2B5XA

Solution structure of a thioredoxin-like protein in the reduced form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
148
structure length
148
Chain Sequence
b'MKLRQPMPELTGEKAWLNGEVTREQLIGEKPTLIHFWSISCHLCKEAMPQVNEFRDKYQDQLNVVAVHMPRSEDDLDPGKIKETAAEHDITQPIFVDSDHALTDAFENEYVPAYYVFDKTGQLRHFQAGGSGMKMLEKRVNRVLAETE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YkuV protein
publication title The bacillus subtilis YKUV is a thiol-disulfide oxidoreductase revealed by its redox structures and activity
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 47
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2b5xA00
5F8BA 3EE2A 1SD9A 2M72A 1EV4A 4GCIA 4I8BA 1O8XA 2B7KA 2L6DA 2N5AA 1SK1A 4KSOA 3ZLPA 2LNSA 4IBPA 3HZ8A 3S9FA 3H1NA 2HZFA 3KP8A 2H6YA 4EDYA 2HRNA 1O73A 5ECOB 2FWGA 2HT9A 2ON7A 4GTUA 3BBYA 4GQCA 4IQ1A 4ZB6A 4XS4A 1GWCA 4QQ7A 4MPGA 3QD9A 4OFMA 3IDVA 5IMAA 5DALB 2RLIA 1JZDA 4ZL7A 1FB6A 2OACA 3DRNA 4O5RA 2FY6A 2LJKA 1DE2A 2PGTA 3QAGA 4LMVA 4TR3A 2OE1A 5DJMA 1PMTA 1EOGA 4HJ2A 2OE3A 5E4WA 2I9HA 2HRFA 3RPPA 5ELAA 4TR0A 2CA8A 1QQ2A 2HXKA 1E2YA 4MJBA 4KDYA 3IOSA 1ABAA 1F2EA 1OKDA 1OE8A 3KXOA 1SL0B 4K7IA 4MF6A 1R4WA 3M8NA 2C4JA 1AQVA 2IFQB 2YANA 1RQMA 3O76A 5ID2B 2MBTA 3TKSC 3D6IA 3TRXA 3U5RE 2C0EA 3L78A 4OCEA 4K9ZA 3FK8A 3TKSE 4MZBA 3E3EA 4OFNA 2HSHA 4TR4A 1LBKA 3GMFA 5DALA 3N5OA 3TDGA 5GSTA 5CO3A 4BWQA 3VPTA 3IK9A 3Q6OA 2JZSA 3G7IA 4IJ3A 3UBKA 2VM1A 1BYEA 4D73B 3ZTLA 1PQNA 4F2IA 1J9BA 3RAZA 1XCCA 3WD6A 2QSIA 3EVIA 4KX4A 2VD1A 2JSYA 2ZCTA 5COHA 1J08A 2H01A 1SK2A 1TRSA 1JZRA 3HYPA 1R26A 2QGVA 1K3LA 1B4QA 4K0NA 2PPTA 2IFQA 1SU9A 5ID2A 4YH2A 4HOJA 1ML6A 2G2QA 4NWYA 4TR1B 1A23A 4MCUA 4F0CA 3G7JA 5A5KA 4KNDA 3QCPA 2F3MA 1XOAA 3H79A 1T4ZA 1TP9A 3DVXA 2DSAA 3A5WA 5CRWA 4X1UA 3FYGA 3VI7A 2GGTA 3CXGA 1C72A 5IPHA 5E59A 2H1AA 4LMWA 1S3CA 4D73A 4XTSA 2O7KA 2CAIA 3KMOA 1K0BA 2YNXA 1XBSA 3RHBA 4IP1A 3A2WA 3APOA 1USBA 2L5LA 1ZOFA 4EO3A 1Z3EA 3TKRA 2E2MA 1G7EA 4OCFA 2WDUA 4H86A 3ZIJA 4PURA 3KIJA 5AN1A 4F9ZA 1TJDA 1EP8A 3TKPA 1IYIA 3PINA 3GYKA 4LA1A 2J23A 1TXXA 1JZWA 4XCSA 1MD4A 1QMVA 2L5OA 4GSSA 4TR1A 2IIYA 2CV4A 2I3YA 3CRUA 1LJRA 1UA5A 1PGTA 2ZNMA 4BVXA 4BA7A 2YV7A 4POMA 4LLRA 2LJAA 1NSWA 1QK8A 1WPIA 5ECQB 3SWLA 5DJLA 1N8JA 2IMFA 3KEBA 2CX3A 5GSSA 4NV5A 4OFTA 2IMDA 2VLTA 2DIZA 4L8EA 5ECIB 1HQOA 3LGCA 4KSMA 4AJ7A 2IPAA 4EE0A 2K6VA 2JZRA 1PL2A 3QAVA 3KJYA 5A4WA 3TJKA 4DSQA 5HFKA 2XPDA 4JBBA 3G7YA 4EVMA 3D4MA 3KMNA 5G5EA 4K7OA 3GURA 2R4VA 3VWWA 2DJ2A 2TIRA 2H1DA 4V2LA 3JCML 4KCEA 2GT5A 5GZZB 4DVCA 1XVQA 2MMOA 5IO0A 3TOTA 1PD21 3P8WA 5KEJA 5EVOA 5DAKB 4Q5RA 3VWXA 2DJJA 3HDCA 1GUHA 2H76A 1VF1A 10GSA 1TU8A 2WB9A 1AAZA 4XIHA 1AUCA 2J9HA 3LXZA 4F03A 2AYTA 1XWBA 2PWJA 1H4OA 4MK3A 2CZ2A 1A2JA 1V2AA 3IE3A 5J9CA 3QFBC 2V32A 2B5YA 4IELA 1ZGNA 3M3MA 4F0BA 4PGTA 3QPMA 1JFUA 3GL3A 3P2AA 5DDLA 1HNBA 5J4UA 5J41A 6GSTA 2V1MA 1WRYA 4BL7A 1YEPA 1WJKA 1GSEA 5B6MA 2H73A 2LNTA 1K0OA 4BWSA 1GSUA 5DAKA 3NZNA 2H19A 2NBSA 1GL8A 3F8UA 3US3A 2P31A 1TI1A 1GNWA 4ID0A 3VLNA 3ZFBA 4MJAA 1U3IA 2B1KA 3HCZA 5IMFA 4MJCA 3DGQA 1O7UA 1F6MC 3CYNA 4P3YB 4GXZA 3RPNA 4HU9A 4I97A 1G6WA 2MZCA 1JLVA 3EYTA 3CBUA 2HLSA 2EIOA 2A2RA 5F07A 18GSA 1HNAA 2DIYA 3VFIA 4POBA 2GZYA 4GSTA 4KB3A 2MBSA 1PX6A 3TB2A 3EINA 1HYUA 3HVXA 5A4VA 4NHWA 4QL9A 4J56E 1K3YA 3IAS2 3E9JB 2K8VA 4RI6A 1SYXA 4ILFA 6GSVA 1AQXA 4HZ4A 4WXTA 2PUKC 1H75A 2BTOT 5C04A 4PX1A 4V2NA 4KW6A 2YWMA 4AJ8A 2KLXA 2YWIA 3M1GA 2DJ3A 3A3TA 3M0FA 3EC3A 1XWKA 1U3AA 4TN8A 2CVKA 3VURA 1V9WA 1FHEA 4I5QA 3CSJA 2GVPA 2KHPA 3EU3A 5IMZA 4HI7A 4Z7XA 4MJEA 2VD0A 2H71A 2H0IA 2EC4A 3WYWA 2YWOA 4POKA 1Y25A 5DCGA 6GSWA 2VIMA 5ECNB 4F82A 4RQXA 3WGDA 2WJUA 2Z9SA 4ZB9A 6GSYA 3FZ5A 1TTZA 2LRCA 1X5CA 2RIIA 4CDOA 1S3AA 2WRTA 2G0FA 1TRVA 5JCUA 3DXBA 4K0GA 2IJYA 1EGRA 2DLXA 3GKKA 4TKYA 5DBQA 3FZAA 4N10A 2FWHA 3TRPA 3APQA 2ZUPA 2BJXA 4G2EA 1XWAA 1BQ7A 1MDIA 1W4VA 3P7XA 4J57E 2IMEA 1MDKA 1EWXA 3CRTA 3KH9A 1DSBA 5EPFA 1SJIA 1F9MA 3WGXA 1SJZA 4WR4A 1SENA 1ACVA 4WETA 1PSQA 4IQAA 5H5QA 1V57A 2GTUA 3CSHA 3WGEA 1VF2A 2YZUA 1X9WB 3CSIA 4ISDA 1BAYA 4HEA2 3M9KA 5LCZA 5IO2A 2PN8A 1Y6EA 1XWGA 1O6JA 4MPFA 3LEFA 1CQHA 1TI3A 1MDJA 2FA8A 3UMAA 3A2VA 2CAQA 5IQYA 4IVFA 4IP6A 1QXHA 3MWHA 3ISOA 2AV4A 3F6FA 3BCIA 2ON5A 2AJQB 2K9FA 3GL5A 4PUFC 2L57A 2A2SA 2FHEA 2VM2A 5CNWA 4EF0A 5HR1A 4OO4A 3EWLA 1VF3A 2YN1A 1EOHA 4N11A 1GTUA 3ERFA 3QMXA 2GS3A 4WKWA 2CQ9A 1FW1A 2DJ1A 4ECIA 2C0DA 1RK4A 1X9SB 2EIQA 4HJMA 3IRAA 4PXOA 3H8QA 2X8CA 2H0HA 4CHSA 2OADA 1M9AA 2RUEA 1GUMA 4NAXA 1KBNA 4POLA 3TKQA 3LFLA 1XW5A 1V98A 2X64A 5ABRA 3ERWA 3L0HA 1CQGA 2JU5A 4KDUA 3PH9A 3F4TA 4NV2A 3MSZA 2AAWA 3DKSA 2DJ0A 2GSRA 3ZITA 2H6ZA 4ACSA 4I2TA 1N2AA 4IS0A 2P5RA 4X0XA 6GSUA 1TK0B 2R6KA 3C7MA 3FR6A 4NHZA 3HVSA 3I69A 1SL1B 2PVOC 4N0ZA 2MMNA 3KM6A 3VWVA 2K18A 3W8SA 1ZYEA 5EY6A 3J7Yk 3E0UA 1ON4A 1K0DA 1A2MA 5L71A 4TOPA 3R2QA 1T8EB 1SKRB 4X43A 5IMCA 5ECSA 2VL2A 4TXOA 1M9BA 3W6GA 2OKAA 4Q5FA 2HFDA 1DUGA 4IJIA 4IHUA 5G1LA 2F8AA 3VPQA 2PVQA 2XC2A 2P0GA 3C8EA 1KNGA 1Z5YE 1SL2B 1B48A 2RM6A 2GT6A 3QFAC 1PN9A 2VL9A 2VL3A 3IA1A 2M80A 3LQ7A 2YJ7A 5F05A 5INYA 2FD3A 2H1BA 1A0FA 4YQMA 5CRHA 17GSA 3N9JA 2HYXA 1OC3A 1W89A 1ERVA 2GSSA 4ULXA 5DQSA 2GZZA 1B9XC 2XBIA 1WE0A 3PGTA 4QL7A 4TW5A 2V6KA 1XVWA 2JADA 2AUVA 4GQFA 2QC7A 1TKDB 1M2BA 2L4CA 3FRCA 2GQKA 1TOFA 3KP9A 2LS5A 3GNJA 1GSQA 1AQWA 2H66A 4WF4A 5FT3A 1T00A 5HR2A 1SJ6A 2GDRA 4ECJA 3DIEA 2N5FA 4TXVA 1A2LA 3C73A 3LG6A 1M2AA 1NHOA 3TRQA 3IC4A 8GSSA 1AW9A 3IAM2 4AJ6A 2MMZA 1PKZA 3V1WA 2C0GA 1GH2A 4HU7A 2DBCA 1HD2A 3IR4A 3F63A 2R5GA 4FYCA 1SK0A 2H74A 4ECCA 1XZOA 4OD7A 3SBCA 1ZYQB 4OWYA 2E7PA 1XFLA 1YEXA 3TCOA 3D5JA 3FR9A 2FCHA 3KCMA 3I43A 2JL4A 2I1UA 2FLSA 3F0IA 2JSZA 2H1GA 1SYRA 1BG5A 2KOKA 4I6XA 4WBRD 4KE3A 2M46A 4RI7A 2WULA 3I6AA 1MD3A 1BEDA 1OAZA 1FVKA 2DMLA 1M99A 2ES7A 1ERTA 1A0RP 5D9TA 1A8LA 3UVHA 5HQPA 4MH3A 2B1LA 3APSA 2VCTA 3ME7A 1EV9A 3ZMLA 2DJKA 2FNOA 2F8FA 1V58A 5FHIA 2VCQA 1EEJA 4AGSA 5KN3A 4TRXA 4NMUA 2I4AA 5FWGA 1X5EA 5CYYA 1FOVA 1WP0A 1TW9A 5KN2A 3DD3A 4FH8A 5G31A 3UBLA 1YF0A 1XIYA 2RUFA 1NW2A 2YWNA 4MF7A 3LYPA 1Q98A 2GZPA 1OC9B 3EMXA 1ZCPA 5H5RA 1IYHA 1ZMAA 1GRXA 1M0UA 4WBJA 3GSSA 2YP6A 4IKHA 2HE3A 1GTBA 5H5SA 5G5FA 3BOAA 3GKXA 3VI5A 3HZ4A 3QAWA 1O81A 4MLYA 2LSTA 3D0ZA 4L0UA 4EL1A 2R2JA 3ERGA 5CREA 3KH7A 3GKNA 1V40A 2P5QA 1SKWB 4MA9A 1B8XA 5IM9A 3GX0A 2MMAA 2DMMA 1A8YA 4NPBA 4ZB8A 5F06A 1HNCA 2H6XA 2X8GA 2H72A 2XHFA 7GSSA 1M2DA 3A2XA 4FYBA 5IOWA 1VRSD 3GX8A 2LKUA 1YQ1A 4KCAA 4IN0A 1FAAA 1J0FA 2K8SA 3GHAA 20GSA 3RDWA 2R3XA 4XHMA 1YF1A 5D93A 4DSSB 2YCDA 2X8HA 2E2GA 1TDIA 11GSA 1OC9A 1I5GA 3U6VA 5G30A 4MH2A 2D2ZA 1THOA 1BJXA 4KH7A 4K1FA 2MYGA 4J2FA 3D21A 1T1VA 3UJ1A 4HDEA 2NVLA 1DE1A 3L4NA 3ZMKA 3QR6A 1VGLA 2CZ3A 1U88A 3RHCA 5AIXA 5GAND 3IK7A 4LL4B 2C3TA 2C3QA 2KP2A 2PBJA 1DBYA 3ZL5A 1M7TA 2YJHA 3UL3A 3ZIVA 3H93A 4IGJA 2EIRA 1K3OA 4MF5A 1WIKA 1UC7A 3MNGA 3NOFA 2V2GA 3UARA 1E6BA 2HI7A 1AXDA 4KDXA 2GQMA 2KUCA 5JWRB 3BCKA 3F9UA 2L59A 1OVNA 1ZZYA 1X5DA 3FR3A 2LV3A 5IIZA 1GULA 2H75A 4GLTA 4JR6A 4DSSA 1VF4A 2X99A 1JZOA 5ECHB 5ECKB 1WMJA 1TK5B 3P90A 5JWOB 1XW9A 2H30A 2GQLA 4L5OA 5G2ZA 2IN3A 2O8VB 2R37A 2VL2C 3DYRA 3HXSA 2LRNA 1ERWA 3ZVJA 2VCVA 3LXTA 1KTEA 1GLPA 4G19A 22GSA 3FZ9A 5HR0A 3IV4A 1I9DA 2B7JA 2IMIA 5ECRB 1ZL9A 4GF0A 3HJPA 4N30A 1URMA 1YZXA 1FG4A 1G6YA 2B3SA 2JZTA 1Z9HA 5A4UA 3KD0A 1TK8B 2FWEA 5J9BA 6GSSA 3LJRA 1PKWA 2OBKA 3FEUA 1YY7A 3F3QA 6GSXA 3DWVA 2H8LA 5AGYA 2VAFA 4RUVA 2H70A 2QKEA 2V41A 4JE1A 1XPVA 4JEDA 3LORA 3WT2A 3FZ4A 3PR8A 2XBQA 3OR5A 2GSTA 3D22A 3J7Yb 1JLWA 3GV1A 4XS6A 2YPMA 4O7HA 5CRDA 3NIVA 1OE7A 1QGVA 2C8UA 2VCWA 5D73A 2VOCA 1Z6MA 3TJBA 2ALBA 3FHKA 4TXOB 2TRCP 4G9HA 5DQYA 4IW9A 4XRAA 1YKAA 4JRRA 3VK9A 3IHQA 3WT1A 1KEBA 4V1Ag 1YDKA 3IBHA 5J5NA 3HD5A 2F9SA 1F3AA 1T7PB 4ZXGA 4YAVA 3GA4A 1XOBA 1JHBA 1XXUA 1U87A 4WF5A 1FVJA 1O8WA 2VLUA 3F4SA 3TJGA 3QDNA 3IXRA 2YV9A 4G10A 3LSZA 5B8AA 4TVEA 3C1SA 1T3BA 1S3DA 4GWRA 5HR3A 4O32A 1PL1A 3HHVA 1T4YA 2N5BA 1XWCA 1YKCA 4L0WA 5IOXA 5J3RA 3UOMA 5G1KA 1GTIA 1UVZA 3HKRA 2IL3A 2O89A 5KN1A 2FUG2 2WZ9A 4CW9A 5LNKe 4MMMA 4MZCA 3GUSA 4K6XA 1TU7A 1OC8A 2AB6A 13GSA 5GAPD 1BX9A 3ED3A 3DMLA 3BD2A 3MAKA 1GSDA 3ME8A 2B5EA 3HVVA 2OJLA 5EL8A 4EXJA 3UVTA 2BMXA 4RQRA 4PNGA 4ZIJA 3M9JA 3TUEA 3C1RA 3VWUA 2GLRA 3GFKA 5F0GA 2CX4A 2PMTA 2OE0A 2REMA 1K0MA 2HSYA 1ST9A 3GKMA 3K8NA 1NHYA 1PX7A 5JWQB 2OBIA 5D9VA 4DSRA 2FWFA 4OO5A 2WFCA 3L9VA 2C0FA 2LUSA 2FA4A 1OKTA 2NTOA 2CVDA 1SD8A 4ML1A 1FB0A 4ZBDA 4K2DA 2HZEB 1EZKA 3D4TA 2A4VA 4ECBA 2PU9C 3HJOA 1K0AA 4FIWA 4PQIA 1NM3A 4MZWA 1F3BA 4BVYA 2I81A 4XRDA 1LU4A 3GTUB 1O85A 1UN2A 3MDKA 5AIVA 3TKSA 2FGXA 4E8HA 2LQOA 1U6TA 5CRGA 1EGOA 5ELGA 1K0NA 1QUWA 2LRTA 1TRWA 1EEMA 3RBTA 2RM5A 5ECPB 3LYKA 4YQUA 4V1Ap 2TRXA 2WCIA 1X0RA 5B7CA 4FO5A 3L9UA 4N0VA 2LTKA 1GNEA 2C1YA 2IMKA 3UEMA 5D96A 5CP1A 3ZYWA 3FW2A 3GH6A 5IPGA 4WR5A 1PA3A 2LEGA 5ENUA 1SKSB 1G0TA 3GN3A 2NPBA 5ECLB 2O87A 5D8IA 12GSA 3HA9A 2HZEA 2VCXA 2NDOA 1GP1A 3Q19A 4JR4A 1MEKA 1XW6A 4HZ2A 1Z7RA 3DEXA 1FO5A 2AHEA 4KUNA 2CVBA 3QOUA 1GTAA 1ILOA 3HJMA 3CTFA 4EUYA 4BPYA 5CAXA 3GTUA 4K8MA 5DCHA 5IMVA 2L4QA 2VUPA 4KGIA 5HFGA 5C00A 3ZRDA 1AIUA 2VCZA 1GSSA 3GH9A 2F51A 1GSYA 3H4KA 2B6MA 2HNLA 1YJ6A 3ZZXA 1RW1A 2IWTA 1K0CA 4GRFA 3TGZA 4HQSA 4PNFA 1TRUA 3DVWA 1EP7A 3TJJA 4GSNA 1B9YC 3LWAA 3F6DA 3GIXA 4KAEA 3HY2A 3KTLA 1GUKA 4HS1A 3Q18A 3ZFLA 5B6NA 3AY8A 5D9WA 2WS2A 3KZQA 2CT6A 4ML6A 1A24A 2KP1A 4Q5NA 9GSSA 1R7HA 19GSA 2JACA 4I2UA 3TJFA 4DEJA 5IMDA 5KN0A 2H0GA 5AISA 2YZHA 5HFIA 1Z6NA 3C71A 2C3NA 2GSQA 3GRXA 2LQQA 4KA0A 1Z7PA 2E0QA 2VO4A 2L6CA 14GSA 3Q74A 2WGRA 5JCGA 1AC1A 5LD0A 2C80A 4PUAA 4EDZA 3GSTA 3I9V2 3W8JA 1QFNA 2B5XA 2VLVA 3F4RA 4K7NA 2V6OA 4ZILA 4EC0A 4OMVA 4L5LA 3FKFA 4PQ1A 4MABA 5JCWA 4MDCA 1PRXA 4ZBBA 5B8BA 3UIWA 2LJRA 4E8EA 1R5PA 4WEYA 3F3RA 5D9XA 2PERA 1F37A 2XPEA 4FYUA 1THXA 4XS1A 3FY7A 4JU5A 3ZREA 4LL1B 2DC5A 4YQVA 1ERUA 1Q4JA 4AF2A 3EURA 5ECMB 3IPZA 4MP4A 3ZVJD 1X9MB 4XS4B 1B4PA 2YOIA 4NXIA 3G9BA 3EMPA 3TOUA 4HQZA 3KGKA 4HUAA 3O6TA 1WWJA 1R5AA 16GSA 4ZL8A 4JZQA 3BJ5A 2OA7A 5DVBA 1GLQA 1GSFA 4ZBAA 1WOUA 4EKZA 1MTCA 2O85A 4Q5QA 4ZL9A 1OYJA 3KTBA 3O3TA 4PQHA 3CTGA 4O92A 1G7OA 3EU4A 4V2MA 3L9SA 3CMIA 4YAPA 3UAPA
chains in the Genus database with same CATH superfamily
5F8BA 3EE2A 1SD9A 2M72A 1EV4A 4GCIA 4I8BA 1O8XA 2B7KA 2L6DA 2N5AA 1SK1A 4KSOA 3ZLPA 2LNSA 4IBPA 3HZ8A 3S9FA 3H1NA 2HZFA 3KP8A 2H6YA 4EDYA 2HRNA 1O73A 5ECOB 2FWGA 2HT9A 2ON7A 4GTUA 2X4AA 3BBYA 4GQCA 4IQ1A 4ZB6A 4XS4A 1GWCA 4QQ7A 4MPGA 3QD9A 4OFMA 3IDVA 5IMAA 5DALB 2RLIA 1JZDA 4ZL7A 1FB6A 2OACA 3DRNA 4O5RA 2FY6A 2LJKA 1DE2A 2UZ8A 2PGTA 3QAGA 4LMVA 4TR3A 2OE1A 5DJMA 1PMTA 1EOGA 4HJ2A 2OE3A 5E4WA 2I9HA 2HRFA 3RPPA 5ELAA 4TR0A 2CA8A 1PFOA 2HRKA 1QQ2A 2HXKA 1E2YA 4MJBA 4KDYA 3IOSA 1ABAA 1F2EA 1OKDA 1OE8A 3KXOA 1SL0B 4K7IA 4Z2UA 4MF6A 1R4WA 3M8NA 2C4JA 1AQVA 2IFQB 2YANA 1RQMA 3O76A 5ID2B 2MBTA 3TKSC 3D6IA 3TRXA 3U5RE 2C0EA 3L78A 4OCEA 4K9ZA 3FK8A 3TKSE 4MZBA 4OFNA 3E3EA 2HSHA 3LW9A 1LBKA 3GMFA 4TR4A 5DALA 3N5OA 3TDGA 5GSTA 5CO3A 4BWQA 3VPTA 3IK9A 3Q6OA 2JZSA 3G7IA 2R0PA 4IJ3A 3UBKA 2VM1A 1BYEA 4D73B 3ZTLA 1PQNA 4F2IA 4USSA 1J9BA 3RAZA 1XCCA 3WD6A 2QSIA 3EVIA 4KX4A 2VD1A 2JSYA 2ZCTA 5COHA 1J08A 2H01A 1SK2A 1TRSA 1JZRA 3HYPA 1R26A 2QGVA 1K3LA 1B4QA 4K0NA 2PPTA 2IFQA 4BVYB 1SU9A 5ID2A 4YH2A 4HOJA 1ML6A 2G2QA 4NWYA 4TR1B 1A23A 4MCUA 4F0CA 3G7JA 5A5KA 4KNDA 4BVXB 3QCPA 2F3MA 1XOAA 3H79A 1T4ZA 1TP9A 3DVXA 2DSAA 3A5WA 5CRWA 4X1UA 3FYGA 3VI7A 2GGTA 3CXGA 4EIQA 1C72A 5IPHA 1M3JA 5E59A 2H1AA 4LMWA 1S3CA 4D73A 4XTSA 2O7KA 2CAIA 3FMWA 3KMOA 1K0BA 2YNXA 1XBSA 3RHBA 4IP1A 3A2WA 3APOA 1USBA 2L5LA 4G0KA 1ZOFA 4EO3A 1Z3EA 3TKRA 2E2MA 1G7EA 4OCFA 2WDUA 4H86A 3ZIJA 4PURA 3KIJA 5AN1A 4F9ZA 1TJDA 1EP8A 3TKPA 1IYIA 3PINA 3GYKA 4LA1A 2J23A 1TXXA 1JZWA 4XCSA 1MD4A 1QMVA 2L5OA 4GSSA 4TR1A 2IIYA 2CV4A 2I3YA 3CRUA 1LJRA 1UA5A 1PGTA 2ZNMA 4BVXA 4BA7A 2YV7A 4POMA 4LLRA 1ZYNA 2LJAA 1NSWA 1QK8A 1WPIA 5ECQB 3SWLA 5DJLA 1N8JA 2IMFA 3KEBA 2CX3A 5GSSA 4NV5A 4OFTA 2IMDA 2VLTA 2DIZA 4L8EA 5ECIB 1HQOA 3LGCA 4KSMA 4AJ7A 2IPAA 4EE0A 2K6VA 2JZRA 1PL2A 3QAVA 3KJYA 5A4WA 3TJKA 4DSQA 5HFKA 2XPDA 4JBBA 3G7YA 4EVMA 3D4MA 3KMNA 5G5EA 4K7OA 3GURA 2R4VA 3VWWA 2DJ2A 2TIRA 2H1DA 4BL7B 4V2LA 3JCML 4KCEA 2GT5A 5GZZB 4DVCA 1XVQA 2MMOA 4O5QA 5IO0A 3TOTA 1PD21 3P8WA 5KEJA 5EVOA 5BRTA 5DAKB 4Q5RA 4PTSA 3VWXA 2DJJA 3HDCA 1GUHA 2H76A 1VF1A 10GSA 1TU8A 2WB9A 1AAZA 4XIHA 1AUCA 2J9HA 4K5RA 3LXZA 4F03A 2AYTA 1XWBA 2PWJA 1H4OA 4MK3A 2CZ2A 1A2JA 1V2AA 3IE3A 5J9CA 3CQFA 3QFBC 2V32A 2B5YA 4IELA 1ZGNA 3M3MA 4F0BA 5BMUA 4PGTA 3QPMA 1JFUA 3GL3A 3P2AA 5DDLA 1HNBA 5J4UA 5J41A 6GSTA 2V1MA 1WRYA 4BL7A 1YEPA 1WJKA 1GSEA 5B6MA 2H73A 2LNTA 1K0OA 4BWSA 1GSUA 5DAKA 3NZNA 2H19A 2NBSA 1GL8A 3F8UA 3US3A 2P31A 1TI1A 1GNWA 4ID0A 3VLNA 3ZFBA 4MJAA 1U3IA 5KOWA 2B1KA 3HCZA 5IMFA 4MJCA 3DGQA 1O7UA 1F6MC 3CYNA 4P3YB 4GXZA 3RPNA 4HU9A 4I97A 1G6WA 2MZCA 1JLVA 3EYTA 3CBUA 2HLSA 2EIOA 2A2RA 2R0GA 5F07A 18GSA 1HNAA 2DIYA 3VFIA 4POBA 2GZYA 4GSTA 4KB3A 2MBSA 1PX6A 3TB2A 3EINA 1HYUA 3HVXA 5A4VA 4NHWA 4QL9A 4CY8A 4J56E 1K3YA 3IAS2 3E9JB 2K8VA 4RI6A 1SYXA 4ILFA 6GSVA 1AQXA 4HZ4A 4WXTA 2PUKC 1H75A 2BTOT 5C04A 4PX1A 4V2NA 4KW6A 1FOHA 2YWMA 4AJ8A 2KLXA 2YWIA 3M1GA 2DJ3A 3A3TA 3M0FA 3EC3A 1XWKA 1U3AA 4TN8A 2CVKA 3VURA 1V9WA 1FHEA 4I5QA 3CSJA 2GVPA 2KHPA 3EU3A 5IMZA 4HI7A 4Z7XA 4MJEA 2VD0A 2H71A 2H0IA 2EC4A 3WYWA 2YWOA 4POKA 1Y25A 5DCGA 2QA2A 6GSWA 2VIMA 5ECNB 4F82A 4RQXA 3WGDA 2WJUA 2Z9SA 4ZB9A 6GSYA 3FZ5A 1TTZA 2LRCA 1X5CA 2RIIA 4K5SA 1S3AA 4CDOA 2WRTA 2G0FA 1TRVA 5JCUA 3DXBA 4K0GA 2IJYA 1EGRA 2DLXA 3GKKA 4TKYA 5DBQA 3FZAA 4N10A 2FWHA 3TRPA 3APQA 2ZUPA 2BJXA 4G2EA 1XWAA 3R3EA 1BQ7A 1MDIA 1W4VA 3P7XA 4J57E 2IMEA 1MDKA 1EWXA 3CRTA 3KH9A 1DSBA 5EPFA 1SJIA 1F9MA 3WGXA 1SJZA 4WR4A 1SENA 5KOXA 1ACVA 4WETA 1PSQA 4IQAA 5H5QA 1V57A 2GTUA 3CSHA 3WGEA 1VF2A 2YZUA 1X9WB 3CSIA 4ISDA 1BAYA 4HEA2 3M9KA 5LCZA 5IO2A 2PN8A 1Y6EA 1XWGA 1O6JA 4MPFA 3LEFA 1CQHA 1TI3A 1MDJA 2FA8A 3UMAA 3A2VA 2A4HA 2CAQA 5IQYA 4IVFA 4IP6A 1QXHA 3MWHA 3ISOA 2AV4A 3F6FA 3BCIA 2ON5A 2AJQB 2K9FA 3GL5A 4PUFC 2L57A 2A2SA 2FHEA 2VM2A 5CNWA 4EF0A 5HR1A 4OO4A 3EWLA 1VF3A 2YN1A 1EOHA 4N11A 1GTUA 3ERFA 3QMXA 2GS3A 4WKWA 2CQ9A 1FW1A 2DJ1A 4ECIA 2C0DA 1RK4A 1X9SB 2EIQA 4HJMA 3IRAA 4PXOA 3H8QA 2X8CA 2H0HA 4CHSA 2OADA 1M9AA 2RUEA 1GUMA 4NAXA 1KBNA 4POLA 3TKQA 3LFLA 1XW5A 1V98A 2X64A 5ABRA 3IC8A 3ERWA 3L0HA 1CQGA 2JU5A 4KDUA 3PH9A 3F4TA 4NV2A 3MSZA 2AAWA 3DKSA 2DJ0A 2GSRA 3ZITA 2H6ZA 4ACSA 4I2TA 1N2AA 4IS0A 2P5RA 4X0XA 6GSUA 1TK0B 2R6KA 3C7MA 3FR6A 4NHZA 3HVSA 3I69A 1SL1B 2PVOC 4N0ZA 2MMNA 3KM6A 3VWVA 2K18A 3W8SA 1ZYEA 5EY6A 3J7Yk 3E0UA 1ON4A 1K0DA 1A2MA 5L71A 4TOPA 3R2QA 1T8EB 1SKRB 4X43A 5IMCA 5ECSA 2VL2A 4TXOA 1M9BA 3W6GA 2OKAA 4Q5FA 2HFDA 1DUGA 4IJIA 4IHUA 5G1LA 2F8AA 3VPQA 2PVQA 3PPUA 2XC2A 2P0GA 3C8EA 1KNGA 1Z5YE 1SL2B 1B48A 2RM6A 2GT6A 3QFAC 1PN9A 2VL9A 2R0CA 2VL3A 4A5PA 3IA1A 1PN0A 2M80A 3LQ7A 2YJ7A 5F05A 5INYA 4YKFA 2FD3A 2H1BA 1A0FA 4YQMA 5CRHA 17GSA 3N9JA 2HYXA 1OC3A 1W89A 1ERVA 2GSSA 4ULXA 5DQSA 2GZZA 1B9XC 2XBIA 1WE0A 3PGTA 4QL7A 4TW5A 2V6KA 1XVWA 2JADA 2AUVA 4GQFA 2QC7A 1TKDB 1M2BA 2L4CA 3FRCA 2GQKA 1TOFA 3KP9A 2LS5A 3GNJA 1GSQA 1AQWA 2H66A 4WF4A 5FT3A 1T00A 5HR2A 1SJ6A 2GDRA 4ECJA 3DIEA 2N5FA 4TXVA 1A2LA 3C73A 3LG6A 1M2AA 1NHOA 3TRQA 3IC4A 8GSSA 1AW9A 3IAM2 4AJ6A 2MMZA 1PKZA 3V1WA 2C0GA 1GH2A 4HU7A 2DBCA 1HD2A 3IR4A 3F63A 2R5GA 4FYCA 1SK0A 2H74A 4ECCA 2QA1A 1XZOA 4OD7A 3SBCA 1ZYQB 4OWYA 2E7PA 1XFLA 1YEXA 3TCOA 3D5JA 3FR9A 2FCHA 3KCMA 3I43A 2JL4A 2I1UA 2FLSA 3F0IA 2JSZA 2H1GA 1SYRA 1BG5A 2KOKA 4I6XA 4WBRD 4KE3A 2M46A 4RI7A 2WULA 3I6AA 1MD3A 1BEDA 1OAZA 1FVKA 2DMLA 1M99A 2ES7A 1ERTA 1A0RP 5D9TA 1A8LA 3UVHA 5HQPA 4MH3A 2B1LA 3APSA 2VCTA 3ME7A 1EV9A 3ZMLA 2DJKA 2FNOA 2F8FA 1V58A 5FHIA 2VCQA 1EEJA 4Z2TA 4AGSA 5KN3A 4CY6A 4TRXA 3A5IA 4NMUA 2I4AA 5FWGA 1X5EA 5CYYA 1FOVA 1WP0A 1TW9A 4G0IA 3DD3A 5KN2A 4FH8A 5G31A 3UBLA 1YF0A 1XIYA 2RUFA 1NW2A 2YWNA 4MF7A 3LYPA 1Q98A 2GZPA 1OC9B 3EMXA 1ZCPA 5H5RA 1IYHA 1ZMAA 1GRXA 1M0UA 4WBJA 3GSSA 2YP6A 4IKHA 2HE3A 1GTBA 5H5SA 5G5FA 3BOAA 3GKXA 3VI5A 3HZ4A 3QAWA 1O81A 4MLYA 2LSTA 3D0ZA 4L0UA 4EL1A 2R2JA 3ERGA 5CREA 3KH7A 3GKNA 1V40A 2P5QA 1SKWB 4MA9A 1B8XA 5IM9A 3GX0A 2MMAA 2DMMA 1A8YA 4NPBA 4ZB8A 5F06A 1HNCA 2H6XA 2X8GA 2H72A 2XHFA 7GSSA 1M2DA 3A2XA 4FYBA 5IOWA 1VRSD 3GX8A 2LKUA 1YQ1A 4KCAA 4IN0A 1FAAA 1J0FA 2K8SA 3GHAA 4MNNA 20GSA 3RDWA 2R3XA 4XHMA 1YF1A 5D93A 4DSSB 2YCDA 3MYDA 2X8HA 2E2GA 1TDIA 11GSA 1OC9A 1I5GA 3U6VA 5G30A 4MH2A 3MIXA 2D2ZA 1THOA 1BJXA 4KH7A 4K1FA 2MYGA 4J2FA 3D21A 1T1VA 3UJ1A 4HDEA 2DKIA 2NVLA 1DE1A 3L4NA 3ZMKA 3QR6A 1VGLA 2CZ3A 1U88A 3RHCA 5AIXA 3EPTA 5GAND 3IK7A 4LL4B 2C3TA 2C3QA 2KP2A 2PBJA 1DBYA 3ZL5A 1M7TA 2YJHA 3UL3A 3ZIVA 3H93A 4IGJA 2EIRA 1K3OA 3HVNA 4MF5A 1WIKA 1UC7A 3MNGA 3NOFA 2V2GA 3UARA 4K2XA 1E6BA 2HI7A 1AXDA 4KDXA 2GQMA 2HSMA 2KUCA 5JWRB 3BCKA 3F9UA 2L59A 1OVNA 1ZZYA 1X5DA 3FR3A 2LV3A 5IIZA 4HSCX 1GULA 2H75A 4GLTA 4JR6A 4DSSA 1VF4A 2HRAA 2X99A 1JZOA 5ECHB 5ECKB 1WMJA 1TK5B 4O5UA 3P90A 5JWOB 1XW9A 2H30A 2GQLA 4L5OA 5G2ZA 2IN3A 2O8VB 2R37A 2VL2C 3DYRA 3HXSA 4FQUA 2LRNA 1ERWA 3ZVJA 2VCVA 1XG8A 3LXTA 1KTEA 1GLPA 4G19A 22GSA 3FZ9A 5HR0A 3IV4A 1I9DA 2B7JA 2IMIA 5ECRB 1M3IA 1ZL9A 4GF0A 3HJPA 4N30A 1URMA 2X49A 1YZXA 1FG4A 1G6YA 2B3SA 2JZTA 1Z9HA 5A4UA 3KD0A 1S3RA 1TK8B 4Z2RA 2FWEA 5J9BA 6GSSA 3LJRA 1PKWA 2OBKA 3FEUA 1YY7A 3F3QA 6GSXA 3DWVA 2H8LA 5AGYA 2VAFA 4RUVA 2H70A 2QKEA 2V41A 4JE1A 1XPVA 4JEDA 3LORA 3WT2A 3FZ4A 3PR8A 2XBQA 3OR5A 2GSTA 3D22A 3J7Yb 1JLWA 3GV1A 4XS6A 2YPMA 4O7HA 5CRDA 3NIVA 1OE7A 1QGVA 2C8UA 2VCWA 5D73A 2VOCA 1Z6MA 3TJBA 2ALBA 3FHKA 4TXOB 2TRCP 4G9HA 5DQYA 4IW9A 4XRAA 1YKAA 4JRRA 3VK9A 3IHQA 3WT1A 1KEBA 4V1Ag 1YDKA 3IBHA 5J5NA 3HD5A 2F9SA 1F3AA 1T7PB 4ZXGA 4YAVA 3GA4A 1XOBA 1JHBA 1XXUA 1U87A 4WF5A 1FVJA 1O8WA 2VLUA 3F4SA 3TJGA 3QDNA 3IXRA 2YV9A 4G10A 3LSZA 5B8AA 4TVEA 3C1SA 1T3BA 1S3DA 4GWRA 5HR3A 4O32A 1PL1A 3HHVA 1T4YA 2N5BA 1XWCA 1YKCA 4L0WA 5IOXA 5J3RA 3UOMA 5G1KA 1ZYPA 1GTIA 1UVZA 3HKRA 2IL3A 2O89A 5KN1A 2FUG2 2WZ9A 4CW9A 5LNKe 4MMMA 4MZCA 3GUSA 4K6XA 1TU7A 1OC8A 2AB6A 13GSA 5GAPD 1BX9A 3ED3A 3DMLA 3BD2A 3MAKA 1GSDA 3ME8A 2B5EA 3HVVA 2OJLA 5EL8A 4EXJA 3UVTA 2BMXA 4RQRA 4PNGA 4ZIJA 3M9JA 3TUEA 3C1RA 3VWUA 2GLRA 3GFKA 5F0GA 2CX4A 2PMTA 2OE0A 2REMA 1K0MA 2HSYA 1ST9A 3GKMA 3K8NA 1NHYA 1PX7A 5JWQB 2OBIA 5D9VA 4DSRA 2FWFA 4OO5A 2WFCA 3L9VA 2C0FA 2LUSA 4X4JA 2FA4A 1OKTA 2NTOA 2CVDA 1SD8A 4ML1A 1FB0A 4ZBDA 4K2DA 2HZEB 1EZKA 3D4TA 2A4VA 4ECBA 2PU9C 3HJOA 1K0AA 4FIWA 4PQIA 1NM3A 4MZWA 1F3BA 4BVYA 2I81A 4XRDA 1LU4A 3GTUB 1O85A 1UN2A 3MDKA 5AIVA 3TKSA 2FGXA 4E8HA 2LQOA 1U6TA 5CRGA 1EGOA 5ELGA 1K0NA 1QUWA 2LRTA 1TRWA 1EEMA 3RBTA 2RM5A 4EIPA 5ECPB 3LYKA 4YQUA 4V1Ap 4ICYA 2TRXA 2WCIA 1X0RA 5B7CA 4FO5A 3L9UA 4N0VA 2LTKA 1GNEA 2C1YA 2IMKA 3UEMA 5D96A 5CP1A 3ZYWA 3FW2A 3GH6A 5IPGA 4WR5A 1PA3A 2LEGA 5ENUA 1SKSB 1G0TA 3GN3A 2NPBA 5ECLB 2O87A 5D8IA 12GSA 3HA9A 2HZEA 2VCXA 2NDOA 1GP1A 4JR4A 3Q19A 1MEKA 1XW6A 4HZ2A 1Z7RA 3DEXA 1FO5A 2AHEA 4KUNA 2CVBA 3QOUA 1GTAA 1ILOA 3HJMA 3CTFA 4EUYA 4BPYA 5CAXA 3GTUA 4K8MA 5DCHA 5IMVA 2L4QA 2VUPA 4KGIA 5HFGA 5C00A 3ZRDA 1AIUA 2VCZA 1GSSA 3GH9A 2F51A 1GSYA 3H4KA 2B6MA 2HNLA 1YJ6A 3ZZXA 1RW1A 2IWTA 1K0CA 4GRFA 3TGZA 4HQSA 4PNFA 1TRUA 3DVWA 1EP7A 3TJJA 4GSNA 1B9YC 3LWAA 3F6DA 3GIXA 4KAEA 3HY2A 3KTLA 1GUKA 4HS1A 3Q18A 3ZFLA 5B6NA 3AY8A 5D9WA 4KF9A 2WS2A 3KZQA 2CT6A 4ML6A 1A24A 2KP1A 4Q5NA 9GSSA 1R7HA 19GSA 2JACA 4I2UA 3TJFA 4DEJA 5IMDA 5KN0A 2H0GA 5AISA 2YZHA 5HFIA 2A2PA 1Z6NA 2DKHA 3C71A 2C3NA 2GSQA 3GRXA 2LQQA 4KA0A 1Z7PA 2E0QA 2VO4A 2L6CA 14GSA 3Q74A 4G0LA 2WGRA 5JCGA 1AC1A 5LD0A 2C80A 4PUAA 4EDZA 3GSTA 3I9V2 3W8JA 1QFNA 2B5XA 2VLVA 3F4RA 4K7NA 2V6OA 4ZILA 4EC0A 4OMVA 4L5LA 3FKFA 4PQ1A 4MABA 5JCWA 4MDCA 1PRXA 4ZBBA 5B8BA 3UIWA 2LJRA 4E8EA 1R5PA 4WEYA 3F3RA 5D9XA 2PERA 1F37A 2XPEA 4FYUA 1THXA 4XS1A 3FY7A 4JU5A 3ZREA 3IHGA 4LL1B 2DC5A 4YQVA 1ERUA 1Q4JA 4AF2A 3EURA 5ECMB 3IPZA 4MP4A 3ZVJD 1X9MB 4XS4B 1B4PA 2YOIA 4NXIA 3G9BA 3EMPA 3TOUA 4HQZA 3KGKA 4HUAA 3O6TA 1WWJA 1R5AA 16GSA 4ZL8A 4JZQA 3BJ5A 2OA7A 4BIKA 5DVBA 1GLQA 1GSFA 4ZBAA 4YKGA 1WOUA 4EKZA 1MTCA 2O85A 4Q5QA 4ZL9A 1OYJA 3KTBA 3O3TA 4PQHA 3CTGA 4O92A 1G7OA 3EU4A 4V2MA 3L9SA 3CMIA 4YAPA 3UAPA
chains in the Genus database with same CATH topology
5F8BA 3EE2A 1SD9A 2M72A 1EV4A 4GCIA 4I8BA 1O8XA 2B7KA 2L6DA 2N5AA 1SK1A 4KSOA 3ZLPA 2LNSA 4IBPA 3HZ8A 3S9FA 3H1NA 2HZFA 3KP8A 2H6YA 4EDYA 2HRNA 1O73A 5ECOB 2FWGA 2HT9A 2ON7A 4GTUA 2X4AA 3BBYA 4GQCA 4IQ1A 4ZB6A 4XS4A 1GWCA 4QQ7A 4MPGA 3QD9A 4OFMA 3IDVA 5IMAA 5DALB 2RLIA 1JZDA 4ZL7A 1FB6A 2OACA 3DRNA 4O5RA 2FY6A 2LJKA 1DE2A 2UZ8A 2PGTA 3QAGA 4LMVA 4TR3A 2OE1A 5DJMA 1PMTA 1EOGA 4HJ2A 2OE3A 5E4WA 2I9HA 2HRFA 3RPPA 5ELAA 4TR0A 2CA8A 2HRKA 1QQ2A 2HXKA 1E2YA 4MJBA 4KDYA 3IOSA 1ABAA 1F2EA 1OKDA 1OE8A 3KXOA 1SL0B 4K7IA 4Z2UA 4MF6A 1R4WA 3M8NA 2C4JA 1AQVA 2IFQB 2YANA 1RQMA 3O76A 5ID2B 2MBTA 3TKSC 3D6IA 3TRXA 3U5RE 2C0EA 3L78A 4OCEA 4K9ZA 3FK8A 3TKSE 4MZBA 4OFNA 3E3EA 2HSHA 3LW9A 1LBKA 3GMFA 4TR4A 5DALA 3N5OA 3TDGA 5GSTA 5CO3A 4BWQA 3VPTA 3IK9A 3Q6OA 2JZSA 3G7IA 2R0PA 4IJ3A 3UBKA 2VM1A 1BYEA 4D73B 3ZTLA 1PQNA 4F2IA 4USSA 1J9BA 3RAZA 1XCCA 3WD6A 2QSIA 3EVIA 4KX4A 2VD1A 2JSYA 2ZCTA 5COHA 1J08A 2H01A 1SK2A 1TRSA 1JZRA 3HYPA 1R26A 2QGVA 1K3LA 1B4QA 4K0NA 2PPTA 2IFQA 4BVYB 1SU9A 5ID2A 4YH2A 4HOJA 1ML6A 2G2QA 4NWYA 4TR1B 1A23A 4MCUA 4F0CA 3G7JA 5A5KA 4KNDA 4BVXB 3QCPA 2F3MA 1XOAA 3H79A 1T4ZA 1TP9A 3DVXA 2DSAA 3A5WA 5CRWA 4X1UA 3FYGA 3VI7A 2GGTA 3CXGA 4EIQA 1C72A 5IPHA 5E59A 2H1AA 4LMWA 1S3CA 4D73A 4XTSA 2O7KA 2CAIA 3FMWA 3KMOA 1K0BA 2YNXA 1XBSA 3RHBA 4IP1A 3A2WA 3APOA 1USBA 2L5LA 4G0KA 1ZOFA 4EO3A 1Z3EA 3TKRA 2E2MA 1G7EA 4OCFA 2WDUA 4H86A 3ZIJA 4PURA 3KIJA 5AN1A 4F9ZA 1TJDA 1EP8A 3TKPA 1IYIA 3PINA 3GYKA 4LA1A 2J23A 1TXXA 1JZWA 4XCSA 1MD4A 1QMVA 2L5OA 4GSSA 4TR1A 2IIYA 2CV4A 2I3YA 3CRUA 1LJRA 1UA5A 1PGTA 2ZNMA 4BVXA 4BA7A 2YV7A 4POMA 4LLRA 1ZYNA 2LJAA 1NSWA 1QK8A 1WPIA 5ECQB 3SWLA 5DJLA 1N8JA 2IMFA 3KEBA 2CX3A 5GSSA 4NV5A 4OFTA 2IMDA 2VLTA 2DIZA 4L8EA 5ECIB 1HQOA 3LGCA 4KSMA 4AJ7A 2IPAA 4EE0A 2K6VA 2JZRA 1PL2A 3QAVA 3KJYA 5A4WA 3TJKA 4DSQA 5HFKA 2XPDA 4JBBA 3G7YA 4EVMA 3D4MA 3KMNA 5G5EA 4K7OA 3GURA 2R4VA 3VWWA 2DJ2A 2TIRA 2H1DA 4BL7B 4V2LA 3JCML 4KCEA 2GT5A 5GZZB 4DVCA 1XVQA 2MMOA 4O5QA 5IO0A 3TOTA 1PD21 3P8WA 5KEJA 5EVOA 5BRTA 5DAKB 4Q5RA 4PTSA 3VWXA 2DJJA 3HDCA 1GUHA 2H76A 1VF1A 10GSA 1TU8A 2WB9A 1AAZA 4XIHA 1AUCA 2J9HA 4K5RA 3LXZA 4F03A 2AYTA 1XWBA 2PWJA 1H4OA 4MK3A 2CZ2A 1A2JA 1V2AA 3IE3A 5J9CA 3QFBC 2V32A 2B5YA 4IELA 1ZGNA 3M3MA 4F0BA 5BMUA 4PGTA 3QPMA 1JFUA 3GL3A 3P2AA 5DDLA 1HNBA 5J4UA 5J41A 6GSTA 2V1MA 1WRYA 4BL7A 1YEPA 1WJKA 1GSEA 5B6MA 2H73A 2LNTA 1K0OA 4BWSA 1GSUA 5DAKA 3NZNA 2H19A 2NBSA 1GL8A 3F8UA 3US3A 2P31A 1TI1A 1GNWA 4ID0A 3VLNA 3ZFBA 4MJAA 1U3IA 5KOWA 2B1KA 3HCZA 5IMFA 4MJCA 3DGQA 1O7UA 1F6MC 3CYNA 4P3YB 4GXZA 3RPNA 4HU9A 4I97A 1G6WA 2MZCA 1JLVA 3EYTA 3CBUA 2HLSA 2EIOA 2A2RA 2R0GA 5F07A 18GSA 1HNAA 2DIYA 3VFIA 4POBA 2GZYA 4GSTA 4KB3A 2MBSA 1PX6A 3TB2A 3EINA 1HYUA 3HVXA 5A4VA 4NHWA 4QL9A 4CY8A 4J56E 1K3YA 3IAS2 3E9JB 2K8VA 4RI6A 1SYXA 4ILFA 6GSVA 1AQXA 4HZ4A 4WXTA 2PUKC 1H75A 2BTOT 5C04A 4PX1A 4V2NA 4KW6A 1FOHA 2YWMA 4AJ8A 2KLXA 2YWIA 3M1GA 2DJ3A 3A3TA 3M0FA 3EC3A 1XWKA 1U3AA 4TN8A 2CVKA 3VURA 1V9WA 1FHEA 4I5QA 3CSJA 2GVPA 2KHPA 3EU3A 5IMZA 4HI7A 4Z7XA 4MJEA 2VD0A 2H71A 2H0IA 2EC4A 3WYWA 2YWOA 4POKA 1Y25A 5DCGA 2QA2A 6GSWA 2VIMA 5ECNB 4F82A 4RQXA 3WGDA 2WJUA 2Z9SA 4ZB9A 6GSYA 3FZ5A 1TTZA 2LRCA 1X5CA 2RIIA 4K5SA 1S3AA 4CDOA 2WRTA 2G0FA 1TRVA 5JCUA 3DXBA 4K0GA 2IJYA 1EGRA 2DLXA 3GKKA 4TKYA 5DBQA 3FZAA 4N10A 2FWHA 3TRPA 3APQA 2ZUPA 2BJXA 4G2EA 1XWAA 3R3EA 1BQ7A 1MDIA 1W4VA 3P7XA 4J57E 2IMEA 1MDKA 1EWXA 3CRTA 3KH9A 1DSBA 5EPFA 1SJIA 1F9MA 3WGXA 1SJZA 4WR4A 1SENA 5KOXA 1ACVA 4WETA 1PSQA 4IQAA 5H5QA 1V57A 2GTUA 3CSHA 3WGEA 1VF2A 2YZUA 1X9WB 3CSIA 4ISDA 1BAYA 4HEA2 3M9KA 5LCZA 5IO2A 2PN8A 1Y6EA 1XWGA 1O6JA 4MPFA 3LEFA 1CQHA 1TI3A 1MDJA 2FA8A 3UMAA 3A2VA 2A4HA 2CAQA 5IQYA 4IVFA 4IP6A 1QXHA 3MWHA 3ISOA 2AV4A 3F6FA 3BCIA 2ON5A 2AJQB 2K9FA 3GL5A 4PUFC 2L57A 2A2SA 2FHEA 2VM2A 5CNWA 4EF0A 5HR1A 4OO4A 3EWLA 1VF3A 2YN1A 1EOHA 4N11A 1GTUA 3ERFA 3QMXA 2GS3A 4WKWA 2CQ9A 1FW1A 2DJ1A 4ECIA 2C0DA 1RK4A 1X9SB 2EIQA 4HJMA 3IRAA 4PXOA 3H8QA 2X8CA 2H0HA 4CHSA 2OADA 1M9AA 2RUEA 1GUMA 4NAXA 1KBNA 4POLA 3TKQA 3LFLA 1XW5A 1V98A 2X64A 5ABRA 3IC8A 3ERWA 3L0HA 1CQGA 2JU5A 4KDUA 3PH9A 3F4TA 4NV2A 3MSZA 2AAWA 3DKSA 2DJ0A 2GSRA 3ZITA 2H6ZA 4ACSA 4I2TA 1N2AA 4IS0A 2P5RA 4X0XA 6GSUA 1TK0B 2R6KA 3C7MA 3FR6A 4NHZA 3HVSA 3I69A 1SL1B 2PVOC 4N0ZA 2MMNA 3KM6A 3VWVA 2K18A 3W8SA 1ZYEA 5EY6A 3J7Yk 3E0UA 1ON4A 1K0DA 1A2MA 5L71A 4TOPA 3R2QA 1T8EB 1SKRB 4X43A 5IMCA 5ECSA 2VL2A 4TXOA 1M9BA 3W6GA 2OKAA 4Q5FA 2HFDA 1DUGA 4IJIA 4IHUA 5G1LA 2F8AA 3VPQA 2PVQA 3PPUA 2XC2A 2P0GA 3C8EA 1KNGA 1Z5YE 1SL2B 1B48A 2RM6A 2GT6A 3QFAC 1PN9A 2VL9A 2R0CA 2VL3A 4A5PA 3IA1A 1PN0A 2M80A 3LQ7A 2YJ7A 5F05A 5INYA 4YKFA 2FD3A 2H1BA 1A0FA 4YQMA 5CRHA 17GSA 3N9JA 2HYXA 1OC3A 1W89A 1ERVA 2GSSA 4ULXA 5DQSA 2GZZA 1B9XC 2XBIA 1WE0A 3PGTA 4QL7A 4TW5A 2V6KA 1XVWA 2JADA 2AUVA 4GQFA 2QC7A 1TKDB 1M2BA 2L4CA 3FRCA 2GQKA 1TOFA 3KP9A 2LS5A 3GNJA 1GSQA 1AQWA 2H66A 4WF4A 5FT3A 1T00A 5HR2A 1SJ6A 2GDRA 4ECJA 3DIEA 2N5FA 4TXVA 1A2LA 3C73A 3LG6A 1M2AA 1NHOA 3TRQA 3IC4A 8GSSA 1AW9A 3IAM2 4AJ6A 2MMZA 1PKZA 3V1WA 2C0GA 1GH2A 4HU7A 2DBCA 1HD2A 3IR4A 3F63A 2R5GA 4FYCA 1SK0A 2H74A 4ECCA 2QA1A 1XZOA 4OD7A 3SBCA 1ZYQB 4OWYA 2E7PA 1XFLA 1YEXA 3TCOA 3D5JA 3FR9A 2FCHA 3KCMA 3I43A 2JL4A 2I1UA 2FLSA 3F0IA 2JSZA 2H1GA 1SYRA 1BG5A 2KOKA 4I6XA 4WBRD 4KE3A 2M46A 4RI7A 2WULA 3I6AA 1MD3A 1BEDA 1OAZA 1FVKA 2DMLA 1M99A 2ES7A 1ERTA 1A0RP 5D9TA 1A8LA 3UVHA 5HQPA 4MH3A 2B1LA 3APSA 2VCTA 3ME7A 1EV9A 3ZMLA 2DJKA 2FNOA 2F8FA 1V58A 5FHIA 2VCQA 1EEJA 4Z2TA 4AGSA 5KN3A 4CY6A 4TRXA 3A5IA 4NMUA 2I4AA 5FWGA 1X5EA 5CYYA 1FOVA 1WP0A 1TW9A 4G0IA 3DD3A 5KN2A 4FH8A 5G31A 3UBLA 1YF0A 1XIYA 2RUFA 1NW2A 2YWNA 4MF7A 3LYPA 1Q98A 2GZPA 1OC9B 3EMXA 1ZCPA 5H5RA 1IYHA 1ZMAA 1GRXA 1M0UA 4WBJA 3GSSA 2YP6A 4IKHA 2HE3A 1GTBA 5H5SA 5G5FA 3BOAA 3GKXA 3VI5A 3HZ4A 3QAWA 1O81A 4MLYA 2LSTA 3D0ZA 4L0UA 4EL1A 2R2JA 3ERGA 5CREA 3KH7A 3GKNA 1V40A 2P5QA 1SKWB 4MA9A 1B8XA 5IM9A 3GX0A 2MMAA 2DMMA 1A8YA 4NPBA 4ZB8A 5F06A 1HNCA 2H6XA 2X8GA 2H72A 2XHFA 7GSSA 1M2DA 3A2XA 4FYBA 5IOWA 1VRSD 3GX8A 2LKUA 1YQ1A 4KCAA 4IN0A 1FAAA 1J0FA 2K8SA 3GHAA 4MNNA 20GSA 3RDWA 2R3XA 4XHMA 1YF1A 5D93A 4DSSB 2YCDA 3MYDA 2X8HA 2E2GA 1TDIA 11GSA 1OC9A 1I5GA 3U6VA 5G30A 4MH2A 3MIXA 2D2ZA 1THOA 1BJXA 4KH7A 4K1FA 2MYGA 4J2FA 3D21A 1T1VA 3UJ1A 4HDEA 2DKIA 2NVLA 1DE1A 3L4NA 3ZMKA 3QR6A 1VGLA 2CZ3A 1U88A 3RHCA 5AIXA 3EPTA 5GAND 3IK7A 4LL4B 2C3TA 2C3QA 2KP2A 2PBJA 1DBYA 3ZL5A 1M7TA 2YJHA 3UL3A 3ZIVA 3H93A 4IGJA 2EIRA 1K3OA 4MF5A 1WIKA 1UC7A 3MNGA 3NOFA 2V2GA 3UARA 4K2XA 1E6BA 2HI7A 1AXDA 4KDXA 2GQMA 2HSMA 2KUCA 5JWRB 3BCKA 3F9UA 2L59A 1OVNA 1ZZYA 1X5DA 3FR3A 2LV3A 5IIZA 1GULA 2H75A 4GLTA 4JR6A 4DSSA 1VF4A 2HRAA 2X99A 1JZOA 5ECHB 5ECKB 1WMJA 1TK5B 4O5UA 3P90A 5JWOB 1XW9A 2H30A 2GQLA 4L5OA 5G2ZA 2IN3A 2O8VB 2R37A 2VL2C 3DYRA 3HXSA 4FQUA 2LRNA 1ERWA 3ZVJA 2VCVA 3LXTA 1KTEA 1GLPA 4G19A 22GSA 3FZ9A 5HR0A 3IV4A 1I9DA 2B7JA 2IMIA 5ECRB 1ZL9A 4GF0A 3HJPA 4N30A 1URMA 2X49A 1YZXA 1FG4A 1G6YA 2B3SA 2JZTA 1Z9HA 5A4UA 3KD0A 1TK8B 4Z2RA 2FWEA 5J9BA 6GSSA 3LJRA 1PKWA 2OBKA 3FEUA 1YY7A 3F3QA 6GSXA 3DWVA 2H8LA 5AGYA 2VAFA 4RUVA 2H70A 2QKEA 2V41A 4JE1A 1XPVA 4JEDA 3LORA 3WT2A 3FZ4A 3PR8A 2XBQA 3OR5A 2GSTA 3D22A 3J7Yb 1JLWA 3GV1A 4XS6A 2YPMA 4O7HA 5CRDA 3NIVA 1OE7A 1QGVA 2C8UA 2VCWA 5D73A 2VOCA 1Z6MA 3TJBA 2ALBA 3FHKA 4TXOB 2TRCP 4G9HA 5DQYA 4IW9A 4XRAA 1YKAA 4JRRA 3VK9A 3IHQA 3WT1A 1KEBA 4V1Ag 1YDKA 3IBHA 5J5NA 3HD5A 2F9SA 1F3AA 1T7PB 4ZXGA 4YAVA 3GA4A 1XOBA 1JHBA 1XXUA 1U87A 4WF5A 1FVJA 1O8WA 2VLUA 3F4SA 3TJGA 3QDNA 3IXRA 2YV9A 4G10A 3LSZA 5B8AA 4TVEA 3C1SA 1T3BA 1S3DA 4GWRA 5HR3A 4O32A 1PL1A 3HHVA 1T4YA 2N5BA 1XWCA 1YKCA 4L0WA 5IOXA 5J3RA 3UOMA 5G1KA 1ZYPA 1GTIA 1UVZA 3HKRA 2IL3A 2O89A 5KN1A 2FUG2 2WZ9A 4CW9A 5LNKe 4MMMA 4MZCA 3GUSA 4K6XA 1TU7A 1OC8A 2AB6A 13GSA 5GAPD 1BX9A 3ED3A 3DMLA 3BD2A 3MAKA 1GSDA 3ME8A 2B5EA 3HVVA 2OJLA 5EL8A 4EXJA 3UVTA 2BMXA 4RQRA 4PNGA 4ZIJA 3M9JA 3TUEA 3C1RA 3VWUA 2GLRA 3GFKA 5F0GA 2CX4A 2PMTA 2OE0A 2REMA 1K0MA 2HSYA 1ST9A 3GKMA 3K8NA 1NHYA 1PX7A 5JWQB 2OBIA 5D9VA 4DSRA 2FWFA 4OO5A 2WFCA 3L9VA 2C0FA 2LUSA 4X4JA 2FA4A 1OKTA 2NTOA 2CVDA 1SD8A 4ML1A 1FB0A 4ZBDA 4K2DA 2HZEB 1EZKA 3D4TA 2A4VA 4ECBA 2PU9C 3HJOA 1K0AA 4FIWA 4PQIA 1NM3A 4MZWA 1F3BA 4BVYA 2I81A 4XRDA 1LU4A 3GTUB 1O85A 1UN2A 3MDKA 5AIVA 3TKSA 2FGXA 4E8HA 2LQOA 1U6TA 5CRGA 1EGOA 5ELGA 1K0NA 1QUWA 2LRTA 1TRWA 1EEMA 3RBTA 2RM5A 4EIPA 5ECPB 3LYKA 4YQUA 4V1Ap 4ICYA 2TRXA 2WCIA 1X0RA 5B7CA 4FO5A 3L9UA 4N0VA 2LTKA 1GNEA 2C1YA 2IMKA 3UEMA 5D96A 5CP1A 3ZYWA 3FW2A 3GH6A 5IPGA 4WR5A 1PA3A 2LEGA 5ENUA 1SKSB 1G0TA 3GN3A 2NPBA 5ECLB 2O87A 5D8IA 12GSA 3HA9A 2HZEA 2VCXA 2NDOA 1GP1A 4JR4A 3Q19A 1MEKA 1XW6A 4HZ2A 1Z7RA 3DEXA 1FO5A 2AHEA 4KUNA 2CVBA 3QOUA 1GTAA 1ILOA 3HJMA 3CTFA 4EUYA 4BPYA 5CAXA 3GTUA 4K8MA 5DCHA 5IMVA 2L4QA 2VUPA 4KGIA 5HFGA 5C00A 3ZRDA 1AIUA 2VCZA 1GSSA 3GH9A 2F51A 1GSYA 3H4KA 2B6MA 2HNLA 1YJ6A 3ZZXA 1RW1A 2IWTA 1K0CA 4GRFA 3TGZA 4HQSA 4PNFA 1TRUA 3DVWA 1EP7A 3TJJA 4GSNA 1B9YC 3LWAA 3F6DA 3GIXA 4KAEA 3HY2A 3KTLA 1GUKA 4HS1A 3Q18A 3ZFLA 5B6NA 3AY8A 5D9WA 4KF9A 2WS2A 3KZQA 2CT6A 4ML6A 1A24A 2KP1A 4Q5NA 9GSSA 1R7HA 19GSA 2JACA 4I2UA 3TJFA 4DEJA 5IMDA 5KN0A 2H0GA 5AISA 2YZHA 5HFIA 2A2PA 1Z6NA 2DKHA 3C71A 2C3NA 2GSQA 3GRXA 2LQQA 4KA0A 1Z7PA 2E0QA 2VO4A 2L6CA 14GSA 3Q74A 4G0LA 2WGRA 5JCGA 1AC1A 5LD0A 2C80A 4PUAA 4EDZA 3GSTA 3I9V2 3W8JA 1QFNA 2B5XA 2VLVA 3F4RA 4K7NA 2V6OA 4ZILA 4EC0A 4OMVA 4L5LA 3FKFA 4PQ1A 4MABA 5JCWA 4MDCA 1PRXA 4ZBBA 5B8BA 3UIWA 2LJRA 4E8EA 1R5PA 4WEYA 3F3RA 5D9XA 2PERA 1F37A 2XPEA 4FYUA 1THXA 4XS1A 3FY7A 4JU5A 3ZREA 3IHGA 4LL1B 2DC5A 4YQVA 1ERUA 1Q4JA 4AF2A 3EURA 5ECMB 3IPZA 4MP4A 3ZVJD 1X9MB 4XS4B 1B4PA 2YOIA 4NXIA 3G9BA 3EMPA 3TOUA 4HQZA 3KGKA 4HUAA 3O6TA 1WWJA 1R5AA 16GSA 4ZL8A 4JZQA 3BJ5A 2OA7A 5DVBA 1GLQA 1GSFA 4ZBAA 4YKGA 1WOUA 4EKZA 1MTCA 2O85A 4Q5QA 4ZL9A 1OYJA 3KTBA 3O3TA 4PQHA 3CTGA 4O92A 1G7OA 3EU4A 4V2MA 3L9SA 3CMIA 4YAPA 3UAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F8B A;  3EE2 A;  1SD9 A;  2M72 A;  1EV4 A;  4GCI A;  4I8B A;  1O8X A;  2B7K A;  2L6D A;  2N5A A;  1SK1 A;  4KSO A;  3ZLP A;  2LNS A;  4IBP A;  3HZ8 A;  3S9F A;  3H1N A;  2HZF A;  3KP8 A;  2H6Y A;  4EDY A;  2HRN A;  1O73 A;  5ECO B;  2FWG A;  2HT9 A;  2ON7 A;  4GTU A;  3BBY A;  4GQC A;  4IQ1 A;  4ZB6 A;  4XS4 A;  1GWC A;  4QQ7 A;  4MPG A;  3QD9 A;  4OFM A;  3IDV A;  5IMA A;  5DAL B;  2RLI A;  1JZD A;  4ZL7 A;  1FB6 A;  2OAC A;  3DRN A;  4O5R A;  2FY6 A;  2LJK A;  1DE2 A;  2PGT A;  3QAG A;  4LMV A;  4TR3 A;  2OE1 A;  5DJM A;  1PMT A;  1EOG A;  4HJ2 A;  2OE3 A;  5E4W A;  2I9H A;  2HRF A;  3RPP A;  5ELA A;  4TR0 A;  2CA8 A;  1QQ2 A;  2HXK A;  1E2Y A;  4MJB A;  4KDY A;  3IOS A;  1ABA A;  1F2E A;  1OKD A;  1OE8 A;  3KXO A;  1SL0 B;  4K7I A;  4MF6 A;  1R4W A;  3M8N A;  2C4J A;  1AQV A;  2IFQ B;  2YAN A;  1RQM A;  3O76 A;  5ID2 B;  2MBT A;  3TKS C;  3D6I A;  3TRX A;  3U5R E;  2C0E A;  3L78 A;  4OCE A;  4K9Z A;  3FK8 A;  3TKS E;  4MZB A;  3E3E A;  4OFN A;  2HSH A;  4TR4 A;  1LBK A;  3GMF A;  5DAL A;  3N5O A;  3TDG A;  5GST A;  5CO3 A;  4BWQ A;  3VPT A;  3IK9 A;  3Q6O A;  2JZS A;  3G7I A;  4IJ3 A;  3UBK A;  2VM1 A;  1BYE A;  4D73 B;  3ZTL A;  1PQN A;  4F2I A;  1J9B A;  3RAZ A;  1XCC A;  3WD6 A;  2QSI A;  3EVI A;  4KX4 A;  2VD1 A;  2JSY A;  2ZCT A;  5COH A;  1J08 A;  2H01 A;  1SK2 A;  1TRS A;  1JZR A;  3HYP A;  1R26 A;  2QGV A;  1K3L A;  1B4Q A;  4K0N A;  2PPT A;  2IFQ A;  1SU9 A;  5ID2 A;  4YH2 A;  4HOJ A;  1ML6 A;  2G2Q A;  4NWY A;  4TR1 B;  1A23 A;  4MCU A;  4F0C A;  3G7J A;  5A5K A;  4KND A;  3QCP A;  2F3M A;  1XOA A;  3H79 A;  1T4Z A;  1TP9 A;  3DVX A;  2DSA A;  3A5W A;  5CRW A;  4X1U A;  3FYG A;  3VI7 A;  2GGT A;  3CXG A;  1C72 A;  5IPH A;  5E59 A;  2H1A A;  4LMW A;  1S3C A;  4D73 A;  4XTS A;  2O7K A;  2CAI A;  3KMO A;  1K0B A;  2YNX A;  1XBS A;  3RHB A;  4IP1 A;  3A2W A;  3APO A;  1USB A;  2L5L A;  1ZOF A;  4EO3 A;  1Z3E A;  3TKR A;  2E2M A;  1G7E A;  4OCF A;  2WDU A;  4H86 A;  3ZIJ A;  4PUR A;  3KIJ A;  5AN1 A;  4F9Z A;  1TJD A;  1EP8 A;  3TKP A;  1IYI A;  3PIN A;  3GYK A;  4LA1 A;  2J23 A;  1TXX A;  1JZW A;  4XCS A;  1MD4 A;  1QMV A;  2L5O A;  4GSS A;  4TR1 A;  2IIY A;  2CV4 A;  2I3Y A;  3CRU A;  1LJR A;  1UA5 A;  1PGT A;  2ZNM A;  4BVX A;  4BA7 A;  2YV7 A;  4POM A;  4LLR A;  2LJA A;  1NSW A;  1QK8 A;  1WPI A;  5ECQ B;  3SWL A;  5DJL A;  1N8J A;  2IMF A;  3KEB A;  2CX3 A;  5GSS A;  4NV5 A;  4OFT A;  2IMD A;  2VLT A;  2DIZ A;  4L8E A;  5ECI B;  1HQO A;  3LGC A;  4KSM A;  4AJ7 A;  2IPA A;  4EE0 A;  2K6V A;  2JZR A;  1PL2 A;  3QAV A;  3KJY A;  5A4W A;  3TJK A;  4DSQ A;  5HFK A;  2XPD A;  4JBB A;  3G7Y A;  4EVM A;  3D4M A;  3KMN A;  5G5E A;  4K7O A;  3GUR A;  2R4V A;  3VWW A;  2DJ2 A;  2TIR A;  2H1D A;  4V2L A;  3JCM L;  4KCE A;  2GT5 A;  5GZZ B;  4DVC A;  1XVQ A;  2MMO A;  5IO0 A;  3TOT A;  1PD2 1;  3P8W A;  5KEJ A;  5EVO A;  5DAK B;  4Q5R A;  3VWX A;  2DJJ A;  3HDC A;  1GUH A;  2H76 A;  1VF1 A;  10GS A;  1TU8 A;  2WB9 A;  1AAZ A;  4XIH A;  1AUC A;  2J9H A;  3LXZ A;  4F03 A;  2AYT A;  1XWB A;  2PWJ A;  1H4O A;  4MK3 A;  2CZ2 A;  1A2J A;  1V2A A;  3IE3 A;  5J9C A;  3QFB C;  2V32 A;  2B5Y A;  4IEL A;  1ZGN A;  3M3M A;  4F0B A;  4PGT A;  3QPM A;  1JFU A;  3GL3 A;  3P2A A;  5DDL A;  1HNB A;  5J4U A;  5J41 A;  6GST A;  2V1M A;  1WRY A;  4BL7 A;  1YEP A;  1WJK A;  1GSE A;  5B6M A;  2H73 A;  2LNT A;  1K0O A;  4BWS A;  1GSU A;  5DAK A;  3NZN A;  2H19 A;  2NBS A;  1GL8 A;  3F8U A;  3US3 A;  2P31 A;  1TI1 A;  1GNW A;  4ID0 A;  3VLN A;  3ZFB A;  4MJA A;  1U3I A;  2B1K A;  3HCZ A;  5IMF A;  4MJC A;  3DGQ A;  1O7U A;  1F6M C;  3CYN A;  4P3Y B;  4GXZ A;  3RPN A;  4HU9 A;  4I97 A;  1G6W A;  2MZC A;  1JLV A;  3EYT A;  3CBU A;  2HLS A;  2EIO A;  2A2R A;  5F07 A;  18GS A;  1HNA A;  2DIY A;  3VFI A;  4POB A;  2GZY A;  4GST A;  4KB3 A;  2MBS A;  1PX6 A;  3TB2 A;  3EIN A;  1HYU A;  3HVX A;  5A4V A;  4NHW A;  4QL9 A;  4J56 E;  1K3Y A;  3IAS 2;  3E9J B;  2K8V A;  4RI6 A;  1SYX A;  4ILF A;  6GSV A;  1AQX A;  4HZ4 A;  4WXT A;  2PUK C;  1H75 A;  2BTO T;  5C04 A;  4PX1 A;  4V2N A;  4KW6 A;  2YWM A;  4AJ8 A;  2KLX A;  2YWI A;  3M1G A;  2DJ3 A;  3A3T A;  3M0F A;  3EC3 A;  1XWK A;  1U3A A;  4TN8 A;  2CVK A;  3VUR A;  1V9W A;  1FHE A;  4I5Q A;  3CSJ A;  2GVP A;  2KHP A;  3EU3 A;  5IMZ A;  4HI7 A;  4Z7X A;  4MJE A;  2VD0 A;  2H71 A;  2H0I A;  2EC4 A;  3WYW A;  2YWO A;  4POK A;  1Y25 A;  5DCG A;  6GSW A;  2VIM A;  5ECN B;  4F82 A;  4RQX A;  3WGD A;  2WJU A;  2Z9S A;  4ZB9 A;  6GSY A;  3FZ5 A;  1TTZ A;  2LRC A;  1X5C A;  2RII A;  4CDO A;  1S3A A;  2WRT A;  2G0F A;  1TRV A;  5JCU A;  3DXB A;  4K0G A;  2IJY A;  1EGR A;  2DLX A;  3GKK A;  4TKY A;  5DBQ A;  3FZA A;  4N10 A;  2FWH A;  3TRP A;  3APQ A;  2ZUP A;  2BJX A;  4G2E A;  1XWA A;  1BQ7 A;  1MDI A;  1W4V A;  3P7X A;  4J57 E;  2IME A;  1MDK A;  1EWX A;  3CRT A;  3KH9 A;  1DSB A;  5EPF A;  1SJI A;  1F9M A;  3WGX A;  1SJZ A;  4WR4 A;  1SEN A;  1ACV A;  4WET A;  1PSQ A;  4IQA A;  5H5Q A;  1V57 A;  2GTU A;  3CSH A;  3WGE A;  1VF2 A;  2YZU A;  1X9W B;  3CSI A;  4ISD A;  1BAY A;  4HEA 2;  3M9K A;  5LCZ A;  5IO2 A;  2PN8 A;  1Y6E A;  1XWG A;  1O6J A;  4MPF A;  3LEF A;  1CQH A;  1TI3 A;  1MDJ A;  2FA8 A;  3UMA A;  3A2V A;  2CAQ A;  5IQY A;  4IVF A;  4IP6 A;  1QXH A;  3MWH A;  3ISO A;  2AV4 A;  3F6F A;  3BCI A;  2ON5 A;  2AJQ B;  2K9F A;  3GL5 A;  4PUF C;  2L57 A;  2A2S A;  2FHE A;  2VM2 A;  5CNW A;  4EF0 A;  5HR1 A;  4OO4 A;  3EWL A;  1VF3 A;  2YN1 A;  1EOH A;  4N11 A;  1GTU A;  3ERF A;  3QMX A;  2GS3 A;  4WKW A;  2CQ9 A;  1FW1 A;  2DJ1 A;  4ECI A;  2C0D A;  1RK4 A;  1X9S B;  2EIQ A;  4HJM A;  3IRA A;  4PXO A;  3H8Q A;  2X8C A;  2H0H A;  4CHS A;  2OAD A;  1M9A A;  2RUE A;  1GUM A;  4NAX A;  1KBN A;  4POL A;  3TKQ A;  3LFL A;  1XW5 A;  1V98 A;  2X64 A;  5ABR A;  3ERW A;  3L0H A;  1CQG A;  2JU5 A;  4KDU A;  3PH9 A;  3F4T A;  4NV2 A;  3MSZ A;  2AAW A;  3DKS A;  2DJ0 A;  2GSR A;  3ZIT A;  2H6Z A;  4ACS A;  4I2T A;  1N2A A;  4IS0 A;  2P5R A;  4X0X A;  6GSU A;  1TK0 B;  2R6K A;  3C7M A;  3FR6 A;  4NHZ A;  3HVS A;  3I69 A;  1SL1 B;  2PVO C;  4N0Z A;  2MMN A;  3KM6 A;  3VWV A;  2K18 A;  3W8S A;  1ZYE A;  5EY6 A;  3J7Y k;  3E0U A;  1ON4 A;  1K0D A;  1A2M A;  5L71 A;  4TOP A;  3R2Q A;  1T8E B;  1SKR B;  4X43 A;  5IMC A;  5ECS A;  2VL2 A;  4TXO A;  1M9B A;  3W6G A;  2OKA A;  4Q5F A;  2HFD A;  1DUG A;  4IJI A;  4IHU A;  5G1L A;  2F8A A;  3VPQ A;  2PVQ A;  2XC2 A;  2P0G A;  3C8E A;  1KNG A;  1Z5Y E;  1SL2 B;  1B48 A;  2RM6 A;  2GT6 A;  3QFA C;  1PN9 A;  2VL9 A;  2VL3 A;  3IA1 A;  2M80 A;  3LQ7 A;  2YJ7 A;  5F05 A;  5INY A;  2FD3 A;  2H1B A;  1A0F A;  4YQM A;  5CRH A;  17GS A;  3N9J A;  2HYX A;  1OC3 A;  1W89 A;  1ERV A;  2GSS A;  4ULX A;  5DQS A;  2GZZ A;  1B9X C;  2XBI A;  1WE0 A;  3PGT A;  4QL7 A;  4TW5 A;  2V6K A;  1XVW A;  2JAD A;  2AUV A;  4GQF A;  2QC7 A;  1TKD B;  1M2B A;  2L4C A;  3FRC A;  2GQK A;  1TOF A;  3KP9 A;  2LS5 A;  3GNJ A;  1GSQ A;  1AQW A;  2H66 A;  4WF4 A;  5FT3 A;  1T00 A;  5HR2 A;  1SJ6 A;  2GDR A;  4ECJ A;  3DIE A;  2N5F A;  4TXV A;  1A2L A;  3C73 A;  3LG6 A;  1M2A A;  1NHO A;  3TRQ A;  3IC4 A;  8GSS A;  1AW9 A;  3IAM 2;  4AJ6 A;  2MMZ A;  1PKZ A;  3V1W A;  2C0G A;  1GH2 A;  4HU7 A;  2DBC A;  1HD2 A;  3IR4 A;  3F63 A;  2R5G A;  4FYC A;  1SK0 A;  2H74 A;  4ECC A;  1XZO A;  4OD7 A;  3SBC A;  1ZYQ B;  4OWY A;  2E7P A;  1XFL A;  1YEX A;  3TCO A;  3D5J A;  3FR9 A;  2FCH A;  3KCM A;  3I43 A;  2JL4 A;  2I1U A;  2FLS A;  3F0I A;  2JSZ A;  2H1G A;  1SYR A;  1BG5 A;  2KOK A;  4I6X A;  4WBR D;  4KE3 A;  2M46 A;  4RI7 A;  2WUL A;  3I6A A;  1MD3 A;  1BED A;  1OAZ A;  1FVK A;  2DML A;  1M99 A;  2ES7 A;  1ERT A;  1A0R P;  5D9T A;  1A8L A;  3UVH A;  5HQP A;  4MH3 A;  2B1L A;  3APS A;  2VCT A;  3ME7 A;  1EV9 A;  3ZML A;  2DJK A;  2FNO A;  2F8F A;  1V58 A;  5FHI A;  2VCQ A;  1EEJ A;  4AGS A;  5KN3 A;  4TRX A;  4NMU A;  2I4A A;  5FWG A;  1X5E A;  5CYY A;  1FOV A;  1WP0 A;  1TW9 A;  5KN2 A;  3DD3 A;  4FH8 A;  5G31 A;  3UBL A;  1YF0 A;  1XIY A;  2RUF A;  1NW2 A;  2YWN A;  4MF7 A;  3LYP A;  1Q98 A;  2GZP A;  1OC9 B;  3EMX A;  1ZCP A;  5H5R A;  1IYH A;  1ZMA A;  1GRX A;  1M0U A;  4WBJ A;  3GSS A;  2YP6 A;  4IKH A;  2HE3 A;  1GTB A;  5H5S A;  5G5F A;  3BOA A;  3GKX A;  3VI5 A;  3HZ4 A;  3QAW A;  1O81 A;  4MLY A;  2LST A;  3D0Z A;  4L0U A;  4EL1 A;  2R2J A;  3ERG A;  5CRE A;  3KH7 A;  3GKN A;  1V40 A;  2P5Q A;  1SKW B;  4MA9 A;  1B8X A;  5IM9 A;  3GX0 A;  2MMA A;  2DMM A;  1A8Y A;  4NPB A;  4ZB8 A;  5F06 A;  1HNC A;  2H6X A;  2X8G A;  2H72 A;  2XHF A;  7GSS A;  1M2D A;  3A2X A;  4FYB A;  5IOW A;  1VRS D;  3GX8 A;  2LKU A;  1YQ1 A;  4KCA A;  4IN0 A;  1FAA A;  1J0F A;  2K8S A;  3GHA A;  20GS A;  3RDW A;  2R3X A;  4XHM A;  1YF1 A;  5D93 A;  4DSS B;  2YCD A;  2X8H A;  2E2G A;  1TDI A;  11GS A;  1OC9 A;  1I5G A;  3U6V A;  5G30 A;  4MH2 A;  2D2Z A;  1THO A;  1BJX A;  4KH7 A;  4K1F A;  2MYG A;  4J2F A;  3D21 A;  1T1V A;  3UJ1 A;  4HDE A;  2NVL A;  1DE1 A;  3L4N A;  3ZMK A;  3QR6 A;  1VGL A;  2CZ3 A;  1U88 A;  3RHC A;  5AIX A;  5GAN D;  3IK7 A;  4LL4 B;  2C3T A;  2C3Q A;  2KP2 A;  2PBJ A;  1DBY A;  3ZL5 A;  1M7T A;  2YJH A;  3UL3 A;  3ZIV A;  3H93 A;  4IGJ A;  2EIR A;  1K3O A;  4MF5 A;  1WIK A;  1UC7 A;  3MNG A;  3NOF A;  2V2G A;  3UAR A;  1E6B A;  2HI7 A;  1AXD A;  4KDX A;  2GQM A;  2KUC A;  5JWR B;  3BCK A;  3F9U A;  2L59 A;  1OVN A;  1ZZY A;  1X5D A;  3FR3 A;  2LV3 A;  5IIZ A;  1GUL A;  2H75 A;  4GLT A;  4JR6 A;  4DSS A;  1VF4 A;  2X99 A;  1JZO A;  5ECH B;  5ECK B;  1WMJ A;  1TK5 B;  3P90 A;  5JWO B;  1XW9 A;  2H30 A;  2GQL A;  4L5O A;  5G2Z A;  2IN3 A;  2O8V B;  2R37 A;  2VL2 C;  3DYR A;  3HXS A;  2LRN A;  1ERW A;  3ZVJ A;  2VCV A;  3LXT A;  1KTE A;  1GLP A;  4G19 A;  22GS A;  3FZ9 A;  5HR0 A;  3IV4 A;  1I9D A;  2B7J A;  2IMI A;  5ECR B;  1ZL9 A;  4GF0 A;  3HJP A;  4N30 A;  1URM A;  1YZX A;  1FG4 A;  1G6Y A;  2B3S A;  2JZT A;  1Z9H A;  5A4U A;  3KD0 A;  1TK8 B;  2FWE A;  5J9B A;  6GSS A;  3LJR A;  1PKW A;  2OBK A;  3FEU A;  1YY7 A;  3F3Q A;  6GSX A;  3DWV A;  2H8L A;  5AGY A;  2VAF A;  4RUV A;  2H70 A;  2QKE A;  2V41 A;  4JE1 A;  1XPV A;  4JED A;  3LOR A;  3WT2 A;  3FZ4 A;  3PR8 A;  2XBQ A;  3OR5 A;  2GST A;  3D22 A;  3J7Y b;  1JLW A;  3GV1 A;  4XS6 A;  2YPM A;  4O7H A;  5CRD A;  3NIV A;  1OE7 A;  1QGV A;  2C8U A;  2VCW A;  5D73 A;  2VOC A;  1Z6M A;  3TJB A;  2ALB A;  3FHK A;  4TXO B;  2TRC P;  4G9H A;  5DQY A;  4IW9 A;  4XRA A;  1YKA A;  4JRR A;  3VK9 A;  3IHQ A;  3WT1 A;  1KEB A;  4V1A g;  1YDK A;  3IBH A;  5J5N A;  3HD5 A;  2F9S A;  1F3A A;  1T7P B;  4ZXG A;  4YAV A;  3GA4 A;  1XOB A;  1JHB A;  1XXU A;  1U87 A;  4WF5 A;  1FVJ A;  1O8W A;  2VLU A;  3F4S A;  3TJG A;  3QDN A;  3IXR A;  2YV9 A;  4G10 A;  3LSZ A;  5B8A A;  4TVE A;  3C1S A;  1T3B A;  1S3D A;  4GWR A;  5HR3 A;  4O32 A;  1PL1 A;  3HHV A;  1T4Y A;  2N5B A;  1XWC A;  1YKC A;  4L0W A;  5IOX A;  5J3R A;  3UOM A;  5G1K A;  1GTI A;  1UVZ A;  3HKR A;  2IL3 A;  2O89 A;  5KN1 A;  2FUG 2;  2WZ9 A;  4CW9 A;  5LNK e;  4MMM A;  4MZC A;  3GUS A;  4K6X A;  1TU7 A;  1OC8 A;  2AB6 A;  13GS A;  5GAP D;  1BX9 A;  3ED3 A;  3DML A;  3BD2 A;  3MAK A;  1GSD A;  3ME8 A;  2B5E A;  3HVV A;  2OJL A;  5EL8 A;  4EXJ A;  3UVT A;  2BMX A;  4RQR A;  4PNG A;  4ZIJ A;  3M9J A;  3TUE A;  3C1R A;  3VWU A;  2GLR A;  3GFK A;  5F0G A;  2CX4 A;  2PMT A;  2OE0 A;  2REM A;  1K0M A;  2HSY A;  1ST9 A;  3GKM A;  3K8N A;  1NHY A;  1PX7 A;  5JWQ B;  2OBI A;  5D9V A;  4DSR A;  2FWF A;  4OO5 A;  2WFC A;  3L9V A;  2C0F A;  2LUS A;  2FA4 A;  1OKT A;  2NTO A;  2CVD A;  1SD8 A;  4ML1 A;  1FB0 A;  4ZBD A;  4K2D A;  2HZE B;  1EZK A;  3D4T A;  2A4V A;  4ECB A;  2PU9 C;  3HJO A;  1K0A A;  4FIW A;  4PQI A;  1NM3 A;  4MZW A;  1F3B A;  4BVY A;  2I81 A;  4XRD A;  1LU4 A;  3GTU B;  1O85 A;  1UN2 A;  3MDK A;  5AIV A;  3TKS A;  2FGX A;  4E8H A;  2LQO A;  1U6T A;  5CRG A;  1EGO A;  5ELG A;  1K0N A;  1QUW A;  2LRT A;  1TRW A;  1EEM A;  3RBT A;  2RM5 A;  5ECP B;  3LYK A;  4YQU A;  4V1A p;  2TRX A;  2WCI A;  1X0R A;  5B7C A;  4FO5 A;  3L9U A;  4N0V A;  2LTK A;  1GNE A;  2C1Y A;  2IMK A;  3UEM A;  5D96 A;  5CP1 A;  3ZYW A;  3FW2 A;  3GH6 A;  5IPG A;  4WR5 A;  1PA3 A;  2LEG A;  5ENU A;  1SKS B;  1G0T A;  3GN3 A;  2NPB A;  5ECL B;  2O87 A;  5D8I A;  12GS A;  3HA9 A;  2HZE A;  2VCX A;  2NDO A;  1GP1 A;  3Q19 A;  4JR4 A;  1MEK A;  1XW6 A;  4HZ2 A;  1Z7R A;  3DEX A;  1FO5 A;  2AHE A;  4KUN A;  2CVB A;  3QOU A;  1GTA A;  1ILO A;  3HJM A;  3CTF A;  4EUY A;  4BPY A;  5CAX A;  3GTU A;  4K8M A;  5DCH A;  5IMV A;  2L4Q A;  2VUP A;  4KGI A;  5HFG A;  5C00 A;  3ZRD A;  1AIU A;  2VCZ A;  1GSS A;  3GH9 A;  2F51 A;  1GSY A;  3H4K A;  2B6M A;  2HNL A;  1YJ6 A;  3ZZX A;  1RW1 A;  2IWT A;  1K0C A;  4GRF A;  3TGZ A;  4HQS A;  4PNF A;  1TRU A;  3DVW A;  1EP7 A;  3TJJ A;  4GSN A;  1B9Y C;  3LWA A;  3F6D A;  3GIX A;  4KAE A;  3HY2 A;  3KTL A;  1GUK A;  4HS1 A;  3Q18 A;  3ZFL A;  5B6N A;  3AY8 A;  5D9W A;  2WS2 A;  3KZQ A;  2CT6 A;  4ML6 A;  1A24 A;  2KP1 A;  4Q5N A;  9GSS A;  1R7H A;  19GS A;  2JAC A;  4I2U A;  3TJF A;  4DEJ A;  5IMD A;  5KN0 A;  2H0G A;  5AIS A;  2YZH A;  5HFI A;  1Z6N A;  3C71 A;  2C3N A;  2GSQ A;  3GRX A;  2LQQ A;  4KA0 A;  1Z7P A;  2E0Q A;  2VO4 A;  2L6C A;  14GS A;  3Q74 A;  2WGR A;  5JCG A;  1AC1 A;  5LD0 A;  2C80 A;  4PUA A;  4EDZ A;  3GST A;  3I9V 2;  3W8J A;  1QFN A;  2B5X A;  2VLV A;  3F4R A;  4K7N A;  2V6O A;  4ZIL A;  4EC0 A;  4OMV A;  4L5L A;  3FKF A;  4PQ1 A;  4MAB A;  5JCW A;  4MDC A;  1PRX A;  4ZBB A;  5B8B A;  3UIW A;  2LJR A;  4E8E A;  1R5P A;  4WEY A;  3F3R A;  5D9X A;  2PER A;  1F37 A;  2XPE A;  4FYU A;  1THX A;  4XS1 A;  3FY7 A;  4JU5 A;  3ZRE A;  4LL1 B;  2DC5 A;  4YQV A;  1ERU A;  1Q4J A;  4AF2 A;  3EUR A;  5ECM B;  3IPZ A;  4MP4 A;  3ZVJ D;  1X9M B;  4XS4 B;  1B4P A;  2YOI A;  4NXI A;  3G9B A;  3EMP A;  3TOU A;  4HQZ A;  3KGK A;  4HUA A;  3O6T A;  1WWJ A;  1R5A A;  16GS A;  4ZL8 A;  4JZQ A;  3BJ5 A;  2OA7 A;  5DVB A;  1GLQ A;  1GSF A;  4ZBA A;  1WOU A;  4EKZ A;  1MTC A;  2O85 A;  4Q5Q A;  4ZL9 A;  1OYJ A;  3KTB A;  3O3T A;  4PQH A;  3CTG A;  4O92 A;  1G7O A;  3EU4 A;  4V2M A;  3L9S A;  3CMI A;  4YAP A;  3UAP A; 
#chains in the Genus database with same CATH topology
 5F8B A;  3EE2 A;  1SD9 A;  2M72 A;  1EV4 A;  4GCI A;  4I8B A;  1O8X A;  2B7K A;  2L6D A;  2N5A A;  1SK1 A;  4KSO A;  3ZLP A;  2LNS A;  4IBP A;  3HZ8 A;  3S9F A;  3H1N A;  2HZF A;  3KP8 A;  2H6Y A;  4EDY A;  2HRN A;  1O73 A;  5ECO B;  2FWG A;  2HT9 A;  2ON7 A;  4GTU A;  2X4A A;  3BBY A;  4GQC A;  4IQ1 A;  4ZB6 A;  4XS4 A;  1GWC A;  4QQ7 A;  4MPG A;  3QD9 A;  4OFM A;  3IDV A;  5IMA A;  5DAL B;  2RLI A;  1JZD A;  4ZL7 A;  1FB6 A;  2OAC A;  3DRN A;  4O5R A;  2FY6 A;  2LJK A;  1DE2 A;  2UZ8 A;  2PGT A;  3QAG A;  4LMV A;  4TR3 A;  2OE1 A;  5DJM A;  1PMT A;  1EOG A;  4HJ2 A;  2OE3 A;  5E4W A;  2I9H A;  2HRF A;  3RPP A;  5ELA A;  4TR0 A;  2CA8 A;  1PFO A;  2HRK A;  1QQ2 A;  2HXK A;  1E2Y A;  4MJB A;  4KDY A;  3IOS A;  1ABA A;  1F2E A;  1OKD A;  1OE8 A;  3KXO A;  1SL0 B;  4K7I A;  4Z2U A;  4MF6 A;  1R4W A;  3M8N A;  2C4J A;  1AQV A;  2IFQ B;  2YAN A;  1RQM A;  3O76 A;  5ID2 B;  2MBT A;  3TKS C;  3D6I A;  3TRX A;  3U5R E;  2C0E A;  3L78 A;  4OCE A;  4K9Z A;  3FK8 A;  3TKS E;  4MZB A;  4OFN A;  3E3E A;  2HSH A;  3LW9 A;  1LBK A;  3GMF A;  4TR4 A;  5DAL A;  3N5O A;  3TDG A;  5GST A;  5CO3 A;  4BWQ A;  3VPT A;  3IK9 A;  3Q6O A;  2JZS A;  3G7I A;  2R0P A;  4IJ3 A;  3UBK A;  2VM1 A;  1BYE A;  4D73 B;  3ZTL A;  1PQN A;  4F2I A;  4USS A;  1J9B A;  3RAZ A;  1XCC A;  3WD6 A;  2QSI A;  3EVI A;  4KX4 A;  2VD1 A;  2JSY A;  2ZCT A;  5COH A;  1J08 A;  2H01 A;  1SK2 A;  1TRS A;  1JZR A;  3HYP A;  1R26 A;  2QGV A;  1K3L A;  1B4Q A;  4K0N A;  2PPT A;  2IFQ A;  4BVY B;  1SU9 A;  5ID2 A;  4YH2 A;  4HOJ A;  1ML6 A;  2G2Q A;  4NWY A;  4TR1 B;  1A23 A;  4MCU A;  4F0C A;  3G7J A;  5A5K A;  4KND A;  4BVX B;  3QCP A;  2F3M A;  1XOA A;  3H79 A;  1T4Z A;  1TP9 A;  3DVX A;  2DSA A;  3A5W A;  5CRW A;  4X1U A;  3FYG A;  3VI7 A;  2GGT A;  3CXG A;  4EIQ A;  1C72 A;  5IPH A;  1M3J A;  5E59 A;  2H1A A;  4LMW A;  1S3C A;  4D73 A;  4XTS A;  2O7K A;  2CAI A;  3FMW A;  3KMO A;  1K0B A;  2YNX A;  1XBS A;  3RHB A;  4IP1 A;  3A2W A;  3APO A;  1USB A;  2L5L A;  4G0K A;  1ZOF A;  4EO3 A;  1Z3E A;  3TKR A;  2E2M A;  1G7E A;  4OCF A;  2WDU A;  4H86 A;  3ZIJ A;  4PUR A;  3KIJ A;  5AN1 A;  4F9Z A;  1TJD A;  1EP8 A;  3TKP A;  1IYI A;  3PIN A;  3GYK A;  4LA1 A;  2J23 A;  1TXX A;  1JZW A;  4XCS A;  1MD4 A;  1QMV A;  2L5O A;  4GSS A;  4TR1 A;  2IIY A;  2CV4 A;  2I3Y A;  3CRU A;  1LJR A;  1UA5 A;  1PGT A;  2ZNM A;  4BVX A;  4BA7 A;  2YV7 A;  4POM A;  4LLR A;  1ZYN A;  2LJA A;  1NSW A;  1QK8 A;  1WPI A;  5ECQ B;  3SWL A;  5DJL A;  1N8J A;  2IMF A;  3KEB A;  2CX3 A;  5GSS A;  4NV5 A;  4OFT A;  2IMD A;  2VLT A;  2DIZ A;  4L8E A;  5ECI B;  1HQO A;  3LGC A;  4KSM A;  4AJ7 A;  2IPA A;  4EE0 A;  2K6V A;  2JZR A;  1PL2 A;  3QAV A;  3KJY A;  5A4W A;  3TJK A;  4DSQ A;  5HFK A;  2XPD A;  4JBB A;  3G7Y A;  4EVM A;  3D4M A;  3KMN A;  5G5E A;  4K7O A;  3GUR A;  2R4V A;  3VWW A;  2DJ2 A;  2TIR A;  2H1D A;  4BL7 B;  4V2L A;  3JCM L;  4KCE A;  2GT5 A;  5GZZ B;  4DVC A;  1XVQ A;  2MMO A;  4O5Q A;  5IO0 A;  3TOT A;  1PD2 1;  3P8W A;  5KEJ A;  5EVO A;  5BRT A;  5DAK B;  4Q5R A;  4PTS A;  3VWX A;  2DJJ A;  3HDC A;  1GUH A;  2H76 A;  1VF1 A;  10GS A;  1TU8 A;  2WB9 A;  1AAZ A;  4XIH A;  1AUC A;  2J9H A;  4K5R A;  3LXZ A;  4F03 A;  2AYT A;  1XWB A;  2PWJ A;  1H4O A;  4MK3 A;  2CZ2 A;  1A2J A;  1V2A A;  3IE3 A;  5J9C A;  3CQF A;  3QFB C;  2V32 A;  2B5Y A;  4IEL A;  1ZGN A;  3M3M A;  4F0B A;  5BMU A;  4PGT A;  3QPM A;  1JFU A;  3GL3 A;  3P2A A;  5DDL A;  1HNB A;  5J4U A;  5J41 A;  6GST A;  2V1M A;  1WRY A;  4BL7 A;  1YEP A;  1WJK A;  1GSE A;  5B6M A;  2H73 A;  2LNT A;  1K0O A;  4BWS A;  1GSU A;  5DAK A;  3NZN A;  2H19 A;  2NBS A;  1GL8 A;  3F8U A;  3US3 A;  2P31 A;  1TI1 A;  1GNW A;  4ID0 A;  3VLN A;  3ZFB A;  4MJA A;  1U3I A;  5KOW A;  2B1K A;  3HCZ A;  5IMF A;  4MJC A;  3DGQ A;  1O7U A;  1F6M C;  3CYN A;  4P3Y B;  4GXZ A;  3RPN A;  4HU9 A;  4I97 A;  1G6W A;  2MZC A;  1JLV A;  3EYT A;  3CBU A;  2HLS A;  2EIO A;  2A2R A;  2R0G A;  5F07 A;  18GS A;  1HNA A;  2DIY A;  3VFI A;  4POB A;  2GZY A;  4GST A;  4KB3 A;  2MBS A;  1PX6 A;  3TB2 A;  3EIN A;  1HYU A;  3HVX A;  5A4V A;  4NHW A;  4QL9 A;  4CY8 A;  4J56 E;  1K3Y A;  3IAS 2;  3E9J B;  2K8V A;  4RI6 A;  1SYX A;  4ILF A;  6GSV A;  1AQX A;  4HZ4 A;  4WXT A;  2PUK C;  1H75 A;  2BTO T;  5C04 A;  4PX1 A;  4V2N A;  4KW6 A;  1FOH A;  2YWM A;  4AJ8 A;  2KLX A;  2YWI A;  3M1G A;  2DJ3 A;  3A3T A;  3M0F A;  3EC3 A;  1XWK A;  1U3A A;  4TN8 A;  2CVK A;  3VUR A;  1V9W A;  1FHE A;  4I5Q A;  3CSJ A;  2GVP A;  2KHP A;  3EU3 A;  5IMZ A;  4HI7 A;  4Z7X A;  4MJE A;  2VD0 A;  2H71 A;  2H0I A;  2EC4 A;  3WYW A;  2YWO A;  4POK A;  1Y25 A;  5DCG A;  2QA2 A;  6GSW A;  2VIM A;  5ECN B;  4F82 A;  4RQX A;  3WGD A;  2WJU A;  2Z9S A;  4ZB9 A;  6GSY A;  3FZ5 A;  1TTZ A;  2LRC A;  1X5C A;  2RII A;  4K5S A;  1S3A A;  4CDO A;  2WRT A;  2G0F A;  1TRV A;  5JCU A;  3DXB A;  4K0G A;  2IJY A;  1EGR A;  2DLX A;  3GKK A;  4TKY A;  5DBQ A;  3FZA A;  4N10 A;  2FWH A;  3TRP A;  3APQ A;  2ZUP A;  2BJX A;  4G2E A;  1XWA A;  3R3E A;  1BQ7 A;  1MDI A;  1W4V A;  3P7X A;  4J57 E;  2IME A;  1MDK A;  1EWX A;  3CRT A;  3KH9 A;  1DSB A;  5EPF A;  1SJI A;  1F9M A;  3WGX A;  1SJZ A;  4WR4 A;  1SEN A;  5KOX A;  1ACV A;  4WET A;  1PSQ A;  4IQA A;  5H5Q A;  1V57 A;  2GTU A;  3CSH A;  3WGE A;  1VF2 A;  2YZU A;  1X9W B;  3CSI A;  4ISD A;  1BAY A;  4HEA 2;  3M9K A;  5LCZ A;  5IO2 A;  2PN8 A;  1Y6E A;  1XWG A;  1O6J A;  4MPF A;  3LEF A;  1CQH A;  1TI3 A;  1MDJ A;  2FA8 A;  3UMA A;  3A2V A;  2A4H A;  2CAQ A;  5IQY A;  4IVF A;  4IP6 A;  1QXH A;  3MWH A;  3ISO A;  2AV4 A;  3F6F A;  3BCI A;  2ON5 A;  2AJQ B;  2K9F A;  3GL5 A;  4PUF C;  2L57 A;  2A2S A;  2FHE A;  2VM2 A;  5CNW A;  4EF0 A;  5HR1 A;  4OO4 A;  3EWL A;  1VF3 A;  2YN1 A;  1EOH A;  4N11 A;  1GTU A;  3ERF A;  3QMX A;  2GS3 A;  4WKW A;  2CQ9 A;  1FW1 A;  2DJ1 A;  4ECI A;  2C0D A;  1RK4 A;  1X9S B;  2EIQ A;  4HJM A;  3IRA A;  4PXO A;  3H8Q A;  2X8C A;  2H0H A;  4CHS A;  2OAD A;  1M9A A;  2RUE A;  1GUM A;  4NAX A;  1KBN A;  4POL A;  3TKQ A;  3LFL A;  1XW5 A;  1V98 A;  2X64 A;  5ABR A;  3IC8 A;  3ERW A;  3L0H A;  1CQG A;  2JU5 A;  4KDU A;  3PH9 A;  3F4T A;  4NV2 A;  3MSZ A;  2AAW A;  3DKS A;  2DJ0 A;  2GSR A;  3ZIT A;  2H6Z A;  4ACS A;  4I2T A;  1N2A A;  4IS0 A;  2P5R A;  4X0X A;  6GSU A;  1TK0 B;  2R6K A;  3C7M A;  3FR6 A;  4NHZ A;  3HVS A;  3I69 A;  1SL1 B;  2PVO C;  4N0Z A;  2MMN A;  3KM6 A;  3VWV A;  2K18 A;  3W8S A;  1ZYE A;  5EY6 A;  3J7Y k;  3E0U A;  1ON4 A;  1K0D A;  1A2M A;  5L71 A;  4TOP A;  3R2Q A;  1T8E B;  1SKR B;  4X43 A;  5IMC A;  5ECS A;  2VL2 A;  4TXO A;  1M9B A;  3W6G A;  2OKA A;  4Q5F A;  2HFD A;  1DUG A;  4IJI A;  4IHU A;  5G1L A;  2F8A A;  3VPQ A;  2PVQ A;  3PPU A;  2XC2 A;  2P0G A;  3C8E A;  1KNG A;  1Z5Y E;  1SL2 B;  1B48 A;  2RM6 A;  2GT6 A;  3QFA C;  1PN9 A;  2VL9 A;  2R0C A;  2VL3 A;  4A5P A;  3IA1 A;  1PN0 A;  2M80 A;  3LQ7 A;  2YJ7 A;  5F05 A;  5INY A;  4YKF A;  2FD3 A;  2H1B A;  1A0F A;  4YQM A;  5CRH A;  17GS A;  3N9J A;  2HYX A;  1OC3 A;  1W89 A;  1ERV A;  2GSS A;  4ULX A;  5DQS A;  2GZZ A;  1B9X C;  2XBI A;  1WE0 A;  3PGT A;  4QL7 A;  4TW5 A;  2V6K A;  1XVW A;  2JAD A;  2AUV A;  4GQF A;  2QC7 A;  1TKD B;  1M2B A;  2L4C A;  3FRC A;  2GQK A;  1TOF A;  3KP9 A;  2LS5 A;  3GNJ A;  1GSQ A;  1AQW A;  2H66 A;  4WF4 A;  5FT3 A;  1T00 A;  5HR2 A;  1SJ6 A;  2GDR A;  4ECJ A;  3DIE A;  2N5F A;  4TXV A;  1A2L A;  3C73 A;  3LG6 A;  1M2A A;  1NHO A;  3TRQ A;  3IC4 A;  8GSS A;  1AW9 A;  3IAM 2;  4AJ6 A;  2MMZ A;  1PKZ A;  3V1W A;  2C0G A;  1GH2 A;  4HU7 A;  2DBC A;  1HD2 A;  3IR4 A;  3F63 A;  2R5G A;  4FYC A;  1SK0 A;  2H74 A;  4ECC A;  2QA1 A;  1XZO A;  4OD7 A;  3SBC A;  1ZYQ B;  4OWY A;  2E7P A;  1XFL A;  1YEX A;  3TCO A;  3D5J A;  3FR9 A;  2FCH A;  3KCM A;  3I43 A;  2JL4 A;  2I1U A;  2FLS A;  3F0I A;  2JSZ A;  2H1G A;  1SYR A;  1BG5 A;  2KOK A;  4I6X A;  4WBR D;  4KE3 A;  2M46 A;  4RI7 A;  2WUL A;  3I6A A;  1MD3 A;  1BED A;  1OAZ A;  1FVK A;  2DML A;  1M99 A;  2ES7 A;  1ERT A;  1A0R P;  5D9T A;  1A8L A;  3UVH A;  5HQP A;  4MH3 A;  2B1L A;  3APS A;  2VCT A;  3ME7 A;  1EV9 A;  3ZML A;  2DJK A;  2FNO A;  2F8F A;  1V58 A;  5FHI A;  2VCQ A;  1EEJ A;  4Z2T A;  4AGS A;  5KN3 A;  4CY6 A;  4TRX A;  3A5I A;  4NMU A;  2I4A A;  5FWG A;  1X5E A;  5CYY A;  1FOV A;  1WP0 A;  1TW9 A;  4G0I A;  3DD3 A;  5KN2 A;  4FH8 A;  5G31 A;  3UBL A;  1YF0 A;  1XIY A;  2RUF A;  1NW2 A;  2YWN A;  4MF7 A;  3LYP A;  1Q98 A;  2GZP A;  1OC9 B;  3EMX A;  1ZCP A;  5H5R A;  1IYH A;  1ZMA A;  1GRX A;  1M0U A;  4WBJ A;  3GSS A;  2YP6 A;  4IKH A;  2HE3 A;  1GTB A;  5H5S A;  5G5F A;  3BOA A;  3GKX A;  3VI5 A;  3HZ4 A;  3QAW A;  1O81 A;  4MLY A;  2LST A;  3D0Z A;  4L0U A;  4EL1 A;  2R2J A;  3ERG A;  5CRE A;  3KH7 A;  3GKN A;  1V40 A;  2P5Q A;  1SKW B;  4MA9 A;  1B8X A;  5IM9 A;  3GX0 A;  2MMA A;  2DMM A;  1A8Y A;  4NPB A;  4ZB8 A;  5F06 A;  1HNC A;  2H6X A;  2X8G A;  2H72 A;  2XHF A;  7GSS A;  1M2D A;  3A2X A;  4FYB A;  5IOW A;  1VRS D;  3GX8 A;  2LKU A;  1YQ1 A;  4KCA A;  4IN0 A;  1FAA A;  1J0F A;  2K8S A;  3GHA A;  4MNN A;  20GS A;  3RDW A;  2R3X A;  4XHM A;  1YF1 A;  5D93 A;  4DSS B;  2YCD A;  3MYD A;  2X8H A;  2E2G A;  1TDI A;  11GS A;  1OC9 A;  1I5G A;  3U6V A;  5G30 A;  4MH2 A;  3MIX A;  2D2Z A;  1THO A;  1BJX A;  4KH7 A;  4K1F A;  2MYG A;  4J2F A;  3D21 A;  1T1V A;  3UJ1 A;  4HDE A;  2DKI A;  2NVL A;  1DE1 A;  3L4N A;  3ZMK A;  3QR6 A;  1VGL A;  2CZ3 A;  1U88 A;  3RHC A;  5AIX A;  3EPT A;  5GAN D;  3IK7 A;  4LL4 B;  2C3T A;  2C3Q A;  2KP2 A;  2PBJ A;  1DBY A;  3ZL5 A;  1M7T A;  2YJH A;  3UL3 A;  3ZIV A;  3H93 A;  4IGJ A;  2EIR A;  1K3O A;  3HVN A;  4MF5 A;  1WIK A;  1UC7 A;  3MNG A;  3NOF A;  2V2G A;  3UAR A;  4K2X A;  1E6B A;  2HI7 A;  1AXD A;  4KDX A;  2GQM A;  2HSM A;  2KUC A;  5JWR B;  3BCK A;  3F9U A;  2L59 A;  1OVN A;  1ZZY A;  1X5D A;  3FR3 A;  2LV3 A;  5IIZ A;  4HSC X;  1GUL A;  2H75 A;  4GLT A;  4JR6 A;  4DSS A;  1VF4 A;  2HRA A;  2X99 A;  1JZO A;  5ECH B;  5ECK B;  1WMJ A;  1TK5 B;  4O5U A;  3P90 A;  5JWO B;  1XW9 A;  2H30 A;  2GQL A;  4L5O A;  5G2Z A;  2IN3 A;  2O8V B;  2R37 A;  2VL2 C;  3DYR A;  3HXS A;  4FQU A;  2LRN A;  1ERW A;  3ZVJ A;  2VCV A;  1XG8 A;  3LXT A;  1KTE A;  1GLP A;  4G19 A;  22GS A;  3FZ9 A;  5HR0 A;  3IV4 A;  1I9D A;  2B7J A;  2IMI A;  5ECR B;  1M3I A;  1ZL9 A;  4GF0 A;  3HJP A;  4N30 A;  1URM A;  2X49 A;  1YZX A;  1FG4 A;  1G6Y A;  2B3S A;  2JZT A;  1Z9H A;  5A4U A;  3KD0 A;  1S3R A;  1TK8 B;  4Z2R A;  2FWE A;  5J9B A;  6GSS A;  3LJR A;  1PKW A;  2OBK A;  3FEU A;  1YY7 A;  3F3Q A;  6GSX A;  3DWV A;  2H8L A;  5AGY A;  2VAF A;  4RUV A;  2H70 A;  2QKE A;  2V41 A;  4JE1 A;  1XPV A;  4JED A;  3LOR A;  3WT2 A;  3FZ4 A;  3PR8 A;  2XBQ A;  3OR5 A;  2GST A;  3D22 A;  3J7Y b;  1JLW A;  3GV1 A;  4XS6 A;  2YPM A;  4O7H A;  5CRD A;  3NIV A;  1OE7 A;  1QGV A;  2C8U A;  2VCW A;  5D73 A;  2VOC A;  1Z6M A;  3TJB A;  2ALB A;  3FHK A;  4TXO B;  2TRC P;  4G9H A;  5DQY A;  4IW9 A;  4XRA A;  1YKA A;  4JRR A;  3VK9 A;  3IHQ A;  3WT1 A;  1KEB A;  4V1A g;  1YDK A;  3IBH A;  5J5N A;  3HD5 A;  2F9S A;  1F3A A;  1T7P B;  4ZXG A;  4YAV A;  3GA4 A;  1XOB A;  1JHB A;  1XXU A;  1U87 A;  4WF5 A;  1FVJ A;  1O8W A;  2VLU A;  3F4S A;  3TJG A;  3QDN A;  3IXR A;  2YV9 A;  4G10 A;  3LSZ A;  5B8A A;  4TVE A;  3C1S A;  1T3B A;  1S3D A;  4GWR A;  5HR3 A;  4O32 A;  1PL1 A;  3HHV A;  1T4Y A;  2N5B A;  1XWC A;  1YKC A;  4L0W A;  5IOX A;  5J3R A;  3UOM A;  5G1K A;  1ZYP A;  1GTI A;  1UVZ A;  3HKR A;  2IL3 A;  2O89 A;  5KN1 A;  2FUG 2;  2WZ9 A;  4CW9 A;  5LNK e;  4MMM A;  4MZC A;  3GUS A;  4K6X A;  1TU7 A;  1OC8 A;  2AB6 A;  13GS A;  5GAP D;  1BX9 A;  3ED3 A;  3DML A;  3BD2 A;  3MAK A;  1GSD A;  3ME8 A;  2B5E A;  3HVV A;  2OJL A;  5EL8 A;  4EXJ A;  3UVT A;  2BMX A;  4RQR A;  4PNG A;  4ZIJ A;  3M9J A;  3TUE A;  3C1R A;  3VWU A;  2GLR A;  3GFK A;  5F0G A;  2CX4 A;  2PMT A;  2OE0 A;  2REM A;  1K0M A;  2HSY A;  1ST9 A;  3GKM A;  3K8N A;  1NHY A;  1PX7 A;  5JWQ B;  2OBI A;  5D9V A;  4DSR A;  2FWF A;  4OO5 A;  2WFC A;  3L9V A;  2C0F A;  2LUS A;  4X4J A;  2FA4 A;  1OKT A;  2NTO A;  2CVD A;  1SD8 A;  4ML1 A;  1FB0 A;  4ZBD A;  4K2D A;  2HZE B;  1EZK A;  3D4T A;  2A4V A;  4ECB A;  2PU9 C;  3HJO A;  1K0A A;  4FIW A;  4PQI A;  1NM3 A;  4MZW A;  1F3B A;  4BVY A;  2I81 A;  4XRD A;  1LU4 A;  3GTU B;  1O85 A;  1UN2 A;  3MDK A;  5AIV A;  3TKS A;  2FGX A;  4E8H A;  2LQO A;  1U6T A;  5CRG A;  1EGO A;  5ELG A;  1K0N A;  1QUW A;  2LRT A;  1TRW A;  1EEM A;  3RBT A;  2RM5 A;  4EIP A;  5ECP B;  3LYK A;  4YQU A;  4V1A p;  4ICY A;  2TRX A;  2WCI A;  1X0R A;  5B7C A;  4FO5 A;  3L9U A;  4N0V A;  2LTK A;  1GNE A;  2C1Y A;  2IMK A;  3UEM A;  5D96 A;  5CP1 A;  3ZYW A;  3FW2 A;  3GH6 A;  5IPG A;  4WR5 A;  1PA3 A;  2LEG A;  5ENU A;  1SKS B;  1G0T A;  3GN3 A;  2NPB A;  5ECL B;  2O87 A;  5D8I A;  12GS A;  3HA9 A;  2HZE A;  2VCX A;  2NDO A;  1GP1 A;  4JR4 A;  3Q19 A;  1MEK A;  1XW6 A;  4HZ2 A;  1Z7R A;  3DEX A;  1FO5 A;  2AHE A;  4KUN A;  2CVB A;  3QOU A;  1GTA A;  1ILO A;  3HJM A;  3CTF A;  4EUY A;  4BPY A;  5CAX A;  3GTU A;  4K8M A;  5DCH A;  5IMV A;  2L4Q A;  2VUP A;  4KGI A;  5HFG A;  5C00 A;  3ZRD A;  1AIU A;  2VCZ A;  1GSS A;  3GH9 A;  2F51 A;  1GSY A;  3H4K A;  2B6M A;  2HNL A;  1YJ6 A;  3ZZX A;  1RW1 A;  2IWT A;  1K0C A;  4GRF A;  3TGZ A;  4HQS A;  4PNF A;  1TRU A;  3DVW A;  1EP7 A;  3TJJ A;  4GSN A;  1B9Y C;  3LWA A;  3F6D A;  3GIX A;  4KAE A;  3HY2 A;  3KTL A;  1GUK A;  4HS1 A;  3Q18 A;  3ZFL A;  5B6N A;  3AY8 A;  5D9W A;  4KF9 A;  2WS2 A;  3KZQ A;  2CT6 A;  4ML6 A;  1A24 A;  2KP1 A;  4Q5N A;  9GSS A;  1R7H A;  19GS A;  2JAC A;  4I2U A;  3TJF A;  4DEJ A;  5IMD A;  5KN0 A;  2H0G A;  5AIS A;  2YZH A;  5HFI A;  2A2P A;  1Z6N A;  2DKH A;  3C71 A;  2C3N A;  2GSQ A;  3GRX A;  2LQQ A;  4KA0 A;  1Z7P A;  2E0Q A;  2VO4 A;  2L6C A;  14GS A;  3Q74 A;  4G0L A;  2WGR A;  5JCG A;  1AC1 A;  5LD0 A;  2C80 A;  4PUA A;  4EDZ A;  3GST A;  3I9V 2;  3W8J A;  1QFN A;  2B5X A;  2VLV A;  3F4R A;  4K7N A;  2V6O A;  4ZIL A;  4EC0 A;  4OMV A;  4L5L A;  3FKF A;  4PQ1 A;  4MAB A;  5JCW A;  4MDC A;  1PRX A;  4ZBB A;  5B8B A;  3UIW A;  2LJR A;  4E8E A;  1R5P A;  4WEY A;  3F3R A;  5D9X A;  2PER A;  1F37 A;  2XPE A;  4FYU A;  1THX A;  4XS1 A;  3FY7 A;  4JU5 A;  3ZRE A;  3IHG A;  4LL1 B;  2DC5 A;  4YQV A;  1ERU A;  1Q4J A;  4AF2 A;  3EUR A;  5ECM B;  3IPZ A;  4MP4 A;  3ZVJ D;  1X9M B;  4XS4 B;  1B4P A;  2YOI A;  4NXI A;  3G9B A;  3EMP A;  3TOU A;  4HQZ A;  3KGK A;  4HUA A;  3O6T A;  1WWJ A;  1R5A A;  16GS A;  4ZL8 A;  4JZQ A;  3BJ5 A;  2OA7 A;  4BIK A;  5DVB A;  1GLQ A;  1GSF A;  4ZBA A;  4YKG A;  1WOU A;  4EKZ A;  1MTC A;  2O85 A;  4Q5Q A;  4ZL9 A;  1OYJ A;  3KTB A;  3O3T A;  4PQH A;  3CTG A;  4O92 A;  1G7O A;  3EU4 A;  4V2M A;  3L9S A;  3CMI A;  4YAP A;  3UAP A; 
#chains in the Genus database with same CATH homology
 5F8B A;  3EE2 A;  1SD9 A;  2M72 A;  1EV4 A;  4GCI A;  4I8B A;  1O8X A;  2B7K A;  2L6D A;  2N5A A;  1SK1 A;  4KSO A;  3ZLP A;  2LNS A;  4IBP A;  3HZ8 A;  3S9F A;  3H1N A;  2HZF A;  3KP8 A;  2H6Y A;  4EDY A;  2HRN A;  1O73 A;  5ECO B;  2FWG A;  2HT9 A;  2ON7 A;  4GTU A;  2X4A A;  3BBY A;  4GQC A;  4IQ1 A;  4ZB6 A;  4XS4 A;  1GWC A;  4QQ7 A;  4MPG A;  3QD9 A;  4OFM A;  3IDV A;  5IMA A;  5DAL B;  2RLI A;  1JZD A;  4ZL7 A;  1FB6 A;  2OAC A;  3DRN A;  4O5R A;  2FY6 A;  2LJK A;  1DE2 A;  2UZ8 A;  2PGT A;  3QAG A;  4LMV A;  4TR3 A;  2OE1 A;  5DJM A;  1PMT A;  1EOG A;  4HJ2 A;  2OE3 A;  5E4W A;  2I9H A;  2HRF A;  3RPP A;  5ELA A;  4TR0 A;  2CA8 A;  2HRK A;  1QQ2 A;  2HXK A;  1E2Y A;  4MJB A;  4KDY A;  3IOS A;  1ABA A;  1F2E A;  1OKD A;  1OE8 A;  3KXO A;  1SL0 B;  4K7I A;  4Z2U A;  4MF6 A;  1R4W A;  3M8N A;  2C4J A;  1AQV A;  2IFQ B;  2YAN A;  1RQM A;  3O76 A;  5ID2 B;  2MBT A;  3TKS C;  3D6I A;  3TRX A;  3U5R E;  2C0E A;  3L78 A;  4OCE A;  4K9Z A;  3FK8 A;  3TKS E;  4MZB A;  4OFN A;  3E3E A;  2HSH A;  3LW9 A;  1LBK A;  3GMF A;  4TR4 A;  5DAL A;  3N5O A;  3TDG A;  5GST A;  5CO3 A;  4BWQ A;  3VPT A;  3IK9 A;  3Q6O A;  2JZS A;  3G7I A;  2R0P A;  4IJ3 A;  3UBK A;  2VM1 A;  1BYE A;  4D73 B;  3ZTL A;  1PQN A;  4F2I A;  4USS A;  1J9B A;  3RAZ A;  1XCC A;  3WD6 A;  2QSI A;  3EVI A;  4KX4 A;  2VD1 A;  2JSY A;  2ZCT A;  5COH A;  1J08 A;  2H01 A;  1SK2 A;  1TRS A;  1JZR A;  3HYP A;  1R26 A;  2QGV A;  1K3L A;  1B4Q A;  4K0N A;  2PPT A;  2IFQ A;  4BVY B;  1SU9 A;  5ID2 A;  4YH2 A;  4HOJ A;  1ML6 A;  2G2Q A;  4NWY A;  4TR1 B;  1A23 A;  4MCU A;  4F0C A;  3G7J A;  5A5K A;  4KND A;  4BVX B;  3QCP A;  2F3M A;  1XOA A;  3H79 A;  1T4Z A;  1TP9 A;  3DVX A;  2DSA A;  3A5W A;  5CRW A;  4X1U A;  3FYG A;  3VI7 A;  2GGT A;  3CXG A;  4EIQ A;  1C72 A;  5IPH A;  5E59 A;  2H1A A;  4LMW A;  1S3C A;  4D73 A;  4XTS A;  2O7K A;  2CAI A;  3FMW A;  3KMO A;  1K0B A;  2YNX A;  1XBS A;  3RHB A;  4IP1 A;  3A2W A;  3APO A;  1USB A;  2L5L A;  4G0K A;  1ZOF A;  4EO3 A;  1Z3E A;  3TKR A;  2E2M A;  1G7E A;  4OCF A;  2WDU A;  4H86 A;  3ZIJ A;  4PUR A;  3KIJ A;  5AN1 A;  4F9Z A;  1TJD A;  1EP8 A;  3TKP A;  1IYI A;  3PIN A;  3GYK A;  4LA1 A;  2J23 A;  1TXX A;  1JZW A;  4XCS A;  1MD4 A;  1QMV A;  2L5O A;  4GSS A;  4TR1 A;  2IIY A;  2CV4 A;  2I3Y A;  3CRU A;  1LJR A;  1UA5 A;  1PGT A;  2ZNM A;  4BVX A;  4BA7 A;  2YV7 A;  4POM A;  4LLR A;  1ZYN A;  2LJA A;  1NSW A;  1QK8 A;  1WPI A;  5ECQ B;  3SWL A;  5DJL A;  1N8J A;  2IMF A;  3KEB A;  2CX3 A;  5GSS A;  4NV5 A;  4OFT A;  2IMD A;  2VLT A;  2DIZ A;  4L8E A;  5ECI B;  1HQO A;  3LGC A;  4KSM A;  4AJ7 A;  2IPA A;  4EE0 A;  2K6V A;  2JZR A;  1PL2 A;  3QAV A;  3KJY A;  5A4W A;  3TJK A;  4DSQ A;  5HFK A;  2XPD A;  4JBB A;  3G7Y A;  4EVM A;  3D4M A;  3KMN A;  5G5E A;  4K7O A;  3GUR A;  2R4V A;  3VWW A;  2DJ2 A;  2TIR A;  2H1D A;  4BL7 B;  4V2L A;  3JCM L;  4KCE A;  2GT5 A;  5GZZ B;  4DVC A;  1XVQ A;  2MMO A;  4O5Q A;  5IO0 A;  3TOT A;  1PD2 1;  3P8W A;  5KEJ A;  5EVO A;  5BRT A;  5DAK B;  4Q5R A;  4PTS A;  3VWX A;  2DJJ A;  3HDC A;  1GUH A;  2H76 A;  1VF1 A;  10GS A;  1TU8 A;  2WB9 A;  1AAZ A;  4XIH A;  1AUC A;  2J9H A;  4K5R A;  3LXZ A;  4F03 A;  2AYT A;  1XWB A;  2PWJ A;  1H4O A;  4MK3 A;  2CZ2 A;  1A2J A;  1V2A A;  3IE3 A;  5J9C A;  3QFB C;  2V32 A;  2B5Y A;  4IEL A;  1ZGN A;  3M3M A;  4F0B A;  5BMU A;  4PGT A;  3QPM A;  1JFU A;  3GL3 A;  3P2A A;  5DDL A;  1HNB A;  5J4U A;  5J41 A;  6GST A;  2V1M A;  1WRY A;  4BL7 A;  1YEP A;  1WJK A;  1GSE A;  5B6M A;  2H73 A;  2LNT A;  1K0O A;  4BWS A;  1GSU A;  5DAK A;  3NZN A;  2H19 A;  2NBS A;  1GL8 A;  3F8U A;  3US3 A;  2P31 A;  1TI1 A;  1GNW A;  4ID0 A;  3VLN A;  3ZFB A;  4MJA A;  1U3I A;  5KOW A;  2B1K A;  3HCZ A;  5IMF A;  4MJC A;  3DGQ A;  1O7U A;  1F6M C;  3CYN A;  4P3Y B;  4GXZ A;  3RPN A;  4HU9 A;  4I97 A;  1G6W A;  2MZC A;  1JLV A;  3EYT A;  3CBU A;  2HLS A;  2EIO A;  2A2R A;  2R0G A;  5F07 A;  18GS A;  1HNA A;  2DIY A;  3VFI A;  4POB A;  2GZY A;  4GST A;  4KB3 A;  2MBS A;  1PX6 A;  3TB2 A;  3EIN A;  1HYU A;  3HVX A;  5A4V A;  4NHW A;  4QL9 A;  4CY8 A;  4J56 E;  1K3Y A;  3IAS 2;  3E9J B;  2K8V A;  4RI6 A;  1SYX A;  4ILF A;  6GSV A;  1AQX A;  4HZ4 A;  4WXT A;  2PUK C;  1H75 A;  2BTO T;  5C04 A;  4PX1 A;  4V2N A;  4KW6 A;  1FOH A;  2YWM A;  4AJ8 A;  2KLX A;  2YWI A;  3M1G A;  2DJ3 A;  3A3T A;  3M0F A;  3EC3 A;  1XWK A;  1U3A A;  4TN8 A;  2CVK A;  3VUR A;  1V9W A;  1FHE A;  4I5Q A;  3CSJ A;  2GVP A;  2KHP A;  3EU3 A;  5IMZ A;  4HI7 A;  4Z7X A;  4MJE A;  2VD0 A;  2H71 A;  2H0I A;  2EC4 A;  3WYW A;  2YWO A;  4POK A;  1Y25 A;  5DCG A;  2QA2 A;  6GSW A;  2VIM A;  5ECN B;  4F82 A;  4RQX A;  3WGD A;  2WJU A;  2Z9S A;  4ZB9 A;  6GSY A;  3FZ5 A;  1TTZ A;  2LRC A;  1X5C A;  2RII A;  4K5S A;  1S3A A;  4CDO A;  2WRT A;  2G0F A;  1TRV A;  5JCU A;  3DXB A;  4K0G A;  2IJY A;  1EGR A;  2DLX A;  3GKK A;  4TKY A;  5DBQ A;  3FZA A;  4N10 A;  2FWH A;  3TRP A;  3APQ A;  2ZUP A;  2BJX A;  4G2E A;  1XWA A;  3R3E A;  1BQ7 A;  1MDI A;  1W4V A;  3P7X A;  4J57 E;  2IME A;  1MDK A;  1EWX A;  3CRT A;  3KH9 A;  1DSB A;  5EPF A;  1SJI A;  1F9M A;  3WGX A;  1SJZ A;  4WR4 A;  1SEN A;  5KOX A;  1ACV A;  4WET A;  1PSQ A;  4IQA A;  5H5Q A;  1V57 A;  2GTU A;  3CSH A;  3WGE A;  1VF2 A;  2YZU A;  1X9W B;  3CSI A;  4ISD A;  1BAY A;  4HEA 2;  3M9K A;  5LCZ A;  5IO2 A;  2PN8 A;  1Y6E A;  1XWG A;  1O6J A;  4MPF A;  3LEF A;  1CQH A;  1TI3 A;  1MDJ A;  2FA8 A;  3UMA A;  3A2V A;  2A4H A;  2CAQ A;  5IQY A;  4IVF A;  4IP6 A;  1QXH A;  3MWH A;  3ISO A;  2AV4 A;  3F6F A;  3BCI A;  2ON5 A;  2AJQ B;  2K9F A;  3GL5 A;  4PUF C;  2L57 A;  2A2S A;  2FHE A;  2VM2 A;  5CNW A;  4EF0 A;  5HR1 A;  4OO4 A;  3EWL A;  1VF3 A;  2YN1 A;  1EOH A;  4N11 A;  1GTU A;  3ERF A;  3QMX A;  2GS3 A;  4WKW A;  2CQ9 A;  1FW1 A;  2DJ1 A;  4ECI A;  2C0D A;  1RK4 A;  1X9S B;  2EIQ A;  4HJM A;  3IRA A;  4PXO A;  3H8Q A;  2X8C A;  2H0H A;  4CHS A;  2OAD A;  1M9A A;  2RUE A;  1GUM A;  4NAX A;  1KBN A;  4POL A;  3TKQ A;  3LFL A;  1XW5 A;  1V98 A;  2X64 A;  5ABR A;  3IC8 A;  3ERW A;  3L0H A;  1CQG A;  2JU5 A;  4KDU A;  3PH9 A;  3F4T A;  4NV2 A;  3MSZ A;  2AAW A;  3DKS A;  2DJ0 A;  2GSR A;  3ZIT A;  2H6Z A;  4ACS A;  4I2T A;  1N2A A;  4IS0 A;  2P5R A;  4X0X A;  6GSU A;  1TK0 B;  2R6K A;  3C7M A;  3FR6 A;  4NHZ A;  3HVS A;  3I69 A;  1SL1 B;  2PVO C;  4N0Z A;  2MMN A;  3KM6 A;  3VWV A;  2K18 A;  3W8S A;  1ZYE A;  5EY6 A;  3J7Y k;  3E0U A;  1ON4 A;  1K0D A;  1A2M A;  5L71 A;  4TOP A;  3R2Q A;  1T8E B;  1SKR B;  4X43 A;  5IMC A;  5ECS A;  2VL2 A;  4TXO A;  1M9B A;  3W6G A;  2OKA A;  4Q5F A;  2HFD A;  1DUG A;  4IJI A;  4IHU A;  5G1L A;  2F8A A;  3VPQ A;  2PVQ A;  3PPU A;  2XC2 A;  2P0G A;  3C8E A;  1KNG A;  1Z5Y E;  1SL2 B;  1B48 A;  2RM6 A;  2GT6 A;  3QFA C;  1PN9 A;  2VL9 A;  2R0C A;  2VL3 A;  4A5P A;  3IA1 A;  1PN0 A;  2M80 A;  3LQ7 A;  2YJ7 A;  5F05 A;  5INY A;  4YKF A;  2FD3 A;  2H1B A;  1A0F A;  4YQM A;  5CRH A;  17GS A;  3N9J A;  2HYX A;  1OC3 A;  1W89 A;  1ERV A;  2GSS A;  4ULX A;  5DQS A;  2GZZ A;  1B9X C;  2XBI A;  1WE0 A;  3PGT A;  4QL7 A;  4TW5 A;  2V6K A;  1XVW A;  2JAD A;  2AUV A;  4GQF A;  2QC7 A;  1TKD B;  1M2B A;  2L4C A;  3FRC A;  2GQK A;  1TOF A;  3KP9 A;  2LS5 A;  3GNJ A;  1GSQ A;  1AQW A;  2H66 A;  4WF4 A;  5FT3 A;  1T00 A;  5HR2 A;  1SJ6 A;  2GDR A;  4ECJ A;  3DIE A;  2N5F A;  4TXV A;  1A2L A;  3C73 A;  3LG6 A;  1M2A A;  1NHO A;  3TRQ A;  3IC4 A;  8GSS A;  1AW9 A;  3IAM 2;  4AJ6 A;  2MMZ A;  1PKZ A;  3V1W A;  2C0G A;  1GH2 A;  4HU7 A;  2DBC A;  1HD2 A;  3IR4 A;  3F63 A;  2R5G A;  4FYC A;  1SK0 A;  2H74 A;  4ECC A;  2QA1 A;  1XZO A;  4OD7 A;  3SBC A;  1ZYQ B;  4OWY A;  2E7P A;  1XFL A;  1YEX A;  3TCO A;  3D5J A;  3FR9 A;  2FCH A;  3KCM A;  3I43 A;  2JL4 A;  2I1U A;  2FLS A;  3F0I A;  2JSZ A;  2H1G A;  1SYR A;  1BG5 A;  2KOK A;  4I6X A;  4WBR D;  4KE3 A;  2M46 A;  4RI7 A;  2WUL A;  3I6A A;  1MD3 A;  1BED A;  1OAZ A;  1FVK A;  2DML A;  1M99 A;  2ES7 A;  1ERT A;  1A0R P;  5D9T A;  1A8L A;  3UVH A;  5HQP A;  4MH3 A;  2B1L A;  3APS A;  2VCT A;  3ME7 A;  1EV9 A;  3ZML A;  2DJK A;  2FNO A;  2F8F A;  1V58 A;  5FHI A;  2VCQ A;  1EEJ A;  4Z2T A;  4AGS A;  5KN3 A;  4CY6 A;  4TRX A;  3A5I A;  4NMU A;  2I4A A;  5FWG A;  1X5E A;  5CYY A;  1FOV A;  1WP0 A;  1TW9 A;  4G0I A;  3DD3 A;  5KN2 A;  4FH8 A;  5G31 A;  3UBL A;  1YF0 A;  1XIY A;  2RUF A;  1NW2 A;  2YWN A;  4MF7 A;  3LYP A;  1Q98 A;  2GZP A;  1OC9 B;  3EMX A;  1ZCP A;  5H5R A;  1IYH A;  1ZMA A;  1GRX A;  1M0U A;  4WBJ A;  3GSS A;  2YP6 A;  4IKH A;  2HE3 A;  1GTB A;  5H5S A;  5G5F A;  3BOA A;  3GKX A;  3VI5 A;  3HZ4 A;  3QAW A;  1O81 A;  4MLY A;  2LST A;  3D0Z A;  4L0U A;  4EL1 A;  2R2J A;  3ERG A;  5CRE A;  3KH7 A;  3GKN A;  1V40 A;  2P5Q A;  1SKW B;  4MA9 A;  1B8X A;  5IM9 A;  3GX0 A;  2MMA A;  2DMM A;  1A8Y A;  4NPB A;  4ZB8 A;  5F06 A;  1HNC A;  2H6X A;  2X8G A;  2H72 A;  2XHF A;  7GSS A;  1M2D A;  3A2X A;  4FYB A;  5IOW A;  1VRS D;  3GX8 A;  2LKU A;  1YQ1 A;  4KCA A;  4IN0 A;  1FAA A;  1J0F A;  2K8S A;  3GHA A;  4MNN A;  20GS A;  3RDW A;  2R3X A;  4XHM A;  1YF1 A;  5D93 A;  4DSS B;  2YCD A;  3MYD A;  2X8H A;  2E2G A;  1TDI A;  11GS A;  1OC9 A;  1I5G A;  3U6V A;  5G30 A;  4MH2 A;  3MIX A;  2D2Z A;  1THO A;  1BJX A;  4KH7 A;  4K1F A;  2MYG A;  4J2F A;  3D21 A;  1T1V A;  3UJ1 A;  4HDE A;  2DKI A;  2NVL A;  1DE1 A;  3L4N A;  3ZMK A;  3QR6 A;  1VGL A;  2CZ3 A;  1U88 A;  3RHC A;  5AIX A;  3EPT A;  5GAN D;  3IK7 A;  4LL4 B;  2C3T A;  2C3Q A;  2KP2 A;  2PBJ A;  1DBY A;  3ZL5 A;  1M7T A;  2YJH A;  3UL3 A;  3ZIV A;  3H93 A;  4IGJ A;  2EIR A;  1K3O A;  4MF5 A;  1WIK A;  1UC7 A;  3MNG A;  3NOF A;  2V2G A;  3UAR A;  4K2X A;  1E6B A;  2HI7 A;  1AXD A;  4KDX A;  2GQM A;  2HSM A;  2KUC A;  5JWR B;  3BCK A;  3F9U A;  2L59 A;  1OVN A;  1ZZY A;  1X5D A;  3FR3 A;  2LV3 A;  5IIZ A;  1GUL A;  2H75 A;  4GLT A;  4JR6 A;  4DSS A;  1VF4 A;  2HRA A;  2X99 A;  1JZO A;  5ECH B;  5ECK B;  1WMJ A;  1TK5 B;  4O5U A;  3P90 A;  5JWO B;  1XW9 A;  2H30 A;  2GQL A;  4L5O A;  5G2Z A;  2IN3 A;  2O8V B;  2R37 A;  2VL2 C;  3DYR A;  3HXS A;  4FQU A;  2LRN A;  1ERW A;  3ZVJ A;  2VCV A;  3LXT A;  1KTE A;  1GLP A;  4G19 A;  22GS A;  3FZ9 A;  5HR0 A;  3IV4 A;  1I9D A;  2B7J A;  2IMI A;  5ECR B;  1ZL9 A;  4GF0 A;  3HJP A;  4N30 A;  1URM A;  2X49 A;  1YZX A;  1FG4 A;  1G6Y A;  2B3S A;  2JZT A;  1Z9H A;  5A4U A;  3KD0 A;  1TK8 B;  4Z2R A;  2FWE A;  5J9B A;  6GSS A;  3LJR A;  1PKW A;  2OBK A;  3FEU A;  1YY7 A;  3F3Q A;  6GSX A;  3DWV A;  2H8L A;  5AGY A;  2VAF A;  4RUV A;  2H70 A;  2QKE A;  2V41 A;  4JE1 A;  1XPV A;  4JED A;  3LOR A;  3WT2 A;  3FZ4 A;  3PR8 A;  2XBQ A;  3OR5 A;  2GST A;  3D22 A;  3J7Y b;  1JLW A;  3GV1 A;  4XS6 A;  2YPM A;  4O7H A;  5CRD A;  3NIV A;  1OE7 A;  1QGV A;  2C8U A;  2VCW A;  5D73 A;  2VOC A;  1Z6M A;  3TJB A;  2ALB A;  3FHK A;  4TXO B;  2TRC P;  4G9H A;  5DQY A;  4IW9 A;  4XRA A;  1YKA A;  4JRR A;  3VK9 A;  3IHQ A;  3WT1 A;  1KEB A;  4V1A g;  1YDK A;  3IBH A;  5J5N A;  3HD5 A;  2F9S A;  1F3A A;  1T7P B;  4ZXG A;  4YAV A;  3GA4 A;  1XOB A;  1JHB A;  1XXU A;  1U87 A;  4WF5 A;  1FVJ A;  1O8W A;  2VLU A;  3F4S A;  3TJG A;  3QDN A;  3IXR A;  2YV9 A;  4G10 A;  3LSZ A;  5B8A A;  4TVE A;  3C1S A;  1T3B A;  1S3D A;  4GWR A;  5HR3 A;  4O32 A;  1PL1 A;  3HHV A;  1T4Y A;  2N5B A;  1XWC A;  1YKC A;  4L0W A;  5IOX A;  5J3R A;  3UOM A;  5G1K A;  1ZYP A;  1GTI A;  1UVZ A;  3HKR A;  2IL3 A;  2O89 A;  5KN1 A;  2FUG 2;  2WZ9 A;  4CW9 A;  5LNK e;  4MMM A;  4MZC A;  3GUS A;  4K6X A;  1TU7 A;  1OC8 A;  2AB6 A;  13GS A;  5GAP D;  1BX9 A;  3ED3 A;  3DML A;  3BD2 A;  3MAK A;  1GSD A;  3ME8 A;  2B5E A;  3HVV A;  2OJL A;  5EL8 A;  4EXJ A;  3UVT A;  2BMX A;  4RQR A;  4PNG A;  4ZIJ A;  3M9J A;  3TUE A;  3C1R A;  3VWU A;  2GLR A;  3GFK A;  5F0G A;  2CX4 A;  2PMT A;  2OE0 A;  2REM A;  1K0M A;  2HSY A;  1ST9 A;  3GKM A;  3K8N A;  1NHY A;  1PX7 A;  5JWQ B;  2OBI A;  5D9V A;  4DSR A;  2FWF A;  4OO5 A;  2WFC A;  3L9V A;  2C0F A;  2LUS A;  4X4J A;  2FA4 A;  1OKT A;  2NTO A;  2CVD A;  1SD8 A;  4ML1 A;  1FB0 A;  4ZBD A;  4K2D A;  2HZE B;  1EZK A;  3D4T A;  2A4V A;  4ECB A;  2PU9 C;  3HJO A;  1K0A A;  4FIW A;  4PQI A;  1NM3 A;  4MZW A;  1F3B A;  4BVY A;  2I81 A;  4XRD A;  1LU4 A;  3GTU B;  1O85 A;  1UN2 A;  3MDK A;  5AIV A;  3TKS A;  2FGX A;  4E8H A;  2LQO A;  1U6T A;  5CRG A;  1EGO A;  5ELG A;  1K0N A;  1QUW A;  2LRT A;  1TRW A;  1EEM A;  3RBT A;  2RM5 A;  4EIP A;  5ECP B;  3LYK A;  4YQU A;  4V1A p;  4ICY A;  2TRX A;  2WCI A;  1X0R A;  5B7C A;  4FO5 A;  3L9U A;  4N0V A;  2LTK A;  1GNE A;  2C1Y A;  2IMK A;  3UEM A;  5D96 A;  5CP1 A;  3ZYW A;  3FW2 A;  3GH6 A;  5IPG A;  4WR5 A;  1PA3 A;  2LEG A;  5ENU A;  1SKS B;  1G0T A;  3GN3 A;  2NPB A;  5ECL B;  2O87 A;  5D8I A;  12GS A;  3HA9 A;  2HZE A;  2VCX A;  2NDO A;  1GP1 A;  4JR4 A;  3Q19 A;  1MEK A;  1XW6 A;  4HZ2 A;  1Z7R A;  3DEX A;  1FO5 A;  2AHE A;  4KUN A;  2CVB A;  3QOU A;  1GTA A;  1ILO A;  3HJM A;  3CTF A;  4EUY A;  4BPY A;  5CAX A;  3GTU A;  4K8M A;  5DCH A;  5IMV A;  2L4Q A;  2VUP A;  4KGI A;  5HFG A;  5C00 A;  3ZRD A;  1AIU A;  2VCZ A;  1GSS A;  3GH9 A;  2F51 A;  1GSY A;  3H4K A;  2B6M A;  2HNL A;  1YJ6 A;  3ZZX A;  1RW1 A;  2IWT A;  1K0C A;  4GRF A;  3TGZ A;  4HQS A;  4PNF A;  1TRU A;  3DVW A;  1EP7 A;  3TJJ A;  4GSN A;  1B9Y C;  3LWA A;  3F6D A;  3GIX A;  4KAE A;  3HY2 A;  3KTL A;  1GUK A;  4HS1 A;  3Q18 A;  3ZFL A;  5B6N A;  3AY8 A;  5D9W A;  4KF9 A;  2WS2 A;  3KZQ A;  2CT6 A;  4ML6 A;  1A24 A;  2KP1 A;  4Q5N A;  9GSS A;  1R7H A;  19GS A;  2JAC A;  4I2U A;  3TJF A;  4DEJ A;  5IMD A;  5KN0 A;  2H0G A;  5AIS A;  2YZH A;  5HFI A;  2A2P A;  1Z6N A;  2DKH A;  3C71 A;  2C3N A;  2GSQ A;  3GRX A;  2LQQ A;  4KA0 A;  1Z7P A;  2E0Q A;  2VO4 A;  2L6C A;  14GS A;  3Q74 A;  4G0L A;  2WGR A;  5JCG A;  1AC1 A;  5LD0 A;  2C80 A;  4PUA A;  4EDZ A;  3GST A;  3I9V 2;  3W8J A;  1QFN A;  2B5X A;  2VLV A;  3F4R A;  4K7N A;  2V6O A;  4ZIL A;  4EC0 A;  4OMV A;  4L5L A;  3FKF A;  4PQ1 A;  4MAB A;  5JCW A;  4MDC A;  1PRX A;  4ZBB A;  5B8B A;  3UIW A;  2LJR A;  4E8E A;  1R5P A;  4WEY A;  3F3R A;  5D9X A;  2PER A;  1F37 A;  2XPE A;  4FYU A;  1THX A;  4XS1 A;  3FY7 A;  4JU5 A;  3ZRE A;  3IHG A;  4LL1 B;  2DC5 A;  4YQV A;  1ERU A;  1Q4J A;  4AF2 A;  3EUR A;  5ECM B;  3IPZ A;  4MP4 A;  3ZVJ D;  1X9M B;  4XS4 B;  1B4P A;  2YOI A;  4NXI A;  3G9B A;  3EMP A;  3TOU A;  4HQZ A;  3KGK A;  4HUA A;  3O6T A;  1WWJ A;  1R5A A;  16GS A;  4ZL8 A;  4JZQ A;  3BJ5 A;  2OA7 A;  5DVB A;  1GLQ A;  1GSF A;  4ZBA A;  4YKG A;  1WOU A;  4EKZ A;  1MTC A;  2O85 A;  4Q5Q A;  4ZL9 A;  1OYJ A;  3KTB A;  3O3T A;  4PQH A;  3CTG A;  4O92 A;  1G7O A;  3EU4 A;  4V2M A;  3L9S A;  3CMI A;  4YAP A;  3UAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...