1ERUA

Human thioredoxin (oxidized form)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Crystal structures of reduced, oxidized, and mutated human thioredoxins: evidence for a regulatory homodimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 30
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1eruA00
5CYYA 1SYXA 4KX4A 2X8GA 2I1UA 5ID2A 1TTZA 4KNDA 4ECCA 1PKZA 1R26A 4ID0A 3VWXA 3WT2A 3GYKA 3DGQA 2L6CA 2FWEA 1ERTA 4POBA 1IYHA 1PN9A 2PU9C 3CSIA 2I9HA 4KDYA 5KN0A 5D73A 4K2DA 3IR4A 3CTGA 1VRSD 4MZBA 1F3BA 4DSRA 1FB6A 1G0TA 4IGJA 2H19A 1ERUA 2HE3A 1XW9A 1K3OA 2M72A 16GSA 2H8LA 1ERWA 1A2JA 4PQHA 4PQ1A 5EVOA 1QK8A 1HQOA 1YDKA 2HT9A 2NPBA 2AV4A 2XBIA 3UVHA 3GIXA 4KDXA 3Q18A 2HNLA 1U3IA 1JZWA 2E7PA 2CX3A 4XHMA 3KEBA 1LU4A 1YF0A 2YANA 3F8UA 3O76A 4WBRD 4AJ7A 2K8SA 3CYNA 4I8BA 3AY8A 1WE0A 3FZAA 1F9MA 5B6NA 3EMPA 3FEUA 5J9CA 2FLSA 1W89A 2MZCA 4EUYA 1ZCPA 3L78A 3KM6A 2HLSA 2DIYA 5AISA 5HFKA 1NSWA 3TDGA 5AGYA 3FZ5A 4TN8A 1R7HA 3MSZA 2DC5A 2H66A 4G9HA 2CZ2A 4BA7A 5G5EA 1EGOA 4F03A 3IHQA 4KGIA 2DJJA 1PKWA 5ID2B 1YEPA 3VK9A 3KXOA 2X8HA 3HYPA 4PUAA 1M0UA 3GRXA 5ELGA 3DKSA 2HXKA 3KTBA 3G7JA 2IMIA 1GL8A 5KN3A 2OACA 1HYUA 3HJOA 3ZITA 3GV1A 1GH2A 2E0QA 3WGDA 4MF7A 5A4VA 3I9V2 1GSDA 2K8VA 3HKRA 4O92A 1R4WA 2GVPA 3UBLA 3MAKA 3QD9A 1V58A 4IN0A 4KDUA 2EIRA 3EU4A 3ZVJA 5KN2A 1GSSA 3IBHA 2PUKC 3BJ5A 3C73A 1X5EA 4Q5QA 4FYUA 4X43A 2JL4A 3HCZA 2JU5A 2GDRA 1VGLA 4F2IA 4N0ZA 1B9XC 3TOTA 1AIUA 3FR3A 1SK2A 1ILOA 3GTUA 5ECKB 5IMZA 1YQ1A 1DBYA 1WPIA 5CNWA 2F8AA 2VCQA 5ECSA 3VWWA 1B4PA 4L0WA 3GNJA 3PR8A 2V1MA 1YEXA 3BOAA 1V57A 5AIVA 5L71A 5KEJA 4L8EA 2L4CA 3TKQA 1M7TA 1SL2B 4KH7A 3P7XA 1DE1A 4IP6A 4POKA 1G7OA 4XTSA 4ML6A 2WZ9A 2F3MA 3BBYA 2PWJA 4HU9A 4PNGA 2A4VA 1FW1A 4YAPA 3C1RA 4WR5A 2OE3A 2P31A 2GZYA 2H70A 4POLA 1GSEA 3ED3A 2JSYA 5J9BA 2M46A 5DVBA 4IQ1A 4MP4A 5GSTA 2C3NA 3UMAA 1B4QA 3SWLA 2TRCP 1UC7A 4XRAA 1DUGA 2LS5A 4NWYA 4BWSA 4EVMA 4PURA 4MJEA 1F3AA 1O81A 3EYTA 1XOBA 2YWIA 1SU9A 5H5RA 1T1VA 2OJLA 2B1KA 4ZXGA 4WKWA 1JLWA 2VM1A 3APQA 2PBJA 5B8AA 1Z3EA 4JBBA 3QDNA 3TKRA 3WD6A 1ABAA 2GQLA 3DD3A 5LCZA 6GSTA 2FA4A 1Y6EA 5F05A 4NMUA 2C0DA 3A3TA 1TOFA 3LXTA 1CQGA 4O32A 3WYWA 4MJBA 3FHKA 1TK5B 1XWKA 2F9SA 2O85A 4LL1B 3J7Yk 2EIOA 1S3CA 2VL9A 5GZZB 4GTUA 4N30A 2DLXA 4MF5A 1THXA 3LWAA 1JZDA 1CQHA 1T00A 2V6KA 3E3EA 5COHA 1M2DA 4EXJA 3DMLA 5ECLB 1K0NA 2TIRA 1FAAA 3KD0A 3MNGA 1ZYQB 4Q5FA 2VL2C 4TXOB 4I2UA 2YV7A 1V2AA 3VPTA 1MTCA 1QUWA 3GKMA 2YV9A 5AIXA 1YJ6A 1SYRA 2ES7A 4GCIA 1TU8A 2I81A 1U3AA 4V2MA 3JCML 3OR5A 3L4NA 3C1SA 5DAKB 5G1LA 4EKZA 4ILFA 5DJLA 4ZL8A 3IE3A 4KW6A 3VFIA 1MDJA 2CVKA 1AXDA 3H79A 3QFAC 3HDCA 1A0FA 4GSTA 3V1WA 3FZ4A 4ZL7A 1N8JA 2LV3A 4MDCA 2L5LA 2H30A 5G30A 3F6DA 3RHCA 2WFCA 1OVNA 3S9FA 3ZLPA 4TR0A 5H5QA 2JZRA 3L9SA 2X64A 4V2NA 1F6MC 1AAZA 1M2AA 2VOCA 1WJKA 4OFNA 5EY6A 4PQIA 2ZNMA 4WBJA 1SKSB 2IFQB 5CAXA 4OWYA 3LG6A 3QAGA 3TOUA 1URMA 2CVBA 3F4SA 1V98A 2IMKA 3QOUA 2H0HA 2I4AA 4Z7XA 6GSUA 5D93A 1X9MB 4TXVA 3HXSA 2IPAA 1JZRA 3F4TA 3ZMLA 4OCEA 2HSHA 1S3DA 2ALBA 2B5EA 2D2ZA 2YCDA 2B1LA 5IMVA 2PN8A 1VF4A 5B8BA 2NTOA 4MZCA 3RAZA 4XCSA 5IMFA 4QQ7A 1FG4A 5LD0A 3IAM2 4KUNA 1XBSA 2AYTA 3ZTLA 2B6MA 4GXZA 1AQXA 1GTIA 2HI7A 1XVQA 2H1DA 4EO3A 1OKTA 1XZOA 4HQSA 1M99A 5A4UA 5B7CA 2H73A 1GTAA 2LKUA 5D9XA 1OE7A 1EP7A 3MDKA 3GKXA 1ACVA 2XPEA 1XW5A 1Z6NA 3TJGA 3D4MA 1BAYA 2WGRA 1MDIA 2N5FA 3GX8A 3TKSC 1TDIA 3DVWA 2GLRA 1QXHA 5J5NA 1QGVA 2XC2A 2IJYA 2CX4A 1Q98A 2GT6A 4YQMA 3A5WA 2FA8A 4MCUA 1T8EB 4K7NA 4NPBA 4RQXA 2B3SA 4V1Ap 5AN1A 4ZBAA 3A2XA 14GSA 1TK8B 3TJFA 8GSSA 4MZWA 4X0XA 2H72A 3HJPA 3ZFBA 19GSA 2IWTA 2VLUA 2YJHA 3N5OA 3GSSA 4FYCA 2EIQA 2V32A 2KP2A 4IELA 2H0IA 3GH9A 1ZL9A 2XHFA 3M1GA 2YOIA 1M9AA 5J41A 2OBKA 4NHWA 4TKYA 3E9JB 3H8QA 2REMA 4IKHA 3UOMA 2BMXA 5G5FA 2C3QA 1E2YA 3KIJA 4K0NA 4IP1A 5J3RA 3EE2A 4P3YB 4GSSA 3CBUA 4JR6A 1JZOA 1ZMAA 2HYXA 3FZ9A 10GSA 4WEYA 4DSSA 1EEMA 4TW5A 4FYBA 3ZMKA 2MMZA 5IMAA 4HU7A 1THOA 4FO5A 2KUCA 1TK0B 2WDUA 3GX0A 2LQQA 2H1BA 4ECBA 1EOHA 4IVFA 1XWBA 4TR4A 4ECIA 1PL2A 5D8IA 6GSXA 1O8WA 1K0DA 1OC9A 3UEMA 2H74A 3QPMA 4IJIA 1W4VA 3RBTA 5HFGA 4N11A 4OCFA 4F9ZA 2ON5A 1SL1B 4PUFC 3LQ7A 5ECNB 1QMVA 3EURA 5IOWA 7GSSA 5JCWA 4ZBDA 4F82A 2FY6A 1GLPA 3APSA 4HZ2A 4Q5RA 3UAPA 2JADA 4OO5A 2KP1A 3DXBA 4HDEA 5G31A 2C0GA 2F51A 4KA0A 1XWAA 6GSYA 2DSAA 1ML6A 3LJRA 3IOSA 3M8NA 2DJ3A 3FK8A 4I2TA 1GLQA 5D96A 4GF0A 4ML1A 2VLVA 2L5OA 2VAFA 4V2LA 1EEJA 4F0BA 1K0BA 4MK3A 2VCXA 3TCOA 4CDOA 1VF1A 2CT6A 1MD4A 3WT1A 3LORA 4HJ2A 2YZUA 5INYA 3TB2A 2GSQA 3LXZA 3Q6OA 2RM5A 1TI1A 3H4KA 1Q4JA 3ERGA 3F3RA 3PH9A 5DQSA 1BJXA 1T3BA 2R4VA 3UBKA 3RDWA 1TI3A 1GUHA 4DSSB 1EWXA 4OO4A 3MWHA 1M9BA 4K8MA 1YZXA 4GWRA 3W6GA 4V1Ag 4AJ8A 3P8WA 4IS0A 2EC4A 4LMVA 1SJIA 2LNTA 2R37A 1ZGNA 4TVEA 6GSSA 2C0FA 2FHEA 5E4WA 1DE2A 4D73A 3ZFLA 3KH7A 1TP9A 1SD9A 1HNAA 3LYKA 1J0FA 1ON4A 2QC7A 2CAIA 2JSZA 1NHYA 1WMJA 3IAS2 4E8HA 3HHVA 1OC9B 1O7UA 4TXOA 5CRWA 3D21A 2CV4A 2E2MA 1F2EA 2O87A 4OMVA 1EZKA 1BEDA 1WWJA 3CXGA 3TJKA 1JLVA 2DMLA 2MBSA 4JR4A 4J56E 1U88A 1J08A 1PA3A 2YNXA 5DAKA 4K0GA 2MMAA 1PL1A 3QMXA 3O6TA 1K0OA 2L6DA 3CSHA 3Q19A 3FKFA 1ERVA 4Q5NA 5ECHB 1GSUA 1K0AA 4HS1A 3VI5A 3P2AA 2XBQA 5EL8A 3IA1A 2X99A 3IPZA 2LQOA 4OFTA 2FGXA 1NW2A 5A4WA 3ME8A 1XWCA 2R2JA 4MH3A 1MD3A 2J9HA 5IM9A 2IFQA 2HRFA 1AQVA 1SK0A 2B5YA 4RI6A 1SKWB 2DMMA 3GL3A 3UL3A 1KTEA 3HVVA 1XWGA 4ZIJA 2R3XA 3TUEA 4JZQA 4K9ZA 3F9UA 1OAZA 1EOGA 5CRHA 4AJ6A 5IMCA 1PRXA 2KLXA 2VD1A 4WXTA 2HZEA 1SJZA 20GSA 1FB0A 5DCHA 2AJQB 3KP9A 3GKNA 1R5AA 5DJMA 3IK7A 2DIZA 1PGTA 1OC3A 4DVCA 4D73B 3IDVA 3VWUA 4IQAA 2JZTA 4G19A 1WP0A 2VUPA 4BPYA 1YKAA 2MMOA 1GSFA 4NAXA 3ME7A 2VIMA 3A2WA 2MMNA 2K6VA 17GSA 1KBNA 4ISDA 3R2QA 5G1KA 1K0CA 1GTBA 4KE3A 5CRGA 3GURA 2RUFA 5F07A 5B6MA 4XIHA 2P5QA 1PD21 1IYIA 2O89A 5HR2A 4LA1A 3IXRA 1Z9HA 1OC8A 5GAPD 3M0FA 4O7HA 1GSYA 1VF2A 4N10A 2WRTA 2CAQA 2H0GA 2LRNA 2YWOA 3W8JA 4BVYA 3GKKA 2YWMA 2FCHA 3EMXA 5KN1A 4J57E 4HOJA 1F37A 2XPDA 4KAEA 3ZL5A 2KOKA 2C4JA 2G2QA 2VCWA 2C0EA 5ELAA 5FHIA 1XPVA 1R5PA 4CHSA 4RUVA 1HNCA 22GSA 3CRUA 4I5QA 11GSA 3KH9A 3I6AA 2YZHA 1Z7PA 3D0ZA 5JCGA 1WOUA 1GUKA 2PPTA 3LEFA 3TGZA 4J2FA 1SKRB 4PX1A 1TW9A 2VLTA 3D4TA 3FY7A 1RW1A 2LJKA 1B9YC 1V40A 2GZPA 2N5BA 1PQNA 5F06A 3HA9A 4K7IA 3BD2A 1TRSA 4WR4A 1XVWA 5ECPB 3ZREA 4GLTA 2L57A 2PVOC 2V6OA 1B8XA 2HZEB 2IL3A 12GSA 4YAVA 5GAND 1UVZA 1G6YA 2J23A 5ECOB 5IMDA 5IPGA 1H75A 2NDOA 1E6BA 3FRCA 3HVXA 4O5RA 1U6TA 6GSWA 4HI7A 3VPQA 4MJAA 1WIKA 3KCMA 1NHOA 5ECRB 1SL0B 3ZIJA 5F8BA 3E0UA 5IQYA 5JWOB 1XIYA 5D9TA 2IN3A 4OD7A 4HEA2 1GWCA 1SJ6A 3GA4A 3CSJA 3EINA 3KP8A 3LFLA 1RK4A 1B48A 3RPPA 4ZB9A 1GNWA 1SD8A 1O6JA 3GH6A 2YN1A 1T4ZA 2LTKA 5HQPA 1HNBA 1GP1A 4YH2A 3EC3A 2PERA 5DALB 1JHBA 1LBKA 5IO2A 2GSRA 5DDLA 4AGSA 4MLYA 2H75A 2LJAA 1TU7A 1TKDB 5ECMB 4GRFA 1N2AA 4XS6A 2H71A 3KJYA 3UIWA 2C80A 1T7PB 2GT5A 4FH8A 1EV4A 2QKEA 3GHAA 4KSMA 3L0HA 1EP8A 4PNFA 1OE8A 3L9UA 3HY2A 3H1NA 3F0IA 2AAWA 2WCIA 3TRXA 3N9JA 1U87A 2TRXA 3CTFA 3NOFA 1K3YA 4F0CA 2ZCTA 3U6VA 1BQ7A 1MDKA 1K3LA 1KNGA 5JWQB 2H6ZA 5HR1A 1TRVA 1AQWA 1EGRA 4FIWA 1C72A 4JEDA 3M9KA 2K18A 1TJDA 5ABRA 3KZQA 1OKDA 5F0GA 2DJ2A 3C71A 4K7OA 3TRQA 4IW9A 3F4RA 2CZ3A 2E2GA 4H86A 4GSNA 2OKAA 3GN3A 3F3QA 6GSVA 1GULA 3UJ1A 2V2GA 2B7JA 1YY7A 5CP1A 1A23A 2RUEA 4WETA 2FWFA 4YQUA 4EE0A 5CO3A 4ZILA 4HUAA 5JCUA 4XS4B 2I3YA 4NV5A 3IV4A 4OFMA 1TXXA 2HFDA 1BX9A 1FVKA 3IRAA 3RHBA 4XRDA 2LEGA 1UN2A 1FOVA 3Q74A 3VLNA 2L4QA 2H01A 1AUCA 2JACA 3PGTA 3TKPA 2IMDA 1GSQA 3G9BA 5E59A 4EDZA 1X9WB 1Z6MA 3IC4A 2NVLA 1XW6A 5ECIB 3I69A 3M9JA 3K8NA 5EPFA 4DEJA 4POMA 3NZNA 2QGVA 2VCZA 4PGTA 1BYEA 4HJMA 1BG5A 3QAWA 4WF4A 3QR6A 4IJ3A 3FYGA 3CRTA 3J7Yb 1X5CA 1O8XA 2OBIA 3QFBC 1A8YA 3PINA 1PX6A 2WULA 3SBCA 3D5JA 2OE1A 3C7MA 5H5SA 3GFKA 3US3A 2VL2A 3FR9A 9GSSA 2GS3A 5FT3A 4TRXA 3EWLA 3VWVA 4N0VA 2VCTA 3EU3A 2VD0A 1A8LA 4NV2A 2H1GA 2B7KA 2M80A 3HVSA 2FWGA 1SK1A 2F8FA 3EVIA 4LLRA 4MMMA 3DWVA 4YQVA 4TR3A 4NHZA 2GSTA 2G0FA 4EL1A 3GSTA 1PMTA 3FR6A 2GZZA 2HSYA 2DJ0A 4LL4B 4KB3A 2DJ1A 3D22A 4EC0A 4WF5A 4G2EA 1X5DA 2YJ7A 4E8EA 2P0GA 1A0RP 2FWHA 2FUG2 1XCCA 1HD2A 2X8CA 4LMWA 5IOXA 4K1FA 3M3MA 3NIVA 2C1YA 2YP6A 5DQYA 1M2BA 2V41A 4L5OA 2GTUA 2GSSA 2FD3A 4GQFA 1SENA 2B5XA 3HZ4A 3G7IA 1FVJA 2LNSA 5A5KA 3IK9A 3DRNA 3P90A 2WS2A 4PXOA 2AHEA 4AF2A 1TRUA 4G10A 4MPGA 3GUSA 2C3TA 1X0RA 3VURA 1AC1A 2VCVA 2VL3A 2MYGA 2HRNA 3BCIA 5FWGA 3ZYWA 4EDYA 4MF6A 2H76A 5C00A 1ZYEA 5IO0A 1ZZYA 2IMEA 2PGTA 1MEKA 1XFLA 3ZRDA 1FHEA 5D9WA 4JRRA 2VM2A 3O3TA 2AB6A 3TJJA 1DSBA 2IIYA 4ZB8A 3DIEA 1J9BA 3WGEA 1V9WA 2R5GA 4TOPA 3VI7A 3TKSA 3ERWA 2ZUPA 2GGTA 5C04A 2ON7A 5DBQA 1X9SB 1QFNA 5LNKe 5D9VA 1ZOFA 2BTOT 4DSQA 2O8VB 1YKCA 1ST9A 3GTUB 3C8EA 3H93A 2BJXA 2H6XA 2AUVA 2O7KA 1TRWA 4ZB6A 4ZL9A 1A2LA 3APOA 5IPHA 3ZIVA 18GSA 1UA5A 4QL7A 4GQCA 3W8SA 1OYJA 3F6FA 3LGCA 1O73A 1Z7RA 4ULXA 5DALA 3ZVJD 2H6YA 3KMOA 1K0MA 4MA9A 1KEBA 3GMFA 1T4YA 5G2ZA 2C8UA 3DVXA 2DJKA 4TR1A 3KGKA 2CA8A 3TKSE 1I9DA 5CREA 2IMFA 1JFUA 4KSOA 2YPMA 3BCKA 4L0UA 2OADA 3WGXA 1GTUA 3A2VA 2A2SA 2CVDA 3G7YA 2LSTA 1S3AA 1A24A 3FW2A 2RIIA 2WJUA 1RQMA 3U5RE 2LUSA 1WRYA 3DEXA 1I5GA 1O85A 4I6XA 2FNOA 4I97A 5GSSA 1QQ2A 2GQMA 4IBPA 4HQZA 4MJCA 1NM3A 1YF1A 1LJRA 2KHPA 1A2MA 2VO4A 3TRPA 3TJBA 1FO5A 2CQ9A 3LSZA 2OE0A 3L9VA 2NBSA 1PX7A 4L5LA 1G7EA 1H4OA 1XOAA 1PSQA 2PMTA 1USBA 1GUMA 5DCGA 3KTLA 3LYPA 4QL9A 2RM6A 4BWQA 4ECJA 2K9FA 3HJMA 4NXIA 2L59A 1VF3A 5ECQB 3DYRA 4BL7A 1AW9A 4MPFA 2GQKA 3ERFA 1G6WA 5HR3A 2R6KA 2OA7A 1XXUA 4IHUA 1Y25A 4MH2A 4RQRA 5CRDA 4BVXA 2QSIA 2YWNA 4JE1A 5IIZA 1Z5YE 4KCEA 3QAVA 2P5RA 3RPNA 2DBCA 3HD5A 4XS4A 5HFIA 4MABA 1GNEA 2LJRA 2MBTA 4K6XA 5JWRB 3D6IA 2Z9SA 3F63A 1GRXA 4JU5A 4X1UA 3ISOA 4ZBBA 3UARA 2LRCA 2H1AA 3UVTA 4XS1A 2HZFA 3ZZXA 2A2RA 4CW9A 3GL5A 4RI7A 4TR1B 2RLIA 5J4UA 3QCPA 5ENUA 13GSA 5HR0A 4ACSA 3I43A 2N5AA 3CMIA 3HZ8A 2PVQA 4EF0A 4KCAA 3KMNA 2LRTA 1EV9A 2JZSA 2WB9A 4HZ4A
chains in the Genus database with same CATH superfamily
5CYYA 1SYXA 4KX4A 2X8GA 2I1UA 5ID2A 1TTZA 4KNDA 4ECCA 1PKZA 1R26A 4ID0A 3VWXA 3WT2A 3GYKA 3DGQA 2L6CA 2FWEA 1ERTA 4POBA 1IYHA 1PN9A 2PU9C 3CSIA 2I9HA 4KDYA 5KN0A 5D73A 4K2DA 3IR4A 3CTGA 1VRSD 4MZBA 1F3BA 4DSRA 1FB6A 1G0TA 4IGJA 2H19A 1ERUA 2HE3A 1XW9A 1K3OA 2M72A 16GSA 4A5PA 2H8LA 1ERWA 1A2JA 4PQHA 4PQ1A 5EVOA 1QK8A 1HQOA 4BL7B 1YDKA 2HT9A 2NPBA 2AV4A 2XBIA 3UVHA 3GIXA 4KDXA 3Q18A 2HNLA 1U3IA 1JZWA 4BVXB 2E7PA 2CX3A 4XHMA 3KEBA 1LU4A 1YF0A 2YANA 3F8UA 3O76A 4WBRD 4AJ7A 2R0PA 2K8SA 3CYNA 4I8BA 3AY8A 1WE0A 3FZAA 1F9MA 5B6NA 3EMPA 3FEUA 5J9CA 2FLSA 1W89A 2MZCA 4EUYA 3IC8A 1ZCPA 3L78A 3KM6A 2HLSA 2DIYA 5AISA 5HFKA 1NSWA 3TDGA 5AGYA 3FZ5A 4TN8A 1R7HA 3MSZA 2DC5A 2H66A 4G9HA 2CZ2A 4BA7A 5G5EA 1EGOA 4F03A 3IHQA 4KGIA 2DJJA 1PKWA 5ID2B 1YEPA 3VK9A 3KXOA 2X8HA 3HYPA 4PUAA 1M0UA 3GRXA 5ELGA 3DKSA 2HXKA 3KTBA 3G7JA 2IMIA 1GL8A 5KN3A 2OACA 1HYUA 3HJOA 3ZITA 3GV1A 1GH2A 2E0QA 3WGDA 4MF7A 5A4VA 3I9V2 4PTSA 1GSDA 2K8VA 3HKRA 4O92A 1R4WA 2GVPA 3UBLA 3MAKA 3QD9A 1V58A 4IN0A 1ZYPA 4KDUA 2EIRA 2UZ8A 4K5RA 3EU4A 3ZVJA 5KN2A 1GSSA 3IBHA 2PUKC 3BJ5A 3C73A 1X5EA 4Q5QA 4FYUA 4X43A 2JL4A 3HCZA 5BRTA 2JU5A 2GDRA 1VGLA 4F2IA 4N0ZA 1B9XC 3TOTA 1AIUA 3FR3A 1SK2A 1ILOA 3GTUA 5ECKB 5IMZA 1YQ1A 1DBYA 1WPIA 5CNWA 2F8AA 2QA2A 4USSA 2VCQA 5ECSA 3VWWA 1B4PA 4L0WA 3GNJA 3PR8A 2V1MA 1YEXA 3BOAA 1V57A 5AIVA 5L71A 5KEJA 4L8EA 2L4CA 3TKQA 1M7TA 1SL2B 4KH7A 3P7XA 1DE1A 4IP6A 4POKA 1G7OA 4XTSA 4ML6A 2WZ9A 2F3MA 3BBYA 2PWJA 4HU9A 4PNGA 2A4VA 1FW1A 4YAPA 3C1RA 4WR5A 2OE3A 2P31A 2GZYA 2H70A 4POLA 1GSEA 3ED3A 2JSYA 5J9BA 2M46A 5DVBA 4IQ1A 4MP4A 5GSTA 2C3NA 3UMAA 1B4QA 3SWLA 2TRCP 1UC7A 4XRAA 1DUGA 2LS5A 4NWYA 4BWSA 4EVMA 4PURA 4MJEA 1F3AA 1O81A 3EYTA 1XOBA 2YWIA 1SU9A 5H5RA 1T1VA 2OJLA 2B1KA 4CY8A 4ZXGA 4WKWA 1JLWA 2VM1A 3APQA 2PBJA 5B8AA 1Z3EA 4JBBA 3QDNA 3TKRA 3WD6A 1ABAA 2GQLA 3DD3A 5LCZA 6GSTA 2FA4A 1Y6EA 5F05A 4NMUA 2C0DA 3A3TA 1TOFA 3LXTA 1CQGA 4O32A 3WYWA 4MJBA 3FHKA 1TK5B 1XWKA 2F9SA 2O85A 4LL1B 3J7Yk 2EIOA 1S3CA 2VL9A 4Z2TA 5GZZB 4GTUA 4N30A 2DLXA 4MF5A 1THXA 3LWAA 1JZDA 1CQHA 1T00A 2V6KA 3E3EA 5COHA 1M2DA 4EXJA 3DMLA 5ECLB 1K0NA 2TIRA 1FAAA 3KD0A 3MNGA 1ZYQB 4Q5FA 2VL2C 4TXOB 4I2UA 2YV7A 1V2AA 3VPTA 1MTCA 1QUWA 3GKMA 3PPUA 2YV9A 5AIXA 1YJ6A 1SYRA 2ES7A 4GCIA 1TU8A 2I81A 1U3AA 4V2MA 3JCML 3OR5A 3L4NA 3C1SA 5DAKB 5G1LA 4EKZA 4ILFA 5DJLA 4ZL8A 3IE3A 4KW6A 3VFIA 1MDJA 2CVKA 1AXDA 3H79A 3QFAC 3HDCA 1A0FA 4GSTA 3V1WA 3FZ4A 3MIXA 4ZL7A 1N8JA 2LV3A 4MDCA 2L5LA 2H30A 5G30A 3F6DA 3RHCA 2WFCA 1OVNA 3S9FA 3ZLPA 4TR0A 5H5QA 2JZRA 3L9SA 2X64A 4V2NA 1F6MC 1AAZA 1M2AA 2VOCA 4X4JA 1WJKA 4OFNA 5EY6A 4PQIA 2ZNMA 4WBJA 1SKSB 2IFQB 5CAXA 4OWYA 3LG6A 3QAGA 3TOUA 1URMA 2CVBA 3F4SA 5BMUA 1V98A 2IMKA 3QOUA 2H0HA 2I4AA 4Z7XA 6GSUA 5D93A 1X9MB 4TXVA 3HXSA 2IPAA 1JZRA 3F4TA 3ZMLA 4OCEA 2HSHA 1S3DA 2ALBA 2B5EA 2D2ZA 2YCDA 2B1LA 5IMVA 2PN8A 1VF4A 5B8BA 2NTOA 4MZCA 3RAZA 4XCSA 1PFOA 5IMFA 4QQ7A 1FG4A 5LD0A 3IAM2 4KUNA 1XBSA 2AYTA 3ZTLA 2B6MA 4GXZA 1AQXA 1GTIA 2HI7A 4K2XA 3MYDA 1XVQA 2H1DA 4EO3A 1OKTA 4Z2RA 1XZOA 4HQSA 1M99A 5A4UA 5B7CA 2H73A 1GTAA 2LKUA 2QA1A 5D9XA 1OE7A 1EP7A 3MDKA 3GKXA 1ACVA 2XPEA 1XW5A 1Z6NA 3TJGA 3D4MA 1BAYA 2WGRA 1MDIA 2N5FA 3GX8A 3TKSC 1TDIA 3DVWA 2GLRA 1QXHA 5J5NA 1QGVA 2XC2A 2IJYA 2CX4A 1Q98A 2GT6A 4YQMA 3A5WA 2FA8A 4MCUA 1T8EB 4K7NA 4NPBA 4RQXA 2B3SA 4V1Ap 5AN1A 4ZBAA 4ICYA 3A2XA 14GSA 1TK8B 3TJFA 8GSSA 4MZWA 4X0XA 2H72A 3HJPA 3ZFBA 19GSA 2IWTA 2VLUA 2YJHA 3N5OA 3GSSA 4FYCA 2EIQA 2V32A 2KP2A 4IELA 2H0IA 3GH9A 1ZL9A 2XHFA 3M1GA 2YOIA 1M9AA 5J41A 2OBKA 4NHWA 4TKYA 3E9JB 3H8QA 2REMA 4IKHA 3UOMA 2BMXA 5G5FA 2C3QA 1E2YA 3KIJA 4K0NA 4IP1A 5J3RA 3EE2A 4P3YB 4GSSA 3CBUA 4JR6A 1JZOA 1ZMAA 2HYXA 3FZ9A 10GSA 4WEYA 4DSSA 4BIKA 1EEMA 4TW5A 4FYBA 3ZMKA 2MMZA 5IMAA 4HU7A 1THOA 4FO5A 2KUCA 1TK0B 2WDUA 3GX0A 2LQQA 2H1BA 4ECBA 1EOHA 4IVFA 4O5QA 1XWBA 4TR4A 4ECIA 1PL2A 5D8IA 6GSXA 1O8WA 1K0DA 1OC9A 3UEMA 2H74A 3QPMA 4IJIA 1W4VA 3RBTA 5HFGA 4N11A 4OCFA 4F9ZA 2ON5A 1SL1B 4PUFC 3LQ7A 5ECNB 1QMVA 3EURA 5IOWA 7GSSA 5JCWA 4ZBDA 4F82A 2FY6A 1GLPA 3APSA 4HZ2A 4Q5RA 3UAPA 2JADA 4OO5A 2KP1A 3DXBA 4HDEA 5G31A 2C0GA 2F51A 4KA0A 1XWAA 6GSYA 2DSAA 1ML6A 3LJRA 3IOSA 3M8NA 2DJ3A 3FK8A 4I2TA 1GLQA 5D96A 4GF0A 4ML1A 2VLVA 2L5OA 2VAFA 4V2LA 1EEJA 4F0BA 1K0BA 4MK3A 2VCXA 3TCOA 4CDOA 1VF1A 2CT6A 1MD4A 3WT1A 3LORA 4HJ2A 2YZUA 5INYA 3TB2A 2GSQA 3LXZA 3Q6OA 2RM5A 1TI1A 3H4KA 1Q4JA 3ERGA 3F3RA 3PH9A 5DQSA 1BJXA 1T3BA 2R4VA 3UBKA 2DKIA 3RDWA 1TI3A 1GUHA 4DSSB 1EWXA 4OO4A 3MWHA 1M9BA 4K8MA 1YZXA 4GWRA 3W6GA 4V1Ag 4AJ8A 3P8WA 4IS0A 2EC4A 4LMVA 5KOWA 1SJIA 2LNTA 2R37A 1ZGNA 4KF9A 4TVEA 6GSSA 3CQFA 2C0FA 2FHEA 5E4WA 1DE2A 4D73A 3ZFLA 3KH7A 1TP9A 1SD9A 1HNAA 3LYKA 1J0FA 1ON4A 2QC7A 2CAIA 2JSZA 1NHYA 1WMJA 3IAS2 4E8HA 3HHVA 1OC9B 1O7UA 4TXOA 5CRWA 3D21A 2CV4A 2E2MA 1F2EA 2O87A 4OMVA 1EZKA 1BEDA 1WWJA 3CXGA 3TJKA 1JLVA 1M3IA 2DMLA 2MBSA 4JR4A 4J56E 1U88A 1J08A 1PA3A 2YNXA 5DAKA 4K0GA 2MMAA 1PL1A 3QMXA 3O6TA 1K0OA 2L6DA 3CSHA 3Q19A 3FKFA 1ERVA 4Q5NA 5ECHB 1GSUA 1K0AA 4HS1A 3VI5A 3P2AA 2XBQA 5EL8A 3IA1A 2X99A 3IPZA 2LQOA 1XG8A 2R0GA 4OFTA 2FGXA 1NW2A 5A4WA 3ME8A 1XWCA 2R2JA 4MH3A 1MD3A 2J9HA 5IM9A 2IFQA 2HRFA 1AQVA 1SK0A 2B5YA 4RI6A 1SKWB 2DMMA 3GL3A 3UL3A 1KTEA 3HVVA 1XWGA 4ZIJA 2R3XA 4G0KA 3TUEA 4JZQA 4K9ZA 3F9UA 1OAZA 1EOGA 5CRHA 3LW9A 4AJ6A 5IMCA 1PRXA 2KLXA 2VD1A 4WXTA 2HZEA 1SJZA 20GSA 1FB0A 5DCHA 2AJQB 3KP9A 3GKNA 1R5AA 5DJMA 3IK7A 2DIZA 1PGTA 1OC3A 4DVCA 4D73B 3IDVA 3VWUA 4IQAA 2JZTA 4G19A 1WP0A 2VUPA 4BPYA 1YKAA 2MMOA 1GSFA 4NAXA 3ME7A 2VIMA 3A2WA 2MMNA 2K6VA 17GSA 1KBNA 4ISDA 3R2QA 5G1KA 1K0CA 1GTBA 4KE3A 5CRGA 3GURA 2RUFA 5F07A 5B6MA 4XIHA 2P5QA 1PD21 1IYIA 2O89A 5HR2A 4LA1A 3IXRA 1Z9HA 1OC8A 2A4HA 5GAPD 3M0FA 4O7HA 1GSYA 1VF2A 4N10A 2WRTA 2CAQA 2H0GA 2LRNA 2YWOA 3W8JA 4BVYA 3GKKA 2YWMA 2FCHA 3EMXA 5KN1A 4J57E 4HOJA 1F37A 2XPDA 4KAEA 3ZL5A 2KOKA 2C4JA 2G2QA 2VCWA 2C0EA 5ELAA 5FHIA 1XPVA 1R5PA 4CHSA 4EIPA 4RUVA 1HNCA 22GSA 3CRUA 4I5QA 11GSA 3KH9A 3I6AA 2YZHA 1Z7PA 3D0ZA 5JCGA 1WOUA 1GUKA 2PPTA 3LEFA 3TGZA 4J2FA 1SKRB 4PX1A 1TW9A 2VLTA 3D4TA 3FY7A 1RW1A 2LJKA 1B9YC 1V40A 2GZPA 2N5BA 1PQNA 5F06A 3HA9A 4K7IA 3BD2A 1TRSA 4WR4A 1XVWA 5ECPB 3ZREA 4GLTA 2L57A 2PVOC 2V6OA 1B8XA 2HZEB 2IL3A 12GSA 4YAVA 5GAND 1UVZA 1G6YA 2J23A 5ECOB 5IMDA 5IPGA 1H75A 2NDOA 1E6BA 5KOXA 3FRCA 3EPTA 3HVXA 4O5RA 1U6TA 6GSWA 4HI7A 3HVNA 4MJAA 3VPQA 1WIKA 3KCMA 1NHOA 5ECRB 1SL0B 3ZIJA 5F8BA 3E0UA 5IQYA 5JWOB 1XIYA 5D9TA 2IN3A 4OD7A 4HEA2 1GWCA 1SJ6A 3GA4A 3CSJA 3EINA 3KP8A 3LFLA 1RK4A 1B48A 3RPPA 4ZB9A 1GNWA 1SD8A 1O6JA 3GH6A 2YN1A 1T4ZA 2LTKA 5HQPA 1HNBA 4BVYB 1GP1A 4YH2A 3EC3A 2PERA 5DALB 1JHBA 1LBKA 5IO2A 2GSRA 5DDLA 4AGSA 4MLYA 2H75A 2LJAA 3R3EA 1TU7A 1TKDB 5ECMB 4GRFA 1N2AA 4XS6A 2H71A 3KJYA 3UIWA 2C80A 1T7PB 2GT5A 4FH8A 1EV4A 2QKEA 3GHAA 4KSMA 3L0HA 1EP8A 4PNFA 1OE8A 3L9UA 3HY2A 3H1NA 3F0IA 2AAWA 2WCIA 3TRXA 3N9JA 1U87A 2TRXA 3CTFA 3NOFA 1K3YA 4F0CA 2ZCTA 3U6VA 1BQ7A 1MDKA 1K3LA 1KNGA 5JWQB 2H6ZA 5HR1A 4YKGA 1TRVA 1AQWA 1EGRA 4FIWA 4G0IA 1C72A 4JEDA 3M9KA 2K18A 1TJDA 5ABRA 3KZQA 1OKDA 5F0GA 2DJ2A 3C71A 4K7OA 3TRQA 4IW9A 3F4RA 2CZ3A 2E2GA 4H86A 4GSNA 2OKAA 3GN3A 3F3QA 6GSVA 1GULA 3UJ1A 2V2GA 2B7JA 4Z2UA 1YY7A 5CP1A 1A23A 2RUEA 2DKHA 4WETA 2FWFA 4YQUA 4EE0A 5CO3A 4ZILA 3A5IA 4HUAA 5JCUA 4XS4B 2I3YA 2HSMA 4NV5A 3IV4A 4OFMA 1TXXA 2HFDA 1BX9A 1FVKA 3IRAA 3RHBA 4XRDA 2LEGA 1UN2A 1FOVA 3Q74A 3VLNA 2L4QA 2H01A 1AUCA 2JACA 3PGTA 3TKPA 2IMDA 1GSQA 3G9BA 5E59A 4EDZA 1X9WB 1Z6MA 3IC4A 2NVLA 1XW6A 5ECIB 3I69A 3M9JA 3K8NA 5EPFA 4DEJA 4POMA 3NZNA 2QGVA 2VCZA 4PGTA 1BYEA 4HJMA 1BG5A 3QAWA 4WF4A 3QR6A 4IJ3A 4K5SA 3FYGA 3CRTA 3J7Yb 1X5CA 1O8XA 2OBIA 1PN0A 3QFBC 1A8YA 3PINA 1PX6A 2WULA 3SBCA 3D5JA 2OE1A 3C7MA 5H5SA 3GFKA 3US3A 2VL2A 3FR9A 9GSSA 2GS3A 5FT3A 4TRXA 3EWLA 3VWVA 4N0VA 2VCTA 3EU3A 2VD0A 4HSCX 1A8LA 4NV2A 2H1GA 2B7KA 2M80A 3HVSA 2FWGA 4FQUA 1SK1A 2F8FA 3EVIA 4LLRA 4MMMA 3DWVA 4YQVA 4TR3A 4NHZA 2GSTA 2G0FA 4EL1A 3GSTA 1PMTA 3FR6A 2GZZA 2HSYA 2DJ0A 4LL4B 4KB3A 2DJ1A 3D22A 4EC0A 4WF5A 4G2EA 1X5DA 2YJ7A 4E8EA 2P0GA 1A0RP 2FWHA 2FUG2 1XCCA 1HD2A 2X8CA 4LMWA 5IOXA 2HRAA 4K1FA 3M3MA 3NIVA 2C1YA 2YP6A 5DQYA 1M2BA 2V41A 4L5OA 2GTUA 2GSSA 2FD3A 4GQFA 1SENA 2B5XA 3HZ4A 3G7IA 1FVJA 2LNSA 5A5KA 3IK9A 3DRNA 3P90A 2WS2A 4PXOA 2AHEA 4AF2A 1TRUA 4G10A 4MPGA 3GUSA 2C3TA 1X0RA 3VURA 1AC1A 2VCVA 2VL3A 2MYGA 2HRNA 2A2PA 3BCIA 5FWGA 4G0LA 3ZYWA 4MF6A 2H76A 4EDYA 5C00A 1ZYEA 5IO0A 1ZZYA 2IMEA 2PGTA 1MEKA 1XFLA 4EIQA 3ZRDA 1FHEA 1S3RA 5D9WA 4JRRA 2VM2A 3O3TA 2AB6A 3TJJA 1DSBA 2IIYA 4ZB8A 3DIEA 1J9BA 3WGEA 1V9WA 2R5GA 4TOPA 3VI7A 3TKSA 3ERWA 2ZUPA 2GGTA 5C04A 2ON7A 5DBQA 2X49A 1X9SB 1QFNA 5LNKe 5D9VA 1ZOFA 2BTOT 4DSQA 2O8VB 1FOHA 2X4AA 1YKCA 1ST9A 3GTUB 3C8EA 3H93A 2BJXA 2H6XA 2AUVA 2O7KA 1TRWA 4ZB6A 4ZL9A 1A2LA 3APOA 5IPHA 3ZIVA 18GSA 1UA5A 4QL7A 4GQCA 3W8SA 1OYJA 3F6FA 3LGCA 1O73A 1Z7RA 4ULXA 5DALA 3ZVJD 2H6YA 3KMOA 1K0MA 4MA9A 1KEBA 4MNNA 3GMFA 1T4YA 5G2ZA 2C8UA 3DVXA 2DJKA 4TR1A 3KGKA 2CA8A 3TKSE 1I9DA 4O5UA 5CREA 2IMFA 1JFUA 4KSOA 2YPMA 3BCKA 4L0UA 2OADA 3WGXA 1GTUA 4CY6A 3A2VA 2A2SA 2CVDA 3G7YA 2LSTA 1S3AA 1A24A 3FW2A 2RIIA 2WJUA 1RQMA 3U5RE 2LUSA 3IHGA 1WRYA 1M3JA 3DEXA 1I5GA 1O85A 4I6XA 2FNOA 4I97A 5GSSA 1QQ2A 2GQMA 4IBPA 4HQZA 4MJCA 3FMWA 1NM3A 1YF1A 1LJRA 2KHPA 1A2MA 2VO4A 3TRPA 3TJBA 1FO5A 2CQ9A 3LSZA 2OE0A 3L9VA 2R0CA 2NBSA 1PX7A 4L5LA 1G7EA 1H4OA 1XOAA 1PSQA 2PMTA 1USBA 1GUMA 5DCGA 3KTLA 3LYPA 4QL9A 2RM6A 4BWQA 4ECJA 2K9FA 3HJMA 4NXIA 2L59A 1VF3A 5ECQB 3DYRA 4BL7A 1AW9A 4MPFA 2GQKA 3ERFA 1G6WA 5HR3A 2R6KA 2OA7A 1XXUA 4IHUA 1Y25A 4MH2A 4RQRA 5CRDA 4BVXA 2QSIA 2YWNA 4JE1A 5IIZA 1Z5YE 4KCEA 3QAVA 2P5RA 3RPNA 2DBCA 3HD5A 4XS4A 5HFIA 4MABA 1GNEA 2LJRA 2MBTA 4K6XA 5JWRB 3D6IA 2Z9SA 3F63A 1GRXA 4JU5A 4X1UA 3ISOA 4ZBBA 3UARA 2LRCA 2H1AA 3UVTA 4XS1A 2HZFA 3ZZXA 2A2RA 4CW9A 3GL5A 4RI7A 4TR1B 2HRKA 2RLIA 5J4UA 3QCPA 5ENUA 13GSA 5HR0A 4ACSA 3I43A 1ZYNA 2N5AA 3CMIA 3HZ8A 2PVQA 4EF0A 4KCAA 3KMNA 2LRTA 1EV9A 2JZSA 2WB9A 4YKFA 4HZ4A
chains in the Genus database with same CATH topology
5CYYA 1SYXA 4KX4A 2X8GA 2I1UA 5ID2A 1TTZA 4KNDA 4ECCA 1PKZA 1R26A 4ID0A 3VWXA 3WT2A 3GYKA 3DGQA 2L6CA 2FWEA 1ERTA 4POBA 1IYHA 1PN9A 2PU9C 3CSIA 2I9HA 4KDYA 5KN0A 5D73A 4K2DA 3IR4A 3CTGA 1VRSD 4MZBA 1F3BA 4DSRA 1FB6A 1G0TA 4IGJA 2H19A 1ERUA 2HE3A 1XW9A 1K3OA 2M72A 16GSA 4A5PA 2H8LA 1ERWA 1A2JA 4PQHA 4PQ1A 5EVOA 1QK8A 1HQOA 4BL7B 1YDKA 2HT9A 2NPBA 2AV4A 2XBIA 3UVHA 3GIXA 4KDXA 3Q18A 2HNLA 1U3IA 1JZWA 4BVXB 2E7PA 2CX3A 4XHMA 3KEBA 1LU4A 1YF0A 2YANA 3F8UA 3O76A 4WBRD 4AJ7A 2R0PA 2K8SA 3CYNA 4I8BA 3AY8A 1WE0A 3FZAA 1F9MA 5B6NA 3EMPA 3FEUA 5J9CA 2FLSA 1W89A 2MZCA 4EUYA 3IC8A 1ZCPA 3L78A 3KM6A 2HLSA 2DIYA 5AISA 5HFKA 1NSWA 3TDGA 5AGYA 3FZ5A 4TN8A 1R7HA 3MSZA 2DC5A 2H66A 4G9HA 2CZ2A 4BA7A 5G5EA 1EGOA 4F03A 3IHQA 4KGIA 2DJJA 1PKWA 5ID2B 1YEPA 3VK9A 3KXOA 2X8HA 3HYPA 4PUAA 1M0UA 3GRXA 5ELGA 3DKSA 2HXKA 3KTBA 3G7JA 2IMIA 1GL8A 5KN3A 2OACA 1HYUA 3HJOA 3ZITA 3GV1A 1GH2A 2E0QA 3WGDA 4MF7A 5A4VA 3I9V2 4PTSA 1GSDA 2K8VA 3HKRA 4O92A 1R4WA 2GVPA 3UBLA 3MAKA 3QD9A 1V58A 4IN0A 1ZYPA 4KDUA 2EIRA 2UZ8A 4K5RA 3EU4A 3ZVJA 5KN2A 1GSSA 3IBHA 2PUKC 3BJ5A 3C73A 1X5EA 4Q5QA 4FYUA 4X43A 2JL4A 3HCZA 5BRTA 2JU5A 2GDRA 1VGLA 4F2IA 4N0ZA 1B9XC 3TOTA 1AIUA 3FR3A 1SK2A 1ILOA 3GTUA 5ECKB 5IMZA 1YQ1A 1DBYA 1WPIA 5CNWA 2F8AA 2QA2A 4USSA 2VCQA 5ECSA 3VWWA 1B4PA 4L0WA 3GNJA 3PR8A 2V1MA 1YEXA 3BOAA 1V57A 5AIVA 5L71A 5KEJA 4L8EA 2L4CA 3TKQA 1M7TA 1SL2B 4KH7A 3P7XA 1DE1A 4IP6A 4POKA 1G7OA 4XTSA 4ML6A 2WZ9A 2F3MA 3BBYA 2PWJA 4HU9A 4PNGA 2A4VA 1FW1A 4YAPA 3C1RA 4WR5A 2OE3A 2P31A 2GZYA 2H70A 4POLA 1GSEA 3ED3A 2JSYA 5J9BA 2M46A 5DVBA 4IQ1A 4MP4A 5GSTA 2C3NA 3UMAA 1B4QA 3SWLA 2TRCP 1UC7A 4XRAA 1DUGA 2LS5A 4NWYA 4BWSA 4EVMA 4PURA 4MJEA 1F3AA 1O81A 3EYTA 1XOBA 2YWIA 1SU9A 5H5RA 1T1VA 2OJLA 2B1KA 4CY8A 4ZXGA 4WKWA 1JLWA 2VM1A 3APQA 2PBJA 5B8AA 1Z3EA 4JBBA 3QDNA 3TKRA 3WD6A 1ABAA 2GQLA 3DD3A 5LCZA 6GSTA 2FA4A 1Y6EA 5F05A 4NMUA 2C0DA 3A3TA 1TOFA 3LXTA 1CQGA 4O32A 3WYWA 4MJBA 3FHKA 1TK5B 1XWKA 2F9SA 2O85A 4LL1B 3J7Yk 2EIOA 1S3CA 2VL9A 4Z2TA 5GZZB 4GTUA 4N30A 2DLXA 4MF5A 1THXA 3LWAA 1JZDA 1CQHA 1T00A 2V6KA 3E3EA 5COHA 1M2DA 4EXJA 3DMLA 5ECLB 1K0NA 2TIRA 1FAAA 3KD0A 3MNGA 1ZYQB 4Q5FA 2VL2C 4TXOB 4I2UA 2YV7A 1V2AA 3VPTA 1MTCA 1QUWA 3GKMA 3PPUA 2YV9A 5AIXA 1YJ6A 1SYRA 2ES7A 4GCIA 1TU8A 2I81A 1U3AA 4V2MA 3JCML 3OR5A 3L4NA 3C1SA 5DAKB 5G1LA 4EKZA 4ILFA 5DJLA 4ZL8A 3IE3A 4KW6A 3VFIA 1MDJA 2CVKA 1AXDA 3H79A 3QFAC 3HDCA 1A0FA 4GSTA 3V1WA 3FZ4A 3MIXA 4ZL7A 1N8JA 2LV3A 4MDCA 2L5LA 2H30A 5G30A 3F6DA 3RHCA 2WFCA 1OVNA 3S9FA 3ZLPA 4TR0A 5H5QA 2JZRA 3L9SA 2X64A 4V2NA 1F6MC 1AAZA 1M2AA 2VOCA 4X4JA 1WJKA 4OFNA 5EY6A 4PQIA 2ZNMA 4WBJA 1SKSB 2IFQB 5CAXA 4OWYA 3LG6A 3QAGA 3TOUA 1URMA 2CVBA 3F4SA 5BMUA 1V98A 2IMKA 3QOUA 2H0HA 2I4AA 4Z7XA 6GSUA 5D93A 1X9MB 4TXVA 3HXSA 2IPAA 1JZRA 3F4TA 3ZMLA 4OCEA 2HSHA 1S3DA 2ALBA 2B5EA 2D2ZA 2YCDA 2B1LA 5IMVA 2PN8A 1VF4A 5B8BA 2NTOA 4MZCA 3RAZA 4XCSA 5IMFA 4QQ7A 1FG4A 5LD0A 3IAM2 4KUNA 1XBSA 2AYTA 3ZTLA 2B6MA 4GXZA 1AQXA 1GTIA 2HI7A 4K2XA 3MYDA 1XVQA 2H1DA 4EO3A 1OKTA 4Z2RA 1XZOA 4HQSA 1M99A 5A4UA 5B7CA 2H73A 1GTAA 2LKUA 2QA1A 5D9XA 1OE7A 1EP7A 3MDKA 3GKXA 1ACVA 2XPEA 1XW5A 1Z6NA 3TJGA 3D4MA 1BAYA 2WGRA 1MDIA 2N5FA 3GX8A 3TKSC 1TDIA 3DVWA 2GLRA 1QXHA 5J5NA 1QGVA 2XC2A 2IJYA 2CX4A 1Q98A 2GT6A 4YQMA 3A5WA 2FA8A 4MCUA 1T8EB 4K7NA 4NPBA 4RQXA 2B3SA 4V1Ap 5AN1A 4ZBAA 4ICYA 3A2XA 14GSA 1TK8B 3TJFA 8GSSA 4MZWA 4X0XA 2H72A 3HJPA 3ZFBA 19GSA 2IWTA 2VLUA 2YJHA 3N5OA 3GSSA 4FYCA 2EIQA 2V32A 2KP2A 4IELA 2H0IA 3GH9A 1ZL9A 2XHFA 3M1GA 2YOIA 1M9AA 5J41A 2OBKA 4NHWA 4TKYA 3E9JB 3H8QA 2REMA 4IKHA 3UOMA 2BMXA 5G5FA 2C3QA 1E2YA 3KIJA 4K0NA 4IP1A 5J3RA 3EE2A 4P3YB 4GSSA 3CBUA 4JR6A 1JZOA 1ZMAA 2HYXA 3FZ9A 10GSA 4WEYA 4DSSA 1EEMA 4TW5A 4FYBA 3ZMKA 2MMZA 5IMAA 4HU7A 1THOA 4FO5A 2KUCA 1TK0B 2WDUA 3GX0A 2LQQA 2H1BA 4ECBA 1EOHA 4IVFA 4O5QA 1XWBA 4TR4A 4ECIA 1PL2A 5D8IA 6GSXA 1O8WA 1K0DA 1OC9A 3UEMA 2H74A 3QPMA 4IJIA 1W4VA 3RBTA 5HFGA 4N11A 4OCFA 4F9ZA 2ON5A 1SL1B 4PUFC 3LQ7A 5ECNB 1QMVA 3EURA 5IOWA 7GSSA 5JCWA 4ZBDA 4F82A 2FY6A 1GLPA 3APSA 4HZ2A 4Q5RA 3UAPA 2JADA 4OO5A 2KP1A 3DXBA 4HDEA 5G31A 2C0GA 2F51A 4KA0A 1XWAA 6GSYA 2DSAA 1ML6A 3LJRA 3IOSA 3M8NA 2DJ3A 3FK8A 4I2TA 1GLQA 5D96A 4GF0A 4ML1A 2VLVA 2L5OA 2VAFA 4V2LA 1EEJA 4F0BA 1K0BA 4MK3A 2VCXA 3TCOA 4CDOA 1VF1A 2CT6A 1MD4A 3WT1A 3LORA 4HJ2A 2YZUA 5INYA 3TB2A 2GSQA 3LXZA 3Q6OA 2RM5A 1TI1A 3H4KA 1Q4JA 3ERGA 3F3RA 3PH9A 5DQSA 1BJXA 1T3BA 2R4VA 3UBKA 2DKIA 3RDWA 1TI3A 1GUHA 4DSSB 1EWXA 4OO4A 3MWHA 1M9BA 4K8MA 1YZXA 4GWRA 3W6GA 4V1Ag 4AJ8A 3P8WA 4IS0A 2EC4A 4LMVA 5KOWA 1SJIA 2LNTA 2R37A 1ZGNA 4KF9A 4TVEA 6GSSA 2C0FA 2FHEA 5E4WA 1DE2A 4D73A 3ZFLA 3KH7A 1TP9A 1SD9A 1HNAA 3LYKA 1J0FA 1ON4A 2QC7A 2CAIA 2JSZA 1NHYA 1WMJA 3IAS2 4E8HA 3HHVA 1OC9B 1O7UA 4TXOA 5CRWA 3D21A 2CV4A 2E2MA 1F2EA 2O87A 4OMVA 1EZKA 1BEDA 1WWJA 3CXGA 3TJKA 1JLVA 2DMLA 2MBSA 4JR4A 4J56E 1U88A 1J08A 1PA3A 2YNXA 5DAKA 4K0GA 2MMAA 1PL1A 3QMXA 3O6TA 1K0OA 2L6DA 3CSHA 3Q19A 3FKFA 1ERVA 4Q5NA 5ECHB 1GSUA 1K0AA 4HS1A 3VI5A 3P2AA 2XBQA 5EL8A 3IA1A 2X99A 3IPZA 2LQOA 2R0GA 4OFTA 2FGXA 1NW2A 5A4WA 3ME8A 1XWCA 2R2JA 4MH3A 1MD3A 2J9HA 5IM9A 2IFQA 2HRFA 1AQVA 1SK0A 2B5YA 4RI6A 1SKWB 2DMMA 3GL3A 3UL3A 1KTEA 3HVVA 1XWGA 4ZIJA 2R3XA 4G0KA 3TUEA 4JZQA 4K9ZA 3F9UA 1OAZA 1EOGA 5CRHA 3LW9A 4AJ6A 5IMCA 1PRXA 2KLXA 2VD1A 4WXTA 2HZEA 1SJZA 20GSA 1FB0A 5DCHA 2AJQB 3KP9A 3GKNA 1R5AA 5DJMA 3IK7A 2DIZA 1PGTA 1OC3A 4DVCA 4D73B 3IDVA 3VWUA 4IQAA 2JZTA 4G19A 1WP0A 2VUPA 4BPYA 1YKAA 2MMOA 1GSFA 4NAXA 3ME7A 2VIMA 3A2WA 2MMNA 2K6VA 17GSA 1KBNA 4ISDA 3R2QA 5G1KA 1K0CA 1GTBA 4KE3A 5CRGA 3GURA 2RUFA 5F07A 5B6MA 4XIHA 2P5QA 1PD21 1IYIA 2O89A 5HR2A 4LA1A 3IXRA 1Z9HA 1OC8A 2A4HA 5GAPD 3M0FA 4O7HA 1GSYA 1VF2A 4N10A 2WRTA 2CAQA 2H0GA 2LRNA 2YWOA 3W8JA 4BVYA 3GKKA 2YWMA 2FCHA 3EMXA 5KN1A 4J57E 4HOJA 1F37A 2XPDA 4KAEA 3ZL5A 2KOKA 2C4JA 2G2QA 2VCWA 2C0EA 5ELAA 5FHIA 1XPVA 1R5PA 4CHSA 4EIPA 4RUVA 1HNCA 22GSA 3CRUA 4I5QA 11GSA 3KH9A 3I6AA 2YZHA 1Z7PA 3D0ZA 5JCGA 1WOUA 1GUKA 2PPTA 3LEFA 3TGZA 4J2FA 1SKRB 4PX1A 1TW9A 2VLTA 3D4TA 3FY7A 1RW1A 2LJKA 1B9YC 1V40A 2GZPA 2N5BA 1PQNA 5F06A 3HA9A 4K7IA 3BD2A 1TRSA 4WR4A 1XVWA 5ECPB 3ZREA 4GLTA 2L57A 2PVOC 2V6OA 1B8XA 2HZEB 2IL3A 12GSA 4YAVA 5GAND 1UVZA 1G6YA 2J23A 5ECOB 5IMDA 5IPGA 1H75A 2NDOA 1E6BA 5KOXA 3FRCA 3EPTA 3HVXA 4O5RA 1U6TA 6GSWA 4HI7A 3VPQA 4MJAA 1WIKA 3KCMA 1NHOA 5ECRB 1SL0B 3ZIJA 5F8BA 3E0UA 5IQYA 5JWOB 1XIYA 5D9TA 2IN3A 4OD7A 4HEA2 1GWCA 1SJ6A 3GA4A 3CSJA 3EINA 3KP8A 3LFLA 1RK4A 1B48A 3RPPA 4ZB9A 1GNWA 1SD8A 1O6JA 3GH6A 2YN1A 1T4ZA 2LTKA 5HQPA 1HNBA 4BVYB 1GP1A 4YH2A 3EC3A 2PERA 5DALB 1JHBA 1LBKA 5IO2A 2GSRA 5DDLA 4AGSA 4MLYA 2H75A 2LJAA 3R3EA 1TU7A 1TKDB 5ECMB 4GRFA 1N2AA 4XS6A 2H71A 3KJYA 3UIWA 2C80A 1T7PB 2GT5A 4FH8A 1EV4A 2QKEA 3GHAA 4KSMA 3L0HA 1EP8A 4PNFA 1OE8A 3L9UA 3HY2A 3H1NA 3F0IA 2AAWA 2WCIA 3TRXA 3N9JA 1U87A 2TRXA 3CTFA 3NOFA 1K3YA 4F0CA 2ZCTA 3U6VA 1BQ7A 1MDKA 1K3LA 1KNGA 5JWQB 2H6ZA 5HR1A 4YKGA 1TRVA 1AQWA 1EGRA 4FIWA 4G0IA 1C72A 4JEDA 3M9KA 2K18A 1TJDA 5ABRA 3KZQA 1OKDA 5F0GA 2DJ2A 3C71A 4K7OA 3TRQA 4IW9A 3F4RA 2CZ3A 2E2GA 4H86A 4GSNA 2OKAA 3GN3A 3F3QA 6GSVA 1GULA 3UJ1A 2V2GA 2B7JA 4Z2UA 1YY7A 5CP1A 1A23A 2RUEA 2DKHA 4WETA 2FWFA 4YQUA 4EE0A 5CO3A 4ZILA 3A5IA 4HUAA 5JCUA 4XS4B 2I3YA 2HSMA 4NV5A 3IV4A 4OFMA 1TXXA 2HFDA 1BX9A 1FVKA 3IRAA 3RHBA 4XRDA 2LEGA 1UN2A 1FOVA 3Q74A 3VLNA 2L4QA 2H01A 1AUCA 2JACA 3PGTA 3TKPA 2IMDA 1GSQA 3G9BA 5E59A 4EDZA 1X9WB 1Z6MA 3IC4A 2NVLA 1XW6A 5ECIB 3I69A 3M9JA 3K8NA 5EPFA 4DEJA 4POMA 3NZNA 2QGVA 2VCZA 4PGTA 1BYEA 4HJMA 1BG5A 3QAWA 4WF4A 3QR6A 4IJ3A 4K5SA 3FYGA 3CRTA 3J7Yb 1X5CA 1O8XA 2OBIA 1PN0A 3QFBC 1A8YA 3PINA 1PX6A 2WULA 3SBCA 3D5JA 2OE1A 3C7MA 5H5SA 3GFKA 3US3A 2VL2A 3FR9A 9GSSA 2GS3A 5FT3A 4TRXA 3EWLA 3VWVA 4N0VA 2VCTA 3EU3A 2VD0A 1A8LA 4NV2A 2H1GA 2B7KA 2M80A 3HVSA 2FWGA 4FQUA 1SK1A 2F8FA 3EVIA 4LLRA 4MMMA 3DWVA 4YQVA 4TR3A 4NHZA 2GSTA 2G0FA 4EL1A 3GSTA 1PMTA 3FR6A 2GZZA 2HSYA 2DJ0A 4LL4B 4KB3A 2DJ1A 3D22A 4EC0A 4WF5A 4G2EA 1X5DA 2YJ7A 4E8EA 2P0GA 1A0RP 2FWHA 2FUG2 1XCCA 1HD2A 2X8CA 4LMWA 5IOXA 2HRAA 4K1FA 3M3MA 3NIVA 2C1YA 2YP6A 5DQYA 1M2BA 2V41A 4L5OA 2GTUA 2GSSA 2FD3A 4GQFA 1SENA 2B5XA 3HZ4A 3G7IA 1FVJA 2LNSA 5A5KA 3IK9A 3DRNA 3P90A 2WS2A 4PXOA 2AHEA 4AF2A 1TRUA 4G10A 4MPGA 3GUSA 2C3TA 1X0RA 3VURA 1AC1A 2VCVA 2VL3A 2MYGA 2HRNA 2A2PA 3BCIA 5FWGA 4G0LA 3ZYWA 4MF6A 2H76A 4EDYA 5C00A 1ZYEA 5IO0A 1ZZYA 2IMEA 2PGTA 1MEKA 1XFLA 4EIQA 3ZRDA 1FHEA 5D9WA 4JRRA 2VM2A 3O3TA 2AB6A 3TJJA 1DSBA 2IIYA 4ZB8A 3DIEA 1J9BA 3WGEA 1V9WA 2R5GA 4TOPA 3VI7A 3TKSA 3ERWA 2ZUPA 2GGTA 5C04A 2ON7A 5DBQA 2X49A 1X9SB 1QFNA 5LNKe 5D9VA 1ZOFA 2BTOT 4DSQA 2O8VB 1FOHA 2X4AA 1YKCA 1ST9A 3GTUB 3C8EA 3H93A 2BJXA 2H6XA 2AUVA 2O7KA 1TRWA 4ZB6A 4ZL9A 1A2LA 3APOA 5IPHA 3ZIVA 18GSA 1UA5A 4QL7A 4GQCA 3W8SA 1OYJA 3F6FA 3LGCA 1O73A 1Z7RA 4ULXA 5DALA 3ZVJD 2H6YA 3KMOA 1K0MA 4MA9A 1KEBA 4MNNA 3GMFA 1T4YA 5G2ZA 2C8UA 3DVXA 2DJKA 4TR1A 3KGKA 2CA8A 3TKSE 1I9DA 4O5UA 5CREA 2IMFA 1JFUA 4KSOA 2YPMA 3BCKA 4L0UA 2OADA 3WGXA 1GTUA 4CY6A 3A2VA 2A2SA 2CVDA 3G7YA 2LSTA 1S3AA 1A24A 3FW2A 2RIIA 2WJUA 1RQMA 3U5RE 2LUSA 3IHGA 1WRYA 3DEXA 1I5GA 1O85A 4I6XA 2FNOA 4I97A 5GSSA 1QQ2A 2GQMA 4IBPA 4HQZA 4MJCA 3FMWA 1NM3A 1YF1A 1LJRA 2KHPA 1A2MA 2VO4A 3TRPA 3TJBA 1FO5A 2CQ9A 3LSZA 2OE0A 3L9VA 2R0CA 2NBSA 1PX7A 4L5LA 1G7EA 1H4OA 1XOAA 1PSQA 2PMTA 1USBA 1GUMA 5DCGA 3KTLA 3LYPA 4QL9A 2RM6A 4BWQA 4ECJA 2K9FA 3HJMA 4NXIA 2L59A 1VF3A 5ECQB 3DYRA 4BL7A 1AW9A 4MPFA 2GQKA 3ERFA 1G6WA 5HR3A 2R6KA 2OA7A 1XXUA 4IHUA 1Y25A 4MH2A 4RQRA 5CRDA 4BVXA 2QSIA 2YWNA 4JE1A 5IIZA 1Z5YE 4KCEA 3QAVA 2P5RA 3RPNA 2DBCA 3HD5A 4XS4A 5HFIA 4MABA 1GNEA 2LJRA 2MBTA 4K6XA 5JWRB 3D6IA 2Z9SA 3F63A 1GRXA 4JU5A 4X1UA 3ISOA 4ZBBA 3UARA 2LRCA 2H1AA 3UVTA 4XS1A 2HZFA 3ZZXA 2A2RA 4CW9A 3GL5A 4RI7A 4TR1B 2HRKA 2RLIA 5J4UA 3QCPA 5ENUA 13GSA 5HR0A 4ACSA 3I43A 1ZYNA 2N5AA 3CMIA 3HZ8A 2PVQA 4EF0A 4KCAA 3KMNA 2LRTA 1EV9A 2JZSA 2WB9A 4YKFA 4HZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CYY A;  1SYX A;  4KX4 A;  2X8G A;  2I1U A;  5ID2 A;  1TTZ A;  4KND A;  4ECC A;  1PKZ A;  1R26 A;  4ID0 A;  3VWX A;  3WT2 A;  3GYK A;  3DGQ A;  2L6C A;  2FWE A;  1ERT A;  4POB A;  1IYH A;  1PN9 A;  2PU9 C;  3CSI A;  2I9H A;  4KDY A;  5KN0 A;  5D73 A;  4K2D A;  3IR4 A;  3CTG A;  1VRS D;  4MZB A;  1F3B A;  4DSR A;  1FB6 A;  1G0T A;  4IGJ A;  2H19 A;  1ERU A;  2HE3 A;  1XW9 A;  1K3O A;  2M72 A;  16GS A;  2H8L A;  1ERW A;  1A2J A;  4PQH A;  4PQ1 A;  5EVO A;  1QK8 A;  1HQO A;  1YDK A;  2HT9 A;  2NPB A;  2AV4 A;  2XBI A;  3UVH A;  3GIX A;  4KDX A;  3Q18 A;  2HNL A;  1U3I A;  1JZW A;  2E7P A;  2CX3 A;  4XHM A;  3KEB A;  1LU4 A;  1YF0 A;  2YAN A;  3F8U A;  3O76 A;  4WBR D;  4AJ7 A;  2K8S A;  3CYN A;  4I8B A;  3AY8 A;  1WE0 A;  3FZA A;  1F9M A;  5B6N A;  3EMP A;  3FEU A;  5J9C A;  2FLS A;  1W89 A;  2MZC A;  4EUY A;  1ZCP A;  3L78 A;  3KM6 A;  2HLS A;  2DIY A;  5AIS A;  5HFK A;  1NSW A;  3TDG A;  5AGY A;  3FZ5 A;  4TN8 A;  1R7H A;  3MSZ A;  2DC5 A;  2H66 A;  4G9H A;  2CZ2 A;  4BA7 A;  5G5E A;  1EGO A;  4F03 A;  3IHQ A;  4KGI A;  2DJJ A;  1PKW A;  5ID2 B;  1YEP A;  3VK9 A;  3KXO A;  2X8H A;  3HYP A;  4PUA A;  1M0U A;  3GRX A;  5ELG A;  3DKS A;  2HXK A;  3KTB A;  3G7J A;  2IMI A;  1GL8 A;  5KN3 A;  2OAC A;  1HYU A;  3HJO A;  3ZIT A;  3GV1 A;  1GH2 A;  2E0Q A;  3WGD A;  4MF7 A;  5A4V A;  3I9V 2;  1GSD A;  2K8V A;  3HKR A;  4O92 A;  1R4W A;  2GVP A;  3UBL A;  3MAK A;  3QD9 A;  1V58 A;  4IN0 A;  4KDU A;  2EIR A;  3EU4 A;  3ZVJ A;  5KN2 A;  1GSS A;  3IBH A;  2PUK C;  3BJ5 A;  3C73 A;  1X5E A;  4Q5Q A;  4FYU A;  4X43 A;  2JL4 A;  3HCZ A;  2JU5 A;  2GDR A;  1VGL A;  4F2I A;  4N0Z A;  1B9X C;  3TOT A;  1AIU A;  3FR3 A;  1SK2 A;  1ILO A;  3GTU A;  5ECK B;  5IMZ A;  1YQ1 A;  1DBY A;  1WPI A;  5CNW A;  2F8A A;  2VCQ A;  5ECS A;  3VWW A;  1B4P A;  4L0W A;  3GNJ A;  3PR8 A;  2V1M A;  1YEX A;  3BOA A;  1V57 A;  5AIV A;  5L71 A;  5KEJ A;  4L8E A;  2L4C A;  3TKQ A;  1M7T A;  1SL2 B;  4KH7 A;  3P7X A;  1DE1 A;  4IP6 A;  4POK A;  1G7O A;  4XTS A;  4ML6 A;  2WZ9 A;  2F3M A;  3BBY A;  2PWJ A;  4HU9 A;  4PNG A;  2A4V A;  1FW1 A;  4YAP A;  3C1R A;  4WR5 A;  2OE3 A;  2P31 A;  2GZY A;  2H70 A;  4POL A;  1GSE A;  3ED3 A;  2JSY A;  5J9B A;  2M46 A;  5DVB A;  4IQ1 A;  4MP4 A;  5GST A;  2C3N A;  3UMA A;  1B4Q A;  3SWL A;  2TRC P;  1UC7 A;  4XRA A;  1DUG A;  2LS5 A;  4NWY A;  4BWS A;  4EVM A;  4PUR A;  4MJE A;  1F3A A;  1O81 A;  3EYT A;  1XOB A;  2YWI A;  1SU9 A;  5H5R A;  1T1V A;  2OJL A;  2B1K A;  4ZXG A;  4WKW A;  1JLW A;  2VM1 A;  3APQ A;  2PBJ A;  5B8A A;  1Z3E A;  4JBB A;  3QDN A;  3TKR A;  3WD6 A;  1ABA A;  2GQL A;  3DD3 A;  5LCZ A;  6GST A;  2FA4 A;  1Y6E A;  5F05 A;  4NMU A;  2C0D A;  3A3T A;  1TOF A;  3LXT A;  1CQG A;  4O32 A;  3WYW A;  4MJB A;  3FHK A;  1TK5 B;  1XWK A;  2F9S A;  2O85 A;  4LL1 B;  3J7Y k;  2EIO A;  1S3C A;  2VL9 A;  5GZZ B;  4GTU A;  4N30 A;  2DLX A;  4MF5 A;  1THX A;  3LWA A;  1JZD A;  1CQH A;  1T00 A;  2V6K A;  3E3E A;  5COH A;  1M2D A;  4EXJ A;  3DML A;  5ECL B;  1K0N A;  2TIR A;  1FAA A;  3KD0 A;  3MNG A;  1ZYQ B;  4Q5F A;  2VL2 C;  4TXO B;  4I2U A;  2YV7 A;  1V2A A;  3VPT A;  1MTC A;  1QUW A;  3GKM A;  2YV9 A;  5AIX A;  1YJ6 A;  1SYR A;  2ES7 A;  4GCI A;  1TU8 A;  2I81 A;  1U3A A;  4V2M A;  3JCM L;  3OR5 A;  3L4N A;  3C1S A;  5DAK B;  5G1L A;  4EKZ A;  4ILF A;  5DJL A;  4ZL8 A;  3IE3 A;  4KW6 A;  3VFI A;  1MDJ A;  2CVK A;  1AXD A;  3H79 A;  3QFA C;  3HDC A;  1A0F A;  4GST A;  3V1W A;  3FZ4 A;  4ZL7 A;  1N8J A;  2LV3 A;  4MDC A;  2L5L A;  2H30 A;  5G30 A;  3F6D A;  3RHC A;  2WFC A;  1OVN A;  3S9F A;  3ZLP A;  4TR0 A;  5H5Q A;  2JZR A;  3L9S A;  2X64 A;  4V2N A;  1F6M C;  1AAZ A;  1M2A A;  2VOC A;  1WJK A;  4OFN A;  5EY6 A;  4PQI A;  2ZNM A;  4WBJ A;  1SKS B;  2IFQ B;  5CAX A;  4OWY A;  3LG6 A;  3QAG A;  3TOU A;  1URM A;  2CVB A;  3F4S A;  1V98 A;  2IMK A;  3QOU A;  2H0H A;  2I4A A;  4Z7X A;  6GSU A;  5D93 A;  1X9M B;  4TXV A;  3HXS A;  2IPA A;  1JZR A;  3F4T A;  3ZML A;  4OCE A;  2HSH A;  1S3D A;  2ALB A;  2B5E A;  2D2Z A;  2YCD A;  2B1L A;  5IMV A;  2PN8 A;  1VF4 A;  5B8B A;  2NTO A;  4MZC A;  3RAZ A;  4XCS A;  5IMF A;  4QQ7 A;  1FG4 A;  5LD0 A;  3IAM 2;  4KUN A;  1XBS A;  2AYT A;  3ZTL A;  2B6M A;  4GXZ A;  1AQX A;  1GTI A;  2HI7 A;  1XVQ A;  2H1D A;  4EO3 A;  1OKT A;  1XZO A;  4HQS A;  1M99 A;  5A4U A;  5B7C A;  2H73 A;  1GTA A;  2LKU A;  5D9X A;  1OE7 A;  1EP7 A;  3MDK A;  3GKX A;  1ACV A;  2XPE A;  1XW5 A;  1Z6N A;  3TJG A;  3D4M A;  1BAY A;  2WGR A;  1MDI A;  2N5F A;  3GX8 A;  3TKS C;  1TDI A;  3DVW A;  2GLR A;  1QXH A;  5J5N A;  1QGV A;  2XC2 A;  2IJY A;  2CX4 A;  1Q98 A;  2GT6 A;  4YQM A;  3A5W A;  2FA8 A;  4MCU A;  1T8E B;  4K7N A;  4NPB A;  4RQX A;  2B3S A;  4V1A p;  5AN1 A;  4ZBA A;  3A2X A;  14GS A;  1TK8 B;  3TJF A;  8GSS A;  4MZW A;  4X0X A;  2H72 A;  3HJP A;  3ZFB A;  19GS A;  2IWT A;  2VLU A;  2YJH A;  3N5O A;  3GSS A;  4FYC A;  2EIQ A;  2V32 A;  2KP2 A;  4IEL A;  2H0I A;  3GH9 A;  1ZL9 A;  2XHF A;  3M1G A;  2YOI A;  1M9A A;  5J41 A;  2OBK A;  4NHW A;  4TKY A;  3E9J B;  3H8Q A;  2REM A;  4IKH A;  3UOM A;  2BMX A;  5G5F A;  2C3Q A;  1E2Y A;  3KIJ A;  4K0N A;  4IP1 A;  5J3R A;  3EE2 A;  4P3Y B;  4GSS A;  3CBU A;  4JR6 A;  1JZO A;  1ZMA A;  2HYX A;  3FZ9 A;  10GS A;  4WEY A;  4DSS A;  1EEM A;  4TW5 A;  4FYB A;  3ZMK A;  2MMZ A;  5IMA A;  4HU7 A;  1THO A;  4FO5 A;  2KUC A;  1TK0 B;  2WDU A;  3GX0 A;  2LQQ A;  2H1B A;  4ECB A;  1EOH A;  4IVF A;  1XWB A;  4TR4 A;  4ECI A;  1PL2 A;  5D8I A;  6GSX A;  1O8W A;  1K0D A;  1OC9 A;  3UEM A;  2H74 A;  3QPM A;  4IJI A;  1W4V A;  3RBT A;  5HFG A;  4N11 A;  4OCF A;  4F9Z A;  2ON5 A;  1SL1 B;  4PUF C;  3LQ7 A;  5ECN B;  1QMV A;  3EUR A;  5IOW A;  7GSS A;  5JCW A;  4ZBD A;  4F82 A;  2FY6 A;  1GLP A;  3APS A;  4HZ2 A;  4Q5R A;  3UAP A;  2JAD A;  4OO5 A;  2KP1 A;  3DXB A;  4HDE A;  5G31 A;  2C0G A;  2F51 A;  4KA0 A;  1XWA A;  6GSY A;  2DSA A;  1ML6 A;  3LJR A;  3IOS A;  3M8N A;  2DJ3 A;  3FK8 A;  4I2T A;  1GLQ A;  5D96 A;  4GF0 A;  4ML1 A;  2VLV A;  2L5O A;  2VAF A;  4V2L A;  1EEJ A;  4F0B A;  1K0B A;  4MK3 A;  2VCX A;  3TCO A;  4CDO A;  1VF1 A;  2CT6 A;  1MD4 A;  3WT1 A;  3LOR A;  4HJ2 A;  2YZU A;  5INY A;  3TB2 A;  2GSQ A;  3LXZ A;  3Q6O A;  2RM5 A;  1TI1 A;  3H4K A;  1Q4J A;  3ERG A;  3F3R A;  3PH9 A;  5DQS A;  1BJX A;  1T3B A;  2R4V A;  3UBK A;  3RDW A;  1TI3 A;  1GUH A;  4DSS B;  1EWX A;  4OO4 A;  3MWH A;  1M9B A;  4K8M A;  1YZX A;  4GWR A;  3W6G A;  4V1A g;  4AJ8 A;  3P8W A;  4IS0 A;  2EC4 A;  4LMV A;  1SJI A;  2LNT A;  2R37 A;  1ZGN A;  4TVE A;  6GSS A;  2C0F A;  2FHE A;  5E4W A;  1DE2 A;  4D73 A;  3ZFL A;  3KH7 A;  1TP9 A;  1SD9 A;  1HNA A;  3LYK A;  1J0F A;  1ON4 A;  2QC7 A;  2CAI A;  2JSZ A;  1NHY A;  1WMJ A;  3IAS 2;  4E8H A;  3HHV A;  1OC9 B;  1O7U A;  4TXO A;  5CRW A;  3D21 A;  2CV4 A;  2E2M A;  1F2E A;  2O87 A;  4OMV A;  1EZK A;  1BED A;  1WWJ A;  3CXG A;  3TJK A;  1JLV A;  2DML A;  2MBS A;  4JR4 A;  4J56 E;  1U88 A;  1J08 A;  1PA3 A;  2YNX A;  5DAK A;  4K0G A;  2MMA A;  1PL1 A;  3QMX A;  3O6T A;  1K0O A;  2L6D A;  3CSH A;  3Q19 A;  3FKF A;  1ERV A;  4Q5N A;  5ECH B;  1GSU A;  1K0A A;  4HS1 A;  3VI5 A;  3P2A A;  2XBQ A;  5EL8 A;  3IA1 A;  2X99 A;  3IPZ A;  2LQO A;  4OFT A;  2FGX A;  1NW2 A;  5A4W A;  3ME8 A;  1XWC A;  2R2J A;  4MH3 A;  1MD3 A;  2J9H A;  5IM9 A;  2IFQ A;  2HRF A;  1AQV A;  1SK0 A;  2B5Y A;  4RI6 A;  1SKW B;  2DMM A;  3GL3 A;  3UL3 A;  1KTE A;  3HVV A;  1XWG A;  4ZIJ A;  2R3X A;  3TUE A;  4JZQ A;  4K9Z A;  3F9U A;  1OAZ A;  1EOG A;  5CRH A;  4AJ6 A;  5IMC A;  1PRX A;  2KLX A;  2VD1 A;  4WXT A;  2HZE A;  1SJZ A;  20GS A;  1FB0 A;  5DCH A;  2AJQ B;  3KP9 A;  3GKN A;  1R5A A;  5DJM A;  3IK7 A;  2DIZ A;  1PGT A;  1OC3 A;  4DVC A;  4D73 B;  3IDV A;  3VWU A;  4IQA A;  2JZT A;  4G19 A;  1WP0 A;  2VUP A;  4BPY A;  1YKA A;  2MMO A;  1GSF A;  4NAX A;  3ME7 A;  2VIM A;  3A2W A;  2MMN A;  2K6V A;  17GS A;  1KBN A;  4ISD A;  3R2Q A;  5G1K A;  1K0C A;  1GTB A;  4KE3 A;  5CRG A;  3GUR A;  2RUF A;  5F07 A;  5B6M A;  4XIH A;  2P5Q A;  1PD2 1;  1IYI A;  2O89 A;  5HR2 A;  4LA1 A;  3IXR A;  1Z9H A;  1OC8 A;  5GAP D;  3M0F A;  4O7H A;  1GSY A;  1VF2 A;  4N10 A;  2WRT A;  2CAQ A;  2H0G A;  2LRN A;  2YWO A;  3W8J A;  4BVY A;  3GKK A;  2YWM A;  2FCH A;  3EMX A;  5KN1 A;  4J57 E;  4HOJ A;  1F37 A;  2XPD A;  4KAE A;  3ZL5 A;  2KOK A;  2C4J A;  2G2Q A;  2VCW A;  2C0E A;  5ELA A;  5FHI A;  1XPV A;  1R5P A;  4CHS A;  4RUV A;  1HNC A;  22GS A;  3CRU A;  4I5Q A;  11GS A;  3KH9 A;  3I6A A;  2YZH A;  1Z7P A;  3D0Z A;  5JCG A;  1WOU A;  1GUK A;  2PPT A;  3LEF A;  3TGZ A;  4J2F A;  1SKR B;  4PX1 A;  1TW9 A;  2VLT A;  3D4T A;  3FY7 A;  1RW1 A;  2LJK A;  1B9Y C;  1V40 A;  2GZP A;  2N5B A;  1PQN A;  5F06 A;  3HA9 A;  4K7I A;  3BD2 A;  1TRS A;  4WR4 A;  1XVW A;  5ECP B;  3ZRE A;  4GLT A;  2L57 A;  2PVO C;  2V6O A;  1B8X A;  2HZE B;  2IL3 A;  12GS A;  4YAV A;  5GAN D;  1UVZ A;  1G6Y A;  2J23 A;  5ECO B;  5IMD A;  5IPG A;  1H75 A;  2NDO A;  1E6B A;  3FRC A;  3HVX A;  4O5R A;  1U6T A;  6GSW A;  4HI7 A;  3VPQ A;  4MJA A;  1WIK A;  3KCM A;  1NHO A;  5ECR B;  1SL0 B;  3ZIJ A;  5F8B A;  3E0U A;  5IQY A;  5JWO B;  1XIY A;  5D9T A;  2IN3 A;  4OD7 A;  4HEA 2;  1GWC A;  1SJ6 A;  3GA4 A;  3CSJ A;  3EIN A;  3KP8 A;  3LFL A;  1RK4 A;  1B48 A;  3RPP A;  4ZB9 A;  1GNW A;  1SD8 A;  1O6J A;  3GH6 A;  2YN1 A;  1T4Z A;  2LTK A;  5HQP A;  1HNB A;  1GP1 A;  4YH2 A;  3EC3 A;  2PER A;  5DAL B;  1JHB A;  1LBK A;  5IO2 A;  2GSR A;  5DDL A;  4AGS A;  4MLY A;  2H75 A;  2LJA A;  1TU7 A;  1TKD B;  5ECM B;  4GRF A;  1N2A A;  4XS6 A;  2H71 A;  3KJY A;  3UIW A;  2C80 A;  1T7P B;  2GT5 A;  4FH8 A;  1EV4 A;  2QKE A;  3GHA A;  4KSM A;  3L0H A;  1EP8 A;  4PNF A;  1OE8 A;  3L9U A;  3HY2 A;  3H1N A;  3F0I A;  2AAW A;  2WCI A;  3TRX A;  3N9J A;  1U87 A;  2TRX A;  3CTF A;  3NOF A;  1K3Y A;  4F0C A;  2ZCT A;  3U6V A;  1BQ7 A;  1MDK A;  1K3L A;  1KNG A;  5JWQ B;  2H6Z A;  5HR1 A;  1TRV A;  1AQW A;  1EGR A;  4FIW A;  1C72 A;  4JED A;  3M9K A;  2K18 A;  1TJD A;  5ABR A;  3KZQ A;  1OKD A;  5F0G A;  2DJ2 A;  3C71 A;  4K7O A;  3TRQ A;  4IW9 A;  3F4R A;  2CZ3 A;  2E2G A;  4H86 A;  4GSN A;  2OKA A;  3GN3 A;  3F3Q A;  6GSV A;  1GUL A;  3UJ1 A;  2V2G A;  2B7J A;  1YY7 A;  5CP1 A;  1A23 A;  2RUE A;  4WET A;  2FWF A;  4YQU A;  4EE0 A;  5CO3 A;  4ZIL A;  4HUA A;  5JCU A;  4XS4 B;  2I3Y A;  4NV5 A;  3IV4 A;  4OFM A;  1TXX A;  2HFD A;  1BX9 A;  1FVK A;  3IRA A;  3RHB A;  4XRD A;  2LEG A;  1UN2 A;  1FOV A;  3Q74 A;  3VLN A;  2L4Q A;  2H01 A;  1AUC A;  2JAC A;  3PGT A;  3TKP A;  2IMD A;  1GSQ A;  3G9B A;  5E59 A;  4EDZ A;  1X9W B;  1Z6M A;  3IC4 A;  2NVL A;  1XW6 A;  5ECI B;  3I69 A;  3M9J A;  3K8N A;  5EPF A;  4DEJ A;  4POM A;  3NZN A;  2QGV A;  2VCZ A;  4PGT A;  1BYE A;  4HJM A;  1BG5 A;  3QAW A;  4WF4 A;  3QR6 A;  4IJ3 A;  3FYG A;  3CRT A;  3J7Y b;  1X5C A;  1O8X A;  2OBI A;  3QFB C;  1A8Y A;  3PIN A;  1PX6 A;  2WUL A;  3SBC A;  3D5J A;  2OE1 A;  3C7M A;  5H5S A;  3GFK A;  3US3 A;  2VL2 A;  3FR9 A;  9GSS A;  2GS3 A;  5FT3 A;  4TRX A;  3EWL A;  3VWV A;  4N0V A;  2VCT A;  3EU3 A;  2VD0 A;  1A8L A;  4NV2 A;  2H1G A;  2B7K A;  2M80 A;  3HVS A;  2FWG A;  1SK1 A;  2F8F A;  3EVI A;  4LLR A;  4MMM A;  3DWV A;  4YQV A;  4TR3 A;  4NHZ A;  2GST A;  2G0F A;  4EL1 A;  3GST A;  1PMT A;  3FR6 A;  2GZZ A;  2HSY A;  2DJ0 A;  4LL4 B;  4KB3 A;  2DJ1 A;  3D22 A;  4EC0 A;  4WF5 A;  4G2E A;  1X5D A;  2YJ7 A;  4E8E A;  2P0G A;  1A0R P;  2FWH A;  2FUG 2;  1XCC A;  1HD2 A;  2X8C A;  4LMW A;  5IOX A;  4K1F A;  3M3M A;  3NIV A;  2C1Y A;  2YP6 A;  5DQY A;  1M2B A;  2V41 A;  4L5O A;  2GTU A;  2GSS A;  2FD3 A;  4GQF A;  1SEN A;  2B5X A;  3HZ4 A;  3G7I A;  1FVJ A;  2LNS A;  5A5K A;  3IK9 A;  3DRN A;  3P90 A;  2WS2 A;  4PXO A;  2AHE A;  4AF2 A;  1TRU A;  4G10 A;  4MPG A;  3GUS A;  2C3T A;  1X0R A;  3VUR A;  1AC1 A;  2VCV A;  2VL3 A;  2MYG A;  2HRN A;  3BCI A;  5FWG A;  3ZYW A;  4EDY A;  4MF6 A;  2H76 A;  5C00 A;  1ZYE A;  5IO0 A;  1ZZY A;  2IME A;  2PGT A;  1MEK A;  1XFL A;  3ZRD A;  1FHE A;  5D9W A;  4JRR A;  2VM2 A;  3O3T A;  2AB6 A;  3TJJ A;  1DSB A;  2IIY A;  4ZB8 A;  3DIE A;  1J9B A;  3WGE A;  1V9W A;  2R5G A;  4TOP A;  3VI7 A;  3TKS A;  3ERW A;  2ZUP A;  2GGT A;  5C04 A;  2ON7 A;  5DBQ A;  1X9S B;  1QFN A;  5LNK e;  5D9V A;  1ZOF A;  2BTO T;  4DSQ A;  2O8V B;  1YKC A;  1ST9 A;  3GTU B;  3C8E A;  3H93 A;  2BJX A;  2H6X A;  2AUV A;  2O7K A;  1TRW A;  4ZB6 A;  4ZL9 A;  1A2L A;  3APO A;  5IPH A;  3ZIV A;  18GS A;  1UA5 A;  4QL7 A;  4GQC A;  3W8S A;  1OYJ A;  3F6F A;  3LGC A;  1O73 A;  1Z7R A;  4ULX A;  5DAL A;  3ZVJ D;  2H6Y A;  3KMO A;  1K0M A;  4MA9 A;  1KEB A;  3GMF A;  1T4Y A;  5G2Z A;  2C8U A;  3DVX A;  2DJK A;  4TR1 A;  3KGK A;  2CA8 A;  3TKS E;  1I9D A;  5CRE A;  2IMF A;  1JFU A;  4KSO A;  2YPM A;  3BCK A;  4L0U A;  2OAD A;  3WGX A;  1GTU A;  3A2V A;  2A2S A;  2CVD A;  3G7Y A;  2LST A;  1S3A A;  1A24 A;  3FW2 A;  2RII A;  2WJU A;  1RQM A;  3U5R E;  2LUS A;  1WRY A;  3DEX A;  1I5G A;  1O85 A;  4I6X A;  2FNO A;  4I97 A;  5GSS A;  1QQ2 A;  2GQM A;  4IBP A;  4HQZ A;  4MJC A;  1NM3 A;  1YF1 A;  1LJR A;  2KHP A;  1A2M A;  2VO4 A;  3TRP A;  3TJB A;  1FO5 A;  2CQ9 A;  3LSZ A;  2OE0 A;  3L9V A;  2NBS A;  1PX7 A;  4L5L A;  1G7E A;  1H4O A;  1XOA A;  1PSQ A;  2PMT A;  1USB A;  1GUM A;  5DCG A;  3KTL A;  3LYP A;  4QL9 A;  2RM6 A;  4BWQ A;  4ECJ A;  2K9F A;  3HJM A;  4NXI A;  2L59 A;  1VF3 A;  5ECQ B;  3DYR A;  4BL7 A;  1AW9 A;  4MPF A;  2GQK A;  3ERF A;  1G6W A;  5HR3 A;  2R6K A;  2OA7 A;  1XXU A;  4IHU A;  1Y25 A;  4MH2 A;  4RQR A;  5CRD A;  4BVX A;  2QSI A;  2YWN A;  4JE1 A;  5IIZ A;  1Z5Y E;  4KCE A;  3QAV A;  2P5R A;  3RPN A;  2DBC A;  3HD5 A;  4XS4 A;  5HFI A;  4MAB A;  1GNE A;  2LJR A;  2MBT A;  4K6X A;  5JWR B;  3D6I A;  2Z9S A;  3F63 A;  1GRX A;  4JU5 A;  4X1U A;  3ISO A;  4ZBB A;  3UAR A;  2LRC A;  2H1A A;  3UVT A;  4XS1 A;  2HZF A;  3ZZX A;  2A2R A;  4CW9 A;  3GL5 A;  4RI7 A;  4TR1 B;  2RLI A;  5J4U A;  3QCP A;  5ENU A;  13GS A;  5HR0 A;  4ACS A;  3I43 A;  2N5A A;  3CMI A;  3HZ8 A;  2PVQ A;  4EF0 A;  4KCA A;  3KMN A;  2LRT A;  1EV9 A;  2JZS A;  2WB9 A;  4HZ4 A; 
#chains in the Genus database with same CATH topology
 5CYY A;  1SYX A;  4KX4 A;  2X8G A;  2I1U A;  5ID2 A;  1TTZ A;  4KND A;  4ECC A;  1PKZ A;  1R26 A;  4ID0 A;  3VWX A;  3WT2 A;  3GYK A;  3DGQ A;  2L6C A;  2FWE A;  1ERT A;  4POB A;  1IYH A;  1PN9 A;  2PU9 C;  3CSI A;  2I9H A;  4KDY A;  5KN0 A;  5D73 A;  4K2D A;  3IR4 A;  3CTG A;  1VRS D;  4MZB A;  1F3B A;  4DSR A;  1FB6 A;  1G0T A;  4IGJ A;  2H19 A;  1ERU A;  2HE3 A;  1XW9 A;  1K3O A;  2M72 A;  16GS A;  4A5P A;  2H8L A;  1ERW A;  1A2J A;  4PQH A;  4PQ1 A;  5EVO A;  1QK8 A;  1HQO A;  4BL7 B;  1YDK A;  2HT9 A;  2NPB A;  2AV4 A;  2XBI A;  3UVH A;  3GIX A;  4KDX A;  3Q18 A;  2HNL A;  1U3I A;  1JZW A;  4BVX B;  2E7P A;  2CX3 A;  4XHM A;  3KEB A;  1LU4 A;  1YF0 A;  2YAN A;  3F8U A;  3O76 A;  4WBR D;  4AJ7 A;  2R0P A;  2K8S A;  3CYN A;  4I8B A;  3AY8 A;  1WE0 A;  3FZA A;  1F9M A;  5B6N A;  3EMP A;  3FEU A;  5J9C A;  2FLS A;  1W89 A;  2MZC A;  4EUY A;  3IC8 A;  1ZCP A;  3L78 A;  3KM6 A;  2HLS A;  2DIY A;  5AIS A;  5HFK A;  1NSW A;  3TDG A;  5AGY A;  3FZ5 A;  4TN8 A;  1R7H A;  3MSZ A;  2DC5 A;  2H66 A;  4G9H A;  2CZ2 A;  4BA7 A;  5G5E A;  1EGO A;  4F03 A;  3IHQ A;  4KGI A;  2DJJ A;  1PKW A;  5ID2 B;  1YEP A;  3VK9 A;  3KXO A;  2X8H A;  3HYP A;  4PUA A;  1M0U A;  3GRX A;  5ELG A;  3DKS A;  2HXK A;  3KTB A;  3G7J A;  2IMI A;  1GL8 A;  5KN3 A;  2OAC A;  1HYU A;  3HJO A;  3ZIT A;  3GV1 A;  1GH2 A;  2E0Q A;  3WGD A;  4MF7 A;  5A4V A;  3I9V 2;  4PTS A;  1GSD A;  2K8V A;  3HKR A;  4O92 A;  1R4W A;  2GVP A;  3UBL A;  3MAK A;  3QD9 A;  1V58 A;  4IN0 A;  1ZYP A;  4KDU A;  2EIR A;  2UZ8 A;  4K5R A;  3EU4 A;  3ZVJ A;  5KN2 A;  1GSS A;  3IBH A;  2PUK C;  3BJ5 A;  3C73 A;  1X5E A;  4Q5Q A;  4FYU A;  4X43 A;  2JL4 A;  3HCZ A;  5BRT A;  2JU5 A;  2GDR A;  1VGL A;  4F2I A;  4N0Z A;  1B9X C;  3TOT A;  1AIU A;  3FR3 A;  1SK2 A;  1ILO A;  3GTU A;  5ECK B;  5IMZ A;  1YQ1 A;  1DBY A;  1WPI A;  5CNW A;  2F8A A;  2QA2 A;  4USS A;  2VCQ A;  5ECS A;  3VWW A;  1B4P A;  4L0W A;  3GNJ A;  3PR8 A;  2V1M A;  1YEX A;  3BOA A;  1V57 A;  5AIV A;  5L71 A;  5KEJ A;  4L8E A;  2L4C A;  3TKQ A;  1M7T A;  1SL2 B;  4KH7 A;  3P7X A;  1DE1 A;  4IP6 A;  4POK A;  1G7O A;  4XTS A;  4ML6 A;  2WZ9 A;  2F3M A;  3BBY A;  2PWJ A;  4HU9 A;  4PNG A;  2A4V A;  1FW1 A;  4YAP A;  3C1R A;  4WR5 A;  2OE3 A;  2P31 A;  2GZY A;  2H70 A;  4POL A;  1GSE A;  3ED3 A;  2JSY A;  5J9B A;  2M46 A;  5DVB A;  4IQ1 A;  4MP4 A;  5GST A;  2C3N A;  3UMA A;  1B4Q A;  3SWL A;  2TRC P;  1UC7 A;  4XRA A;  1DUG A;  2LS5 A;  4NWY A;  4BWS A;  4EVM A;  4PUR A;  4MJE A;  1F3A A;  1O81 A;  3EYT A;  1XOB A;  2YWI A;  1SU9 A;  5H5R A;  1T1V A;  2OJL A;  2B1K A;  4CY8 A;  4ZXG A;  4WKW A;  1JLW A;  2VM1 A;  3APQ A;  2PBJ A;  5B8A A;  1Z3E A;  4JBB A;  3QDN A;  3TKR A;  3WD6 A;  1ABA A;  2GQL A;  3DD3 A;  5LCZ A;  6GST A;  2FA4 A;  1Y6E A;  5F05 A;  4NMU A;  2C0D A;  3A3T A;  1TOF A;  3LXT A;  1CQG A;  4O32 A;  3WYW A;  4MJB A;  3FHK A;  1TK5 B;  1XWK A;  2F9S A;  2O85 A;  4LL1 B;  3J7Y k;  2EIO A;  1S3C A;  2VL9 A;  4Z2T A;  5GZZ B;  4GTU A;  4N30 A;  2DLX A;  4MF5 A;  1THX A;  3LWA A;  1JZD A;  1CQH A;  1T00 A;  2V6K A;  3E3E A;  5COH A;  1M2D A;  4EXJ A;  3DML A;  5ECL B;  1K0N A;  2TIR A;  1FAA A;  3KD0 A;  3MNG A;  1ZYQ B;  4Q5F A;  2VL2 C;  4TXO B;  4I2U A;  2YV7 A;  1V2A A;  3VPT A;  1MTC A;  1QUW A;  3GKM A;  3PPU A;  2YV9 A;  5AIX A;  1YJ6 A;  1SYR A;  2ES7 A;  4GCI A;  1TU8 A;  2I81 A;  1U3A A;  4V2M A;  3JCM L;  3OR5 A;  3L4N A;  3C1S A;  5DAK B;  5G1L A;  4EKZ A;  4ILF A;  5DJL A;  4ZL8 A;  3IE3 A;  4KW6 A;  3VFI A;  1MDJ A;  2CVK A;  1AXD A;  3H79 A;  3QFA C;  3HDC A;  1A0F A;  4GST A;  3V1W A;  3FZ4 A;  3MIX A;  4ZL7 A;  1N8J A;  2LV3 A;  4MDC A;  2L5L A;  2H30 A;  5G30 A;  3F6D A;  3RHC A;  2WFC A;  1OVN A;  3S9F A;  3ZLP A;  4TR0 A;  5H5Q A;  2JZR A;  3L9S A;  2X64 A;  4V2N A;  1F6M C;  1AAZ A;  1M2A A;  2VOC A;  4X4J A;  1WJK A;  4OFN A;  5EY6 A;  4PQI A;  2ZNM A;  4WBJ A;  1SKS B;  2IFQ B;  5CAX A;  4OWY A;  3LG6 A;  3QAG A;  3TOU A;  1URM A;  2CVB A;  3F4S A;  5BMU A;  1V98 A;  2IMK A;  3QOU A;  2H0H A;  2I4A A;  4Z7X A;  6GSU A;  5D93 A;  1X9M B;  4TXV A;  3HXS A;  2IPA A;  1JZR A;  3F4T A;  3ZML A;  4OCE A;  2HSH A;  1S3D A;  2ALB A;  2B5E A;  2D2Z A;  2YCD A;  2B1L A;  5IMV A;  2PN8 A;  1VF4 A;  5B8B A;  2NTO A;  4MZC A;  3RAZ A;  4XCS A;  1PFO A;  5IMF A;  4QQ7 A;  1FG4 A;  5LD0 A;  3IAM 2;  4KUN A;  1XBS A;  2AYT A;  3ZTL A;  2B6M A;  4GXZ A;  1AQX A;  1GTI A;  2HI7 A;  4K2X A;  3MYD A;  1XVQ A;  2H1D A;  4EO3 A;  1OKT A;  4Z2R A;  1XZO A;  4HQS A;  1M99 A;  5A4U A;  5B7C A;  2H73 A;  1GTA A;  2LKU A;  2QA1 A;  5D9X A;  1OE7 A;  1EP7 A;  3MDK A;  3GKX A;  1ACV A;  2XPE A;  1XW5 A;  1Z6N A;  3TJG A;  3D4M A;  1BAY A;  2WGR A;  1MDI A;  2N5F A;  3GX8 A;  3TKS C;  1TDI A;  3DVW A;  2GLR A;  1QXH A;  5J5N A;  1QGV A;  2XC2 A;  2IJY A;  2CX4 A;  1Q98 A;  2GT6 A;  4YQM A;  3A5W A;  2FA8 A;  4MCU A;  1T8E B;  4K7N A;  4NPB A;  4RQX A;  2B3S A;  4V1A p;  5AN1 A;  4ZBA A;  4ICY A;  3A2X A;  14GS A;  1TK8 B;  3TJF A;  8GSS A;  4MZW A;  4X0X A;  2H72 A;  3HJP A;  3ZFB A;  19GS A;  2IWT A;  2VLU A;  2YJH A;  3N5O A;  3GSS A;  4FYC A;  2EIQ A;  2V32 A;  2KP2 A;  4IEL A;  2H0I A;  3GH9 A;  1ZL9 A;  2XHF A;  3M1G A;  2YOI A;  1M9A A;  5J41 A;  2OBK A;  4NHW A;  4TKY A;  3E9J B;  3H8Q A;  2REM A;  4IKH A;  3UOM A;  2BMX A;  5G5F A;  2C3Q A;  1E2Y A;  3KIJ A;  4K0N A;  4IP1 A;  5J3R A;  3EE2 A;  4P3Y B;  4GSS A;  3CBU A;  4JR6 A;  1JZO A;  1ZMA A;  2HYX A;  3FZ9 A;  10GS A;  4WEY A;  4DSS A;  4BIK A;  1EEM A;  4TW5 A;  4FYB A;  3ZMK A;  2MMZ A;  5IMA A;  4HU7 A;  1THO A;  4FO5 A;  2KUC A;  1TK0 B;  2WDU A;  3GX0 A;  2LQQ A;  2H1B A;  4ECB A;  1EOH A;  4IVF A;  4O5Q A;  1XWB A;  4TR4 A;  4ECI A;  1PL2 A;  5D8I A;  6GSX A;  1O8W A;  1K0D A;  1OC9 A;  3UEM A;  2H74 A;  3QPM A;  4IJI A;  1W4V A;  3RBT A;  5HFG A;  4N11 A;  4OCF A;  4F9Z A;  2ON5 A;  1SL1 B;  4PUF C;  3LQ7 A;  5ECN B;  1QMV A;  3EUR A;  5IOW A;  7GSS A;  5JCW A;  4ZBD A;  4F82 A;  2FY6 A;  1GLP A;  3APS A;  4HZ2 A;  4Q5R A;  3UAP A;  2JAD A;  4OO5 A;  2KP1 A;  3DXB A;  4HDE A;  5G31 A;  2C0G A;  2F51 A;  4KA0 A;  1XWA A;  6GSY A;  2DSA A;  1ML6 A;  3LJR A;  3IOS A;  3M8N A;  2DJ3 A;  3FK8 A;  4I2T A;  1GLQ A;  5D96 A;  4GF0 A;  4ML1 A;  2VLV A;  2L5O A;  2VAF A;  4V2L A;  1EEJ A;  4F0B A;  1K0B A;  4MK3 A;  2VCX A;  3TCO A;  4CDO A;  1VF1 A;  2CT6 A;  1MD4 A;  3WT1 A;  3LOR A;  4HJ2 A;  2YZU A;  5INY A;  3TB2 A;  2GSQ A;  3LXZ A;  3Q6O A;  2RM5 A;  1TI1 A;  3H4K A;  1Q4J A;  3ERG A;  3F3R A;  3PH9 A;  5DQS A;  1BJX A;  1T3B A;  2R4V A;  3UBK A;  2DKI A;  3RDW A;  1TI3 A;  1GUH A;  4DSS B;  1EWX A;  4OO4 A;  3MWH A;  1M9B A;  4K8M A;  1YZX A;  4GWR A;  3W6G A;  4V1A g;  4AJ8 A;  3P8W A;  4IS0 A;  2EC4 A;  4LMV A;  5KOW A;  1SJI A;  2LNT A;  2R37 A;  1ZGN A;  4KF9 A;  4TVE A;  6GSS A;  3CQF A;  2C0F A;  2FHE A;  5E4W A;  1DE2 A;  4D73 A;  3ZFL A;  3KH7 A;  1TP9 A;  1SD9 A;  1HNA A;  3LYK A;  1J0F A;  1ON4 A;  2QC7 A;  2CAI A;  2JSZ A;  1NHY A;  1WMJ A;  3IAS 2;  4E8H A;  3HHV A;  1OC9 B;  1O7U A;  4TXO A;  5CRW A;  3D21 A;  2CV4 A;  2E2M A;  1F2E A;  2O87 A;  4OMV A;  1EZK A;  1BED A;  1WWJ A;  3CXG A;  3TJK A;  1JLV A;  1M3I A;  2DML A;  2MBS A;  4JR4 A;  4J56 E;  1U88 A;  1J08 A;  1PA3 A;  2YNX A;  5DAK A;  4K0G A;  2MMA A;  1PL1 A;  3QMX A;  3O6T A;  1K0O A;  2L6D A;  3CSH A;  3Q19 A;  3FKF A;  1ERV A;  4Q5N A;  5ECH B;  1GSU A;  1K0A A;  4HS1 A;  3VI5 A;  3P2A A;  2XBQ A;  5EL8 A;  3IA1 A;  2X99 A;  3IPZ A;  2LQO A;  1XG8 A;  2R0G A;  4OFT A;  2FGX A;  1NW2 A;  5A4W A;  3ME8 A;  1XWC A;  2R2J A;  4MH3 A;  1MD3 A;  2J9H A;  5IM9 A;  2IFQ A;  2HRF A;  1AQV A;  1SK0 A;  2B5Y A;  4RI6 A;  1SKW B;  2DMM A;  3GL3 A;  3UL3 A;  1KTE A;  3HVV A;  1XWG A;  4ZIJ A;  2R3X A;  4G0K A;  3TUE A;  4JZQ A;  4K9Z A;  3F9U A;  1OAZ A;  1EOG A;  5CRH A;  3LW9 A;  4AJ6 A;  5IMC A;  1PRX A;  2KLX A;  2VD1 A;  4WXT A;  2HZE A;  1SJZ A;  20GS A;  1FB0 A;  5DCH A;  2AJQ B;  3KP9 A;  3GKN A;  1R5A A;  5DJM A;  3IK7 A;  2DIZ A;  1PGT A;  1OC3 A;  4DVC A;  4D73 B;  3IDV A;  3VWU A;  4IQA A;  2JZT A;  4G19 A;  1WP0 A;  2VUP A;  4BPY A;  1YKA A;  2MMO A;  1GSF A;  4NAX A;  3ME7 A;  2VIM A;  3A2W A;  2MMN A;  2K6V A;  17GS A;  1KBN A;  4ISD A;  3R2Q A;  5G1K A;  1K0C A;  1GTB A;  4KE3 A;  5CRG A;  3GUR A;  2RUF A;  5F07 A;  5B6M A;  4XIH A;  2P5Q A;  1PD2 1;  1IYI A;  2O89 A;  5HR2 A;  4LA1 A;  3IXR A;  1Z9H A;  1OC8 A;  2A4H A;  5GAP D;  3M0F A;  4O7H A;  1GSY A;  1VF2 A;  4N10 A;  2WRT A;  2CAQ A;  2H0G A;  2LRN A;  2YWO A;  3W8J A;  4BVY A;  3GKK A;  2YWM A;  2FCH A;  3EMX A;  5KN1 A;  4J57 E;  4HOJ A;  1F37 A;  2XPD A;  4KAE A;  3ZL5 A;  2KOK A;  2C4J A;  2G2Q A;  2VCW A;  2C0E A;  5ELA A;  5FHI A;  1XPV A;  1R5P A;  4CHS A;  4EIP A;  4RUV A;  1HNC A;  22GS A;  3CRU A;  4I5Q A;  11GS A;  3KH9 A;  3I6A A;  2YZH A;  1Z7P A;  3D0Z A;  5JCG A;  1WOU A;  1GUK A;  2PPT A;  3LEF A;  3TGZ A;  4J2F A;  1SKR B;  4PX1 A;  1TW9 A;  2VLT A;  3D4T A;  3FY7 A;  1RW1 A;  2LJK A;  1B9Y C;  1V40 A;  2GZP A;  2N5B A;  1PQN A;  5F06 A;  3HA9 A;  4K7I A;  3BD2 A;  1TRS A;  4WR4 A;  1XVW A;  5ECP B;  3ZRE A;  4GLT A;  2L57 A;  2PVO C;  2V6O A;  1B8X A;  2HZE B;  2IL3 A;  12GS A;  4YAV A;  5GAN D;  1UVZ A;  1G6Y A;  2J23 A;  5ECO B;  5IMD A;  5IPG A;  1H75 A;  2NDO A;  1E6B A;  5KOX A;  3FRC A;  3EPT A;  3HVX A;  4O5R A;  1U6T A;  6GSW A;  4HI7 A;  3HVN A;  4MJA A;  3VPQ A;  1WIK A;  3KCM A;  1NHO A;  5ECR B;  1SL0 B;  3ZIJ A;  5F8B A;  3E0U A;  5IQY A;  5JWO B;  1XIY A;  5D9T A;  2IN3 A;  4OD7 A;  4HEA 2;  1GWC A;  1SJ6 A;  3GA4 A;  3CSJ A;  3EIN A;  3KP8 A;  3LFL A;  1RK4 A;  1B48 A;  3RPP A;  4ZB9 A;  1GNW A;  1SD8 A;  1O6J A;  3GH6 A;  2YN1 A;  1T4Z A;  2LTK A;  5HQP A;  1HNB A;  4BVY B;  1GP1 A;  4YH2 A;  3EC3 A;  2PER A;  5DAL B;  1JHB A;  1LBK A;  5IO2 A;  2GSR A;  5DDL A;  4AGS A;  4MLY A;  2H75 A;  2LJA A;  3R3E A;  1TU7 A;  1TKD B;  5ECM B;  4GRF A;  1N2A A;  4XS6 A;  2H71 A;  3KJY A;  3UIW A;  2C80 A;  1T7P B;  2GT5 A;  4FH8 A;  1EV4 A;  2QKE A;  3GHA A;  4KSM A;  3L0H A;  1EP8 A;  4PNF A;  1OE8 A;  3L9U A;  3HY2 A;  3H1N A;  3F0I A;  2AAW A;  2WCI A;  3TRX A;  3N9J A;  1U87 A;  2TRX A;  3CTF A;  3NOF A;  1K3Y A;  4F0C A;  2ZCT A;  3U6V A;  1BQ7 A;  1MDK A;  1K3L A;  1KNG A;  5JWQ B;  2H6Z A;  5HR1 A;  4YKG A;  1TRV A;  1AQW A;  1EGR A;  4FIW A;  4G0I A;  1C72 A;  4JED A;  3M9K A;  2K18 A;  1TJD A;  5ABR A;  3KZQ A;  1OKD A;  5F0G A;  2DJ2 A;  3C71 A;  4K7O A;  3TRQ A;  4IW9 A;  3F4R A;  2CZ3 A;  2E2G A;  4H86 A;  4GSN A;  2OKA A;  3GN3 A;  3F3Q A;  6GSV A;  1GUL A;  3UJ1 A;  2V2G A;  2B7J A;  4Z2U A;  1YY7 A;  5CP1 A;  1A23 A;  2RUE A;  2DKH A;  4WET A;  2FWF A;  4YQU A;  4EE0 A;  5CO3 A;  4ZIL A;  3A5I A;  4HUA A;  5JCU A;  4XS4 B;  2I3Y A;  2HSM A;  4NV5 A;  3IV4 A;  4OFM A;  1TXX A;  2HFD A;  1BX9 A;  1FVK A;  3IRA A;  3RHB A;  4XRD A;  2LEG A;  1UN2 A;  1FOV A;  3Q74 A;  3VLN A;  2L4Q A;  2H01 A;  1AUC A;  2JAC A;  3PGT A;  3TKP A;  2IMD A;  1GSQ A;  3G9B A;  5E59 A;  4EDZ A;  1X9W B;  1Z6M A;  3IC4 A;  2NVL A;  1XW6 A;  5ECI B;  3I69 A;  3M9J A;  3K8N A;  5EPF A;  4DEJ A;  4POM A;  3NZN A;  2QGV A;  2VCZ A;  4PGT A;  1BYE A;  4HJM A;  1BG5 A;  3QAW A;  4WF4 A;  3QR6 A;  4IJ3 A;  4K5S A;  3FYG A;  3CRT A;  3J7Y b;  1X5C A;  1O8X A;  2OBI A;  1PN0 A;  3QFB C;  1A8Y A;  3PIN A;  1PX6 A;  2WUL A;  3SBC A;  3D5J A;  2OE1 A;  3C7M A;  5H5S A;  3GFK A;  3US3 A;  2VL2 A;  3FR9 A;  9GSS A;  2GS3 A;  5FT3 A;  4TRX A;  3EWL A;  3VWV A;  4N0V A;  2VCT A;  3EU3 A;  2VD0 A;  4HSC X;  1A8L A;  4NV2 A;  2H1G A;  2B7K A;  2M80 A;  3HVS A;  2FWG A;  4FQU A;  1SK1 A;  2F8F A;  3EVI A;  4LLR A;  4MMM A;  3DWV A;  4YQV A;  4TR3 A;  4NHZ A;  2GST A;  2G0F A;  4EL1 A;  3GST A;  1PMT A;  3FR6 A;  2GZZ A;  2HSY A;  2DJ0 A;  4LL4 B;  4KB3 A;  2DJ1 A;  3D22 A;  4EC0 A;  4WF5 A;  4G2E A;  1X5D A;  2YJ7 A;  4E8E A;  2P0G A;  1A0R P;  2FWH A;  2FUG 2;  1XCC A;  1HD2 A;  2X8C A;  4LMW A;  5IOX A;  2HRA A;  4K1F A;  3M3M A;  3NIV A;  2C1Y A;  2YP6 A;  5DQY A;  1M2B A;  2V41 A;  4L5O A;  2GTU A;  2GSS A;  2FD3 A;  4GQF A;  1SEN A;  2B5X A;  3HZ4 A;  3G7I A;  1FVJ A;  2LNS A;  5A5K A;  3IK9 A;  3DRN A;  3P90 A;  2WS2 A;  4PXO A;  2AHE A;  4AF2 A;  1TRU A;  4G10 A;  4MPG A;  3GUS A;  2C3T A;  1X0R A;  3VUR A;  1AC1 A;  2VCV A;  2VL3 A;  2MYG A;  2HRN A;  2A2P A;  3BCI A;  5FWG A;  4G0L A;  3ZYW A;  4MF6 A;  2H76 A;  4EDY A;  5C00 A;  1ZYE A;  5IO0 A;  1ZZY A;  2IME A;  2PGT A;  1MEK A;  1XFL A;  4EIQ A;  3ZRD A;  1FHE A;  1S3R A;  5D9W A;  4JRR A;  2VM2 A;  3O3T A;  2AB6 A;  3TJJ A;  1DSB A;  2IIY A;  4ZB8 A;  3DIE A;  1J9B A;  3WGE A;  1V9W A;  2R5G A;  4TOP A;  3VI7 A;  3TKS A;  3ERW A;  2ZUP A;  2GGT A;  5C04 A;  2ON7 A;  5DBQ A;  2X49 A;  1X9S B;  1QFN A;  5LNK e;  5D9V A;  1ZOF A;  2BTO T;  4DSQ A;  2O8V B;  1FOH A;  2X4A A;  1YKC A;  1ST9 A;  3GTU B;  3C8E A;  3H93 A;  2BJX A;  2H6X A;  2AUV A;  2O7K A;  1TRW A;  4ZB6 A;  4ZL9 A;  1A2L A;  3APO A;  5IPH A;  3ZIV A;  18GS A;  1UA5 A;  4QL7 A;  4GQC A;  3W8S A;  1OYJ A;  3F6F A;  3LGC A;  1O73 A;  1Z7R A;  4ULX A;  5DAL A;  3ZVJ D;  2H6Y A;  3KMO A;  1K0M A;  4MA9 A;  1KEB A;  4MNN A;  3GMF A;  1T4Y A;  5G2Z A;  2C8U A;  3DVX A;  2DJK A;  4TR1 A;  3KGK A;  2CA8 A;  3TKS E;  1I9D A;  4O5U A;  5CRE A;  2IMF A;  1JFU A;  4KSO A;  2YPM A;  3BCK A;  4L0U A;  2OAD A;  3WGX A;  1GTU A;  4CY6 A;  3A2V A;  2A2S A;  2CVD A;  3G7Y A;  2LST A;  1S3A A;  1A24 A;  3FW2 A;  2RII A;  2WJU A;  1RQM A;  3U5R E;  2LUS A;  3IHG A;  1WRY A;  1M3J A;  3DEX A;  1I5G A;  1O85 A;  4I6X A;  2FNO A;  4I97 A;  5GSS A;  1QQ2 A;  2GQM A;  4IBP A;  4HQZ A;  4MJC A;  3FMW A;  1NM3 A;  1YF1 A;  1LJR A;  2KHP A;  1A2M A;  2VO4 A;  3TRP A;  3TJB A;  1FO5 A;  2CQ9 A;  3LSZ A;  2OE0 A;  3L9V A;  2R0C A;  2NBS A;  1PX7 A;  4L5L A;  1G7E A;  1H4O A;  1XOA A;  1PSQ A;  2PMT A;  1USB A;  1GUM A;  5DCG A;  3KTL A;  3LYP A;  4QL9 A;  2RM6 A;  4BWQ A;  4ECJ A;  2K9F A;  3HJM A;  4NXI A;  2L59 A;  1VF3 A;  5ECQ B;  3DYR A;  4BL7 A;  1AW9 A;  4MPF A;  2GQK A;  3ERF A;  1G6W A;  5HR3 A;  2R6K A;  2OA7 A;  1XXU A;  4IHU A;  1Y25 A;  4MH2 A;  4RQR A;  5CRD A;  4BVX A;  2QSI A;  2YWN A;  4JE1 A;  5IIZ A;  1Z5Y E;  4KCE A;  3QAV A;  2P5R A;  3RPN A;  2DBC A;  3HD5 A;  4XS4 A;  5HFI A;  4MAB A;  1GNE A;  2LJR A;  2MBT A;  4K6X A;  5JWR B;  3D6I A;  2Z9S A;  3F63 A;  1GRX A;  4JU5 A;  4X1U A;  3ISO A;  4ZBB A;  3UAR A;  2LRC A;  2H1A A;  3UVT A;  4XS1 A;  2HZF A;  3ZZX A;  2A2R A;  4CW9 A;  3GL5 A;  4RI7 A;  4TR1 B;  2HRK A;  2RLI A;  5J4U A;  3QCP A;  5ENU A;  13GS A;  5HR0 A;  4ACS A;  3I43 A;  1ZYN A;  2N5A A;  3CMI A;  3HZ8 A;  2PVQ A;  4EF0 A;  4KCA A;  3KMN A;  2LRT A;  1EV9 A;  2JZS A;  2WB9 A;  4YKF A;  4HZ4 A; 
#chains in the Genus database with same CATH homology
 5CYY A;  1SYX A;  4KX4 A;  2X8G A;  2I1U A;  5ID2 A;  1TTZ A;  4KND A;  4ECC A;  1PKZ A;  1R26 A;  4ID0 A;  3VWX A;  3WT2 A;  3GYK A;  3DGQ A;  2L6C A;  2FWE A;  1ERT A;  4POB A;  1IYH A;  1PN9 A;  2PU9 C;  3CSI A;  2I9H A;  4KDY A;  5KN0 A;  5D73 A;  4K2D A;  3IR4 A;  3CTG A;  1VRS D;  4MZB A;  1F3B A;  4DSR A;  1FB6 A;  1G0T A;  4IGJ A;  2H19 A;  1ERU A;  2HE3 A;  1XW9 A;  1K3O A;  2M72 A;  16GS A;  4A5P A;  2H8L A;  1ERW A;  1A2J A;  4PQH A;  4PQ1 A;  5EVO A;  1QK8 A;  1HQO A;  4BL7 B;  1YDK A;  2HT9 A;  2NPB A;  2AV4 A;  2XBI A;  3UVH A;  3GIX A;  4KDX A;  3Q18 A;  2HNL A;  1U3I A;  1JZW A;  4BVX B;  2E7P A;  2CX3 A;  4XHM A;  3KEB A;  1LU4 A;  1YF0 A;  2YAN A;  3F8U A;  3O76 A;  4WBR D;  4AJ7 A;  2R0P A;  2K8S A;  3CYN A;  4I8B A;  3AY8 A;  1WE0 A;  3FZA A;  1F9M A;  5B6N A;  3EMP A;  3FEU A;  5J9C A;  2FLS A;  1W89 A;  2MZC A;  4EUY A;  3IC8 A;  1ZCP A;  3L78 A;  3KM6 A;  2HLS A;  2DIY A;  5AIS A;  5HFK A;  1NSW A;  3TDG A;  5AGY A;  3FZ5 A;  4TN8 A;  1R7H A;  3MSZ A;  2DC5 A;  2H66 A;  4G9H A;  2CZ2 A;  4BA7 A;  5G5E A;  1EGO A;  4F03 A;  3IHQ A;  4KGI A;  2DJJ A;  1PKW A;  5ID2 B;  1YEP A;  3VK9 A;  3KXO A;  2X8H A;  3HYP A;  4PUA A;  1M0U A;  3GRX A;  5ELG A;  3DKS A;  2HXK A;  3KTB A;  3G7J A;  2IMI A;  1GL8 A;  5KN3 A;  2OAC A;  1HYU A;  3HJO A;  3ZIT A;  3GV1 A;  1GH2 A;  2E0Q A;  3WGD A;  4MF7 A;  5A4V A;  3I9V 2;  4PTS A;  1GSD A;  2K8V A;  3HKR A;  4O92 A;  1R4W A;  2GVP A;  3UBL A;  3MAK A;  3QD9 A;  1V58 A;  4IN0 A;  1ZYP A;  4KDU A;  2EIR A;  2UZ8 A;  4K5R A;  3EU4 A;  3ZVJ A;  5KN2 A;  1GSS A;  3IBH A;  2PUK C;  3BJ5 A;  3C73 A;  1X5E A;  4Q5Q A;  4FYU A;  4X43 A;  2JL4 A;  3HCZ A;  5BRT A;  2JU5 A;  2GDR A;  1VGL A;  4F2I A;  4N0Z A;  1B9X C;  3TOT A;  1AIU A;  3FR3 A;  1SK2 A;  1ILO A;  3GTU A;  5ECK B;  5IMZ A;  1YQ1 A;  1DBY A;  1WPI A;  5CNW A;  2F8A A;  2QA2 A;  4USS A;  2VCQ A;  5ECS A;  3VWW A;  1B4P A;  4L0W A;  3GNJ A;  3PR8 A;  2V1M A;  1YEX A;  3BOA A;  1V57 A;  5AIV A;  5L71 A;  5KEJ A;  4L8E A;  2L4C A;  3TKQ A;  1M7T A;  1SL2 B;  4KH7 A;  3P7X A;  1DE1 A;  4IP6 A;  4POK A;  1G7O A;  4XTS A;  4ML6 A;  2WZ9 A;  2F3M A;  3BBY A;  2PWJ A;  4HU9 A;  4PNG A;  2A4V A;  1FW1 A;  4YAP A;  3C1R A;  4WR5 A;  2OE3 A;  2P31 A;  2GZY A;  2H70 A;  4POL A;  1GSE A;  3ED3 A;  2JSY A;  5J9B A;  2M46 A;  5DVB A;  4IQ1 A;  4MP4 A;  5GST A;  2C3N A;  3UMA A;  1B4Q A;  3SWL A;  2TRC P;  1UC7 A;  4XRA A;  1DUG A;  2LS5 A;  4NWY A;  4BWS A;  4EVM A;  4PUR A;  4MJE A;  1F3A A;  1O81 A;  3EYT A;  1XOB A;  2YWI A;  1SU9 A;  5H5R A;  1T1V A;  2OJL A;  2B1K A;  4CY8 A;  4ZXG A;  4WKW A;  1JLW A;  2VM1 A;  3APQ A;  2PBJ A;  5B8A A;  1Z3E A;  4JBB A;  3QDN A;  3TKR A;  3WD6 A;  1ABA A;  2GQL A;  3DD3 A;  5LCZ A;  6GST A;  2FA4 A;  1Y6E A;  5F05 A;  4NMU A;  2C0D A;  3A3T A;  1TOF A;  3LXT A;  1CQG A;  4O32 A;  3WYW A;  4MJB A;  3FHK A;  1TK5 B;  1XWK A;  2F9S A;  2O85 A;  4LL1 B;  3J7Y k;  2EIO A;  1S3C A;  2VL9 A;  4Z2T A;  5GZZ B;  4GTU A;  4N30 A;  2DLX A;  4MF5 A;  1THX A;  3LWA A;  1JZD A;  1CQH A;  1T00 A;  2V6K A;  3E3E A;  5COH A;  1M2D A;  4EXJ A;  3DML A;  5ECL B;  1K0N A;  2TIR A;  1FAA A;  3KD0 A;  3MNG A;  1ZYQ B;  4Q5F A;  2VL2 C;  4TXO B;  4I2U A;  2YV7 A;  1V2A A;  3VPT A;  1MTC A;  1QUW A;  3GKM A;  3PPU A;  2YV9 A;  5AIX A;  1YJ6 A;  1SYR A;  2ES7 A;  4GCI A;  1TU8 A;  2I81 A;  1U3A A;  4V2M A;  3JCM L;  3OR5 A;  3L4N A;  3C1S A;  5DAK B;  5G1L A;  4EKZ A;  4ILF A;  5DJL A;  4ZL8 A;  3IE3 A;  4KW6 A;  3VFI A;  1MDJ A;  2CVK A;  1AXD A;  3H79 A;  3QFA C;  3HDC A;  1A0F A;  4GST A;  3V1W A;  3FZ4 A;  3MIX A;  4ZL7 A;  1N8J A;  2LV3 A;  4MDC A;  2L5L A;  2H30 A;  5G30 A;  3F6D A;  3RHC A;  2WFC A;  1OVN A;  3S9F A;  3ZLP A;  4TR0 A;  5H5Q A;  2JZR A;  3L9S A;  2X64 A;  4V2N A;  1F6M C;  1AAZ A;  1M2A A;  2VOC A;  4X4J A;  1WJK A;  4OFN A;  5EY6 A;  4PQI A;  2ZNM A;  4WBJ A;  1SKS B;  2IFQ B;  5CAX A;  4OWY A;  3LG6 A;  3QAG A;  3TOU A;  1URM A;  2CVB A;  3F4S A;  5BMU A;  1V98 A;  2IMK A;  3QOU A;  2H0H A;  2I4A A;  4Z7X A;  6GSU A;  5D93 A;  1X9M B;  4TXV A;  3HXS A;  2IPA A;  1JZR A;  3F4T A;  3ZML A;  4OCE A;  2HSH A;  1S3D A;  2ALB A;  2B5E A;  2D2Z A;  2YCD A;  2B1L A;  5IMV A;  2PN8 A;  1VF4 A;  5B8B A;  2NTO A;  4MZC A;  3RAZ A;  4XCS A;  5IMF A;  4QQ7 A;  1FG4 A;  5LD0 A;  3IAM 2;  4KUN A;  1XBS A;  2AYT A;  3ZTL A;  2B6M A;  4GXZ A;  1AQX A;  1GTI A;  2HI7 A;  4K2X A;  3MYD A;  1XVQ A;  2H1D A;  4EO3 A;  1OKT A;  4Z2R A;  1XZO A;  4HQS A;  1M99 A;  5A4U A;  5B7C A;  2H73 A;  1GTA A;  2LKU A;  2QA1 A;  5D9X A;  1OE7 A;  1EP7 A;  3MDK A;  3GKX A;  1ACV A;  2XPE A;  1XW5 A;  1Z6N A;  3TJG A;  3D4M A;  1BAY A;  2WGR A;  1MDI A;  2N5F A;  3GX8 A;  3TKS C;  1TDI A;  3DVW A;  2GLR A;  1QXH A;  5J5N A;  1QGV A;  2XC2 A;  2IJY A;  2CX4 A;  1Q98 A;  2GT6 A;  4YQM A;  3A5W A;  2FA8 A;  4MCU A;  1T8E B;  4K7N A;  4NPB A;  4RQX A;  2B3S A;  4V1A p;  5AN1 A;  4ZBA A;  4ICY A;  3A2X A;  14GS A;  1TK8 B;  3TJF A;  8GSS A;  4MZW A;  4X0X A;  2H72 A;  3HJP A;  3ZFB A;  19GS A;  2IWT A;  2VLU A;  2YJH A;  3N5O A;  3GSS A;  4FYC A;  2EIQ A;  2V32 A;  2KP2 A;  4IEL A;  2H0I A;  3GH9 A;  1ZL9 A;  2XHF A;  3M1G A;  2YOI A;  1M9A A;  5J41 A;  2OBK A;  4NHW A;  4TKY A;  3E9J B;  3H8Q A;  2REM A;  4IKH A;  3UOM A;  2BMX A;  5G5F A;  2C3Q A;  1E2Y A;  3KIJ A;  4K0N A;  4IP1 A;  5J3R A;  3EE2 A;  4P3Y B;  4GSS A;  3CBU A;  4JR6 A;  1JZO A;  1ZMA A;  2HYX A;  3FZ9 A;  10GS A;  4WEY A;  4DSS A;  1EEM A;  4TW5 A;  4FYB A;  3ZMK A;  2MMZ A;  5IMA A;  4HU7 A;  1THO A;  4FO5 A;  2KUC A;  1TK0 B;  2WDU A;  3GX0 A;  2LQQ A;  2H1B A;  4ECB A;  1EOH A;  4IVF A;  4O5Q A;  1XWB A;  4TR4 A;  4ECI A;  1PL2 A;  5D8I A;  6GSX A;  1O8W A;  1K0D A;  1OC9 A;  3UEM A;  2H74 A;  3QPM A;  4IJI A;  1W4V A;  3RBT A;  5HFG A;  4N11 A;  4OCF A;  4F9Z A;  2ON5 A;  1SL1 B;  4PUF C;  3LQ7 A;  5ECN B;  1QMV A;  3EUR A;  5IOW A;  7GSS A;  5JCW A;  4ZBD A;  4F82 A;  2FY6 A;  1GLP A;  3APS A;  4HZ2 A;  4Q5R A;  3UAP A;  2JAD A;  4OO5 A;  2KP1 A;  3DXB A;  4HDE A;  5G31 A;  2C0G A;  2F51 A;  4KA0 A;  1XWA A;  6GSY A;  2DSA A;  1ML6 A;  3LJR A;  3IOS A;  3M8N A;  2DJ3 A;  3FK8 A;  4I2T A;  1GLQ A;  5D96 A;  4GF0 A;  4ML1 A;  2VLV A;  2L5O A;  2VAF A;  4V2L A;  1EEJ A;  4F0B A;  1K0B A;  4MK3 A;  2VCX A;  3TCO A;  4CDO A;  1VF1 A;  2CT6 A;  1MD4 A;  3WT1 A;  3LOR A;  4HJ2 A;  2YZU A;  5INY A;  3TB2 A;  2GSQ A;  3LXZ A;  3Q6O A;  2RM5 A;  1TI1 A;  3H4K A;  1Q4J A;  3ERG A;  3F3R A;  3PH9 A;  5DQS A;  1BJX A;  1T3B A;  2R4V A;  3UBK A;  2DKI A;  3RDW A;  1TI3 A;  1GUH A;  4DSS B;  1EWX A;  4OO4 A;  3MWH A;  1M9B A;  4K8M A;  1YZX A;  4GWR A;  3W6G A;  4V1A g;  4AJ8 A;  3P8W A;  4IS0 A;  2EC4 A;  4LMV A;  5KOW A;  1SJI A;  2LNT A;  2R37 A;  1ZGN A;  4KF9 A;  4TVE A;  6GSS A;  2C0F A;  2FHE A;  5E4W A;  1DE2 A;  4D73 A;  3ZFL A;  3KH7 A;  1TP9 A;  1SD9 A;  1HNA A;  3LYK A;  1J0F A;  1ON4 A;  2QC7 A;  2CAI A;  2JSZ A;  1NHY A;  1WMJ A;  3IAS 2;  4E8H A;  3HHV A;  1OC9 B;  1O7U A;  4TXO A;  5CRW A;  3D21 A;  2CV4 A;  2E2M A;  1F2E A;  2O87 A;  4OMV A;  1EZK A;  1BED A;  1WWJ A;  3CXG A;  3TJK A;  1JLV A;  2DML A;  2MBS A;  4JR4 A;  4J56 E;  1U88 A;  1J08 A;  1PA3 A;  2YNX A;  5DAK A;  4K0G A;  2MMA A;  1PL1 A;  3QMX A;  3O6T A;  1K0O A;  2L6D A;  3CSH A;  3Q19 A;  3FKF A;  1ERV A;  4Q5N A;  5ECH B;  1GSU A;  1K0A A;  4HS1 A;  3VI5 A;  3P2A A;  2XBQ A;  5EL8 A;  3IA1 A;  2X99 A;  3IPZ A;  2LQO A;  2R0G A;  4OFT A;  2FGX A;  1NW2 A;  5A4W A;  3ME8 A;  1XWC A;  2R2J A;  4MH3 A;  1MD3 A;  2J9H A;  5IM9 A;  2IFQ A;  2HRF A;  1AQV A;  1SK0 A;  2B5Y A;  4RI6 A;  1SKW B;  2DMM A;  3GL3 A;  3UL3 A;  1KTE A;  3HVV A;  1XWG A;  4ZIJ A;  2R3X A;  4G0K A;  3TUE A;  4JZQ A;  4K9Z A;  3F9U A;  1OAZ A;  1EOG A;  5CRH A;  3LW9 A;  4AJ6 A;  5IMC A;  1PRX A;  2KLX A;  2VD1 A;  4WXT A;  2HZE A;  1SJZ A;  20GS A;  1FB0 A;  5DCH A;  2AJQ B;  3KP9 A;  3GKN A;  1R5A A;  5DJM A;  3IK7 A;  2DIZ A;  1PGT A;  1OC3 A;  4DVC A;  4D73 B;  3IDV A;  3VWU A;  4IQA A;  2JZT A;  4G19 A;  1WP0 A;  2VUP A;  4BPY A;  1YKA A;  2MMO A;  1GSF A;  4NAX A;  3ME7 A;  2VIM A;  3A2W A;  2MMN A;  2K6V A;  17GS A;  1KBN A;  4ISD A;  3R2Q A;  5G1K A;  1K0C A;  1GTB A;  4KE3 A;  5CRG A;  3GUR A;  2RUF A;  5F07 A;  5B6M A;  4XIH A;  2P5Q A;  1PD2 1;  1IYI A;  2O89 A;  5HR2 A;  4LA1 A;  3IXR A;  1Z9H A;  1OC8 A;  2A4H A;  5GAP D;  3M0F A;  4O7H A;  1GSY A;  1VF2 A;  4N10 A;  2WRT A;  2CAQ A;  2H0G A;  2LRN A;  2YWO A;  3W8J A;  4BVY A;  3GKK A;  2YWM A;  2FCH A;  3EMX A;  5KN1 A;  4J57 E;  4HOJ A;  1F37 A;  2XPD A;  4KAE A;  3ZL5 A;  2KOK A;  2C4J A;  2G2Q A;  2VCW A;  2C0E A;  5ELA A;  5FHI A;  1XPV A;  1R5P A;  4CHS A;  4EIP A;  4RUV A;  1HNC A;  22GS A;  3CRU A;  4I5Q A;  11GS A;  3KH9 A;  3I6A A;  2YZH A;  1Z7P A;  3D0Z A;  5JCG A;  1WOU A;  1GUK A;  2PPT A;  3LEF A;  3TGZ A;  4J2F A;  1SKR B;  4PX1 A;  1TW9 A;  2VLT A;  3D4T A;  3FY7 A;  1RW1 A;  2LJK A;  1B9Y C;  1V40 A;  2GZP A;  2N5B A;  1PQN A;  5F06 A;  3HA9 A;  4K7I A;  3BD2 A;  1TRS A;  4WR4 A;  1XVW A;  5ECP B;  3ZRE A;  4GLT A;  2L57 A;  2PVO C;  2V6O A;  1B8X A;  2HZE B;  2IL3 A;  12GS A;  4YAV A;  5GAN D;  1UVZ A;  1G6Y A;  2J23 A;  5ECO B;  5IMD A;  5IPG A;  1H75 A;  2NDO A;  1E6B A;  5KOX A;  3FRC A;  3EPT A;  3HVX A;  4O5R A;  1U6T A;  6GSW A;  4HI7 A;  3VPQ A;  4MJA A;  1WIK A;  3KCM A;  1NHO A;  5ECR B;  1SL0 B;  3ZIJ A;  5F8B A;  3E0U A;  5IQY A;  5JWO B;  1XIY A;  5D9T A;  2IN3 A;  4OD7 A;  4HEA 2;  1GWC A;  1SJ6 A;  3GA4 A;  3CSJ A;  3EIN A;  3KP8 A;  3LFL A;  1RK4 A;  1B48 A;  3RPP A;  4ZB9 A;  1GNW A;  1SD8 A;  1O6J A;  3GH6 A;  2YN1 A;  1T4Z A;  2LTK A;  5HQP A;  1HNB A;  4BVY B;  1GP1 A;  4YH2 A;  3EC3 A;  2PER A;  5DAL B;  1JHB A;  1LBK A;  5IO2 A;  2GSR A;  5DDL A;  4AGS A;  4MLY A;  2H75 A;  2LJA A;  3R3E A;  1TU7 A;  1TKD B;  5ECM B;  4GRF A;  1N2A A;  4XS6 A;  2H71 A;  3KJY A;  3UIW A;  2C80 A;  1T7P B;  2GT5 A;  4FH8 A;  1EV4 A;  2QKE A;  3GHA A;  4KSM A;  3L0H A;  1EP8 A;  4PNF A;  1OE8 A;  3L9U A;  3HY2 A;  3H1N A;  3F0I A;  2AAW A;  2WCI A;  3TRX A;  3N9J A;  1U87 A;  2TRX A;  3CTF A;  3NOF A;  1K3Y A;  4F0C A;  2ZCT A;  3U6V A;  1BQ7 A;  1MDK A;  1K3L A;  1KNG A;  5JWQ B;  2H6Z A;  5HR1 A;  4YKG A;  1TRV A;  1AQW A;  1EGR A;  4FIW A;  4G0I A;  1C72 A;  4JED A;  3M9K A;  2K18 A;  1TJD A;  5ABR A;  3KZQ A;  1OKD A;  5F0G A;  2DJ2 A;  3C71 A;  4K7O A;  3TRQ A;  4IW9 A;  3F4R A;  2CZ3 A;  2E2G A;  4H86 A;  4GSN A;  2OKA A;  3GN3 A;  3F3Q A;  6GSV A;  1GUL A;  3UJ1 A;  2V2G A;  2B7J A;  4Z2U A;  1YY7 A;  5CP1 A;  1A23 A;  2RUE A;  2DKH A;  4WET A;  2FWF A;  4YQU A;  4EE0 A;  5CO3 A;  4ZIL A;  3A5I A;  4HUA A;  5JCU A;  4XS4 B;  2I3Y A;  2HSM A;  4NV5 A;  3IV4 A;  4OFM A;  1TXX A;  2HFD A;  1BX9 A;  1FVK A;  3IRA A;  3RHB A;  4XRD A;  2LEG A;  1UN2 A;  1FOV A;  3Q74 A;  3VLN A;  2L4Q A;  2H01 A;  1AUC A;  2JAC A;  3PGT A;  3TKP A;  2IMD A;  1GSQ A;  3G9B A;  5E59 A;  4EDZ A;  1X9W B;  1Z6M A;  3IC4 A;  2NVL A;  1XW6 A;  5ECI B;  3I69 A;  3M9J A;  3K8N A;  5EPF A;  4DEJ A;  4POM A;  3NZN A;  2QGV A;  2VCZ A;  4PGT A;  1BYE A;  4HJM A;  1BG5 A;  3QAW A;  4WF4 A;  3QR6 A;  4IJ3 A;  4K5S A;  3FYG A;  3CRT A;  3J7Y b;  1X5C A;  1O8X A;  2OBI A;  1PN0 A;  3QFB C;  1A8Y A;  3PIN A;  1PX6 A;  2WUL A;  3SBC A;  3D5J A;  2OE1 A;  3C7M A;  5H5S A;  3GFK A;  3US3 A;  2VL2 A;  3FR9 A;  9GSS A;  2GS3 A;  5FT3 A;  4TRX A;  3EWL A;  3VWV A;  4N0V A;  2VCT A;  3EU3 A;  2VD0 A;  1A8L A;  4NV2 A;  2H1G A;  2B7K A;  2M80 A;  3HVS A;  2FWG A;  4FQU A;  1SK1 A;  2F8F A;  3EVI A;  4LLR A;  4MMM A;  3DWV A;  4YQV A;  4TR3 A;  4NHZ A;  2GST A;  2G0F A;  4EL1 A;  3GST A;  1PMT A;  3FR6 A;  2GZZ A;  2HSY A;  2DJ0 A;  4LL4 B;  4KB3 A;  2DJ1 A;  3D22 A;  4EC0 A;  4WF5 A;  4G2E A;  1X5D A;  2YJ7 A;  4E8E A;  2P0G A;  1A0R P;  2FWH A;  2FUG 2;  1XCC A;  1HD2 A;  2X8C A;  4LMW A;  5IOX A;  2HRA A;  4K1F A;  3M3M A;  3NIV A;  2C1Y A;  2YP6 A;  5DQY A;  1M2B A;  2V41 A;  4L5O A;  2GTU A;  2GSS A;  2FD3 A;  4GQF A;  1SEN A;  2B5X A;  3HZ4 A;  3G7I A;  1FVJ A;  2LNS A;  5A5K A;  3IK9 A;  3DRN A;  3P90 A;  2WS2 A;  4PXO A;  2AHE A;  4AF2 A;  1TRU A;  4G10 A;  4MPG A;  3GUS A;  2C3T A;  1X0R A;  3VUR A;  1AC1 A;  2VCV A;  2VL3 A;  2MYG A;  2HRN A;  2A2P A;  3BCI A;  5FWG A;  4G0L A;  3ZYW A;  4MF6 A;  2H76 A;  4EDY A;  5C00 A;  1ZYE A;  5IO0 A;  1ZZY A;  2IME A;  2PGT A;  1MEK A;  1XFL A;  4EIQ A;  3ZRD A;  1FHE A;  5D9W A;  4JRR A;  2VM2 A;  3O3T A;  2AB6 A;  3TJJ A;  1DSB A;  2IIY A;  4ZB8 A;  3DIE A;  1J9B A;  3WGE A;  1V9W A;  2R5G A;  4TOP A;  3VI7 A;  3TKS A;  3ERW A;  2ZUP A;  2GGT A;  5C04 A;  2ON7 A;  5DBQ A;  2X49 A;  1X9S B;  1QFN A;  5LNK e;  5D9V A;  1ZOF A;  2BTO T;  4DSQ A;  2O8V B;  1FOH A;  2X4A A;  1YKC A;  1ST9 A;  3GTU B;  3C8E A;  3H93 A;  2BJX A;  2H6X A;  2AUV A;  2O7K A;  1TRW A;  4ZB6 A;  4ZL9 A;  1A2L A;  3APO A;  5IPH A;  3ZIV A;  18GS A;  1UA5 A;  4QL7 A;  4GQC A;  3W8S A;  1OYJ A;  3F6F A;  3LGC A;  1O73 A;  1Z7R A;  4ULX A;  5DAL A;  3ZVJ D;  2H6Y A;  3KMO A;  1K0M A;  4MA9 A;  1KEB A;  4MNN A;  3GMF A;  1T4Y A;  5G2Z A;  2C8U A;  3DVX A;  2DJK A;  4TR1 A;  3KGK A;  2CA8 A;  3TKS E;  1I9D A;  4O5U A;  5CRE A;  2IMF A;  1JFU A;  4KSO A;  2YPM A;  3BCK A;  4L0U A;  2OAD A;  3WGX A;  1GTU A;  4CY6 A;  3A2V A;  2A2S A;  2CVD A;  3G7Y A;  2LST A;  1S3A A;  1A24 A;  3FW2 A;  2RII A;  2WJU A;  1RQM A;  3U5R E;  2LUS A;  3IHG A;  1WRY A;  3DEX A;  1I5G A;  1O85 A;  4I6X A;  2FNO A;  4I97 A;  5GSS A;  1QQ2 A;  2GQM A;  4IBP A;  4HQZ A;  4MJC A;  3FMW A;  1NM3 A;  1YF1 A;  1LJR A;  2KHP A;  1A2M A;  2VO4 A;  3TRP A;  3TJB A;  1FO5 A;  2CQ9 A;  3LSZ A;  2OE0 A;  3L9V A;  2R0C A;  2NBS A;  1PX7 A;  4L5L A;  1G7E A;  1H4O A;  1XOA A;  1PSQ A;  2PMT A;  1USB A;  1GUM A;  5DCG A;  3KTL A;  3LYP A;  4QL9 A;  2RM6 A;  4BWQ A;  4ECJ A;  2K9F A;  3HJM A;  4NXI A;  2L59 A;  1VF3 A;  5ECQ B;  3DYR A;  4BL7 A;  1AW9 A;  4MPF A;  2GQK A;  3ERF A;  1G6W A;  5HR3 A;  2R6K A;  2OA7 A;  1XXU A;  4IHU A;  1Y25 A;  4MH2 A;  4RQR A;  5CRD A;  4BVX A;  2QSI A;  2YWN A;  4JE1 A;  5IIZ A;  1Z5Y E;  4KCE A;  3QAV A;  2P5R A;  3RPN A;  2DBC A;  3HD5 A;  4XS4 A;  5HFI A;  4MAB A;  1GNE A;  2LJR A;  2MBT A;  4K6X A;  5JWR B;  3D6I A;  2Z9S A;  3F63 A;  1GRX A;  4JU5 A;  4X1U A;  3ISO A;  4ZBB A;  3UAR A;  2LRC A;  2H1A A;  3UVT A;  4XS1 A;  2HZF A;  3ZZX A;  2A2R A;  4CW9 A;  3GL5 A;  4RI7 A;  4TR1 B;  2HRK A;  2RLI A;  5J4U A;  3QCP A;  5ENU A;  13GS A;  5HR0 A;  4ACS A;  3I43 A;  1ZYN A;  2N5A A;  3CMI A;  3HZ8 A;  2PVQ A;  4EF0 A;  4KCA A;  3KMN A;  2LRT A;  1EV9 A;  2JZS A;  2WB9 A;  4YKF A;  4HZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...