3QDN A;  3FY7 A;  3ZRE A;  2TIR A;  2VO4 A;  3ME7 A;  4K6X A;  4NAX A;  3HD5 A;  2B6M A;  1GNW A;  2FA8 A;  3FHK A;  2YOI A;  2KUC A;  3APO A;  4BVX B;  1XWK A;  2V32 A;  4ZL8 A;  1AUC A;  1GTB A;  3ZIJ A;  3KCM A;  2YPM A;  5CYY A;  3ERF A;  2DKI A;  4KSO A;  1A2L A;  2YP6 A;  2VD1 A;  3KH9 A;  5AIS A;  2K8S A;  3HA9 A;  2QC7 A;  3LYK A;  3ZYW A;  2NDO A;  2DKH A;  3IBH A;  4FYB A;  1LJR A;  3KM6 A;  6GSV A;  4X1U A;  3L4N A;  3M9K A;  1V40 A;  1GWC A;  1XVQ A;  2FWH A;  1TOF A;  4RI6 A;  3ZL5 A;  2QA2 A;  17GS A;  3EIN A;  2I9H A;  3HCZ A;  3LFL A;  4TRX A;  4FYC A;  2XBI A;  2AAW A;  1FOH A;  2P31 A;  1ABA A;  2UZ8 A;  4Q5Q A;  4EC0 A;  5A5K A;  5DVB A;  3A2X A;  1CQH A;  3CSJ A;  1QMV A;  4KF9 A;  4YAV A;  2DBC A;  3ZIV A;  1AQW A;  4XTS A;  3FR3 A;  1SU9 A;  3F4T A;  4CW9 A;  2HZE B;  3IK7 A;  4IQ1 A;  4YKG A;  3TJJ A;  5AGY A;  3GX8 A;  2LRN A;  5B8A A;  1X9S B;  2L5L A;  1Q4J A;  3E3E A;  4IEL A;  2MMN A;  1G0T A;  1SYR A;  6GST A;  2FGX A;  3GTU B;  3MDK A;  4JU5 A;  4OMV A;  5G30 A;  1SYX A;  4PQ1 A;  2O87 A;  3QOU A;  3C73 A;  3P90 A;  1GTI A;  3TRP A;  4GSS A;  2HXK A;  1X5D A;  1T4Y A;  1OC8 A;  2J23 A;  4K7O A;  3EMX A;  3FK8 A;  6GSX A;  5IMA A;  4K5S A;  4N11 A;  2R3X A;  1XW6 A;  1UN2 A;  3US3 A;  1UC7 A;  4GSN A;  1Z9H A;  1TW9 A;  1FVJ A;  4HI7 A;  1SEN A;  4WET A;  3F63 A;  3FZA A;  4L8E A;  2HSM A;  3M3M A;  1EP8 A;  2PUK C;  2C0F A;  2LRC A;  4IVF A;  3UEM A;  2DJ0 A;  2HZF A;  5ECH B;  1ZCP A;  1J9B A;  2OAD A;  4NHZ A;  3O6T A;  5A4V A;  4KUN A;  1YQ1 A;  5IMD A;  3EU4 A;  1HNC A;  1T7P B;  2C3T A;  2OA7 A;  3FZ4 A;  3QD9 A;  3GNJ A;  4IS0 A;  1EGO A;  3IRA A;  2VLU A;  1PN0 A;  6GSW A;  2DSA A;  1ZL9 A;  2HRK A;  3HVV A;  2NTO A;  1R7H A;  1M9A A;  1DSB A;  2I1U A;  2KOK A;  3TB2 A;  3TOT A;  2IJY A;  3UBK A;  2B5X A;  4MLY A;  2VL3 A;  3EWL A;  2XBQ A;  2H30 A;  4MF6 A;  5IO0 A;  1X0R A;  4BA7 A;  4MCU A;  1W4V A;  2X99 A;  5IPH A;  1FO5 A;  4TXO B;  3KTB A;  1Z6N A;  1YJ6 A;  2V6K A;  4PNF A;  1K0D A;  3LG6 A;  4MPF A;  4BWQ A;  2MZC A;  3RHB A;  5HR1 A;  2B7K A;  3VWU A;  2X49 A;  2CX4 A;  2M46 A;  2VAF A;  3C8E A;  3WT2 A;  4PNG A;  4NMU A;  5CP1 A;  2GSR A;  2D2Z A;  2N5F A;  4XS4 B;  1XWA A;  3F6F A;  3QAG A;  4CHS A;  3GMF A;  5ECS A;  2FA4 A;  1X5E A;  3GKK A;  4PXO A;  1UA5 A;  2RUE A;  1M2B A;  2AB6 A;  2ZCT A;  2V2G A;  4H86 A;  4LL1 B;  4YH2 A;  4X4J A;  2CQ9 A;  1G6Y A;  22GS A;  3PH9 A;  2R6K A;  2R4V A;  2PVO C;  4FO5 A;  1EOH A;  1NW2 A;  1R4W A;  2X8C A;  4TKY A;  5ECK B;  1PL2 A;  5J4U A;  3F4S A;  1PD2 1;  3TKS C;  1U87 A;  2RLI A;  3ZLP A;  1MEK A;  3OR5 A;  1OVN A;  5CRH A;  5L71 A;  2R0P A;  1EWX A;  1A2M A;  4WKW A;  2DML A;  2H01 A;  3HXS A;  2JL4 A;  1A8Y A;  4K0N A;  1K3L A;  4L0U A;  4V1A g;  2LJK A;  3KP9 A;  4HEA 2;  2FLS A;  1GSD A;  4GWR A;  1G7O A;  1F37 A;  4POK A;  4V2N A;  3D0Z A;  3DXB A;  1AIU A;  5ECR B;  1R5A A;  2PWJ A;  3HZ8 A;  2JAC A;  3Q18 A;  5ID2 B;  1ZGN A;  1V2A A;  3ZVJ A;  3F4R A;  4NWY A;  3W6G A;  2JZT A;  2HSH A;  2BJX A;  2DJ3 A;  1TK8 B;  1WJK A;  2O7K A;  2H70 A;  5COH A;  2LQO A;  2A4V A;  1EOG A;  2C0E A;  2YCD A;  2LUS A;  3FKF A;  4N0Z A;  2YNX A;  3F3R A;  2R0C A;  2VL2 C;  3QAW A;  1FB0 A;  5IQY A;  3NZN A;  1YEX A;  5H5R A;  2MMA A;  2PN8 A;  3VLN A;  3CMI A;  3QFB C;  5IM9 A;  2L4Q A;  2ON5 A;  2CZ2 A;  1TRS A;  2CV4 A;  1LBK A;  4ZL9 A;  4F9Z A;  4DSS B;  2HLS A;  2E7P A;  4FQU A;  4ZIL A;  4Q5N A;  4RUV A;  1PA3 A;  1SD8 A;  5DAK A;  4YQM A;  2IWT A;  4JZQ A;  2IFQ A;  3KMO A;  4V1A p;  1ZYQ B;  2E2G A;  3TKS E;  1FW1 A;  1TI3 A;  5EPF A;  2MMZ A;  4MZB A;  3WGD A;  3LJR A;  1NSW A;  3RDW A;  4FH8 A;  1OKD A;  1X9M B;  3EC3 A;  3I9V 2;  1Z3E A;  2E0Q A;  3F8U A;  3UL3 A;  4P3Y B;  5HFK A;  1QFN A;  4LA1 A;  3E9J B;  1SJZ A;  4F2I A;  2ON7 A;  2GSQ A;  4G9H A;  3WT1 A;  3FZ9 A;  2A2S A;  1OE7 A;  2OAC A;  1U88 A;  1VF3 A;  4KW6 A;  1JZD A;  2WB9 A;  4OCE A;  5ENU A;  5ABR A;  3KGK A;  1R26 A;  3M8N A;  4QL7 A;  3I6A A;  3VI7 A;  2FHE A;  1Y6E A;  2WJU A;  5KN2 A;  3A2V A;  4QQ7 A;  2XPE A;  1TRV A;  4RQX A;  2M80 A;  1XFL A;  2GST A;  5FT3 A;  5KN1 A;  3D4T A;  4E8E A;  2L6D A;  2HT9 A;  5IOX A;  3BD2 A;  4ZL7 A;  2HNL A;  2H8L A;  4EDZ A;  1FOV A;  2LST A;  4XCS A;  3GST A;  3KZQ A;  3LYP A;  4F0C A;  3Q6O A;  1KBN A;  3DVX A;  2C0D A;  3QAV A;  1X5C A;  5LCZ A;  1Q98 A;  2VCX A;  2HYX A;  2LEG A;  3S9F A;  4K5R A;  2YZH A;  4FIW A;  4EL1 A;  3KH7 A;  1E6B A;  2LNT A;  3A5I A;  4HJM A;  2H1A A;  1TI1 A;  3AY8 A;  5D73 A;  4IN0 A;  1MD3 A;  4ZIJ A;  16GS A;  1YY7 A;  18GS A;  2N5B A;  6GSS A;  5D93 A;  1M2A A;  5KN0 A;  1YZX A;  3IE3 A;  1GL8 A;  4PUR A;  3ZML A;  1F9M A;  4OO4 A;  5DQS A;  1OC9 A;  2VCT A;  4GST A;  4GF0 A;  4O7H A;  4BL7 B;  1M9B A;  5D9V A;  2I81 A;  4TW5 A;  4L5L A;  5H5Q A;  1GRX A;  2AYT A;  1V98 A;  1WE0 A;  2DMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...