2B5XA

Solution structure of a thioredoxin-like protein in the reduced form
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
148
structure length
148
Chain Sequence
MKLRQPMPELTGEKAWLNGEVTREQLIGEKPTLIHFWSISCHLCKEAMPQVNEFRDKYQDQLNVVAVHMPRSEDDLDPGKIKETAAEHDITQPIFVDSDHALTDAFENEYVPAYYVFDKTGQLRHFQAGGSGMKMLEKRVNRVLAETE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YkuV protein
publication title The bacillus subtilis YKUV is a thiol-disulfide oxidoreductase revealed by its redox structures and activity
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 47
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2b5xA00
1MDJA 2WULA 4F9ZA 3FZ9A 2HSYA 3WGDA 4K0GA 5ECLB 1R7HA 2RUEA 5G5FA 2LV3A 4V2MA 2C0FA 3EE2A 3KJYA 3Q6OA 4I8BA 2ON7A 1Y25A 4TKYA 4OO5A 3HYPA 4CHSA 3BCKA 1YKAA 3GKKA 3Q74A 4GTUA 3KM6A 3C73A 1PL2A 2OE1A 5CRWA 4AJ8A 1LU4A 2GZZA 1XVWA 3LG6A 2DIZA 1SJIA 3F4TA 2B1LA 4MF5A 2JSZA 2VCZA 1KEBA 2VOCA 4DSQA 4AJ7A 3HXSA 2L57A 2YOIA 1OE7A 5GSSA 4ZL8A 2GS3A 1EOGA 4F03A 2QSIA 1TTZA 4WF4A 3GKXA 2DJ0A 3DVXA 2C0GA 3QAWA 5LCZA 5DVBA 1K0OA 2LJAA 2N5AA 5COHA 4MDCA 2WDUA 4KUNA 3ZFLA 2FWHA 1V57A 3ERFA 2GGTA 2L59A 3O3TA 3KZQA 5ECMB 4JU5A 4IW9A 1Z7PA 3A5WA 1MEKA 3MWHA 2FA8A 3GSTA 4GCIA 4IN0A 4KH7A 1W89A 4EE0A 3FR3A 4K7IA 4IELA 1TRSA 4F0BA 2G2QA 2CVKA 4IKHA 4IS0A 2L6DA 3FYGA 2IMFA 3L4NA 2L4QA 2VLTA 3UVTA 2L6CA 2E0QA 1XZOA 5JWOB 2MBTA 5A5KA 1XW5A 1X0RA 3FR6A 4LMVA 1OE8A 1YEPA 4DSSB 2FNOA 1G6WA 1FB6A 3D22A 4V1Ap 1F9MA 1TW9A 4WXTA 1B4PA 3N5OA 3CXGA 2YJHA 2GTUA 3HVXA 2H01A 3M3MA 1OC3A 4GRFA 4HI7A 4BWSA 3CSIA 3QPMA 1EGRA 1PMTA 2YV7A 5JCGA 2WCIA 1S3CA 1ERTA 4POMA 2IMDA 5IMFA 5IQYA 5IOXA 1T7PB 4KNDA 3ME7A 3QFAC 1URMA 1G0TA 2LRTA 4KGIA 5IMDA 4KDYA 2CX4A 4ML6A 3FY7A 2GLRA 1TP9A 3I6AA 4OCFA 16GSA 3KGKA 2E2MA 2LQOA 2P5QA 2EIOA 1WE0A 2MYGA 1KBNA 3Q19A 5B8BA 1THOA 2H8LA 4XRDA 3IK9A 4DSSA 2VL2A 3UBKA 2DJ1A 2DC5A 2YANA 4BWQA 5G1LA 1PKZA 3US3A 3GNJA 3PGTA 2OE3A 1YDKA 2B6MA 1HYUA 4K6XA 3F0IA 2TRCP 5ECIB 3VI5A 2WRTA 1R26A 4K7NA 3FKFA 2GSTA 3QCPA 5ECQB 5LNKe 4EDZA 1U3AA 4X1UA 3D0ZA 3L9UA 2GSSA 2IIYA 5HR2A 4TVEA 1BEDA 4J56E 3VWUA 1RQMA 4NWYA 1R4WA 1XOBA 1SD8A 3TRXA 4DSRA 4DVCA 1K0MA 2RUFA 2CVBA 2C3NA 2CA8A 2LJKA 2KLXA 4K8MA 2F9SA 2EIQA 1EP8A 1THXA 2NDOA 4TXVA 3TKQA 3O6TA 1RW1A 1SENA 2H72A 2IMIA 3TJKA 4KCAA 3CSJA 3UJ1A 3DD3A 4HJMA 1XCCA 1TU7A 2VL3A 1QK8A 3W6GA 2H76A 4QL7A 5J9CA 2H1BA 2I3YA 1M99A 3KXOA 1Z6NA 1K0NA 1WP0A 5HFKA 2FY6A 3ZITA 3FEUA 5D9WA 2V41A 3KD0A 1TU8A 4MABA 1HQOA 1OKTA 3FZAA 3MAKA 2P0GA 1A23A 2HI7A 3S9FA 3DXBA 3GN3A 5DCHA 3LFLA 4XS1A 4WR5A 1SU9A 2CZ2A 1FVKA 3I9V2 4IBPA 3HA9A 3IBHA 2OADA 2GDRA 3D21A 5IOWA 4QL9A 1WMJA 3GYKA 5C00A 4PGTA 3GX8A 1ACVA 2R2JA 5ABRA 4KE3A 2VL9A 3TRQA 4MJCA 3L0HA 1JLVA 3WYWA 3CSHA 1JZDA 1EV9A 2L5LA 2VM2A 1A2MA 3C8EA 2C1YA 3TJJA 3D4MA 4KB3A 5IMZA 3UARA 2R6KA 4Q5FA 1O8XA 3IXRA 4FO5A 2DJKA 1A24A 2X99A 1VGLA 4XS4B 1WPIA 2I81A 4YH2A 1WJKA 4V1Ag 5JWRB 5DQSA 3HZ4A 3PH9A 2EC4A 1UC7A 4N0ZA 3ZLPA 5A4UA 2ALBA 1OKDA 5G2ZA 1GSYA 1S3DA 1ZGNA 4F0CA 2KP2A 3HKRA 4Q5RA 4JZQA 5KN2A 5H5SA 1GRXA 20GSA 3SBCA 3ISOA 1QGVA 3Q18A 4BPYA 2H6YA 2NPBA 3DGQA 2I4AA 3KH7A 4PURA 1SK2A 5L71A 4OFTA 2R5GA 1DSBA 2YV9A 2EIRA 1X5EA 2RM6A 2K9FA 2AV4A 3EMXA 1Y6EA 2X8HA 5A4WA 2HLSA 1A0FA 4HEA2 4GF0A 4AJ6A 3ZYWA 2VO4A 4KCEA 1ZL9A 4XS4A 2JADA 3TRPA 2MMNA 1F3AA 4BL7A 1M2DA 1TK8B 1M9AA 2C80A 1GUMA 3HDCA 2R4VA 4MZWA 2AAWA 1PL1A 2O87A 4IJIA 3PINA 1G7EA 1TK0B 13GSA 3ZVJD 3MSZA 2F8FA 2VD1A 1GSFA 1GUKA 4L8EA 5J41A 3KMOA 4GQCA 2B5EA 3CMIA 4YQVA 3TOTA 1TI1A 4IP6A 1JHBA 1JLWA 4K7OA 2GQMA 4HZ2A 2VL2C 1B8XA 3DMLA 4IQ1A 1LJRA 1BJXA 2X64A 1K0CA 4MPFA 1GP1A 4MH2A 1GNEA 4ID0A 1CQGA 4ZL9A 3L9SA 5F06A 1TKDB 2PMTA 3RBTA 4OD7A 2AHEA 3AY8A 3HVVA 3DRNA 1TRWA 3L78A 1A0RP 4AGSA 4RI6A 3N9JA 3GX0A 3OR5A 1NW2A 3HVSA 4FIWA 5AISA 4N10A 3TJFA 4ECCA 3RPNA 2DMLA 1ZYEA 3GTUA 1KTEA 2VCTA 4HZ4A 4MJEA 3GSSA 2HT9A 4XHMA 2NVLA 3K8NA 4HOJA 18GSA 1T00A 4ZBBA 4YQUA 2LRNA 4GLTA 4X43A 1SL2B 2PPTA 5CRDA 2MMZA 5JCWA 1H4OA 3EYTA 1M9BA 3GMFA 3HJPA 4GSSA 11GSA 5D9XA 3H4KA 4KDXA 4WEYA 3UAPA 2TRXA 4MH3A 4ZL7A 2H71A 1J08A 3ZRDA 2J23A 3IA1A 3LEFA 4PUAA 3APOA 3CRTA 2LRCA 2X8GA 2A2SA 2D2ZA 4PQ1A 1XW9A 3BBYA 4WKWA 1T8EB 1S3AA 1M0UA 1SYRA 1WIKA 6GSXA 5J4UA 3E0UA 2V2GA 2TIRA 3VURA 4L5OA 1QMVA 2DJ3A 4JEDA 5DQYA 3EMPA 4RQXA 1GSQA 4YAPA 2PVOC 3FK8A 4IP1A 4JE1A 2F8AA 3VI7A 4ZB8A 2LJRA 4P3YB 2ON5A 1Z6MA 1SKRB 1TI3A 1XBSA 4ZXGA 3WT1A 2LNTA 2H0HA 2H74A 3WGXA 3SWLA 4WBRD 2PU9C 3KCMA 2N5BA 1UN2A 2DJJA 4KX4A 1PX7A 2H6ZA 4FYCA 3BOAA 1N2AA 4ZILA 5AIVA 3M1GA 1KNGA 2XPDA 4MZCA 5CO3A 4F2IA 3IOSA 3KH9A 1OAZA 5B6NA 3GH9A 2Z9SA 3EC3A 5A4VA 2HYXA 4YAVA 5DBQA 5J3RA 1XPVA 2GSRA 3EURA 1M2BA 1GULA 4WF5A 2PERA 3APSA 3P90A 1U88A 3A2WA 3KMNA 1HNAA 4L5LA 3TKSA 1E6BA 2VIMA 2ES7A 4NPBA 19GSA 4GXZA 4HS1A 2DMMA 2YWNA 1V40A 3V1WA 4Z7XA 1EZKA 3UVHA 1PN9A 3D5JA 2B7KA 6GSYA 2M80A 2V6OA 1IYIA 4ECBA 1NM3A 1J9BA 1ERWA 3KP8A 3KP9A 2H19A 2KHPA 4ECJA 2AB6A 2H1DA 2GQLA 3M9JA 3IHQA 1GSDA 1ZCPA 3TDGA 2H70A 5F07A 1AQXA 3O76A 1EWXA 1BYEA 3I43A 14GSA 2VCVA 2PBJA 3GKMA 1WRYA 4WETA 2I9HA 1B9XC 3KIJA 4JR6A 1J0FA 1GTAA 1GSEA 2ZCTA 2R3XA 2HZEB 1A8LA 2NTOA 1V58A 3U5RE 2A4VA 3IC4A 4RQRA 4XIHA 3QMXA 3FR9A 5FHIA 4JR4A 3ERWA 3QFBC 2FWFA 3VFIA 3E9JB 5HFGA 1GLQA 2CT6A 5IMCA 4LL1B 4XCSA 5F8BA 4LLRA 4ZBDA 1F37A 1YY7A 2GZYA 4KSMA 2RIIA 2XBQA 1X9SB 5DAKB 4MCUA 5CYYA 3G7JA 2P31A 1GWCA 2H75A 3EINA 3G7YA 5IPGA 1LBKA 4ISDA 2QGVA 3APQA 3W8SA 3HJMA 2QC7A 3P8WA 2HNLA 2V6KA 4YQMA 1R5PA 2JU5A 5DJMA 1SKSB 4OCEA 4RI7A 2FUG2 3F3QA 2HZEA 5ID2B 5G1KA 1MD4A 2FCHA 1QFNA 4NXIA 12GSA 1AAZA 3WT2A 5IPHA 1R5AA 4RUVA 1O6JA 5HR3A 5CRHA 1BQ7A 3IE3A 3HY2A 4MF7A 2CV4A 4FYBA 4HU7A 5EY6A 4EXJA 1O81A 3F3RA 3UEMA 3NIVA 1JZWA 3D6IA 2VD0A 5DAKA 3GURA 3TKPA 2M72A 2WS2A 1K0DA 1T1VA 2O7KA 1OVNA 2HZFA 1Z9HA 1O73A 4X0XA 4F82A 2OJLA 3ZTLA 3A3TA 2QKEA 1A2LA 1PQNA 4HDEA 2WB9A 5IMVA 3C7MA 5ID2A 1JZOA 4TRXA 2E2GA 2LNSA 3ZMLA 1SK1A 5G30A 4HJ2A 2V1MA 1FW1A 5KN1A 3LXTA 2PWJA 4N0VA 2HRNA 1MDIA 4EVMA 4IVFA 1AIUA 6GSUA 5EL8A 4GWRA 2AUVA 9GSSA 4KAEA 6GSVA 1T4YA 5IO2A 4L0WA 3UIWA 3F8UA 4K9ZA 4I2TA 3RPPA 3TOUA 4CDOA 5INYA 4D73B 2YZHA 1G6YA 2OACA 3W8JA 3ZIJA 3D4TA 2OBKA 3LJRA 2WJUA 3GUSA 2CVDA 4MJBA 2H66A 2JZRA 5D8IA 1FAAA 5ECPB 3G7IA 1GLPA 1FO5A 5ENUA 3GIXA 1WWJA 1TK5B 4BVXA 3HHVA 2ZUPA 4I5QA 2GZPA 5F0GA 1ERVA 1K3OA 2LEGA 1V9WA 3WGEA 3TUEA 1FHEA 1XWBA 2YCDA 1VRSD 2MBSA 2AYTA 1NHOA 5B8AA 1OC9B 4TR0A 4IGJA 4HU9A 4OMVA 1PD21 4H86A 3GKNA 4KDUA 4D73A 1VF3A 2PVQA 4TXOB 1SJ6A 4NMUA 3WD6A 2V32A 3F63A 1FB0A 3QR6A 2YNXA 3IAM2 2VCWA 1XOAA 2GT5A 5ECRB 4EF0A 3F4SA 1ZYQB 3BCIA 5CNWA 3C1SA 5AN1A 1ZOFA 4OFMA 2YWIA 4LL4B 2DSAA 3ZIVA 2OE0A 2YN1A 5FT3A 2FD3A 1UVZA 2PGTA 1M7TA 4MMMA 4JBBA 1UA5A 1Z3EA 2FA4A 1OC9A 1SK0A 4ULXA 4PNGA 1VF1A 5D96A 4KSOA 3F6FA 4NHZA 3FRCA 4Q5NA 1EV4A 5KEJA 2CX3A 3DVWA 1VF4A 5ECNB 3DIEA 2H1GA 5D73A 1GSUA 4BA7A 3HZ8A 17GSA 1PRXA 4FYUA 4PXOA 3M0FA 4LA1A 4N11A 1T4ZA 4NAXA 1O8WA 5B6MA 5J5NA 4ILFA 3VWVA 5G5EA 4E8HA 2HSHA 3U6VA 6GSWA 1A8YA 4LMWA 3JCML 1DE2A 3P7XA 2RM5A 4EKZA 4TR4A 5IO0A 6GSTA 4O32A 3NOFA 1V98A 3HCZA 2F51A 4POBA 2PUKC 4CW9A 1I5GA 2LTKA 1XVQA 2NBSA 3RAZA 2VLUA 3GFKA 4I2UA 3IRAA 3GRXA 2WZ9A 4MF6A 1K3LA 3IV4A 5ECSA 1K0BA 1FOVA 1NHYA 2CAQA 2MMOA 1X5CA 5HR0A 3H93A 4OFNA 1YQ1A 3EWLA 2OBIA 2C0DA 1K3YA 2LS5A 3QOUA 1EEMA 3EVIA 1XIYA 2FLSA 1VF2A 2IMEA 2YP6A 1B48A 2HXKA 2R37A 3CYNA 2DJ2A 3BD2A 2H73A 2CQ9A 4TW5A 1QUWA 2FWGA 4FH8A 3J7Yk 3FZ4A 1ILOA 4XTSA 4MA9A 5F05A 2XPEA 2VCXA 2N5FA 2M46A 2G0FA 2A2RA 2IWTA 5LD0A 1YF0A 2FWEA 1NSWA 3IDVA 4NHWA 1U87A 4KW6A 1W4VA 3LXZA 5H5RA 2DIYA 3VWXA 5HFIA 2XBIA 4MPGA 5ECKB 2H1AA 3CTGA 3J7Yb 3LWAA 1XWCA 3IAS2 1X9WB 1YKCA 3H79A 5GAPD 3CTFA 3VK9A 2I1UA 3M9KA 1BX9A 2L4CA 3GL5A 3R2QA 1GUHA 3ZREA 4NV5A 4PX1A 3RHCA 5E59A 5EVOA 1N8JA 5B7CA 1DBYA 1U6TA 4O5RA 4G9HA 1ML6A 5KN0A 2MZCA 3RDWA 3A2VA 1TJDA 1SJZA 3DKSA 2XC2A 3F6DA 3IR4A 3C71A 4ZB6A 2BMXA 1ABAA 3LSZA 2DLXA 4K1FA 4EUYA 5HR1A 2JACA 4G2EA 1AC1A 4POLA 3DYRA 2K6VA 4K2DA 3G9BA 1QQ2A 2P5RA 2YZUA 2LUSA 2VM1A 3GV1A 2HRFA 4GSNA 2JSYA 2LSTA 1HNBA 4IJ3A 1GH2A 3ME8A 5KN3A 4WR4A 2O89A 1AQVA 5CREA 2HFDA 3A2XA 4JRRA 3LGCA 4PQIA 5AIXA 1MTCA 2MMAA 2KUCA 1EOHA 4OO4A 2H0GA 2IL3A 4G10A 3ZL5A 3VPQA 1TOFA 3TB2A 1YJ6A 5G31A 4EO3A 1XWKA 3ZZXA 2LQQA 1K0AA 1U3IA 1OC8A 1HNCA 5AGYA 1MD3A 2H0IA 2YJ7A 3QDNA 2JZSA 3ZVJA 4ACSA 2VAFA 4TOPA 4MLYA 4ZIJA 3M8NA 1EGOA 3DEXA 4GSTA 1XWGA 2XHFA 4L0UA 2C8UA 2FHEA 4IHUA 2X8CA 3HD5A 1GTBA 2WGRA 1RK4A 2IMKA 5CRGA 5ELGA 4ZB9A 1GL8A 2DBCA 8GSSA 5IMAA 1FVJA 3IK7A 3NZNA 1TRVA 3BJ5A 5GAND 3LORA 3KEBA 2CAIA 3KTLA 1M2AA 4ZBAA 3LQ7A 4XRAA 2GT6A 2CZ3A 1BG5A 2O85A 5DALB 3MDKA 4Q5QA 4AF2A 2REMA 3ZFBA 2B5XA 3ERGA 1CQHA 5DCGA 3VPTA 1GSSA 4TN8A 1AUCA 5C04A 3GL3A 4MP4A 3KTBA 2C3QA 2H30A 5D9TA 5GSTA 4OWYA 3UMAA 1XWAA 1B9YC 2GSQA 4TR3A 1OYJA 1GTIA 6GSSA 2J9HA 2KP1A 4ML1A 4EDYA 10GSA 3MNGA 1C72A 2C4JA 3TJBA 5FWGA 1TDIA 3QD9A 4HQZA 5ECHB 7GSSA 2K18A 3I69A 3EU4A 5JWQB 2K8SA 4K0NA 1SL1B 5D93A 2H6XA 1MDKA 4HQSA 5D9VA 4PUFC 3C1RA 3L9VA 2IPAA 3LYPA 5DALA 3FW2A 4DEJA 1ERUA 5IM9A 2B1KA 1H75A 2YWOA 5DDLA 3IPZA 1SYXA 4MJAA 4I97A 4V2NA 1QXHA 5GZZB 2VCQA 2B7JA 1SKWB 5ECOB 4EC0A 1X5DA 3H1NA 1AQWA 1I9DA 4O92A 5JCUA 1DUGA 3TKSE 2IFQB 1JFUA 2FGXA 2IJYA 4J2FA 1F6MC 4NV2A 2KOKA 2GVPA 1PGTA 2PN8A 4ECIA 2OA7A 1G7OA 3FHKA 3EU3A 1Q98A 2B5YA 3F4RA 2VUPA 2C3TA 1PA3A 5IIZA 1PSQA 1GTUA 5H5QA 1YZXA 3TJGA 1DE1A 3TCOA 5J9BA 4KA0A 1F2EA 1XFLA 1JZRA 4WBJA 3TKSC 1Z5YE 2BTOT 3FZ5A 1Q4JA 4G19A 4HUAA 2YWMA 4MZBA 1B4QA 1YF1A 3VLNA 3H8QA 5ELAA 2LKUA 4BVYA 3QAVA 1SD9A 3VWWA 2IFQA 2B3SA 5DJLA 22GSA 4PNFA 1SL0B 2OKAA 4TR1B 5EPFA 3GH6A 1TXXA 3GA4A 4J57E 1ON4A 4XS6A 3CRUA 4N30A 1E2YA 2YPMA 2RLIA 2E7PA 2JL4A 4QQ7A 1AW9A 3GTUB 1USBA 3GHAA 1WOUA 2WFCA 2ZNMA 2AJQB 1IYHA 3DWVA 3CBUA 3UBLA 3F9UA 3P2AA 4MK3A 1XXUA 3E3EA 4O7HA 2HE3A 1XW6A 3TGZA 1HD2A 4V2LA 1ZZYA 1Z7RA 1TRUA 4EL1A 5CAXA 3PR8A 1GNWA 3TKRA 2JZTA 4E8EA 5E4WA 2C0EA 2L5OA 1FG4A 3LYKA 2VLVA 2O8VB 1AXDA 4TR1A 3UL3A 3QAGA 5CP1A 4GQFA 4PQHA 3ED3A 2GQKA 1EP7A 4IQAA 4TXOA 3RHBA 1F3BA 3ZMKA 1PKWA 1X9MB 2K8VA 3UOMA 5HQPA 1A2JA 1T3BA 1O85A 1ST9A 1BAYA 1O7UA 1YEXA 1EEJA 1PX6A 2BJXA 3HJOA 4I6XA 1ZMAA 2F3MA 4POKA 1V2AA 2IN3A
chains in the Genus database with same CATH superfamily
1MDJA 2WULA 4F9ZA 3FZ9A 2HSYA 3WGDA 4K0GA 5ECLB 1R7HA 2RUEA 5G5FA 2LV3A 4V2MA 2C0FA 3LW9A 3EE2A 3KJYA 3Q6OA 4I8BA 2ON7A 1Y25A 4TKYA 4OO5A 3HYPA 4CHSA 3BCKA 1YKAA 3GKKA 3MIXA 3Q74A 4GTUA 3KM6A 3C73A 1PL2A 2OE1A 5CRWA 4AJ8A 1LU4A 2GZZA 1XVWA 3LG6A 2DIZA 1SJIA 3F4TA 5BMUA 2B1LA 4MF5A 2JSZA 2VCZA 1KEBA 2VOCA 4DSQA 4AJ7A 3HXSA 2L57A 2YOIA 1OE7A 5GSSA 4ZL8A 2GS3A 1EOGA 1PN0A 4F03A 2QSIA 1TTZA 4WF4A 3GKXA 2DJ0A 3DVXA 2C0GA 3QAWA 5LCZA 5DVBA 1K0OA 2LJAA 2N5AA 5COHA 4MDCA 2WDUA 4KUNA 3ZFLA 2FWHA 1V57A 3ERFA 2GGTA 2L59A 3O3TA 3KZQA 5ECMB 4JU5A 4IW9A 1Z7PA 3A5WA 1MEKA 3MWHA 2FA8A 3GSTA 4GCIA 4IN0A 4KH7A 1W89A 4EE0A 3FR3A 4K7IA 4IELA 1TRSA 4F0BA 2G2QA 2CVKA 4IKHA 4IS0A 2L6DA 3FYGA 2IMFA 3L4NA 2L4QA 2VLTA 3UVTA 2L6CA 2E0QA 1XZOA 5JWOB 2MBTA 5A5KA 1XW5A 1X0RA 3FR6A 4LMVA 1OE8A 1YEPA 4DSSB 2FNOA 1G6WA 1FB6A 3D22A 4V1Ap 1F9MA 1TW9A 4WXTA 1B4PA 3N5OA 3CXGA 2YJHA 2GTUA 3HVXA 2H01A 3M3MA 1OC3A 4GRFA 4HI7A 4BWSA 3CSIA 3QPMA 1EGRA 1PMTA 2YV7A 5JCGA 2WCIA 1S3CA 1ERTA 4POMA 2IMDA 5IMFA 5IQYA 5IOXA 1T7PB 4KNDA 3ME7A 3QFAC 1URMA 1G0TA 2LRTA 4KGIA 5IMDA 4KDYA 2CX4A 4ML6A 3FY7A 2GLRA 1TP9A 3I6AA 4OCFA 16GSA 3KGKA 2E2MA 2LQOA 2P5QA 2EIOA 1WE0A 2MYGA 1KBNA 3Q19A 5B8BA 5BRTA 1THOA 2H8LA 4XRDA 3IK9A 4DSSA 2VL2A 3UBKA 2DJ1A 2DC5A 2YANA 4BWQA 5G1LA 1PKZA 3US3A 3GNJA 3PGTA 2OE3A 1YDKA 2B6MA 1HYUA 4K6XA 3F0IA 2TRCP 5ECIB 3VI5A 2WRTA 1R26A 4K7NA 3FKFA 2GSTA 3QCPA 5ECQB 5LNKe 4EDZA 1U3AA 4X1UA 3D0ZA 3L9UA 2GSSA 2IIYA 5HR2A 4TVEA 1BEDA 4J56E 3VWUA 1RQMA 4NWYA 1R4WA 1XOBA 1SD8A 3TRXA 4DSRA 4DVCA 1K0MA 2RUFA 2CVBA 2C3NA 2CA8A 2LJKA 2KLXA 4K8MA 2F9SA 2EIQA 1EP8A 1THXA 2NDOA 4TXVA 3TKQA 3O6TA 1RW1A 1SENA 2H72A 2IMIA 3TJKA 4KCAA 3CSJA 3UJ1A 3DD3A 4HJMA 1XCCA 1TU7A 2VL3A 1QK8A 3W6GA 2H76A 4QL7A 5J9CA 2H1BA 2I3YA 1M99A 3KXOA 1Z6NA 1K0NA 1WP0A 5HFKA 2FY6A 3ZITA 3FEUA 5D9WA 2V41A 3KD0A 1TU8A 4MABA 1HQOA 1OKTA 3FZAA 3MAKA 2P0GA 1A23A 2HI7A 3S9FA 3DXBA 3GN3A 5DCHA 3LFLA 4XS1A 4WR5A 1SU9A 2CZ2A 1FVKA 3I9V2 4IBPA 3HA9A 3IBHA 2OADA 2GDRA 3D21A 5IOWA 4QL9A 1WMJA 3GYKA 5C00A 4PGTA 3GX8A 1ACVA 2R2JA 5ABRA 4KE3A 2VL9A 3TRQA 4MJCA 3L0HA 1JLVA 3WYWA 3CSHA 1JZDA 1EV9A 2L5LA 2VM2A 1A2MA 3C8EA 2C1YA 3TJJA 3D4MA 4KB3A 5IMZA 3UARA 2R6KA 4Q5FA 1O8XA 3IXRA 4FO5A 2DJKA 1A24A 2X99A 1VGLA 4XS4B 1WPIA 2I81A 4YH2A 4BL7B 1WJKA 4V1Ag 5JWRB 2HRAA 5DQSA 3HZ4A 3PH9A 2EC4A 1UC7A 4N0ZA 3ZLPA 5A4UA 2ALBA 1OKDA 5G2ZA 1GSYA 1S3DA 1ZGNA 4F0CA 2KP2A 3HKRA 3IHGA 4Q5RA 4JZQA 5KN2A 5H5SA 1GRXA 20GSA 3SBCA 3ISOA 1QGVA 3Q18A 4BPYA 2H6YA 2NPBA 3DGQA 2I4AA 3KH7A 4PURA 1SK2A 5L71A 4OFTA 2R5GA 1DSBA 2YV9A 2EIRA 1X5EA 2RM6A 2K9FA 2AV4A 3EMXA 1Y6EA 2X8HA 5A4WA 2HLSA 1A0FA 4HEA2 4GF0A 4AJ6A 3ZYWA 2VO4A 4KCEA 1ZL9A 4XS4A 2JADA 3TRPA 2MMNA 1F3AA 4BL7A 1M2DA 1TK8B 1M9AA 2C80A 1GUMA 3HDCA 2R4VA 4MZWA 2AAWA 1PL1A 2O87A 4IJIA 3PINA 1G7EA 1TK0B 13GSA 3ZVJD 3MSZA 2F8FA 2VD1A 1GSFA 1GUKA 4L8EA 5J41A 3KMOA 3MYDA 4GQCA 2B5EA 3CMIA 4EIPA 4YQVA 3TOTA 1TI1A 4IP6A 1JHBA 1JLWA 4K7OA 2GQMA 4HZ2A 2VL2C 1B8XA 3DMLA 4IQ1A 1LJRA 1BJXA 2X64A 1K0CA 4MPFA 1GP1A 4MH2A 1GNEA 4ID0A 4MNNA 4ZL9A 1CQGA 3L9SA 5F06A 1TKDB 2PMTA 3RBTA 4OD7A 2AHEA 3AY8A 3HVVA 3DRNA 1TRWA 3L78A 1A0RP 4AGSA 4RI6A 3N9JA 3GX0A 4FQUA 3OR5A 1NW2A 3HVSA 4FIWA 5AISA 4N10A 3TJFA 2HRKA 4ECCA 3RPNA 2DMLA 1ZYEA 3GTUA 1KTEA 2VCTA 4HZ4A 4MJEA 3GSSA 2HT9A 4XHMA 2NVLA 3K8NA 4HOJA 18GSA 1T00A 4ZBBA 4YQUA 2LRNA 4GLTA 4X43A 1SL2B 2PPTA 5CRDA 2MMZA 5JCWA 1H4OA 3EYTA 1M9BA 3GMFA 4EIQA 3HJPA 4GSSA 11GSA 5D9XA 3H4KA 4KDXA 4WEYA 3UAPA 2TRXA 4MH3A 4ZL7A 2H71A 1J08A 3ZRDA 2J23A 3IA1A 2A4HA 3LEFA 4PUAA 3APOA 3CRTA 2LRCA 2X8GA 4G0LA 2A2SA 2D2ZA 4PQ1A 1XW9A 3BBYA 4CY6A 4WKWA 1T8EB 1S3AA 1M0UA 1SYRA 3R3EA 1WIKA 6GSXA 5J4UA 3E0UA 2V2GA 2TIRA 3VURA 4L5OA 1QMVA 4HSCX 2DJ3A 4JEDA 5DQYA 3EMPA 4RQXA 1GSQA 4YAPA 2PVOC 3FK8A 4IP1A 4JE1A 2F8AA 3VI7A 4ZB8A 2LJRA 4P3YB 2ON5A 1Z6MA 1SKRB 1TI3A 1XBSA 3IC8A 4ZXGA 3WT1A 1XG8A 2LNTA 2H0HA 2H74A 3WGXA 3SWLA 4WBRD 2PU9C 3KCMA 2N5BA 1M3IA 1UN2A 2DJJA 4KX4A 1PX7A 2H6ZA 4FYCA 3BOAA 1N2AA 4ZILA 2UZ8A 5AIVA 1ZYPA 3M1GA 1KNGA 2XPDA 4MZCA 5CO3A 4F2IA 3IOSA 3KH9A 1OAZA 5B6NA 3GH9A 2Z9SA 3EC3A 5A4VA 2HYXA 4YAVA 4Z2UA 5DBQA 5J3RA 1XPVA 2GSRA 3EURA 1M2BA 4ICYA 1GULA 4WF5A 2PERA 3APSA 3P90A 1U88A 3A2WA 4YKFA 3KMNA 1HNAA 4L5LA 3TKSA 1E6BA 2VIMA 2ES7A 4NPBA 19GSA 4GXZA 4HS1A 2DMMA 2YWNA 4BIKA 1V40A 3V1WA 4Z7XA 1EZKA 3UVHA 1PN9A 3D5JA 2B7KA 6GSYA 2M80A 2V6OA 5KOWA 1IYIA 4ECBA 1NM3A 1J9BA 1ERWA 3KP8A 3KP9A 2H19A 2KHPA 4ECJA 2AB6A 2H1DA 2GQLA 3M9JA 3IHQA 1GSDA 1ZCPA 3TDGA 2H70A 5F07A 1AQXA 3O76A 1EWXA 1BYEA 3I43A 14GSA 2VCVA 2PBJA 3GKMA 1WRYA 4WETA 2I9HA 1B9XC 2DKIA 3KIJA 4JR6A 1J0FA 1GTAA 1GSEA 2ZCTA 2R3XA 2HZEB 1A8LA 2NTOA 1V58A 3U5RE 2A4VA 3IC4A 4USSA 4PTSA 4RQRA 4XIHA 3QMXA 3FR9A 5FHIA 4JR4A 3ERWA 3QFBC 2FWFA 3VFIA 3E9JB 5HFGA 1GLQA 2CT6A 5IMCA 4LL1B 4XCSA 5F8BA 3PPUA 4LLRA 4ZBDA 1F37A 1YY7A 2GZYA 4KSMA 2RIIA 2XBQA 1X9SB 5DAKB 4MCUA 5CYYA 3G7JA 2P31A 1GWCA 2H75A 2HSMA 3EINA 3G7YA 5IPGA 1LBKA 4ISDA 2QGVA 3APQA 3W8SA 3HJMA 2QC7A 2R0CA 3P8WA 2HNLA 2V6KA 4YQMA 1R5PA 2JU5A 5DJMA 1SKSB 4OCEA 4RI7A 2FUG2 3F3QA 2HZEA 5ID2B 5G1KA 1MD4A 2FCHA 1QFNA 4NXIA 12GSA 1AAZA 3WT2A 5IPHA 1R5AA 4RUVA 1O6JA 5HR3A 5CRHA 1BQ7A 3IE3A 3HY2A 4MF7A 2CV4A 4Z2RA 3FMWA 4FYBA 4K5RA 4HU7A 5EY6A 4EXJA 1O81A 3F3RA 3UEMA 3NIVA 1JZWA 3D6IA 2VD0A 5DAKA 3GURA 3TKPA 2M72A 2WS2A 1K0DA 4K2XA 1T1VA 2O7KA 5KOXA 1OVNA 2HZFA 1Z9HA 1O73A 4X0XA 4F82A 2OJLA 3ZTLA 3A3TA 2QKEA 1A2LA 1PQNA 4HDEA 2WB9A 5IMVA 3C7MA 5ID2A 1JZOA 4TRXA 2E2GA 2LNSA 3ZMLA 1SK1A 5G30A 4HJ2A 2V1MA 1FW1A 5KN1A 3LXTA 2PWJA 4BVXB 2DKHA 4N0VA 2HRNA 1MDIA 4EVMA 4IVFA 1AIUA 6GSUA 5EL8A 4GWRA 2AUVA 9GSSA 4KAEA 6GSVA 1T4YA 5IO2A 4L0WA 3UIWA 3F8UA 4K9ZA 4I2TA 3RPPA 3TOUA 4CDOA 5INYA 4D73B 2YZHA 1G6YA 2OACA 3W8JA 3ZIJA 3D4TA 2OBKA 3LJRA 2WJUA 3GUSA 2CVDA 4MJBA 2H66A 2JZRA 5D8IA 1FAAA 5ECPB 3G7IA 1GLPA 1FO5A 5ENUA 3CQFA 3GIXA 1WWJA 1TK5B 4BVXA 3HHVA 2ZUPA 4I5QA 2GZPA 4G0IA 5F0GA 1ERVA 1K3OA 2LEGA 1V9WA 3WGEA 3TUEA 1FHEA 1XWBA 2YCDA 1VRSD 2MBSA 2AYTA 1NHOA 5B8AA 1OC9B 4TR0A 4IGJA 4HU9A 4OMVA 1PD21 4H86A 3GKNA 4KDUA 4D73A 1VF3A 2PVQA 4TXOB 1SJ6A 4NMUA 3WD6A 2V32A 3F63A 1FB0A 3QR6A 2YNXA 3IAM2 2VCWA 1XOAA 2GT5A 5ECRB 4EF0A 3F4SA 1ZYQB 3BCIA 5CNWA 3C1SA 5AN1A 1ZOFA 4OFMA 2YWIA 4LL4B 2DSAA 3ZIVA 2OE0A 2YN1A 5FT3A 2FD3A 1UVZA 2PGTA 1M7TA 4MMMA 4JBBA 1FOHA 1UA5A 1Z3EA 2FA4A 1OC9A 1SK0A 4ULXA 4PNGA 1VF1A 5D96A 4KSOA 3F6FA 4NHZA 3FRCA 4Q5NA 1EV4A 5KEJA 2CX3A 3DVWA 1VF4A 5ECNB 3DIEA 2H1GA 5D73A 1GSUA 4BA7A 3HZ8A 17GSA 1PRXA 4FYUA 4PXOA 3M0FA 4LA1A 4N11A 1T4ZA 4NAXA 1O8WA 5B6MA 5J5NA 4ILFA 3VWVA 5G5EA 4E8HA 2HSHA 3U6VA 6GSWA 1A8YA 4LMWA 3JCML 1DE2A 3P7XA 2RM5A 4EKZA 4TR4A 5IO0A 6GSTA 4O32A 3NOFA 1V98A 3HCZA 2F51A 4POBA 2PUKC 4CW9A 1I5GA 2LTKA 1XVQA 2NBSA 4O5QA 3RAZA 2VLUA 3GFKA 4I2UA 3IRAA 3GRXA 3EPTA 2WZ9A 4MF6A 1K3LA 3IV4A 5ECSA 1K0BA 1FOVA 1NHYA 2CAQA 2MMOA 1X5CA 5HR0A 3H93A 4OFNA 1YQ1A 1PFOA 3EWLA 2OBIA 2C0DA 1K3YA 2LS5A 3QOUA 1EEMA 3EVIA 1XIYA 2FLSA 1VF2A 2IMEA 2YP6A 1B48A 2HXKA 2R37A 3CYNA 2DJ2A 3BD2A 2H73A 2CQ9A 4TW5A 1QUWA 2FWGA 4FH8A 3J7Yk 3FZ4A 1ILOA 4XTSA 2X49A 4MA9A 5F05A 2XPEA 2VCXA 2N5FA 2M46A 2G0FA 2A2RA 2R0GA 2IWTA 5LD0A 3HVNA 1YF0A 2FWEA 1NSWA 3IDVA 4NHWA 1U87A 4KW6A 1W4VA 3LXZA 1ZYNA 4X4JA 5H5RA 2DIYA 3VWXA 5HFIA 2XBIA 4MPGA 5ECKB 2H1AA 3CTGA 3J7Yb 3LWAA 1XWCA 3IAS2 1X9WB 1YKCA 3H79A 5GAPD 3CTFA 3VK9A 2I1UA 3M9KA 1BX9A 2L4CA 3GL5A 4YKGA 3R2QA 1GUHA 3ZREA 4NV5A 4PX1A 3RHCA 5E59A 5EVOA 1N8JA 5B7CA 1DBYA 1U6TA 4O5RA 4G9HA 1ML6A 5KN0A 2MZCA 3RDWA 3A2VA 1TJDA 1SJZA 3DKSA 4Z2TA 2XC2A 3F6DA 3IR4A 3C71A 4ZB6A 4G0KA 2BMXA 1ABAA 3LSZA 2DLXA 4K1FA 4EUYA 5HR1A 2JACA 4G2EA 1AC1A 4POLA 4K5SA 3DYRA 2K6VA 4K2DA 3G9BA 1QQ2A 2P5RA 2YZUA 2LUSA 2VM1A 3GV1A 4A5PA 2HRFA 4GSNA 2JSYA 2LSTA 1HNBA 4IJ3A 1GH2A 3ME8A 5KN3A 4WR4A 2O89A 1AQVA 5CREA 2HFDA 3A2XA 4JRRA 3LGCA 4PQIA 5AIXA 1MTCA 2MMAA 2KUCA 1EOHA 4OO4A 2H0GA 2IL3A 4G10A 3ZL5A 3VPQA 1TOFA 3TB2A 1YJ6A 5G31A 4EO3A 1XWKA 3ZZXA 2LQQA 1K0AA 1U3IA 1OC8A 4O5UA 1HNCA 5AGYA 1MD3A 2H0IA 2YJ7A 3QDNA 2JZSA 3ZVJA 4ACSA 2VAFA 4TOPA 4MLYA 4ZIJA 3M8NA 1EGOA 3DEXA 4GSTA 1XWGA 2XHFA 4L0UA 2C8UA 2FHEA 4IHUA 2X8CA 3HD5A 1GTBA 2WGRA 1RK4A 2IMKA 5CRGA 5ELGA 4ZB9A 1GL8A 2DBCA 8GSSA 5IMAA 1FVJA 3IK7A 3NZNA 1TRVA 3BJ5A 5GAND 3LORA 3KEBA 2CAIA 3KTLA 1M2AA 4ZBAA 3LQ7A 4XRAA 2GT6A 2CZ3A 1BG5A 2O85A 5DALB 2A2PA 3MDKA 4CY8A 4Q5QA 4AF2A 2REMA 2R0PA 3ZFBA 2B5XA 3ERGA 3A5IA 1CQHA 5DCGA 3VPTA 1GSSA 4TN8A 1AUCA 5C04A 3GL3A 4MP4A 3KTBA 2C3QA 2H30A 5D9TA 5GSTA 4OWYA 3UMAA 1XWAA 1B9YC 2GSQA 4TR3A 1OYJA 1GTIA 6GSSA 2J9HA 2KP1A 4ML1A 4EDYA 10GSA 3MNGA 1C72A 2C4JA 3TJBA 5FWGA 1TDIA 3QD9A 4HQZA 5ECHB 7GSSA 2K18A 3I69A 3EU4A 5JWQB 2K8SA 4K0NA 1SL1B 5D93A 2H6XA 1MDKA 4HQSA 5D9VA 4PUFC 3C1RA 3L9VA 2IPAA 3LYPA 5DALA 3FW2A 4DEJA 1ERUA 5IM9A 2B1KA 1H75A 2YWOA 5DDLA 3IPZA 1SYXA 4MJAA 4I97A 4V2NA 1QXHA 5GZZB 2VCQA 2B7JA 1SKWB 5ECOB 4EC0A 1X5DA 3H1NA 1AQWA 1I9DA 4O92A 5JCUA 4BVYB 1DUGA 3TKSE 2IFQB 1JFUA 2FGXA 2IJYA 4J2FA 1F6MC 4NV2A 2KOKA 2GVPA 1PGTA 2PN8A 4ECIA 2OA7A 1G7OA 3FHKA 3EU3A 1Q98A 2B5YA 3F4RA 2VUPA 2C3TA 1PA3A 5IIZA 1PSQA 1GTUA 5H5QA 1YZXA 3TJGA 1DE1A 3TCOA 5J9BA 4KA0A 1F2EA 1XFLA 1JZRA 4WBJA 3TKSC 1Z5YE 2BTOT 3FZ5A 1Q4JA 4G19A 4HUAA 2YWMA 4MZBA 1B4QA 1YF1A 3VLNA 3H8QA 5ELAA 2LKUA 4BVYA 1S3RA 3QAVA 1SD9A 3VWWA 2IFQA 2B3SA 5DJLA 22GSA 4PNFA 1SL0B 2OKAA 4TR1B 5EPFA 3GH6A 1TXXA 3GA4A 4J57E 1ON4A 2QA1A 4XS6A 3CRUA 4N30A 1E2YA 2QA2A 2YPMA 2RLIA 2E7PA 2JL4A 4QQ7A 1AW9A 3GTUB 1USBA 3GHAA 1WOUA 2WFCA 2ZNMA 2AJQB 1IYHA 3DWVA 3CBUA 3UBLA 3F9UA 3P2AA 4MK3A 1XXUA 3E3EA 4O7HA 2HE3A 1XW6A 3TGZA 1HD2A 4V2LA 1ZZYA 1Z7RA 1TRUA 4EL1A 5CAXA 3PR8A 1GNWA 1M3JA 3TKRA 2JZTA 4E8EA 5E4WA 2C0EA 2L5OA 1FG4A 3LYKA 2VLVA 2O8VB 1AXDA 4TR1A 4KF9A 3UL3A 3QAGA 5CP1A 4GQFA 4PQHA 3ED3A 2GQKA 1EP7A 4IQAA 4TXOA 2X4AA 3RHBA 1F3BA 3ZMKA 1PKWA 1X9MB 2K8VA 3UOMA 5HQPA 1A2JA 1T3BA 1O85A 1ST9A 1BAYA 1O7UA 1YEXA 1EEJA 1PX6A 2BJXA 3HJOA 4I6XA 1ZMAA 2F3MA 4POKA 1V2AA 2IN3A
chains in the Genus database with same CATH topology
1MDJA 2WULA 4F9ZA 3FZ9A 2HSYA 3WGDA 4K0GA 5ECLB 1R7HA 2RUEA 5G5FA 2LV3A 4V2MA 2C0FA 3LW9A 3EE2A 3KJYA 3Q6OA 4I8BA 2ON7A 1Y25A 4TKYA 4OO5A 3HYPA 4CHSA 3BCKA 1YKAA 3GKKA 3MIXA 3Q74A 4GTUA 3KM6A 3C73A 1PL2A 2OE1A 5CRWA 4AJ8A 1LU4A 2GZZA 1XVWA 3LG6A 2DIZA 1SJIA 3F4TA 5BMUA 2B1LA 4MF5A 2JSZA 2VCZA 1KEBA 2VOCA 4DSQA 4AJ7A 3HXSA 2L57A 2YOIA 1OE7A 5GSSA 4ZL8A 2GS3A 1EOGA 1PN0A 4F03A 2QSIA 1TTZA 4WF4A 3GKXA 2DJ0A 3DVXA 2C0GA 3QAWA 5LCZA 5DVBA 1K0OA 2LJAA 2N5AA 5COHA 4MDCA 2WDUA 4KUNA 3ZFLA 2FWHA 1V57A 3ERFA 2GGTA 2L59A 3O3TA 3KZQA 5ECMB 4JU5A 4IW9A 1Z7PA 3A5WA 1MEKA 3MWHA 2FA8A 3GSTA 4GCIA 4IN0A 4KH7A 1W89A 4EE0A 3FR3A 4K7IA 4IELA 1TRSA 4F0BA 2G2QA 2CVKA 4IKHA 4IS0A 2L6DA 3FYGA 2IMFA 3L4NA 2L4QA 2VLTA 3UVTA 2L6CA 2E0QA 1XZOA 5JWOB 2MBTA 5A5KA 1XW5A 1X0RA 3FR6A 4LMVA 1OE8A 1YEPA 4DSSB 2FNOA 1G6WA 1FB6A 3D22A 4V1Ap 1F9MA 1TW9A 4WXTA 1B4PA 3N5OA 3CXGA 2YJHA 2GTUA 3HVXA 2H01A 3M3MA 1OC3A 4GRFA 4HI7A 4BWSA 3CSIA 3QPMA 1EGRA 1PMTA 2YV7A 5JCGA 2WCIA 1S3CA 1ERTA 4POMA 2IMDA 5IMFA 5IQYA 5IOXA 1T7PB 4KNDA 3ME7A 3QFAC 1URMA 1G0TA 2LRTA 4KGIA 5IMDA 4KDYA 2CX4A 4ML6A 3FY7A 2GLRA 1TP9A 3I6AA 4OCFA 16GSA 3KGKA 2E2MA 2LQOA 2P5QA 2EIOA 1WE0A 2MYGA 1KBNA 3Q19A 5B8BA 5BRTA 1THOA 2H8LA 4XRDA 3IK9A 4DSSA 2VL2A 3UBKA 2DJ1A 2DC5A 2YANA 4BWQA 5G1LA 1PKZA 3US3A 3GNJA 3PGTA 2OE3A 1YDKA 2B6MA 1HYUA 4K6XA 3F0IA 2TRCP 5ECIB 3VI5A 2WRTA 1R26A 4K7NA 3FKFA 2GSTA 3QCPA 5ECQB 5LNKe 4EDZA 1U3AA 4X1UA 3D0ZA 3L9UA 2GSSA 2IIYA 5HR2A 4TVEA 1BEDA 4J56E 3VWUA 1RQMA 4NWYA 1R4WA 1XOBA 1SD8A 3TRXA 4DSRA 4DVCA 1K0MA 2RUFA 2CVBA 2C3NA 2CA8A 2LJKA 2KLXA 4K8MA 2F9SA 2EIQA 1EP8A 1THXA 2NDOA 4TXVA 3TKQA 3O6TA 1RW1A 1SENA 2H72A 2IMIA 3TJKA 4KCAA 3CSJA 3UJ1A 3DD3A 4HJMA 1XCCA 1TU7A 2VL3A 1QK8A 3W6GA 2H76A 4QL7A 5J9CA 2H1BA 2I3YA 1M99A 3KXOA 1Z6NA 1K0NA 1WP0A 5HFKA 2FY6A 3ZITA 3FEUA 5D9WA 2V41A 3KD0A 1TU8A 4MABA 1HQOA 1OKTA 3FZAA 3MAKA 2P0GA 1A23A 2HI7A 3S9FA 3DXBA 3GN3A 5DCHA 3LFLA 4XS1A 4WR5A 1SU9A 2CZ2A 1FVKA 3I9V2 4IBPA 3HA9A 3IBHA 2OADA 2GDRA 3D21A 5IOWA 4QL9A 1WMJA 3GYKA 5C00A 4PGTA 3GX8A 1ACVA 2R2JA 5ABRA 4KE3A 2VL9A 3TRQA 4MJCA 3L0HA 1JLVA 3WYWA 3CSHA 1JZDA 1EV9A 2L5LA 2VM2A 1A2MA 3C8EA 2C1YA 3TJJA 3D4MA 4KB3A 5IMZA 3UARA 2R6KA 4Q5FA 1O8XA 3IXRA 4FO5A 2DJKA 1A24A 2X99A 1VGLA 4XS4B 1WPIA 2I81A 4YH2A 4BL7B 1WJKA 4V1Ag 5JWRB 2HRAA 5DQSA 3HZ4A 3PH9A 2EC4A 1UC7A 4N0ZA 3ZLPA 5A4UA 2ALBA 1OKDA 5G2ZA 1GSYA 1S3DA 1ZGNA 4F0CA 2KP2A 3HKRA 3IHGA 4Q5RA 4JZQA 5KN2A 5H5SA 1GRXA 20GSA 3SBCA 3ISOA 1QGVA 3Q18A 4BPYA 2H6YA 2NPBA 3DGQA 2I4AA 3KH7A 4PURA 1SK2A 5L71A 4OFTA 2R5GA 1DSBA 2YV9A 2EIRA 1X5EA 2RM6A 2K9FA 2AV4A 3EMXA 1Y6EA 2X8HA 5A4WA 2HLSA 1A0FA 4HEA2 4GF0A 4AJ6A 3ZYWA 2VO4A 4KCEA 1ZL9A 4XS4A 2JADA 3TRPA 2MMNA 1F3AA 4BL7A 1M2DA 1TK8B 1M9AA 2C80A 1GUMA 3HDCA 2R4VA 4MZWA 2AAWA 1PL1A 2O87A 4IJIA 3PINA 1G7EA 1TK0B 13GSA 3ZVJD 3MSZA 2F8FA 2VD1A 1GSFA 1GUKA 4L8EA 5J41A 3KMOA 3MYDA 4GQCA 2B5EA 3CMIA 4EIPA 4YQVA 3TOTA 1TI1A 4IP6A 1JHBA 1JLWA 4K7OA 2GQMA 4HZ2A 2VL2C 1B8XA 3DMLA 4IQ1A 1LJRA 1BJXA 2X64A 1K0CA 4MPFA 1GP1A 4MH2A 1GNEA 4ID0A 4MNNA 4ZL9A 1CQGA 3L9SA 5F06A 1TKDB 2PMTA 3RBTA 4OD7A 2AHEA 3AY8A 3HVVA 3DRNA 1TRWA 3L78A 1A0RP 4AGSA 4RI6A 3N9JA 3GX0A 4FQUA 3OR5A 1NW2A 3HVSA 4FIWA 5AISA 4N10A 3TJFA 2HRKA 4ECCA 3RPNA 2DMLA 1ZYEA 3GTUA 1KTEA 2VCTA 4HZ4A 4MJEA 3GSSA 2HT9A 4XHMA 2NVLA 3K8NA 4HOJA 18GSA 1T00A 4ZBBA 4YQUA 2LRNA 4GLTA 4X43A 1SL2B 2PPTA 5CRDA 2MMZA 5JCWA 1H4OA 3EYTA 1M9BA 3GMFA 4EIQA 3HJPA 4GSSA 11GSA 5D9XA 3H4KA 4KDXA 4WEYA 3UAPA 2TRXA 4MH3A 4ZL7A 2H71A 1J08A 3ZRDA 2J23A 3IA1A 2A4HA 3LEFA 4PUAA 3APOA 3CRTA 2LRCA 2X8GA 4G0LA 2A2SA 2D2ZA 4PQ1A 1XW9A 3BBYA 4CY6A 4WKWA 1T8EB 1S3AA 1M0UA 1SYRA 3R3EA 1WIKA 6GSXA 5J4UA 3E0UA 2V2GA 2TIRA 3VURA 4L5OA 1QMVA 2DJ3A 4JEDA 5DQYA 3EMPA 4RQXA 1GSQA 4YAPA 2PVOC 3FK8A 4IP1A 4JE1A 2F8AA 3VI7A 4ZB8A 2LJRA 4P3YB 2ON5A 1Z6MA 1SKRB 1TI3A 1XBSA 3IC8A 4ZXGA 3WT1A 2LNTA 2H0HA 2H74A 3WGXA 3SWLA 4WBRD 2PU9C 3KCMA 2N5BA 1UN2A 2DJJA 4KX4A 1PX7A 2H6ZA 4FYCA 3BOAA 1N2AA 4ZILA 2UZ8A 5AIVA 1ZYPA 3M1GA 1KNGA 2XPDA 4MZCA 5CO3A 4F2IA 3IOSA 3KH9A 1OAZA 5B6NA 3GH9A 2Z9SA 3EC3A 5A4VA 2HYXA 4YAVA 4Z2UA 5DBQA 5J3RA 1XPVA 2GSRA 3EURA 1M2BA 4ICYA 1GULA 4WF5A 2PERA 3APSA 3P90A 1U88A 3A2WA 4YKFA 3KMNA 1HNAA 4L5LA 3TKSA 1E6BA 2VIMA 2ES7A 4NPBA 19GSA 4GXZA 4HS1A 2DMMA 2YWNA 1V40A 3V1WA 4Z7XA 1EZKA 3UVHA 1PN9A 3D5JA 2B7KA 6GSYA 2M80A 2V6OA 5KOWA 1IYIA 4ECBA 1NM3A 1J9BA 1ERWA 3KP8A 3KP9A 2H19A 2KHPA 4ECJA 2AB6A 2H1DA 2GQLA 3M9JA 3IHQA 1GSDA 1ZCPA 3TDGA 2H70A 5F07A 1AQXA 3O76A 1EWXA 1BYEA 3I43A 14GSA 2VCVA 2PBJA 3GKMA 1WRYA 4WETA 2I9HA 1B9XC 2DKIA 3KIJA 4JR6A 1J0FA 1GTAA 1GSEA 2ZCTA 2R3XA 2HZEB 1A8LA 2NTOA 1V58A 3U5RE 2A4VA 3IC4A 4USSA 4PTSA 4RQRA 4XIHA 3QMXA 3FR9A 5FHIA 4JR4A 3ERWA 3QFBC 2FWFA 3VFIA 3E9JB 5HFGA 1GLQA 2CT6A 5IMCA 4LL1B 4XCSA 5F8BA 3PPUA 4LLRA 4ZBDA 1F37A 1YY7A 2GZYA 4KSMA 2RIIA 2XBQA 1X9SB 5DAKB 4MCUA 5CYYA 3G7JA 2P31A 1GWCA 2H75A 2HSMA 3EINA 3G7YA 5IPGA 1LBKA 4ISDA 2QGVA 3APQA 3W8SA 3HJMA 2QC7A 2R0CA 3P8WA 2HNLA 2V6KA 4YQMA 1R5PA 2JU5A 5DJMA 1SKSB 4OCEA 4RI7A 2FUG2 3F3QA 2HZEA 5ID2B 5G1KA 1MD4A 2FCHA 1QFNA 4NXIA 12GSA 1AAZA 3WT2A 5IPHA 1R5AA 4RUVA 1O6JA 5HR3A 5CRHA 1BQ7A 3IE3A 3HY2A 4MF7A 2CV4A 4Z2RA 3FMWA 4FYBA 4K5RA 4HU7A 5EY6A 4EXJA 1O81A 3F3RA 3UEMA 3NIVA 1JZWA 3D6IA 2VD0A 5DAKA 3GURA 3TKPA 2M72A 2WS2A 1K0DA 4K2XA 1T1VA 2O7KA 5KOXA 1OVNA 2HZFA 1Z9HA 1O73A 4X0XA 4F82A 2OJLA 3ZTLA 3A3TA 2QKEA 1A2LA 1PQNA 4HDEA 2WB9A 5IMVA 3C7MA 5ID2A 1JZOA 4TRXA 2E2GA 2LNSA 3ZMLA 1SK1A 5G30A 4HJ2A 2V1MA 1FW1A 5KN1A 3LXTA 2PWJA 4BVXB 2DKHA 4N0VA 2HRNA 1MDIA 4EVMA 4IVFA 1AIUA 6GSUA 5EL8A 4GWRA 2AUVA 9GSSA 4KAEA 6GSVA 1T4YA 5IO2A 4L0WA 3UIWA 3F8UA 4K9ZA 4I2TA 3RPPA 3TOUA 4CDOA 5INYA 4D73B 2YZHA 1G6YA 2OACA 3W8JA 3ZIJA 3D4TA 2OBKA 3LJRA 2WJUA 3GUSA 2CVDA 4MJBA 2H66A 2JZRA 5D8IA 1FAAA 5ECPB 3G7IA 1GLPA 1FO5A 5ENUA 3GIXA 1WWJA 1TK5B 4BVXA 3HHVA 2ZUPA 4I5QA 2GZPA 4G0IA 5F0GA 1ERVA 1K3OA 2LEGA 1V9WA 3WGEA 3TUEA 1FHEA 1XWBA 2YCDA 1VRSD 2MBSA 2AYTA 1NHOA 5B8AA 1OC9B 4TR0A 4IGJA 4HU9A 4OMVA 1PD21 4H86A 3GKNA 4KDUA 4D73A 1VF3A 2PVQA 4TXOB 1SJ6A 4NMUA 3WD6A 2V32A 3F63A 1FB0A 3QR6A 2YNXA 3IAM2 2VCWA 1XOAA 2GT5A 5ECRB 4EF0A 3F4SA 1ZYQB 3BCIA 5CNWA 3C1SA 5AN1A 1ZOFA 4OFMA 2YWIA 4LL4B 2DSAA 3ZIVA 2OE0A 2YN1A 5FT3A 2FD3A 1UVZA 2PGTA 1M7TA 4MMMA 4JBBA 1FOHA 1UA5A 1Z3EA 2FA4A 1OC9A 1SK0A 4ULXA 4PNGA 1VF1A 5D96A 4KSOA 3F6FA 4NHZA 3FRCA 4Q5NA 1EV4A 5KEJA 2CX3A 3DVWA 1VF4A 5ECNB 3DIEA 2H1GA 5D73A 1GSUA 4BA7A 3HZ8A 17GSA 1PRXA 4FYUA 4PXOA 3M0FA 4LA1A 4N11A 1T4ZA 4NAXA 1O8WA 5B6MA 5J5NA 4ILFA 3VWVA 5G5EA 4E8HA 2HSHA 3U6VA 6GSWA 1A8YA 4LMWA 3JCML 1DE2A 3P7XA 2RM5A 4EKZA 4TR4A 5IO0A 6GSTA 4O32A 3NOFA 1V98A 3HCZA 2F51A 4POBA 2PUKC 4CW9A 1I5GA 2LTKA 1XVQA 2NBSA 4O5QA 3RAZA 2VLUA 3GFKA 4I2UA 3IRAA 3GRXA 3EPTA 2WZ9A 4MF6A 1K3LA 3IV4A 5ECSA 1K0BA 1FOVA 1NHYA 2CAQA 2MMOA 1X5CA 5HR0A 3H93A 4OFNA 1YQ1A 3EWLA 2OBIA 2C0DA 1K3YA 2LS5A 3QOUA 1EEMA 3EVIA 1XIYA 2FLSA 1VF2A 2IMEA 2YP6A 1B48A 2HXKA 2R37A 3CYNA 2DJ2A 3BD2A 2H73A 2CQ9A 4TW5A 1QUWA 2FWGA 4FH8A 3J7Yk 3FZ4A 1ILOA 4XTSA 2X49A 4MA9A 5F05A 2XPEA 2VCXA 2N5FA 2M46A 2G0FA 2A2RA 2R0GA 2IWTA 5LD0A 1YF0A 2FWEA 1NSWA 3IDVA 4NHWA 1U87A 4KW6A 1W4VA 3LXZA 1ZYNA 4X4JA 5H5RA 2DIYA 3VWXA 5HFIA 2XBIA 4MPGA 5ECKB 2H1AA 3CTGA 3J7Yb 3LWAA 1XWCA 3IAS2 1X9WB 1YKCA 3H79A 5GAPD 3CTFA 3VK9A 2I1UA 3M9KA 1BX9A 2L4CA 3GL5A 4YKGA 3R2QA 1GUHA 3ZREA 4NV5A 4PX1A 3RHCA 5E59A 5EVOA 1N8JA 5B7CA 1DBYA 1U6TA 4O5RA 4G9HA 1ML6A 5KN0A 2MZCA 3RDWA 3A2VA 1TJDA 1SJZA 3DKSA 4Z2TA 2XC2A 3F6DA 3IR4A 3C71A 4ZB6A 4G0KA 2BMXA 1ABAA 3LSZA 2DLXA 4K1FA 4EUYA 5HR1A 2JACA 4G2EA 1AC1A 4POLA 4K5SA 3DYRA 2K6VA 4K2DA 3G9BA 1QQ2A 2P5RA 2YZUA 2LUSA 2VM1A 3GV1A 4A5PA 2HRFA 4GSNA 2JSYA 2LSTA 1HNBA 4IJ3A 1GH2A 3ME8A 5KN3A 4WR4A 2O89A 1AQVA 5CREA 2HFDA 3A2XA 4JRRA 3LGCA 4PQIA 5AIXA 1MTCA 2MMAA 2KUCA 1EOHA 4OO4A 2H0GA 2IL3A 4G10A 3ZL5A 3VPQA 1TOFA 3TB2A 1YJ6A 5G31A 4EO3A 1XWKA 3ZZXA 2LQQA 1K0AA 1U3IA 1OC8A 4O5UA 1HNCA 5AGYA 1MD3A 2H0IA 2YJ7A 3QDNA 2JZSA 3ZVJA 4ACSA 2VAFA 4TOPA 4MLYA 4ZIJA 3M8NA 1EGOA 3DEXA 4GSTA 1XWGA 2XHFA 4L0UA 2C8UA 2FHEA 4IHUA 2X8CA 3HD5A 1GTBA 2WGRA 1RK4A 2IMKA 5CRGA 5ELGA 4ZB9A 1GL8A 2DBCA 8GSSA 5IMAA 1FVJA 3IK7A 3NZNA 1TRVA 3BJ5A 5GAND 3LORA 3KEBA 2CAIA 3KTLA 1M2AA 4ZBAA 3LQ7A 4XRAA 2GT6A 2CZ3A 1BG5A 2O85A 5DALB 2A2PA 3MDKA 4CY8A 4Q5QA 4AF2A 2REMA 2R0PA 3ZFBA 2B5XA 3ERGA 3A5IA 1CQHA 5DCGA 3VPTA 1GSSA 4TN8A 1AUCA 5C04A 3GL3A 4MP4A 3KTBA 2C3QA 2H30A 5D9TA 5GSTA 4OWYA 3UMAA 1XWAA 1B9YC 2GSQA 4TR3A 1OYJA 1GTIA 6GSSA 2J9HA 2KP1A 4ML1A 4EDYA 10GSA 3MNGA 1C72A 2C4JA 3TJBA 5FWGA 1TDIA 3QD9A 4HQZA 5ECHB 7GSSA 2K18A 3I69A 3EU4A 5JWQB 2K8SA 4K0NA 1SL1B 5D93A 2H6XA 1MDKA 4HQSA 5D9VA 4PUFC 3C1RA 3L9VA 2IPAA 3LYPA 5DALA 3FW2A 4DEJA 1ERUA 5IM9A 2B1KA 1H75A 2YWOA 5DDLA 3IPZA 1SYXA 4MJAA 4I97A 4V2NA 1QXHA 5GZZB 2VCQA 2B7JA 1SKWB 5ECOB 4EC0A 1X5DA 3H1NA 1AQWA 1I9DA 4O92A 5JCUA 4BVYB 1DUGA 3TKSE 2IFQB 1JFUA 2FGXA 2IJYA 4J2FA 1F6MC 4NV2A 2KOKA 2GVPA 1PGTA 2PN8A 4ECIA 2OA7A 1G7OA 3FHKA 3EU3A 1Q98A 2B5YA 3F4RA 2VUPA 2C3TA 1PA3A 5IIZA 1PSQA 1GTUA 5H5QA 1YZXA 3TJGA 1DE1A 3TCOA 5J9BA 4KA0A 1F2EA 1XFLA 1JZRA 4WBJA 3TKSC 1Z5YE 2BTOT 3FZ5A 1Q4JA 4G19A 4HUAA 2YWMA 4MZBA 1B4QA 1YF1A 3VLNA 3H8QA 5ELAA 2LKUA 4BVYA 3QAVA 1SD9A 3VWWA 2IFQA 2B3SA 5DJLA 22GSA 4PNFA 1SL0B 2OKAA 4TR1B 5EPFA 3GH6A 1TXXA 3GA4A 4J57E 1ON4A 2QA1A 4XS6A 3CRUA 4N30A 1E2YA 2QA2A 2YPMA 2RLIA 2E7PA 2JL4A 4QQ7A 1AW9A 3GTUB 1USBA 3GHAA 1WOUA 2WFCA 2ZNMA 2AJQB 1IYHA 3DWVA 3CBUA 3UBLA 3F9UA 3P2AA 4MK3A 1XXUA 3E3EA 4O7HA 2HE3A 1XW6A 3TGZA 1HD2A 4V2LA 1ZZYA 1Z7RA 1TRUA 4EL1A 5CAXA 3PR8A 1GNWA 3TKRA 2JZTA 4E8EA 5E4WA 2C0EA 2L5OA 1FG4A 3LYKA 2VLVA 2O8VB 1AXDA 4TR1A 4KF9A 3UL3A 3QAGA 5CP1A 4GQFA 4PQHA 3ED3A 2GQKA 1EP7A 4IQAA 4TXOA 2X4AA 3RHBA 1F3BA 3ZMKA 1PKWA 1X9MB 2K8VA 3UOMA 5HQPA 1A2JA 1T3BA 1O85A 1ST9A 1BAYA 1O7UA 1YEXA 1EEJA 1PX6A 2BJXA 3HJOA 4I6XA 1ZMAA 2F3MA 4POKA 1V2AA 2IN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDJ A;  2WUL A;  4F9Z A;  3FZ9 A;  2HSY A;  3WGD A;  4K0G A;  5ECL B;  1R7H A;  2RUE A;  5G5F A;  2LV3 A;  4V2M A;  2C0F A;  3EE2 A;  3KJY A;  3Q6O A;  4I8B A;  2ON7 A;  1Y25 A;  4TKY A;  4OO5 A;  3HYP A;  4CHS A;  3BCK A;  1YKA A;  3GKK A;  3Q74 A;  4GTU A;  3KM6 A;  3C73 A;  1PL2 A;  2OE1 A;  5CRW A;  4AJ8 A;  1LU4 A;  2GZZ A;  1XVW A;  3LG6 A;  2DIZ A;  1SJI A;  3F4T A;  2B1L A;  4MF5 A;  2JSZ A;  2VCZ A;  1KEB A;  2VOC A;  4DSQ A;  4AJ7 A;  3HXS A;  2L57 A;  2YOI A;  1OE7 A;  5GSS A;  4ZL8 A;  2GS3 A;  1EOG A;  4F03 A;  2QSI A;  1TTZ A;  4WF4 A;  3GKX A;  2DJ0 A;  3DVX A;  2C0G A;  3QAW A;  5LCZ A;  5DVB A;  1K0O A;  2LJA A;  2N5A A;  5COH A;  4MDC A;  2WDU A;  4KUN A;  3ZFL A;  2FWH A;  1V57 A;  3ERF A;  2GGT A;  2L59 A;  3O3T A;  3KZQ A;  5ECM B;  4JU5 A;  4IW9 A;  1Z7P A;  3A5W A;  1MEK A;  3MWH A;  2FA8 A;  3GST A;  4GCI A;  4IN0 A;  4KH7 A;  1W89 A;  4EE0 A;  3FR3 A;  4K7I A;  4IEL A;  1TRS A;  4F0B A;  2G2Q A;  2CVK A;  4IKH A;  4IS0 A;  2L6D A;  3FYG A;  2IMF A;  3L4N A;  2L4Q A;  2VLT A;  3UVT A;  2L6C A;  2E0Q A;  1XZO A;  5JWO B;  2MBT A;  5A5K A;  1XW5 A;  1X0R A;  3FR6 A;  4LMV A;  1OE8 A;  1YEP A;  4DSS B;  2FNO A;  1G6W A;  1FB6 A;  3D22 A;  4V1A p;  1F9M A;  1TW9 A;  4WXT A;  1B4P A;  3N5O A;  3CXG A;  2YJH A;  2GTU A;  3HVX A;  2H01 A;  3M3M A;  1OC3 A;  4GRF A;  4HI7 A;  4BWS A;  3CSI A;  3QPM A;  1EGR A;  1PMT A;  2YV7 A;  5JCG A;  2WCI A;  1S3C A;  1ERT A;  4POM A;  2IMD A;  5IMF A;  5IQY A;  5IOX A;  1T7P B;  4KND A;  3ME7 A;  3QFA C;  1URM A;  1G0T A;  2LRT A;  4KGI A;  5IMD A;  4KDY A;  2CX4 A;  4ML6 A;  3FY7 A;  2GLR A;  1TP9 A;  3I6A A;  4OCF A;  16GS A;  3KGK A;  2E2M A;  2LQO A;  2P5Q A;  2EIO A;  1WE0 A;  2MYG A;  1KBN A;  3Q19 A;  5B8B A;  1THO A;  2H8L A;  4XRD A;  3IK9 A;  4DSS A;  2VL2 A;  3UBK A;  2DJ1 A;  2DC5 A;  2YAN A;  4BWQ A;  5G1L A;  1PKZ A;  3US3 A;  3GNJ A;  3PGT A;  2OE3 A;  1YDK A;  2B6M A;  1HYU A;  4K6X A;  3F0I A;  2TRC P;  5ECI B;  3VI5 A;  2WRT A;  1R26 A;  4K7N A;  3FKF A;  2GST A;  3QCP A;  5ECQ B;  5LNK e;  4EDZ A;  1U3A A;  4X1U A;  3D0Z A;  3L9U A;  2GSS A;  2IIY A;  5HR2 A;  4TVE A;  1BED A;  4J56 E;  3VWU A;  1RQM A;  4NWY A;  1R4W A;  1XOB A;  1SD8 A;  3TRX A;  4DSR A;  4DVC A;  1K0M A;  2RUF A;  2CVB A;  2C3N A;  2CA8 A;  2LJK A;  2KLX A;  4K8M A;  2F9S A;  2EIQ A;  1EP8 A;  1THX A;  2NDO A;  4TXV A;  3TKQ A;  3O6T A;  1RW1 A;  1SEN A;  2H72 A;  2IMI A;  3TJK A;  4KCA A;  3CSJ A;  3UJ1 A;  3DD3 A;  4HJM A;  1XCC A;  1TU7 A;  2VL3 A;  1QK8 A;  3W6G A;  2H76 A;  4QL7 A;  5J9C A;  2H1B A;  2I3Y A;  1M99 A;  3KXO A;  1Z6N A;  1K0N A;  1WP0 A;  5HFK A;  2FY6 A;  3ZIT A;  3FEU A;  5D9W A;  2V41 A;  3KD0 A;  1TU8 A;  4MAB A;  1HQO A;  1OKT A;  3FZA A;  3MAK A;  2P0G A;  1A23 A;  2HI7 A;  3S9F A;  3DXB A;  3GN3 A;  5DCH A;  3LFL A;  4XS1 A;  4WR5 A;  1SU9 A;  2CZ2 A;  1FVK A;  3I9V 2;  4IBP A;  3HA9 A;  3IBH A;  2OAD A;  2GDR A;  3D21 A;  5IOW A;  4QL9 A;  1WMJ A;  3GYK A;  5C00 A;  4PGT A;  3GX8 A;  1ACV A;  2R2J A;  5ABR A;  4KE3 A;  2VL9 A;  3TRQ A;  4MJC A;  3L0H A;  1JLV A;  3WYW A;  3CSH A;  1JZD A;  1EV9 A;  2L5L A;  2VM2 A;  1A2M A;  3C8E A;  2C1Y A;  3TJJ A;  3D4M A;  4KB3 A;  5IMZ A;  3UAR A;  2R6K A;  4Q5F A;  1O8X A;  3IXR A;  4FO5 A;  2DJK A;  1A24 A;  2X99 A;  1VGL A;  4XS4 B;  1WPI A;  2I81 A;  4YH2 A;  1WJK A;  4V1A g;  5JWR B;  5DQS A;  3HZ4 A;  3PH9 A;  2EC4 A;  1UC7 A;  4N0Z A;  3ZLP A;  5A4U A;  2ALB A;  1OKD A;  5G2Z A;  1GSY A;  1S3D A;  1ZGN A;  4F0C A;  2KP2 A;  3HKR A;  4Q5R A;  4JZQ A;  5KN2 A;  5H5S A;  1GRX A;  20GS A;  3SBC A;  3ISO A;  1QGV A;  3Q18 A;  4BPY A;  2H6Y A;  2NPB A;  3DGQ A;  2I4A A;  3KH7 A;  4PUR A;  1SK2 A;  5L71 A;  4OFT A;  2R5G A;  1DSB A;  2YV9 A;  2EIR A;  1X5E A;  2RM6 A;  2K9F A;  2AV4 A;  3EMX A;  1Y6E A;  2X8H A;  5A4W A;  2HLS A;  1A0F A;  4HEA 2;  4GF0 A;  4AJ6 A;  3ZYW A;  2VO4 A;  4KCE A;  1ZL9 A;  4XS4 A;  2JAD A;  3TRP A;  2MMN A;  1F3A A;  4BL7 A;  1M2D A;  1TK8 B;  1M9A A;  2C80 A;  1GUM A;  3HDC A;  2R4V A;  4MZW A;  2AAW A;  1PL1 A;  2O87 A;  4IJI A;  3PIN A;  1G7E A;  1TK0 B;  13GS A;  3ZVJ D;  3MSZ A;  2F8F A;  2VD1 A;  1GSF A;  1GUK A;  4L8E A;  5J41 A;  3KMO A;  4GQC A;  2B5E A;  3CMI A;  4YQV A;  3TOT A;  1TI1 A;  4IP6 A;  1JHB A;  1JLW A;  4K7O A;  2GQM A;  4HZ2 A;  2VL2 C;  1B8X A;  3DML A;  4IQ1 A;  1LJR A;  1BJX A;  2X64 A;  1K0C A;  4MPF A;  1GP1 A;  4MH2 A;  1GNE A;  4ID0 A;  1CQG A;  4ZL9 A;  3L9S A;  5F06 A;  1TKD B;  2PMT A;  3RBT A;  4OD7 A;  2AHE A;  3AY8 A;  3HVV A;  3DRN A;  1TRW A;  3L78 A;  1A0R P;  4AGS A;  4RI6 A;  3N9J A;  3GX0 A;  3OR5 A;  1NW2 A;  3HVS A;  4FIW A;  5AIS A;  4N10 A;  3TJF A;  4ECC A;  3RPN A;  2DML A;  1ZYE A;  3GTU A;  1KTE A;  2VCT A;  4HZ4 A;  4MJE A;  3GSS A;  2HT9 A;  4XHM A;  2NVL A;  3K8N A;  4HOJ A;  18GS A;  1T00 A;  4ZBB A;  4YQU A;  2LRN A;  4GLT A;  4X43 A;  1SL2 B;  2PPT A;  5CRD A;  2MMZ A;  5JCW A;  1H4O A;  3EYT A;  1M9B A;  3GMF A;  3HJP A;  4GSS A;  11GS A;  5D9X A;  3H4K A;  4KDX A;  4WEY A;  3UAP A;  2TRX A;  4MH3 A;  4ZL7 A;  2H71 A;  1J08 A;  3ZRD A;  2J23 A;  3IA1 A;  3LEF A;  4PUA A;  3APO A;  3CRT A;  2LRC A;  2X8G A;  2A2S A;  2D2Z A;  4PQ1 A;  1XW9 A;  3BBY A;  4WKW A;  1T8E B;  1S3A A;  1M0U A;  1SYR A;  1WIK A;  6GSX A;  5J4U A;  3E0U A;  2V2G A;  2TIR A;  3VUR A;  4L5O A;  1QMV A;  2DJ3 A;  4JED A;  5DQY A;  3EMP A;  4RQX A;  1GSQ A;  4YAP A;  2PVO C;  3FK8 A;  4IP1 A;  4JE1 A;  2F8A A;  3VI7 A;  4ZB8 A;  2LJR A;  4P3Y B;  2ON5 A;  1Z6M A;  1SKR B;  1TI3 A;  1XBS A;  4ZXG A;  3WT1 A;  2LNT A;  2H0H A;  2H74 A;  3WGX A;  3SWL A;  4WBR D;  2PU9 C;  3KCM A;  2N5B A;  1UN2 A;  2DJJ A;  4KX4 A;  1PX7 A;  2H6Z A;  4FYC A;  3BOA A;  1N2A A;  4ZIL A;  5AIV A;  3M1G A;  1KNG A;  2XPD A;  4MZC A;  5CO3 A;  4F2I A;  3IOS A;  3KH9 A;  1OAZ A;  5B6N A;  3GH9 A;  2Z9S A;  3EC3 A;  5A4V A;  2HYX A;  4YAV A;  5DBQ A;  5J3R A;  1XPV A;  2GSR A;  3EUR A;  1M2B A;  1GUL A;  4WF5 A;  2PER A;  3APS A;  3P90 A;  1U88 A;  3A2W A;  3KMN A;  1HNA A;  4L5L A;  3TKS A;  1E6B A;  2VIM A;  2ES7 A;  4NPB A;  19GS A;  4GXZ A;  4HS1 A;  2DMM A;  2YWN A;  1V40 A;  3V1W A;  4Z7X A;  1EZK A;  3UVH A;  1PN9 A;  3D5J A;  2B7K A;  6GSY A;  2M80 A;  2V6O A;  1IYI A;  4ECB A;  1NM3 A;  1J9B A;  1ERW A;  3KP8 A;  3KP9 A;  2H19 A;  2KHP A;  4ECJ A;  2AB6 A;  2H1D A;  2GQL A;  3M9J A;  3IHQ A;  1GSD A;  1ZCP A;  3TDG A;  2H70 A;  5F07 A;  1AQX A;  3O76 A;  1EWX A;  1BYE A;  3I43 A;  14GS A;  2VCV A;  2PBJ A;  3GKM A;  1WRY A;  4WET A;  2I9H A;  1B9X C;  3KIJ A;  4JR6 A;  1J0F A;  1GTA A;  1GSE A;  2ZCT A;  2R3X A;  2HZE B;  1A8L A;  2NTO A;  1V58 A;  3U5R E;  2A4V A;  3IC4 A;  4RQR A;  4XIH A;  3QMX A;  3FR9 A;  5FHI A;  4JR4 A;  3ERW A;  3QFB C;  2FWF A;  3VFI A;  3E9J B;  5HFG A;  1GLQ A;  2CT6 A;  5IMC A;  4LL1 B;  4XCS A;  5F8B A;  4LLR A;  4ZBD A;  1F37 A;  1YY7 A;  2GZY A;  4KSM A;  2RII A;  2XBQ A;  1X9S B;  5DAK B;  4MCU A;  5CYY A;  3G7J A;  2P31 A;  1GWC A;  2H75 A;  3EIN A;  3G7Y A;  5IPG A;  1LBK A;  4ISD A;  2QGV A;  3APQ A;  3W8S A;  3HJM A;  2QC7 A;  3P8W A;  2HNL A;  2V6K A;  4YQM A;  1R5P A;  2JU5 A;  5DJM A;  1SKS B;  4OCE A;  4RI7 A;  2FUG 2;  3F3Q A;  2HZE A;  5ID2 B;  5G1K A;  1MD4 A;  2FCH A;  1QFN A;  4NXI A;  12GS A;  1AAZ A;  3WT2 A;  5IPH A;  1R5A A;  4RUV A;  1O6J A;  5HR3 A;  5CRH A;  1BQ7 A;  3IE3 A;  3HY2 A;  4MF7 A;  2CV4 A;  4FYB A;  4HU7 A;  5EY6 A;  4EXJ A;  1O81 A;  3F3R A;  3UEM A;  3NIV A;  1JZW A;  3D6I A;  2VD0 A;  5DAK A;  3GUR A;  3TKP A;  2M72 A;  2WS2 A;  1K0D A;  1T1V A;  2O7K A;  1OVN A;  2HZF A;  1Z9H A;  1O73 A;  4X0X A;  4F82 A;  2OJL A;  3ZTL A;  3A3T A;  2QKE A;  1A2L A;  1PQN A;  4HDE A;  2WB9 A;  5IMV A;  3C7M A;  5ID2 A;  1JZO A;  4TRX A;  2E2G A;  2LNS A;  3ZML A;  1SK1 A;  5G30 A;  4HJ2 A;  2V1M A;  1FW1 A;  5KN1 A;  3LXT A;  2PWJ A;  4N0V A;  2HRN A;  1MDI A;  4EVM A;  4IVF A;  1AIU A;  6GSU A;  5EL8 A;  4GWR A;  2AUV A;  9GSS A;  4KAE A;  6GSV A;  1T4Y A;  5IO2 A;  4L0W A;  3UIW A;  3F8U A;  4K9Z A;  4I2T A;  3RPP A;  3TOU A;  4CDO A;  5INY A;  4D73 B;  2YZH A;  1G6Y A;  2OAC A;  3W8J A;  3ZIJ A;  3D4T A;  2OBK A;  3LJR A;  2WJU A;  3GUS A;  2CVD A;  4MJB A;  2H66 A;  2JZR A;  5D8I A;  1FAA A;  5ECP B;  3G7I A;  1GLP A;  1FO5 A;  5ENU A;  3GIX A;  1WWJ A;  1TK5 B;  4BVX A;  3HHV A;  2ZUP A;  4I5Q A;  2GZP A;  5F0G A;  1ERV A;  1K3O A;  2LEG A;  1V9W A;  3WGE A;  3TUE A;  1FHE A;  1XWB A;  2YCD A;  1VRS D;  2MBS A;  2AYT A;  1NHO A;  5B8A A;  1OC9 B;  4TR0 A;  4IGJ A;  4HU9 A;  4OMV A;  1PD2 1;  4H86 A;  3GKN A;  4KDU A;  4D73 A;  1VF3 A;  2PVQ A;  4TXO B;  1SJ6 A;  4NMU A;  3WD6 A;  2V32 A;  3F63 A;  1FB0 A;  3QR6 A;  2YNX A;  3IAM 2;  2VCW A;  1XOA A;  2GT5 A;  5ECR B;  4EF0 A;  3F4S A;  1ZYQ B;  3BCI A;  5CNW A;  3C1S A;  5AN1 A;  1ZOF A;  4OFM A;  2YWI A;  4LL4 B;  2DSA A;  3ZIV A;  2OE0 A;  2YN1 A;  5FT3 A;  2FD3 A;  1UVZ A;  2PGT A;  1M7T A;  4MMM A;  4JBB A;  1UA5 A;  1Z3E A;  2FA4 A;  1OC9 A;  1SK0 A;  4ULX A;  4PNG A;  1VF1 A;  5D96 A;  4KSO A;  3F6F A;  4NHZ A;  3FRC A;  4Q5N A;  1EV4 A;  5KEJ A;  2CX3 A;  3DVW A;  1VF4 A;  5ECN B;  3DIE A;  2H1G A;  5D73 A;  1GSU A;  4BA7 A;  3HZ8 A;  17GS A;  1PRX A;  4FYU A;  4PXO A;  3M0F A;  4LA1 A;  4N11 A;  1T4Z A;  4NAX A;  1O8W A;  5B6M A;  5J5N A;  4ILF A;  3VWV A;  5G5E A;  4E8H A;  2HSH A;  3U6V A;  6GSW A;  1A8Y A;  4LMW A;  3JCM L;  1DE2 A;  3P7X A;  2RM5 A;  4EKZ A;  4TR4 A;  5IO0 A;  6GST A;  4O32 A;  3NOF A;  1V98 A;  3HCZ A;  2F51 A;  4POB A;  2PUK C;  4CW9 A;  1I5G A;  2LTK A;  1XVQ A;  2NBS A;  3RAZ A;  2VLU A;  3GFK A;  4I2U A;  3IRA A;  3GRX A;  2WZ9 A;  4MF6 A;  1K3L A;  3IV4 A;  5ECS A;  1K0B A;  1FOV A;  1NHY A;  2CAQ A;  2MMO A;  1X5C A;  5HR0 A;  3H93 A;  4OFN A;  1YQ1 A;  3EWL A;  2OBI A;  2C0D A;  1K3Y A;  2LS5 A;  3QOU A;  1EEM A;  3EVI A;  1XIY A;  2FLS A;  1VF2 A;  2IME A;  2YP6 A;  1B48 A;  2HXK A;  2R37 A;  3CYN A;  2DJ2 A;  3BD2 A;  2H73 A;  2CQ9 A;  4TW5 A;  1QUW A;  2FWG A;  4FH8 A;  3J7Y k;  3FZ4 A;  1ILO A;  4XTS A;  4MA9 A;  5F05 A;  2XPE A;  2VCX A;  2N5F A;  2M46 A;  2G0F A;  2A2R A;  2IWT A;  5LD0 A;  1YF0 A;  2FWE A;  1NSW A;  3IDV A;  4NHW A;  1U87 A;  4KW6 A;  1W4V A;  3LXZ A;  5H5R A;  2DIY A;  3VWX A;  5HFI A;  2XBI A;  4MPG A;  5ECK B;  2H1A A;  3CTG A;  3J7Y b;  3LWA A;  1XWC A;  3IAS 2;  1X9W B;  1YKC A;  3H79 A;  5GAP D;  3CTF A;  3VK9 A;  2I1U A;  3M9K A;  1BX9 A;  2L4C A;  3GL5 A;  3R2Q A;  1GUH A;  3ZRE A;  4NV5 A;  4PX1 A;  3RHC A;  5E59 A;  5EVO A;  1N8J A;  5B7C A;  1DBY A;  1U6T A;  4O5R A;  4G9H A;  1ML6 A;  5KN0 A;  2MZC A;  3RDW A;  3A2V A;  1TJD A;  1SJZ A;  3DKS A;  2XC2 A;  3F6D A;  3IR4 A;  3C71 A;  4ZB6 A;  2BMX A;  1ABA A;  3LSZ A;  2DLX A;  4K1F A;  4EUY A;  5HR1 A;  2JAC A;  4G2E A;  1AC1 A;  4POL A;  3DYR A;  2K6V A;  4K2D A;  3G9B A;  1QQ2 A;  2P5R A;  2YZU A;  2LUS A;  2VM1 A;  3GV1 A;  2HRF A;  4GSN A;  2JSY A;  2LST A;  1HNB A;  4IJ3 A;  1GH2 A;  3ME8 A;  5KN3 A;  4WR4 A;  2O89 A;  1AQV A;  5CRE A;  2HFD A;  3A2X A;  4JRR A;  3LGC A;  4PQI A;  5AIX A;  1MTC A;  2MMA A;  2KUC A;  1EOH A;  4OO4 A;  2H0G A;  2IL3 A;  4G10 A;  3ZL5 A;  3VPQ A;  1TOF A;  3TB2 A;  1YJ6 A;  5G31 A;  4EO3 A;  1XWK A;  3ZZX A;  2LQQ A;  1K0A A;  1U3I A;  1OC8 A;  1HNC A;  5AGY A;  1MD3 A;  2H0I A;  2YJ7 A;  3QDN A;  2JZS A;  3ZVJ A;  4ACS A;  2VAF A;  4TOP A;  4MLY A;  4ZIJ A;  3M8N A;  1EGO A;  3DEX A;  4GST A;  1XWG A;  2XHF A;  4L0U A;  2C8U A;  2FHE A;  4IHU A;  2X8C A;  3HD5 A;  1GTB A;  2WGR A;  1RK4 A;  2IMK A;  5CRG A;  5ELG A;  4ZB9 A;  1GL8 A;  2DBC A;  8GSS A;  5IMA A;  1FVJ A;  3IK7 A;  3NZN A;  1TRV A;  3BJ5 A;  5GAN D;  3LOR A;  3KEB A;  2CAI A;  3KTL A;  1M2A A;  4ZBA A;  3LQ7 A;  4XRA A;  2GT6 A;  2CZ3 A;  1BG5 A;  2O85 A;  5DAL B;  3MDK A;  4Q5Q A;  4AF2 A;  2REM A;  3ZFB A;  2B5X A;  3ERG A;  1CQH A;  5DCG A;  3VPT A;  1GSS A;  4TN8 A;  1AUC A;  5C04 A;  3GL3 A;  4MP4 A;  3KTB A;  2C3Q A;  2H30 A;  5D9T A;  5GST A;  4OWY A;  3UMA A;  1XWA A;  1B9Y C;  2GSQ A;  4TR3 A;  1OYJ A;  1GTI A;  6GSS A;  2J9H A;  2KP1 A;  4ML1 A;  4EDY A;  10GS A;  3MNG A;  1C72 A;  2C4J A;  3TJB A;  5FWG A;  1TDI A;  3QD9 A;  4HQZ A;  5ECH B;  7GSS A;  2K18 A;  3I69 A;  3EU4 A;  5JWQ B;  2K8S A;  4K0N A;  1SL1 B;  5D93 A;  2H6X A;  1MDK A;  4HQS A;  5D9V A;  4PUF C;  3C1R A;  3L9V A;  2IPA A;  3LYP A;  5DAL A;  3FW2 A;  4DEJ A;  1ERU A;  5IM9 A;  2B1K A;  1H75 A;  2YWO A;  5DDL A;  3IPZ A;  1SYX A;  4MJA A;  4I97 A;  4V2N A;  1QXH A;  5GZZ B;  2VCQ A;  2B7J A;  1SKW B;  5ECO B;  4EC0 A;  1X5D A;  3H1N A;  1AQW A;  1I9D A;  4O92 A;  5JCU A;  1DUG A;  3TKS E;  2IFQ B;  1JFU A;  2FGX A;  2IJY A;  4J2F A;  1F6M C;  4NV2 A;  2KOK A;  2GVP A;  1PGT A;  2PN8 A;  4ECI A;  2OA7 A;  1G7O A;  3FHK A;  3EU3 A;  1Q98 A;  2B5Y A;  3F4R A;  2VUP A;  2C3T A;  1PA3 A;  5IIZ A;  1PSQ A;  1GTU A;  5H5Q A;  1YZX A;  3TJG A;  1DE1 A;  3TCO A;  5J9B A;  4KA0 A;  1F2E A;  1XFL A;  1JZR A;  4WBJ A;  3TKS C;  1Z5Y E;  2BTO T;  3FZ5 A;  1Q4J A;  4G19 A;  4HUA A;  2YWM A;  4MZB A;  1B4Q A;  1YF1 A;  3VLN A;  3H8Q A;  5ELA A;  2LKU A;  4BVY A;  3QAV A;  1SD9 A;  3VWW A;  2IFQ A;  2B3S A;  5DJL A;  22GS A;  4PNF A;  1SL0 B;  2OKA A;  4TR1 B;  5EPF A;  3GH6 A;  1TXX A;  3GA4 A;  4J57 E;  1ON4 A;  4XS6 A;  3CRU A;  4N30 A;  1E2Y A;  2YPM A;  2RLI A;  2E7P A;  2JL4 A;  4QQ7 A;  1AW9 A;  3GTU B;  1USB A;  3GHA A;  1WOU A;  2WFC A;  2ZNM A;  2AJQ B;  1IYH A;  3DWV A;  3CBU A;  3UBL A;  3F9U A;  3P2A A;  4MK3 A;  1XXU A;  3E3E A;  4O7H A;  2HE3 A;  1XW6 A;  3TGZ A;  1HD2 A;  4V2L A;  1ZZY A;  1Z7R A;  1TRU A;  4EL1 A;  5CAX A;  3PR8 A;  1GNW A;  3TKR A;  2JZT A;  4E8E A;  5E4W A;  2C0E A;  2L5O A;  1FG4 A;  3LYK A;  2VLV A;  2O8V B;  1AXD A;  4TR1 A;  3UL3 A;  3QAG A;  5CP1 A;  4GQF A;  4PQH A;  3ED3 A;  2GQK A;  1EP7 A;  4IQA A;  4TXO A;  3RHB A;  1F3B A;  3ZMK A;  1PKW A;  1X9M B;  2K8V A;  3UOM A;  5HQP A;  1A2J A;  1T3B A;  1O85 A;  1ST9 A;  1BAY A;  1O7U A;  1YEX A;  1EEJ A;  1PX6 A;  2BJX A;  3HJO A;  4I6X A;  1ZMA A;  2F3M A;  4POK A;  1V2A A;  2IN3 A; 
#chains in the Genus database with same CATH topology
 1MDJ A;  2WUL A;  4F9Z A;  3FZ9 A;  2HSY A;  3WGD A;  4K0G A;  5ECL B;  1R7H A;  2RUE A;  5G5F A;  2LV3 A;  4V2M A;  2C0F A;  3LW9 A;  3EE2 A;  3KJY A;  3Q6O A;  4I8B A;  2ON7 A;  1Y25 A;  4TKY A;  4OO5 A;  3HYP A;  4CHS A;  3BCK A;  1YKA A;  3GKK A;  3MIX A;  3Q74 A;  4GTU A;  3KM6 A;  3C73 A;  1PL2 A;  2OE1 A;  5CRW A;  4AJ8 A;  1LU4 A;  2GZZ A;  1XVW A;  3LG6 A;  2DIZ A;  1SJI A;  3F4T A;  5BMU A;  2B1L A;  4MF5 A;  2JSZ A;  2VCZ A;  1KEB A;  2VOC A;  4DSQ A;  4AJ7 A;  3HXS A;  2L57 A;  2YOI A;  1OE7 A;  5GSS A;  4ZL8 A;  2GS3 A;  1EOG A;  1PN0 A;  4F03 A;  2QSI A;  1TTZ A;  4WF4 A;  3GKX A;  2DJ0 A;  3DVX A;  2C0G A;  3QAW A;  5LCZ A;  5DVB A;  1K0O A;  2LJA A;  2N5A A;  5COH A;  4MDC A;  2WDU A;  4KUN A;  3ZFL A;  2FWH A;  1V57 A;  3ERF A;  2GGT A;  2L59 A;  3O3T A;  3KZQ A;  5ECM B;  4JU5 A;  4IW9 A;  1Z7P A;  3A5W A;  1MEK A;  3MWH A;  2FA8 A;  3GST A;  4GCI A;  4IN0 A;  4KH7 A;  1W89 A;  4EE0 A;  3FR3 A;  4K7I A;  4IEL A;  1TRS A;  4F0B A;  2G2Q A;  2CVK A;  4IKH A;  4IS0 A;  2L6D A;  3FYG A;  2IMF A;  3L4N A;  2L4Q A;  2VLT A;  3UVT A;  2L6C A;  2E0Q A;  1XZO A;  5JWO B;  2MBT A;  5A5K A;  1XW5 A;  1X0R A;  3FR6 A;  4LMV A;  1OE8 A;  1YEP A;  4DSS B;  2FNO A;  1G6W A;  1FB6 A;  3D22 A;  4V1A p;  1F9M A;  1TW9 A;  4WXT A;  1B4P A;  3N5O A;  3CXG A;  2YJH A;  2GTU A;  3HVX A;  2H01 A;  3M3M A;  1OC3 A;  4GRF A;  4HI7 A;  4BWS A;  3CSI A;  3QPM A;  1EGR A;  1PMT A;  2YV7 A;  5JCG A;  2WCI A;  1S3C A;  1ERT A;  4POM A;  2IMD A;  5IMF A;  5IQY A;  5IOX A;  1T7P B;  4KND A;  3ME7 A;  3QFA C;  1URM A;  1G0T A;  2LRT A;  4KGI A;  5IMD A;  4KDY A;  2CX4 A;  4ML6 A;  3FY7 A;  2GLR A;  1TP9 A;  3I6A A;  4OCF A;  16GS A;  3KGK A;  2E2M A;  2LQO A;  2P5Q A;  2EIO A;  1WE0 A;  2MYG A;  1KBN A;  3Q19 A;  5B8B A;  5BRT A;  1THO A;  2H8L A;  4XRD A;  3IK9 A;  4DSS A;  2VL2 A;  3UBK A;  2DJ1 A;  2DC5 A;  2YAN A;  4BWQ A;  5G1L A;  1PKZ A;  3US3 A;  3GNJ A;  3PGT A;  2OE3 A;  1YDK A;  2B6M A;  1HYU A;  4K6X A;  3F0I A;  2TRC P;  5ECI B;  3VI5 A;  2WRT A;  1R26 A;  4K7N A;  3FKF A;  2GST A;  3QCP A;  5ECQ B;  5LNK e;  4EDZ A;  1U3A A;  4X1U A;  3D0Z A;  3L9U A;  2GSS A;  2IIY A;  5HR2 A;  4TVE A;  1BED A;  4J56 E;  3VWU A;  1RQM A;  4NWY A;  1R4W A;  1XOB A;  1SD8 A;  3TRX A;  4DSR A;  4DVC A;  1K0M A;  2RUF A;  2CVB A;  2C3N A;  2CA8 A;  2LJK A;  2KLX A;  4K8M A;  2F9S A;  2EIQ A;  1EP8 A;  1THX A;  2NDO A;  4TXV A;  3TKQ A;  3O6T A;  1RW1 A;  1SEN A;  2H72 A;  2IMI A;  3TJK A;  4KCA A;  3CSJ A;  3UJ1 A;  3DD3 A;  4HJM A;  1XCC A;  1TU7 A;  2VL3 A;  1QK8 A;  3W6G A;  2H76 A;  4QL7 A;  5J9C A;  2H1B A;  2I3Y A;  1M99 A;  3KXO A;  1Z6N A;  1K0N A;  1WP0 A;  5HFK A;  2FY6 A;  3ZIT A;  3FEU A;  5D9W A;  2V41 A;  3KD0 A;  1TU8 A;  4MAB A;  1HQO A;  1OKT A;  3FZA A;  3MAK A;  2P0G A;  1A23 A;  2HI7 A;  3S9F A;  3DXB A;  3GN3 A;  5DCH A;  3LFL A;  4XS1 A;  4WR5 A;  1SU9 A;  2CZ2 A;  1FVK A;  3I9V 2;  4IBP A;  3HA9 A;  3IBH A;  2OAD A;  2GDR A;  3D21 A;  5IOW A;  4QL9 A;  1WMJ A;  3GYK A;  5C00 A;  4PGT A;  3GX8 A;  1ACV A;  2R2J A;  5ABR A;  4KE3 A;  2VL9 A;  3TRQ A;  4MJC A;  3L0H A;  1JLV A;  3WYW A;  3CSH A;  1JZD A;  1EV9 A;  2L5L A;  2VM2 A;  1A2M A;  3C8E A;  2C1Y A;  3TJJ A;  3D4M A;  4KB3 A;  5IMZ A;  3UAR A;  2R6K A;  4Q5F A;  1O8X A;  3IXR A;  4FO5 A;  2DJK A;  1A24 A;  2X99 A;  1VGL A;  4XS4 B;  1WPI A;  2I81 A;  4YH2 A;  4BL7 B;  1WJK A;  4V1A g;  5JWR B;  2HRA A;  5DQS A;  3HZ4 A;  3PH9 A;  2EC4 A;  1UC7 A;  4N0Z A;  3ZLP A;  5A4U A;  2ALB A;  1OKD A;  5G2Z A;  1GSY A;  1S3D A;  1ZGN A;  4F0C A;  2KP2 A;  3HKR A;  3IHG A;  4Q5R A;  4JZQ A;  5KN2 A;  5H5S A;  1GRX A;  20GS A;  3SBC A;  3ISO A;  1QGV A;  3Q18 A;  4BPY A;  2H6Y A;  2NPB A;  3DGQ A;  2I4A A;  3KH7 A;  4PUR A;  1SK2 A;  5L71 A;  4OFT A;  2R5G A;  1DSB A;  2YV9 A;  2EIR A;  1X5E A;  2RM6 A;  2K9F A;  2AV4 A;  3EMX A;  1Y6E A;  2X8H A;  5A4W A;  2HLS A;  1A0F A;  4HEA 2;  4GF0 A;  4AJ6 A;  3ZYW A;  2VO4 A;  4KCE A;  1ZL9 A;  4XS4 A;  2JAD A;  3TRP A;  2MMN A;  1F3A A;  4BL7 A;  1M2D A;  1TK8 B;  1M9A A;  2C80 A;  1GUM A;  3HDC A;  2R4V A;  4MZW A;  2AAW A;  1PL1 A;  2O87 A;  4IJI A;  3PIN A;  1G7E A;  1TK0 B;  13GS A;  3ZVJ D;  3MSZ A;  2F8F A;  2VD1 A;  1GSF A;  1GUK A;  4L8E A;  5J41 A;  3KMO A;  3MYD A;  4GQC A;  2B5E A;  3CMI A;  4EIP A;  4YQV A;  3TOT A;  1TI1 A;  4IP6 A;  1JHB A;  1JLW A;  4K7O A;  2GQM A;  4HZ2 A;  2VL2 C;  1B8X A;  3DML A;  4IQ1 A;  1LJR A;  1BJX A;  2X64 A;  1K0C A;  4MPF A;  1GP1 A;  4MH2 A;  1GNE A;  4ID0 A;  4MNN A;  4ZL9 A;  1CQG A;  3L9S A;  5F06 A;  1TKD B;  2PMT A;  3RBT A;  4OD7 A;  2AHE A;  3AY8 A;  3HVV A;  3DRN A;  1TRW A;  3L78 A;  1A0R P;  4AGS A;  4RI6 A;  3N9J A;  3GX0 A;  4FQU A;  3OR5 A;  1NW2 A;  3HVS A;  4FIW A;  5AIS A;  4N10 A;  3TJF A;  2HRK A;  4ECC A;  3RPN A;  2DML A;  1ZYE A;  3GTU A;  1KTE A;  2VCT A;  4HZ4 A;  4MJE A;  3GSS A;  2HT9 A;  4XHM A;  2NVL A;  3K8N A;  4HOJ A;  18GS A;  1T00 A;  4ZBB A;  4YQU A;  2LRN A;  4GLT A;  4X43 A;  1SL2 B;  2PPT A;  5CRD A;  2MMZ A;  5JCW A;  1H4O A;  3EYT A;  1M9B A;  3GMF A;  4EIQ A;  3HJP A;  4GSS A;  11GS A;  5D9X A;  3H4K A;  4KDX A;  4WEY A;  3UAP A;  2TRX A;  4MH3 A;  4ZL7 A;  2H71 A;  1J08 A;  3ZRD A;  2J23 A;  3IA1 A;  2A4H A;  3LEF A;  4PUA A;  3APO A;  3CRT A;  2LRC A;  2X8G A;  4G0L A;  2A2S A;  2D2Z A;  4PQ1 A;  1XW9 A;  3BBY A;  4CY6 A;  4WKW A;  1T8E B;  1S3A A;  1M0U A;  1SYR A;  3R3E A;  1WIK A;  6GSX A;  5J4U A;  3E0U A;  2V2G A;  2TIR A;  3VUR A;  4L5O A;  1QMV A;  4HSC X;  2DJ3 A;  4JED A;  5DQY A;  3EMP A;  4RQX A;  1GSQ A;  4YAP A;  2PVO C;  3FK8 A;  4IP1 A;  4JE1 A;  2F8A A;  3VI7 A;  4ZB8 A;  2LJR A;  4P3Y B;  2ON5 A;  1Z6M A;  1SKR B;  1TI3 A;  1XBS A;  3IC8 A;  4ZXG A;  3WT1 A;  1XG8 A;  2LNT A;  2H0H A;  2H74 A;  3WGX A;  3SWL A;  4WBR D;  2PU9 C;  3KCM A;  2N5B A;  1M3I A;  1UN2 A;  2DJJ A;  4KX4 A;  1PX7 A;  2H6Z A;  4FYC A;  3BOA A;  1N2A A;  4ZIL A;  2UZ8 A;  5AIV A;  1ZYP A;  3M1G A;  1KNG A;  2XPD A;  4MZC A;  5CO3 A;  4F2I A;  3IOS A;  3KH9 A;  1OAZ A;  5B6N A;  3GH9 A;  2Z9S A;  3EC3 A;  5A4V A;  2HYX A;  4YAV A;  4Z2U A;  5DBQ A;  5J3R A;  1XPV A;  2GSR A;  3EUR A;  1M2B A;  4ICY A;  1GUL A;  4WF5 A;  2PER A;  3APS A;  3P90 A;  1U88 A;  3A2W A;  4YKF A;  3KMN A;  1HNA A;  4L5L A;  3TKS A;  1E6B A;  2VIM A;  2ES7 A;  4NPB A;  19GS A;  4GXZ A;  4HS1 A;  2DMM A;  2YWN A;  4BIK A;  1V40 A;  3V1W A;  4Z7X A;  1EZK A;  3UVH A;  1PN9 A;  3D5J A;  2B7K A;  6GSY A;  2M80 A;  2V6O A;  5KOW A;  1IYI A;  4ECB A;  1NM3 A;  1J9B A;  1ERW A;  3KP8 A;  3KP9 A;  2H19 A;  2KHP A;  4ECJ A;  2AB6 A;  2H1D A;  2GQL A;  3M9J A;  3IHQ A;  1GSD A;  1ZCP A;  3TDG A;  2H70 A;  5F07 A;  1AQX A;  3O76 A;  1EWX A;  1BYE A;  3I43 A;  14GS A;  2VCV A;  2PBJ A;  3GKM A;  1WRY A;  4WET A;  2I9H A;  1B9X C;  2DKI A;  3KIJ A;  4JR6 A;  1J0F A;  1GTA A;  1GSE A;  2ZCT A;  2R3X A;  2HZE B;  1A8L A;  2NTO A;  1V58 A;  3U5R E;  2A4V A;  3IC4 A;  4USS A;  4PTS A;  4RQR A;  4XIH A;  3QMX A;  3FR9 A;  5FHI A;  4JR4 A;  3ERW A;  3QFB C;  2FWF A;  3VFI A;  3E9J B;  5HFG A;  1GLQ A;  2CT6 A;  5IMC A;  4LL1 B;  4XCS A;  5F8B A;  3PPU A;  4LLR A;  4ZBD A;  1F37 A;  1YY7 A;  2GZY A;  4KSM A;  2RII A;  2XBQ A;  1X9S B;  5DAK B;  4MCU A;  5CYY A;  3G7J A;  2P31 A;  1GWC A;  2H75 A;  2HSM A;  3EIN A;  3G7Y A;  5IPG A;  1LBK A;  4ISD A;  2QGV A;  3APQ A;  3W8S A;  3HJM A;  2QC7 A;  2R0C A;  3P8W A;  2HNL A;  2V6K A;  4YQM A;  1R5P A;  2JU5 A;  5DJM A;  1SKS B;  4OCE A;  4RI7 A;  2FUG 2;  3F3Q A;  2HZE A;  5ID2 B;  5G1K A;  1MD4 A;  2FCH A;  1QFN A;  4NXI A;  12GS A;  1AAZ A;  3WT2 A;  5IPH A;  1R5A A;  4RUV A;  1O6J A;  5HR3 A;  5CRH A;  1BQ7 A;  3IE3 A;  3HY2 A;  4MF7 A;  2CV4 A;  4Z2R A;  3FMW A;  4FYB A;  4K5R A;  4HU7 A;  5EY6 A;  4EXJ A;  1O81 A;  3F3R A;  3UEM A;  3NIV A;  1JZW A;  3D6I A;  2VD0 A;  5DAK A;  3GUR A;  3TKP A;  2M72 A;  2WS2 A;  1K0D A;  4K2X A;  1T1V A;  2O7K A;  5KOX A;  1OVN A;  2HZF A;  1Z9H A;  1O73 A;  4X0X A;  4F82 A;  2OJL A;  3ZTL A;  3A3T A;  2QKE A;  1A2L A;  1PQN A;  4HDE A;  2WB9 A;  5IMV A;  3C7M A;  5ID2 A;  1JZO A;  4TRX A;  2E2G A;  2LNS A;  3ZML A;  1SK1 A;  5G30 A;  4HJ2 A;  2V1M A;  1FW1 A;  5KN1 A;  3LXT A;  2PWJ A;  4BVX B;  2DKH A;  4N0V A;  2HRN A;  1MDI A;  4EVM A;  4IVF A;  1AIU A;  6GSU A;  5EL8 A;  4GWR A;  2AUV A;  9GSS A;  4KAE A;  6GSV A;  1T4Y A;  5IO2 A;  4L0W A;  3UIW A;  3F8U A;  4K9Z A;  4I2T A;  3RPP A;  3TOU A;  4CDO A;  5INY A;  4D73 B;  2YZH A;  1G6Y A;  2OAC A;  3W8J A;  3ZIJ A;  3D4T A;  2OBK A;  3LJR A;  2WJU A;  3GUS A;  2CVD A;  4MJB A;  2H66 A;  2JZR A;  5D8I A;  1FAA A;  5ECP B;  3G7I A;  1GLP A;  1FO5 A;  5ENU A;  3CQF A;  3GIX A;  1WWJ A;  1TK5 B;  4BVX A;  3HHV A;  2ZUP A;  4I5Q A;  2GZP A;  4G0I A;  5F0G A;  1ERV A;  1K3O A;  2LEG A;  1V9W A;  3WGE A;  3TUE A;  1FHE A;  1XWB A;  2YCD A;  1VRS D;  2MBS A;  2AYT A;  1NHO A;  5B8A A;  1OC9 B;  4TR0 A;  4IGJ A;  4HU9 A;  4OMV A;  1PD2 1;  4H86 A;  3GKN A;  4KDU A;  4D73 A;  1VF3 A;  2PVQ A;  4TXO B;  1SJ6 A;  4NMU A;  3WD6 A;  2V32 A;  3F63 A;  1FB0 A;  3QR6 A;  2YNX A;  3IAM 2;  2VCW A;  1XOA A;  2GT5 A;  5ECR B;  4EF0 A;  3F4S A;  1ZYQ B;  3BCI A;  5CNW A;  3C1S A;  5AN1 A;  1ZOF A;  4OFM A;  2YWI A;  4LL4 B;  2DSA A;  3ZIV A;  2OE0 A;  2YN1 A;  5FT3 A;  2FD3 A;  1UVZ A;  2PGT A;  1M7T A;  4MMM A;  4JBB A;  1FOH A;  1UA5 A;  1Z3E A;  2FA4 A;  1OC9 A;  1SK0 A;  4ULX A;  4PNG A;  1VF1 A;  5D96 A;  4KSO A;  3F6F A;  4NHZ A;  3FRC A;  4Q5N A;  1EV4 A;  5KEJ A;  2CX3 A;  3DVW A;  1VF4 A;  5ECN B;  3DIE A;  2H1G A;  5D73 A;  1GSU A;  4BA7 A;  3HZ8 A;  17GS A;  1PRX A;  4FYU A;  4PXO A;  3M0F A;  4LA1 A;  4N11 A;  1T4Z A;  4NAX A;  1O8W A;  5B6M A;  5J5N A;  4ILF A;  3VWV A;  5G5E A;  4E8H A;  2HSH A;  3U6V A;  6GSW A;  1A8Y A;  4LMW A;  3JCM L;  1DE2 A;  3P7X A;  2RM5 A;  4EKZ A;  4TR4 A;  5IO0 A;  6GST A;  4O32 A;  3NOF A;  1V98 A;  3HCZ A;  2F51 A;  4POB A;  2PUK C;  4CW9 A;  1I5G A;  2LTK A;  1XVQ A;  2NBS A;  4O5Q A;  3RAZ A;  2VLU A;  3GFK A;  4I2U A;  3IRA A;  3GRX A;  3EPT A;  2WZ9 A;  4MF6 A;  1K3L A;  3IV4 A;  5ECS A;  1K0B A;  1FOV A;  1NHY A;  2CAQ A;  2MMO A;  1X5C A;  5HR0 A;  3H93 A;  4OFN A;  1YQ1 A;  1PFO A;  3EWL A;  2OBI A;  2C0D A;  1K3Y A;  2LS5 A;  3QOU A;  1EEM A;  3EVI A;  1XIY A;  2FLS A;  1VF2 A;  2IME A;  2YP6 A;  1B48 A;  2HXK A;  2R37 A;  3CYN A;  2DJ2 A;  3BD2 A;  2H73 A;  2CQ9 A;  4TW5 A;  1QUW A;  2FWG A;  4FH8 A;  3J7Y k;  3FZ4 A;  1ILO A;  4XTS A;  2X49 A;  4MA9 A;  5F05 A;  2XPE A;  2VCX A;  2N5F A;  2M46 A;  2G0F A;  2A2R A;  2R0G A;  2IWT A;  5LD0 A;  3HVN A;  1YF0 A;  2FWE A;  1NSW A;  3IDV A;  4NHW A;  1U87 A;  4KW6 A;  1W4V A;  3LXZ A;  1ZYN A;  4X4J A;  5H5R A;  2DIY A;  3VWX A;  5HFI A;  2XBI A;  4MPG A;  5ECK B;  2H1A A;  3CTG A;  3J7Y b;  3LWA A;  1XWC A;  3IAS 2;  1X9W B;  1YKC A;  3H79 A;  5GAP D;  3CTF A;  3VK9 A;  2I1U A;  3M9K A;  1BX9 A;  2L4C A;  3GL5 A;  4YKG A;  3R2Q A;  1GUH A;  3ZRE A;  4NV5 A;  4PX1 A;  3RHC A;  5E59 A;  5EVO A;  1N8J A;  5B7C A;  1DBY A;  1U6T A;  4O5R A;  4G9H A;  1ML6 A;  5KN0 A;  2MZC A;  3RDW A;  3A2V A;  1TJD A;  1SJZ A;  3DKS A;  4Z2T A;  2XC2 A;  3F6D A;  3IR4 A;  3C71 A;  4ZB6 A;  4G0K A;  2BMX A;  1ABA A;  3LSZ A;  2DLX A;  4K1F A;  4EUY A;  5HR1 A;  2JAC A;  4G2E A;  1AC1 A;  4POL A;  4K5S A;  3DYR A;  2K6V A;  4K2D A;  3G9B A;  1QQ2 A;  2P5R A;  2YZU A;  2LUS A;  2VM1 A;  3GV1 A;  4A5P A;  2HRF A;  4GSN A;  2JSY A;  2LST A;  1HNB A;  4IJ3 A;  1GH2 A;  3ME8 A;  5KN3 A;  4WR4 A;  2O89 A;  1AQV A;  5CRE A;  2HFD A;  3A2X A;  4JRR A;  3LGC A;  4PQI A;  5AIX A;  1MTC A;  2MMA A;  2KUC A;  1EOH A;  4OO4 A;  2H0G A;  2IL3 A;  4G10 A;  3ZL5 A;  3VPQ A;  1TOF A;  3TB2 A;  1YJ6 A;  5G31 A;  4EO3 A;  1XWK A;  3ZZX A;  2LQQ A;  1K0A A;  1U3I A;  1OC8 A;  4O5U A;  1HNC A;  5AGY A;  1MD3 A;  2H0I A;  2YJ7 A;  3QDN A;  2JZS A;  3ZVJ A;  4ACS A;  2VAF A;  4TOP A;  4MLY A;  4ZIJ A;  3M8N A;  1EGO A;  3DEX A;  4GST A;  1XWG A;  2XHF A;  4L0U A;  2C8U A;  2FHE A;  4IHU A;  2X8C A;  3HD5 A;  1GTB A;  2WGR A;  1RK4 A;  2IMK A;  5CRG A;  5ELG A;  4ZB9 A;  1GL8 A;  2DBC A;  8GSS A;  5IMA A;  1FVJ A;  3IK7 A;  3NZN A;  1TRV A;  3BJ5 A;  5GAN D;  3LOR A;  3KEB A;  2CAI A;  3KTL A;  1M2A A;  4ZBA A;  3LQ7 A;  4XRA A;  2GT6 A;  2CZ3 A;  1BG5 A;  2O85 A;  5DAL B;  2A2P A;  3MDK A;  4CY8 A;  4Q5Q A;  4AF2 A;  2REM A;  2R0P A;  3ZFB A;  2B5X A;  3ERG A;  3A5I A;  1CQH A;  5DCG A;  3VPT A;  1GSS A;  4TN8 A;  1AUC A;  5C04 A;  3GL3 A;  4MP4 A;  3KTB A;  2C3Q A;  2H30 A;  5D9T A;  5GST A;  4OWY A;  3UMA A;  1XWA A;  1B9Y C;  2GSQ A;  4TR3 A;  1OYJ A;  1GTI A;  6GSS A;  2J9H A;  2KP1 A;  4ML1 A;  4EDY A;  10GS A;  3MNG A;  1C72 A;  2C4J A;  3TJB A;  5FWG A;  1TDI A;  3QD9 A;  4HQZ A;  5ECH B;  7GSS A;  2K18 A;  3I69 A;  3EU4 A;  5JWQ B;  2K8S A;  4K0N A;  1SL1 B;  5D93 A;  2H6X A;  1MDK A;  4HQS A;  5D9V A;  4PUF C;  3C1R A;  3L9V A;  2IPA A;  3LYP A;  5DAL A;  3FW2 A;  4DEJ A;  1ERU A;  5IM9 A;  2B1K A;  1H75 A;  2YWO A;  5DDL A;  3IPZ A;  1SYX A;  4MJA A;  4I97 A;  4V2N A;  1QXH A;  5GZZ B;  2VCQ A;  2B7J A;  1SKW B;  5ECO B;  4EC0 A;  1X5D A;  3H1N A;  1AQW A;  1I9D A;  4O92 A;  5JCU A;  4BVY B;  1DUG A;  3TKS E;  2IFQ B;  1JFU A;  2FGX A;  2IJY A;  4J2F A;  1F6M C;  4NV2 A;  2KOK A;  2GVP A;  1PGT A;  2PN8 A;  4ECI A;  2OA7 A;  1G7O A;  3FHK A;  3EU3 A;  1Q98 A;  2B5Y A;  3F4R A;  2VUP A;  2C3T A;  1PA3 A;  5IIZ A;  1PSQ A;  1GTU A;  5H5Q A;  1YZX A;  3TJG A;  1DE1 A;  3TCO A;  5J9B A;  4KA0 A;  1F2E A;  1XFL A;  1JZR A;  4WBJ A;  3TKS C;  1Z5Y E;  2BTO T;  3FZ5 A;  1Q4J A;  4G19 A;  4HUA A;  2YWM A;  4MZB A;  1B4Q A;  1YF1 A;  3VLN A;  3H8Q A;  5ELA A;  2LKU A;  4BVY A;  1S3R A;  3QAV A;  1SD9 A;  3VWW A;  2IFQ A;  2B3S A;  5DJL A;  22GS A;  4PNF A;  1SL0 B;  2OKA A;  4TR1 B;  5EPF A;  3GH6 A;  1TXX A;  3GA4 A;  4J57 E;  1ON4 A;  2QA1 A;  4XS6 A;  3CRU A;  4N30 A;  1E2Y A;  2QA2 A;  2YPM A;  2RLI A;  2E7P A;  2JL4 A;  4QQ7 A;  1AW9 A;  3GTU B;  1USB A;  3GHA A;  1WOU A;  2WFC A;  2ZNM A;  2AJQ B;  1IYH A;  3DWV A;  3CBU A;  3UBL A;  3F9U A;  3P2A A;  4MK3 A;  1XXU A;  3E3E A;  4O7H A;  2HE3 A;  1XW6 A;  3TGZ A;  1HD2 A;  4V2L A;  1ZZY A;  1Z7R A;  1TRU A;  4EL1 A;  5CAX A;  3PR8 A;  1GNW A;  1M3J A;  3TKR A;  2JZT A;  4E8E A;  5E4W A;  2C0E A;  2L5O A;  1FG4 A;  3LYK A;  2VLV A;  2O8V B;  1AXD A;  4TR1 A;  4KF9 A;  3UL3 A;  3QAG A;  5CP1 A;  4GQF A;  4PQH A;  3ED3 A;  2GQK A;  1EP7 A;  4IQA A;  4TXO A;  2X4A A;  3RHB A;  1F3B A;  3ZMK A;  1PKW A;  1X9M B;  2K8V A;  3UOM A;  5HQP A;  1A2J A;  1T3B A;  1O85 A;  1ST9 A;  1BAY A;  1O7U A;  1YEX A;  1EEJ A;  1PX6 A;  2BJX A;  3HJO A;  4I6X A;  1ZMA A;  2F3M A;  4POK A;  1V2A A;  2IN3 A; 
#chains in the Genus database with same CATH homology
 1MDJ A;  2WUL A;  4F9Z A;  3FZ9 A;  2HSY A;  3WGD A;  4K0G A;  5ECL B;  1R7H A;  2RUE A;  5G5F A;  2LV3 A;  4V2M A;  2C0F A;  3LW9 A;  3EE2 A;  3KJY A;  3Q6O A;  4I8B A;  2ON7 A;  1Y25 A;  4TKY A;  4OO5 A;  3HYP A;  4CHS A;  3BCK A;  1YKA A;  3GKK A;  3MIX A;  3Q74 A;  4GTU A;  3KM6 A;  3C73 A;  1PL2 A;  2OE1 A;  5CRW A;  4AJ8 A;  1LU4 A;  2GZZ A;  1XVW A;  3LG6 A;  2DIZ A;  1SJI A;  3F4T A;  5BMU A;  2B1L A;  4MF5 A;  2JSZ A;  2VCZ A;  1KEB A;  2VOC A;  4DSQ A;  4AJ7 A;  3HXS A;  2L57 A;  2YOI A;  1OE7 A;  5GSS A;  4ZL8 A;  2GS3 A;  1EOG A;  1PN0 A;  4F03 A;  2QSI A;  1TTZ A;  4WF4 A;  3GKX A;  2DJ0 A;  3DVX A;  2C0G A;  3QAW A;  5LCZ A;  5DVB A;  1K0O A;  2LJA A;  2N5A A;  5COH A;  4MDC A;  2WDU A;  4KUN A;  3ZFL A;  2FWH A;  1V57 A;  3ERF A;  2GGT A;  2L59 A;  3O3T A;  3KZQ A;  5ECM B;  4JU5 A;  4IW9 A;  1Z7P A;  3A5W A;  1MEK A;  3MWH A;  2FA8 A;  3GST A;  4GCI A;  4IN0 A;  4KH7 A;  1W89 A;  4EE0 A;  3FR3 A;  4K7I A;  4IEL A;  1TRS A;  4F0B A;  2G2Q A;  2CVK A;  4IKH A;  4IS0 A;  2L6D A;  3FYG A;  2IMF A;  3L4N A;  2L4Q A;  2VLT A;  3UVT A;  2L6C A;  2E0Q A;  1XZO A;  5JWO B;  2MBT A;  5A5K A;  1XW5 A;  1X0R A;  3FR6 A;  4LMV A;  1OE8 A;  1YEP A;  4DSS B;  2FNO A;  1G6W A;  1FB6 A;  3D22 A;  4V1A p;  1F9M A;  1TW9 A;  4WXT A;  1B4P A;  3N5O A;  3CXG A;  2YJH A;  2GTU A;  3HVX A;  2H01 A;  3M3M A;  1OC3 A;  4GRF A;  4HI7 A;  4BWS A;  3CSI A;  3QPM A;  1EGR A;  1PMT A;  2YV7 A;  5JCG A;  2WCI A;  1S3C A;  1ERT A;  4POM A;  2IMD A;  5IMF A;  5IQY A;  5IOX A;  1T7P B;  4KND A;  3ME7 A;  3QFA C;  1URM A;  1G0T A;  2LRT A;  4KGI A;  5IMD A;  4KDY A;  2CX4 A;  4ML6 A;  3FY7 A;  2GLR A;  1TP9 A;  3I6A A;  4OCF A;  16GS A;  3KGK A;  2E2M A;  2LQO A;  2P5Q A;  2EIO A;  1WE0 A;  2MYG A;  1KBN A;  3Q19 A;  5B8B A;  5BRT A;  1THO A;  2H8L A;  4XRD A;  3IK9 A;  4DSS A;  2VL2 A;  3UBK A;  2DJ1 A;  2DC5 A;  2YAN A;  4BWQ A;  5G1L A;  1PKZ A;  3US3 A;  3GNJ A;  3PGT A;  2OE3 A;  1YDK A;  2B6M A;  1HYU A;  4K6X A;  3F0I A;  2TRC P;  5ECI B;  3VI5 A;  2WRT A;  1R26 A;  4K7N A;  3FKF A;  2GST A;  3QCP A;  5ECQ B;  5LNK e;  4EDZ A;  1U3A A;  4X1U A;  3D0Z A;  3L9U A;  2GSS A;  2IIY A;  5HR2 A;  4TVE A;  1BED A;  4J56 E;  3VWU A;  1RQM A;  4NWY A;  1R4W A;  1XOB A;  1SD8 A;  3TRX A;  4DSR A;  4DVC A;  1K0M A;  2RUF A;  2CVB A;  2C3N A;  2CA8 A;  2LJK A;  2KLX A;  4K8M A;  2F9S A;  2EIQ A;  1EP8 A;  1THX A;  2NDO A;  4TXV A;  3TKQ A;  3O6T A;  1RW1 A;  1SEN A;  2H72 A;  2IMI A;  3TJK A;  4KCA A;  3CSJ A;  3UJ1 A;  3DD3 A;  4HJM A;  1XCC A;  1TU7 A;  2VL3 A;  1QK8 A;  3W6G A;  2H76 A;  4QL7 A;  5J9C A;  2H1B A;  2I3Y A;  1M99 A;  3KXO A;  1Z6N A;  1K0N A;  1WP0 A;  5HFK A;  2FY6 A;  3ZIT A;  3FEU A;  5D9W A;  2V41 A;  3KD0 A;  1TU8 A;  4MAB A;  1HQO A;  1OKT A;  3FZA A;  3MAK A;  2P0G A;  1A23 A;  2HI7 A;  3S9F A;  3DXB A;  3GN3 A;  5DCH A;  3LFL A;  4XS1 A;  4WR5 A;  1SU9 A;  2CZ2 A;  1FVK A;  3I9V 2;  4IBP A;  3HA9 A;  3IBH A;  2OAD A;  2GDR A;  3D21 A;  5IOW A;  4QL9 A;  1WMJ A;  3GYK A;  5C00 A;  4PGT A;  3GX8 A;  1ACV A;  2R2J A;  5ABR A;  4KE3 A;  2VL9 A;  3TRQ A;  4MJC A;  3L0H A;  1JLV A;  3WYW A;  3CSH A;  1JZD A;  1EV9 A;  2L5L A;  2VM2 A;  1A2M A;  3C8E A;  2C1Y A;  3TJJ A;  3D4M A;  4KB3 A;  5IMZ A;  3UAR A;  2R6K A;  4Q5F A;  1O8X A;  3IXR A;  4FO5 A;  2DJK A;  1A24 A;  2X99 A;  1VGL A;  4XS4 B;  1WPI A;  2I81 A;  4YH2 A;  4BL7 B;  1WJK A;  4V1A g;  5JWR B;  2HRA A;  5DQS A;  3HZ4 A;  3PH9 A;  2EC4 A;  1UC7 A;  4N0Z A;  3ZLP A;  5A4U A;  2ALB A;  1OKD A;  5G2Z A;  1GSY A;  1S3D A;  1ZGN A;  4F0C A;  2KP2 A;  3HKR A;  3IHG A;  4Q5R A;  4JZQ A;  5KN2 A;  5H5S A;  1GRX A;  20GS A;  3SBC A;  3ISO A;  1QGV A;  3Q18 A;  4BPY A;  2H6Y A;  2NPB A;  3DGQ A;  2I4A A;  3KH7 A;  4PUR A;  1SK2 A;  5L71 A;  4OFT A;  2R5G A;  1DSB A;  2YV9 A;  2EIR A;  1X5E A;  2RM6 A;  2K9F A;  2AV4 A;  3EMX A;  1Y6E A;  2X8H A;  5A4W A;  2HLS A;  1A0F A;  4HEA 2;  4GF0 A;  4AJ6 A;  3ZYW A;  2VO4 A;  4KCE A;  1ZL9 A;  4XS4 A;  2JAD A;  3TRP A;  2MMN A;  1F3A A;  4BL7 A;  1M2D A;  1TK8 B;  1M9A A;  2C80 A;  1GUM A;  3HDC A;  2R4V A;  4MZW A;  2AAW A;  1PL1 A;  2O87 A;  4IJI A;  3PIN A;  1G7E A;  1TK0 B;  13GS A;  3ZVJ D;  3MSZ A;  2F8F A;  2VD1 A;  1GSF A;  1GUK A;  4L8E A;  5J41 A;  3KMO A;  3MYD A;  4GQC A;  2B5E A;  3CMI A;  4EIP A;  4YQV A;  3TOT A;  1TI1 A;  4IP6 A;  1JHB A;  1JLW A;  4K7O A;  2GQM A;  4HZ2 A;  2VL2 C;  1B8X A;  3DML A;  4IQ1 A;  1LJR A;  1BJX A;  2X64 A;  1K0C A;  4MPF A;  1GP1 A;  4MH2 A;  1GNE A;  4ID0 A;  4MNN A;  4ZL9 A;  1CQG A;  3L9S A;  5F06 A;  1TKD B;  2PMT A;  3RBT A;  4OD7 A;  2AHE A;  3AY8 A;  3HVV A;  3DRN A;  1TRW A;  3L78 A;  1A0R P;  4AGS A;  4RI6 A;  3N9J A;  3GX0 A;  4FQU A;  3OR5 A;  1NW2 A;  3HVS A;  4FIW A;  5AIS A;  4N10 A;  3TJF A;  2HRK A;  4ECC A;  3RPN A;  2DML A;  1ZYE A;  3GTU A;  1KTE A;  2VCT A;  4HZ4 A;  4MJE A;  3GSS A;  2HT9 A;  4XHM A;  2NVL A;  3K8N A;  4HOJ A;  18GS A;  1T00 A;  4ZBB A;  4YQU A;  2LRN A;  4GLT A;  4X43 A;  1SL2 B;  2PPT A;  5CRD A;  2MMZ A;  5JCW A;  1H4O A;  3EYT A;  1M9B A;  3GMF A;  4EIQ A;  3HJP A;  4GSS A;  11GS A;  5D9X A;  3H4K A;  4KDX A;  4WEY A;  3UAP A;  2TRX A;  4MH3 A;  4ZL7 A;  2H71 A;  1J08 A;  3ZRD A;  2J23 A;  3IA1 A;  2A4H A;  3LEF A;  4PUA A;  3APO A;  3CRT A;  2LRC A;  2X8G A;  4G0L A;  2A2S A;  2D2Z A;  4PQ1 A;  1XW9 A;  3BBY A;  4CY6 A;  4WKW A;  1T8E B;  1S3A A;  1M0U A;  1SYR A;  3R3E A;  1WIK A;  6GSX A;  5J4U A;  3E0U A;  2V2G A;  2TIR A;  3VUR A;  4L5O A;  1QMV A;  2DJ3 A;  4JED A;  5DQY A;  3EMP A;  4RQX A;  1GSQ A;  4YAP A;  2PVO C;  3FK8 A;  4IP1 A;  4JE1 A;  2F8A A;  3VI7 A;  4ZB8 A;  2LJR A;  4P3Y B;  2ON5 A;  1Z6M A;  1SKR B;  1TI3 A;  1XBS A;  3IC8 A;  4ZXG A;  3WT1 A;  2LNT A;  2H0H A;  2H74 A;  3WGX A;  3SWL A;  4WBR D;  2PU9 C;  3KCM A;  2N5B A;  1UN2 A;  2DJJ A;  4KX4 A;  1PX7 A;  2H6Z A;  4FYC A;  3BOA A;  1N2A A;  4ZIL A;  2UZ8 A;  5AIV A;  1ZYP A;  3M1G A;  1KNG A;  2XPD A;  4MZC A;  5CO3 A;  4F2I A;  3IOS A;  3KH9 A;  1OAZ A;  5B6N A;  3GH9 A;  2Z9S A;  3EC3 A;  5A4V A;  2HYX A;  4YAV A;  4Z2U A;  5DBQ A;  5J3R A;  1XPV A;  2GSR A;  3EUR A;  1M2B A;  4ICY A;  1GUL A;  4WF5 A;  2PER A;  3APS A;  3P90 A;  1U88 A;  3A2W A;  4YKF A;  3KMN A;  1HNA A;  4L5L A;  3TKS A;  1E6B A;  2VIM A;  2ES7 A;  4NPB A;  19GS A;  4GXZ A;  4HS1 A;  2DMM A;  2YWN A;  1V40 A;  3V1W A;  4Z7X A;  1EZK A;  3UVH A;  1PN9 A;  3D5J A;  2B7K A;  6GSY A;  2M80 A;  2V6O A;  5KOW A;  1IYI A;  4ECB A;  1NM3 A;  1J9B A;  1ERW A;  3KP8 A;  3KP9 A;  2H19 A;  2KHP A;  4ECJ A;  2AB6 A;  2H1D A;  2GQL A;  3M9J A;  3IHQ A;  1GSD A;  1ZCP A;  3TDG A;  2H70 A;  5F07 A;  1AQX A;  3O76 A;  1EWX A;  1BYE A;  3I43 A;  14GS A;  2VCV A;  2PBJ A;  3GKM A;  1WRY A;  4WET A;  2I9H A;  1B9X C;  2DKI A;  3KIJ A;  4JR6 A;  1J0F A;  1GTA A;  1GSE A;  2ZCT A;  2R3X A;  2HZE B;  1A8L A;  2NTO A;  1V58 A;  3U5R E;  2A4V A;  3IC4 A;  4USS A;  4PTS A;  4RQR A;  4XIH A;  3QMX A;  3FR9 A;  5FHI A;  4JR4 A;  3ERW A;  3QFB C;  2FWF A;  3VFI A;  3E9J B;  5HFG A;  1GLQ A;  2CT6 A;  5IMC A;  4LL1 B;  4XCS A;  5F8B A;  3PPU A;  4LLR A;  4ZBD A;  1F37 A;  1YY7 A;  2GZY A;  4KSM A;  2RII A;  2XBQ A;  1X9S B;  5DAK B;  4MCU A;  5CYY A;  3G7J A;  2P31 A;  1GWC A;  2H75 A;  2HSM A;  3EIN A;  3G7Y A;  5IPG A;  1LBK A;  4ISD A;  2QGV A;  3APQ A;  3W8S A;  3HJM A;  2QC7 A;  2R0C A;  3P8W A;  2HNL A;  2V6K A;  4YQM A;  1R5P A;  2JU5 A;  5DJM A;  1SKS B;  4OCE A;  4RI7 A;  2FUG 2;  3F3Q A;  2HZE A;  5ID2 B;  5G1K A;  1MD4 A;  2FCH A;  1QFN A;  4NXI A;  12GS A;  1AAZ A;  3WT2 A;  5IPH A;  1R5A A;  4RUV A;  1O6J A;  5HR3 A;  5CRH A;  1BQ7 A;  3IE3 A;  3HY2 A;  4MF7 A;  2CV4 A;  4Z2R A;  3FMW A;  4FYB A;  4K5R A;  4HU7 A;  5EY6 A;  4EXJ A;  1O81 A;  3F3R A;  3UEM A;  3NIV A;  1JZW A;  3D6I A;  2VD0 A;  5DAK A;  3GUR A;  3TKP A;  2M72 A;  2WS2 A;  1K0D A;  4K2X A;  1T1V A;  2O7K A;  5KOX A;  1OVN A;  2HZF A;  1Z9H A;  1O73 A;  4X0X A;  4F82 A;  2OJL A;  3ZTL A;  3A3T A;  2QKE A;  1A2L A;  1PQN A;  4HDE A;  2WB9 A;  5IMV A;  3C7M A;  5ID2 A;  1JZO A;  4TRX A;  2E2G A;  2LNS A;  3ZML A;  1SK1 A;  5G30 A;  4HJ2 A;  2V1M A;  1FW1 A;  5KN1 A;  3LXT A;  2PWJ A;  4BVX B;  2DKH A;  4N0V A;  2HRN A;  1MDI A;  4EVM A;  4IVF A;  1AIU A;  6GSU A;  5EL8 A;  4GWR A;  2AUV A;  9GSS A;  4KAE A;  6GSV A;  1T4Y A;  5IO2 A;  4L0W A;  3UIW A;  3F8U A;  4K9Z A;  4I2T A;  3RPP A;  3TOU A;  4CDO A;  5INY A;  4D73 B;  2YZH A;  1G6Y A;  2OAC A;  3W8J A;  3ZIJ A;  3D4T A;  2OBK A;  3LJR A;  2WJU A;  3GUS A;  2CVD A;  4MJB A;  2H66 A;  2JZR A;  5D8I A;  1FAA A;  5ECP B;  3G7I A;  1GLP A;  1FO5 A;  5ENU A;  3GIX A;  1WWJ A;  1TK5 B;  4BVX A;  3HHV A;  2ZUP A;  4I5Q A;  2GZP A;  4G0I A;  5F0G A;  1ERV A;  1K3O A;  2LEG A;  1V9W A;  3WGE A;  3TUE A;  1FHE A;  1XWB A;  2YCD A;  1VRS D;  2MBS A;  2AYT A;  1NHO A;  5B8A A;  1OC9 B;  4TR0 A;  4IGJ A;  4HU9 A;  4OMV A;  1PD2 1;  4H86 A;  3GKN A;  4KDU A;  4D73 A;  1VF3 A;  2PVQ A;  4TXO B;  1SJ6 A;  4NMU A;  3WD6 A;  2V32 A;  3F63 A;  1FB0 A;  3QR6 A;  2YNX A;  3IAM 2;  2VCW A;  1XOA A;  2GT5 A;  5ECR B;  4EF0 A;  3F4S A;  1ZYQ B;  3BCI A;  5CNW A;  3C1S A;  5AN1 A;  1ZOF A;  4OFM A;  2YWI A;  4LL4 B;  2DSA A;  3ZIV A;  2OE0 A;  2YN1 A;  5FT3 A;  2FD3 A;  1UVZ A;  2PGT A;  1M7T A;  4MMM A;  4JBB A;  1FOH A;  1UA5 A;  1Z3E A;  2FA4 A;  1OC9 A;  1SK0 A;  4ULX A;  4PNG A;  1VF1 A;  5D96 A;  4KSO A;  3F6F A;  4NHZ A;  3FRC A;  4Q5N A;  1EV4 A;  5KEJ A;  2CX3 A;  3DVW A;  1VF4 A;  5ECN B;  3DIE A;  2H1G A;  5D73 A;  1GSU A;  4BA7 A;  3HZ8 A;  17GS A;  1PRX A;  4FYU A;  4PXO A;  3M0F A;  4LA1 A;  4N11 A;  1T4Z A;  4NAX A;  1O8W A;  5B6M A;  5J5N A;  4ILF A;  3VWV A;  5G5E A;  4E8H A;  2HSH A;  3U6V A;  6GSW A;  1A8Y A;  4LMW A;  3JCM L;  1DE2 A;  3P7X A;  2RM5 A;  4EKZ A;  4TR4 A;  5IO0 A;  6GST A;  4O32 A;  3NOF A;  1V98 A;  3HCZ A;  2F51 A;  4POB A;  2PUK C;  4CW9 A;  1I5G A;  2LTK A;  1XVQ A;  2NBS A;  4O5Q A;  3RAZ A;  2VLU A;  3GFK A;  4I2U A;  3IRA A;  3GRX A;  3EPT A;  2WZ9 A;  4MF6 A;  1K3L A;  3IV4 A;  5ECS A;  1K0B A;  1FOV A;  1NHY A;  2CAQ A;  2MMO A;  1X5C A;  5HR0 A;  3H93 A;  4OFN A;  1YQ1 A;  3EWL A;  2OBI A;  2C0D A;  1K3Y A;  2LS5 A;  3QOU A;  1EEM A;  3EVI A;  1XIY A;  2FLS A;  1VF2 A;  2IME A;  2YP6 A;  1B48 A;  2HXK A;  2R37 A;  3CYN A;  2DJ2 A;  3BD2 A;  2H73 A;  2CQ9 A;  4TW5 A;  1QUW A;  2FWG A;  4FH8 A;  3J7Y k;  3FZ4 A;  1ILO A;  4XTS A;  2X49 A;  4MA9 A;  5F05 A;  2XPE A;  2VCX A;  2N5F A;  2M46 A;  2G0F A;  2A2R A;  2R0G A;  2IWT A;  5LD0 A;  1YF0 A;  2FWE A;  1NSW A;  3IDV A;  4NHW A;  1U87 A;  4KW6 A;  1W4V A;  3LXZ A;  1ZYN A;  4X4J A;  5H5R A;  2DIY A;  3VWX A;  5HFI A;  2XBI A;  4MPG A;  5ECK B;  2H1A A;  3CTG A;  3J7Y b;  3LWA A;  1XWC A;  3IAS 2;  1X9W B;  1YKC A;  3H79 A;  5GAP D;  3CTF A;  3VK9 A;  2I1U A;  3M9K A;  1BX9 A;  2L4C A;  3GL5 A;  4YKG A;  3R2Q A;  1GUH A;  3ZRE A;  4NV5 A;  4PX1 A;  3RHC A;  5E59 A;  5EVO A;  1N8J A;  5B7C A;  1DBY A;  1U6T A;  4O5R A;  4G9H A;  1ML6 A;  5KN0 A;  2MZC A;  3RDW A;  3A2V A;  1TJD A;  1SJZ A;  3DKS A;  4Z2T A;  2XC2 A;  3F6D A;  3IR4 A;  3C71 A;  4ZB6 A;  4G0K A;  2BMX A;  1ABA A;  3LSZ A;  2DLX A;  4K1F A;  4EUY A;  5HR1 A;  2JAC A;  4G2E A;  1AC1 A;  4POL A;  4K5S A;  3DYR A;  2K6V A;  4K2D A;  3G9B A;  1QQ2 A;  2P5R A;  2YZU A;  2LUS A;  2VM1 A;  3GV1 A;  4A5P A;  2HRF A;  4GSN A;  2JSY A;  2LST A;  1HNB A;  4IJ3 A;  1GH2 A;  3ME8 A;  5KN3 A;  4WR4 A;  2O89 A;  1AQV A;  5CRE A;  2HFD A;  3A2X A;  4JRR A;  3LGC A;  4PQI A;  5AIX A;  1MTC A;  2MMA A;  2KUC A;  1EOH A;  4OO4 A;  2H0G A;  2IL3 A;  4G10 A;  3ZL5 A;  3VPQ A;  1TOF A;  3TB2 A;  1YJ6 A;  5G31 A;  4EO3 A;  1XWK A;  3ZZX A;  2LQQ A;  1K0A A;  1U3I A;  1OC8 A;  4O5U A;  1HNC A;  5AGY A;  1MD3 A;  2H0I A;  2YJ7 A;  3QDN A;  2JZS A;  3ZVJ A;  4ACS A;  2VAF A;  4TOP A;  4MLY A;  4ZIJ A;  3M8N A;  1EGO A;  3DEX A;  4GST A;  1XWG A;  2XHF A;  4L0U A;  2C8U A;  2FHE A;  4IHU A;  2X8C A;  3HD5 A;  1GTB A;  2WGR A;  1RK4 A;  2IMK A;  5CRG A;  5ELG A;  4ZB9 A;  1GL8 A;  2DBC A;  8GSS A;  5IMA A;  1FVJ A;  3IK7 A;  3NZN A;  1TRV A;  3BJ5 A;  5GAN D;  3LOR A;  3KEB A;  2CAI A;  3KTL A;  1M2A A;  4ZBA A;  3LQ7 A;  4XRA A;  2GT6 A;  2CZ3 A;  1BG5 A;  2O85 A;  5DAL B;  2A2P A;  3MDK A;  4CY8 A;  4Q5Q A;  4AF2 A;  2REM A;  2R0P A;  3ZFB A;  2B5X A;  3ERG A;  3A5I A;  1CQH A;  5DCG A;  3VPT A;  1GSS A;  4TN8 A;  1AUC A;  5C04 A;  3GL3 A;  4MP4 A;  3KTB A;  2C3Q A;  2H30 A;  5D9T A;  5GST A;  4OWY A;  3UMA A;  1XWA A;  1B9Y C;  2GSQ A;  4TR3 A;  1OYJ A;  1GTI A;  6GSS A;  2J9H A;  2KP1 A;  4ML1 A;  4EDY A;  10GS A;  3MNG A;  1C72 A;  2C4J A;  3TJB A;  5FWG A;  1TDI A;  3QD9 A;  4HQZ A;  5ECH B;  7GSS A;  2K18 A;  3I69 A;  3EU4 A;  5JWQ B;  2K8S A;  4K0N A;  1SL1 B;  5D93 A;  2H6X A;  1MDK A;  4HQS A;  5D9V A;  4PUF C;  3C1R A;  3L9V A;  2IPA A;  3LYP A;  5DAL A;  3FW2 A;  4DEJ A;  1ERU A;  5IM9 A;  2B1K A;  1H75 A;  2YWO A;  5DDL A;  3IPZ A;  1SYX A;  4MJA A;  4I97 A;  4V2N A;  1QXH A;  5GZZ B;  2VCQ A;  2B7J A;  1SKW B;  5ECO B;  4EC0 A;  1X5D A;  3H1N A;  1AQW A;  1I9D A;  4O92 A;  5JCU A;  4BVY B;  1DUG A;  3TKS E;  2IFQ B;  1JFU A;  2FGX A;  2IJY A;  4J2F A;  1F6M C;  4NV2 A;  2KOK A;  2GVP A;  1PGT A;  2PN8 A;  4ECI A;  2OA7 A;  1G7O A;  3FHK A;  3EU3 A;  1Q98 A;  2B5Y A;  3F4R A;  2VUP A;  2C3T A;  1PA3 A;  5IIZ A;  1PSQ A;  1GTU A;  5H5Q A;  1YZX A;  3TJG A;  1DE1 A;  3TCO A;  5J9B A;  4KA0 A;  1F2E A;  1XFL A;  1JZR A;  4WBJ A;  3TKS C;  1Z5Y E;  2BTO T;  3FZ5 A;  1Q4J A;  4G19 A;  4HUA A;  2YWM A;  4MZB A;  1B4Q A;  1YF1 A;  3VLN A;  3H8Q A;  5ELA A;  2LKU A;  4BVY A;  3QAV A;  1SD9 A;  3VWW A;  2IFQ A;  2B3S A;  5DJL A;  22GS A;  4PNF A;  1SL0 B;  2OKA A;  4TR1 B;  5EPF A;  3GH6 A;  1TXX A;  3GA4 A;  4J57 E;  1ON4 A;  2QA1 A;  4XS6 A;  3CRU A;  4N30 A;  1E2Y A;  2QA2 A;  2YPM A;  2RLI A;  2E7P A;  2JL4 A;  4QQ7 A;  1AW9 A;  3GTU B;  1USB A;  3GHA A;  1WOU A;  2WFC A;  2ZNM A;  2AJQ B;  1IYH A;  3DWV A;  3CBU A;  3UBL A;  3F9U A;  3P2A A;  4MK3 A;  1XXU A;  3E3E A;  4O7H A;  2HE3 A;  1XW6 A;  3TGZ A;  1HD2 A;  4V2L A;  1ZZY A;  1Z7R A;  1TRU A;  4EL1 A;  5CAX A;  3PR8 A;  1GNW A;  3TKR A;  2JZT A;  4E8E A;  5E4W A;  2C0E A;  2L5O A;  1FG4 A;  3LYK A;  2VLV A;  2O8V B;  1AXD A;  4TR1 A;  4KF9 A;  3UL3 A;  3QAG A;  5CP1 A;  4GQF A;  4PQH A;  3ED3 A;  2GQK A;  1EP7 A;  4IQA A;  4TXO A;  2X4A A;  3RHB A;  1F3B A;  3ZMK A;  1PKW A;  1X9M B;  2K8V A;  3UOM A;  5HQP A;  1A2J A;  1T3B A;  1O85 A;  1ST9 A;  1BAY A;  1O7U A;  1YEX A;  1EEJ A;  1PX6 A;  2BJX A;  3HJO A;  4I6X A;  1ZMA A;  2F3M A;  4POK A;  1V2A A;  2IN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...