1VGLA

Crystal structure of tetrameric kaib from t.elongatus bp-1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
KTYVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKILATPCLAKVLPPPVRRIIGDLSNREKVLIGLDLLYEEIGDQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Circadian clock protein
molecule keywords Circadian clock protein kaiB
publication title Functionally important substructures of circadian clock protein KaiB in a unique tetramer complex.
pubmed doi rcsb
source organism Thermosynechococcus elongatus bp-1
total genus 22
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07689 KaiB KaiB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1vglA00
4G19A 1A8LA 2ON5A 2GSSA 1BAYA 5EL8A 1XVQA 1EWXA 4F9ZA 1JZWA 1B9XC 2CAIA 5ENUA 4OFNA 3IC4A 2I4AA 3EMXA 4XRDA 1GUHA 3E0UA 1XW5A 1EOGA 6GSYA 1ERWA 3GURA 2I9HA 3ZYWA 3ZITA 2C3NA 3KMNA 1HYUA 2OBKA 2JZSA 2QC7A 2K9FA 5D9TA 4POLA 2YJ7A 2C4JA 1QK8A 2HZFA 3LSZA 2XC2A 3CSIA 4KUNA 4EDZA 1HNAA 2VL2A 1EEMA 4GSTA 4MJEA 2V2GA 3TJJA 3KJYA 4MDCA 4ZL7A 3RHBA 2R5GA 1X5DA 4F82A 4EF0A 2LUSA 3KCMA 4WBJA 4PGTA 2L4QA 2N5AA 3FZAA 3GTUA 3C1SA 3LEFA 1B4PA 4PUFC 2X8GA 4GQCA 3W6GA 3VWXA 1B4QA 3F3RA 1SKWB 1UVZA 2OACA 2VO4A 1OVNA 4RUVA 4BVYA 1O81A 3ISOA 3GH9A 4K6XA 2IMFA 1GLPA 2GS3A 5JCWA 2ZUPA 2B5XA 4CHSA 4GSSA 1XWCA 2DJKA 4K8MA 4WEYA 5G2ZA 4AJ6A 3FR9A 1UC7A 5IOXA 3F4SA 2VOCA 1R5PA 3KTLA 4Q5FA 2P5RA 2L59A 3QMXA 3EWLA 1VGLA 1WIKA 4KGIA 1PGTA 4X0XA 2KHPA 3HCZA 4ZIJA 4ZILA 1XOBA 3KEBA 1T4YA 4GSNA 1EV4A 2ES7A 4XS6A 4YAVA 1FVJA 3P90A 1ST9A 3ED3A 4IQ1A 1QXHA 3RPNA 2H0GA 4ZB9A 1SJZA 4ECBA 2AHEA 3DYRA 1DUGA 1AIUA 2P0GA 2XPEA 3F4RA 1PX6A 3EU4A 6GSVA 2YV9A 1M0UA 16GSA 2CA8A 2JSYA 1LBKA 1XWKA 3ZLPA 5CAXA 1EP7A 5DCGA 4EL1A 4WR5A 1ZZYA 4F0BA 5DALB 1M2AA 2H72A 1TRVA 1A2JA 5CYYA 2CX3A 3DIEA 3RHCA 2LQQA 2VCQA 1V58A 2DSAA 2KOKA 1XCCA 1SJIA 4MF5A 3ZREA 3RAZA 2PPTA 1MDIA 1V57A 4O7HA 3L9SA 1FW1A 4EVMA 3M1GA 3KXOA 1FO5A 5H5QA 4DEJA 4MA9A 2TRCP 3VWVA 2TRXA 3ME7A 5LD0A 3M9KA 1V9WA 2VLVA 3FZ9A 2J23A 5J9BA 2FWHA 5C00A 1YY7A 1OKTA 4ZL9A 4TOPA 13GSA 1LU4A 3HJPA 4HU7A 3I69A 3IBHA 4DVCA 4FYBA 2L5LA 3APSA 4K2DA 4K7IA 1J0FA 2OE3A 3TB2A 3PR8A 4EE0A 4I2UA 2NVLA 3NOFA 4WF5A 4NHWA 1K3OA 4IW9A 4WETA 2FNOA 1YDKA 2YP6A 1GNWA 5LNKe 2DMMA 4TXVA 4MK3A 3L78A 3MNGA 3HVSA 2VAFA 2VD1A 4YQMA 1EGOA 3TJFA 1VF1A 5B6MA 1YJ6A 2I81A 4ZB6A 1THOA 3C71A 4MF6A 1ZOFA 4Q5NA 2FA8A 2C0EA 4BWQA 3J7Yb 3IK9A 2H1AA 2A4VA 3F63A 4KSMA 1O8WA 3HZ4A 1GTAA 8GSSA 3DVXA 1S3AA 4OD7A 4V1Ap 1EP8A 2LJRA 3C1RA 3LG6A 1X0RA 4HQSA 2H76A 1YQ1A 2VL2C 1K0OA 1B48A 1ILOA 4NXIA 3KH9A 3HY2A 4K7NA 1SD8A 4J57E 4GWRA 3M8NA 3AY8A 2MMZA 2L6CA 3I9V2 3VURA 1PL2A 1SYXA 2RM6A 1DE1A 1Z6NA 5JCGA 2WFCA 3GHAA 3HVVA 2C8UA 5COHA 3WGEA 2H6XA 2FGXA 5DBQA 1DSBA 4IQAA 1HQOA 1PA3A 5CRGA 1C72A 3FHKA 2AYTA 2E2GA 1R5AA 2LKUA 1OAZA 5HFKA 4KDYA 1WRYA 3NZNA 3IDVA 4V2LA 2GVPA 4RI6A 2NPBA 2O87A 3IK7A 3HJMA 3RDWA 2JADA 3PH9A 1TI3A 2H73A 4RI7A 5HFGA 4IS0A 4PNFA 5EY6A 5D73A 1FB6A 3UMAA 3EINA 5J3RA 5IMCA 4NMUA 2K6VA 20GSA 2AB6A 1GUKA 1IYIA 5L71A 4WBRD 2GDRA 2P31A 1VF2A 4AJ8A 4YAPA 5IMZA 3H4KA 1GSYA 2LNSA 1AC1A 1K3LA 1GNEA 1XWBA 5ECPB 2LTKA 3QAGA 2HI7A 5ECRB 5EPFA 2X8HA 2H74A 2V41A 5A4VA 2O85A 5HR3A 1E6BA 2FA4A 2H6ZA 4H86A 2YWIA 1J08A 1E2YA 2ALBA 3F4TA 3W8JA 1XBSA 2VCVA 2X99A 3VI7A 4XS4B 1U88A 3LXZA 3FZ5A 1K0AA 4FIWA 4KB3A 3A5WA 3GSTA 2QKEA 3VK9A 3VWUA 2H66A 2VCZA 5HR2A 3RPPA 2FCHA 5IOWA 2AV4A 2HZEA 2H19A 4PURA 2YNXA 3QFAC 2HSHA 1OC3A 4IN0A 1YZXA 1GTBA 1VRSD 1JFUA 3EE2A 2FWGA 2LRNA 1TK5B 4FO5A 2LJKA 3M9JA 2RUFA 5GZZB 2IFQB 3QDNA 4N0ZA 3KIJA 3VPTA 1TP9A 3UARA 3UVHA 2L6DA 1M7TA 3GMFA 5HQPA 1XXUA 4IJ3A 3UJ1A 4K7OA 2GQMA 4AJ7A 4ZBBA 4HJMA 1AAZA 2WZ9A 4L0UA 2MZCA 1URMA 1M9AA 5ECKB 3TJKA 5DAKA 3EURA 4GTUA 3O3TA 3D4MA 3TKSE 1XZOA 1NHYA 1FVKA 3DEXA 2EIQA 3D5JA 3G7JA 1DE2A 1X9MB 1SL0B 1ERUA 2YWNA 1XWGA 3VI5A 1TU8A 1TKDB 4D73A 2CT6A 2MBSA 1G7OA 3FKFA 3TCOA 2CX4A 4LL1B 4XCSA 2HZEB 3KP9A 3MDKA 1OYJA 4N10A 1MD4A 1PQNA 2V32A 2CQ9A 1TI1A 1NW2A 4HOJA 3DD3A 1KEBA 5IPHA 1GLQA 4Q5QA 4LMWA 4ML6A 3C73A 3QR6A 4FYUA 4KCAA 3E9JB 1YF0A 3IRAA 4ECJA 2HLSA 6GSSA 5DAKB 1M99A 2I3YA 5IMAA 1R4WA 1G7EA 4LL4B 1V98A 3APOA 3TKRA 3Q74A 1M2BA 1SKSB 4MH2A 1RQMA 3GYKA 2LEGA 4K9ZA 4JR4A 3DXBA 3TUEA 1GUMA 4NHZA 1CQGA 1X9SB 2MYGA 1WJKA 4HQZA 2DJJA 4D73B 3L9UA 1A24A 1EOHA 1PSQA 1Z5YE 2BMXA 2K8SA 2XHFA 4MF7A 2XPDA 5A4UA 1A8YA 1ZCPA 3CXGA 4PQIA 5ELAA 1JZDA 14GSA 3DMLA 2YWOA 1XWAA 4KW6A 5GAND 4L5LA 3D4TA 1H4OA 4N0VA 3Q18A 2PVQA 4KDXA 3TOTA 5J5NA 5G1KA 2YJHA 1TTZA 2WS2A 2JZRA 1SL2B 5E59A 1UN2A 3IR4A 1WOUA 3R2QA 1N2AA 4KSOA 4KX4A 2DC5A 1HNCA 4IHUA 1T1VA 5F06A 5DALA 6GSXA 1Q4JA 4LA1A 4TR1B 1U6TA 2K18A 1OC8A 1ZL9A 2CVKA 2WRTA 3ZZXA 2QGVA 3W8SA 1K0NA 1RW1A 3JCML 1TRWA 1GWCA 3KGKA 2WULA 3OR5A 2OBIA 1YEXA 3LGCA 2GZZA 2MMOA 2C1YA 2BJXA 1TK0B 4ZB8A 2H1DA 3KH7A 4GRFA 1BG5A 4EXJA 1PMTA 2FHEA 1SL1B 2KP2A 3BCIA 4E8HA 4CDOA 2MMAA 4EKZA 2JZTA 1M2DA 1EEJA 2QSIA 4YQVA 2D2ZA 1X9WB 3ERGA 4I2TA 5H5SA 2F8FA 11GSA 2E7PA 5FHIA 1EV9A 4IBPA 5IO2A 1A2MA 4GLTA 4MPGA 2G2QA 2WJUA 2GQLA 3ZMKA 4TVEA 2I1UA 1Y6EA 2FUG2 2TIRA 1XFLA 2GT5A 2VL9A 2RLIA 4POKA 4DSRA 3ZVJA 4ML1A 4X1UA 4MCUA 3NIVA 2AUVA 2LRCA 2GSRA 4XRAA 4PQHA 3LJRA 3LYPA 4BA7A 3LFLA 3TJBA 4OCEA 4IJIA 4MZWA 2VM2A 1NHOA 1WMJA 3TGZA 2B7JA 2BTOT 5G5EA 1GSSA 3L0HA 4GQFA 4PX1A 1U3AA 18GSA 4J56E 4MJAA 2F51A 3GH6A 2FWEA 1HD2A 5KEJA 1A0RP 4TR4A 3WD6A 2DIYA 3ZFBA 3GV1A 1F3AA 4YH2A 2YPMA 3WGXA 2GGTA 5CO3A 2IL3A 4PNGA 2PUKC 2YWMA 2R37A 3VPQA 2B3SA 4I8BA 2YN1A 4KDUA 1Q98A 1PRXA 5ECOB 2X8CA 2OA7A 1O73A 3P2AA 2VL3A 4MZCA 3V1WA 1WP0A 3IE3A 2JSZA 3HDCA 3ZIJA 5KN0A 4JZQA 1USBA 3D22A 3MWHA 3TKPA 1GSEA 2IJYA 4WR4A 6GSWA 2CZ2A 2DMLA 3HJOA 4F03A 1TRUA 3HD5A 2VLUA 1X5CA 2H71A 3VWWA 1PD21 5G30A 2G0FA 1Z6MA 3ZFLA 3ME8A 5D93A 5AIXA 2YOIA 5E4WA 3HKRA 1T7PB 3BD2A 4HZ4A 1K3YA 1F2EA 3G7IA 2R4VA 3VFIA 4ZBDA 2CVDA 1QGVA 1XOAA 1K0DA 4DSQA 3GKXA 3L4NA 3MSZA 4XS1A 5KN1A 4FH8A 4ZL8A 2C0DA 3BCKA 1Z3EA 3ZIVA 3HZ8A 1YEPA 4TN8A 5ECNB 2B1KA 4MZBA 5ECIB 4LLRA 4MP4A 3KM6A 3N5OA 4BWSA 1NSWA 3EC3A 1RK4A 4XS4A 2R2JA 1JHBA 3UVTA 5CREA 3GFKA 1AQWA 5LCZA 3F6FA 1TXXA 3QD9A 3GN3A 2YZUA 2MMNA 4WF4A 4EDYA 2LNTA 5B6NA 3TJGA 2R6KA 3EU3A 2IFQA 1F6MC 5AISA 4MLYA 1F3BA 3CTGA 4OCFA 4I5QA 1PKWA 3IPZA 4ULXA 3ZL5A 5EVOA 1SK2A 4ID0A 2YCDA 3UOMA 2FY6A 2IWTA 4N30A 3KP8A 4CW9A 1BEDA 3CYNA 4X43A 5DJMA 1MTCA 1I9DA 3TOUA 3ERFA 1MEKA 5FWGA 4HEA2 4MJBA 3UL3A 4FYCA 3L9VA 3UEMA 1M9BA 3UIWA 3E3EA 3FR3A 5DQYA 3GX0A 1XW6A 2PVOC 2B5EA 4NPBA 1JLVA 4TXOA 2M80A 4JEDA 1BQ7A 3FR6A 1QMVA 4GF0A 1AXDA 1KTEA 4HI7A 2WDUA 3C8EA 2IMDA 1B9YC 5A4WA 3WT1A 2DJ2A 2WCIA 3IV4A 2KLXA 3CSHA 3LXTA 4RQRA 3P8WA 4JBBA 1TOFA 5DVBA 1O8XA 3H93A 4KA0A 2LRTA 3CBUA 3GL5A 2VLTA 2C3QA 3GA4A 2H75A 2C0FA 1G0TA 1S3DA 4KCEA 3ERWA 2REMA 1PKZA 4OWYA 3H8QA 4KH7A 2CV4A 3DVWA 4E8EA 1O6JA 3F0IA 4I6XA 2FWFA 4N11A 1TRSA 3CMIA 1YKAA 1TDIA 1LJRA 1VF4A 4TXOB 4ISDA 1A2LA 4YQUA 2F8AA 5F0GA 3A2WA 3LYKA 3HYPA 2H6YA 4WKWA 3J7Yk 4TW5A 1ZGNA 5AGYA 1Y25A 3IXRA 4ECCA 5H5RA 3MAKA 1QFNA 1TW9A 1V2AA 5D9WA 1DBYA 1OE7A 2H0IA 1QQ2A 1SKRB 9GSSA 3APQA 1SYRA 5GSTA 3I6AA 3WT2A 3DRNA 4G9HA 2P5QA 4KAEA 1ON4A 3TRPA 5IMFA 4AGSA 2PWJA 5IMDA 3M3MA 5IPGA 4DSSB 4TR1A 2YZHA 1WWJA 4IVFA 1GP1A 5D8IA 1SU9A 4NAXA 1TJDA 1ERTA 2E2MA 3HHVA 1G6WA 5IO0A 3GRXA 1JZRA 2ON7A 3F8UA 2AJQB 3KMOA 3IHQA 2GLRA 2JU5A 2V6OA 3GX8A 3P7XA 1AQXA 1JLWA 4GXZA 2OADA 1EGRA 4EC0A 3CSJA 2HT9A 2RM5A 2YANA 2MBTA 10GSA 5ECHB 2VCTA 5KN2A 4QL9A 3O76A 4HJ2A 1F37A 1GTUA 2HYXA 3IAS2 1WE0A 3GSSA 2HRNA 3D6IA 2FLSA 2H8LA 1AUCA 2B6MA 3LQ7A 1BYEA 4ACSA 2OJLA 1T00A 2H70A 5D96A 2LSTA 2HRFA 5AIVA 3PINA 1W89A 4F0CA 3H1NA 4V1Ag 3UBLA 3BJ5A 3HVXA 1U3IA 1Z9HA 1IYHA 2KUCA 1R26A 5AN1A 3CTFA 4XHMA 4I97A 4O92A 5ID2A 2DLXA 4HS1A 2GSQA 2GSTA 3CRUA 2O7KA 2E0QA 2H30A 2L57A 4XTSA 5CRWA 2DJ0A 1SENA 5CRDA 1MDJA 2WGRA 4POBA 2XBQA 2V1MA 1V40A 1GULA 2M46A 1BX9A 5CRHA 3TKQA 2FD3A 2VUPA 5G31A 5G5FA 2LJAA 4Q5RA 2RIIA 3GTUB 3GL3A 4BVXA 4G10A 1FOVA 3GKMA 2JACA 2A2RA 1OKDA 1YKCA 1ZMAA 1TK8B 1GTIA 1NM3A 3GIXA 4PXOA 4NWYA 2LS5A 5IM9A 4K0GA 1Z7RA 1W4VA 3C7MA 4IKHA 1J9BA 1ML6A 2L4CA 5B8AA 1SD9A 3KZQA 2GZPA 3F6DA 5ID2B 2B1LA 2O89A 4BPYA 5DCHA 4HU9A 1T3BA 2C3TA 5ABRA 3TKSA 4QL7A 1XPVA 3BBYA 3SWLA 3QAVA 4MMMA 2GT6A 2A2SA 1JZOA 3TRXA 3HA9A 4ILFA 1THXA 4LMVA 3A3TA 4PUAA 3PGTA 2IMIA 5GAPD 1FB0A 1X5EA 1ERVA 5ECQB 4HUAA 2L5OA 1B8XA 4IGJA 19GSA 2KP1A 1SK1A 1OE8A 2EIRA 4NV2A 2XBIA 4TKYA 1S3CA 1SJ6A 3ZMLA 4ECIA 22GSA 3FEUA 1FAAA 5F07A 4PQ1A 5FT3A 2IPAA 1A0FA 3EYTA 3FYGA 17GSA 5IQYA 1GRXA 3DKSA 1GH2A 3GUSA 1A23A 3ZVJD 4BL7A 2EIOA 4OFMA 4MH3A 3A2XA 2OE0A 5CNWA 3DWVA 1O7UA 5ECSA 5HR1A 2M72A 3F9UA 1KBNA 5JWRB 1H75A 3U5RE 3IA1A 3EMPA 4MABA 1FG4A 4JRRA 5KN3A 3F3QA 7GSSA 2WB9A 5JWOB 3UBKA 1O85A 2VCWA 2VD0A 2Z9SA 2PU9C 1AQVA 5J41A 1OC9A 2V6KA 1G6YA 1N8JA 3LORA 3FY7A 1TU7A 4V2MA 5G1LA 3U6VA 2EC4A 3K8NA 5CP1A 5C04A 1PX7A 2R3XA 4K0NA 2HXKA 5JWQB 1QUWA 3QOUA 3QPMA 5IMVA 5ELGA 3O6TA 3US3A 1ABAA 2PGTA 1K0BA 1ZYEA 5ECMB 3RBTA 2PMTA 2CVBA 3KTBA 1FHEA 5F05A 3D0ZA 3FZ4A 3G7YA 4J2FA 5J9CA 2YV7A 5JCUA 2B7KA 3BOAA 4TR0A 2IIYA 1K0CA 1GSQA 2PERA 1XVWA 2X64A 4EUYA 1XW9A 3Q19A 2B5YA 2H1GA 5B7CA 2GTUA 2GQKA 4QQ7A 4G2EA 4HZ2A 3IOSA 1BJXA 3VLNA 5DQSA 1UA5A 4JR6A 3D21A 4OFTA 2NBSA 3A2VA 4KNDA 1OC9B 3FW2A 2GZYA 2OKAA 3KD0A 3QFBC 5DDLA 1ZYQB 5INYA 2O8VB 1AW9A 1I5GA 3GKKA 1EZKA 2NDOA 5HFIA 4TR3A 5J4UA 3IAM2 4OO4A 1XIYA 3Q6OA 4AF2A 2HSYA 3GNJA 2CZ3A 4IELA 3FK8A 3H79A 4RQXA 4HDEA 1MD3A 1R7HA 2PBJA 2DBCA 2LV3A 2LQOA 4F2IA 4NV5A 1PN9A 4WXTA 5ECLB 2N5BA 3UAPA 4L5OA 2H1BA 2C80A 2ZCTA 1YF1A 3I43A 4IP6A 12GSA 3GKNA 2HFDA 4POMA 5A5KA 2HNLA 2H01A 2K8VA 2F9SA 1ACVA 3WGDA 4K1FA 3EVIA 2J9HA 3QCPA 5D9XA 5DJLA 2VM1A 1GSDA 4ZBAA 6GSUA 4P3YB 3DGQA 2ZNMA 1WPIA 4V2NA 4JE1A 1PL1A 6GSTA 3ZRDA 2DJ1A 3ZTLA 2NTOA 2OE1A 1VF3A 3FRCA 2N5FA 3TRQA 4TRXA 1T4ZA 4JU5A 1GSFA 2VIMA 2VCXA 1U87A 1MDKA 5HR0A 3SBCA 5B8BA 2DJ3A 1GSUA 1T8EB 2AAWA 2HE3A 2CAQA 3TDGA 5D9VA 2IMEA 3TKSC 4O32A 2JL4A 3CRTA 4GCIA 3S9FA 4Z7XA 1Z7PA 4MJCA 2IMKA 4L8EA 4O5RA 4DSSA 4IP1A 2F3MA 3HXSA 4ZXGA 4KE3A 4EO3A 5F8BA 2PN8A 5GSSA 3M0FA 1K0MA 2C0GA 1F9MA 1HNBA 2IN3A 1GL8A 3WYWA 3N9JA 3QAWA 4XIHA 1SK0A 3G9BA 4OO5A 5IIZA 4OMVA 1CQHA 2H0HA 4MPFA 2RUEA 4L0WA 2DIZA 3LWAA 1KNGA
chains in the Genus database with same CATH superfamily
4G19A 1A8LA 2ON5A 2GSSA 1BAYA 5EL8A 1XVQA 1EWXA 4F9ZA 1JZWA 1B9XC 2CAIA 5ENUA 4OFNA 3IC4A 2I4AA 3EMXA 4XRDA 1GUHA 3E0UA 1XW5A 1EOGA 6GSYA 1ERWA 3GURA 2I9HA 3ZYWA 2A2PA 3ZITA 2C3NA 3KMNA 1HYUA 2OBKA 2JZSA 4BIKA 2QC7A 2K9FA 5D9TA 4POLA 2YJ7A 2C4JA 1QK8A 2HZFA 3LSZA 2XC2A 3CSIA 4KUNA 4EDZA 3CQFA 1HNAA 2VL2A 1EEMA 4GSTA 4MJEA 2V2GA 3TJJA 3KJYA 1PN0A 4MDCA 4ZL7A 3RHBA 2R5GA 1X5DA 4F82A 4EF0A 2LUSA 3KCMA 4WBJA 4PGTA 2L4QA 2N5AA 3FZAA 3GTUA 3C1SA 3LEFA 1B4PA 4PUFC 2X8GA 4GQCA 3W6GA 3VWXA 1B4QA 2X4AA 3F3RA 1SKWB 1UVZA 2OACA 2VO4A 1S3RA 1OVNA 4RUVA 4BVYA 1O81A 3ISOA 3GH9A 4K6XA 2IMFA 1GLPA 2GS3A 5JCWA 2ZUPA 2B5XA 4CHSA 4GSSA 1XWCA 2DJKA 4K8MA 4WEYA 5G2ZA 4AJ6A 3FR9A 1UC7A 5IOXA 3F4SA 2VOCA 1R5PA 3KTLA 4Q5FA 2P5RA 2L59A 3QMXA 3EWLA 1VGLA 1WIKA 4KGIA 1PGTA 4X0XA 2KHPA 3HCZA 4ZIJA 4ZILA 1XOBA 3KEBA 1T4YA 4GSNA 1EV4A 2ES7A 4XS6A 4YAVA 1FVJA 3P90A 1ST9A 3ED3A 4IQ1A 1QXHA 3RPNA 2H0GA 4ZB9A 1SJZA 4ECBA 2AHEA 3DYRA 1DUGA 1AIUA 2P0GA 2XPEA 3F4RA 1PX6A 3EU4A 4BVYB 6GSVA 2YV9A 1M0UA 16GSA 2CA8A 2JSYA 1LBKA 1XWKA 3ZLPA 5CAXA 1EP7A 5DCGA 4EL1A 4WR5A 1ZZYA 4F0BA 5DALB 1M2AA 2H72A 1TRVA 1A2JA 5CYYA 2CX3A 3DIEA 3RHCA 2LQQA 2VCQA 1V58A 2DSAA 2KOKA 1XCCA 1SJIA 4MF5A 3ZREA 3RAZA 2PPTA 1MDIA 1V57A 4O7HA 4A5PA 3L9SA 1FW1A 4EVMA 3M1GA 3KXOA 1FO5A 5H5QA 4DEJA 4MA9A 2TRCP 3VWVA 2TRXA 3ME7A 5LD0A 3M9KA 1V9WA 2VLVA 3FZ9A 2J23A 5J9BA 2FWHA 5C00A 1YY7A 1OKTA 4ZL9A 4TOPA 13GSA 1LU4A 3HJPA 4HU7A 3I69A 3IBHA 4DVCA 4FYBA 2L5LA 3APSA 4K2DA 4K7IA 1J0FA 2OE3A 3TB2A 3PR8A 4EE0A 4I2UA 2NVLA 3NOFA 2HSMA 4WF5A 4PTSA 3IC8A 4NHWA 1K3OA 4IW9A 4WETA 2FNOA 1YDKA 2YP6A 1GNWA 5LNKe 2DMMA 4TXVA 4MK3A 3L78A 3MNGA 3HVSA 2VAFA 2VD1A 4YQMA 1EGOA 3TJFA 1VF1A 5B6MA 1YJ6A 2I81A 4ZB6A 1THOA 3C71A 4MF6A 1ZOFA 4Q5NA 2FA8A 2C0EA 4BWQA 3J7Yb 3IK9A 2H1AA 2A4VA 3F63A 4KSMA 1O8WA 3HZ4A 1GTAA 8GSSA 3DVXA 1S3AA 4OD7A 4V1Ap 1EP8A 2LJRA 3C1RA 3LG6A 3R3EA 1X0RA 4HQSA 2H76A 1YQ1A 2VL2C 1K0OA 1B48A 1ILOA 4NXIA 3KH9A 3HY2A 4K7NA 1SD8A 4J57E 4GWRA 3M8NA 3AY8A 2MMZA 2L6CA 3I9V2 3VURA 1FOHA 1PL2A 1SYXA 2RM6A 1DE1A 1Z6NA 5JCGA 2WFCA 3GHAA 3HVVA 2C8UA 5COHA 3WGEA 2H6XA 2FGXA 5DBQA 1DSBA 4IQAA 1HQOA 1PA3A 5CRGA 1C72A 3FHKA 2AYTA 2E2GA 1R5AA 2LKUA 1OAZA 5HFKA 4KDYA 1WRYA 3NZNA 3IDVA 4V2LA 2GVPA 4O5QA 4RI6A 2NPBA 2O87A 3IK7A 3HJMA 3RDWA 2JADA 3PH9A 1TI3A 2H73A 4RI7A 5HFGA 4IS0A 4PNFA 5EY6A 5D73A 1FB6A 3UMAA 3EINA 4O5UA 5J3RA 5IMCA 4NMUA 2K6VA 20GSA 2AB6A 1GUKA 1IYIA 5L71A 4WBRD 2GDRA 2P31A 4Z2UA 1VF2A 4AJ8A 4YAPA 5IMZA 3H4KA 1GSYA 2LNSA 1AC1A 1K3LA 1GNEA 1XWBA 5ECPB 2LTKA 3QAGA 2HI7A 5ECRB 5EPFA 2X8HA 2H74A 2V41A 5A4VA 2O85A 5HR3A 1E6BA 2FA4A 2H6ZA 4H86A 2YWIA 1J08A 1E2YA 2ALBA 3F4TA 3W8JA 3PPUA 1XBSA 2VCVA 5BMUA 2X99A 3VI7A 4XS4B 1U88A 3LXZA 3FZ5A 1K0AA 4FIWA 4KB3A 3A5WA 3GSTA 2QKEA 3VK9A 3VWUA 2H66A 2VCZA 5HR2A 3RPPA 2FCHA 5IOWA 2AV4A 2HZEA 2H19A 4PURA 2YNXA 3QFAC 2HSHA 1OC3A 4IN0A 1YZXA 1GTBA 1VRSD 1JFUA 3EE2A 2FWGA 2LRNA 1TK5B 4FO5A 2LJKA 3M9JA 2RUFA 5GZZB 2IFQB 3QDNA 4N0ZA 3KIJA 3VPTA 1TP9A 3EPTA 3UARA 3UVHA 2L6DA 1M7TA 3GMFA 5HQPA 1XXUA 4IJ3A 3UJ1A 4K7OA 2GQMA 4AJ7A 4ZBBA 4HJMA 1AAZA 2WZ9A 4L0UA 2MZCA 1URMA 1M9AA 5ECKB 3TJKA 5DAKA 3EURA 4GTUA 3O3TA 3D4MA 3TKSE 1XZOA 1NHYA 1FVKA 3DEXA 2EIQA 3D5JA 3G7JA 1DE2A 1X9MB 4G0KA 1SL0B 1ERUA 2YWNA 1XWGA 3VI5A 2X49A 1TU8A 1TKDB 4D73A 2CT6A 2MBSA 1G7OA 3FKFA 3TCOA 2CX4A 4LL1B 4XCSA 4K5SA 2HZEB 3KP9A 3MDKA 1OYJA 4N10A 1MD4A 1PQNA 3FMWA 2V32A 2CQ9A 1TI1A 1NW2A 4HOJA 3DD3A 1KEBA 5IPHA 1GLQA 4Q5QA 4LMWA 4ML6A 3C73A 3QR6A 4FYUA 4KCAA 3E9JB 1YF0A 4ICYA 3IRAA 4ECJA 2HLSA 6GSSA 1M99A 5DAKB 2I3YA 4X4JA 5IMAA 1R4WA 1G7EA 4LL4B 1V98A 3APOA 3IHGA 3TKRA 3Q74A 1M2BA 1SKSB 4MH2A 2R0GA 1RQMA 3GYKA 2LEGA 4K9ZA 4JR4A 3DXBA 3TUEA 1GUMA 4NHZA 2UZ8A 3A5IA 1CQGA 1X9SB 2MYGA 1WJKA 4HQZA 2DJJA 4D73B 3L9UA 1A24A 1EOHA 1PSQA 1Z5YE 2BMXA 2K8SA 2XHFA 4MF7A 2XPDA 5A4UA 1A8YA 2HRAA 1ZCPA 3CXGA 4PQIA 5ELAA 1JZDA 14GSA 3DMLA 2YWOA 1XWAA 4KW6A 5GAND 2QA1A 4L5LA 3D4TA 1H4OA 4N0VA 3Q18A 2PVQA 4KDXA 3TOTA 5J5NA 5G1KA 2YJHA 1TTZA 2WS2A 2JZRA 1SL2B 5E59A 1UN2A 3IR4A 1WOUA 1M3IA 3R2QA 1N2AA 4KSOA 4KX4A 2DC5A 1HNCA 4IHUA 1T1VA 5F06A 5DALA 6GSXA 1Q4JA 4LA1A 4TR1B 1U6TA 2K18A 1OC8A 1ZL9A 2CVKA 2WRTA 3ZZXA 2QGVA 3W8SA 1K0NA 1RW1A 3JCML 1TRWA 1GWCA 3KGKA 2WULA 3OR5A 2OBIA 1YEXA 3LGCA 2GZZA 2MMOA 2C1YA 2BJXA 1TK0B 4ZB8A 2H1DA 3KH7A 4GRFA 1BG5A 4EXJA 1PMTA 2FHEA 1SL1B 2KP2A 3BCIA 4E8HA 4CDOA 2MMAA 4EKZA 2JZTA 1M2DA 4YKGA 1EEJA 2QSIA 4YQVA 2D2ZA 1X9WB 3ERGA 4I2TA 5H5SA 2F8FA 11GSA 2E7PA 5FHIA 1EV9A 4IBPA 2R0CA 4G0IA 5IO2A 1A2MA 4GLTA 4MPGA 2G2QA 2WJUA 2GQLA 3ZMKA 4TVEA 2I1UA 1Y6EA 2FUG2 2TIRA 1XFLA 3HVNA 2GT5A 2VL9A 2RLIA 4POKA 4DSRA 3ZVJA 4ML1A 4X1UA 4MCUA 3NIVA 2AUVA 2LRCA 2GSRA 4XRAA 4PQHA 3LJRA 3LYPA 4BA7A 3LFLA 3TJBA 4OCEA 4IJIA 4MZWA 2VM2A 1NHOA 1WMJA 3TGZA 2B7JA 2BTOT 5G5EA 1GSSA 3L0HA 4GQFA 4PX1A 1U3AA 4G0LA 18GSA 4J56E 4MJAA 2F51A 3GH6A 2FWEA 1HD2A 5KEJA 1A0RP 4TR4A 3WD6A 2DIYA 4BVXB 3ZFBA 3GV1A 1F3AA 4YH2A 2YPMA 3WGXA 2GGTA 5CO3A 2IL3A 4PNGA 2PUKC 2YWMA 2R37A 3VPQA 2B3SA 4I8BA 2YN1A 4EIPA 4KDUA 1Q98A 1PRXA 5ECOB 2X8CA 2OA7A 1O73A 3P2AA 2VL3A 4MZCA 3V1WA 1WP0A 3IE3A 2JSZA 3HDCA 3ZIJA 5KN0A 4JZQA 1USBA 3D22A 3MWHA 3TKPA 1GSEA 1ZYNA 2IJYA 4WR4A 6GSWA 2CZ2A 2DMLA 3HJOA 4F03A 1TRUA 3HD5A 2VLUA 1X5CA 2H71A 3VWWA 1PD21 5G30A 2G0FA 1Z6MA 3ZFLA 3ME8A 5D93A 5AIXA 2YOIA 5E4WA 3HKRA 1T7PB 3BD2A 4HZ4A 1K3YA 1F2EA 3G7IA 2R4VA 3VFIA 4ZBDA 2CVDA 1QGVA 1XOAA 1K0DA 4DSQA 3GKXA 3L4NA 3MSZA 4XS1A 5KN1A 4FH8A 4ZL8A 2C0DA 3BCKA 1Z3EA 3ZIVA 4Z2RA 3HZ8A 1YEPA 4TN8A 5ECNB 4BL7B 2B1KA 4MZBA 5ECIB 4LLRA 4MP4A 3KM6A 3N5OA 4BWSA 1NSWA 3EC3A 1RK4A 4XS4A 2R2JA 1JHBA 3UVTA 5CREA 3GFKA 1AQWA 5LCZA 3F6FA 4Z2TA 1TXXA 3QD9A 3GN3A 2YZUA 2MMNA 4WF4A 4EDYA 2LNTA 5B6NA 3TJGA 2R6KA 3EU3A 2IFQA 1F6MC 5AISA 4MLYA 1F3BA 3CTGA 4OCFA 4I5QA 1PKWA 3IPZA 4ULXA 3ZL5A 5EVOA 1SK2A 4ID0A 2YCDA 4YKFA 3UOMA 2FY6A 2IWTA 4N30A 3KP8A 4CW9A 1BEDA 3CYNA 4X43A 5DJMA 1MTCA 1I9DA 3TOUA 3ERFA 1MEKA 5FWGA 4HEA2 4MJBA 3UL3A 4FYCA 3L9VA 3UEMA 1M9BA 3UIWA 3E3EA 3FR3A 5DQYA 4KF9A 3GX0A 1XW6A 2PVOC 2B5EA 4FQUA 4NPBA 1JLVA 4TXOA 2M80A 4JEDA 1BQ7A 3FR6A 1QMVA 3LW9A 4GF0A 1AXDA 1KTEA 4HI7A 2WDUA 3C8EA 2IMDA 1B9YC 5A4WA 3WT1A 2DJ2A 2WCIA 3IV4A 2KLXA 5KOXA 4K2XA 3CSHA 3LXTA 2HRKA 4RQRA 4CY8A 3P8WA 4JBBA 1TOFA 5DVBA 1O8XA 3H93A 4KA0A 2LRTA 3CBUA 3GL5A 2VLTA 2C3QA 3GA4A 2H75A 2C0FA 1G0TA 1S3DA 4KCEA 3ERWA 2REMA 1PKZA 4OWYA 3H8QA 4KH7A 2CV4A 3DVWA 4E8EA 1O6JA 3F0IA 4I6XA 2FWFA 4N11A 1TRSA 3CMIA 1YKAA 1TDIA 1LJRA 1VF4A 4TXOB 4ISDA 1A2LA 4YQUA 2F8AA 5F0GA 3A2WA 3MYDA 3LYKA 3HYPA 2H6YA 4WKWA 3J7Yk 4TW5A 1ZGNA 2QA2A 5AGYA 1Y25A 3IXRA 4ECCA 5H5RA 3MAKA 1QFNA 1TW9A 1V2AA 2A4HA 5D9WA 1DBYA 1OE7A 2H0IA 1QQ2A 1SKRB 9GSSA 3APQA 1SYRA 5GSTA 3I6AA 3WT2A 3DRNA 4G9HA 2P5QA 4KAEA 1ON4A 3TRPA 5IMFA 4AGSA 2PWJA 5IMDA 3M3MA 5IPGA 4DSSB 4TR1A 2YZHA 1WWJA 4IVFA 1GP1A 5D8IA 1SU9A 4NAXA 1TJDA 1ERTA 2E2MA 3HHVA 1G6WA 5IO0A 3GRXA 1JZRA 2ON7A 3F8UA 2AJQB 3KMOA 3IHQA 2GLRA 2JU5A 2V6OA 3GX8A 3P7XA 1AQXA 1JLWA 4GXZA 2OADA 1EGRA 4HSCX 4EC0A 3CSJA 2HT9A 2RM5A 2YANA 2MBTA 10GSA 5ECHB 2VCTA 5KN2A 4QL9A 3O76A 4HJ2A 1F37A 1GTUA 2HYXA 3IAS2 1WE0A 3GSSA 2HRNA 3D6IA 2FLSA 2H8LA 1PFOA 1AUCA 2B6MA 3LQ7A 1BYEA 4ACSA 2OJLA 1T00A 2H70A 5D96A 2LSTA 2HRFA 5AIVA 3PINA 1W89A 4F0CA 3H1NA 4V1Ag 3UBLA 3BJ5A 3HVXA 1U3IA 1Z9HA 1IYHA 2KUCA 1R26A 5AN1A 3CTFA 4XHMA 4I97A 4O92A 5KOWA 5ID2A 2DLXA 4HS1A 2GSQA 2GSTA 3CRUA 2O7KA 2E0QA 2H30A 2L57A 4XTSA 5CRWA 2DJ0A 1SENA 5CRDA 1MDJA 2WGRA 4POBA 2XBQA 2V1MA 1V40A 1GULA 2M46A 1BX9A 5CRHA 3TKQA 2FD3A 2VUPA 5G31A 5G5FA 2LJAA 4Q5RA 2RIIA 3GTUB 3GL3A 4BVXA 4G10A 1FOVA 3GKMA 2JACA 2A2RA 1OKDA 4MNNA 2DKHA 1YKCA 1ZMAA 1TK8B 1GTIA 1NM3A 3GIXA 4PXOA 4NWYA 2LS5A 5IM9A 4K0GA 1Z7RA 1W4VA 3C7MA 4IKHA 1J9BA 1ML6A 2L4CA 5B8AA 1SD9A 3KZQA 2GZPA 3F6DA 5ID2B 2B1LA 2O89A 4BPYA 5DCHA 4HU9A 1T3BA 2C3TA 5ABRA 3TKSA 4QL7A 1XPVA 3BBYA 3SWLA 3QAVA 4MMMA 2GT6A 2A2SA 1JZOA 3TRXA 3HA9A 4ILFA 1THXA 4LMVA 3A3TA 4PUAA 3PGTA 2IMIA 4K5RA 5GAPD 1FB0A 2R0PA 1X5EA 1ERVA 5ECQB 4HUAA 2L5OA 1B8XA 4IGJA 19GSA 2KP1A 1SK1A 1OE8A 2EIRA 4NV2A 2XBIA 4TKYA 1S3CA 1SJ6A 3ZMLA 4ECIA 22GSA 3FEUA 1XG8A 1FAAA 5F07A 4PQ1A 5FT3A 2IPAA 1A0FA 3EYTA 3FYGA 17GSA 5IQYA 1GRXA 4USSA 3DKSA 1GH2A 3GUSA 1A23A 3ZVJD 4BL7A 2EIOA 4OFMA 4MH3A 3A2XA 2OE0A 5CNWA 3DWVA 1O7UA 5ECSA 5HR1A 2M72A 3F9UA 1KBNA 5JWRB 1H75A 3U5RE 3IA1A 3EMPA 4MABA 1FG4A 4JRRA 2DKIA 5KN3A 3F3QA 7GSSA 2WB9A 5JWOB 3UBKA 1O85A 2VCWA 2VD0A 2Z9SA 2PU9C 1AQVA 5J41A 1OC9A 2V6KA 1G6YA 1N8JA 3LORA 3FY7A 1TU7A 4V2MA 5G1LA 3U6VA 2EC4A 3K8NA 5CP1A 5C04A 1PX7A 2R3XA 4K0NA 2HXKA 5JWQB 1QUWA 3QOUA 3QPMA 5IMVA 5ELGA 1M3JA 3O6TA 3US3A 1ABAA 2PGTA 1K0BA 1ZYEA 5ECMB 3RBTA 5BRTA 2PMTA 2CVBA 3KTBA 1FHEA 5F05A 3D0ZA 3FZ4A 3G7YA 4J2FA 5J9CA 2YV7A 5JCUA 2B7KA 3BOAA 4TR0A 2IIYA 1K0CA 1GSQA 2PERA 1XVWA 2X64A 4EUYA 1XW9A 3Q19A 2B5YA 2H1GA 5B7CA 2GTUA 2GQKA 4QQ7A 4G2EA 4HZ2A 3IOSA 1BJXA 3VLNA 5DQSA 1UA5A 4JR6A 3D21A 4OFTA 2NBSA 3A2VA 4KNDA 1OC9B 3FW2A 2GZYA 2OKAA 3KD0A 3QFBC 5DDLA 1ZYQB 5INYA 2O8VB 1AW9A 1I5GA 3GKKA 1EZKA 2NDOA 5HFIA 4TR3A 5J4UA 3IAM2 4OO4A 1XIYA 3Q6OA 4AF2A 2HSYA 3GNJA 2CZ3A 4IELA 3FK8A 3H79A 4RQXA 4HDEA 1MD3A 1R7HA 2PBJA 2DBCA 2LV3A 2LQOA 4F2IA 4NV5A 1PN9A 4WXTA 5ECLB 2N5BA 3UAPA 4L5OA 4EIQA 2H1BA 2C80A 2ZCTA 1YF1A 3I43A 4IP6A 12GSA 3GKNA 2HFDA 4POMA 5A5KA 2HNLA 2H01A 2K8VA 2F9SA 1ACVA 3WGDA 4K1FA 3EVIA 2J9HA 3QCPA 5D9XA 5DJLA 2VM1A 1GSDA 4ZBAA 6GSUA 4P3YB 3DGQA 2ZNMA 1WPIA 4V2NA 4JE1A 1PL1A 6GSTA 3ZRDA 2DJ1A 3ZTLA 2NTOA 2OE1A 1VF3A 3FRCA 2N5FA 3TRQA 4TRXA 1T4ZA 4JU5A 1GSFA 2VIMA 2VCXA 4CY6A 1U87A 3MIXA 1MDKA 5HR0A 3SBCA 5B8BA 2DJ3A 1GSUA 1ZYPA 1T8EB 2AAWA 2HE3A 2CAQA 3TDGA 5D9VA 2IMEA 3TKSC 4O32A 2JL4A 3CRTA 4GCIA 3S9FA 4Z7XA 1Z7PA 4MJCA 2IMKA 4L8EA 4O5RA 4DSSA 4IP1A 2F3MA 3HXSA 4ZXGA 4KE3A 4EO3A 5F8BA 2PN8A 5GSSA 3M0FA 1K0MA 2C0GA 1F9MA 1HNBA 2IN3A 1GL8A 3WYWA 3N9JA 3QAWA 4XIHA 1SK0A 3G9BA 4OO5A 5IIZA 4OMVA 1CQHA 2H0HA 4MPFA 2RUEA 4L0WA 2DIZA 3LWAA 1KNGA
chains in the Genus database with same CATH topology
4G19A 1A8LA 2ON5A 2GSSA 1BAYA 5EL8A 1XVQA 1EWXA 4F9ZA 1JZWA 1B9XC 2CAIA 5ENUA 4OFNA 3IC4A 2I4AA 3EMXA 4XRDA 1GUHA 3E0UA 1XW5A 1EOGA 6GSYA 1ERWA 3GURA 2I9HA 3ZYWA 2A2PA 3ZITA 2C3NA 3KMNA 1HYUA 2OBKA 2JZSA 2QC7A 2K9FA 5D9TA 4POLA 2YJ7A 2C4JA 1QK8A 2HZFA 3LSZA 2XC2A 3CSIA 4KUNA 4EDZA 1HNAA 2VL2A 1EEMA 4GSTA 4MJEA 2V2GA 3TJJA 3KJYA 1PN0A 4MDCA 4ZL7A 3RHBA 2R5GA 1X5DA 4F82A 4EF0A 2LUSA 3KCMA 4WBJA 4PGTA 2L4QA 2N5AA 3FZAA 3GTUA 3C1SA 3LEFA 1B4PA 4PUFC 2X8GA 4GQCA 3W6GA 3VWXA 1B4QA 2X4AA 3F3RA 1SKWB 1UVZA 2OACA 2VO4A 1OVNA 4RUVA 4BVYA 1O81A 3ISOA 3GH9A 4K6XA 2IMFA 1GLPA 2GS3A 5JCWA 2ZUPA 2B5XA 4CHSA 4GSSA 1XWCA 2DJKA 4K8MA 4WEYA 5G2ZA 4AJ6A 3FR9A 1UC7A 5IOXA 3F4SA 2VOCA 1R5PA 3KTLA 4Q5FA 2P5RA 2L59A 3QMXA 3EWLA 1VGLA 1WIKA 4KGIA 1PGTA 4X0XA 2KHPA 3HCZA 4ZIJA 4ZILA 1XOBA 3KEBA 1T4YA 4GSNA 1EV4A 2ES7A 4XS6A 4YAVA 1FVJA 3P90A 1ST9A 3ED3A 4IQ1A 1QXHA 3RPNA 2H0GA 4ZB9A 1SJZA 4ECBA 2AHEA 3DYRA 1DUGA 1AIUA 2P0GA 2XPEA 3F4RA 1PX6A 3EU4A 4BVYB 6GSVA 2YV9A 1M0UA 16GSA 2CA8A 2JSYA 1LBKA 1XWKA 3ZLPA 5CAXA 1EP7A 5DCGA 4EL1A 4WR5A 1ZZYA 4F0BA 5DALB 1M2AA 2H72A 1TRVA 1A2JA 5CYYA 2CX3A 3DIEA 3RHCA 2LQQA 2VCQA 1V58A 2DSAA 2KOKA 1XCCA 1SJIA 4MF5A 3ZREA 3RAZA 2PPTA 1MDIA 1V57A 4O7HA 4A5PA 3L9SA 1FW1A 4EVMA 3M1GA 3KXOA 1FO5A 5H5QA 4DEJA 4MA9A 2TRCP 3VWVA 2TRXA 3ME7A 5LD0A 3M9KA 1V9WA 2VLVA 3FZ9A 2J23A 5J9BA 2FWHA 5C00A 1YY7A 1OKTA 4ZL9A 4TOPA 13GSA 1LU4A 3HJPA 4HU7A 3I69A 3IBHA 4DVCA 4FYBA 2L5LA 3APSA 4K2DA 4K7IA 1J0FA 2OE3A 3TB2A 3PR8A 4EE0A 4I2UA 2NVLA 3NOFA 2HSMA 4WF5A 4PTSA 3IC8A 4NHWA 1K3OA 4IW9A 4WETA 2FNOA 1YDKA 2YP6A 1GNWA 5LNKe 2DMMA 4TXVA 4MK3A 3L78A 3MNGA 3HVSA 2VAFA 2VD1A 4YQMA 1EGOA 3TJFA 1VF1A 5B6MA 1YJ6A 2I81A 4ZB6A 1THOA 3C71A 4MF6A 1ZOFA 4Q5NA 2FA8A 2C0EA 4BWQA 3J7Yb 3IK9A 2H1AA 2A4VA 3F63A 4KSMA 1O8WA 3HZ4A 1GTAA 8GSSA 3DVXA 1S3AA 4OD7A 4V1Ap 1EP8A 2LJRA 3C1RA 3LG6A 3R3EA 1X0RA 4HQSA 2H76A 1YQ1A 2VL2C 1K0OA 1B48A 1ILOA 4NXIA 3KH9A 3HY2A 4K7NA 1SD8A 4J57E 4GWRA 3M8NA 3AY8A 2MMZA 2L6CA 3I9V2 3VURA 1FOHA 1PL2A 1SYXA 2RM6A 1DE1A 1Z6NA 5JCGA 2WFCA 3GHAA 3HVVA 2C8UA 5COHA 3WGEA 2H6XA 2FGXA 5DBQA 1DSBA 4IQAA 1HQOA 1PA3A 5CRGA 1C72A 3FHKA 2AYTA 2E2GA 1R5AA 2LKUA 1OAZA 5HFKA 4KDYA 1WRYA 3NZNA 3IDVA 4V2LA 2GVPA 4O5QA 4RI6A 2NPBA 2O87A 3IK7A 3HJMA 3RDWA 2JADA 3PH9A 1TI3A 2H73A 4RI7A 5HFGA 4IS0A 4PNFA 5EY6A 5D73A 1FB6A 3UMAA 3EINA 4O5UA 5J3RA 5IMCA 4NMUA 2K6VA 20GSA 2AB6A 1GUKA 1IYIA 5L71A 4WBRD 2GDRA 2P31A 4Z2UA 1VF2A 4AJ8A 4YAPA 5IMZA 3H4KA 1GSYA 2LNSA 1AC1A 1K3LA 1GNEA 1XWBA 5ECPB 2LTKA 3QAGA 2HI7A 5ECRB 5EPFA 2X8HA 2H74A 2V41A 5A4VA 2O85A 5HR3A 1E6BA 2FA4A 2H6ZA 4H86A 2YWIA 1J08A 1E2YA 2ALBA 3F4TA 3W8JA 3PPUA 1XBSA 2VCVA 5BMUA 2X99A 3VI7A 4XS4B 1U88A 3LXZA 3FZ5A 1K0AA 4FIWA 4KB3A 3A5WA 3GSTA 2QKEA 3VK9A 3VWUA 2H66A 2VCZA 5HR2A 3RPPA 2FCHA 5IOWA 2AV4A 2HZEA 2H19A 4PURA 2YNXA 3QFAC 2HSHA 1OC3A 4IN0A 1YZXA 1GTBA 1VRSD 1JFUA 3EE2A 2FWGA 2LRNA 1TK5B 4FO5A 2LJKA 3M9JA 2RUFA 5GZZB 2IFQB 3QDNA 4N0ZA 3KIJA 3VPTA 1TP9A 3EPTA 3UARA 3UVHA 2L6DA 1M7TA 3GMFA 5HQPA 1XXUA 4IJ3A 3UJ1A 4K7OA 2GQMA 4AJ7A 4ZBBA 4HJMA 1AAZA 2WZ9A 4L0UA 2MZCA 1URMA 1M9AA 5ECKB 3TJKA 5DAKA 3EURA 4GTUA 3O3TA 3D4MA 3TKSE 1XZOA 1NHYA 1FVKA 3DEXA 2EIQA 3D5JA 3G7JA 1DE2A 1X9MB 4G0KA 1SL0B 1ERUA 2YWNA 1XWGA 3VI5A 2X49A 1TU8A 1TKDB 4D73A 2CT6A 2MBSA 1G7OA 3FKFA 3TCOA 2CX4A 4LL1B 4XCSA 4K5SA 2HZEB 3KP9A 3MDKA 1OYJA 4N10A 1MD4A 1PQNA 3FMWA 2V32A 2CQ9A 1TI1A 1NW2A 4HOJA 3DD3A 1KEBA 5IPHA 1GLQA 4Q5QA 4LMWA 4ML6A 3C73A 3QR6A 4FYUA 4KCAA 3E9JB 1YF0A 4ICYA 3IRAA 4ECJA 2HLSA 6GSSA 1M99A 5DAKB 2I3YA 4X4JA 5IMAA 1R4WA 1G7EA 4LL4B 1V98A 3APOA 3IHGA 3TKRA 3Q74A 1M2BA 1SKSB 4MH2A 2R0GA 1RQMA 3GYKA 2LEGA 4K9ZA 4JR4A 3DXBA 3TUEA 1GUMA 4NHZA 2UZ8A 3A5IA 1CQGA 1X9SB 2MYGA 1WJKA 4HQZA 2DJJA 4D73B 3L9UA 1A24A 1EOHA 1PSQA 1Z5YE 2BMXA 2K8SA 2XHFA 4MF7A 2XPDA 5A4UA 1A8YA 2HRAA 1ZCPA 3CXGA 4PQIA 5ELAA 1JZDA 14GSA 3DMLA 2YWOA 1XWAA 4KW6A 5GAND 2QA1A 4L5LA 3D4TA 1H4OA 4N0VA 3Q18A 2PVQA 4KDXA 3TOTA 5J5NA 5G1KA 2YJHA 1TTZA 2WS2A 2JZRA 1SL2B 5E59A 1UN2A 3IR4A 1WOUA 3R2QA 1N2AA 4KSOA 4KX4A 2DC5A 1HNCA 4IHUA 1T1VA 5F06A 5DALA 6GSXA 1Q4JA 4LA1A 4TR1B 1U6TA 2K18A 1OC8A 1ZL9A 2CVKA 2WRTA 3ZZXA 2QGVA 3W8SA 1K0NA 1RW1A 3JCML 1TRWA 1GWCA 3KGKA 2WULA 3OR5A 2OBIA 1YEXA 3LGCA 2GZZA 2MMOA 2C1YA 2BJXA 1TK0B 4ZB8A 2H1DA 3KH7A 4GRFA 1BG5A 4EXJA 1PMTA 2FHEA 1SL1B 2KP2A 3BCIA 4E8HA 4CDOA 2MMAA 4EKZA 2JZTA 1M2DA 4YKGA 1EEJA 2QSIA 4YQVA 2D2ZA 1X9WB 3ERGA 4I2TA 5H5SA 2F8FA 11GSA 2E7PA 5FHIA 1EV9A 4IBPA 2R0CA 4G0IA 5IO2A 1A2MA 4GLTA 4MPGA 2G2QA 2WJUA 2GQLA 3ZMKA 4TVEA 2I1UA 1Y6EA 2FUG2 2TIRA 1XFLA 2GT5A 2VL9A 2RLIA 4POKA 4DSRA 3ZVJA 4ML1A 4X1UA 4MCUA 3NIVA 2AUVA 2LRCA 2GSRA 4XRAA 4PQHA 3LJRA 3LYPA 4BA7A 3LFLA 3TJBA 4OCEA 4IJIA 4MZWA 2VM2A 1NHOA 1WMJA 3TGZA 2B7JA 2BTOT 5G5EA 1GSSA 3L0HA 4GQFA 4PX1A 1U3AA 4G0LA 18GSA 4J56E 4MJAA 2F51A 3GH6A 2FWEA 1HD2A 5KEJA 1A0RP 4TR4A 3WD6A 2DIYA 4BVXB 3ZFBA 3GV1A 1F3AA 4YH2A 2YPMA 3WGXA 2GGTA 5CO3A 2IL3A 4PNGA 2PUKC 2YWMA 2R37A 3VPQA 2B3SA 4I8BA 2YN1A 4EIPA 4KDUA 1Q98A 1PRXA 5ECOB 2X8CA 2OA7A 1O73A 3P2AA 2VL3A 4MZCA 3V1WA 1WP0A 3IE3A 2JSZA 3HDCA 3ZIJA 5KN0A 4JZQA 1USBA 3D22A 3MWHA 3TKPA 1GSEA 1ZYNA 2IJYA 4WR4A 6GSWA 2CZ2A 2DMLA 3HJOA 4F03A 1TRUA 3HD5A 2VLUA 1X5CA 2H71A 3VWWA 1PD21 5G30A 2G0FA 1Z6MA 3ZFLA 3ME8A 5D93A 5AIXA 2YOIA 5E4WA 3HKRA 1T7PB 3BD2A 4HZ4A 1K3YA 1F2EA 3G7IA 2R4VA 3VFIA 4ZBDA 2CVDA 1QGVA 1XOAA 1K0DA 4DSQA 3GKXA 3L4NA 3MSZA 4XS1A 5KN1A 4FH8A 4ZL8A 2C0DA 3BCKA 1Z3EA 3ZIVA 4Z2RA 3HZ8A 1YEPA 4TN8A 5ECNB 4BL7B 2B1KA 4MZBA 5ECIB 4LLRA 4MP4A 3KM6A 3N5OA 4BWSA 1NSWA 3EC3A 1RK4A 4XS4A 2R2JA 1JHBA 3UVTA 5CREA 3GFKA 1AQWA 5LCZA 3F6FA 4Z2TA 1TXXA 3QD9A 3GN3A 2YZUA 2MMNA 4WF4A 4EDYA 2LNTA 5B6NA 3TJGA 2R6KA 3EU3A 2IFQA 1F6MC 5AISA 4MLYA 1F3BA 3CTGA 4OCFA 4I5QA 1PKWA 3IPZA 4ULXA 3ZL5A 5EVOA 1SK2A 4ID0A 2YCDA 4YKFA 3UOMA 2FY6A 2IWTA 4N30A 3KP8A 4CW9A 1BEDA 3CYNA 4X43A 5DJMA 1MTCA 1I9DA 3TOUA 3ERFA 1MEKA 5FWGA 4HEA2 4MJBA 3UL3A 4FYCA 3L9VA 3UEMA 1M9BA 3UIWA 3E3EA 3FR3A 5DQYA 4KF9A 3GX0A 1XW6A 2PVOC 2B5EA 4FQUA 4NPBA 1JLVA 4TXOA 2M80A 4JEDA 1BQ7A 3FR6A 1QMVA 3LW9A 4GF0A 1AXDA 1KTEA 4HI7A 2WDUA 3C8EA 2IMDA 1B9YC 5A4WA 3WT1A 2DJ2A 2WCIA 3IV4A 2KLXA 5KOXA 4K2XA 3CSHA 3LXTA 2HRKA 4RQRA 4CY8A 3P8WA 4JBBA 1TOFA 5DVBA 1O8XA 3H93A 4KA0A 2LRTA 3CBUA 3GL5A 2VLTA 2C3QA 3GA4A 2H75A 2C0FA 1G0TA 1S3DA 4KCEA 3ERWA 2REMA 1PKZA 4OWYA 3H8QA 4KH7A 2CV4A 3DVWA 4E8EA 1O6JA 3F0IA 4I6XA 2FWFA 4N11A 1TRSA 3CMIA 1YKAA 1TDIA 1LJRA 1VF4A 4TXOB 4ISDA 1A2LA 4YQUA 2F8AA 5F0GA 3A2WA 3MYDA 3LYKA 3HYPA 2H6YA 4WKWA 3J7Yk 4TW5A 1ZGNA 2QA2A 5AGYA 1Y25A 3IXRA 4ECCA 5H5RA 3MAKA 1QFNA 1TW9A 1V2AA 2A4HA 5D9WA 1DBYA 1OE7A 2H0IA 1QQ2A 1SKRB 9GSSA 3APQA 1SYRA 5GSTA 3I6AA 3WT2A 3DRNA 4G9HA 2P5QA 4KAEA 1ON4A 3TRPA 5IMFA 4AGSA 2PWJA 5IMDA 3M3MA 5IPGA 4DSSB 4TR1A 2YZHA 1WWJA 4IVFA 1GP1A 5D8IA 1SU9A 4NAXA 1TJDA 1ERTA 2E2MA 3HHVA 1G6WA 5IO0A 3GRXA 1JZRA 2ON7A 3F8UA 2AJQB 3KMOA 3IHQA 2GLRA 2JU5A 2V6OA 3GX8A 3P7XA 1AQXA 1JLWA 4GXZA 2OADA 1EGRA 4EC0A 3CSJA 2HT9A 2RM5A 2YANA 2MBTA 10GSA 5ECHB 2VCTA 5KN2A 4QL9A 3O76A 4HJ2A 1F37A 1GTUA 2HYXA 3IAS2 1WE0A 3GSSA 2HRNA 3D6IA 2FLSA 2H8LA 1AUCA 2B6MA 3LQ7A 1BYEA 4ACSA 2OJLA 1T00A 2H70A 5D96A 2LSTA 2HRFA 5AIVA 3PINA 1W89A 4F0CA 3H1NA 4V1Ag 3UBLA 3BJ5A 3HVXA 1U3IA 1Z9HA 1IYHA 2KUCA 1R26A 5AN1A 3CTFA 4XHMA 4I97A 4O92A 5KOWA 5ID2A 2DLXA 4HS1A 2GSQA 2GSTA 3CRUA 2O7KA 2E0QA 2H30A 2L57A 4XTSA 5CRWA 2DJ0A 1SENA 5CRDA 1MDJA 2WGRA 4POBA 2XBQA 2V1MA 1V40A 1GULA 2M46A 1BX9A 5CRHA 3TKQA 2FD3A 2VUPA 5G31A 5G5FA 2LJAA 4Q5RA 2RIIA 3GTUB 3GL3A 4BVXA 4G10A 1FOVA 3GKMA 2JACA 2A2RA 1OKDA 4MNNA 2DKHA 1YKCA 1ZMAA 1TK8B 1GTIA 1NM3A 3GIXA 4PXOA 4NWYA 2LS5A 5IM9A 4K0GA 1Z7RA 1W4VA 3C7MA 4IKHA 1J9BA 1ML6A 2L4CA 5B8AA 1SD9A 3KZQA 2GZPA 3F6DA 5ID2B 2B1LA 2O89A 4BPYA 5DCHA 4HU9A 1T3BA 2C3TA 5ABRA 3TKSA 4QL7A 1XPVA 3BBYA 3SWLA 3QAVA 4MMMA 2GT6A 2A2SA 1JZOA 3TRXA 3HA9A 4ILFA 1THXA 4LMVA 3A3TA 4PUAA 3PGTA 2IMIA 4K5RA 5GAPD 1FB0A 2R0PA 1X5EA 1ERVA 5ECQB 4HUAA 2L5OA 1B8XA 4IGJA 19GSA 2KP1A 1SK1A 1OE8A 2EIRA 4NV2A 2XBIA 4TKYA 1S3CA 1SJ6A 3ZMLA 4ECIA 22GSA 3FEUA 1FAAA 5F07A 4PQ1A 5FT3A 2IPAA 1A0FA 3EYTA 3FYGA 17GSA 5IQYA 1GRXA 4USSA 3DKSA 1GH2A 3GUSA 1A23A 3ZVJD 4BL7A 2EIOA 4OFMA 4MH3A 3A2XA 2OE0A 5CNWA 3DWVA 1O7UA 5ECSA 5HR1A 2M72A 3F9UA 1KBNA 5JWRB 1H75A 3U5RE 3IA1A 3EMPA 4MABA 1FG4A 4JRRA 2DKIA 5KN3A 3F3QA 7GSSA 2WB9A 5JWOB 3UBKA 1O85A 2VCWA 2VD0A 2Z9SA 2PU9C 1AQVA 5J41A 1OC9A 2V6KA 1G6YA 1N8JA 3LORA 3FY7A 1TU7A 4V2MA 5G1LA 3U6VA 2EC4A 3K8NA 5CP1A 5C04A 1PX7A 2R3XA 4K0NA 2HXKA 5JWQB 1QUWA 3QOUA 3QPMA 5IMVA 5ELGA 3O6TA 3US3A 1ABAA 2PGTA 1K0BA 1ZYEA 5ECMB 3RBTA 5BRTA 2PMTA 2CVBA 3KTBA 1FHEA 5F05A 3D0ZA 3FZ4A 3G7YA 4J2FA 5J9CA 2YV7A 5JCUA 2B7KA 3BOAA 4TR0A 2IIYA 1K0CA 1GSQA 2PERA 1XVWA 2X64A 4EUYA 1XW9A 3Q19A 2B5YA 2H1GA 5B7CA 2GTUA 2GQKA 4QQ7A 4G2EA 4HZ2A 3IOSA 1BJXA 3VLNA 5DQSA 1UA5A 4JR6A 3D21A 4OFTA 2NBSA 3A2VA 4KNDA 1OC9B 3FW2A 2GZYA 2OKAA 3KD0A 3QFBC 5DDLA 1ZYQB 5INYA 2O8VB 1AW9A 1I5GA 3GKKA 1EZKA 2NDOA 5HFIA 4TR3A 5J4UA 3IAM2 4OO4A 1XIYA 3Q6OA 4AF2A 2HSYA 3GNJA 2CZ3A 4IELA 3FK8A 3H79A 4RQXA 4HDEA 1MD3A 1R7HA 2PBJA 2DBCA 2LV3A 2LQOA 4F2IA 4NV5A 1PN9A 4WXTA 5ECLB 2N5BA 3UAPA 4L5OA 4EIQA 2H1BA 2C80A 2ZCTA 1YF1A 3I43A 4IP6A 12GSA 3GKNA 2HFDA 4POMA 5A5KA 2HNLA 2H01A 2K8VA 2F9SA 1ACVA 3WGDA 4K1FA 3EVIA 2J9HA 3QCPA 5D9XA 5DJLA 2VM1A 1GSDA 4ZBAA 6GSUA 4P3YB 3DGQA 2ZNMA 1WPIA 4V2NA 4JE1A 1PL1A 6GSTA 3ZRDA 2DJ1A 3ZTLA 2NTOA 2OE1A 1VF3A 3FRCA 2N5FA 3TRQA 4TRXA 1T4ZA 4JU5A 1GSFA 2VIMA 2VCXA 4CY6A 1U87A 3MIXA 1MDKA 5HR0A 3SBCA 5B8BA 2DJ3A 1GSUA 1ZYPA 1T8EB 2AAWA 2HE3A 2CAQA 3TDGA 5D9VA 2IMEA 3TKSC 4O32A 2JL4A 3CRTA 4GCIA 3S9FA 4Z7XA 1Z7PA 4MJCA 2IMKA 4L8EA 4O5RA 4DSSA 4IP1A 2F3MA 3HXSA 4ZXGA 4KE3A 4EO3A 5F8BA 2PN8A 5GSSA 3M0FA 1K0MA 2C0GA 1F9MA 1HNBA 2IN3A 1GL8A 3WYWA 3N9JA 3QAWA 4XIHA 1SK0A 3G9BA 4OO5A 5IIZA 4OMVA 1CQHA 2H0HA 4MPFA 2RUEA 4L0WA 2DIZA 3LWAA 1KNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G19 A;  1A8L A;  2ON5 A;  2GSS A;  1BAY A;  5EL8 A;  1XVQ A;  1EWX A;  4F9Z A;  1JZW A;  1B9X C;  2CAI A;  5ENU A;  4OFN A;  3IC4 A;  2I4A A;  3EMX A;  4XRD A;  1GUH A;  3E0U A;  1XW5 A;  1EOG A;  6GSY A;  1ERW A;  3GUR A;  2I9H A;  3ZYW A;  3ZIT A;  2C3N A;  3KMN A;  1HYU A;  2OBK A;  2JZS A;  2QC7 A;  2K9F A;  5D9T A;  4POL A;  2YJ7 A;  2C4J A;  1QK8 A;  2HZF A;  3LSZ A;  2XC2 A;  3CSI A;  4KUN A;  4EDZ A;  1HNA A;  2VL2 A;  1EEM A;  4GST A;  4MJE A;  2V2G A;  3TJJ A;  3KJY A;  4MDC A;  4ZL7 A;  3RHB A;  2R5G A;  1X5D A;  4F82 A;  4EF0 A;  2LUS A;  3KCM A;  4WBJ A;  4PGT A;  2L4Q A;  2N5A A;  3FZA A;  3GTU A;  3C1S A;  3LEF A;  1B4P A;  4PUF C;  2X8G A;  4GQC A;  3W6G A;  3VWX A;  1B4Q A;  3F3R A;  1SKW B;  1UVZ A;  2OAC A;  2VO4 A;  1OVN A;  4RUV A;  4BVY A;  1O81 A;  3ISO A;  3GH9 A;  4K6X A;  2IMF A;  1GLP A;  2GS3 A;  5JCW A;  2ZUP A;  2B5X A;  4CHS A;  4GSS A;  1XWC A;  2DJK A;  4K8M A;  4WEY A;  5G2Z A;  4AJ6 A;  3FR9 A;  1UC7 A;  5IOX A;  3F4S A;  2VOC A;  1R5P A;  3KTL A;  4Q5F A;  2P5R A;  2L59 A;  3QMX A;  3EWL A;  1VGL A;  1WIK A;  4KGI A;  1PGT A;  4X0X A;  2KHP A;  3HCZ A;  4ZIJ A;  4ZIL A;  1XOB A;  3KEB A;  1T4Y A;  4GSN A;  1EV4 A;  2ES7 A;  4XS6 A;  4YAV A;  1FVJ A;  3P90 A;  1ST9 A;  3ED3 A;  4IQ1 A;  1QXH A;  3RPN A;  2H0G A;  4ZB9 A;  1SJZ A;  4ECB A;  2AHE A;  3DYR A;  1DUG A;  1AIU A;  2P0G A;  2XPE A;  3F4R A;  1PX6 A;  3EU4 A;  6GSV A;  2YV9 A;  1M0U A;  16GS A;  2CA8 A;  2JSY A;  1LBK A;  1XWK A;  3ZLP A;  5CAX A;  1EP7 A;  5DCG A;  4EL1 A;  4WR5 A;  1ZZY A;  4F0B A;  5DAL B;  1M2A A;  2H72 A;  1TRV A;  1A2J A;  5CYY A;  2CX3 A;  3DIE A;  3RHC A;  2LQQ A;  2VCQ A;  1V58 A;  2DSA A;  2KOK A;  1XCC A;  1SJI A;  4MF5 A;  3ZRE A;  3RAZ A;  2PPT A;  1MDI A;  1V57 A;  4O7H A;  3L9S A;  1FW1 A;  4EVM A;  3M1G A;  3KXO A;  1FO5 A;  5H5Q A;  4DEJ A;  4MA9 A;  2TRC P;  3VWV A;  2TRX A;  3ME7 A;  5LD0 A;  3M9K A;  1V9W A;  2VLV A;  3FZ9 A;  2J23 A;  5J9B A;  2FWH A;  5C00 A;  1YY7 A;  1OKT A;  4ZL9 A;  4TOP A;  13GS A;  1LU4 A;  3HJP A;  4HU7 A;  3I69 A;  3IBH A;  4DVC A;  4FYB A;  2L5L A;  3APS A;  4K2D A;  4K7I A;  1J0F A;  2OE3 A;  3TB2 A;  3PR8 A;  4EE0 A;  4I2U A;  2NVL A;  3NOF A;  4WF5 A;  4NHW A;  1K3O A;  4IW9 A;  4WET A;  2FNO A;  1YDK A;  2YP6 A;  1GNW A;  5LNK e;  2DMM A;  4TXV A;  4MK3 A;  3L78 A;  3MNG A;  3HVS A;  2VAF A;  2VD1 A;  4YQM A;  1EGO A;  3TJF A;  1VF1 A;  5B6M A;  1YJ6 A;  2I81 A;  4ZB6 A;  1THO A;  3C71 A;  4MF6 A;  1ZOF A;  4Q5N A;  2FA8 A;  2C0E A;  4BWQ A;  3J7Y b;  3IK9 A;  2H1A A;  2A4V A;  3F63 A;  4KSM A;  1O8W A;  3HZ4 A;  1GTA A;  8GSS A;  3DVX A;  1S3A A;  4OD7 A;  4V1A p;  1EP8 A;  2LJR A;  3C1R A;  3LG6 A;  1X0R A;  4HQS A;  2H76 A;  1YQ1 A;  2VL2 C;  1K0O A;  1B48 A;  1ILO A;  4NXI A;  3KH9 A;  3HY2 A;  4K7N A;  1SD8 A;  4J57 E;  4GWR A;  3M8N A;  3AY8 A;  2MMZ A;  2L6C A;  3I9V 2;  3VUR A;  1PL2 A;  1SYX A;  2RM6 A;  1DE1 A;  1Z6N A;  5JCG A;  2WFC A;  3GHA A;  3HVV A;  2C8U A;  5COH A;  3WGE A;  2H6X A;  2FGX A;  5DBQ A;  1DSB A;  4IQA A;  1HQO A;  1PA3 A;  5CRG A;  1C72 A;  3FHK A;  2AYT A;  2E2G A;  1R5A A;  2LKU A;  1OAZ A;  5HFK A;  4KDY A;  1WRY A;  3NZN A;  3IDV A;  4V2L A;  2GVP A;  4RI6 A;  2NPB A;  2O87 A;  3IK7 A;  3HJM A;  3RDW A;  2JAD A;  3PH9 A;  1TI3 A;  2H73 A;  4RI7 A;  5HFG A;  4IS0 A;  4PNF A;  5EY6 A;  5D73 A;  1FB6 A;  3UMA A;  3EIN A;  5J3R A;  5IMC A;  4NMU A;  2K6V A;  20GS A;  2AB6 A;  1GUK A;  1IYI A;  5L71 A;  4WBR D;  2GDR A;  2P31 A;  1VF2 A;  4AJ8 A;  4YAP A;  5IMZ A;  3H4K A;  1GSY A;  2LNS A;  1AC1 A;  1K3L A;  1GNE A;  1XWB A;  5ECP B;  2LTK A;  3QAG A;  2HI7 A;  5ECR B;  5EPF A;  2X8H A;  2H74 A;  2V41 A;  5A4V A;  2O85 A;  5HR3 A;  1E6B A;  2FA4 A;  2H6Z A;  4H86 A;  2YWI A;  1J08 A;  1E2Y A;  2ALB A;  3F4T A;  3W8J A;  1XBS A;  2VCV A;  2X99 A;  3VI7 A;  4XS4 B;  1U88 A;  3LXZ A;  3FZ5 A;  1K0A A;  4FIW A;  4KB3 A;  3A5W A;  3GST A;  2QKE A;  3VK9 A;  3VWU A;  2H66 A;  2VCZ A;  5HR2 A;  3RPP A;  2FCH A;  5IOW A;  2AV4 A;  2HZE A;  2H19 A;  4PUR A;  2YNX A;  3QFA C;  2HSH A;  1OC3 A;  4IN0 A;  1YZX A;  1GTB A;  1VRS D;  1JFU A;  3EE2 A;  2FWG A;  2LRN A;  1TK5 B;  4FO5 A;  2LJK A;  3M9J A;  2RUF A;  5GZZ B;  2IFQ B;  3QDN A;  4N0Z A;  3KIJ A;  3VPT A;  1TP9 A;  3UAR A;  3UVH A;  2L6D A;  1M7T A;  3GMF A;  5HQP A;  1XXU A;  4IJ3 A;  3UJ1 A;  4K7O A;  2GQM A;  4AJ7 A;  4ZBB A;  4HJM A;  1AAZ A;  2WZ9 A;  4L0U A;  2MZC A;  1URM A;  1M9A A;  5ECK B;  3TJK A;  5DAK A;  3EUR A;  4GTU A;  3O3T A;  3D4M A;  3TKS E;  1XZO A;  1NHY A;  1FVK A;  3DEX A;  2EIQ A;  3D5J A;  3G7J A;  1DE2 A;  1X9M B;  1SL0 B;  1ERU A;  2YWN A;  1XWG A;  3VI5 A;  1TU8 A;  1TKD B;  4D73 A;  2CT6 A;  2MBS A;  1G7O A;  3FKF A;  3TCO A;  2CX4 A;  4LL1 B;  4XCS A;  2HZE B;  3KP9 A;  3MDK A;  1OYJ A;  4N10 A;  1MD4 A;  1PQN A;  2V32 A;  2CQ9 A;  1TI1 A;  1NW2 A;  4HOJ A;  3DD3 A;  1KEB A;  5IPH A;  1GLQ A;  4Q5Q A;  4LMW A;  4ML6 A;  3C73 A;  3QR6 A;  4FYU A;  4KCA A;  3E9J B;  1YF0 A;  3IRA A;  4ECJ A;  2HLS A;  6GSS A;  5DAK B;  1M99 A;  2I3Y A;  5IMA A;  1R4W A;  1G7E A;  4LL4 B;  1V98 A;  3APO A;  3TKR A;  3Q74 A;  1M2B A;  1SKS B;  4MH2 A;  1RQM A;  3GYK A;  2LEG A;  4K9Z A;  4JR4 A;  3DXB A;  3TUE A;  1GUM A;  4NHZ A;  1CQG A;  1X9S B;  2MYG A;  1WJK A;  4HQZ A;  2DJJ A;  4D73 B;  3L9U A;  1A24 A;  1EOH A;  1PSQ A;  1Z5Y E;  2BMX A;  2K8S A;  2XHF A;  4MF7 A;  2XPD A;  5A4U A;  1A8Y A;  1ZCP A;  3CXG A;  4PQI A;  5ELA A;  1JZD A;  14GS A;  3DML A;  2YWO A;  1XWA A;  4KW6 A;  5GAN D;  4L5L A;  3D4T A;  1H4O A;  4N0V A;  3Q18 A;  2PVQ A;  4KDX A;  3TOT A;  5J5N A;  5G1K A;  2YJH A;  1TTZ A;  2WS2 A;  2JZR A;  1SL2 B;  5E59 A;  1UN2 A;  3IR4 A;  1WOU A;  3R2Q A;  1N2A A;  4KSO A;  4KX4 A;  2DC5 A;  1HNC A;  4IHU A;  1T1V A;  5F06 A;  5DAL A;  6GSX A;  1Q4J A;  4LA1 A;  4TR1 B;  1U6T A;  2K18 A;  1OC8 A;  1ZL9 A;  2CVK A;  2WRT A;  3ZZX A;  2QGV A;  3W8S A;  1K0N A;  1RW1 A;  3JCM L;  1TRW A;  1GWC A;  3KGK A;  2WUL A;  3OR5 A;  2OBI A;  1YEX A;  3LGC A;  2GZZ A;  2MMO A;  2C1Y A;  2BJX A;  1TK0 B;  4ZB8 A;  2H1D A;  3KH7 A;  4GRF A;  1BG5 A;  4EXJ A;  1PMT A;  2FHE A;  1SL1 B;  2KP2 A;  3BCI A;  4E8H A;  4CDO A;  2MMA A;  4EKZ A;  2JZT A;  1M2D A;  1EEJ A;  2QSI A;  4YQV A;  2D2Z A;  1X9W B;  3ERG A;  4I2T A;  5H5S A;  2F8F A;  11GS A;  2E7P A;  5FHI A;  1EV9 A;  4IBP A;  5IO2 A;  1A2M A;  4GLT A;  4MPG A;  2G2Q A;  2WJU A;  2GQL A;  3ZMK A;  4TVE A;  2I1U A;  1Y6E A;  2FUG 2;  2TIR A;  1XFL A;  2GT5 A;  2VL9 A;  2RLI A;  4POK A;  4DSR A;  3ZVJ A;  4ML1 A;  4X1U A;  4MCU A;  3NIV A;  2AUV A;  2LRC A;  2GSR A;  4XRA A;  4PQH A;  3LJR A;  3LYP A;  4BA7 A;  3LFL A;  3TJB A;  4OCE A;  4IJI A;  4MZW A;  2VM2 A;  1NHO A;  1WMJ A;  3TGZ A;  2B7J A;  2BTO T;  5G5E A;  1GSS A;  3L0H A;  4GQF A;  4PX1 A;  1U3A A;  18GS A;  4J56 E;  4MJA A;  2F51 A;  3GH6 A;  2FWE A;  1HD2 A;  5KEJ A;  1A0R P;  4TR4 A;  3WD6 A;  2DIY A;  3ZFB A;  3GV1 A;  1F3A A;  4YH2 A;  2YPM A;  3WGX A;  2GGT A;  5CO3 A;  2IL3 A;  4PNG A;  2PUK C;  2YWM A;  2R37 A;  3VPQ A;  2B3S A;  4I8B A;  2YN1 A;  4KDU A;  1Q98 A;  1PRX A;  5ECO B;  2X8C A;  2OA7 A;  1O73 A;  3P2A A;  2VL3 A;  4MZC A;  3V1W A;  1WP0 A;  3IE3 A;  2JSZ A;  3HDC A;  3ZIJ A;  5KN0 A;  4JZQ A;  1USB A;  3D22 A;  3MWH A;  3TKP A;  1GSE A;  2IJY A;  4WR4 A;  6GSW A;  2CZ2 A;  2DML A;  3HJO A;  4F03 A;  1TRU A;  3HD5 A;  2VLU A;  1X5C A;  2H71 A;  3VWW A;  1PD2 1;  5G30 A;  2G0F A;  1Z6M A;  3ZFL A;  3ME8 A;  5D93 A;  5AIX A;  2YOI A;  5E4W A;  3HKR A;  1T7P B;  3BD2 A;  4HZ4 A;  1K3Y A;  1F2E A;  3G7I A;  2R4V A;  3VFI A;  4ZBD A;  2CVD A;  1QGV A;  1XOA A;  1K0D A;  4DSQ A;  3GKX A;  3L4N A;  3MSZ A;  4XS1 A;  5KN1 A;  4FH8 A;  4ZL8 A;  2C0D A;  3BCK A;  1Z3E A;  3ZIV A;  3HZ8 A;  1YEP A;  4TN8 A;  5ECN B;  2B1K A;  4MZB A;  5ECI B;  4LLR A;  4MP4 A;  3KM6 A;  3N5O A;  4BWS A;  1NSW A;  3EC3 A;  1RK4 A;  4XS4 A;  2R2J A;  1JHB A;  3UVT A;  5CRE A;  3GFK A;  1AQW A;  5LCZ A;  3F6F A;  1TXX A;  3QD9 A;  3GN3 A;  2YZU A;  2MMN A;  4WF4 A;  4EDY A;  2LNT A;  5B6N A;  3TJG A;  2R6K A;  3EU3 A;  2IFQ A;  1F6M C;  5AIS A;  4MLY A;  1F3B A;  3CTG A;  4OCF A;  4I5Q A;  1PKW A;  3IPZ A;  4ULX A;  3ZL5 A;  5EVO A;  1SK2 A;  4ID0 A;  2YCD A;  3UOM A;  2FY6 A;  2IWT A;  4N30 A;  3KP8 A;  4CW9 A;  1BED A;  3CYN A;  4X43 A;  5DJM A;  1MTC A;  1I9D A;  3TOU A;  3ERF A;  1MEK A;  5FWG A;  4HEA 2;  4MJB A;  3UL3 A;  4FYC A;  3L9V A;  3UEM A;  1M9B A;  3UIW A;  3E3E A;  3FR3 A;  5DQY A;  3GX0 A;  1XW6 A;  2PVO C;  2B5E A;  4NPB A;  1JLV A;  4TXO A;  2M80 A;  4JED A;  1BQ7 A;  3FR6 A;  1QMV A;  4GF0 A;  1AXD A;  1KTE A;  4HI7 A;  2WDU A;  3C8E A;  2IMD A;  1B9Y C;  5A4W A;  3WT1 A;  2DJ2 A;  2WCI A;  3IV4 A;  2KLX A;  3CSH A;  3LXT A;  4RQR A;  3P8W A;  4JBB A;  1TOF A;  5DVB A;  1O8X A;  3H93 A;  4KA0 A;  2LRT A;  3CBU A;  3GL5 A;  2VLT A;  2C3Q A;  3GA4 A;  2H75 A;  2C0F A;  1G0T A;  1S3D A;  4KCE A;  3ERW A;  2REM A;  1PKZ A;  4OWY A;  3H8Q A;  4KH7 A;  2CV4 A;  3DVW A;  4E8E A;  1O6J A;  3F0I A;  4I6X A;  2FWF A;  4N11 A;  1TRS A;  3CMI A;  1YKA A;  1TDI A;  1LJR A;  1VF4 A;  4TXO B;  4ISD A;  1A2L A;  4YQU A;  2F8A A;  5F0G A;  3A2W A;  3LYK A;  3HYP A;  2H6Y A;  4WKW A;  3J7Y k;  4TW5 A;  1ZGN A;  5AGY A;  1Y25 A;  3IXR A;  4ECC A;  5H5R A;  3MAK A;  1QFN A;  1TW9 A;  1V2A A;  5D9W A;  1DBY A;  1OE7 A;  2H0I A;  1QQ2 A;  1SKR B;  9GSS A;  3APQ A;  1SYR A;  5GST A;  3I6A A;  3WT2 A;  3DRN A;  4G9H A;  2P5Q A;  4KAE A;  1ON4 A;  3TRP A;  5IMF A;  4AGS A;  2PWJ A;  5IMD A;  3M3M A;  5IPG A;  4DSS B;  4TR1 A;  2YZH A;  1WWJ A;  4IVF A;  1GP1 A;  5D8I A;  1SU9 A;  4NAX A;  1TJD A;  1ERT A;  2E2M A;  3HHV A;  1G6W A;  5IO0 A;  3GRX A;  1JZR A;  2ON7 A;  3F8U A;  2AJQ B;  3KMO A;  3IHQ A;  2GLR A;  2JU5 A;  2V6O A;  3GX8 A;  3P7X A;  1AQX A;  1JLW A;  4GXZ A;  2OAD A;  1EGR A;  4EC0 A;  3CSJ A;  2HT9 A;  2RM5 A;  2YAN A;  2MBT A;  10GS A;  5ECH B;  2VCT A;  5KN2 A;  4QL9 A;  3O76 A;  4HJ2 A;  1F37 A;  1GTU A;  2HYX A;  3IAS 2;  1WE0 A;  3GSS A;  2HRN A;  3D6I A;  2FLS A;  2H8L A;  1AUC A;  2B6M A;  3LQ7 A;  1BYE A;  4ACS A;  2OJL A;  1T00 A;  2H70 A;  5D96 A;  2LST A;  2HRF A;  5AIV A;  3PIN A;  1W89 A;  4F0C A;  3H1N A;  4V1A g;  3UBL A;  3BJ5 A;  3HVX A;  1U3I A;  1Z9H A;  1IYH A;  2KUC A;  1R26 A;  5AN1 A;  3CTF A;  4XHM A;  4I97 A;  4O92 A;  5ID2 A;  2DLX A;  4HS1 A;  2GSQ A;  2GST A;  3CRU A;  2O7K A;  2E0Q A;  2H30 A;  2L57 A;  4XTS A;  5CRW A;  2DJ0 A;  1SEN A;  5CRD A;  1MDJ A;  2WGR A;  4POB A;  2XBQ A;  2V1M A;  1V40 A;  1GUL A;  2M46 A;  1BX9 A;  5CRH A;  3TKQ A;  2FD3 A;  2VUP A;  5G31 A;  5G5F A;  2LJA A;  4Q5R A;  2RII A;  3GTU B;  3GL3 A;  4BVX A;  4G10 A;  1FOV A;  3GKM A;  2JAC A;  2A2R A;  1OKD A;  1YKC A;  1ZMA A;  1TK8 B;  1GTI A;  1NM3 A;  3GIX A;  4PXO A;  4NWY A;  2LS5 A;  5IM9 A;  4K0G A;  1Z7R A;  1W4V A;  3C7M A;  4IKH A;  1J9B A;  1ML6 A;  2L4C A;  5B8A A;  1SD9 A;  3KZQ A;  2GZP A;  3F6D A;  5ID2 B;  2B1L A;  2O89 A;  4BPY A;  5DCH A;  4HU9 A;  1T3B A;  2C3T A;  5ABR A;  3TKS A;  4QL7 A;  1XPV A;  3BBY A;  3SWL A;  3QAV A;  4MMM A;  2GT6 A;  2A2S A;  1JZO A;  3TRX A;  3HA9 A;  4ILF A;  1THX A;  4LMV A;  3A3T A;  4PUA A;  3PGT A;  2IMI A;  5GAP D;  1FB0 A;  1X5E A;  1ERV A;  5ECQ B;  4HUA A;  2L5O A;  1B8X A;  4IGJ A;  19GS A;  2KP1 A;  1SK1 A;  1OE8 A;  2EIR A;  4NV2 A;  2XBI A;  4TKY A;  1S3C A;  1SJ6 A;  3ZML A;  4ECI A;  22GS A;  3FEU A;  1FAA A;  5F07 A;  4PQ1 A;  5FT3 A;  2IPA A;  1A0F A;  3EYT A;  3FYG A;  17GS A;  5IQY A;  1GRX A;  3DKS A;  1GH2 A;  3GUS A;  1A23 A;  3ZVJ D;  4BL7 A;  2EIO A;  4OFM A;  4MH3 A;  3A2X A;  2OE0 A;  5CNW A;  3DWV A;  1O7U A;  5ECS A;  5HR1 A;  2M72 A;  3F9U A;  1KBN A;  5JWR B;  1H75 A;  3U5R E;  3IA1 A;  3EMP A;  4MAB A;  1FG4 A;  4JRR A;  5KN3 A;  3F3Q A;  7GSS A;  2WB9 A;  5JWO B;  3UBK A;  1O85 A;  2VCW A;  2VD0 A;  2Z9S A;  2PU9 C;  1AQV A;  5J41 A;  1OC9 A;  2V6K A;  1G6Y A;  1N8J A;  3LOR A;  3FY7 A;  1TU7 A;  4V2M A;  5G1L A;  3U6V A;  2EC4 A;  3K8N A;  5CP1 A;  5C04 A;  1PX7 A;  2R3X A;  4K0N A;  2HXK A;  5JWQ B;  1QUW A;  3QOU A;  3QPM A;  5IMV A;  5ELG A;  3O6T A;  3US3 A;  1ABA A;  2PGT A;  1K0B A;  1ZYE A;  5ECM B;  3RBT A;  2PMT A;  2CVB A;  3KTB A;  1FHE A;  5F05 A;  3D0Z A;  3FZ4 A;  3G7Y A;  4J2F A;  5J9C A;  2YV7 A;  5JCU A;  2B7K A;  3BOA A;  4TR0 A;  2IIY A;  1K0C A;  1GSQ A;  2PER A;  1XVW A;  2X64 A;  4EUY A;  1XW9 A;  3Q19 A;  2B5Y A;  2H1G A;  5B7C A;  2GTU A;  2GQK A;  4QQ7 A;  4G2E A;  4HZ2 A;  3IOS A;  1BJX A;  3VLN A;  5DQS A;  1UA5 A;  4JR6 A;  3D21 A;  4OFT A;  2NBS A;  3A2V A;  4KND A;  1OC9 B;  3FW2 A;  2GZY A;  2OKA A;  3KD0 A;  3QFB C;  5DDL A;  1ZYQ B;  5INY A;  2O8V B;  1AW9 A;  1I5G A;  3GKK A;  1EZK A;  2NDO A;  5HFI A;  4TR3 A;  5J4U A;  3IAM 2;  4OO4 A;  1XIY A;  3Q6O A;  4AF2 A;  2HSY A;  3GNJ A;  2CZ3 A;  4IEL A;  3FK8 A;  3H79 A;  4RQX A;  4HDE A;  1MD3 A;  1R7H A;  2PBJ A;  2DBC A;  2LV3 A;  2LQO A;  4F2I A;  4NV5 A;  1PN9 A;  4WXT A;  5ECL B;  2N5B A;  3UAP A;  4L5O A;  2H1B A;  2C80 A;  2ZCT A;  1YF1 A;  3I43 A;  4IP6 A;  12GS A;  3GKN A;  2HFD A;  4POM A;  5A5K A;  2HNL A;  2H01 A;  2K8V A;  2F9S A;  1ACV A;  3WGD A;  4K1F A;  3EVI A;  2J9H A;  3QCP A;  5D9X A;  5DJL A;  2VM1 A;  1GSD A;  4ZBA A;  6GSU A;  4P3Y B;  3DGQ A;  2ZNM A;  1WPI A;  4V2N A;  4JE1 A;  1PL1 A;  6GST A;  3ZRD A;  2DJ1 A;  3ZTL A;  2NTO A;  2OE1 A;  1VF3 A;  3FRC A;  2N5F A;  3TRQ A;  4TRX A;  1T4Z A;  4JU5 A;  1GSF A;  2VIM A;  2VCX A;  1U87 A;  1MDK A;  5HR0 A;  3SBC A;  5B8B A;  2DJ3 A;  1GSU A;  1T8E B;  2AAW A;  2HE3 A;  2CAQ A;  3TDG A;  5D9V A;  2IME A;  3TKS C;  4O32 A;  2JL4 A;  3CRT A;  4GCI A;  3S9F A;  4Z7X A;  1Z7P A;  4MJC A;  2IMK A;  4L8E A;  4O5R A;  4DSS A;  4IP1 A;  2F3M A;  3HXS A;  4ZXG A;  4KE3 A;  4EO3 A;  5F8B A;  2PN8 A;  5GSS A;  3M0F A;  1K0M A;  2C0G A;  1F9M A;  1HNB A;  2IN3 A;  1GL8 A;  3WYW A;  3N9J A;  3QAW A;  4XIH A;  1SK0 A;  3G9B A;  4OO5 A;  5IIZ A;  4OMV A;  1CQH A;  2H0H A;  4MPF A;  2RUE A;  4L0W A;  2DIZ A;  3LWA A;  1KNG A; 
#chains in the Genus database with same CATH topology
 4G19 A;  1A8L A;  2ON5 A;  2GSS A;  1BAY A;  5EL8 A;  1XVQ A;  1EWX A;  4F9Z A;  1JZW A;  1B9X C;  2CAI A;  5ENU A;  4OFN A;  3IC4 A;  2I4A A;  3EMX A;  4XRD A;  1GUH A;  3E0U A;  1XW5 A;  1EOG A;  6GSY A;  1ERW A;  3GUR A;  2I9H A;  3ZYW A;  2A2P A;  3ZIT A;  2C3N A;  3KMN A;  1HYU A;  2OBK A;  2JZS A;  4BIK A;  2QC7 A;  2K9F A;  5D9T A;  4POL A;  2YJ7 A;  2C4J A;  1QK8 A;  2HZF A;  3LSZ A;  2XC2 A;  3CSI A;  4KUN A;  4EDZ A;  3CQF A;  1HNA A;  2VL2 A;  1EEM A;  4GST A;  4MJE A;  2V2G A;  3TJJ A;  3KJY A;  1PN0 A;  4MDC A;  4ZL7 A;  3RHB A;  2R5G A;  1X5D A;  4F82 A;  4EF0 A;  2LUS A;  3KCM A;  4WBJ A;  4PGT A;  2L4Q A;  2N5A A;  3FZA A;  3GTU A;  3C1S A;  3LEF A;  1B4P A;  4PUF C;  2X8G A;  4GQC A;  3W6G A;  3VWX A;  1B4Q A;  2X4A A;  3F3R A;  1SKW B;  1UVZ A;  2OAC A;  2VO4 A;  1S3R A;  1OVN A;  4RUV A;  4BVY A;  1O81 A;  3ISO A;  3GH9 A;  4K6X A;  2IMF A;  1GLP A;  2GS3 A;  5JCW A;  2ZUP A;  2B5X A;  4CHS A;  4GSS A;  1XWC A;  2DJK A;  4K8M A;  4WEY A;  5G2Z A;  4AJ6 A;  3FR9 A;  1UC7 A;  5IOX A;  3F4S A;  2VOC A;  1R5P A;  3KTL A;  4Q5F A;  2P5R A;  2L59 A;  3QMX A;  3EWL A;  1VGL A;  1WIK A;  4KGI A;  1PGT A;  4X0X A;  2KHP A;  3HCZ A;  4ZIJ A;  4ZIL A;  1XOB A;  3KEB A;  1T4Y A;  4GSN A;  1EV4 A;  2ES7 A;  4XS6 A;  4YAV A;  1FVJ A;  3P90 A;  1ST9 A;  3ED3 A;  4IQ1 A;  1QXH A;  3RPN A;  2H0G A;  4ZB9 A;  1SJZ A;  4ECB A;  2AHE A;  3DYR A;  1DUG A;  1AIU A;  2P0G A;  2XPE A;  3F4R A;  1PX6 A;  3EU4 A;  4BVY B;  6GSV A;  2YV9 A;  1M0U A;  16GS A;  2CA8 A;  2JSY A;  1LBK A;  1XWK A;  3ZLP A;  5CAX A;  1EP7 A;  5DCG A;  4EL1 A;  4WR5 A;  1ZZY A;  4F0B A;  5DAL B;  1M2A A;  2H72 A;  1TRV A;  1A2J A;  5CYY A;  2CX3 A;  3DIE A;  3RHC A;  2LQQ A;  2VCQ A;  1V58 A;  2DSA A;  2KOK A;  1XCC A;  1SJI A;  4MF5 A;  3ZRE A;  3RAZ A;  2PPT A;  1MDI A;  1V57 A;  4O7H A;  4A5P A;  3L9S A;  1FW1 A;  4EVM A;  3M1G A;  3KXO A;  1FO5 A;  5H5Q A;  4DEJ A;  4MA9 A;  2TRC P;  3VWV A;  2TRX A;  3ME7 A;  5LD0 A;  3M9K A;  1V9W A;  2VLV A;  3FZ9 A;  2J23 A;  5J9B A;  2FWH A;  5C00 A;  1YY7 A;  1OKT A;  4ZL9 A;  4TOP A;  13GS A;  1LU4 A;  3HJP A;  4HU7 A;  3I69 A;  3IBH A;  4DVC A;  4FYB A;  2L5L A;  3APS A;  4K2D A;  4K7I A;  1J0F A;  2OE3 A;  3TB2 A;  3PR8 A;  4EE0 A;  4I2U A;  2NVL A;  3NOF A;  2HSM A;  4WF5 A;  4PTS A;  3IC8 A;  4NHW A;  1K3O A;  4IW9 A;  4WET A;  2FNO A;  1YDK A;  2YP6 A;  1GNW A;  5LNK e;  2DMM A;  4TXV A;  4MK3 A;  3L78 A;  3MNG A;  3HVS A;  2VAF A;  2VD1 A;  4YQM A;  1EGO A;  3TJF A;  1VF1 A;  5B6M A;  1YJ6 A;  2I81 A;  4ZB6 A;  1THO A;  3C71 A;  4MF6 A;  1ZOF A;  4Q5N A;  2FA8 A;  2C0E A;  4BWQ A;  3J7Y b;  3IK9 A;  2H1A A;  2A4V A;  3F63 A;  4KSM A;  1O8W A;  3HZ4 A;  1GTA A;  8GSS A;  3DVX A;  1S3A A;  4OD7 A;  4V1A p;  1EP8 A;  2LJR A;  3C1R A;  3LG6 A;  3R3E A;  1X0R A;  4HQS A;  2H76 A;  1YQ1 A;  2VL2 C;  1K0O A;  1B48 A;  1ILO A;  4NXI A;  3KH9 A;  3HY2 A;  4K7N A;  1SD8 A;  4J57 E;  4GWR A;  3M8N A;  3AY8 A;  2MMZ A;  2L6C A;  3I9V 2;  3VUR A;  1FOH A;  1PL2 A;  1SYX A;  2RM6 A;  1DE1 A;  1Z6N A;  5JCG A;  2WFC A;  3GHA A;  3HVV A;  2C8U A;  5COH A;  3WGE A;  2H6X A;  2FGX A;  5DBQ A;  1DSB A;  4IQA A;  1HQO A;  1PA3 A;  5CRG A;  1C72 A;  3FHK A;  2AYT A;  2E2G A;  1R5A A;  2LKU A;  1OAZ A;  5HFK A;  4KDY A;  1WRY A;  3NZN A;  3IDV A;  4V2L A;  2GVP A;  4O5Q A;  4RI6 A;  2NPB A;  2O87 A;  3IK7 A;  3HJM A;  3RDW A;  2JAD A;  3PH9 A;  1TI3 A;  2H73 A;  4RI7 A;  5HFG A;  4IS0 A;  4PNF A;  5EY6 A;  5D73 A;  1FB6 A;  3UMA A;  3EIN A;  4O5U A;  5J3R A;  5IMC A;  4NMU A;  2K6V A;  20GS A;  2AB6 A;  1GUK A;  1IYI A;  5L71 A;  4WBR D;  2GDR A;  2P31 A;  4Z2U A;  1VF2 A;  4AJ8 A;  4YAP A;  5IMZ A;  3H4K A;  1GSY A;  2LNS A;  1AC1 A;  1K3L A;  1GNE A;  1XWB A;  5ECP B;  2LTK A;  3QAG A;  2HI7 A;  5ECR B;  5EPF A;  2X8H A;  2H74 A;  2V41 A;  5A4V A;  2O85 A;  5HR3 A;  1E6B A;  2FA4 A;  2H6Z A;  4H86 A;  2YWI A;  1J08 A;  1E2Y A;  2ALB A;  3F4T A;  3W8J A;  3PPU A;  1XBS A;  2VCV A;  5BMU A;  2X99 A;  3VI7 A;  4XS4 B;  1U88 A;  3LXZ A;  3FZ5 A;  1K0A A;  4FIW A;  4KB3 A;  3A5W A;  3GST A;  2QKE A;  3VK9 A;  3VWU A;  2H66 A;  2VCZ A;  5HR2 A;  3RPP A;  2FCH A;  5IOW A;  2AV4 A;  2HZE A;  2H19 A;  4PUR A;  2YNX A;  3QFA C;  2HSH A;  1OC3 A;  4IN0 A;  1YZX A;  1GTB A;  1VRS D;  1JFU A;  3EE2 A;  2FWG A;  2LRN A;  1TK5 B;  4FO5 A;  2LJK A;  3M9J A;  2RUF A;  5GZZ B;  2IFQ B;  3QDN A;  4N0Z A;  3KIJ A;  3VPT A;  1TP9 A;  3EPT A;  3UAR A;  3UVH A;  2L6D A;  1M7T A;  3GMF A;  5HQP A;  1XXU A;  4IJ3 A;  3UJ1 A;  4K7O A;  2GQM A;  4AJ7 A;  4ZBB A;  4HJM A;  1AAZ A;  2WZ9 A;  4L0U A;  2MZC A;  1URM A;  1M9A A;  5ECK B;  3TJK A;  5DAK A;  3EUR A;  4GTU A;  3O3T A;  3D4M A;  3TKS E;  1XZO A;  1NHY A;  1FVK A;  3DEX A;  2EIQ A;  3D5J A;  3G7J A;  1DE2 A;  1X9M B;  4G0K A;  1SL0 B;  1ERU A;  2YWN A;  1XWG A;  3VI5 A;  2X49 A;  1TU8 A;  1TKD B;  4D73 A;  2CT6 A;  2MBS A;  1G7O A;  3FKF A;  3TCO A;  2CX4 A;  4LL1 B;  4XCS A;  4K5S A;  2HZE B;  3KP9 A;  3MDK A;  1OYJ A;  4N10 A;  1MD4 A;  1PQN A;  3FMW A;  2V32 A;  2CQ9 A;  1TI1 A;  1NW2 A;  4HOJ A;  3DD3 A;  1KEB A;  5IPH A;  1GLQ A;  4Q5Q A;  4LMW A;  4ML6 A;  3C73 A;  3QR6 A;  4FYU A;  4KCA A;  3E9J B;  1YF0 A;  4ICY A;  3IRA A;  4ECJ A;  2HLS A;  6GSS A;  1M99 A;  5DAK B;  2I3Y A;  4X4J A;  5IMA A;  1R4W A;  1G7E A;  4LL4 B;  1V98 A;  3APO A;  3IHG A;  3TKR A;  3Q74 A;  1M2B A;  1SKS B;  4MH2 A;  2R0G A;  1RQM A;  3GYK A;  2LEG A;  4K9Z A;  4JR4 A;  3DXB A;  3TUE A;  1GUM A;  4NHZ A;  2UZ8 A;  3A5I A;  1CQG A;  1X9S B;  2MYG A;  1WJK A;  4HQZ A;  2DJJ A;  4D73 B;  3L9U A;  1A24 A;  1EOH A;  1PSQ A;  1Z5Y E;  2BMX A;  2K8S A;  2XHF A;  4MF7 A;  2XPD A;  5A4U A;  1A8Y A;  2HRA A;  1ZCP A;  3CXG A;  4PQI A;  5ELA A;  1JZD A;  14GS A;  3DML A;  2YWO A;  1XWA A;  4KW6 A;  5GAN D;  2QA1 A;  4L5L A;  3D4T A;  1H4O A;  4N0V A;  3Q18 A;  2PVQ A;  4KDX A;  3TOT A;  5J5N A;  5G1K A;  2YJH A;  1TTZ A;  2WS2 A;  2JZR A;  1SL2 B;  5E59 A;  1UN2 A;  3IR4 A;  1WOU A;  1M3I A;  3R2Q A;  1N2A A;  4KSO A;  4KX4 A;  2DC5 A;  1HNC A;  4IHU A;  1T1V A;  5F06 A;  5DAL A;  6GSX A;  1Q4J A;  4LA1 A;  4TR1 B;  1U6T A;  2K18 A;  1OC8 A;  1ZL9 A;  2CVK A;  2WRT A;  3ZZX A;  2QGV A;  3W8S A;  1K0N A;  1RW1 A;  3JCM L;  1TRW A;  1GWC A;  3KGK A;  2WUL A;  3OR5 A;  2OBI A;  1YEX A;  3LGC A;  2GZZ A;  2MMO A;  2C1Y A;  2BJX A;  1TK0 B;  4ZB8 A;  2H1D A;  3KH7 A;  4GRF A;  1BG5 A;  4EXJ A;  1PMT A;  2FHE A;  1SL1 B;  2KP2 A;  3BCI A;  4E8H A;  4CDO A;  2MMA A;  4EKZ A;  2JZT A;  1M2D A;  4YKG A;  1EEJ A;  2QSI A;  4YQV A;  2D2Z A;  1X9W B;  3ERG A;  4I2T A;  5H5S A;  2F8F A;  11GS A;  2E7P A;  5FHI A;  1EV9 A;  4IBP A;  2R0C A;  4G0I A;  5IO2 A;  1A2M A;  4GLT A;  4MPG A;  2G2Q A;  2WJU A;  2GQL A;  3ZMK A;  4TVE A;  2I1U A;  1Y6E A;  2FUG 2;  2TIR A;  1XFL A;  3HVN A;  2GT5 A;  2VL9 A;  2RLI A;  4POK A;  4DSR A;  3ZVJ A;  4ML1 A;  4X1U A;  4MCU A;  3NIV A;  2AUV A;  2LRC A;  2GSR A;  4XRA A;  4PQH A;  3LJR A;  3LYP A;  4BA7 A;  3LFL A;  3TJB A;  4OCE A;  4IJI A;  4MZW A;  2VM2 A;  1NHO A;  1WMJ A;  3TGZ A;  2B7J A;  2BTO T;  5G5E A;  1GSS A;  3L0H A;  4GQF A;  4PX1 A;  1U3A A;  4G0L A;  18GS A;  4J56 E;  4MJA A;  2F51 A;  3GH6 A;  2FWE A;  1HD2 A;  5KEJ A;  1A0R P;  4TR4 A;  3WD6 A;  2DIY A;  4BVX B;  3ZFB A;  3GV1 A;  1F3A A;  4YH2 A;  2YPM A;  3WGX A;  2GGT A;  5CO3 A;  2IL3 A;  4PNG A;  2PUK C;  2YWM A;  2R37 A;  3VPQ A;  2B3S A;  4I8B A;  2YN1 A;  4EIP A;  4KDU A;  1Q98 A;  1PRX A;  5ECO B;  2X8C A;  2OA7 A;  1O73 A;  3P2A A;  2VL3 A;  4MZC A;  3V1W A;  1WP0 A;  3IE3 A;  2JSZ A;  3HDC A;  3ZIJ A;  5KN0 A;  4JZQ A;  1USB A;  3D22 A;  3MWH A;  3TKP A;  1GSE A;  1ZYN A;  2IJY A;  4WR4 A;  6GSW A;  2CZ2 A;  2DML A;  3HJO A;  4F03 A;  1TRU A;  3HD5 A;  2VLU A;  1X5C A;  2H71 A;  3VWW A;  1PD2 1;  5G30 A;  2G0F A;  1Z6M A;  3ZFL A;  3ME8 A;  5D93 A;  5AIX A;  2YOI A;  5E4W A;  3HKR A;  1T7P B;  3BD2 A;  4HZ4 A;  1K3Y A;  1F2E A;  3G7I A;  2R4V A;  3VFI A;  4ZBD A;  2CVD A;  1QGV A;  1XOA A;  1K0D A;  4DSQ A;  3GKX A;  3L4N A;  3MSZ A;  4XS1 A;  5KN1 A;  4FH8 A;  4ZL8 A;  2C0D A;  3BCK A;  1Z3E A;  3ZIV A;  4Z2R A;  3HZ8 A;  1YEP A;  4TN8 A;  5ECN B;  4BL7 B;  2B1K A;  4MZB A;  5ECI B;  4LLR A;  4MP4 A;  3KM6 A;  3N5O A;  4BWS A;  1NSW A;  3EC3 A;  1RK4 A;  4XS4 A;  2R2J A;  1JHB A;  3UVT A;  5CRE A;  3GFK A;  1AQW A;  5LCZ A;  3F6F A;  4Z2T A;  1TXX A;  3QD9 A;  3GN3 A;  2YZU A;  2MMN A;  4WF4 A;  4EDY A;  2LNT A;  5B6N A;  3TJG A;  2R6K A;  3EU3 A;  2IFQ A;  1F6M C;  5AIS A;  4MLY A;  1F3B A;  3CTG A;  4OCF A;  4I5Q A;  1PKW A;  3IPZ A;  4ULX A;  3ZL5 A;  5EVO A;  1SK2 A;  4ID0 A;  2YCD A;  4YKF A;  3UOM A;  2FY6 A;  2IWT A;  4N30 A;  3KP8 A;  4CW9 A;  1BED A;  3CYN A;  4X43 A;  5DJM A;  1MTC A;  1I9D A;  3TOU A;  3ERF A;  1MEK A;  5FWG A;  4HEA 2;  4MJB A;  3UL3 A;  4FYC A;  3L9V A;  3UEM A;  1M9B A;  3UIW A;  3E3E A;  3FR3 A;  5DQY A;  4KF9 A;  3GX0 A;  1XW6 A;  2PVO C;  2B5E A;  4FQU A;  4NPB A;  1JLV A;  4TXO A;  2M80 A;  4JED A;  1BQ7 A;  3FR6 A;  1QMV A;  3LW9 A;  4GF0 A;  1AXD A;  1KTE A;  4HI7 A;  2WDU A;  3C8E A;  2IMD A;  1B9Y C;  5A4W A;  3WT1 A;  2DJ2 A;  2WCI A;  3IV4 A;  2KLX A;  5KOX A;  4K2X A;  3CSH A;  3LXT A;  2HRK A;  4RQR A;  4CY8 A;  3P8W A;  4JBB A;  1TOF A;  5DVB A;  1O8X A;  3H93 A;  4KA0 A;  2LRT A;  3CBU A;  3GL5 A;  2VLT A;  2C3Q A;  3GA4 A;  2H75 A;  2C0F A;  1G0T A;  1S3D A;  4KCE A;  3ERW A;  2REM A;  1PKZ A;  4OWY A;  3H8Q A;  4KH7 A;  2CV4 A;  3DVW A;  4E8E A;  1O6J A;  3F0I A;  4I6X A;  2FWF A;  4N11 A;  1TRS A;  3CMI A;  1YKA A;  1TDI A;  1LJR A;  1VF4 A;  4TXO B;  4ISD A;  1A2L A;  4YQU A;  2F8A A;  5F0G A;  3A2W A;  3MYD A;  3LYK A;  3HYP A;  2H6Y A;  4WKW A;  3J7Y k;  4TW5 A;  1ZGN A;  2QA2 A;  5AGY A;  1Y25 A;  3IXR A;  4ECC A;  5H5R A;  3MAK A;  1QFN A;  1TW9 A;  1V2A A;  2A4H A;  5D9W A;  1DBY A;  1OE7 A;  2H0I A;  1QQ2 A;  1SKR B;  9GSS A;  3APQ A;  1SYR A;  5GST A;  3I6A A;  3WT2 A;  3DRN A;  4G9H A;  2P5Q A;  4KAE A;  1ON4 A;  3TRP A;  5IMF A;  4AGS A;  2PWJ A;  5IMD A;  3M3M A;  5IPG A;  4DSS B;  4TR1 A;  2YZH A;  1WWJ A;  4IVF A;  1GP1 A;  5D8I A;  1SU9 A;  4NAX A;  1TJD A;  1ERT A;  2E2M A;  3HHV A;  1G6W A;  5IO0 A;  3GRX A;  1JZR A;  2ON7 A;  3F8U A;  2AJQ B;  3KMO A;  3IHQ A;  2GLR A;  2JU5 A;  2V6O A;  3GX8 A;  3P7X A;  1AQX A;  1JLW A;  4GXZ A;  2OAD A;  1EGR A;  4HSC X;  4EC0 A;  3CSJ A;  2HT9 A;  2RM5 A;  2YAN A;  2MBT A;  10GS A;  5ECH B;  2VCT A;  5KN2 A;  4QL9 A;  3O76 A;  4HJ2 A;  1F37 A;  1GTU A;  2HYX A;  3IAS 2;  1WE0 A;  3GSS A;  2HRN A;  3D6I A;  2FLS A;  2H8L A;  1PFO A;  1AUC A;  2B6M A;  3LQ7 A;  1BYE A;  4ACS A;  2OJL A;  1T00 A;  2H70 A;  5D96 A;  2LST A;  2HRF A;  5AIV A;  3PIN A;  1W89 A;  4F0C A;  3H1N A;  4V1A g;  3UBL A;  3BJ5 A;  3HVX A;  1U3I A;  1Z9H A;  1IYH A;  2KUC A;  1R26 A;  5AN1 A;  3CTF A;  4XHM A;  4I97 A;  4O92 A;  5KOW A;  5ID2 A;  2DLX A;  4HS1 A;  2GSQ A;  2GST A;  3CRU A;  2O7K A;  2E0Q A;  2H30 A;  2L57 A;  4XTS A;  5CRW A;  2DJ0 A;  1SEN A;  5CRD A;  1MDJ A;  2WGR A;  4POB A;  2XBQ A;  2V1M A;  1V40 A;  1GUL A;  2M46 A;  1BX9 A;  5CRH A;  3TKQ A;  2FD3 A;  2VUP A;  5G31 A;  5G5F A;  2LJA A;  4Q5R A;  2RII A;  3GTU B;  3GL3 A;  4BVX A;  4G10 A;  1FOV A;  3GKM A;  2JAC A;  2A2R A;  1OKD A;  4MNN A;  2DKH A;  1YKC A;  1ZMA A;  1TK8 B;  1GTI A;  1NM3 A;  3GIX A;  4PXO A;  4NWY A;  2LS5 A;  5IM9 A;  4K0G A;  1Z7R A;  1W4V A;  3C7M A;  4IKH A;  1J9B A;  1ML6 A;  2L4C A;  5B8A A;  1SD9 A;  3KZQ A;  2GZP A;  3F6D A;  5ID2 B;  2B1L A;  2O89 A;  4BPY A;  5DCH A;  4HU9 A;  1T3B A;  2C3T A;  5ABR A;  3TKS A;  4QL7 A;  1XPV A;  3BBY A;  3SWL A;  3QAV A;  4MMM A;  2GT6 A;  2A2S A;  1JZO A;  3TRX A;  3HA9 A;  4ILF A;  1THX A;  4LMV A;  3A3T A;  4PUA A;  3PGT A;  2IMI A;  4K5R A;  5GAP D;  1FB0 A;  2R0P A;  1X5E A;  1ERV A;  5ECQ B;  4HUA A;  2L5O A;  1B8X A;  4IGJ A;  19GS A;  2KP1 A;  1SK1 A;  1OE8 A;  2EIR A;  4NV2 A;  2XBI A;  4TKY A;  1S3C A;  1SJ6 A;  3ZML A;  4ECI A;  22GS A;  3FEU A;  1XG8 A;  1FAA A;  5F07 A;  4PQ1 A;  5FT3 A;  2IPA A;  1A0F A;  3EYT A;  3FYG A;  17GS A;  5IQY A;  1GRX A;  4USS A;  3DKS A;  1GH2 A;  3GUS A;  1A23 A;  3ZVJ D;  4BL7 A;  2EIO A;  4OFM A;  4MH3 A;  3A2X A;  2OE0 A;  5CNW A;  3DWV A;  1O7U A;  5ECS A;  5HR1 A;  2M72 A;  3F9U A;  1KBN A;  5JWR B;  1H75 A;  3U5R E;  3IA1 A;  3EMP A;  4MAB A;  1FG4 A;  4JRR A;  2DKI A;  5KN3 A;  3F3Q A;  7GSS A;  2WB9 A;  5JWO B;  3UBK A;  1O85 A;  2VCW A;  2VD0 A;  2Z9S A;  2PU9 C;  1AQV A;  5J41 A;  1OC9 A;  2V6K A;  1G6Y A;  1N8J A;  3LOR A;  3FY7 A;  1TU7 A;  4V2M A;  5G1L A;  3U6V A;  2EC4 A;  3K8N A;  5CP1 A;  5C04 A;  1PX7 A;  2R3X A;  4K0N A;  2HXK A;  5JWQ B;  1QUW A;  3QOU A;  3QPM A;  5IMV A;  5ELG A;  1M3J A;  3O6T A;  3US3 A;  1ABA A;  2PGT A;  1K0B A;  1ZYE A;  5ECM B;  3RBT A;  5BRT A;  2PMT A;  2CVB A;  3KTB A;  1FHE A;  5F05 A;  3D0Z A;  3FZ4 A;  3G7Y A;  4J2F A;  5J9C A;  2YV7 A;  5JCU A;  2B7K A;  3BOA A;  4TR0 A;  2IIY A;  1K0C A;  1GSQ A;  2PER A;  1XVW A;  2X64 A;  4EUY A;  1XW9 A;  3Q19 A;  2B5Y A;  2H1G A;  5B7C A;  2GTU A;  2GQK A;  4QQ7 A;  4G2E A;  4HZ2 A;  3IOS A;  1BJX A;  3VLN A;  5DQS A;  1UA5 A;  4JR6 A;  3D21 A;  4OFT A;  2NBS A;  3A2V A;  4KND A;  1OC9 B;  3FW2 A;  2GZY A;  2OKA A;  3KD0 A;  3QFB C;  5DDL A;  1ZYQ B;  5INY A;  2O8V B;  1AW9 A;  1I5G A;  3GKK A;  1EZK A;  2NDO A;  5HFI A;  4TR3 A;  5J4U A;  3IAM 2;  4OO4 A;  1XIY A;  3Q6O A;  4AF2 A;  2HSY A;  3GNJ A;  2CZ3 A;  4IEL A;  3FK8 A;  3H79 A;  4RQX A;  4HDE A;  1MD3 A;  1R7H A;  2PBJ A;  2DBC A;  2LV3 A;  2LQO A;  4F2I A;  4NV5 A;  1PN9 A;  4WXT A;  5ECL B;  2N5B A;  3UAP A;  4L5O A;  4EIQ A;  2H1B A;  2C80 A;  2ZCT A;  1YF1 A;  3I43 A;  4IP6 A;  12GS A;  3GKN A;  2HFD A;  4POM A;  5A5K A;  2HNL A;  2H01 A;  2K8V A;  2F9S A;  1ACV A;  3WGD A;  4K1F A;  3EVI A;  2J9H A;  3QCP A;  5D9X A;  5DJL A;  2VM1 A;  1GSD A;  4ZBA A;  6GSU A;  4P3Y B;  3DGQ A;  2ZNM A;  1WPI A;  4V2N A;  4JE1 A;  1PL1 A;  6GST A;  3ZRD A;  2DJ1 A;  3ZTL A;  2NTO A;  2OE1 A;  1VF3 A;  3FRC A;  2N5F A;  3TRQ A;  4TRX A;  1T4Z A;  4JU5 A;  1GSF A;  2VIM A;  2VCX A;  4CY6 A;  1U87 A;  3MIX A;  1MDK A;  5HR0 A;  3SBC A;  5B8B A;  2DJ3 A;  1GSU A;  1ZYP A;  1T8E B;  2AAW A;  2HE3 A;  2CAQ A;  3TDG A;  5D9V A;  2IME A;  3TKS C;  4O32 A;  2JL4 A;  3CRT A;  4GCI A;  3S9F A;  4Z7X A;  1Z7P A;  4MJC A;  2IMK A;  4L8E A;  4O5R A;  4DSS A;  4IP1 A;  2F3M A;  3HXS A;  4ZXG A;  4KE3 A;  4EO3 A;  5F8B A;  2PN8 A;  5GSS A;  3M0F A;  1K0M A;  2C0G A;  1F9M A;  1HNB A;  2IN3 A;  1GL8 A;  3WYW A;  3N9J A;  3QAW A;  4XIH A;  1SK0 A;  3G9B A;  4OO5 A;  5IIZ A;  4OMV A;  1CQH A;  2H0H A;  4MPF A;  2RUE A;  4L0W A;  2DIZ A;  3LWA A;  1KNG A; 
#chains in the Genus database with same CATH homology
 4G19 A;  1A8L A;  2ON5 A;  2GSS A;  1BAY A;  5EL8 A;  1XVQ A;  1EWX A;  4F9Z A;  1JZW A;  1B9X C;  2CAI A;  5ENU A;  4OFN A;  3IC4 A;  2I4A A;  3EMX A;  4XRD A;  1GUH A;  3E0U A;  1XW5 A;  1EOG A;  6GSY A;  1ERW A;  3GUR A;  2I9H A;  3ZYW A;  2A2P A;  3ZIT A;  2C3N A;  3KMN A;  1HYU A;  2OBK A;  2JZS A;  2QC7 A;  2K9F A;  5D9T A;  4POL A;  2YJ7 A;  2C4J A;  1QK8 A;  2HZF A;  3LSZ A;  2XC2 A;  3CSI A;  4KUN A;  4EDZ A;  1HNA A;  2VL2 A;  1EEM A;  4GST A;  4MJE A;  2V2G A;  3TJJ A;  3KJY A;  1PN0 A;  4MDC A;  4ZL7 A;  3RHB A;  2R5G A;  1X5D A;  4F82 A;  4EF0 A;  2LUS A;  3KCM A;  4WBJ A;  4PGT A;  2L4Q A;  2N5A A;  3FZA A;  3GTU A;  3C1S A;  3LEF A;  1B4P A;  4PUF C;  2X8G A;  4GQC A;  3W6G A;  3VWX A;  1B4Q A;  2X4A A;  3F3R A;  1SKW B;  1UVZ A;  2OAC A;  2VO4 A;  1OVN A;  4RUV A;  4BVY A;  1O81 A;  3ISO A;  3GH9 A;  4K6X A;  2IMF A;  1GLP A;  2GS3 A;  5JCW A;  2ZUP A;  2B5X A;  4CHS A;  4GSS A;  1XWC A;  2DJK A;  4K8M A;  4WEY A;  5G2Z A;  4AJ6 A;  3FR9 A;  1UC7 A;  5IOX A;  3F4S A;  2VOC A;  1R5P A;  3KTL A;  4Q5F A;  2P5R A;  2L59 A;  3QMX A;  3EWL A;  1VGL A;  1WIK A;  4KGI A;  1PGT A;  4X0X A;  2KHP A;  3HCZ A;  4ZIJ A;  4ZIL A;  1XOB A;  3KEB A;  1T4Y A;  4GSN A;  1EV4 A;  2ES7 A;  4XS6 A;  4YAV A;  1FVJ A;  3P90 A;  1ST9 A;  3ED3 A;  4IQ1 A;  1QXH A;  3RPN A;  2H0G A;  4ZB9 A;  1SJZ A;  4ECB A;  2AHE A;  3DYR A;  1DUG A;  1AIU A;  2P0G A;  2XPE A;  3F4R A;  1PX6 A;  3EU4 A;  4BVY B;  6GSV A;  2YV9 A;  1M0U A;  16GS A;  2CA8 A;  2JSY A;  1LBK A;  1XWK A;  3ZLP A;  5CAX A;  1EP7 A;  5DCG A;  4EL1 A;  4WR5 A;  1ZZY A;  4F0B A;  5DAL B;  1M2A A;  2H72 A;  1TRV A;  1A2J A;  5CYY A;  2CX3 A;  3DIE A;  3RHC A;  2LQQ A;  2VCQ A;  1V58 A;  2DSA A;  2KOK A;  1XCC A;  1SJI A;  4MF5 A;  3ZRE A;  3RAZ A;  2PPT A;  1MDI A;  1V57 A;  4O7H A;  4A5P A;  3L9S A;  1FW1 A;  4EVM A;  3M1G A;  3KXO A;  1FO5 A;  5H5Q A;  4DEJ A;  4MA9 A;  2TRC P;  3VWV A;  2TRX A;  3ME7 A;  5LD0 A;  3M9K A;  1V9W A;  2VLV A;  3FZ9 A;  2J23 A;  5J9B A;  2FWH A;  5C00 A;  1YY7 A;  1OKT A;  4ZL9 A;  4TOP A;  13GS A;  1LU4 A;  3HJP A;  4HU7 A;  3I69 A;  3IBH A;  4DVC A;  4FYB A;  2L5L A;  3APS A;  4K2D A;  4K7I A;  1J0F A;  2OE3 A;  3TB2 A;  3PR8 A;  4EE0 A;  4I2U A;  2NVL A;  3NOF A;  2HSM A;  4WF5 A;  4PTS A;  3IC8 A;  4NHW A;  1K3O A;  4IW9 A;  4WET A;  2FNO A;  1YDK A;  2YP6 A;  1GNW A;  5LNK e;  2DMM A;  4TXV A;  4MK3 A;  3L78 A;  3MNG A;  3HVS A;  2VAF A;  2VD1 A;  4YQM A;  1EGO A;  3TJF A;  1VF1 A;  5B6M A;  1YJ6 A;  2I81 A;  4ZB6 A;  1THO A;  3C71 A;  4MF6 A;  1ZOF A;  4Q5N A;  2FA8 A;  2C0E A;  4BWQ A;  3J7Y b;  3IK9 A;  2H1A A;  2A4V A;  3F63 A;  4KSM A;  1O8W A;  3HZ4 A;  1GTA A;  8GSS A;  3DVX A;  1S3A A;  4OD7 A;  4V1A p;  1EP8 A;  2LJR A;  3C1R A;  3LG6 A;  3R3E A;  1X0R A;  4HQS A;  2H76 A;  1YQ1 A;  2VL2 C;  1K0O A;  1B48 A;  1ILO A;  4NXI A;  3KH9 A;  3HY2 A;  4K7N A;  1SD8 A;  4J57 E;  4GWR A;  3M8N A;  3AY8 A;  2MMZ A;  2L6C A;  3I9V 2;  3VUR A;  1FOH A;  1PL2 A;  1SYX A;  2RM6 A;  1DE1 A;  1Z6N A;  5JCG A;  2WFC A;  3GHA A;  3HVV A;  2C8U A;  5COH A;  3WGE A;  2H6X A;  2FGX A;  5DBQ A;  1DSB A;  4IQA A;  1HQO A;  1PA3 A;  5CRG A;  1C72 A;  3FHK A;  2AYT A;  2E2G A;  1R5A A;  2LKU A;  1OAZ A;  5HFK A;  4KDY A;  1WRY A;  3NZN A;  3IDV A;  4V2L A;  2GVP A;  4O5Q A;  4RI6 A;  2NPB A;  2O87 A;  3IK7 A;  3HJM A;  3RDW A;  2JAD A;  3PH9 A;  1TI3 A;  2H73 A;  4RI7 A;  5HFG A;  4IS0 A;  4PNF A;  5EY6 A;  5D73 A;  1FB6 A;  3UMA A;  3EIN A;  4O5U A;  5J3R A;  5IMC A;  4NMU A;  2K6V A;  20GS A;  2AB6 A;  1GUK A;  1IYI A;  5L71 A;  4WBR D;  2GDR A;  2P31 A;  4Z2U A;  1VF2 A;  4AJ8 A;  4YAP A;  5IMZ A;  3H4K A;  1GSY A;  2LNS A;  1AC1 A;  1K3L A;  1GNE A;  1XWB A;  5ECP B;  2LTK A;  3QAG A;  2HI7 A;  5ECR B;  5EPF A;  2X8H A;  2H74 A;  2V41 A;  5A4V A;  2O85 A;  5HR3 A;  1E6B A;  2FA4 A;  2H6Z A;  4H86 A;  2YWI A;  1J08 A;  1E2Y A;  2ALB A;  3F4T A;  3W8J A;  3PPU A;  1XBS A;  2VCV A;  5BMU A;  2X99 A;  3VI7 A;  4XS4 B;  1U88 A;  3LXZ A;  3FZ5 A;  1K0A A;  4FIW A;  4KB3 A;  3A5W A;  3GST A;  2QKE A;  3VK9 A;  3VWU A;  2H66 A;  2VCZ A;  5HR2 A;  3RPP A;  2FCH A;  5IOW A;  2AV4 A;  2HZE A;  2H19 A;  4PUR A;  2YNX A;  3QFA C;  2HSH A;  1OC3 A;  4IN0 A;  1YZX A;  1GTB A;  1VRS D;  1JFU A;  3EE2 A;  2FWG A;  2LRN A;  1TK5 B;  4FO5 A;  2LJK A;  3M9J A;  2RUF A;  5GZZ B;  2IFQ B;  3QDN A;  4N0Z A;  3KIJ A;  3VPT A;  1TP9 A;  3EPT A;  3UAR A;  3UVH A;  2L6D A;  1M7T A;  3GMF A;  5HQP A;  1XXU A;  4IJ3 A;  3UJ1 A;  4K7O A;  2GQM A;  4AJ7 A;  4ZBB A;  4HJM A;  1AAZ A;  2WZ9 A;  4L0U A;  2MZC A;  1URM A;  1M9A A;  5ECK B;  3TJK A;  5DAK A;  3EUR A;  4GTU A;  3O3T A;  3D4M A;  3TKS E;  1XZO A;  1NHY A;  1FVK A;  3DEX A;  2EIQ A;  3D5J A;  3G7J A;  1DE2 A;  1X9M B;  4G0K A;  1SL0 B;  1ERU A;  2YWN A;  1XWG A;  3VI5 A;  2X49 A;  1TU8 A;  1TKD B;  4D73 A;  2CT6 A;  2MBS A;  1G7O A;  3FKF A;  3TCO A;  2CX4 A;  4LL1 B;  4XCS A;  4K5S A;  2HZE B;  3KP9 A;  3MDK A;  1OYJ A;  4N10 A;  1MD4 A;  1PQN A;  3FMW A;  2V32 A;  2CQ9 A;  1TI1 A;  1NW2 A;  4HOJ A;  3DD3 A;  1KEB A;  5IPH A;  1GLQ A;  4Q5Q A;  4LMW A;  4ML6 A;  3C73 A;  3QR6 A;  4FYU A;  4KCA A;  3E9J B;  1YF0 A;  4ICY A;  3IRA A;  4ECJ A;  2HLS A;  6GSS A;  1M99 A;  5DAK B;  2I3Y A;  4X4J A;  5IMA A;  1R4W A;  1G7E A;  4LL4 B;  1V98 A;  3APO A;  3IHG A;  3TKR A;  3Q74 A;  1M2B A;  1SKS B;  4MH2 A;  2R0G A;  1RQM A;  3GYK A;  2LEG A;  4K9Z A;  4JR4 A;  3DXB A;  3TUE A;  1GUM A;  4NHZ A;  2UZ8 A;  3A5I A;  1CQG A;  1X9S B;  2MYG A;  1WJK A;  4HQZ A;  2DJJ A;  4D73 B;  3L9U A;  1A24 A;  1EOH A;  1PSQ A;  1Z5Y E;  2BMX A;  2K8S A;  2XHF A;  4MF7 A;  2XPD A;  5A4U A;  1A8Y A;  2HRA A;  1ZCP A;  3CXG A;  4PQI A;  5ELA A;  1JZD A;  14GS A;  3DML A;  2YWO A;  1XWA A;  4KW6 A;  5GAN D;  2QA1 A;  4L5L A;  3D4T A;  1H4O A;  4N0V A;  3Q18 A;  2PVQ A;  4KDX A;  3TOT A;  5J5N A;  5G1K A;  2YJH A;  1TTZ A;  2WS2 A;  2JZR A;  1SL2 B;  5E59 A;  1UN2 A;  3IR4 A;  1WOU A;  3R2Q A;  1N2A A;  4KSO A;  4KX4 A;  2DC5 A;  1HNC A;  4IHU A;  1T1V A;  5F06 A;  5DAL A;  6GSX A;  1Q4J A;  4LA1 A;  4TR1 B;  1U6T A;  2K18 A;  1OC8 A;  1ZL9 A;  2CVK A;  2WRT A;  3ZZX A;  2QGV A;  3W8S A;  1K0N A;  1RW1 A;  3JCM L;  1TRW A;  1GWC A;  3KGK A;  2WUL A;  3OR5 A;  2OBI A;  1YEX A;  3LGC A;  2GZZ A;  2MMO A;  2C1Y A;  2BJX A;  1TK0 B;  4ZB8 A;  2H1D A;  3KH7 A;  4GRF A;  1BG5 A;  4EXJ A;  1PMT A;  2FHE A;  1SL1 B;  2KP2 A;  3BCI A;  4E8H A;  4CDO A;  2MMA A;  4EKZ A;  2JZT A;  1M2D A;  4YKG A;  1EEJ A;  2QSI A;  4YQV A;  2D2Z A;  1X9W B;  3ERG A;  4I2T A;  5H5S A;  2F8F A;  11GS A;  2E7P A;  5FHI A;  1EV9 A;  4IBP A;  2R0C A;  4G0I A;  5IO2 A;  1A2M A;  4GLT A;  4MPG A;  2G2Q A;  2WJU A;  2GQL A;  3ZMK A;  4TVE A;  2I1U A;  1Y6E A;  2FUG 2;  2TIR A;  1XFL A;  2GT5 A;  2VL9 A;  2RLI A;  4POK A;  4DSR A;  3ZVJ A;  4ML1 A;  4X1U A;  4MCU A;  3NIV A;  2AUV A;  2LRC A;  2GSR A;  4XRA A;  4PQH A;  3LJR A;  3LYP A;  4BA7 A;  3LFL A;  3TJB A;  4OCE A;  4IJI A;  4MZW A;  2VM2 A;  1NHO A;  1WMJ A;  3TGZ A;  2B7J A;  2BTO T;  5G5E A;  1GSS A;  3L0H A;  4GQF A;  4PX1 A;  1U3A A;  4G0L A;  18GS A;  4J56 E;  4MJA A;  2F51 A;  3GH6 A;  2FWE A;  1HD2 A;  5KEJ A;  1A0R P;  4TR4 A;  3WD6 A;  2DIY A;  4BVX B;  3ZFB A;  3GV1 A;  1F3A A;  4YH2 A;  2YPM A;  3WGX A;  2GGT A;  5CO3 A;  2IL3 A;  4PNG A;  2PUK C;  2YWM A;  2R37 A;  3VPQ A;  2B3S A;  4I8B A;  2YN1 A;  4EIP A;  4KDU A;  1Q98 A;  1PRX A;  5ECO B;  2X8C A;  2OA7 A;  1O73 A;  3P2A A;  2VL3 A;  4MZC A;  3V1W A;  1WP0 A;  3IE3 A;  2JSZ A;  3HDC A;  3ZIJ A;  5KN0 A;  4JZQ A;  1USB A;  3D22 A;  3MWH A;  3TKP A;  1GSE A;  1ZYN A;  2IJY A;  4WR4 A;  6GSW A;  2CZ2 A;  2DML A;  3HJO A;  4F03 A;  1TRU A;  3HD5 A;  2VLU A;  1X5C A;  2H71 A;  3VWW A;  1PD2 1;  5G30 A;  2G0F A;  1Z6M A;  3ZFL A;  3ME8 A;  5D93 A;  5AIX A;  2YOI A;  5E4W A;  3HKR A;  1T7P B;  3BD2 A;  4HZ4 A;  1K3Y A;  1F2E A;  3G7I A;  2R4V A;  3VFI A;  4ZBD A;  2CVD A;  1QGV A;  1XOA A;  1K0D A;  4DSQ A;  3GKX A;  3L4N A;  3MSZ A;  4XS1 A;  5KN1 A;  4FH8 A;  4ZL8 A;  2C0D A;  3BCK A;  1Z3E A;  3ZIV A;  4Z2R A;  3HZ8 A;  1YEP A;  4TN8 A;  5ECN B;  4BL7 B;  2B1K A;  4MZB A;  5ECI B;  4LLR A;  4MP4 A;  3KM6 A;  3N5O A;  4BWS A;  1NSW A;  3EC3 A;  1RK4 A;  4XS4 A;  2R2J A;  1JHB A;  3UVT A;  5CRE A;  3GFK A;  1AQW A;  5LCZ A;  3F6F A;  4Z2T A;  1TXX A;  3QD9 A;  3GN3 A;  2YZU A;  2MMN A;  4WF4 A;  4EDY A;  2LNT A;  5B6N A;  3TJG A;  2R6K A;  3EU3 A;  2IFQ A;  1F6M C;  5AIS A;  4MLY A;  1F3B A;  3CTG A;  4OCF A;  4I5Q A;  1PKW A;  3IPZ A;  4ULX A;  3ZL5 A;  5EVO A;  1SK2 A;  4ID0 A;  2YCD A;  4YKF A;  3UOM A;  2FY6 A;  2IWT A;  4N30 A;  3KP8 A;  4CW9 A;  1BED A;  3CYN A;  4X43 A;  5DJM A;  1MTC A;  1I9D A;  3TOU A;  3ERF A;  1MEK A;  5FWG A;  4HEA 2;  4MJB A;  3UL3 A;  4FYC A;  3L9V A;  3UEM A;  1M9B A;  3UIW A;  3E3E A;  3FR3 A;  5DQY A;  4KF9 A;  3GX0 A;  1XW6 A;  2PVO C;  2B5E A;  4FQU A;  4NPB A;  1JLV A;  4TXO A;  2M80 A;  4JED A;  1BQ7 A;  3FR6 A;  1QMV A;  3LW9 A;  4GF0 A;  1AXD A;  1KTE A;  4HI7 A;  2WDU A;  3C8E A;  2IMD A;  1B9Y C;  5A4W A;  3WT1 A;  2DJ2 A;  2WCI A;  3IV4 A;  2KLX A;  5KOX A;  4K2X A;  3CSH A;  3LXT A;  2HRK A;  4RQR A;  4CY8 A;  3P8W A;  4JBB A;  1TOF A;  5DVB A;  1O8X A;  3H93 A;  4KA0 A;  2LRT A;  3CBU A;  3GL5 A;  2VLT A;  2C3Q A;  3GA4 A;  2H75 A;  2C0F A;  1G0T A;  1S3D A;  4KCE A;  3ERW A;  2REM A;  1PKZ A;  4OWY A;  3H8Q A;  4KH7 A;  2CV4 A;  3DVW A;  4E8E A;  1O6J A;  3F0I A;  4I6X A;  2FWF A;  4N11 A;  1TRS A;  3CMI A;  1YKA A;  1TDI A;  1LJR A;  1VF4 A;  4TXO B;  4ISD A;  1A2L A;  4YQU A;  2F8A A;  5F0G A;  3A2W A;  3MYD A;  3LYK A;  3HYP A;  2H6Y A;  4WKW A;  3J7Y k;  4TW5 A;  1ZGN A;  2QA2 A;  5AGY A;  1Y25 A;  3IXR A;  4ECC A;  5H5R A;  3MAK A;  1QFN A;  1TW9 A;  1V2A A;  2A4H A;  5D9W A;  1DBY A;  1OE7 A;  2H0I A;  1QQ2 A;  1SKR B;  9GSS A;  3APQ A;  1SYR A;  5GST A;  3I6A A;  3WT2 A;  3DRN A;  4G9H A;  2P5Q A;  4KAE A;  1ON4 A;  3TRP A;  5IMF A;  4AGS A;  2PWJ A;  5IMD A;  3M3M A;  5IPG A;  4DSS B;  4TR1 A;  2YZH A;  1WWJ A;  4IVF A;  1GP1 A;  5D8I A;  1SU9 A;  4NAX A;  1TJD A;  1ERT A;  2E2M A;  3HHV A;  1G6W A;  5IO0 A;  3GRX A;  1JZR A;  2ON7 A;  3F8U A;  2AJQ B;  3KMO A;  3IHQ A;  2GLR A;  2JU5 A;  2V6O A;  3GX8 A;  3P7X A;  1AQX A;  1JLW A;  4GXZ A;  2OAD A;  1EGR A;  4EC0 A;  3CSJ A;  2HT9 A;  2RM5 A;  2YAN A;  2MBT A;  10GS A;  5ECH B;  2VCT A;  5KN2 A;  4QL9 A;  3O76 A;  4HJ2 A;  1F37 A;  1GTU A;  2HYX A;  3IAS 2;  1WE0 A;  3GSS A;  2HRN A;  3D6I A;  2FLS A;  2H8L A;  1AUC A;  2B6M A;  3LQ7 A;  1BYE A;  4ACS A;  2OJL A;  1T00 A;  2H70 A;  5D96 A;  2LST A;  2HRF A;  5AIV A;  3PIN A;  1W89 A;  4F0C A;  3H1N A;  4V1A g;  3UBL A;  3BJ5 A;  3HVX A;  1U3I A;  1Z9H A;  1IYH A;  2KUC A;  1R26 A;  5AN1 A;  3CTF A;  4XHM A;  4I97 A;  4O92 A;  5KOW A;  5ID2 A;  2DLX A;  4HS1 A;  2GSQ A;  2GST A;  3CRU A;  2O7K A;  2E0Q A;  2H30 A;  2L57 A;  4XTS A;  5CRW A;  2DJ0 A;  1SEN A;  5CRD A;  1MDJ A;  2WGR A;  4POB A;  2XBQ A;  2V1M A;  1V40 A;  1GUL A;  2M46 A;  1BX9 A;  5CRH A;  3TKQ A;  2FD3 A;  2VUP A;  5G31 A;  5G5F A;  2LJA A;  4Q5R A;  2RII A;  3GTU B;  3GL3 A;  4BVX A;  4G10 A;  1FOV A;  3GKM A;  2JAC A;  2A2R A;  1OKD A;  4MNN A;  2DKH A;  1YKC A;  1ZMA A;  1TK8 B;  1GTI A;  1NM3 A;  3GIX A;  4PXO A;  4NWY A;  2LS5 A;  5IM9 A;  4K0G A;  1Z7R A;  1W4V A;  3C7M A;  4IKH A;  1J9B A;  1ML6 A;  2L4C A;  5B8A A;  1SD9 A;  3KZQ A;  2GZP A;  3F6D A;  5ID2 B;  2B1L A;  2O89 A;  4BPY A;  5DCH A;  4HU9 A;  1T3B A;  2C3T A;  5ABR A;  3TKS A;  4QL7 A;  1XPV A;  3BBY A;  3SWL A;  3QAV A;  4MMM A;  2GT6 A;  2A2S A;  1JZO A;  3TRX A;  3HA9 A;  4ILF A;  1THX A;  4LMV A;  3A3T A;  4PUA A;  3PGT A;  2IMI A;  4K5R A;  5GAP D;  1FB0 A;  2R0P A;  1X5E A;  1ERV A;  5ECQ B;  4HUA A;  2L5O A;  1B8X A;  4IGJ A;  19GS A;  2KP1 A;  1SK1 A;  1OE8 A;  2EIR A;  4NV2 A;  2XBI A;  4TKY A;  1S3C A;  1SJ6 A;  3ZML A;  4ECI A;  22GS A;  3FEU A;  1FAA A;  5F07 A;  4PQ1 A;  5FT3 A;  2IPA A;  1A0F A;  3EYT A;  3FYG A;  17GS A;  5IQY A;  1GRX A;  4USS A;  3DKS A;  1GH2 A;  3GUS A;  1A23 A;  3ZVJ D;  4BL7 A;  2EIO A;  4OFM A;  4MH3 A;  3A2X A;  2OE0 A;  5CNW A;  3DWV A;  1O7U A;  5ECS A;  5HR1 A;  2M72 A;  3F9U A;  1KBN A;  5JWR B;  1H75 A;  3U5R E;  3IA1 A;  3EMP A;  4MAB A;  1FG4 A;  4JRR A;  2DKI A;  5KN3 A;  3F3Q A;  7GSS A;  2WB9 A;  5JWO B;  3UBK A;  1O85 A;  2VCW A;  2VD0 A;  2Z9S A;  2PU9 C;  1AQV A;  5J41 A;  1OC9 A;  2V6K A;  1G6Y A;  1N8J A;  3LOR A;  3FY7 A;  1TU7 A;  4V2M A;  5G1L A;  3U6V A;  2EC4 A;  3K8N A;  5CP1 A;  5C04 A;  1PX7 A;  2R3X A;  4K0N A;  2HXK A;  5JWQ B;  1QUW A;  3QOU A;  3QPM A;  5IMV A;  5ELG A;  3O6T A;  3US3 A;  1ABA A;  2PGT A;  1K0B A;  1ZYE A;  5ECM B;  3RBT A;  5BRT A;  2PMT A;  2CVB A;  3KTB A;  1FHE A;  5F05 A;  3D0Z A;  3FZ4 A;  3G7Y A;  4J2F A;  5J9C A;  2YV7 A;  5JCU A;  2B7K A;  3BOA A;  4TR0 A;  2IIY A;  1K0C A;  1GSQ A;  2PER A;  1XVW A;  2X64 A;  4EUY A;  1XW9 A;  3Q19 A;  2B5Y A;  2H1G A;  5B7C A;  2GTU A;  2GQK A;  4QQ7 A;  4G2E A;  4HZ2 A;  3IOS A;  1BJX A;  3VLN A;  5DQS A;  1UA5 A;  4JR6 A;  3D21 A;  4OFT A;  2NBS A;  3A2V A;  4KND A;  1OC9 B;  3FW2 A;  2GZY A;  2OKA A;  3KD0 A;  3QFB C;  5DDL A;  1ZYQ B;  5INY A;  2O8V B;  1AW9 A;  1I5G A;  3GKK A;  1EZK A;  2NDO A;  5HFI A;  4TR3 A;  5J4U A;  3IAM 2;  4OO4 A;  1XIY A;  3Q6O A;  4AF2 A;  2HSY A;  3GNJ A;  2CZ3 A;  4IEL A;  3FK8 A;  3H79 A;  4RQX A;  4HDE A;  1MD3 A;  1R7H A;  2PBJ A;  2DBC A;  2LV3 A;  2LQO A;  4F2I A;  4NV5 A;  1PN9 A;  4WXT A;  5ECL B;  2N5B A;  3UAP A;  4L5O A;  4EIQ A;  2H1B A;  2C80 A;  2ZCT A;  1YF1 A;  3I43 A;  4IP6 A;  12GS A;  3GKN A;  2HFD A;  4POM A;  5A5K A;  2HNL A;  2H01 A;  2K8V A;  2F9S A;  1ACV A;  3WGD A;  4K1F A;  3EVI A;  2J9H A;  3QCP A;  5D9X A;  5DJL A;  2VM1 A;  1GSD A;  4ZBA A;  6GSU A;  4P3Y B;  3DGQ A;  2ZNM A;  1WPI A;  4V2N A;  4JE1 A;  1PL1 A;  6GST A;  3ZRD A;  2DJ1 A;  3ZTL A;  2NTO A;  2OE1 A;  1VF3 A;  3FRC A;  2N5F A;  3TRQ A;  4TRX A;  1T4Z A;  4JU5 A;  1GSF A;  2VIM A;  2VCX A;  4CY6 A;  1U87 A;  3MIX A;  1MDK A;  5HR0 A;  3SBC A;  5B8B A;  2DJ3 A;  1GSU A;  1ZYP A;  1T8E B;  2AAW A;  2HE3 A;  2CAQ A;  3TDG A;  5D9V A;  2IME A;  3TKS C;  4O32 A;  2JL4 A;  3CRT A;  4GCI A;  3S9F A;  4Z7X A;  1Z7P A;  4MJC A;  2IMK A;  4L8E A;  4O5R A;  4DSS A;  4IP1 A;  2F3M A;  3HXS A;  4ZXG A;  4KE3 A;  4EO3 A;  5F8B A;  2PN8 A;  5GSS A;  3M0F A;  1K0M A;  2C0G A;  1F9M A;  1HNB A;  2IN3 A;  1GL8 A;  3WYW A;  3N9J A;  3QAW A;  4XIH A;  1SK0 A;  3G9B A;  4OO5 A;  5IIZ A;  4OMV A;  1CQH A;  2H0H A;  4MPF A;  2RUE A;  4L0W A;  2DIZ A;  3LWA A;  1KNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...