2B6MA

Structure of the dsba mutant (p31a-c33a)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
187
structure length
187
Chain Sequence
QYEDGKQYTTLEKPVAGAPQVLEFFSFFCAHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein dsbA
publication title Structure of the DsbA mutant
rcsb
source organism Escherichia coli
total genus 55
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2b6mA00
1URMA 2B1KA 3J7Yb 1SL1B 1NHYA 2IIYA 2K6VA 4HOJA 1XW5A 4I2TA 4KA0A 4GSTA 4RI7A 3A3TA 1G7EA 5CRHA 5CO3A 1SD9A 2HE3A 1VRSD 2JACA 2B1LA 2ON5A 3IHQA 3H1NA 3KH7A 4WBJA 1BYEA 2LJKA 5DVBA 4JU5A 3ZVJA 4N10A 4ILFA 1FVKA 4EVMA 1B8XA 4MH3A 2GT5A 3P90A 2J23A 1NM3A 2FLSA 4KSMA 4EKZA 3ZZXA 2X8CA 1PX7A 1JZDA 4D73A 3FR9A 1Z7RA 2EC4A 1ACVA 3HJMA 4L8EA 2R2JA 5CYYA 2OBIA 3HZ4A 4PX1A 3KP9A 2B5EA 1DUGA 2VCTA 1TK5B 22GSA 2VM1A 4MJBA 3ERFA 1K0BA 3IAS2 2HT9A 5IM9A 3RHBA 1V9WA 3GUSA 4KUNA 1AIUA 3IE3A 3KJYA 2PUKC 1EZKA 1JLWA 1GULA 5A5KA 1K0CA 3L4NA 2JU5A 2YZHA 4V1Ap 1X5EA 3C8EA 4Q5FA 1FW1A 3GMFA 3UL3A 2YN1A 3TJFA 2TRCP 2R5GA 3TJGA 3GL3A 2GSQA 4QL9A 2WJUA 1ZYQB 1AC1A 2K8VA 3GRXA 4RI6A 1T8EB 2VD1A 2F3MA 5ECOB 2AYTA 1ZYEA 3D4MA 4X1UA 4NWYA 5IPGA 2VL3A 3TKQA 2DBCA 1A24A 3EU4A 2ZNMA 1EGRA 1X0RA 2PERA 4ID0A 2TIRA 3Q6OA 2CV4A 3IXRA 1TU8A 2H75A 7GSSA 5IOWA 1UA5A 4ZBDA 2KUCA 2CVDA 3GIXA 4MPGA 4BPYA 5B8BA 3Q19A 2N5AA 2DJ2A 2YJHA 4Q5RA 1PKZA 2IMIA 1T7PB 3GHAA 9GSSA 2I9HA 8GSSA 5LCZA 5FWGA 1R26A 4JR4A 5GZZB 2LUSA 4YAPA 4FIWA 4F2IA 3RBTA 4MP4A 1OKDA 4OCFA 4PNGA 4IW9A 3LWAA 2RM5A 5B8AA 2H8LA 2IN3A 4PURA 5ID2B 3KMNA 2VCQA 4LMWA 1TRUA 2OE3A 2N5FA 2BJXA 2YWMA 2WZ9A 4ZB6A 1AQWA 1OC9A 1JZOA 3EVIA 1QXHA 2GS3A 2H66A 4TXOB 3K8NA 3KMOA 1SKRB 2LSTA 1NSWA 4DSQA 2Z9SA 2CZ2A 4ECIA 5INYA 2ON7A 1Z3EA 2A4VA 2AUVA 3U5RE 5B7CA 4KDUA 4HEA2 4GWRA 4O32A 5IMVA 1ERWA 3KGKA 3SWLA 1TW9A 4V2MA 2MMOA 3M9JA 1ABAA 1TRSA 3BJ5A 4RQRA 2WFCA 2IFQB 3LG6A 4QQ7A 1VF4A 1F3AA 3HVVA 2H1DA 3N5OA 4PXOA 3AY8A 3KCMA 4BVYA 4GLTA 4J56E 5B6MA 2FWGA 1V57A 5JWOB 5EY6A 3DWVA 1A2LA 3IPZA 19GSA 2ZCTA 2YP6A 1RK4A 3G7IA 4JZQA 1KBNA 4K8MA 5DQSA 2CT6A 5DJMA 6GSXA 3QAGA 4LMVA 1XWKA 5KN2A 2VM2A 4K7IA 4KB3A 3Q74A 3UJ1A 1MD3A 4XS4B 2DC5A 3C7MA 3ZMKA 4EUYA 4KE3A 2HRNA 2CA8A 3CXGA 4K0GA 1B48A 2H0HA 4XS1A 1T1VA 2H73A 1KTEA 2C80A 5JCWA 1SK1A 4HZ2A 5CRGA 2IL3A 2H01A 6GSYA 4CW9A 4MJEA 5F05A 2VL2C 2O89A 3GX0A 2CVBA 4ML1A 4NHZA 2DIZA 3FEUA 2F51A 3LEFA 3ZIJA 2GZYA 3D21A 1BX9A 1TJDA 16GSA 17GSA 1M2BA 4K7OA 4IP6A 3UAPA 2R4VA 3ERGA 3GA4A 1WOUA 1F6MC 3VFIA 5DCHA 2K18A 3ZLPA 1G6WA 2HRFA 2VCVA 5G31A 4TW5A 5DAKB 1R7HA 1SYXA 4ZB9A 4G19A 4TR1B 1Q4JA 2ZUPA 4G10A 1GTIA 3RPPA 5F0GA 3UVHA 3HA9A 1YEXA 1HD2A 3NOFA 3G9BA 2C3QA 4L5OA 3UEMA 3CRTA 4NV2A 4IBPA 3MAKA 3FZ4A 2C3TA 3E9JB 4KCEA 3EMPA 4EDYA 4WF5A 1TI1A 4HJMA 3C1RA 5JWQB 2FGXA 2YANA 4GSNA 1H75A 5D9VA 1FB6A 1K3OA 4ISDA 4N0ZA 1H4OA 10GSA 2VLUA 2XPDA 1EWXA 3H4KA 3LXTA 3GTUA 5G5FA 5KN3A 1MTCA 3DIEA 5A4VA 2HSYA 3EE2A 1GSSA 3TRQA 1V98A 5CNWA 4JR6A 2L6CA 5G1KA 3I6AA 3TDGA 1PX6A 2V1MA 3GSSA 2R3XA 5ECRB 1XZOA 2FUG2 1XWCA 1BEDA 3O3TA 3VLNA 1HNCA 2WDUA 2J9HA 5ID2A 4NV5A 3F4RA 2DJ1A 2DJKA 1U3AA 4NMUA 3M3MA 2PVOC 2MZCA 5J4UA 1VF1A 3Q18A 2QSIA 2OJLA 1ZMAA 4IHUA 2AHEA 2DIYA 3LXZA 2HZEA 1A0FA 1O7UA 2M46A 13GSA 1XCCA 3ZIVA 3TKPA 1T00A 2N5BA 1M2DA 3C73A 4L0UA 1XPVA 3KH9A 6GSUA 1BQ7A 2HSHA 1JFUA 4XCSA 4NXIA 1G7OA 4KGIA 3DVXA 3L9SA 4MZBA 1XWAA 1S3CA 4ML6A 4NHWA 2GT6A 3F9UA 3GV1A 4OO4A 5HFKA 1BAYA 1GUMA 1SD8A 5DALA 1CQGA 2JSZA 2JZTA 4X43A 4TN8A 4MF5A 4DSRA 4DSSB 2L6DA 4MABA 2XC2A 4HQZA 1AQXA 4ECBA 2YPMA 1O6JA 5JCUA 1TXXA 1UN2A 2V2GA 2HFDA 4IGJA 5E4WA 5D93A 1A8YA 4PQHA 3GNJA 2AAWA 4HUAA 1AXDA 3HYPA 4MA9A 2F8AA 1MDJA 5HFGA 1GUHA 2V6OA 2VO4A 1XIYA 5COHA 3PH9A 1GSDA 3VPTA 3P8WA 4FYUA 1W4VA 3ZVJD 4YQMA 3WGDA 1BG5A 1QUWA 4V2LA 1WP0A 1A23A 2VOCA 2RIIA 1GSEA 1M9AA 4N11A 3RHCA 5E59A 4ECJA 3G7YA 2MMAA 4HDEA 1TP9A 4ZXGA 3TRXA 2YV7A 4OO5A 2FA4A 2ALBA 3R2QA 5F06A 4I5QA 5IMDA 3GFKA 5DDLA 3KIJA 1JZRA 5HR0A 2GQMA 4MK3A 3QOUA 1GUKA 1XWBA 2LJRA 4KDYA 2IJYA 4TVEA 3JCML 5CP1A 3E3EA 2GGTA 1K3LA 3FY7A 4MPFA 1Y25A 4GQFA 3TOUA 5GAPD 1PA3A 2P5QA 2D2ZA 1TU7A 3QFAC 2FWHA 3LQ7A 2HNLA 6GSTA 1SKSB 2EIOA 3GSTA 1GTBA 4TR1A 1LJRA 2VCZA 2GSRA 4WXTA 5AN1A 4K9ZA 3KZQA 3C1SA 3FZAA 4MJAA 4I97A 5D73A 1GTAA 1Z7PA 4EL1A 5C00A 2HYXA 3IAM2 1K0DA 3PR8A 5IPHA 2OE1A 2C8UA 5DBQA 4G2EA 2HI7A 4IQAA 2WRTA 4WF4A 2R6KA 5AIXA 1JHBA 1I9DA 3NIVA 5JCGA 2XBIA 1THXA 5ELAA 5CRWA 1U87A 1GSYA 4KH7A 2LRCA 4NPBA 4I8BA 1SKWB 4XTSA 3RPNA 1TRVA 1Z6NA 3QAVA 2LQOA 2PPTA 4YH2A 1R5PA 4FYCA 5AGYA 3TCOA 1YJ6A 3IOSA 5ECKB 3PINA 2WCIA 2LQQA 1ZL9A 2OE0A 3L0HA 2G2QA 3ISOA 3DXBA 4GCIA 3EU3A 1OVNA 3HHVA 2DSAA 4MLYA 4I2UA 4Z7XA 1WRYA 2B7JA 2FA8A 2RLIA 3LJRA 5CAXA 2L57A 2CVKA 4IJ3A 4WETA 2PU9C 3SBCA 2YWIA 2FY6A 3FZ9A 5DCGA 1JZWA 3TKRA 1A8LA 4F03A 1N2AA 4TR3A 1VF3A 5F07A 2CX4A 5G30A 1DSBA 1IYHA 2XBQA 1ERVA 1K0NA 3W8SA 1EP8A 1O81A 1LU4A 1PL2A 3IRAA 1B4QA 1FO5A 1Z6MA 1YZXA 4I6XA 4POMA 4ECCA 3LYKA 4JEDA 2IMEA 2LNTA 4POKA 4F0BA 3QAWA 2EIQA 4HU7A 2V41A 4OCEA 2H72A 3RAZA 2VL9A 1DE2A 2NVLA 2H19A 1Z5YE 1X5CA 4AJ8A 1B4PA 1F9MA 4RUVA 4WR4A 3ED3A 3TGZA 3BCIA 2KLXA 3UVTA 3ZITA 5IMCA 1YEPA 4EE0A 2MBTA 2X64A 3MSZA 6GSVA 2P31A 3VWUA 2HLSA 4ZILA 3P7XA 5JWRB 2PN8A 3M0FA 3ME8A 4FO5A 2NDOA 5ECMB 5G2ZA 2OBKA 3KM6A 5A4UA 4BWQA 5IMZA 1F3BA 2GSTA 5DJLA 2JZSA 2B3SA 2E2MA 4F82A 4AF2A 2LJAA 4CHSA 4PGTA 3QPMA 3O6TA 1SJZA 4KX4A 1AQVA 1XOBA 1WIKA 1TDIA 2OACA 5AIVA 4IJIA 4KDXA 2FNOA 2I3YA 5ELGA 2JSYA 3ZRDA 1F2EA 2DMLA 2BMXA 1K0OA 1SJIA 2IWTA 3FK8A 2H0IA 4HS1A 1GSQA 2C0FA 3CYNA 4L5LA 4MJCA 1QMVA 1SYRA 2BTOT 1EEMA 4EDZA 5ABRA 2AV4A 1MEKA 2R37A 4GSSA 2H6ZA 4LL4B 3HJOA 3KTLA 1MDKA 3MDKA 1UC7A 4QL7A 4TRXA 3MWHA 1ERUA 1TOFA 4KAEA 4XRAA 1PKWA 4BL7A 3J7Yk 1PGTA 4G9HA 3TKSC 1R4WA 4LLRA 1TK8B 1TTZA 2RUEA 2H0GA 3VWVA 5FT3A 2NPBA 4IVFA 5HR3A 4TR4A 2B5YA 1X9MB 3QDNA 3KD0A 3GN3A 2CAQA 3VURA 5IQYA 3F4SA 4OWYA 1MDIA 4YQUA 6GSSA 1Z9HA 2IMFA 1VF2A 2YZUA 4NAXA 1S3AA 2VLTA 3A2XA 2VD0A 5H5RA 2E2GA 3ERWA 1EV9A 5IIZA 4PQ1A 1FVJA 3VI5A 1GLPA 18GSA 3GX8A 4K2DA 1U88A 1SL2B 3HVSA 3US3A 1LBKA 3D4TA 4OFMA 4H86A 1XVQA 2VIMA 2LTKA 5D9WA 4TKYA 1ZGNA 2VL2A 1NW2A 4KSOA 20GSA 2JL4A 3CSIA 3EMXA 1X5DA 1T3BA 2GQKA 4ZB8A 2CQ9A 1YKCA 3F3QA 1E6BA 1OC9B 1AUCA 4YAVA 4WBRD 3QMXA 2E0QA 2KOKA 5ECLB 4BWSA 1W89A 5DQYA 5H5QA 4TXOA 5J9BA 5D96A 2C0EA 5LNKe 4GQCA 2XHFA 4O92A 4ZBBA 3GKNA 3HKRA 3LYPA 1MD4A 3UMAA 2FD3A 1EP7A 2P0GA 5ECPB 3GKMA 3F6DA 1SK0A 4AJ7A 2O87A 3IK9A 1M9BA 1GL8A 3APOA 1OE7A 2B6MA 1ON4A 2YV9A 4KNDA 2H1BA 2IMDA 3D5JA 2KP2A 2A2SA 1GLQA 3A2WA 3ZYWA 5EL8A 2V6KA 2H1AA 1XOAA 1GSFA 3HZ8A 2H70A 4IELA 2IFQA 3IV4A 4TXVA 4MMMA 1ZZYA 3ZFLA 4MZCA 1V2AA 4P3YB 1XXUA 1HNBA 3DGQA 3L9VA 5J9CA 2F9SA 2O85A 3DD3A 2OKAA 3H79A 1K0AA 3HJPA 3H93A 1UVZA 4KW6A 3CMIA 4DEJA 1G6YA 6GSWA 1X9WB 1S3DA 1B9YC 4ZIJA 3KEBA 1KEBA 1EGOA 4LL1B 4V2NA 4XS4A 2NBSA 2H6YA 3BCKA 3GH6A 2H76A 1DBYA 5D8IA 3W8JA 3FZ5A 5ECHB 1WWJA 3KP8A 1A2MA 5ECNB 2OA7A 5EPFA 3ZL5A 1J08A 1OE8A 4EF0A 4MH2A 4K1FA 2M72A 1XFLA 4HQSA 3WD6A 5G5EA 5EVOA 3PGTA 4LA1A 14GSA 5GSSA 3QR6A 1J0FA 3O76A 1PL1A 1V58A 1RQMA 2L4CA 1O8WA 3TKSE 5D9XA 2X99A 1OC8A 2YOIA 4O7HA 4XS6A 3WYWA 1WPIA 3CTFA 1YKAA 2GSSA 1GNWA 3ZMLA 3QCPA 3C71A 3D22A 2PWJA 3EC3A 5IMFA 1OKTA 3TJJA 2CAIA 3DMLA 3VWXA 4IQ1A 1XW9A 1T4YA 3GH9A 5A4WA 3FR3A 2F8FA 3RDWA 4PUAA 1ILOA 4IS0A 5F8BA 5DAKA 5J3RA 1YDKA 4V1Ag 4J57E 3TB2A 1XW6A 3APSA 1SL0B 1ZOFA 4IN0A 2X8GA 2GZZA 1PQNA 4MF6A 2REMA 1TK0B 2K8SA 3ZFBA 3UIWA 2YWNA 2VCXA 4HZ4A 1SU9A 4WKWA 4Q5QA 3LSZA 3HXSA 3EWLA 2WS2A 4F9ZA 3U6VA 4ACSA 5AISA 3DRNA 2B7KA 4O5RA 2XPEA 3LORA 1XBSA 4WEYA 1AW9A 3GL5A 3WT2A 3F8UA 3A2VA 3E0UA 3L9UA 2ES7A 5IO0A 3HD5A 1TKDB 1PSQA 1RW1A 2AB6A 1QK8A 2G0FA 3GTUB 3I69A 1Y6EA 2K9FA 2QGVA 1FHEA 2H30A 3ZTLA 1K3YA 4AGSA 5HQPA 1NHOA 2LS5A 2DJ3A 4YQVA 3IDVA 3DYRA 4E8HA 3S9FA 1X9SB 1T4ZA 3I43A 1M7TA 4OFTA 2IPAA 1TRWA 5J5NA 3F63A 2CZ3A 1WJKA 2PBJA 1OC3A 1O8XA 1V40A 1ML6A 3KTBA 3LGCA 1GTUA 4K6XA 3FHKA 3DKSA 2PVQA 4HU9A 2H71A 3CSJA 3IC4A 4X0XA 4PQIA 3EURA 2EIRA 4HJ2A 1F37A 2P5RA 1A2JA 2HZEB 1ZCPA 1N8JA 1EV4A 2NTOA 1YF1A 2VAFA 3UARA 1FG4A 2DLXA 2YJ7A 11GSA 2WB9A 3HVXA 3MNGA 5J41A 3D6IA 4BVXA 3WGEA 3NZNA 4IP1A 2YCDA 5DALB 3FKFA 4MCUA 2GZPA 1XWGA 4GF0A 3WGXA 1PMTA 3VK9A 4PNFA 4DSSA 2H1GA 2GTUA 3APQA 3FYGA 4ZBAA 1OAZA 3TJKA 5B6NA 2KP1A 1TI3A 1JLVA 1YF0A 5CRDA 3CSHA 1PD21 2PMTA 3M1GA 4MDCA 3TOTA 2C4JA 4EO3A 3DEXA 1SJ6A 4K7NA 5D9TA 1C72A 1J9BA 2L4QA 3F4TA 3W6GA 3G7JA 1THOA 1PN9A 4OD7A 2C0DA 1K0MA 2RM6A 2MBSA 2MMZA 4JRRA 3GYKA 3DVWA 4BA7A 2GDRA 3TJBA 5FHIA 5HR1A 4F0CA 1G0TA 1GWCA 3FW2A 2QKEA 2C0GA 1GH2A 2HXKA 1QQ2A 4CDOA 4D73B 5KEJA 3WT1A 3F3RA 4MZWA 3F6FA 4DVCA 1HYUA 2LNSA 3IA1A 4EC0A 1U3IA 4XRDA 3IK7A 3UOMA 3F0IA 5GSTA 4POBA 2FCHA 5ECQB 3TRPA 3N9JA 5KN1A 3LFLA 5IO2A 2FWEA 3M8NA 3P2AA 2MMNA 4E8EA 2DJJA 2LKUA 3EYTA 5GAND 2A2RA 1IYIA 4FH8A 4RQXA 1Q98A 3QFBC 5KN0A 2FWFA 4IKHA 1O73A 3UBKA 3L78A 4WR5A 2QC7A 1M0UA 1SK2A 3FR6A 2LRNA 5ENUA 1XVWA 1OYJA 2JZRA 4ZL9A 4PUFC 1M99A 3BOAA 12GSA 3ME7A 1SENA 3BD2A 4N30A 1GRXA 1KNGA 4JE1A 1AAZA 1FAAA 3V1WA 4TR0A 3I9V2 4FYBA 1VGLA 1EOGA 5ECSA 3OR5A 1GSUA 3ZREA 4KCAA 1HNAA 2RUFA 1ERTA 1M2AA 1PRXA 4XHMA 4JBBA 4POLA 2I81A 4MF7A 2V32A 2YWOA 4Q5NA 1YQ1A 3CRUA 1FOVA 1HQOA 4L0WA 3TUEA 2TRXA 3A5WA 2VCWA 4OFNA 1EEJA 2JADA 5CREA 3GKKA 1EOHA 4XIHA 2LRTA 5H5SA 2L5OA 1E2YA 1WE0A 3UBLA 5IOXA 3EINA 2CX3A 4K0NA 3VPQA 3QD9A 1A0RP 3VWWA 3VI7A 1GP1A 2GVPA 1I5GA 3GURA 3GKXA 4TOPA 5C04A 2O7KA 1U6TA 2X8HA 5HFIA 2O8VB 2GLRA 3HDCA 2OADA 2B5XA 3D0ZA 4HI7A 1O85A 3CTGA 4AJ6A 5L71A 3FRCA 2YNXA 4ZL8A 2GQLA 1BJXA 4OMVA 1WMJA 1GNEA 2H6XA 5LD0A 3KXOA 2AJQB 2I1UA 4N0VA 5IMAA 2LEGA 3H8QA 2L59A 2VUPA 3HCZA 3BBYA 1ST9A 2M80A 2PGTA 3CBUA 2WGRA 3TKSA 2LV3A 2C1YA 2E7PA 2I4AA 2IMKA 2C3NA 3HY2A 4ZL7A 2FHEA 3IR4A 1DE1A 1B9XC 1YY7A 4J2FA 5G1LA 5ECIB 1QFNA 1R5AA 2DJ0A 2KHPA 2WULA 4EXJA 1QGVA 2VLVA 2HZFA 3IBHA 4GXZA 4ULXA 1FB0A 2DMMA 3M9KA 1USBA 2MYGA 2L5LA 4GTUA 1CQHA 4GRFA 5HR2A 2H74A
chains in the Genus database with same CATH superfamily
1URMA 2B1KA 3J7Yb 1SL1B 1NHYA 2IIYA 2K6VA 4HOJA 1XW5A 4I2TA 4KA0A 4GSTA 4RI7A 3A3TA 1G7EA 5CRHA 5CO3A 1SD9A 2HE3A 1VRSD 2JACA 2B1LA 2ON5A 3IHQA 3H1NA 3KH7A 4WBJA 1BYEA 2LJKA 5DVBA 4JU5A 3ZVJA 4N10A 4ILFA 1FVKA 4EVMA 1B8XA 4MH3A 2GT5A 3P90A 2J23A 1NM3A 2FLSA 4KSMA 4EKZA 3ZZXA 4O5UA 2X8CA 4X4JA 1PX7A 1JZDA 4D73A 3FR9A 1Z7RA 2EC4A 1ACVA 3HJMA 4L8EA 2R2JA 5CYYA 2OBIA 3HZ4A 4PX1A 3KP9A 2B5EA 1DUGA 2VCTA 1TK5B 22GSA 2VM1A 4MJBA 3ERFA 1K0BA 3IAS2 2HT9A 5IM9A 3RHBA 1V9WA 3GUSA 4KUNA 1AIUA 3IE3A 3KJYA 2PUKC 1EZKA 1JLWA 1GULA 5A5KA 1K0CA 3L4NA 2JU5A 2YZHA 4BL7B 4V1Ap 1X5EA 3C8EA 4Q5FA 1FW1A 3GMFA 3UL3A 2YN1A 3TJFA 2TRCP 2R5GA 3TJGA 3GL3A 2GSQA 4QL9A 2WJUA 1ZYQB 1AC1A 2K8VA 3GRXA 4RI6A 1T8EB 2VD1A 2F3MA 5ECOB 2AYTA 1ZYEA 3D4MA 4X1UA 1ZYPA 4NWYA 5IPGA 2VL3A 3TKQA 2DBCA 1A24A 3EU4A 2ZNMA 1EGRA 1X0RA 2PERA 4ID0A 2TIRA 3Q6OA 2CV4A 3IXRA 1TU8A 2H75A 7GSSA 5IOWA 1UA5A 4ZBDA 2KUCA 2CVDA 3GIXA 4MPGA 4BPYA 5B8BA 3Q19A 2N5AA 2DJ2A 2YJHA 4Q5RA 1PKZA 2IMIA 1T7PB 3GHAA 9GSSA 2I9HA 8GSSA 5LCZA 4CY8A 5FWGA 1R26A 4JR4A 5GZZB 2LUSA 4YAPA 4FIWA 4F2IA 3RBTA 4MP4A 1OKDA 4OCFA 4PNGA 4IW9A 3LWAA 2RM5A 5B8AA 2H8LA 2IN3A 4PURA 5ID2B 3KMNA 2VCQA 4LMWA 1TRUA 2OE3A 2N5FA 2BJXA 2YWMA 2WZ9A 2A4HA 4ZB6A 1AQWA 1OC9A 1JZOA 3EVIA 1QXHA 2GS3A 2H66A 4TXOB 3K8NA 3KMOA 1SKRB 2LSTA 1NSWA 4DSQA 2Z9SA 2CZ2A 4ECIA 5INYA 2ON7A 4YKFA 1Z3EA 4Z2TA 2A4VA 2AUVA 3U5RE 4G0LA 5B7CA 4KDUA 4HEA2 4GWRA 4O32A 5IMVA 1ERWA 3KGKA 3SWLA 1TW9A 4V2MA 2MMOA 3M9JA 1ABAA 1TRSA 3BJ5A 4RQRA 2WFCA 2IFQB 3LG6A 4HSCX 4QQ7A 1VF4A 1F3AA 3HVVA 2H1DA 3N5OA 4PXOA 3AY8A 3KCMA 4BVYA 4GLTA 4J56E 4MNNA 5B6MA 2FWGA 3MYDA 1V57A 5JWOB 5EY6A 3DWVA 1A2LA 3IPZA 19GSA 2ZCTA 2YP6A 1RK4A 3G7IA 4JZQA 1KBNA 4K8MA 5DQSA 2CT6A 5DJMA 6GSXA 3QAGA 4LMVA 1XWKA 5KN2A 2VM2A 4K7IA 4KB3A 3Q74A 3UJ1A 1MD3A 4XS4B 2DC5A 3C7MA 3ZMKA 4EUYA 4KE3A 2HRNA 2CA8A 1ZYNA 3CXGA 4K0GA 1B48A 2H0HA 4XS1A 1T1VA 2H73A 1KTEA 2C80A 5JCWA 1SK1A 4HZ2A 5CRGA 2IL3A 2H01A 6GSYA 4CW9A 4MJEA 5F05A 2VL2C 2O89A 3GX0A 2CVBA 4ML1A 4NHZA 2DIZA 3FEUA 2F51A 3LEFA 3ZIJA 2GZYA 3D21A 1BX9A 1TJDA 16GSA 17GSA 1M2BA 4K7OA 4IP6A 3UAPA 2R4VA 3ERGA 5BMUA 3GA4A 2QA2A 1WOUA 1F6MC 3VFIA 5DCHA 2K18A 3ZLPA 1G6WA 2HRFA 2VCVA 5G31A 4TW5A 5DAKB 1R7HA 1SYXA 4ZB9A 4G19A 4TR1B 1Q4JA 2ZUPA 4G10A 1GTIA 3RPPA 5F0GA 3UVHA 3HA9A 1YEXA 1HD2A 3NOFA 3G9BA 2C3QA 4K5RA 4L5OA 3UEMA 3CRTA 4NV2A 4IBPA 4BIKA 3MAKA 3FZ4A 2C3TA 3E9JB 4KCEA 3EMPA 4EDYA 3PPUA 4WF5A 1TI1A 4HJMA 3C1RA 5JWQB 2FGXA 2YANA 4GSNA 1H75A 5D9VA 1FB6A 1K3OA 4ISDA 4N0ZA 1H4OA 10GSA 2VLUA 2XPDA 1EWXA 3H4KA 3LXTA 3GTUA 5G5FA 5KN3A 1MTCA 3DIEA 5A4VA 2HSYA 3EE2A 1GSSA 3TRQA 1V98A 5CNWA 4JR6A 2L6CA 5G1KA 3I6AA 3TDGA 1PX6A 2V1MA 3GSSA 2R3XA 5ECRB 1XZOA 2FUG2 1XWCA 1BEDA 3O3TA 3VLNA 1HNCA 2WDUA 2J9HA 5ID2A 4NV5A 3F4RA 2DJ1A 2DJKA 1U3AA 4NMUA 3M3MA 2PVOC 2MZCA 5J4UA 1VF1A 3Q18A 2QSIA 2OJLA 1ZMAA 4IHUA 2AHEA 2DIYA 3LXZA 2HZEA 1A0FA 1O7UA 2X49A 2M46A 13GSA 1XCCA 3ZIVA 3TKPA 1T00A 2N5BA 1M2DA 3C73A 4L0UA 1XPVA 3KH9A 6GSUA 1BQ7A 2HSHA 1JFUA 4XCSA 4NXIA 1G7OA 4KGIA 3DVXA 3L9SA 4MZBA 1XWAA 1S3CA 4ML6A 4NHWA 2GT6A 4BVXB 2R0GA 3F9UA 3GV1A 4OO4A 5HFKA 1BAYA 1GUMA 1SD8A 5DALA 1CQGA 2JSZA 2JZTA 4X43A 4TN8A 4MF5A 4DSRA 4DSSB 2L6DA 4MABA 2XC2A 4HQZA 1AQXA 4ECBA 2YPMA 1O6JA 5JCUA 1TXXA 1UN2A 2V2GA 2HFDA 4IGJA 5E4WA 5D93A 1A8YA 4PQHA 3GNJA 2AAWA 4HUAA 1AXDA 3HYPA 4MA9A 2F8AA 1MDJA 5HFGA 1GUHA 2V6OA 2VO4A 1XIYA 5COHA 3PH9A 1GSDA 3VPTA 3P8WA 4FYUA 4O5QA 1W4VA 3ZVJD 4YQMA 3WGDA 1BG5A 1QUWA 4V2LA 1WP0A 1A23A 2VOCA 2RIIA 1GSEA 1M9AA 4N11A 3RHCA 5E59A 4ECJA 3G7YA 2MMAA 4HDEA 1TP9A 4ZXGA 3TRXA 2YV7A 4OO5A 2FA4A 4PTSA 2ALBA 3R2QA 5F06A 4I5QA 4K2XA 3GFKA 5DDLA 5IMDA 3KIJA 1JZRA 5HR0A 2GQMA 4MK3A 3QOUA 1GUKA 1XWBA 2LJRA 4KDYA 2IJYA 4TVEA 3JCML 5CP1A 3E3EA 2GGTA 1K3LA 3FY7A 4MPFA 1Y25A 4GQFA 3TOUA 5GAPD 1PA3A 2P5QA 2D2ZA 1TU7A 3QFAC 2FWHA 3LQ7A 2HNLA 6GSTA 1SKSB 2EIOA 3GSTA 1GTBA 4TR1A 1LJRA 2VCZA 2GSRA 3LW9A 4WXTA 5AN1A 4K9ZA 3KZQA 3C1SA 3FZAA 4MJAA 4I97A 5D73A 1GTAA 4YKGA 1Z7PA 4EL1A 5C00A 2HYXA 3IAM2 1K0DA 4FQUA 3PR8A 5IPHA 2OE1A 2C8UA 5DBQA 4G2EA 2HI7A 4IQAA 2WRTA 4WF4A 2R6KA 5AIXA 1JHBA 1I9DA 2R0PA 3IHGA 3NIVA 5JCGA 2XBIA 1THXA 5ELAA 5CRWA 1U87A 1GSYA 4KH7A 2LRCA 4NPBA 4I8BA 1SKWB 4XTSA 3RPNA 1TRVA 1Z6NA 3QAVA 2LQOA 2PPTA 4YH2A 1R5PA 4FYCA 5AGYA 3TCOA 1YJ6A 3IOSA 5ECKB 3PINA 2WCIA 2LQQA 1ZL9A 2OE0A 3L0HA 2G2QA 3ISOA 3DXBA 4GCIA 3EU3A 1OVNA 3HHVA 2DSAA 4MLYA 4I2UA 4Z7XA 1WRYA 2B7JA 2FA8A 2RLIA 3LJRA 5CAXA 2L57A 2CVKA 4IJ3A 4WETA 2PU9C 3SBCA 2YWIA 4K5SA 2FY6A 3FZ9A 5DCGA 1JZWA 3TKRA 1A8LA 4F03A 1N2AA 4TR3A 1VF3A 5F07A 2CX4A 5G30A 1DSBA 1IYHA 2XBQA 1ERVA 1K0NA 3W8SA 1EP8A 1O81A 1LU4A 1PL2A 3IRAA 1B4QA 1FO5A 1Z6MA 1YZXA 4I6XA 4POMA 4ECCA 3LYKA 4JEDA 2IMEA 2LNTA 4POKA 4F0BA 3QAWA 2EIQA 4HU7A 2V41A 4OCEA 2H72A 3RAZA 2VL9A 1DE2A 2NVLA 2H19A 1Z5YE 1X5CA 4AJ8A 1B4PA 1F9MA 4RUVA 4WR4A 3ED3A 3TGZA 3BCIA 2KLXA 3UVTA 3ZITA 5IMCA 1YEPA 4EE0A 2MBTA 2X64A 3MSZA 6GSVA 2P31A 3VWUA 2HLSA 4ZILA 3P7XA 5JWRB 2PN8A 3M0FA 3ME8A 4FO5A 2NDOA 1PFOA 5ECMB 5G2ZA 2OBKA 3KM6A 5A4UA 4BWQA 5IMZA 1F3BA 2GSTA 5DJLA 2JZSA 2B3SA 2E2MA 4F82A 4AF2A 2LJAA 4CHSA 4PGTA 3QPMA 3O6TA 4CY6A 1SJZA 4KX4A 1AQVA 1XOBA 1WIKA 1TDIA 2OACA 5AIVA 4IJIA 4KDXA 2FNOA 2I3YA 5ELGA 2JSYA 3ZRDA 1F2EA 2DMLA 2BMXA 1K0OA 1SJIA 2IWTA 3FK8A 2H0IA 4HS1A 1GSQA 2C0FA 3CYNA 4L5LA 4MJCA 1QMVA 1SYRA 2BTOT 1EEMA 4EDZA 5ABRA 2AV4A 1MEKA 2R37A 4GSSA 2H6ZA 4LL4B 3HJOA 3KTLA 1MDKA 3MDKA 1UC7A 4QL7A 4TRXA 3MWHA 1ERUA 1TOFA 2X4AA 4KAEA 4XRAA 1PKWA 4BL7A 3J7Yk 1PGTA 4G9HA 3TKSC 1R4WA 4LLRA 1TK8B 1TTZA 2RUEA 2H0GA 3VWVA 5FT3A 2NPBA 4IVFA 5HR3A 4TR4A 2B5YA 1X9MB 3QDNA 3KD0A 3GN3A 2UZ8A 2CAQA 3VURA 5IQYA 3F4SA 4OWYA 4G0IA 1MDIA 4YQUA 6GSSA 1Z9HA 3A5IA 2IMFA 1VF2A 2YZUA 4NAXA 1S3AA 2VLTA 3A2XA 2VD0A 5H5RA 2E2GA 3ERWA 1EV9A 5IIZA 4PQ1A 1FVJA 3VI5A 1GLPA 18GSA 2DKHA 3GX8A 4K2DA 3IC8A 1U88A 1SL2B 3HVSA 3US3A 1LBKA 3D4TA 4OFMA 5KOXA 4H86A 1XVQA 2VIMA 2LTKA 5D9WA 4TKYA 1ZGNA 2VL2A 1NW2A 4KSOA 20GSA 2JL4A 3CSIA 3EMXA 1X5DA 1T3BA 2GQKA 4ZB8A 2CQ9A 1YKCA 3F3QA 1E6BA 1OC9B 1AUCA 4YAVA 4WBRD 3QMXA 2E0QA 2KOKA 5ECLB 4BWSA 1W89A 5DQYA 5H5QA 4TXOA 5J9BA 5D96A 2C0EA 5LNKe 4GQCA 2XHFA 4O92A 4ZBBA 3GKNA 3HKRA 3LYPA 1MD4A 3UMAA 2FD3A 1EP7A 2P0GA 5ECPB 3GKMA 3F6DA 1SK0A 4AJ7A 2O87A 3IK9A 1M9BA 1GL8A 3APOA 1OE7A 2B6MA 1ON4A 2YV9A 4KNDA 2H1BA 2IMDA 3D5JA 2KP2A 2A2SA 1GLQA 3A2WA 3ZYWA 5EL8A 2V6KA 2H1AA 1XOAA 1GSFA 3HZ8A 2H70A 4IELA 2IFQA 3IV4A 4TXVA 4MMMA 1ZZYA 3ZFLA 4MZCA 4USSA 1V2AA 4P3YB 1XXUA 1HNBA 3DGQA 3L9VA 5J9CA 2F9SA 2O85A 3DD3A 2OKAA 3H79A 1K0AA 3HJPA 3H93A 1UVZA 4KW6A 3CMIA 4DEJA 1G6YA 6GSWA 1X9WB 1S3DA 1B9YC 4ZIJA 3KEBA 1KEBA 1EGOA 4LL1B 4V2NA 4XS4A 2NBSA 2H6YA 3BCKA 3GH6A 2H76A 1DBYA 5D8IA 3W8JA 3FZ5A 5ECHB 1WWJA 3KP8A 4EIPA 1A2MA 5ECNB 2OA7A 5EPFA 3ZL5A 1J08A 1OE8A 4EF0A 4MH2A 4K1FA 2M72A 1XFLA 4Z2RA 4HQSA 3WD6A 5G5EA 5EVOA 3PGTA 4LA1A 14GSA 5GSSA 3QR6A 1J0FA 3O76A 1PL1A 1V58A 1RQMA 2L4CA 1O8WA 3TKSE 5D9XA 2X99A 1OC8A 2YOIA 4O7HA 4XS6A 3WYWA 1WPIA 3CTFA 1YKAA 2GSSA 1GNWA 3ZMLA 3QCPA 3C71A 3D22A 2PWJA 3EC3A 5IMFA 1OKTA 3TJJA 2CAIA 3DMLA 3VWXA 4IQ1A 1XW9A 1T4YA 3GH9A 5A4WA 3FR3A 2F8FA 3RDWA 4PUAA 1M3JA 1ILOA 4IS0A 5F8BA 2HRAA 5DAKA 5J3RA 1YDKA 4V1Ag 4J57E 3TB2A 1XW6A 3APSA 1SL0B 1ZOFA 4IN0A 2X8GA 5KOWA 2GZZA 1PQNA 1XG8A 4MF6A 2REMA 1TK0B 2K8SA 3ZFBA 3UIWA 2YWNA 3HVNA 2VCXA 4HZ4A 1SU9A 4WKWA 4Q5QA 3LSZA 3HXSA 3EWLA 2WS2A 4F9ZA 3U6VA 4ACSA 5AISA 3DRNA 2B7KA 4O5RA 2XPEA 3LORA 1XBSA 4WEYA 1AW9A 3GL5A 3WT2A 3F8UA 3A2VA 3E0UA 3L9UA 2ES7A 5IO0A 3HD5A 1TKDB 1PSQA 1RW1A 2AB6A 1QK8A 2G0FA 3GTUB 3I69A 1Y6EA 2K9FA 4ICYA 2QGVA 1FHEA 2H30A 3ZTLA 1K3YA 4AGSA 5HQPA 1NHOA 2LS5A 2DJ3A 1FOHA 4YQVA 3IDVA 3DYRA 4E8HA 3S9FA 1X9SB 1T4ZA 3I43A 1M7TA 4OFTA 2IPAA 1TRWA 5J5NA 3F63A 2CZ3A 1WJKA 2PBJA 1OC3A 1O8XA 5BRTA 1V40A 1ML6A 3KTBA 3LGCA 1GTUA 4K6XA 3FHKA 3DKSA 2PVQA 4HU9A 2H71A 3CSJA 3IC4A 4X0XA 4PQIA 3EURA 2EIRA 1PN0A 4HJ2A 1F37A 2P5RA 1A2JA 2HZEB 1ZCPA 1N8JA 1EV4A 2NTOA 1YF1A 2VAFA 3UARA 1FG4A 2DLXA 2YJ7A 11GSA 2WB9A 3HVXA 3MNGA 5J41A 3D6IA 4BVXA 3WGEA 3NZNA 4IP1A 2YCDA 5DALB 3FKFA 4MCUA 2GZPA 1XWGA 4KF9A 4GF0A 3WGXA 1PMTA 3VK9A 4PNFA 4DSSA 2H1GA 2GTUA 3APQA 3FYGA 4ZBAA 1OAZA 3TJKA 5B6NA 2KP1A 1TI3A 1JLVA 1YF0A 2DKIA 5CRDA 3CSHA 1PD21 2PMTA 3M1GA 4MDCA 3TOTA 2C4JA 4EO3A 3DEXA 1SJ6A 4K7NA 5D9TA 1C72A 1J9BA 2L4QA 3F4TA 3W6GA 3G7JA 1THOA 1PN9A 4OD7A 2C0DA 1K0MA 2RM6A 2MBSA 2MMZA 3CQFA 4JRRA 3GYKA 3DVWA 4BA7A 2GDRA 3TJBA 5FHIA 5HR1A 4F0CA 1G0TA 1GWCA 3FW2A 2QKEA 2C0GA 1GH2A 2HXKA 1QQ2A 4CDOA 4D73B 5KEJA 3WT1A 3F3RA 4MZWA 3F6FA 4DVCA 1HYUA 2LNSA 3IA1A 4EC0A 1U3IA 2A2PA 4XRDA 3IK7A 3UOMA 3F0IA 5GSTA 4POBA 2FCHA 5ECQB 3TRPA 3N9JA 5KN1A 3LFLA 5IO2A 2FWEA 3M8NA 3P2AA 2MMNA 4E8EA 4A5PA 2DJJA 2LKUA 3EYTA 5GAND 4G0KA 2A2RA 1IYIA 4FH8A 4RQXA 1Q98A 3QFBC 5KN0A 2FWFA 4IKHA 1O73A 3UBKA 3L78A 4WR5A 2QC7A 1M0UA 1SK2A 3FR6A 2LRNA 5ENUA 1XVWA 1OYJA 2JZRA 4ZL9A 4PUFC 1M99A 3BOAA 12GSA 3ME7A 1SENA 3BD2A 4N30A 1GRXA 1KNGA 4JE1A 1AAZA 1FAAA 3V1WA 4Z2UA 4TR0A 3I9V2 4FYBA 1VGLA 1EOGA 5ECSA 3OR5A 1GSUA 3ZREA 4KCAA 1HNAA 2RUFA 1ERTA 1M2AA 1PRXA 2HRKA 4XHMA 4JBBA 4POLA 2I81A 4MF7A 2V32A 2YWOA 4Q5NA 1YQ1A 3CRUA 1FOVA 1HQOA 4L0WA 3TUEA 2TRXA 3A5WA 2VCWA 4OFNA 1EEJA 2JADA 5CREA 3GKKA 1EOHA 4XIHA 2LRTA 5H5SA 2L5OA 1E2YA 1WE0A 3UBLA 5IOXA 3EINA 2CX3A 4K0NA 3VPQA 2QA1A 3QD9A 1A0RP 3R3EA 3VWWA 3VI7A 1GP1A 2GVPA 1I5GA 3GURA 3GKXA 4TOPA 5C04A 2O7KA 1U6TA 2X8HA 5HFIA 2O8VB 2GLRA 3HDCA 2OADA 3MIXA 2B5XA 3D0ZA 1S3RA 4HI7A 1O85A 3CTGA 1M3IA 4AJ6A 5L71A 3FRCA 2YNXA 4ZL8A 2GQLA 3EPTA 1BJXA 4OMVA 1WMJA 1GNEA 2H6XA 5LD0A 3KXOA 2AJQB 2I1UA 4N0VA 3FMWA 5IMAA 2LEGA 3H8QA 2L59A 2VUPA 3HCZA 3BBYA 1ST9A 2M80A 2PGTA 3CBUA 2WGRA 3TKSA 2LV3A 2C1YA 2E7PA 2I4AA 2IMKA 2C3NA 3HY2A 4ZL7A 2FHEA 3IR4A 1DE1A 1B9XC 1YY7A 4J2FA 5G1LA 5ECIB 1QFNA 1R5AA 2DJ0A 2R0CA 2KHPA 2WULA 4EXJA 1QGVA 2VLVA 2HZFA 3IBHA 4GXZA 4ULXA 1FB0A 2DMMA 3M9KA 4BVYB 4EIQA 1USBA 2HSMA 2MYGA 2L5LA 4GTUA 1CQHA 4GRFA 5HR2A 2H74A
chains in the Genus database with same CATH topology
1URMA 2B1KA 3J7Yb 1SL1B 1NHYA 2IIYA 2K6VA 4HOJA 1XW5A 4I2TA 4KA0A 4GSTA 4RI7A 3A3TA 1G7EA 5CRHA 5CO3A 1SD9A 2HE3A 1VRSD 2JACA 2B1LA 2ON5A 3IHQA 3H1NA 3KH7A 4WBJA 1BYEA 2LJKA 5DVBA 4JU5A 3ZVJA 4N10A 4ILFA 1FVKA 4EVMA 1B8XA 4MH3A 2GT5A 3P90A 2J23A 1NM3A 2FLSA 4KSMA 4EKZA 3ZZXA 4O5UA 2X8CA 4X4JA 1PX7A 1JZDA 4D73A 3FR9A 1Z7RA 2EC4A 1ACVA 3HJMA 4L8EA 2R2JA 5CYYA 2OBIA 3HZ4A 4PX1A 3KP9A 2B5EA 1DUGA 2VCTA 1TK5B 22GSA 2VM1A 4MJBA 3ERFA 1K0BA 3IAS2 2HT9A 5IM9A 3RHBA 1V9WA 3GUSA 4KUNA 1AIUA 3IE3A 3KJYA 2PUKC 1EZKA 1JLWA 1GULA 5A5KA 1K0CA 3L4NA 2JU5A 2YZHA 4BL7B 4V1Ap 1X5EA 3C8EA 4Q5FA 1FW1A 3GMFA 3UL3A 2YN1A 3TJFA 2TRCP 2R5GA 3TJGA 3GL3A 2GSQA 4QL9A 2WJUA 1ZYQB 1AC1A 2K8VA 3GRXA 4RI6A 1T8EB 2VD1A 2F3MA 5ECOB 2AYTA 1ZYEA 3D4MA 4X1UA 1ZYPA 4NWYA 5IPGA 2VL3A 3TKQA 2DBCA 1A24A 3EU4A 2ZNMA 1EGRA 1X0RA 2PERA 4ID0A 2TIRA 3Q6OA 2CV4A 3IXRA 1TU8A 2H75A 7GSSA 5IOWA 1UA5A 4ZBDA 2KUCA 2CVDA 3GIXA 4MPGA 4BPYA 5B8BA 3Q19A 2N5AA 2DJ2A 2YJHA 4Q5RA 1PKZA 2IMIA 1T7PB 3GHAA 9GSSA 2I9HA 8GSSA 5LCZA 4CY8A 5FWGA 1R26A 4JR4A 5GZZB 2LUSA 4YAPA 4FIWA 4F2IA 3RBTA 4MP4A 1OKDA 4OCFA 4PNGA 4IW9A 3LWAA 2RM5A 5B8AA 2H8LA 2IN3A 4PURA 5ID2B 3KMNA 2VCQA 4LMWA 1TRUA 2OE3A 2N5FA 2BJXA 2YWMA 2WZ9A 2A4HA 4ZB6A 1AQWA 1OC9A 1JZOA 3EVIA 1QXHA 2GS3A 2H66A 4TXOB 3K8NA 3KMOA 1SKRB 2LSTA 1NSWA 4DSQA 2Z9SA 2CZ2A 4ECIA 5INYA 2ON7A 4YKFA 1Z3EA 4Z2TA 2A4VA 2AUVA 3U5RE 4G0LA 5B7CA 4KDUA 4HEA2 4GWRA 4O32A 5IMVA 1ERWA 3KGKA 3SWLA 1TW9A 4V2MA 2MMOA 3M9JA 1ABAA 1TRSA 3BJ5A 4RQRA 2WFCA 2IFQB 3LG6A 4QQ7A 1VF4A 1F3AA 3HVVA 2H1DA 3N5OA 4PXOA 3AY8A 3KCMA 4BVYA 4GLTA 4J56E 4MNNA 5B6MA 2FWGA 3MYDA 1V57A 5JWOB 5EY6A 3DWVA 1A2LA 3IPZA 19GSA 2ZCTA 2YP6A 1RK4A 3G7IA 4JZQA 1KBNA 4K8MA 5DQSA 2CT6A 5DJMA 6GSXA 3QAGA 4LMVA 1XWKA 5KN2A 2VM2A 4K7IA 4KB3A 3Q74A 3UJ1A 1MD3A 4XS4B 2DC5A 3C7MA 3ZMKA 4EUYA 4KE3A 2HRNA 2CA8A 1ZYNA 3CXGA 4K0GA 1B48A 2H0HA 4XS1A 1T1VA 2H73A 1KTEA 2C80A 5JCWA 1SK1A 4HZ2A 5CRGA 2IL3A 2H01A 6GSYA 4CW9A 4MJEA 5F05A 2VL2C 2O89A 3GX0A 2CVBA 4ML1A 4NHZA 2DIZA 3FEUA 2F51A 3LEFA 3ZIJA 2GZYA 3D21A 1BX9A 1TJDA 16GSA 17GSA 1M2BA 4K7OA 4IP6A 3UAPA 2R4VA 3ERGA 5BMUA 3GA4A 2QA2A 1WOUA 1F6MC 3VFIA 5DCHA 2K18A 3ZLPA 1G6WA 2HRFA 2VCVA 5G31A 4TW5A 5DAKB 1R7HA 1SYXA 4ZB9A 4G19A 4TR1B 1Q4JA 2ZUPA 4G10A 1GTIA 3RPPA 5F0GA 3UVHA 3HA9A 1YEXA 1HD2A 3NOFA 3G9BA 2C3QA 4K5RA 4L5OA 3UEMA 3CRTA 4NV2A 4IBPA 3MAKA 3FZ4A 2C3TA 3E9JB 4KCEA 3EMPA 4EDYA 3PPUA 4WF5A 1TI1A 4HJMA 3C1RA 5JWQB 2FGXA 2YANA 4GSNA 1H75A 5D9VA 1FB6A 1K3OA 4ISDA 4N0ZA 1H4OA 10GSA 2VLUA 2XPDA 1EWXA 3H4KA 3LXTA 3GTUA 5G5FA 5KN3A 1MTCA 3DIEA 5A4VA 2HSYA 3EE2A 1GSSA 3TRQA 1V98A 5CNWA 4JR6A 2L6CA 5G1KA 3I6AA 3TDGA 1PX6A 2V1MA 3GSSA 2R3XA 5ECRB 1XZOA 2FUG2 1XWCA 1BEDA 3O3TA 3VLNA 1HNCA 2WDUA 2J9HA 5ID2A 4NV5A 3F4RA 2DJ1A 2DJKA 1U3AA 4NMUA 3M3MA 2PVOC 2MZCA 5J4UA 1VF1A 3Q18A 2QSIA 2OJLA 1ZMAA 4IHUA 2AHEA 2DIYA 3LXZA 2HZEA 1A0FA 1O7UA 2X49A 2M46A 13GSA 1XCCA 3ZIVA 3TKPA 1T00A 2N5BA 1M2DA 3C73A 4L0UA 1XPVA 3KH9A 6GSUA 1BQ7A 2HSHA 1JFUA 4XCSA 4NXIA 1G7OA 4KGIA 3DVXA 3L9SA 4MZBA 1XWAA 1S3CA 4ML6A 4NHWA 2GT6A 4BVXB 2R0GA 3F9UA 3GV1A 4OO4A 5HFKA 1BAYA 1GUMA 1SD8A 5DALA 1CQGA 2JSZA 2JZTA 4X43A 4TN8A 4MF5A 4DSRA 4DSSB 2L6DA 4MABA 2XC2A 4HQZA 1AQXA 4ECBA 2YPMA 1O6JA 5JCUA 1TXXA 1UN2A 2V2GA 2HFDA 4IGJA 5E4WA 5D93A 1A8YA 4PQHA 3GNJA 2AAWA 4HUAA 1AXDA 3HYPA 4MA9A 2F8AA 1MDJA 5HFGA 1GUHA 2V6OA 2VO4A 1XIYA 5COHA 3PH9A 1GSDA 3VPTA 3P8WA 4FYUA 4O5QA 1W4VA 3ZVJD 4YQMA 3WGDA 1BG5A 1QUWA 4V2LA 1WP0A 1A23A 2VOCA 2RIIA 1GSEA 1M9AA 4N11A 3RHCA 5E59A 4ECJA 3G7YA 2MMAA 4HDEA 1TP9A 4ZXGA 3TRXA 2YV7A 4OO5A 2FA4A 4PTSA 2ALBA 3R2QA 5F06A 4I5QA 4K2XA 3GFKA 5DDLA 5IMDA 3KIJA 1JZRA 5HR0A 2GQMA 4MK3A 3QOUA 1GUKA 1XWBA 2LJRA 4KDYA 2IJYA 4TVEA 3JCML 5CP1A 3E3EA 2GGTA 1K3LA 3FY7A 4MPFA 1Y25A 4GQFA 3TOUA 5GAPD 1PA3A 2P5QA 2D2ZA 1TU7A 3QFAC 2FWHA 3LQ7A 2HNLA 6GSTA 1SKSB 2EIOA 3GSTA 1GTBA 4TR1A 1LJRA 2VCZA 2GSRA 3LW9A 4WXTA 5AN1A 4K9ZA 3KZQA 3C1SA 3FZAA 4MJAA 4I97A 5D73A 1GTAA 4YKGA 1Z7PA 4EL1A 5C00A 2HYXA 3IAM2 1K0DA 4FQUA 3PR8A 5IPHA 2OE1A 2C8UA 5DBQA 4G2EA 2HI7A 4IQAA 2WRTA 4WF4A 2R6KA 5AIXA 1JHBA 1I9DA 2R0PA 3IHGA 3NIVA 5JCGA 2XBIA 1THXA 5ELAA 5CRWA 1U87A 1GSYA 4KH7A 2LRCA 4NPBA 4I8BA 1SKWB 4XTSA 3RPNA 1TRVA 1Z6NA 3QAVA 2LQOA 2PPTA 4YH2A 1R5PA 4FYCA 5AGYA 3TCOA 1YJ6A 3IOSA 5ECKB 3PINA 2WCIA 2LQQA 1ZL9A 2OE0A 3L0HA 2G2QA 3ISOA 3DXBA 4GCIA 3EU3A 1OVNA 3HHVA 2DSAA 4MLYA 4I2UA 4Z7XA 1WRYA 2B7JA 2FA8A 2RLIA 3LJRA 5CAXA 2L57A 2CVKA 4IJ3A 4WETA 2PU9C 3SBCA 2YWIA 4K5SA 2FY6A 3FZ9A 5DCGA 1JZWA 3TKRA 1A8LA 4F03A 1N2AA 4TR3A 1VF3A 5F07A 2CX4A 5G30A 1DSBA 1IYHA 2XBQA 1ERVA 1K0NA 3W8SA 1EP8A 1O81A 1LU4A 1PL2A 3IRAA 1B4QA 1FO5A 1Z6MA 1YZXA 4I6XA 4POMA 4ECCA 3LYKA 4JEDA 2IMEA 2LNTA 4POKA 4F0BA 3QAWA 2EIQA 4HU7A 2V41A 4OCEA 2H72A 3RAZA 2VL9A 1DE2A 2NVLA 2H19A 1Z5YE 1X5CA 4AJ8A 1B4PA 1F9MA 4RUVA 4WR4A 3ED3A 3TGZA 3BCIA 2KLXA 3UVTA 3ZITA 5IMCA 1YEPA 4EE0A 2MBTA 2X64A 3MSZA 6GSVA 2P31A 3VWUA 2HLSA 4ZILA 3P7XA 5JWRB 2PN8A 3M0FA 3ME8A 4FO5A 2NDOA 5ECMB 5G2ZA 2OBKA 3KM6A 5A4UA 4BWQA 5IMZA 1F3BA 2GSTA 5DJLA 2JZSA 2B3SA 2E2MA 4F82A 4AF2A 2LJAA 4CHSA 4PGTA 3QPMA 3O6TA 4CY6A 1SJZA 4KX4A 1AQVA 1XOBA 1WIKA 1TDIA 2OACA 5AIVA 4IJIA 4KDXA 2FNOA 2I3YA 5ELGA 2JSYA 3ZRDA 1F2EA 2DMLA 2BMXA 1K0OA 1SJIA 2IWTA 3FK8A 2H0IA 4HS1A 1GSQA 2C0FA 3CYNA 4L5LA 4MJCA 1QMVA 1SYRA 2BTOT 1EEMA 4EDZA 5ABRA 2AV4A 1MEKA 2R37A 4GSSA 2H6ZA 4LL4B 3HJOA 3KTLA 1MDKA 3MDKA 1UC7A 4QL7A 4TRXA 3MWHA 1ERUA 1TOFA 2X4AA 4KAEA 4XRAA 1PKWA 4BL7A 3J7Yk 1PGTA 4G9HA 3TKSC 1R4WA 4LLRA 1TK8B 1TTZA 2RUEA 2H0GA 3VWVA 5FT3A 2NPBA 4IVFA 5HR3A 4TR4A 2B5YA 1X9MB 3QDNA 3KD0A 3GN3A 2UZ8A 2CAQA 3VURA 5IQYA 3F4SA 4OWYA 4G0IA 1MDIA 4YQUA 6GSSA 1Z9HA 3A5IA 2IMFA 1VF2A 2YZUA 4NAXA 1S3AA 2VLTA 3A2XA 2VD0A 5H5RA 2E2GA 3ERWA 1EV9A 5IIZA 4PQ1A 1FVJA 3VI5A 1GLPA 18GSA 2DKHA 3GX8A 4K2DA 3IC8A 1U88A 1SL2B 3HVSA 3US3A 1LBKA 3D4TA 4OFMA 5KOXA 4H86A 1XVQA 2VIMA 2LTKA 5D9WA 4TKYA 1ZGNA 2VL2A 1NW2A 4KSOA 20GSA 2JL4A 3CSIA 3EMXA 1X5DA 1T3BA 2GQKA 4ZB8A 2CQ9A 1YKCA 3F3QA 1E6BA 1OC9B 1AUCA 4YAVA 4WBRD 3QMXA 2E0QA 2KOKA 5ECLB 4BWSA 1W89A 5DQYA 5H5QA 4TXOA 5J9BA 5D96A 2C0EA 5LNKe 4GQCA 2XHFA 4O92A 4ZBBA 3GKNA 3HKRA 3LYPA 1MD4A 3UMAA 2FD3A 1EP7A 2P0GA 5ECPB 3GKMA 3F6DA 1SK0A 4AJ7A 2O87A 3IK9A 1M9BA 1GL8A 3APOA 1OE7A 2B6MA 1ON4A 2YV9A 4KNDA 2H1BA 2IMDA 3D5JA 2KP2A 2A2SA 1GLQA 3A2WA 3ZYWA 5EL8A 2V6KA 2H1AA 1XOAA 1GSFA 3HZ8A 2H70A 4IELA 2IFQA 3IV4A 4TXVA 4MMMA 1ZZYA 3ZFLA 4MZCA 4USSA 1V2AA 4P3YB 1XXUA 1HNBA 3DGQA 3L9VA 5J9CA 2F9SA 2O85A 3DD3A 2OKAA 3H79A 1K0AA 3HJPA 3H93A 1UVZA 4KW6A 3CMIA 4DEJA 1G6YA 6GSWA 1X9WB 1S3DA 1B9YC 4ZIJA 3KEBA 1KEBA 1EGOA 4LL1B 4V2NA 4XS4A 2NBSA 2H6YA 3BCKA 3GH6A 2H76A 1DBYA 5D8IA 3W8JA 3FZ5A 5ECHB 1WWJA 3KP8A 4EIPA 1A2MA 5ECNB 2OA7A 5EPFA 3ZL5A 1J08A 1OE8A 4EF0A 4MH2A 4K1FA 2M72A 1XFLA 4Z2RA 4HQSA 3WD6A 5G5EA 5EVOA 3PGTA 4LA1A 14GSA 5GSSA 3QR6A 1J0FA 3O76A 1PL1A 1V58A 1RQMA 2L4CA 1O8WA 3TKSE 5D9XA 2X99A 1OC8A 2YOIA 4O7HA 4XS6A 3WYWA 1WPIA 3CTFA 1YKAA 2GSSA 1GNWA 3ZMLA 3QCPA 3C71A 3D22A 2PWJA 3EC3A 5IMFA 1OKTA 3TJJA 2CAIA 3DMLA 3VWXA 4IQ1A 1XW9A 1T4YA 3GH9A 5A4WA 3FR3A 2F8FA 3RDWA 4PUAA 1ILOA 4IS0A 5F8BA 2HRAA 5DAKA 5J3RA 1YDKA 4V1Ag 4J57E 3TB2A 1XW6A 3APSA 1SL0B 1ZOFA 4IN0A 2X8GA 5KOWA 2GZZA 1PQNA 4MF6A 2REMA 1TK0B 2K8SA 3ZFBA 3UIWA 2YWNA 2VCXA 4HZ4A 1SU9A 4WKWA 4Q5QA 3LSZA 3HXSA 3EWLA 2WS2A 4F9ZA 3U6VA 4ACSA 5AISA 3DRNA 2B7KA 4O5RA 2XPEA 3LORA 1XBSA 4WEYA 1AW9A 3GL5A 3WT2A 3F8UA 3A2VA 3E0UA 3L9UA 2ES7A 5IO0A 3HD5A 1TKDB 1PSQA 1RW1A 2AB6A 1QK8A 2G0FA 3GTUB 3I69A 1Y6EA 2K9FA 4ICYA 2QGVA 1FHEA 2H30A 3ZTLA 1K3YA 4AGSA 5HQPA 1NHOA 2LS5A 2DJ3A 1FOHA 4YQVA 3IDVA 3DYRA 4E8HA 3S9FA 1X9SB 1T4ZA 3I43A 1M7TA 4OFTA 2IPAA 1TRWA 5J5NA 3F63A 2CZ3A 1WJKA 2PBJA 1OC3A 1O8XA 5BRTA 1V40A 1ML6A 3KTBA 3LGCA 1GTUA 4K6XA 3FHKA 3DKSA 2PVQA 4HU9A 2H71A 3CSJA 3IC4A 4X0XA 4PQIA 3EURA 2EIRA 1PN0A 4HJ2A 1F37A 2P5RA 1A2JA 2HZEB 1ZCPA 1N8JA 1EV4A 2NTOA 1YF1A 2VAFA 3UARA 1FG4A 2DLXA 2YJ7A 11GSA 2WB9A 3HVXA 3MNGA 5J41A 3D6IA 4BVXA 3WGEA 3NZNA 4IP1A 2YCDA 5DALB 3FKFA 4MCUA 2GZPA 1XWGA 4KF9A 4GF0A 3WGXA 1PMTA 3VK9A 4PNFA 4DSSA 2H1GA 2GTUA 3APQA 3FYGA 4ZBAA 1OAZA 3TJKA 5B6NA 2KP1A 1TI3A 1JLVA 1YF0A 2DKIA 5CRDA 3CSHA 1PD21 2PMTA 3M1GA 4MDCA 3TOTA 2C4JA 4EO3A 3DEXA 1SJ6A 4K7NA 5D9TA 1C72A 1J9BA 2L4QA 3F4TA 3W6GA 3G7JA 1THOA 1PN9A 4OD7A 2C0DA 1K0MA 2RM6A 2MBSA 2MMZA 4JRRA 3GYKA 3DVWA 4BA7A 2GDRA 3TJBA 5FHIA 5HR1A 4F0CA 1G0TA 1GWCA 3FW2A 2QKEA 2C0GA 1GH2A 2HXKA 1QQ2A 4CDOA 4D73B 5KEJA 3WT1A 3F3RA 4MZWA 3F6FA 4DVCA 1HYUA 2LNSA 3IA1A 4EC0A 1U3IA 2A2PA 4XRDA 3IK7A 3UOMA 3F0IA 5GSTA 4POBA 2FCHA 5ECQB 3TRPA 3N9JA 5KN1A 3LFLA 5IO2A 2FWEA 3M8NA 3P2AA 2MMNA 4E8EA 4A5PA 2DJJA 2LKUA 3EYTA 5GAND 4G0KA 2A2RA 1IYIA 4FH8A 4RQXA 1Q98A 3QFBC 5KN0A 2FWFA 4IKHA 1O73A 3UBKA 3L78A 4WR5A 2QC7A 1M0UA 1SK2A 3FR6A 2LRNA 5ENUA 1XVWA 1OYJA 2JZRA 4ZL9A 4PUFC 1M99A 3BOAA 12GSA 3ME7A 1SENA 3BD2A 4N30A 1GRXA 1KNGA 4JE1A 1AAZA 1FAAA 3V1WA 4Z2UA 4TR0A 3I9V2 4FYBA 1VGLA 1EOGA 5ECSA 3OR5A 1GSUA 3ZREA 4KCAA 1HNAA 2RUFA 1ERTA 1M2AA 1PRXA 2HRKA 4XHMA 4JBBA 4POLA 2I81A 4MF7A 2V32A 2YWOA 4Q5NA 1YQ1A 3CRUA 1FOVA 1HQOA 4L0WA 3TUEA 2TRXA 3A5WA 2VCWA 4OFNA 1EEJA 2JADA 5CREA 3GKKA 1EOHA 4XIHA 2LRTA 5H5SA 2L5OA 1E2YA 1WE0A 3UBLA 5IOXA 3EINA 2CX3A 4K0NA 3VPQA 2QA1A 3QD9A 1A0RP 3R3EA 3VWWA 3VI7A 1GP1A 2GVPA 1I5GA 3GURA 3GKXA 4TOPA 5C04A 2O7KA 1U6TA 2X8HA 5HFIA 2O8VB 2GLRA 3HDCA 2OADA 3MIXA 2B5XA 3D0ZA 4HI7A 1O85A 3CTGA 4AJ6A 5L71A 3FRCA 2YNXA 4ZL8A 2GQLA 3EPTA 1BJXA 4OMVA 1WMJA 1GNEA 2H6XA 5LD0A 3KXOA 2AJQB 2I1UA 4N0VA 3FMWA 5IMAA 2LEGA 3H8QA 2L59A 2VUPA 3HCZA 3BBYA 1ST9A 2M80A 2PGTA 3CBUA 2WGRA 3TKSA 2LV3A 2C1YA 2E7PA 2I4AA 2IMKA 2C3NA 3HY2A 4ZL7A 2FHEA 3IR4A 1DE1A 1B9XC 1YY7A 4J2FA 5G1LA 5ECIB 1QFNA 1R5AA 2DJ0A 2R0CA 2KHPA 2WULA 4EXJA 1QGVA 2VLVA 2HZFA 3IBHA 4GXZA 4ULXA 1FB0A 2DMMA 3M9KA 4BVYB 4EIQA 1USBA 2HSMA 2MYGA 2L5LA 4GTUA 1CQHA 4GRFA 5HR2A 2H74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1URM A;  2B1K A;  3J7Y b;  1SL1 B;  1NHY A;  2IIY A;  2K6V A;  4HOJ A;  1XW5 A;  4I2T A;  4KA0 A;  4GST A;  4RI7 A;  3A3T A;  1G7E A;  5CRH A;  5CO3 A;  1SD9 A;  2HE3 A;  1VRS D;  2JAC A;  2B1L A;  2ON5 A;  3IHQ A;  3H1N A;  3KH7 A;  4WBJ A;  1BYE A;  2LJK A;  5DVB A;  4JU5 A;  3ZVJ A;  4N10 A;  4ILF A;  1FVK A;  4EVM A;  1B8X A;  4MH3 A;  2GT5 A;  3P90 A;  2J23 A;  1NM3 A;  2FLS A;  4KSM A;  4EKZ A;  3ZZX A;  2X8C A;  1PX7 A;  1JZD A;  4D73 A;  3FR9 A;  1Z7R A;  2EC4 A;  1ACV A;  3HJM A;  4L8E A;  2R2J A;  5CYY A;  2OBI A;  3HZ4 A;  4PX1 A;  3KP9 A;  2B5E A;  1DUG A;  2VCT A;  1TK5 B;  22GS A;  2VM1 A;  4MJB A;  3ERF A;  1K0B A;  3IAS 2;  2HT9 A;  5IM9 A;  3RHB A;  1V9W A;  3GUS A;  4KUN A;  1AIU A;  3IE3 A;  3KJY A;  2PUK C;  1EZK A;  1JLW A;  1GUL A;  5A5K A;  1K0C A;  3L4N A;  2JU5 A;  2YZH A;  4V1A p;  1X5E A;  3C8E A;  4Q5F A;  1FW1 A;  3GMF A;  3UL3 A;  2YN1 A;  3TJF A;  2TRC P;  2R5G A;  3TJG A;  3GL3 A;  2GSQ A;  4QL9 A;  2WJU A;  1ZYQ B;  1AC1 A;  2K8V A;  3GRX A;  4RI6 A;  1T8E B;  2VD1 A;  2F3M A;  5ECO B;  2AYT A;  1ZYE A;  3D4M A;  4X1U A;  4NWY A;  5IPG A;  2VL3 A;  3TKQ A;  2DBC A;  1A24 A;  3EU4 A;  2ZNM A;  1EGR A;  1X0R A;  2PER A;  4ID0 A;  2TIR A;  3Q6O A;  2CV4 A;  3IXR A;  1TU8 A;  2H75 A;  7GSS A;  5IOW A;  1UA5 A;  4ZBD A;  2KUC A;  2CVD A;  3GIX A;  4MPG A;  4BPY A;  5B8B A;  3Q19 A;  2N5A A;  2DJ2 A;  2YJH A;  4Q5R A;  1PKZ A;  2IMI A;  1T7P B;  3GHA A;  9GSS A;  2I9H A;  8GSS A;  5LCZ A;  5FWG A;  1R26 A;  4JR4 A;  5GZZ B;  2LUS A;  4YAP A;  4FIW A;  4F2I A;  3RBT A;  4MP4 A;  1OKD A;  4OCF A;  4PNG A;  4IW9 A;  3LWA A;  2RM5 A;  5B8A A;  2H8L A;  2IN3 A;  4PUR A;  5ID2 B;  3KMN A;  2VCQ A;  4LMW A;  1TRU A;  2OE3 A;  2N5F A;  2BJX A;  2YWM A;  2WZ9 A;  4ZB6 A;  1AQW A;  1OC9 A;  1JZO A;  3EVI A;  1QXH A;  2GS3 A;  2H66 A;  4TXO B;  3K8N A;  3KMO A;  1SKR B;  2LST A;  1NSW A;  4DSQ A;  2Z9S A;  2CZ2 A;  4ECI A;  5INY A;  2ON7 A;  1Z3E A;  2A4V A;  2AUV A;  3U5R E;  5B7C A;  4KDU A;  4HEA 2;  4GWR A;  4O32 A;  5IMV A;  1ERW A;  3KGK A;  3SWL A;  1TW9 A;  4V2M A;  2MMO A;  3M9J A;  1ABA A;  1TRS A;  3BJ5 A;  4RQR A;  2WFC A;  2IFQ B;  3LG6 A;  4QQ7 A;  1VF4 A;  1F3A A;  3HVV A;  2H1D A;  3N5O A;  4PXO A;  3AY8 A;  3KCM A;  4BVY A;  4GLT A;  4J56 E;  5B6M A;  2FWG A;  1V57 A;  5JWO B;  5EY6 A;  3DWV A;  1A2L A;  3IPZ A;  19GS A;  2ZCT A;  2YP6 A;  1RK4 A;  3G7I A;  4JZQ A;  1KBN A;  4K8M A;  5DQS A;  2CT6 A;  5DJM A;  6GSX A;  3QAG A;  4LMV A;  1XWK A;  5KN2 A;  2VM2 A;  4K7I A;  4KB3 A;  3Q74 A;  3UJ1 A;  1MD3 A;  4XS4 B;  2DC5 A;  3C7M A;  3ZMK A;  4EUY A;  4KE3 A;  2HRN A;  2CA8 A;  3CXG A;  4K0G A;  1B48 A;  2H0H A;  4XS1 A;  1T1V A;  2H73 A;  1KTE A;  2C80 A;  5JCW A;  1SK1 A;  4HZ2 A;  5CRG A;  2IL3 A;  2H01 A;  6GSY A;  4CW9 A;  4MJE A;  5F05 A;  2VL2 C;  2O89 A;  3GX0 A;  2CVB A;  4ML1 A;  4NHZ A;  2DIZ A;  3FEU A;  2F51 A;  3LEF A;  3ZIJ A;  2GZY A;  3D21 A;  1BX9 A;  1TJD A;  16GS A;  17GS A;  1M2B A;  4K7O A;  4IP6 A;  3UAP A;  2R4V A;  3ERG A;  3GA4 A;  1WOU A;  1F6M C;  3VFI A;  5DCH A;  2K18 A;  3ZLP A;  1G6W A;  2HRF A;  2VCV A;  5G31 A;  4TW5 A;  5DAK B;  1R7H A;  1SYX A;  4ZB9 A;  4G19 A;  4TR1 B;  1Q4J A;  2ZUP A;  4G10 A;  1GTI A;  3RPP A;  5F0G A;  3UVH A;  3HA9 A;  1YEX A;  1HD2 A;  3NOF A;  3G9B A;  2C3Q A;  4L5O A;  3UEM A;  3CRT A;  4NV2 A;  4IBP A;  3MAK A;  3FZ4 A;  2C3T A;  3E9J B;  4KCE A;  3EMP A;  4EDY A;  4WF5 A;  1TI1 A;  4HJM A;  3C1R A;  5JWQ B;  2FGX A;  2YAN A;  4GSN A;  1H75 A;  5D9V A;  1FB6 A;  1K3O A;  4ISD A;  4N0Z A;  1H4O A;  10GS A;  2VLU A;  2XPD A;  1EWX A;  3H4K A;  3LXT A;  3GTU A;  5G5F A;  5KN3 A;  1MTC A;  3DIE A;  5A4V A;  2HSY A;  3EE2 A;  1GSS A;  3TRQ A;  1V98 A;  5CNW A;  4JR6 A;  2L6C A;  5G1K A;  3I6A A;  3TDG A;  1PX6 A;  2V1M A;  3GSS A;  2R3X A;  5ECR B;  1XZO A;  2FUG 2;  1XWC A;  1BED A;  3O3T A;  3VLN A;  1HNC A;  2WDU A;  2J9H A;  5ID2 A;  4NV5 A;  3F4R A;  2DJ1 A;  2DJK A;  1U3A A;  4NMU A;  3M3M A;  2PVO C;  2MZC A;  5J4U A;  1VF1 A;  3Q18 A;  2QSI A;  2OJL A;  1ZMA A;  4IHU A;  2AHE A;  2DIY A;  3LXZ A;  2HZE A;  1A0F A;  1O7U A;  2M46 A;  13GS A;  1XCC A;  3ZIV A;  3TKP A;  1T00 A;  2N5B A;  1M2D A;  3C73 A;  4L0U A;  1XPV A;  3KH9 A;  6GSU A;  1BQ7 A;  2HSH A;  1JFU A;  4XCS A;  4NXI A;  1G7O A;  4KGI A;  3DVX A;  3L9S A;  4MZB A;  1XWA A;  1S3C A;  4ML6 A;  4NHW A;  2GT6 A;  3F9U A;  3GV1 A;  4OO4 A;  5HFK A;  1BAY A;  1GUM A;  1SD8 A;  5DAL A;  1CQG A;  2JSZ A;  2JZT A;  4X43 A;  4TN8 A;  4MF5 A;  4DSR A;  4DSS B;  2L6D A;  4MAB A;  2XC2 A;  4HQZ A;  1AQX A;  4ECB A;  2YPM A;  1O6J A;  5JCU A;  1TXX A;  1UN2 A;  2V2G A;  2HFD A;  4IGJ A;  5E4W A;  5D93 A;  1A8Y A;  4PQH A;  3GNJ A;  2AAW A;  4HUA A;  1AXD A;  3HYP A;  4MA9 A;  2F8A A;  1MDJ A;  5HFG A;  1GUH A;  2V6O A;  2VO4 A;  1XIY A;  5COH A;  3PH9 A;  1GSD A;  3VPT A;  3P8W A;  4FYU A;  1W4V A;  3ZVJ D;  4YQM A;  3WGD A;  1BG5 A;  1QUW A;  4V2L A;  1WP0 A;  1A23 A;  2VOC A;  2RII A;  1GSE A;  1M9A A;  4N11 A;  3RHC A;  5E59 A;  4ECJ A;  3G7Y A;  2MMA A;  4HDE A;  1TP9 A;  4ZXG A;  3TRX A;  2YV7 A;  4OO5 A;  2FA4 A;  2ALB A;  3R2Q A;  5F06 A;  4I5Q A;  5IMD A;  3GFK A;  5DDL A;  3KIJ A;  1JZR A;  5HR0 A;  2GQM A;  4MK3 A;  3QOU A;  1GUK A;  1XWB A;  2LJR A;  4KDY A;  2IJY A;  4TVE A;  3JCM L;  5CP1 A;  3E3E A;  2GGT A;  1K3L A;  3FY7 A;  4MPF A;  1Y25 A;  4GQF A;  3TOU A;  5GAP D;  1PA3 A;  2P5Q A;  2D2Z A;  1TU7 A;  3QFA C;  2FWH A;  3LQ7 A;  2HNL A;  6GST A;  1SKS B;  2EIO A;  3GST A;  1GTB A;  4TR1 A;  1LJR A;  2VCZ A;  2GSR A;  4WXT A;  5AN1 A;  4K9Z A;  3KZQ A;  3C1S A;  3FZA A;  4MJA A;  4I97 A;  5D73 A;  1GTA A;  1Z7P A;  4EL1 A;  5C00 A;  2HYX A;  3IAM 2;  1K0D A;  3PR8 A;  5IPH A;  2OE1 A;  2C8U A;  5DBQ A;  4G2E A;  2HI7 A;  4IQA A;  2WRT A;  4WF4 A;  2R6K A;  5AIX A;  1JHB A;  1I9D A;  3NIV A;  5JCG A;  2XBI A;  1THX A;  5ELA A;  5CRW A;  1U87 A;  1GSY A;  4KH7 A;  2LRC A;  4NPB A;  4I8B A;  1SKW B;  4XTS A;  3RPN A;  1TRV A;  1Z6N A;  3QAV A;  2LQO A;  2PPT A;  4YH2 A;  1R5P A;  4FYC A;  5AGY A;  3TCO A;  1YJ6 A;  3IOS A;  5ECK B;  3PIN A;  2WCI A;  2LQQ A;  1ZL9 A;  2OE0 A;  3L0H A;  2G2Q A;  3ISO A;  3DXB A;  4GCI A;  3EU3 A;  1OVN A;  3HHV A;  2DSA A;  4MLY A;  4I2U A;  4Z7X A;  1WRY A;  2B7J A;  2FA8 A;  2RLI A;  3LJR A;  5CAX A;  2L57 A;  2CVK A;  4IJ3 A;  4WET A;  2PU9 C;  3SBC A;  2YWI A;  2FY6 A;  3FZ9 A;  5DCG A;  1JZW A;  3TKR A;  1A8L A;  4F03 A;  1N2A A;  4TR3 A;  1VF3 A;  5F07 A;  2CX4 A;  5G30 A;  1DSB A;  1IYH A;  2XBQ A;  1ERV A;  1K0N A;  3W8S A;  1EP8 A;  1O81 A;  1LU4 A;  1PL2 A;  3IRA A;  1B4Q A;  1FO5 A;  1Z6M A;  1YZX A;  4I6X A;  4POM A;  4ECC A;  3LYK A;  4JED A;  2IME A;  2LNT A;  4POK A;  4F0B A;  3QAW A;  2EIQ A;  4HU7 A;  2V41 A;  4OCE A;  2H72 A;  3RAZ A;  2VL9 A;  1DE2 A;  2NVL A;  2H19 A;  1Z5Y E;  1X5C A;  4AJ8 A;  1B4P A;  1F9M A;  4RUV A;  4WR4 A;  3ED3 A;  3TGZ A;  3BCI A;  2KLX A;  3UVT A;  3ZIT A;  5IMC A;  1YEP A;  4EE0 A;  2MBT A;  2X64 A;  3MSZ A;  6GSV A;  2P31 A;  3VWU A;  2HLS A;  4ZIL A;  3P7X A;  5JWR B;  2PN8 A;  3M0F A;  3ME8 A;  4FO5 A;  2NDO A;  5ECM B;  5G2Z A;  2OBK A;  3KM6 A;  5A4U A;  4BWQ A;  5IMZ A;  1F3B A;  2GST A;  5DJL A;  2JZS A;  2B3S A;  2E2M A;  4F82 A;  4AF2 A;  2LJA A;  4CHS A;  4PGT A;  3QPM A;  3O6T A;  1SJZ A;  4KX4 A;  1AQV A;  1XOB A;  1WIK A;  1TDI A;  2OAC A;  5AIV A;  4IJI A;  4KDX A;  2FNO A;  2I3Y A;  5ELG A;  2JSY A;  3ZRD A;  1F2E A;  2DML A;  2BMX A;  1K0O A;  1SJI A;  2IWT A;  3FK8 A;  2H0I A;  4HS1 A;  1GSQ A;  2C0F A;  3CYN A;  4L5L A;  4MJC A;  1QMV A;  1SYR A;  2BTO T;  1EEM A;  4EDZ A;  5ABR A;  2AV4 A;  1MEK A;  2R37 A;  4GSS A;  2H6Z A;  4LL4 B;  3HJO A;  3KTL A;  1MDK A;  3MDK A;  1UC7 A;  4QL7 A;  4TRX A;  3MWH A;  1ERU A;  1TOF A;  4KAE A;  4XRA A;  1PKW A;  4BL7 A;  3J7Y k;  1PGT A;  4G9H A;  3TKS C;  1R4W A;  4LLR A;  1TK8 B;  1TTZ A;  2RUE A;  2H0G A;  3VWV A;  5FT3 A;  2NPB A;  4IVF A;  5HR3 A;  4TR4 A;  2B5Y A;  1X9M B;  3QDN A;  3KD0 A;  3GN3 A;  2CAQ A;  3VUR A;  5IQY A;  3F4S A;  4OWY A;  1MDI A;  4YQU A;  6GSS A;  1Z9H A;  2IMF A;  1VF2 A;  2YZU A;  4NAX A;  1S3A A;  2VLT A;  3A2X A;  2VD0 A;  5H5R A;  2E2G A;  3ERW A;  1EV9 A;  5IIZ A;  4PQ1 A;  1FVJ A;  3VI5 A;  1GLP A;  18GS A;  3GX8 A;  4K2D A;  1U88 A;  1SL2 B;  3HVS A;  3US3 A;  1LBK A;  3D4T A;  4OFM A;  4H86 A;  1XVQ A;  2VIM A;  2LTK A;  5D9W A;  4TKY A;  1ZGN A;  2VL2 A;  1NW2 A;  4KSO A;  20GS A;  2JL4 A;  3CSI A;  3EMX A;  1X5D A;  1T3B A;  2GQK A;  4ZB8 A;  2CQ9 A;  1YKC A;  3F3Q A;  1E6B A;  1OC9 B;  1AUC A;  4YAV A;  4WBR D;  3QMX A;  2E0Q A;  2KOK A;  5ECL B;  4BWS A;  1W89 A;  5DQY A;  5H5Q A;  4TXO A;  5J9B A;  5D96 A;  2C0E A;  5LNK e;  4GQC A;  2XHF A;  4O92 A;  4ZBB A;  3GKN A;  3HKR A;  3LYP A;  1MD4 A;  3UMA A;  2FD3 A;  1EP7 A;  2P0G A;  5ECP B;  3GKM A;  3F6D A;  1SK0 A;  4AJ7 A;  2O87 A;  3IK9 A;  1M9B A;  1GL8 A;  3APO A;  1OE7 A;  2B6M A;  1ON4 A;  2YV9 A;  4KND A;  2H1B A;  2IMD A;  3D5J A;  2KP2 A;  2A2S A;  1GLQ A;  3A2W A;  3ZYW A;  5EL8 A;  2V6K A;  2H1A A;  1XOA A;  1GSF A;  3HZ8 A;  2H70 A;  4IEL A;  2IFQ A;  3IV4 A;  4TXV A;  4MMM A;  1ZZY A;  3ZFL A;  4MZC A;  1V2A A;  4P3Y B;  1XXU A;  1HNB A;  3DGQ A;  3L9V A;  5J9C A;  2F9S A;  2O85 A;  3DD3 A;  2OKA A;  3H79 A;  1K0A A;  3HJP A;  3H93 A;  1UVZ A;  4KW6 A;  3CMI A;  4DEJ A;  1G6Y A;  6GSW A;  1X9W B;  1S3D A;  1B9Y C;  4ZIJ A;  3KEB A;  1KEB A;  1EGO A;  4LL1 B;  4V2N A;  4XS4 A;  2NBS A;  2H6Y A;  3BCK A;  3GH6 A;  2H76 A;  1DBY A;  5D8I A;  3W8J A;  3FZ5 A;  5ECH B;  1WWJ A;  3KP8 A;  1A2M A;  5ECN B;  2OA7 A;  5EPF A;  3ZL5 A;  1J08 A;  1OE8 A;  4EF0 A;  4MH2 A;  4K1F A;  2M72 A;  1XFL A;  4HQS A;  3WD6 A;  5G5E A;  5EVO A;  3PGT A;  4LA1 A;  14GS A;  5GSS A;  3QR6 A;  1J0F A;  3O76 A;  1PL1 A;  1V58 A;  1RQM A;  2L4C A;  1O8W A;  3TKS E;  5D9X A;  2X99 A;  1OC8 A;  2YOI A;  4O7H A;  4XS6 A;  3WYW A;  1WPI A;  3CTF A;  1YKA A;  2GSS A;  1GNW A;  3ZML A;  3QCP A;  3C71 A;  3D22 A;  2PWJ A;  3EC3 A;  5IMF A;  1OKT A;  3TJJ A;  2CAI A;  3DML A;  3VWX A;  4IQ1 A;  1XW9 A;  1T4Y A;  3GH9 A;  5A4W A;  3FR3 A;  2F8F A;  3RDW A;  4PUA A;  1ILO A;  4IS0 A;  5F8B A;  5DAK A;  5J3R A;  1YDK A;  4V1A g;  4J57 E;  3TB2 A;  1XW6 A;  3APS A;  1SL0 B;  1ZOF A;  4IN0 A;  2X8G A;  2GZZ A;  1PQN A;  4MF6 A;  2REM A;  1TK0 B;  2K8S A;  3ZFB A;  3UIW A;  2YWN A;  2VCX A;  4HZ4 A;  1SU9 A;  4WKW A;  4Q5Q A;  3LSZ A;  3HXS A;  3EWL A;  2WS2 A;  4F9Z A;  3U6V A;  4ACS A;  5AIS A;  3DRN A;  2B7K A;  4O5R A;  2XPE A;  3LOR A;  1XBS A;  4WEY A;  1AW9 A;  3GL5 A;  3WT2 A;  3F8U A;  3A2V A;  3E0U A;  3L9U A;  2ES7 A;  5IO0 A;  3HD5 A;  1TKD B;  1PSQ A;  1RW1 A;  2AB6 A;  1QK8 A;  2G0F A;  3GTU B;  3I69 A;  1Y6E A;  2K9F A;  2QGV A;  1FHE A;  2H30 A;  3ZTL A;  1K3Y A;  4AGS A;  5HQP A;  1NHO A;  2LS5 A;  2DJ3 A;  4YQV A;  3IDV A;  3DYR A;  4E8H A;  3S9F A;  1X9S B;  1T4Z A;  3I43 A;  1M7T A;  4OFT A;  2IPA A;  1TRW A;  5J5N A;  3F63 A;  2CZ3 A;  1WJK A;  2PBJ A;  1OC3 A;  1O8X A;  1V40 A;  1ML6 A;  3KTB A;  3LGC A;  1GTU A;  4K6X A;  3FHK A;  3DKS A;  2PVQ A;  4HU9 A;  2H71 A;  3CSJ A;  3IC4 A;  4X0X A;  4PQI A;  3EUR A;  2EIR A;  4HJ2 A;  1F37 A;  2P5R A;  1A2J A;  2HZE B;  1ZCP A;  1N8J A;  1EV4 A;  2NTO A;  1YF1 A;  2VAF A;  3UAR A;  1FG4 A;  2DLX A;  2YJ7 A;  11GS A;  2WB9 A;  3HVX A;  3MNG A;  5J41 A;  3D6I A;  4BVX A;  3WGE A;  3NZN A;  4IP1 A;  2YCD A;  5DAL B;  3FKF A;  4MCU A;  2GZP A;  1XWG A;  4GF0 A;  3WGX A;  1PMT A;  3VK9 A;  4PNF A;  4DSS A;  2H1G A;  2GTU A;  3APQ A;  3FYG A;  4ZBA A;  1OAZ A;  3TJK A;  5B6N A;  2KP1 A;  1TI3 A;  1JLV A;  1YF0 A;  5CRD A;  3CSH A;  1PD2 1;  2PMT A;  3M1G A;  4MDC A;  3TOT A;  2C4J A;  4EO3 A;  3DEX A;  1SJ6 A;  4K7N A;  5D9T A;  1C72 A;  1J9B A;  2L4Q A;  3F4T A;  3W6G A;  3G7J A;  1THO A;  1PN9 A;  4OD7 A;  2C0D A;  1K0M A;  2RM6 A;  2MBS A;  2MMZ A;  4JRR A;  3GYK A;  3DVW A;  4BA7 A;  2GDR A;  3TJB A;  5FHI A;  5HR1 A;  4F0C A;  1G0T A;  1GWC A;  3FW2 A;  2QKE A;  2C0G A;  1GH2 A;  2HXK A;  1QQ2 A;  4CDO A;  4D73 B;  5KEJ A;  3WT1 A;  3F3R A;  4MZW A;  3F6F A;  4DVC A;  1HYU A;  2LNS A;  3IA1 A;  4EC0 A;  1U3I A;  4XRD A;  3IK7 A;  3UOM A;  3F0I A;  5GST A;  4POB A;  2FCH A;  5ECQ B;  3TRP A;  3N9J A;  5KN1 A;  3LFL A;  5IO2 A;  2FWE A;  3M8N A;  3P2A A;  2MMN A;  4E8E A;  2DJJ A;  2LKU A;  3EYT A;  5GAN D;  2A2R A;  1IYI A;  4FH8 A;  4RQX A;  1Q98 A;  3QFB C;  5KN0 A;  2FWF A;  4IKH A;  1O73 A;  3UBK A;  3L78 A;  4WR5 A;  2QC7 A;  1M0U A;  1SK2 A;  3FR6 A;  2LRN A;  5ENU A;  1XVW A;  1OYJ A;  2JZR A;  4ZL9 A;  4PUF C;  1M99 A;  3BOA A;  12GS A;  3ME7 A;  1SEN A;  3BD2 A;  4N30 A;  1GRX A;  1KNG A;  4JE1 A;  1AAZ A;  1FAA A;  3V1W A;  4TR0 A;  3I9V 2;  4FYB A;  1VGL A;  1EOG A;  5ECS A;  3OR5 A;  1GSU A;  3ZRE A;  4KCA A;  1HNA A;  2RUF A;  1ERT A;  1M2A A;  1PRX A;  4XHM A;  4JBB A;  4POL A;  2I81 A;  4MF7 A;  2V32 A;  2YWO A;  4Q5N A;  1YQ1 A;  3CRU A;  1FOV A;  1HQO A;  4L0W A;  3TUE A;  2TRX A;  3A5W A;  2VCW A;  4OFN A;  1EEJ A;  2JAD A;  5CRE A;  3GKK A;  1EOH A;  4XIH A;  2LRT A;  5H5S A;  2L5O A;  1E2Y A;  1WE0 A;  3UBL A;  5IOX A;  3EIN A;  2CX3 A;  4K0N A;  3VPQ A;  3QD9 A;  1A0R P;  3VWW A;  3VI7 A;  1GP1 A;  2GVP A;  1I5G A;  3GUR A;  3GKX A;  4TOP A;  5C04 A;  2O7K A;  1U6T A;  2X8H A;  5HFI A;  2O8V B;  2GLR A;  3HDC A;  2OAD A;  2B5X A;  3D0Z A;  4HI7 A;  1O85 A;  3CTG A;  4AJ6 A;  5L71 A;  3FRC A;  2YNX A;  4ZL8 A;  2GQL A;  1BJX A;  4OMV A;  1WMJ A;  1GNE A;  2H6X A;  5LD0 A;  3KXO A;  2AJQ B;  2I1U A;  4N0V A;  5IMA A;  2LEG A;  3H8Q A;  2L59 A;  2VUP A;  3HCZ A;  3BBY A;  1ST9 A;  2M80 A;  2PGT A;  3CBU A;  2WGR A;  3TKS A;  2LV3 A;  2C1Y A;  2E7P A;  2I4A A;  2IMK A;  2C3N A;  3HY2 A;  4ZL7 A;  2FHE A;  3IR4 A;  1DE1 A;  1B9X C;  1YY7 A;  4J2F A;  5G1L A;  5ECI B;  1QFN A;  1R5A A;  2DJ0 A;  2KHP A;  2WUL A;  4EXJ A;  1QGV A;  2VLV A;  2HZF A;  3IBH A;  4GXZ A;  4ULX A;  1FB0 A;  2DMM A;  3M9K A;  1USB A;  2MYG A;  2L5L A;  4GTU A;  1CQH A;  4GRF A;  5HR2 A;  2H74 A; 
#chains in the Genus database with same CATH topology
 1URM A;  2B1K A;  3J7Y b;  1SL1 B;  1NHY A;  2IIY A;  2K6V A;  4HOJ A;  1XW5 A;  4I2T A;  4KA0 A;  4GST A;  4RI7 A;  3A3T A;  1G7E A;  5CRH A;  5CO3 A;  1SD9 A;  2HE3 A;  1VRS D;  2JAC A;  2B1L A;  2ON5 A;  3IHQ A;  3H1N A;  3KH7 A;  4WBJ A;  1BYE A;  2LJK A;  5DVB A;  4JU5 A;  3ZVJ A;  4N10 A;  4ILF A;  1FVK A;  4EVM A;  1B8X A;  4MH3 A;  2GT5 A;  3P90 A;  2J23 A;  1NM3 A;  2FLS A;  4KSM A;  4EKZ A;  3ZZX A;  4O5U A;  2X8C A;  4X4J A;  1PX7 A;  1JZD A;  4D73 A;  3FR9 A;  1Z7R A;  2EC4 A;  1ACV A;  3HJM A;  4L8E A;  2R2J A;  5CYY A;  2OBI A;  3HZ4 A;  4PX1 A;  3KP9 A;  2B5E A;  1DUG A;  2VCT A;  1TK5 B;  22GS A;  2VM1 A;  4MJB A;  3ERF A;  1K0B A;  3IAS 2;  2HT9 A;  5IM9 A;  3RHB A;  1V9W A;  3GUS A;  4KUN A;  1AIU A;  3IE3 A;  3KJY A;  2PUK C;  1EZK A;  1JLW A;  1GUL A;  5A5K A;  1K0C A;  3L4N A;  2JU5 A;  2YZH A;  4BL7 B;  4V1A p;  1X5E A;  3C8E A;  4Q5F A;  1FW1 A;  3GMF A;  3UL3 A;  2YN1 A;  3TJF A;  2TRC P;  2R5G A;  3TJG A;  3GL3 A;  2GSQ A;  4QL9 A;  2WJU A;  1ZYQ B;  1AC1 A;  2K8V A;  3GRX A;  4RI6 A;  1T8E B;  2VD1 A;  2F3M A;  5ECO B;  2AYT A;  1ZYE A;  3D4M A;  4X1U A;  1ZYP A;  4NWY A;  5IPG A;  2VL3 A;  3TKQ A;  2DBC A;  1A24 A;  3EU4 A;  2ZNM A;  1EGR A;  1X0R A;  2PER A;  4ID0 A;  2TIR A;  3Q6O A;  2CV4 A;  3IXR A;  1TU8 A;  2H75 A;  7GSS A;  5IOW A;  1UA5 A;  4ZBD A;  2KUC A;  2CVD A;  3GIX A;  4MPG A;  4BPY A;  5B8B A;  3Q19 A;  2N5A A;  2DJ2 A;  2YJH A;  4Q5R A;  1PKZ A;  2IMI A;  1T7P B;  3GHA A;  9GSS A;  2I9H A;  8GSS A;  5LCZ A;  4CY8 A;  5FWG A;  1R26 A;  4JR4 A;  5GZZ B;  2LUS A;  4YAP A;  4FIW A;  4F2I A;  3RBT A;  4MP4 A;  1OKD A;  4OCF A;  4PNG A;  4IW9 A;  3LWA A;  2RM5 A;  5B8A A;  2H8L A;  2IN3 A;  4PUR A;  5ID2 B;  3KMN A;  2VCQ A;  4LMW A;  1TRU A;  2OE3 A;  2N5F A;  2BJX A;  2YWM A;  2WZ9 A;  2A4H A;  4ZB6 A;  1AQW A;  1OC9 A;  1JZO A;  3EVI A;  1QXH A;  2GS3 A;  2H66 A;  4TXO B;  3K8N A;  3KMO A;  1SKR B;  2LST A;  1NSW A;  4DSQ A;  2Z9S A;  2CZ2 A;  4ECI A;  5INY A;  2ON7 A;  4YKF A;  1Z3E A;  4Z2T A;  2A4V A;  2AUV A;  3U5R E;  4G0L A;  5B7C A;  4KDU A;  4HEA 2;  4GWR A;  4O32 A;  5IMV A;  1ERW A;  3KGK A;  3SWL A;  1TW9 A;  4V2M A;  2MMO A;  3M9J A;  1ABA A;  1TRS A;  3BJ5 A;  4RQR A;  2WFC A;  2IFQ B;  3LG6 A;  4HSC X;  4QQ7 A;  1VF4 A;  1F3A A;  3HVV A;  2H1D A;  3N5O A;  4PXO A;  3AY8 A;  3KCM A;  4BVY A;  4GLT A;  4J56 E;  4MNN A;  5B6M A;  2FWG A;  3MYD A;  1V57 A;  5JWO B;  5EY6 A;  3DWV A;  1A2L A;  3IPZ A;  19GS A;  2ZCT A;  2YP6 A;  1RK4 A;  3G7I A;  4JZQ A;  1KBN A;  4K8M A;  5DQS A;  2CT6 A;  5DJM A;  6GSX A;  3QAG A;  4LMV A;  1XWK A;  5KN2 A;  2VM2 A;  4K7I A;  4KB3 A;  3Q74 A;  3UJ1 A;  1MD3 A;  4XS4 B;  2DC5 A;  3C7M A;  3ZMK A;  4EUY A;  4KE3 A;  2HRN A;  2CA8 A;  1ZYN A;  3CXG A;  4K0G A;  1B48 A;  2H0H A;  4XS1 A;  1T1V A;  2H73 A;  1KTE A;  2C80 A;  5JCW A;  1SK1 A;  4HZ2 A;  5CRG A;  2IL3 A;  2H01 A;  6GSY A;  4CW9 A;  4MJE A;  5F05 A;  2VL2 C;  2O89 A;  3GX0 A;  2CVB A;  4ML1 A;  4NHZ A;  2DIZ A;  3FEU A;  2F51 A;  3LEF A;  3ZIJ A;  2GZY A;  3D21 A;  1BX9 A;  1TJD A;  16GS A;  17GS A;  1M2B A;  4K7O A;  4IP6 A;  3UAP A;  2R4V A;  3ERG A;  5BMU A;  3GA4 A;  2QA2 A;  1WOU A;  1F6M C;  3VFI A;  5DCH A;  2K18 A;  3ZLP A;  1G6W A;  2HRF A;  2VCV A;  5G31 A;  4TW5 A;  5DAK B;  1R7H A;  1SYX A;  4ZB9 A;  4G19 A;  4TR1 B;  1Q4J A;  2ZUP A;  4G10 A;  1GTI A;  3RPP A;  5F0G A;  3UVH A;  3HA9 A;  1YEX A;  1HD2 A;  3NOF A;  3G9B A;  2C3Q A;  4K5R A;  4L5O A;  3UEM A;  3CRT A;  4NV2 A;  4IBP A;  4BIK A;  3MAK A;  3FZ4 A;  2C3T A;  3E9J B;  4KCE A;  3EMP A;  4EDY A;  3PPU A;  4WF5 A;  1TI1 A;  4HJM A;  3C1R A;  5JWQ B;  2FGX A;  2YAN A;  4GSN A;  1H75 A;  5D9V A;  1FB6 A;  1K3O A;  4ISD A;  4N0Z A;  1H4O A;  10GS A;  2VLU A;  2XPD A;  1EWX A;  3H4K A;  3LXT A;  3GTU A;  5G5F A;  5KN3 A;  1MTC A;  3DIE A;  5A4V A;  2HSY A;  3EE2 A;  1GSS A;  3TRQ A;  1V98 A;  5CNW A;  4JR6 A;  2L6C A;  5G1K A;  3I6A A;  3TDG A;  1PX6 A;  2V1M A;  3GSS A;  2R3X A;  5ECR B;  1XZO A;  2FUG 2;  1XWC A;  1BED A;  3O3T A;  3VLN A;  1HNC A;  2WDU A;  2J9H A;  5ID2 A;  4NV5 A;  3F4R A;  2DJ1 A;  2DJK A;  1U3A A;  4NMU A;  3M3M A;  2PVO C;  2MZC A;  5J4U A;  1VF1 A;  3Q18 A;  2QSI A;  2OJL A;  1ZMA A;  4IHU A;  2AHE A;  2DIY A;  3LXZ A;  2HZE A;  1A0F A;  1O7U A;  2X49 A;  2M46 A;  13GS A;  1XCC A;  3ZIV A;  3TKP A;  1T00 A;  2N5B A;  1M2D A;  3C73 A;  4L0U A;  1XPV A;  3KH9 A;  6GSU A;  1BQ7 A;  2HSH A;  1JFU A;  4XCS A;  4NXI A;  1G7O A;  4KGI A;  3DVX A;  3L9S A;  4MZB A;  1XWA A;  1S3C A;  4ML6 A;  4NHW A;  2GT6 A;  4BVX B;  2R0G A;  3F9U A;  3GV1 A;  4OO4 A;  5HFK A;  1BAY A;  1GUM A;  1SD8 A;  5DAL A;  1CQG A;  2JSZ A;  2JZT A;  4X43 A;  4TN8 A;  4MF5 A;  4DSR A;  4DSS B;  2L6D A;  4MAB A;  2XC2 A;  4HQZ A;  1AQX A;  4ECB A;  2YPM A;  1O6J A;  5JCU A;  1TXX A;  1UN2 A;  2V2G A;  2HFD A;  4IGJ A;  5E4W A;  5D93 A;  1A8Y A;  4PQH A;  3GNJ A;  2AAW A;  4HUA A;  1AXD A;  3HYP A;  4MA9 A;  2F8A A;  1MDJ A;  5HFG A;  1GUH A;  2V6O A;  2VO4 A;  1XIY A;  5COH A;  3PH9 A;  1GSD A;  3VPT A;  3P8W A;  4FYU A;  4O5Q A;  1W4V A;  3ZVJ D;  4YQM A;  3WGD A;  1BG5 A;  1QUW A;  4V2L A;  1WP0 A;  1A23 A;  2VOC A;  2RII A;  1GSE A;  1M9A A;  4N11 A;  3RHC A;  5E59 A;  4ECJ A;  3G7Y A;  2MMA A;  4HDE A;  1TP9 A;  4ZXG A;  3TRX A;  2YV7 A;  4OO5 A;  2FA4 A;  4PTS A;  2ALB A;  3R2Q A;  5F06 A;  4I5Q A;  4K2X A;  3GFK A;  5DDL A;  5IMD A;  3KIJ A;  1JZR A;  5HR0 A;  2GQM A;  4MK3 A;  3QOU A;  1GUK A;  1XWB A;  2LJR A;  4KDY A;  2IJY A;  4TVE A;  3JCM L;  5CP1 A;  3E3E A;  2GGT A;  1K3L A;  3FY7 A;  4MPF A;  1Y25 A;  4GQF A;  3TOU A;  5GAP D;  1PA3 A;  2P5Q A;  2D2Z A;  1TU7 A;  3QFA C;  2FWH A;  3LQ7 A;  2HNL A;  6GST A;  1SKS B;  2EIO A;  3GST A;  1GTB A;  4TR1 A;  1LJR A;  2VCZ A;  2GSR A;  3LW9 A;  4WXT A;  5AN1 A;  4K9Z A;  3KZQ A;  3C1S A;  3FZA A;  4MJA A;  4I97 A;  5D73 A;  1GTA A;  4YKG A;  1Z7P A;  4EL1 A;  5C00 A;  2HYX A;  3IAM 2;  1K0D A;  4FQU A;  3PR8 A;  5IPH A;  2OE1 A;  2C8U A;  5DBQ A;  4G2E A;  2HI7 A;  4IQA A;  2WRT A;  4WF4 A;  2R6K A;  5AIX A;  1JHB A;  1I9D A;  2R0P A;  3IHG A;  3NIV A;  5JCG A;  2XBI A;  1THX A;  5ELA A;  5CRW A;  1U87 A;  1GSY A;  4KH7 A;  2LRC A;  4NPB A;  4I8B A;  1SKW B;  4XTS A;  3RPN A;  1TRV A;  1Z6N A;  3QAV A;  2LQO A;  2PPT A;  4YH2 A;  1R5P A;  4FYC A;  5AGY A;  3TCO A;  1YJ6 A;  3IOS A;  5ECK B;  3PIN A;  2WCI A;  2LQQ A;  1ZL9 A;  2OE0 A;  3L0H A;  2G2Q A;  3ISO A;  3DXB A;  4GCI A;  3EU3 A;  1OVN A;  3HHV A;  2DSA A;  4MLY A;  4I2U A;  4Z7X A;  1WRY A;  2B7J A;  2FA8 A;  2RLI A;  3LJR A;  5CAX A;  2L57 A;  2CVK A;  4IJ3 A;  4WET A;  2PU9 C;  3SBC A;  2YWI A;  4K5S A;  2FY6 A;  3FZ9 A;  5DCG A;  1JZW A;  3TKR A;  1A8L A;  4F03 A;  1N2A A;  4TR3 A;  1VF3 A;  5F07 A;  2CX4 A;  5G30 A;  1DSB A;  1IYH A;  2XBQ A;  1ERV A;  1K0N A;  3W8S A;  1EP8 A;  1O81 A;  1LU4 A;  1PL2 A;  3IRA A;  1B4Q A;  1FO5 A;  1Z6M A;  1YZX A;  4I6X A;  4POM A;  4ECC A;  3LYK A;  4JED A;  2IME A;  2LNT A;  4POK A;  4F0B A;  3QAW A;  2EIQ A;  4HU7 A;  2V41 A;  4OCE A;  2H72 A;  3RAZ A;  2VL9 A;  1DE2 A;  2NVL A;  2H19 A;  1Z5Y E;  1X5C A;  4AJ8 A;  1B4P A;  1F9M A;  4RUV A;  4WR4 A;  3ED3 A;  3TGZ A;  3BCI A;  2KLX A;  3UVT A;  3ZIT A;  5IMC A;  1YEP A;  4EE0 A;  2MBT A;  2X64 A;  3MSZ A;  6GSV A;  2P31 A;  3VWU A;  2HLS A;  4ZIL A;  3P7X A;  5JWR B;  2PN8 A;  3M0F A;  3ME8 A;  4FO5 A;  2NDO A;  1PFO A;  5ECM B;  5G2Z A;  2OBK A;  3KM6 A;  5A4U A;  4BWQ A;  5IMZ A;  1F3B A;  2GST A;  5DJL A;  2JZS A;  2B3S A;  2E2M A;  4F82 A;  4AF2 A;  2LJA A;  4CHS A;  4PGT A;  3QPM A;  3O6T A;  4CY6 A;  1SJZ A;  4KX4 A;  1AQV A;  1XOB A;  1WIK A;  1TDI A;  2OAC A;  5AIV A;  4IJI A;  4KDX A;  2FNO A;  2I3Y A;  5ELG A;  2JSY A;  3ZRD A;  1F2E A;  2DML A;  2BMX A;  1K0O A;  1SJI A;  2IWT A;  3FK8 A;  2H0I A;  4HS1 A;  1GSQ A;  2C0F A;  3CYN A;  4L5L A;  4MJC A;  1QMV A;  1SYR A;  2BTO T;  1EEM A;  4EDZ A;  5ABR A;  2AV4 A;  1MEK A;  2R37 A;  4GSS A;  2H6Z A;  4LL4 B;  3HJO A;  3KTL A;  1MDK A;  3MDK A;  1UC7 A;  4QL7 A;  4TRX A;  3MWH A;  1ERU A;  1TOF A;  2X4A A;  4KAE A;  4XRA A;  1PKW A;  4BL7 A;  3J7Y k;  1PGT A;  4G9H A;  3TKS C;  1R4W A;  4LLR A;  1TK8 B;  1TTZ A;  2RUE A;  2H0G A;  3VWV A;  5FT3 A;  2NPB A;  4IVF A;  5HR3 A;  4TR4 A;  2B5Y A;  1X9M B;  3QDN A;  3KD0 A;  3GN3 A;  2UZ8 A;  2CAQ A;  3VUR A;  5IQY A;  3F4S A;  4OWY A;  4G0I A;  1MDI A;  4YQU A;  6GSS A;  1Z9H A;  3A5I A;  2IMF A;  1VF2 A;  2YZU A;  4NAX A;  1S3A A;  2VLT A;  3A2X A;  2VD0 A;  5H5R A;  2E2G A;  3ERW A;  1EV9 A;  5IIZ A;  4PQ1 A;  1FVJ A;  3VI5 A;  1GLP A;  18GS A;  2DKH A;  3GX8 A;  4K2D A;  3IC8 A;  1U88 A;  1SL2 B;  3HVS A;  3US3 A;  1LBK A;  3D4T A;  4OFM A;  5KOX A;  4H86 A;  1XVQ A;  2VIM A;  2LTK A;  5D9W A;  4TKY A;  1ZGN A;  2VL2 A;  1NW2 A;  4KSO A;  20GS A;  2JL4 A;  3CSI A;  3EMX A;  1X5D A;  1T3B A;  2GQK A;  4ZB8 A;  2CQ9 A;  1YKC A;  3F3Q A;  1E6B A;  1OC9 B;  1AUC A;  4YAV A;  4WBR D;  3QMX A;  2E0Q A;  2KOK A;  5ECL B;  4BWS A;  1W89 A;  5DQY A;  5H5Q A;  4TXO A;  5J9B A;  5D96 A;  2C0E A;  5LNK e;  4GQC A;  2XHF A;  4O92 A;  4ZBB A;  3GKN A;  3HKR A;  3LYP A;  1MD4 A;  3UMA A;  2FD3 A;  1EP7 A;  2P0G A;  5ECP B;  3GKM A;  3F6D A;  1SK0 A;  4AJ7 A;  2O87 A;  3IK9 A;  1M9B A;  1GL8 A;  3APO A;  1OE7 A;  2B6M A;  1ON4 A;  2YV9 A;  4KND A;  2H1B A;  2IMD A;  3D5J A;  2KP2 A;  2A2S A;  1GLQ A;  3A2W A;  3ZYW A;  5EL8 A;  2V6K A;  2H1A A;  1XOA A;  1GSF A;  3HZ8 A;  2H70 A;  4IEL A;  2IFQ A;  3IV4 A;  4TXV A;  4MMM A;  1ZZY A;  3ZFL A;  4MZC A;  4USS A;  1V2A A;  4P3Y B;  1XXU A;  1HNB A;  3DGQ A;  3L9V A;  5J9C A;  2F9S A;  2O85 A;  3DD3 A;  2OKA A;  3H79 A;  1K0A A;  3HJP A;  3H93 A;  1UVZ A;  4KW6 A;  3CMI A;  4DEJ A;  1G6Y A;  6GSW A;  1X9W B;  1S3D A;  1B9Y C;  4ZIJ A;  3KEB A;  1KEB A;  1EGO A;  4LL1 B;  4V2N A;  4XS4 A;  2NBS A;  2H6Y A;  3BCK A;  3GH6 A;  2H76 A;  1DBY A;  5D8I A;  3W8J A;  3FZ5 A;  5ECH B;  1WWJ A;  3KP8 A;  4EIP A;  1A2M A;  5ECN B;  2OA7 A;  5EPF A;  3ZL5 A;  1J08 A;  1OE8 A;  4EF0 A;  4MH2 A;  4K1F A;  2M72 A;  1XFL A;  4Z2R A;  4HQS A;  3WD6 A;  5G5E A;  5EVO A;  3PGT A;  4LA1 A;  14GS A;  5GSS A;  3QR6 A;  1J0F A;  3O76 A;  1PL1 A;  1V58 A;  1RQM A;  2L4C A;  1O8W A;  3TKS E;  5D9X A;  2X99 A;  1OC8 A;  2YOI A;  4O7H A;  4XS6 A;  3WYW A;  1WPI A;  3CTF A;  1YKA A;  2GSS A;  1GNW A;  3ZML A;  3QCP A;  3C71 A;  3D22 A;  2PWJ A;  3EC3 A;  5IMF A;  1OKT A;  3TJJ A;  2CAI A;  3DML A;  3VWX A;  4IQ1 A;  1XW9 A;  1T4Y A;  3GH9 A;  5A4W A;  3FR3 A;  2F8F A;  3RDW A;  4PUA A;  1M3J A;  1ILO A;  4IS0 A;  5F8B A;  2HRA A;  5DAK A;  5J3R A;  1YDK A;  4V1A g;  4J57 E;  3TB2 A;  1XW6 A;  3APS A;  1SL0 B;  1ZOF A;  4IN0 A;  2X8G A;  5KOW A;  2GZZ A;  1PQN A;  1XG8 A;  4MF6 A;  2REM A;  1TK0 B;  2K8S A;  3ZFB A;  3UIW A;  2YWN A;  3HVN A;  2VCX A;  4HZ4 A;  1SU9 A;  4WKW A;  4Q5Q A;  3LSZ A;  3HXS A;  3EWL A;  2WS2 A;  4F9Z A;  3U6V A;  4ACS A;  5AIS A;  3DRN A;  2B7K A;  4O5R A;  2XPE A;  3LOR A;  1XBS A;  4WEY A;  1AW9 A;  3GL5 A;  3WT2 A;  3F8U A;  3A2V A;  3E0U A;  3L9U A;  2ES7 A;  5IO0 A;  3HD5 A;  1TKD B;  1PSQ A;  1RW1 A;  2AB6 A;  1QK8 A;  2G0F A;  3GTU B;  3I69 A;  1Y6E A;  2K9F A;  4ICY A;  2QGV A;  1FHE A;  2H30 A;  3ZTL A;  1K3Y A;  4AGS A;  5HQP A;  1NHO A;  2LS5 A;  2DJ3 A;  1FOH A;  4YQV A;  3IDV A;  3DYR A;  4E8H A;  3S9F A;  1X9S B;  1T4Z A;  3I43 A;  1M7T A;  4OFT A;  2IPA A;  1TRW A;  5J5N A;  3F63 A;  2CZ3 A;  1WJK A;  2PBJ A;  1OC3 A;  1O8X A;  5BRT A;  1V40 A;  1ML6 A;  3KTB A;  3LGC A;  1GTU A;  4K6X A;  3FHK A;  3DKS A;  2PVQ A;  4HU9 A;  2H71 A;  3CSJ A;  3IC4 A;  4X0X A;  4PQI A;  3EUR A;  2EIR A;  1PN0 A;  4HJ2 A;  1F37 A;  2P5R A;  1A2J A;  2HZE B;  1ZCP A;  1N8J A;  1EV4 A;  2NTO A;  1YF1 A;  2VAF A;  3UAR A;  1FG4 A;  2DLX A;  2YJ7 A;  11GS A;  2WB9 A;  3HVX A;  3MNG A;  5J41 A;  3D6I A;  4BVX A;  3WGE A;  3NZN A;  4IP1 A;  2YCD A;  5DAL B;  3FKF A;  4MCU A;  2GZP A;  1XWG A;  4KF9 A;  4GF0 A;  3WGX A;  1PMT A;  3VK9 A;  4PNF A;  4DSS A;  2H1G A;  2GTU A;  3APQ A;  3FYG A;  4ZBA A;  1OAZ A;  3TJK A;  5B6N A;  2KP1 A;  1TI3 A;  1JLV A;  1YF0 A;  2DKI A;  5CRD A;  3CSH A;  1PD2 1;  2PMT A;  3M1G A;  4MDC A;  3TOT A;  2C4J A;  4EO3 A;  3DEX A;  1SJ6 A;  4K7N A;  5D9T A;  1C72 A;  1J9B A;  2L4Q A;  3F4T A;  3W6G A;  3G7J A;  1THO A;  1PN9 A;  4OD7 A;  2C0D A;  1K0M A;  2RM6 A;  2MBS A;  2MMZ A;  3CQF A;  4JRR A;  3GYK A;  3DVW A;  4BA7 A;  2GDR A;  3TJB A;  5FHI A;  5HR1 A;  4F0C A;  1G0T A;  1GWC A;  3FW2 A;  2QKE A;  2C0G A;  1GH2 A;  2HXK A;  1QQ2 A;  4CDO A;  4D73 B;  5KEJ A;  3WT1 A;  3F3R A;  4MZW A;  3F6F A;  4DVC A;  1HYU A;  2LNS A;  3IA1 A;  4EC0 A;  1U3I A;  2A2P A;  4XRD A;  3IK7 A;  3UOM A;  3F0I A;  5GST A;  4POB A;  2FCH A;  5ECQ B;  3TRP A;  3N9J A;  5KN1 A;  3LFL A;  5IO2 A;  2FWE A;  3M8N A;  3P2A A;  2MMN A;  4E8E A;  4A5P A;  2DJJ A;  2LKU A;  3EYT A;  5GAN D;  4G0K A;  2A2R A;  1IYI A;  4FH8 A;  4RQX A;  1Q98 A;  3QFB C;  5KN0 A;  2FWF A;  4IKH A;  1O73 A;  3UBK A;  3L78 A;  4WR5 A;  2QC7 A;  1M0U A;  1SK2 A;  3FR6 A;  2LRN A;  5ENU A;  1XVW A;  1OYJ A;  2JZR A;  4ZL9 A;  4PUF C;  1M99 A;  3BOA A;  12GS A;  3ME7 A;  1SEN A;  3BD2 A;  4N30 A;  1GRX A;  1KNG A;  4JE1 A;  1AAZ A;  1FAA A;  3V1W A;  4Z2U A;  4TR0 A;  3I9V 2;  4FYB A;  1VGL A;  1EOG A;  5ECS A;  3OR5 A;  1GSU A;  3ZRE A;  4KCA A;  1HNA A;  2RUF A;  1ERT A;  1M2A A;  1PRX A;  2HRK A;  4XHM A;  4JBB A;  4POL A;  2I81 A;  4MF7 A;  2V32 A;  2YWO A;  4Q5N A;  1YQ1 A;  3CRU A;  1FOV A;  1HQO A;  4L0W A;  3TUE A;  2TRX A;  3A5W A;  2VCW A;  4OFN A;  1EEJ A;  2JAD A;  5CRE A;  3GKK A;  1EOH A;  4XIH A;  2LRT A;  5H5S A;  2L5O A;  1E2Y A;  1WE0 A;  3UBL A;  5IOX A;  3EIN A;  2CX3 A;  4K0N A;  3VPQ A;  2QA1 A;  3QD9 A;  1A0R P;  3R3E A;  3VWW A;  3VI7 A;  1GP1 A;  2GVP A;  1I5G A;  3GUR A;  3GKX A;  4TOP A;  5C04 A;  2O7K A;  1U6T A;  2X8H A;  5HFI A;  2O8V B;  2GLR A;  3HDC A;  2OAD A;  3MIX A;  2B5X A;  3D0Z A;  1S3R A;  4HI7 A;  1O85 A;  3CTG A;  1M3I A;  4AJ6 A;  5L71 A;  3FRC A;  2YNX A;  4ZL8 A;  2GQL A;  3EPT A;  1BJX A;  4OMV A;  1WMJ A;  1GNE A;  2H6X A;  5LD0 A;  3KXO A;  2AJQ B;  2I1U A;  4N0V A;  3FMW A;  5IMA A;  2LEG A;  3H8Q A;  2L59 A;  2VUP A;  3HCZ A;  3BBY A;  1ST9 A;  2M80 A;  2PGT A;  3CBU A;  2WGR A;  3TKS A;  2LV3 A;  2C1Y A;  2E7P A;  2I4A A;  2IMK A;  2C3N A;  3HY2 A;  4ZL7 A;  2FHE A;  3IR4 A;  1DE1 A;  1B9X C;  1YY7 A;  4J2F A;  5G1L A;  5ECI B;  1QFN A;  1R5A A;  2DJ0 A;  2R0C A;  2KHP A;  2WUL A;  4EXJ A;  1QGV A;  2VLV A;  2HZF A;  3IBH A;  4GXZ A;  4ULX A;  1FB0 A;  2DMM A;  3M9K A;  4BVY B;  4EIQ A;  1USB A;  2HSM A;  2MYG A;  2L5L A;  4GTU A;  1CQH A;  4GRF A;  5HR2 A;  2H74 A; 
#chains in the Genus database with same CATH homology
 1URM A;  2B1K A;  3J7Y b;  1SL1 B;  1NHY A;  2IIY A;  2K6V A;  4HOJ A;  1XW5 A;  4I2T A;  4KA0 A;  4GST A;  4RI7 A;  3A3T A;  1G7E A;  5CRH A;  5CO3 A;  1SD9 A;  2HE3 A;  1VRS D;  2JAC A;  2B1L A;  2ON5 A;  3IHQ A;  3H1N A;  3KH7 A;  4WBJ A;  1BYE A;  2LJK A;  5DVB A;  4JU5 A;  3ZVJ A;  4N10 A;  4ILF A;  1FVK A;  4EVM A;  1B8X A;  4MH3 A;  2GT5 A;  3P90 A;  2J23 A;  1NM3 A;  2FLS A;  4KSM A;  4EKZ A;  3ZZX A;  4O5U A;  2X8C A;  4X4J A;  1PX7 A;  1JZD A;  4D73 A;  3FR9 A;  1Z7R A;  2EC4 A;  1ACV A;  3HJM A;  4L8E A;  2R2J A;  5CYY A;  2OBI A;  3HZ4 A;  4PX1 A;  3KP9 A;  2B5E A;  1DUG A;  2VCT A;  1TK5 B;  22GS A;  2VM1 A;  4MJB A;  3ERF A;  1K0B A;  3IAS 2;  2HT9 A;  5IM9 A;  3RHB A;  1V9W A;  3GUS A;  4KUN A;  1AIU A;  3IE3 A;  3KJY A;  2PUK C;  1EZK A;  1JLW A;  1GUL A;  5A5K A;  1K0C A;  3L4N A;  2JU5 A;  2YZH A;  4BL7 B;  4V1A p;  1X5E A;  3C8E A;  4Q5F A;  1FW1 A;  3GMF A;  3UL3 A;  2YN1 A;  3TJF A;  2TRC P;  2R5G A;  3TJG A;  3GL3 A;  2GSQ A;  4QL9 A;  2WJU A;  1ZYQ B;  1AC1 A;  2K8V A;  3GRX A;  4RI6 A;  1T8E B;  2VD1 A;  2F3M A;  5ECO B;  2AYT A;  1ZYE A;  3D4M A;  4X1U A;  1ZYP A;  4NWY A;  5IPG A;  2VL3 A;  3TKQ A;  2DBC A;  1A24 A;  3EU4 A;  2ZNM A;  1EGR A;  1X0R A;  2PER A;  4ID0 A;  2TIR A;  3Q6O A;  2CV4 A;  3IXR A;  1TU8 A;  2H75 A;  7GSS A;  5IOW A;  1UA5 A;  4ZBD A;  2KUC A;  2CVD A;  3GIX A;  4MPG A;  4BPY A;  5B8B A;  3Q19 A;  2N5A A;  2DJ2 A;  2YJH A;  4Q5R A;  1PKZ A;  2IMI A;  1T7P B;  3GHA A;  9GSS A;  2I9H A;  8GSS A;  5LCZ A;  4CY8 A;  5FWG A;  1R26 A;  4JR4 A;  5GZZ B;  2LUS A;  4YAP A;  4FIW A;  4F2I A;  3RBT A;  4MP4 A;  1OKD A;  4OCF A;  4PNG A;  4IW9 A;  3LWA A;  2RM5 A;  5B8A A;  2H8L A;  2IN3 A;  4PUR A;  5ID2 B;  3KMN A;  2VCQ A;  4LMW A;  1TRU A;  2OE3 A;  2N5F A;  2BJX A;  2YWM A;  2WZ9 A;  2A4H A;  4ZB6 A;  1AQW A;  1OC9 A;  1JZO A;  3EVI A;  1QXH A;  2GS3 A;  2H66 A;  4TXO B;  3K8N A;  3KMO A;  1SKR B;  2LST A;  1NSW A;  4DSQ A;  2Z9S A;  2CZ2 A;  4ECI A;  5INY A;  2ON7 A;  4YKF A;  1Z3E A;  4Z2T A;  2A4V A;  2AUV A;  3U5R E;  4G0L A;  5B7C A;  4KDU A;  4HEA 2;  4GWR A;  4O32 A;  5IMV A;  1ERW A;  3KGK A;  3SWL A;  1TW9 A;  4V2M A;  2MMO A;  3M9J A;  1ABA A;  1TRS A;  3BJ5 A;  4RQR A;  2WFC A;  2IFQ B;  3LG6 A;  4QQ7 A;  1VF4 A;  1F3A A;  3HVV A;  2H1D A;  3N5O A;  4PXO A;  3AY8 A;  3KCM A;  4BVY A;  4GLT A;  4J56 E;  4MNN A;  5B6M A;  2FWG A;  3MYD A;  1V57 A;  5JWO B;  5EY6 A;  3DWV A;  1A2L A;  3IPZ A;  19GS A;  2ZCT A;  2YP6 A;  1RK4 A;  3G7I A;  4JZQ A;  1KBN A;  4K8M A;  5DQS A;  2CT6 A;  5DJM A;  6GSX A;  3QAG A;  4LMV A;  1XWK A;  5KN2 A;  2VM2 A;  4K7I A;  4KB3 A;  3Q74 A;  3UJ1 A;  1MD3 A;  4XS4 B;  2DC5 A;  3C7M A;  3ZMK A;  4EUY A;  4KE3 A;  2HRN A;  2CA8 A;  1ZYN A;  3CXG A;  4K0G A;  1B48 A;  2H0H A;  4XS1 A;  1T1V A;  2H73 A;  1KTE A;  2C80 A;  5JCW A;  1SK1 A;  4HZ2 A;  5CRG A;  2IL3 A;  2H01 A;  6GSY A;  4CW9 A;  4MJE A;  5F05 A;  2VL2 C;  2O89 A;  3GX0 A;  2CVB A;  4ML1 A;  4NHZ A;  2DIZ A;  3FEU A;  2F51 A;  3LEF A;  3ZIJ A;  2GZY A;  3D21 A;  1BX9 A;  1TJD A;  16GS A;  17GS A;  1M2B A;  4K7O A;  4IP6 A;  3UAP A;  2R4V A;  3ERG A;  5BMU A;  3GA4 A;  2QA2 A;  1WOU A;  1F6M C;  3VFI A;  5DCH A;  2K18 A;  3ZLP A;  1G6W A;  2HRF A;  2VCV A;  5G31 A;  4TW5 A;  5DAK B;  1R7H A;  1SYX A;  4ZB9 A;  4G19 A;  4TR1 B;  1Q4J A;  2ZUP A;  4G10 A;  1GTI A;  3RPP A;  5F0G A;  3UVH A;  3HA9 A;  1YEX A;  1HD2 A;  3NOF A;  3G9B A;  2C3Q A;  4K5R A;  4L5O A;  3UEM A;  3CRT A;  4NV2 A;  4IBP A;  3MAK A;  3FZ4 A;  2C3T A;  3E9J B;  4KCE A;  3EMP A;  4EDY A;  3PPU A;  4WF5 A;  1TI1 A;  4HJM A;  3C1R A;  5JWQ B;  2FGX A;  2YAN A;  4GSN A;  1H75 A;  5D9V A;  1FB6 A;  1K3O A;  4ISD A;  4N0Z A;  1H4O A;  10GS A;  2VLU A;  2XPD A;  1EWX A;  3H4K A;  3LXT A;  3GTU A;  5G5F A;  5KN3 A;  1MTC A;  3DIE A;  5A4V A;  2HSY A;  3EE2 A;  1GSS A;  3TRQ A;  1V98 A;  5CNW A;  4JR6 A;  2L6C A;  5G1K A;  3I6A A;  3TDG A;  1PX6 A;  2V1M A;  3GSS A;  2R3X A;  5ECR B;  1XZO A;  2FUG 2;  1XWC A;  1BED A;  3O3T A;  3VLN A;  1HNC A;  2WDU A;  2J9H A;  5ID2 A;  4NV5 A;  3F4R A;  2DJ1 A;  2DJK A;  1U3A A;  4NMU A;  3M3M A;  2PVO C;  2MZC A;  5J4U A;  1VF1 A;  3Q18 A;  2QSI A;  2OJL A;  1ZMA A;  4IHU A;  2AHE A;  2DIY A;  3LXZ A;  2HZE A;  1A0F A;  1O7U A;  2X49 A;  2M46 A;  13GS A;  1XCC A;  3ZIV A;  3TKP A;  1T00 A;  2N5B A;  1M2D A;  3C73 A;  4L0U A;  1XPV A;  3KH9 A;  6GSU A;  1BQ7 A;  2HSH A;  1JFU A;  4XCS A;  4NXI A;  1G7O A;  4KGI A;  3DVX A;  3L9S A;  4MZB A;  1XWA A;  1S3C A;  4ML6 A;  4NHW A;  2GT6 A;  4BVX B;  2R0G A;  3F9U A;  3GV1 A;  4OO4 A;  5HFK A;  1BAY A;  1GUM A;  1SD8 A;  5DAL A;  1CQG A;  2JSZ A;  2JZT A;  4X43 A;  4TN8 A;  4MF5 A;  4DSR A;  4DSS B;  2L6D A;  4MAB A;  2XC2 A;  4HQZ A;  1AQX A;  4ECB A;  2YPM A;  1O6J A;  5JCU A;  1TXX A;  1UN2 A;  2V2G A;  2HFD A;  4IGJ A;  5E4W A;  5D93 A;  1A8Y A;  4PQH A;  3GNJ A;  2AAW A;  4HUA A;  1AXD A;  3HYP A;  4MA9 A;  2F8A A;  1MDJ A;  5HFG A;  1GUH A;  2V6O A;  2VO4 A;  1XIY A;  5COH A;  3PH9 A;  1GSD A;  3VPT A;  3P8W A;  4FYU A;  4O5Q A;  1W4V A;  3ZVJ D;  4YQM A;  3WGD A;  1BG5 A;  1QUW A;  4V2L A;  1WP0 A;  1A23 A;  2VOC A;  2RII A;  1GSE A;  1M9A A;  4N11 A;  3RHC A;  5E59 A;  4ECJ A;  3G7Y A;  2MMA A;  4HDE A;  1TP9 A;  4ZXG A;  3TRX A;  2YV7 A;  4OO5 A;  2FA4 A;  4PTS A;  2ALB A;  3R2Q A;  5F06 A;  4I5Q A;  4K2X A;  3GFK A;  5DDL A;  5IMD A;  3KIJ A;  1JZR A;  5HR0 A;  2GQM A;  4MK3 A;  3QOU A;  1GUK A;  1XWB A;  2LJR A;  4KDY A;  2IJY A;  4TVE A;  3JCM L;  5CP1 A;  3E3E A;  2GGT A;  1K3L A;  3FY7 A;  4MPF A;  1Y25 A;  4GQF A;  3TOU A;  5GAP D;  1PA3 A;  2P5Q A;  2D2Z A;  1TU7 A;  3QFA C;  2FWH A;  3LQ7 A;  2HNL A;  6GST A;  1SKS B;  2EIO A;  3GST A;  1GTB A;  4TR1 A;  1LJR A;  2VCZ A;  2GSR A;  3LW9 A;  4WXT A;  5AN1 A;  4K9Z A;  3KZQ A;  3C1S A;  3FZA A;  4MJA A;  4I97 A;  5D73 A;  1GTA A;  4YKG A;  1Z7P A;  4EL1 A;  5C00 A;  2HYX A;  3IAM 2;  1K0D A;  4FQU A;  3PR8 A;  5IPH A;  2OE1 A;  2C8U A;  5DBQ A;  4G2E A;  2HI7 A;  4IQA A;  2WRT A;  4WF4 A;  2R6K A;  5AIX A;  1JHB A;  1I9D A;  2R0P A;  3IHG A;  3NIV A;  5JCG A;  2XBI A;  1THX A;  5ELA A;  5CRW A;  1U87 A;  1GSY A;  4KH7 A;  2LRC A;  4NPB A;  4I8B A;  1SKW B;  4XTS A;  3RPN A;  1TRV A;  1Z6N A;  3QAV A;  2LQO A;  2PPT A;  4YH2 A;  1R5P A;  4FYC A;  5AGY A;  3TCO A;  1YJ6 A;  3IOS A;  5ECK B;  3PIN A;  2WCI A;  2LQQ A;  1ZL9 A;  2OE0 A;  3L0H A;  2G2Q A;  3ISO A;  3DXB A;  4GCI A;  3EU3 A;  1OVN A;  3HHV A;  2DSA A;  4MLY A;  4I2U A;  4Z7X A;  1WRY A;  2B7J A;  2FA8 A;  2RLI A;  3LJR A;  5CAX A;  2L57 A;  2CVK A;  4IJ3 A;  4WET A;  2PU9 C;  3SBC A;  2YWI A;  4K5S A;  2FY6 A;  3FZ9 A;  5DCG A;  1JZW A;  3TKR A;  1A8L A;  4F03 A;  1N2A A;  4TR3 A;  1VF3 A;  5F07 A;  2CX4 A;  5G30 A;  1DSB A;  1IYH A;  2XBQ A;  1ERV A;  1K0N A;  3W8S A;  1EP8 A;  1O81 A;  1LU4 A;  1PL2 A;  3IRA A;  1B4Q A;  1FO5 A;  1Z6M A;  1YZX A;  4I6X A;  4POM A;  4ECC A;  3LYK A;  4JED A;  2IME A;  2LNT A;  4POK A;  4F0B A;  3QAW A;  2EIQ A;  4HU7 A;  2V41 A;  4OCE A;  2H72 A;  3RAZ A;  2VL9 A;  1DE2 A;  2NVL A;  2H19 A;  1Z5Y E;  1X5C A;  4AJ8 A;  1B4P A;  1F9M A;  4RUV A;  4WR4 A;  3ED3 A;  3TGZ A;  3BCI A;  2KLX A;  3UVT A;  3ZIT A;  5IMC A;  1YEP A;  4EE0 A;  2MBT A;  2X64 A;  3MSZ A;  6GSV A;  2P31 A;  3VWU A;  2HLS A;  4ZIL A;  3P7X A;  5JWR B;  2PN8 A;  3M0F A;  3ME8 A;  4FO5 A;  2NDO A;  5ECM B;  5G2Z A;  2OBK A;  3KM6 A;  5A4U A;  4BWQ A;  5IMZ A;  1F3B A;  2GST A;  5DJL A;  2JZS A;  2B3S A;  2E2M A;  4F82 A;  4AF2 A;  2LJA A;  4CHS A;  4PGT A;  3QPM A;  3O6T A;  4CY6 A;  1SJZ A;  4KX4 A;  1AQV A;  1XOB A;  1WIK A;  1TDI A;  2OAC A;  5AIV A;  4IJI A;  4KDX A;  2FNO A;  2I3Y A;  5ELG A;  2JSY A;  3ZRD A;  1F2E A;  2DML A;  2BMX A;  1K0O A;  1SJI A;  2IWT A;  3FK8 A;  2H0I A;  4HS1 A;  1GSQ A;  2C0F A;  3CYN A;  4L5L A;  4MJC A;  1QMV A;  1SYR A;  2BTO T;  1EEM A;  4EDZ A;  5ABR A;  2AV4 A;  1MEK A;  2R37 A;  4GSS A;  2H6Z A;  4LL4 B;  3HJO A;  3KTL A;  1MDK A;  3MDK A;  1UC7 A;  4QL7 A;  4TRX A;  3MWH A;  1ERU A;  1TOF A;  2X4A A;  4KAE A;  4XRA A;  1PKW A;  4BL7 A;  3J7Y k;  1PGT A;  4G9H A;  3TKS C;  1R4W A;  4LLR A;  1TK8 B;  1TTZ A;  2RUE A;  2H0G A;  3VWV A;  5FT3 A;  2NPB A;  4IVF A;  5HR3 A;  4TR4 A;  2B5Y A;  1X9M B;  3QDN A;  3KD0 A;  3GN3 A;  2UZ8 A;  2CAQ A;  3VUR A;  5IQY A;  3F4S A;  4OWY A;  4G0I A;  1MDI A;  4YQU A;  6GSS A;  1Z9H A;  3A5I A;  2IMF A;  1VF2 A;  2YZU A;  4NAX A;  1S3A A;  2VLT A;  3A2X A;  2VD0 A;  5H5R A;  2E2G A;  3ERW A;  1EV9 A;  5IIZ A;  4PQ1 A;  1FVJ A;  3VI5 A;  1GLP A;  18GS A;  2DKH A;  3GX8 A;  4K2D A;  3IC8 A;  1U88 A;  1SL2 B;  3HVS A;  3US3 A;  1LBK A;  3D4T A;  4OFM A;  5KOX A;  4H86 A;  1XVQ A;  2VIM A;  2LTK A;  5D9W A;  4TKY A;  1ZGN A;  2VL2 A;  1NW2 A;  4KSO A;  20GS A;  2JL4 A;  3CSI A;  3EMX A;  1X5D A;  1T3B A;  2GQK A;  4ZB8 A;  2CQ9 A;  1YKC A;  3F3Q A;  1E6B A;  1OC9 B;  1AUC A;  4YAV A;  4WBR D;  3QMX A;  2E0Q A;  2KOK A;  5ECL B;  4BWS A;  1W89 A;  5DQY A;  5H5Q A;  4TXO A;  5J9B A;  5D96 A;  2C0E A;  5LNK e;  4GQC A;  2XHF A;  4O92 A;  4ZBB A;  3GKN A;  3HKR A;  3LYP A;  1MD4 A;  3UMA A;  2FD3 A;  1EP7 A;  2P0G A;  5ECP B;  3GKM A;  3F6D A;  1SK0 A;  4AJ7 A;  2O87 A;  3IK9 A;  1M9B A;  1GL8 A;  3APO A;  1OE7 A;  2B6M A;  1ON4 A;  2YV9 A;  4KND A;  2H1B A;  2IMD A;  3D5J A;  2KP2 A;  2A2S A;  1GLQ A;  3A2W A;  3ZYW A;  5EL8 A;  2V6K A;  2H1A A;  1XOA A;  1GSF A;  3HZ8 A;  2H70 A;  4IEL A;  2IFQ A;  3IV4 A;  4TXV A;  4MMM A;  1ZZY A;  3ZFL A;  4MZC A;  4USS A;  1V2A A;  4P3Y B;  1XXU A;  1HNB A;  3DGQ A;  3L9V A;  5J9C A;  2F9S A;  2O85 A;  3DD3 A;  2OKA A;  3H79 A;  1K0A A;  3HJP A;  3H93 A;  1UVZ A;  4KW6 A;  3CMI A;  4DEJ A;  1G6Y A;  6GSW A;  1X9W B;  1S3D A;  1B9Y C;  4ZIJ A;  3KEB A;  1KEB A;  1EGO A;  4LL1 B;  4V2N A;  4XS4 A;  2NBS A;  2H6Y A;  3BCK A;  3GH6 A;  2H76 A;  1DBY A;  5D8I A;  3W8J A;  3FZ5 A;  5ECH B;  1WWJ A;  3KP8 A;  4EIP A;  1A2M A;  5ECN B;  2OA7 A;  5EPF A;  3ZL5 A;  1J08 A;  1OE8 A;  4EF0 A;  4MH2 A;  4K1F A;  2M72 A;  1XFL A;  4Z2R A;  4HQS A;  3WD6 A;  5G5E A;  5EVO A;  3PGT A;  4LA1 A;  14GS A;  5GSS A;  3QR6 A;  1J0F A;  3O76 A;  1PL1 A;  1V58 A;  1RQM A;  2L4C A;  1O8W A;  3TKS E;  5D9X A;  2X99 A;  1OC8 A;  2YOI A;  4O7H A;  4XS6 A;  3WYW A;  1WPI A;  3CTF A;  1YKA A;  2GSS A;  1GNW A;  3ZML A;  3QCP A;  3C71 A;  3D22 A;  2PWJ A;  3EC3 A;  5IMF A;  1OKT A;  3TJJ A;  2CAI A;  3DML A;  3VWX A;  4IQ1 A;  1XW9 A;  1T4Y A;  3GH9 A;  5A4W A;  3FR3 A;  2F8F A;  3RDW A;  4PUA A;  1ILO A;  4IS0 A;  5F8B A;  2HRA A;  5DAK A;  5J3R A;  1YDK A;  4V1A g;  4J57 E;  3TB2 A;  1XW6 A;  3APS A;  1SL0 B;  1ZOF A;  4IN0 A;  2X8G A;  5KOW A;  2GZZ A;  1PQN A;  4MF6 A;  2REM A;  1TK0 B;  2K8S A;  3ZFB A;  3UIW A;  2YWN A;  2VCX A;  4HZ4 A;  1SU9 A;  4WKW A;  4Q5Q A;  3LSZ A;  3HXS A;  3EWL A;  2WS2 A;  4F9Z A;  3U6V A;  4ACS A;  5AIS A;  3DRN A;  2B7K A;  4O5R A;  2XPE A;  3LOR A;  1XBS A;  4WEY A;  1AW9 A;  3GL5 A;  3WT2 A;  3F8U A;  3A2V A;  3E0U A;  3L9U A;  2ES7 A;  5IO0 A;  3HD5 A;  1TKD B;  1PSQ A;  1RW1 A;  2AB6 A;  1QK8 A;  2G0F A;  3GTU B;  3I69 A;  1Y6E A;  2K9F A;  4ICY A;  2QGV A;  1FHE A;  2H30 A;  3ZTL A;  1K3Y A;  4AGS A;  5HQP A;  1NHO A;  2LS5 A;  2DJ3 A;  1FOH A;  4YQV A;  3IDV A;  3DYR A;  4E8H A;  3S9F A;  1X9S B;  1T4Z A;  3I43 A;  1M7T A;  4OFT A;  2IPA A;  1TRW A;  5J5N A;  3F63 A;  2CZ3 A;  1WJK A;  2PBJ A;  1OC3 A;  1O8X A;  5BRT A;  1V40 A;  1ML6 A;  3KTB A;  3LGC A;  1GTU A;  4K6X A;  3FHK A;  3DKS A;  2PVQ A;  4HU9 A;  2H71 A;  3CSJ A;  3IC4 A;  4X0X A;  4PQI A;  3EUR A;  2EIR A;  1PN0 A;  4HJ2 A;  1F37 A;  2P5R A;  1A2J A;  2HZE B;  1ZCP A;  1N8J A;  1EV4 A;  2NTO A;  1YF1 A;  2VAF A;  3UAR A;  1FG4 A;  2DLX A;  2YJ7 A;  11GS A;  2WB9 A;  3HVX A;  3MNG A;  5J41 A;  3D6I A;  4BVX A;  3WGE A;  3NZN A;  4IP1 A;  2YCD A;  5DAL B;  3FKF A;  4MCU A;  2GZP A;  1XWG A;  4KF9 A;  4GF0 A;  3WGX A;  1PMT A;  3VK9 A;  4PNF A;  4DSS A;  2H1G A;  2GTU A;  3APQ A;  3FYG A;  4ZBA A;  1OAZ A;  3TJK A;  5B6N A;  2KP1 A;  1TI3 A;  1JLV A;  1YF0 A;  2DKI A;  5CRD A;  3CSH A;  1PD2 1;  2PMT A;  3M1G A;  4MDC A;  3TOT A;  2C4J A;  4EO3 A;  3DEX A;  1SJ6 A;  4K7N A;  5D9T A;  1C72 A;  1J9B A;  2L4Q A;  3F4T A;  3W6G A;  3G7J A;  1THO A;  1PN9 A;  4OD7 A;  2C0D A;  1K0M A;  2RM6 A;  2MBS A;  2MMZ A;  4JRR A;  3GYK A;  3DVW A;  4BA7 A;  2GDR A;  3TJB A;  5FHI A;  5HR1 A;  4F0C A;  1G0T A;  1GWC A;  3FW2 A;  2QKE A;  2C0G A;  1GH2 A;  2HXK A;  1QQ2 A;  4CDO A;  4D73 B;  5KEJ A;  3WT1 A;  3F3R A;  4MZW A;  3F6F A;  4DVC A;  1HYU A;  2LNS A;  3IA1 A;  4EC0 A;  1U3I A;  2A2P A;  4XRD A;  3IK7 A;  3UOM A;  3F0I A;  5GST A;  4POB A;  2FCH A;  5ECQ B;  3TRP A;  3N9J A;  5KN1 A;  3LFL A;  5IO2 A;  2FWE A;  3M8N A;  3P2A A;  2MMN A;  4E8E A;  4A5P A;  2DJJ A;  2LKU A;  3EYT A;  5GAN D;  4G0K A;  2A2R A;  1IYI A;  4FH8 A;  4RQX A;  1Q98 A;  3QFB C;  5KN0 A;  2FWF A;  4IKH A;  1O73 A;  3UBK A;  3L78 A;  4WR5 A;  2QC7 A;  1M0U A;  1SK2 A;  3FR6 A;  2LRN A;  5ENU A;  1XVW A;  1OYJ A;  2JZR A;  4ZL9 A;  4PUF C;  1M99 A;  3BOA A;  12GS A;  3ME7 A;  1SEN A;  3BD2 A;  4N30 A;  1GRX A;  1KNG A;  4JE1 A;  1AAZ A;  1FAA A;  3V1W A;  4Z2U A;  4TR0 A;  3I9V 2;  4FYB A;  1VGL A;  1EOG A;  5ECS A;  3OR5 A;  1GSU A;  3ZRE A;  4KCA A;  1HNA A;  2RUF A;  1ERT A;  1M2A A;  1PRX A;  2HRK A;  4XHM A;  4JBB A;  4POL A;  2I81 A;  4MF7 A;  2V32 A;  2YWO A;  4Q5N A;  1YQ1 A;  3CRU A;  1FOV A;  1HQO A;  4L0W A;  3TUE A;  2TRX A;  3A5W A;  2VCW A;  4OFN A;  1EEJ A;  2JAD A;  5CRE A;  3GKK A;  1EOH A;  4XIH A;  2LRT A;  5H5S A;  2L5O A;  1E2Y A;  1WE0 A;  3UBL A;  5IOX A;  3EIN A;  2CX3 A;  4K0N A;  3VPQ A;  2QA1 A;  3QD9 A;  1A0R P;  3R3E A;  3VWW A;  3VI7 A;  1GP1 A;  2GVP A;  1I5G A;  3GUR A;  3GKX A;  4TOP A;  5C04 A;  2O7K A;  1U6T A;  2X8H A;  5HFI A;  2O8V B;  2GLR A;  3HDC A;  2OAD A;  3MIX A;  2B5X A;  3D0Z A;  4HI7 A;  1O85 A;  3CTG A;  4AJ6 A;  5L71 A;  3FRC A;  2YNX A;  4ZL8 A;  2GQL A;  3EPT A;  1BJX A;  4OMV A;  1WMJ A;  1GNE A;  2H6X A;  5LD0 A;  3KXO A;  2AJQ B;  2I1U A;  4N0V A;  3FMW A;  5IMA A;  2LEG A;  3H8Q A;  2L59 A;  2VUP A;  3HCZ A;  3BBY A;  1ST9 A;  2M80 A;  2PGT A;  3CBU A;  2WGR A;  3TKS A;  2LV3 A;  2C1Y A;  2E7P A;  2I4A A;  2IMK A;  2C3N A;  3HY2 A;  4ZL7 A;  2FHE A;  3IR4 A;  1DE1 A;  1B9X C;  1YY7 A;  4J2F A;  5G1L A;  5ECI B;  1QFN A;  1R5A A;  2DJ0 A;  2R0C A;  2KHP A;  2WUL A;  4EXJ A;  1QGV A;  2VLV A;  2HZF A;  3IBH A;  4GXZ A;  4ULX A;  1FB0 A;  2DMM A;  3M9K A;  4BVY B;  4EIQ A;  1USB A;  2HSM A;  2MYG A;  2L5L A;  4GTU A;  1CQH A;  4GRF A;  5HR2 A;  2H74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...