1VGLA

Crystal structure of tetrameric kaib from t.elongatus bp-1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
KTYVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKILATPCLAKVLPPPVRRIIGDLSNREKVLIGLDLLYEEIGDQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Circadian clock protein kaiB
publication title Functionally important substructures of circadian clock protein KaiB in a unique tetramer complex.
pubmed doi rcsb
source organism Thermosynechococcus elongatus bp-1
molecule tags Circadian clock protein
total genus 22
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07689 KaiB KaiB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1vglA00
4GRFA 1TTZA 4AJ8A 2LV3A 1TI1A 3TKPA 2B5XA 2JACA 4HU9A 3ZVJA 1J0FA 1K3LA 2GSQA 1GRXA 2DIZA 2YP6A 4MPGA 4WETA 3I43A 3D6IA 1T3BA 5ECSA 3CYNA 1TP9A 2L6CA 3M9KA 4MMMA 3GSSA 3A2XA 4HOJA 3W8JA 2WB9A 2VCZA 5ECQB 1USBA 1EZKA 2MMZA 5CRGA 2JZSA 3UBKA 2MMOA 2A2SA 2VL3A 3KIJA 2DJ0A 4KE3A 1KEBA 3CXGA 5DDLA 2P31A 4L5OA 1TU7A 3ME8A 3HD5A 2H76A 1J08A 3G7JA 3O3TA 1TK5B 4N30A 2RM6A 2C80A 1Z6NA 3HZ8A 1KNGA 2EIRA 4G2EA 3P7XA 1GTUA 2V6OA 5IQYA 2NBSA 3G9BA 1I9DA 4EXJA 4MZCA 4ZB9A 3APSA 1SU9A 1Z7PA 1OAZA 2YCDA 1DE2A 4L5LA 3KTLA 5IMVA 4MJAA 3IPZA 3TJGA 2M80A 3GIXA 4IP1A 2CVKA 2LNSA 3DVXA 2L5OA 1UVZA 2H6ZA 3ED3A 1FG4A 3GA4A 2VD1A 3Q18A 1V40A 4GF0A 3GNJA 4ZXGA 3A2WA 6GSTA 1A2JA 1GSYA 1YF0A 1V9WA 2CVBA 3ME7A 1U6TA 4X43A 5DCHA 2H1GA 5CYYA 3EURA 3TJBA 4OMVA 2G0FA 1A24A 3LYPA 1Y6EA 3ERWA 4J2FA 2R4VA 1Q4JA 3EU3A 3GKMA 4E8EA 1OC9B 4EL1A 3ZFBA 6GSXA 1EOGA 3HJOA 3LGCA 3KZQA 5IIZA 4WR5A 2HXKA 4YAPA 2H71A 3H79A 2GZPA 3H93A 1K0MA 6GSSA 5JWOB 3ISOA 4DVCA 2LRCA 4IGJA 3GHAA 1JZOA 2VLTA 5A4UA 3LXZA 2AJQB 2ZNMA 3D22A 3FHKA 2R5GA 2IWTA 2B1LA 4F2IA 2H0HA 2HZEA 1Z5YE 4LL4B 4NXIA 1Z6MA 1YJ6A 2WJUA 1XW9A 1TXXA 3O6TA 3QPMA 4F0BA 4AF2A 3TKSA 2MYGA 1OE8A 1PX6A 2GS3A 2WDUA 2I4AA 1LJRA 4TR4A 2XC2A 3C71A 5G2ZA 3DGQA 1U3IA 4TXVA 2N5FA 2DSAA 1AC1A 2YOIA 3N9JA 3TOTA 1PSQA 2QGVA 1K0CA 5IMZA 3VPTA 3VWUA 1KTEA 2CZ2A 3PR8A 3RBTA 4TN8A 5F0GA 2MMAA 3C1SA 2PN8A 3MWHA 5DQSA 2WZ9A 3GKNA 3IR4A 2WCIA 3UVHA 3FZAA 5D93A 3IK9A 3A3TA 4P3YB 4I2TA 6GSVA 1AAZA 1XWAA 4E8HA 5ECRB 1M7TA 1TU8A 1Z3EA 1C72A 4DSSB 3O76A 3IRAA 2YV9A 4ZL9A 4HEA2 1FO5A 3F6DA 1ZL9A 1GL8A 4TR3A 1JFUA 1JZWA 4ZIJA 1SD8A 3DXBA 1G6YA 3U5RE 1U87A 1MDJA 1ZOFA 2VL9A 2WULA 4FYCA 1S3DA 1SKWB 2VD0A 4KSOA 3ERGA 1CQGA 2FY6A 1HD2A 5G5EA 2IMEA 1TDIA 4NMUA 1EWXA 2IFQB 3DWVA 2V41A 1OYJA 3HKRA 4GCIA 3HYPA 4PNFA 4GSNA 2C1YA 4POKA 5IOWA 4OWYA 2C0FA 4MCUA 2B7JA 3BBYA 1UC7A 2BJXA 1PL1A 4MP4A 4AJ6A 1EGOA 3GKXA 5ID2B 3HXSA 2F9SA 4NHZA 1JLWA 1SK0A 3CSHA 5F07A 2QSIA 1TJDA 5HR1A 5IMCA 8GSSA 2FA4A 2RLIA 1M2BA 4FYBA 5ECLB 1M9AA 1YZXA 2P5QA 4TR0A 4RI7A 3TKSE 4N11A 1XIYA 2E2GA 1BAYA 1FAAA 3IDVA 3TOUA 1XVQA 2V2GA 1B8XA 1A0RP 2K8VA 3ZITA 3VPQA 2OBIA 3EWLA 3GL3A 4YH2A 1ZGNA 2XBQA 3PINA 3QAWA 4OO5A 3W8SA 2OACA 3KXOA 4BWQA 2VCXA 3HJPA 5CRHA 1K0DA 5G5FA 5KN3A 4IQAA 1R4WA 4K0NA 5G1LA 4K8MA 1XBSA 1ZYEA 3ZTLA 1F9MA 1B9YC 1YDKA 3M1GA 4OFMA 2HE3A 1M2DA 3UEMA 2VCTA 5J9BA 17GSA 1TW9A 1WP0A 5B6NA 2C3QA 5LNKe 2AV4A 3WD6A 1UA5A 4HJMA 4XS6A 1XZOA 5AISA 3G7IA 2H6XA 2LS5A 3HZ4A 3TRPA 4OFNA 3F4SA 4YQUA 2FGXA 2I1UA 5CP1A 13GSA 3M9JA 4RQXA 4K0GA 3BOAA 2KHPA 4FH8A 3VWVA 1GP1A 1SJZA 1K0BA 1SL0B 5HR2A 5H5QA 5KEJA 3Q6OA 1OC8A 1BX9A 1GLQA 5AIXA 4ISDA 4ZBAA 1GSUA 3DYRA 1S3CA 2V32A 2H0IA 2GQLA 5ECKB 3UOMA 5J4UA 2VM2A 4TXOB 4EO3A 3GSTA 2BMXA 4EKZA 3TJKA 4RQRA 1YQ1A 4JEDA 2I3YA 1EV9A 3P90A 4V2LA 3DRNA 4D73A 3H1NA 2XHFA 1SYXA 4JZQA 3GUSA 3F3QA 2M46A 1DUGA 5GSSA 2H72A 3UL3A 2P0GA 1SD9A 1GSQA 4GSTA 5D9WA 1R5AA 4JU5A 3C7MA 2L59A 4ZL8A 4IJIA 1THXA 5HFGA 3TRXA 5A5KA 1AIUA 1BG5A 4I97A 2PERA 3ZL5A 4JR6A 3L9UA 1W89A 3IAM2 4KB3A 3VLNA 4JRRA 1EP8A 4N10A 4XTSA 2H6YA 5DJLA 2DJ2A 4MLYA 3VK9A 3DEXA 4TVEA 1XW5A 3UJ1A 3TKSC 4G19A 1NHYA 3SWLA 1M99A 1R7HA 4L0UA 4GQCA 1CQHA 4MA9A 2X99A 2AYTA 4IBPA 2V1MA 4GWRA 4XS4B 3HA9A 4N0VA 2K9FA 2H73A 5C04A 4PUFC 3RAZA 2I81A 4F03A 4WF5A 5HQPA 1WE0A 1O85A 4ML6A 2LEGA 5CAXA 2GTUA 3VWXA 4POMA 4K7NA 2R6KA 4WR4A 1GULA 1A0FA 2YWMA 1ZYQB 1GWCA 3FR3A 2A4VA 4ZB6A 4O92A 4JR4A 2EIQA 1WJKA 1G0TA 2IPAA 5J41A 3BD2A 3L0HA 2MBSA 3W6GA 2DJ1A 4TR1B 5H5RA 5D9VA 2L4CA 2CAQA 3GH9A 2XBIA 3APOA 3CBUA 4K9ZA 5FWGA 1VF1A 4GXZA 6GSYA 2C0DA 5DCGA 5E59A 2LRNA 1U88A 1X0RA 1X9MB 4PURA 1VF3A 2KLXA 5B8BA 1FB6A 5A4WA 1A8LA 4BVXA 3EMPA 5L71A 4IS0A 3ZZXA 3IK7A 2LQQA 4PXOA 1K0NA 2VAFA 4V1Ag 5CRDA 4XHMA 4FYUA 3SBCA 3CMIA 2QKEA 3FZ5A 3QMXA 3KM6A 3GTUA 3L78A 2YV7A 4GQFA 1B9XC 5E4WA 1EOHA 3WT2A 5CREA 3R2QA 2H30A 3F4RA 1VGLA 4EE0A 3HJMA 1PX7A 3EE2A 3A2VA 1QUWA 2OE3A 3TDGA 5KN2A 3N5OA 1M9BA 3HDCA 3CTFA 2HI7A 3CTGA 4KX4A 3K8NA 2GSRA 5DALA 4X1UA 3F0IA 4I6XA 1V98A 3DMLA 5DAKB 4WBJA 1R5PA 1GTIA 3F63A 4MJBA 1QK8A 4Q5FA 2O87A 1MEKA 3MAKA 1I5GA 2QC7A 1Q98A 5GSTA 2B5EA 1Y25A 2GSTA 3VWWA 1O73A 2C0GA 2ON7A 2VOCA 2IN3A 1F37A 5G1KA 1XWKA 3LSZA 2JADA 2X8GA 3G7YA 1FHEA 19GSA 4WKWA 1FW1A 1VF2A 1NW2A 4KAEA 4X0XA 5ELGA 3TKRA 3BCIA 3WT1A 3FR6A 4MZBA 2YNXA 3FY7A 4MH2A 2VLUA 2B1KA 2CX3A 4I8BA 4K7OA 1QGVA 4ILFA 4TW5A 2FUG2 2CVDA 3C73A 1AQXA 3DKSA 2ALBA 4CDOA 4EDYA 3FZ4A 3HCZA 1A2LA 5LD0A 1T7PB 1O7UA 3EYTA 1K3OA 4G10A 2R3XA 4QL9A 5JCWA 2BTOT 2FHEA 4YAVA 4MF6A 2I9HA 3TUEA 2WS2A 5COHA 2E7PA 1GH2A 3D5JA 1TRVA 1AUCA 3DD3A 5G31A 1M0UA 4DSRA 4PQHA 3C1RA 2F3MA 3GKKA 2LNTA 2F8FA 4TRXA 5EY6A 3WGEA 3UBLA 1AXDA 3CRTA 2H66A 4OO4A 3FRCA 4EF0A 4KW6A 3BCKA 2FWHA 5IM9A 3D0ZA 3QDNA 2GSSA 4G9HA 1DSBA 3APQA 1ACVA 1O81A 3M3MA 5HFKA 4TOPA 4KA0A 1YF1A 2TRCP 1XWBA 1MDKA 5B7CA 1MD4A 2CZ3A 1PGTA 3RHBA 3US3A 2AHEA 2LJKA 2REMA 3LJRA 3UAPA 6GSWA 5D8IA 3ZRDA 12GSA 3EMXA 3FYGA 4DSQA 4IJ3A 5HFIA 1DBYA 3F3RA 5ENUA 4AJ7A 4I2UA 4NAXA 3UMAA 1IYIA 1JZDA 2HYXA 3ZREA 1SENA 4POLA 4BPYA 2H75A 6GSUA 1GSEA 1TRWA 3HY2A 1XWGA 3OR5A 3E0UA 3LFLA 14GSA 5IO0A 2M72A 2DMLA 1O8WA 3GL5A 4KH7A 4F9ZA 3NZNA 1RQMA 3GV1A 2JSZA 4Q5QA 5H5SA 2HRNA 4NV2A 2HZEB 5B6MA 3TGZA 4EUYA 3UVTA 1K3YA 4ZL7A 4ECCA 2IIYA 2AUVA 5ECNB 3EVIA 1NSWA 5IMFA 5DBQA 3UARA 2LKUA 3D4MA 2DJ3A 1HQOA 3QR6A 4HS1A 3AY8A 2GGTA 1U3AA 3RDWA 4J57E 4ZBDA 1WIKA 4ECBA 2B6MA 1Z9HA 3PH9A 3ZLPA 4JE1A 1E6BA 4IW9A 2OBKA 3RPPA 2X8HA 2GLRA 1A23A 3C8EA 4IELA 1SK1A 1B4QA 2IMFA 2GQMA 2FNOA 1S3AA 2JU5A 2NPBA 2NDOA 2GZYA 3LYKA 4WXTA 4LL1B 3ZMKA 4XRAA 2IMDA 3IHQA 3QAVA 5D9TA 7GSSA 1OKDA 5DJMA 2PVOC 3H8QA 4MF5A 5IOXA 3KMNA 1XCCA 3ZMLA 4LLRA 2TRXA 3ZFLA 2GQKA 3MDKA 1EGRA 2MBTA 5LCZA 4PUAA 2DC5A 5ABRA 2CX4A 2O85A 4F0CA 2FLSA 3J7Yb 3UIWA 1LBKA 1NHOA 2H19A 3HVVA 4PGTA 2PBJA 3TCOA 2C8UA 3HVSA 3F9UA 5D73A 5IPGA 2OE1A 4PX1A 2EIOA 5EVOA 4LMWA 1J9BA 4WF4A 2K8SA 2C3TA 2E2MA 3MSZA 1BYEA 4ML1A 3TJFA 1X5EA 4MPFA 2HNLA 2YWNA 3GX0A 4MDCA 9GSSA 4K6XA 2LQOA 3GN3A 2WRTA 1YKAA 3QCPA 2OA7A 2WGRA 11GSA 4YQVA 1XWCA 3IAS2 2ES7A 4POBA 4ULXA 2DJKA 4CHSA 3IXRA 3KP8A 3KH7A 3WGDA 3QOUA 3LG6A 5CO3A 1GUKA 2L4QA 1RK4A 1AQVA 1G6WA 1GUMA 1HNAA 3FZ9A 2B5YA 1T4ZA 4Z7XA 4O5RA 4NV5A 4MF7A 2X64A 2H8LA 3KGKA 4V2NA 2OADA 4CW9A 3L9SA 1FB0A 2FCHA 3WGXA 4QQ7A 3I69A 16GSA 3LXTA 2VO4A 2KOKA 3FKFA 3GX8A 4V2MA 5J9CA 3P8WA 4FO5A 2YWOA 2H0GA 2XPEA 3LQ7A 3ZVJD 4HZ2A 4ZBBA 5ECHB 1OC9A 5JCUA 2HSYA 1XPVA 2J9HA 2FWGA 1ML6A 1OVNA 5DQYA 1OE7A 5JWQB 1GUHA 4L8EA 1MTCA 3KTBA 2O8VB 4H86A 3KD0A 5ECPB 3D4TA 1SJIA 2PVQA 3LEFA 2B3SA 2GT5A 4HQZA 1YEPA 2PU9C 1SKSB 2PUKC 1UN2A 1SKRB 1F3AA 4IP6A 1TRSA 5INYA 1EEMA 5JWRB 3E3EA 1GSDA 2X8CA 1SK2A 3GYKA 2H01A 1G7EA 1GSFA 3NOFA 1FVKA 2RIIA 4WBRD 2OJLA 3JCML 2YZUA 1PKZA 4XIHA 5ECIB 3HHVA 3L9VA 2TIRA 1H75A 4ECJA 22GSA 1PD21 4KSMA 5ECMB 1JHBA 3VURA 2EC4A 4OCFA 1XOBA 1AW9A 2KP1A 1PN9A 1ERUA 2VCVA 2C4JA 2N5BA 4D73B 3QD9A 1WOUA 1SL2B 1QXHA 2VUPA 4Q5RA 4PQIA 1E2YA 4KNDA 3ZYWA 2CV4A 2MZCA 2F8AA 4K2DA 1O6JA 4IKHA 3S9FA 2PGTA 3TRQA 4IN0A 1YEXA 2GT6A 5F05A 4DSSA 2FD3A 4FIWA 4IHUA 3TKQA 4XCSA 1THOA 1YY7A 2L57A 2VM1A 1XW6A 3GMFA 1JZRA 1LU4A 3TJJA 2R37A 3VFIA 2F51A 5FT3A 5IO2A 4EVMA 3PGTA 3HVXA 2V6KA 1X5CA 2IMIA 4I5QA 5A4VA 2HRFA 3KH9A 1TRUA 1MD3A 5KN0A 4HU7A 2YWIA 1XOAA 4QL7A 4HQSA 3CSIA 4MABA 5F06A 5D9XA 5D96A 2XPDA 4MK3A 3CRUA 1K0AA 3VI5A 5ECOB 3P2AA 4ZB8A 3IE3A 2IFQA 1F6MC 4TKYA 1TKDB 2YZHA 4RUVA 3RHCA 1ILOA 1YKCA 4KDXA 4EC0A 1BQ7A 2AAWA 3IA1A 1WWJA 2LJAA 3KP9A 1PRXA 2K6VA 1QMVA 2J23A 4XS1A 1W4VA 1ZMAA 4N0ZA 3IV4A 3QAGA 1TOFA 2HZFA 4KDYA 5ID2A 2PPTA 2NTOA 2JZRA 3LORA 1ABAA 2VCWA 4O7HA 3TB2A 1HNBA 2RUFA 1ERVA 2LTKA 2B7KA 3MNGA 3V1WA 4LMVA 2RUEA 2AB6A 2KP2A 4ZILA 1TK0B 2KUCA 3A5WA 5C00A 1X5DA 1H4OA 2DMMA 5EPFA 3M8NA 4L0WA 5AN1A 1T00A 5HR0A 4NPBA 2N5AA 4ACSA 4J56E 1SJ6A 2ON5A 3H4KA 5CRWA 3J7Yk 3KEBA 4IVFA 3I6AA 3GTUB 2NVLA 5B8AA 3QFAC 4K1FA 4BA7A 1XXUA 5F8BA 4YQMA 4WEYA 3WYWA 2OKAA 4K7IA 1X9SB 1F3BA 1PKWA 5IPHA 1BJXA 2G2QA 4ID0A 2E0QA 3BJ5A 4LA1A 5FHIA 1T1VA 5G30A 1F2EA 4HI7A 2YANA 2YPMA 2H70A 1SYRA 4HDEA 1X9WB 3L4NA 3I9V2 2C0EA 4KCEA 5DALB 1T8EB 1JLVA 1ST9A 2FWFA 1URMA 3DVWA 2C3NA 4RI6A 1RW1A 2ZUPA 4HZ4A 2L5LA 3GH6A 1G7OA 1HYUA 4OFTA 2VL2C 4GSSA 1TI3A 4AGSA 4EDZA 1OKTA 3GRXA 1EP7A 3EU4A 1IYHA 3F6FA 1ZZYA 3M0FA 2CT6A 4BWSA 2RM5A 1DE1A 4TXOA 2ZCTA 5AGYA 1N2AA 1V57A 2LUSA 2GVPA 4HUAA 3FK8A 1V58A 1B48A 1ERTA 4OCEA 5GAPD 2JZTA 4MJEA 1EEJA 1GNEA 2FWEA 1K0OA 2IMKA 4KUNA 4OD7A 2H1BA 5AIVA 2VCQA 1QQ2A 5GZZB 2PMTA 1M2AA 2O7KA 3LWAA 4BL7A 3Q19A 2L6DA 3E9JB 2JSYA 5IMDA 3ZIVA 4KDUA 1PA3A 3RPNA 2K18A 3VI7A 3DIEA 4DEJA 4MZWA 1B4PA 3FEUA 2LSTA 2DIYA 1KBNA 4XRDA 3EC3A 3QFBC 4KGIA 1NM3A 4O32A 1Z7RA 1FOVA 4MJCA 5JCGA 4XS4A 3ZIJA 2CA8A 1WPIA 4KCAA 1A8YA 1WRYA 20GSA 3F8UA 4PQ1A 5EL8A 3GURA 3FR9A 2A2RA 5CNWA 1PMTA 1OC3A 3GFKA 4NHWA 3U6VA 4NWYA 2DJJA 2LRTA 4ECIA 3ERFA 2LJRA 2Z9SA 10GSA 1PQNA 1PL2A 4JBBA 5DVBA 3F4TA 2HLSA 3D21A 2YN1A 2DLXA 2YJ7A 2CQ9A 4TR1A 5KN1A 2VLVA 2FA8A 2IL3A 1FVJA 2JL4A 1TK8B 1SL1B 4GLTA 3NIVA 3IC4A 1ERWA 2H1AA 2D2ZA 3EINA 4Q5NA 1XVWA 1QFNA 18GSA 3Q74A 2DBCA 1N8JA 2GDRA 4GTUA 2OE0A 5J3RA 1T4YA 3KJYA 4BVYA 1WMJA 2YJHA 4HJ2A 1GLPA 1V2AA 5GAND 5J5NA 3KMOA 2MMNA 3IOSA 2HFDA 1GSSA 5HR3A 2GZZA 2WFCA 2P5RA 1HNCA 1BEDA 2O89A 3FW2A 3CSJA 1ON4A 1GTAA 1GTBA 1O8XA 4IQ1A 3IBHA 1VRSD 2HSHA 1A2MA 2PWJA 2R2JA 2CAIA 1EV4A 2VL2A 2IJYA 2HT9A 4PNGA 2H1DA 2H74A 5ELAA 4F82A 1VF4A 4V1Ap 5IMAA 1R26A 1ZCPA 1AQWA 1XFLA 5DAKA 3KCMA 4MH3A 2VIMA 1MDIA 1GNWA
chains in the Genus database with same CATH superfamily
4EIQA 4GRFA 1TTZA 4AJ8A 2LV3A 1TI1A 3TKPA 2B5XA 2JACA 4HU9A 3ZVJA 1J0FA 1K3LA 2GSQA 1GRXA 2DIZA 2YP6A 2X49A 4MPGA 4WETA 3I43A 3D6IA 3EPTA 1T3BA 5ECSA 3CYNA 1TP9A 2L6CA 3M9KA 4MMMA 3GSSA 3A2XA 4HOJA 3W8JA 2WB9A 2VCZA 5ECQB 1USBA 1EZKA 2MMZA 5CRGA 2JZSA 3UBKA 2MMOA 2A2SA 2VL3A 3KIJA 2DJ0A 4KE3A 1KEBA 3CXGA 5DDLA 2P31A 4L5OA 1TU7A 3ME8A 3HD5A 3MIXA 2H76A 1J08A 3G7JA 3O3TA 1TK5B 4N30A 2RM6A 2C80A 1Z6NA 3HZ8A 1KNGA 2EIRA 4G2EA 3P7XA 1GTUA 2V6OA 5IQYA 2NBSA 3G9BA 1I9DA 4EXJA 4MZCA 4ZB9A 3APSA 1SU9A 1Z7PA 1OAZA 5KOXA 2YCDA 1DE2A 4L5LA 3KTLA 5IMVA 4MJAA 3IPZA 3TJGA 2R0GA 2M80A 3GIXA 4IP1A 2CVKA 2LNSA 3DVXA 2L5OA 1UVZA 2H6ZA 3ED3A 1FG4A 3GA4A 2VD1A 3Q18A 1V40A 4GF0A 3GNJA 4ZXGA 3A2WA 6GSTA 1A2JA 1GSYA 1YF0A 1V9WA 2CVBA 3ME7A 1U6TA 5KOWA 4X43A 5DCHA 4YKGA 2H1GA 5CYYA 3EURA 3TJBA 4OMVA 2G0FA 1A24A 3LYPA 1Y6EA 3ERWA 4J2FA 2R4VA 1Q4JA 3EU3A 3GKMA 4E8EA 1OC9B 4EL1A 3ZFBA 6GSXA 1EOGA 3HJOA 3LGCA 3KZQA 5IIZA 4WR5A 2HXKA 4YAPA 2H71A 3H79A 2GZPA 3H93A 1PFOA 1K0MA 6GSSA 5JWOB 3ISOA 4DVCA 2LRCA 4IGJA 3GHAA 1JZOA 2VLTA 5A4UA 3LXZA 2AJQB 2ZNMA 3D22A 3FHKA 2R5GA 2IWTA 2B1LA 4F2IA 2H0HA 2HZEA 1Z5YE 4LL4B 4NXIA 1Z6MA 1YJ6A 2WJUA 1XW9A 1TXXA 3O6TA 3QPMA 4F0BA 4AF2A 3TKSA 2MYGA 1OE8A 1PX6A 2GS3A 2WDUA 2I4AA 1LJRA 4TR4A 2UZ8A 2XC2A 3C71A 5G2ZA 3DGQA 1U3IA 4TXVA 2N5FA 2DSAA 1AC1A 2YOIA 3A5IA 3N9JA 3TOTA 1PSQA 2QGVA 1K0CA 5IMZA 3VPTA 3VWUA 1KTEA 2CZ2A 3PR8A 3RBTA 3LW9A 4TN8A 5F0GA 2MMAA 3C1SA 2PN8A 3MWHA 5DQSA 2WZ9A 3GKNA 3IR4A 2WCIA 3UVHA 3FZAA 5D93A 3IK9A 3A3TA 4P3YB 4I2TA 6GSVA 1AAZA 1XWAA 4E8HA 5ECRB 1M7TA 1TU8A 1Z3EA 1C72A 4DSSB 3O76A 3IRAA 2YV9A 4ZL9A 4HEA2 1FO5A 3F6DA 1ZL9A 1GL8A 4TR3A 1JFUA 1JZWA 4ZIJA 1SD8A 3DXBA 1G6YA 3U5RE 1U87A 1MDJA 1ZOFA 2VL9A 2WULA 4FYCA 1S3DA 1SKWB 2VD0A 4KSOA 3ERGA 1CQGA 2FY6A 1HD2A 5G5EA 2IMEA 4HSCX 1TDIA 4NMUA 1EWXA 2IFQB 3DWVA 2V41A 1OYJA 3HKRA 4GCIA 3HYPA 4PNFA 4GSNA 2C1YA 4POKA 5IOWA 4OWYA 2C0FA 4MCUA 2B7JA 3BBYA 1UC7A 2BJXA 1PL1A 4MP4A 4AJ6A 1EGOA 3GKXA 5ID2B 3HXSA 2F9SA 4NHZA 1JLWA 1SK0A 3CSHA 5F07A 2QSIA 1TJDA 5HR1A 5IMCA 8GSSA 2FA4A 2RLIA 1M2BA 4FYBA 5ECLB 1M9AA 1YZXA 4USSA 2P5QA 4TR0A 4RI7A 3TKSE 4N11A 1XIYA 2E2GA 1BAYA 1FAAA 3IDVA 3TOUA 1XVQA 4Z2TA 2V2GA 1B8XA 1A0RP 2K8VA 3ZITA 3VPQA 2OBIA 3EWLA 3GL3A 1M3IA 4YH2A 1ZGNA 2XBQA 3PINA 3QAWA 4OO5A 3W8SA 2DKIA 2OACA 3KXOA 4BWQA 2VCXA 3HJPA 5CRHA 1K0DA 5G5FA 5KN3A 4IQAA 1R4WA 4K0NA 5G1LA 4K8MA 1XBSA 1ZYEA 3ZTLA 1F9MA 1B9YC 1YDKA 3M1GA 4OFMA 2HE3A 1M2DA 3UEMA 2VCTA 5J9BA 17GSA 1TW9A 1WP0A 5B6NA 2C3QA 5LNKe 2AV4A 3WD6A 1UA5A 4HJMA 4XS6A 1XZOA 5AISA 3G7IA 2H6XA 2LS5A 3HZ4A 3TRPA 4OFNA 3F4SA 4YQUA 2FGXA 2I1UA 5CP1A 13GSA 3M9JA 4RQXA 4K0GA 3BOAA 2KHPA 4FH8A 5BMUA 3VWVA 1GP1A 1SJZA 1K0BA 1SL0B 5HR2A 5H5QA 5KEJA 3Q6OA 1OC8A 1BX9A 1GLQA 5AIXA 4ISDA 4ZBAA 1GSUA 3DYRA 1S3CA 2V32A 2H0IA 2GQLA 5ECKB 3UOMA 5J4UA 1PN0A 2VM2A 4TXOB 4EO3A 3GSTA 2BMXA 4EKZA 3TJKA 4RQRA 1YQ1A 4JEDA 2I3YA 1EV9A 3P90A 4V2LA 4Z2UA 3DRNA 4D73A 3H1NA 2XHFA 1SYXA 4JZQA 3GUSA 3F3QA 2M46A 1DUGA 5GSSA 2H72A 4EIPA 3UL3A 2P0GA 1SD9A 1GSQA 4GSTA 5D9WA 1R5AA 4JU5A 3C7MA 2L59A 4ZL8A 4IJIA 1THXA 5HFGA 3TRXA 5A5KA 1AIUA 1BG5A 4I97A 2PERA 3ZL5A 4JR6A 1ZYNA 3L9UA 1W89A 3IAM2 4KB3A 3VLNA 4JRRA 1EP8A 4X4JA 4N10A 4XTSA 2H6YA 5DJLA 2DJ2A 4MLYA 3VK9A 3DEXA 4TVEA 1XW5A 3UJ1A 3TKSC 4G19A 1NHYA 3SWLA 2A4HA 1M99A 1R7HA 4L0UA 4GQCA 1CQHA 4MA9A 2X99A 2AYTA 4IBPA 2V1MA 4GWRA 4XS4B 3HA9A 4N0VA 4K5SA 2K9FA 2H73A 5C04A 4PUFC 3RAZA 2I81A 4F03A 4WF5A 5HQPA 1WE0A 1O85A 4ML6A 2LEGA 5CAXA 2GTUA 3VWXA 4POMA 4K7NA 2R6KA 4WR4A 1GULA 1A0FA 2YWMA 1ZYQB 1GWCA 3FR3A 2A4VA 4ICYA 4ZB6A 4O92A 4JR4A 2EIQA 1WJKA 1G0TA 2IPAA 5J41A 3BD2A 3L0HA 2MBSA 3W6GA 2DJ1A 4TR1B 5H5RA 5D9VA 2L4CA 2CAQA 3GH9A 2XBIA 3APOA 3CBUA 4K9ZA 5FWGA 1VF1A 4GXZA 6GSYA 2C0DA 5DCGA 5E59A 2LRNA 1U88A 1X0RA 4A5PA 1X9MB 4PURA 1VF3A 2KLXA 5B8BA 1FB6A 5A4WA 1A8LA 4BVYB 4BVXA 3EMPA 5L71A 4IS0A 3ZZXA 4MNNA 3IK7A 2LQQA 4PXOA 1K0NA 2VAFA 4V1Ag 5CRDA 4XHMA 4FYUA 3SBCA 3CMIA 2QKEA 3FZ5A 3QMXA 3KM6A 3GTUA 3L78A 2YV7A 4GQFA 1B9XC 5E4WA 1EOHA 3WT2A 5CREA 3IHGA 3R2QA 2H30A 3F4RA 1VGLA 4EE0A 3HJMA 1PX7A 3EE2A 3A2VA 4BIKA 1QUWA 2OE3A 3TDGA 5KN2A 3N5OA 1M9BA 3HDCA 3CTFA 2HI7A 3CTGA 4G0LA 4KX4A 3K8NA 2GSRA 5DALA 4X1UA 3F0IA 4I6XA 1V98A 3DMLA 5DAKB 4WBJA 1R5PA 1GTIA 3F63A 4MJBA 1QK8A 4Q5FA 2O87A 1MEKA 3MAKA 1I5GA 2QC7A 1Q98A 3CQFA 5GSTA 2B5EA 1Y25A 2GSTA 3VWWA 1O73A 2C0GA 2ON7A 2VOCA 2IN3A 1F37A 4YKFA 5G1KA 1XWKA 3LSZA 2JADA 2X8GA 3G7YA 1FHEA 2DKHA 4PTSA 19GSA 4WKWA 1FW1A 1VF2A 1NW2A 4KAEA 4X0XA 5ELGA 3TKRA 3BCIA 3WT1A 3FR6A 4MZBA 2YNXA 3FY7A 4MH2A 2VLUA 2B1KA 2CX3A 4I8BA 4K7OA 1QGVA 4ILFA 4TW5A 2FUG2 2CVDA 3C73A 1AQXA 3DKSA 2ALBA 4CDOA 4EDYA 3FZ4A 3HCZA 1A2LA 5LD0A 1T7PB 4O5UA 1O7UA 3EYTA 1K3OA 4G10A 2R3XA 4QL9A 5JCWA 2BTOT 2FHEA 4YAVA 4MF6A 2I9HA 3TUEA 2WS2A 5COHA 2E7PA 1GH2A 3D5JA 1TRVA 1AUCA 3DD3A 5G31A 1M0UA 4DSRA 4PQHA 3C1RA 2F3MA 3GKKA 2LNTA 2F8FA 4TRXA 5EY6A 3WGEA 3UBLA 1AXDA 3CRTA 2H66A 4OO4A 3FRCA 4EF0A 4KW6A 3BCKA 2FWHA 5IM9A 3D0ZA 3QDNA 2GSSA 4G9HA 1DSBA 3APQA 1ACVA 1O81A 3M3MA 5HFKA 4TOPA 4KA0A 1YF1A 2TRCP 1XWBA 1MDKA 5B7CA 1MD4A 2CZ3A 1PGTA 3RHBA 3US3A 2AHEA 2LJKA 2REMA 3LJRA 3UAPA 4K5RA 6GSWA 5D8IA 3ZRDA 12GSA 3EMXA 3FYGA 4DSQA 4IJ3A 5HFIA 1DBYA 3F3RA 5ENUA 4AJ7A 4I2UA 4NAXA 4KF9A 3UMAA 1IYIA 1JZDA 2HYXA 1M3JA 3ZREA 1SENA 4POLA 4BPYA 2H75A 6GSUA 1GSEA 1TRWA 3HY2A 1XWGA 3OR5A 3E0UA 3LFLA 14GSA 5IO0A 2M72A 2DMLA 1O8WA 3GL5A 4KH7A 4F9ZA 3NZNA 1RQMA 3GV1A 2JSZA 4Q5QA 5H5SA 2HRNA 4CY6A 4NV2A 2HZEB 5B6MA 3TGZA 4EUYA 3UVTA 1K3YA 4ZL7A 4ECCA 2IIYA 2AUVA 5ECNB 3EVIA 1NSWA 5IMFA 5DBQA 3UARA 2LKUA 3D4MA 2DJ3A 1HQOA 3QR6A 4HS1A 3AY8A 2GGTA 1U3AA 3RDWA 4J57E 4ZBDA 1WIKA 4ECBA 2B6MA 1Z9HA 3PH9A 4K2XA 3ZLPA 4JE1A 1E6BA 4IW9A 2OBKA 3RPPA 2X8HA 2GLRA 1A23A 3C8EA 4IELA 1SK1A 1B4QA 2IMFA 2GQMA 2FNOA 1S3AA 2JU5A 2NPBA 4O5QA 2NDOA 2GZYA 3LYKA 2HRKA 4WXTA 4LL1B 3ZMKA 4XRAA 2IMDA 3IHQA 3QAVA 5D9TA 7GSSA 1OKDA 5DJMA 2PVOC 3H8QA 4MF5A 5IOXA 3KMNA 1XCCA 3ZMLA 4LLRA 2TRXA 3ZFLA 2GQKA 3MDKA 1EGRA 2MBTA 5LCZA 4PUAA 2DC5A 5ABRA 2CX4A 2O85A 1XG8A 4F0CA 2FLSA 3J7Yb 3UIWA 1LBKA 1NHOA 2H19A 3HVVA 4PGTA 2PBJA 5BRTA 3TCOA 2C8UA 3HVSA 3F9UA 5D73A 5IPGA 2OE1A 4PX1A 2EIOA 5EVOA 4LMWA 1J9BA 4WF4A 2K8SA 2C3TA 2E2MA 3MSZA 1BYEA 4ML1A 3TJFA 1X5EA 4MPFA 2HNLA 2YWNA 3GX0A 4MDCA 9GSSA 4K6XA 2LQOA 3GN3A 2WRTA 1YKAA 3QCPA 2OA7A 2WGRA 11GSA 4YQVA 1XWCA 3IAS2 2ES7A 4POBA 4ULXA 2DJKA 4CHSA 3IXRA 3KP8A 3KH7A 3WGDA 3QOUA 2HRAA 3LG6A 5CO3A 1GUKA 2L4QA 1RK4A 1AQVA 1G6WA 1GUMA 1HNAA 3FZ9A 2B5YA 1T4ZA 4BL7B 1ZYPA 4Z7XA 2QA2A 4O5RA 4NV5A 4MF7A 2X64A 2H8LA 3KGKA 4V2NA 2OADA 4CW9A 3L9SA 1FB0A 2FCHA 3WGXA 4QQ7A 3I69A 16GSA 3LXTA 2VO4A 2KOKA 3FKFA 3GX8A 4V2MA 5J9CA 3P8WA 4FO5A 2YWOA 2H0GA 2XPEA 3LQ7A 3ZVJD 4HZ2A 4ZBBA 5ECHB 1OC9A 5JCUA 2HSYA 1XPVA 2J9HA 2FWGA 1ML6A 1OVNA 5DQYA 1OE7A 5JWQB 1GUHA 4L8EA 1MTCA 3KTBA 2O8VB 4H86A 3KD0A 5ECPB 3D4TA 1SJIA 2PVQA 3LEFA 2B3SA 2GT5A 4HQZA 1YEPA 2PU9C 1SKSB 2PUKC 1UN2A 1SKRB 1F3AA 4IP6A 1TRSA 5INYA 1EEMA 5JWRB 3E3EA 1GSDA 2X8CA 1SK2A 3GYKA 2H01A 1G7EA 1GSFA 3NOFA 1FVKA 2RIIA 4WBRD 2OJLA 3JCML 2YZUA 1PKZA 4XIHA 5ECIB 3HHVA 3L9VA 2TIRA 1H75A 4ECJA 22GSA 1PD21 4KSMA 5ECMB 1JHBA 3VURA 2EC4A 4OCFA 1XOBA 1AW9A 2KP1A 1PN9A 1ERUA 2VCVA 2C4JA 2N5BA 4D73B 3QD9A 1WOUA 1SL2B 1QXHA 2R0PA 2VUPA 4Q5RA 4PQIA 1E2YA 4KNDA 3ZYWA 2CV4A 2MZCA 2F8AA 4K2DA 2QA1A 1O6JA 4IKHA 3S9FA 2PGTA 3TRQA 4IN0A 1YEXA 2GT6A 3MYDA 5F05A 4DSSA 2FD3A 4FIWA 4IHUA 3TKQA 4XCSA 1THOA 1YY7A 2L57A 2VM1A 1XW6A 3GMFA 1JZRA 1LU4A 3TJJA 2R37A 3VFIA 2F51A 5FT3A 5IO2A 4EVMA 3PGTA 3HVXA 2V6KA 1X5CA 2IMIA 4I5QA 5A4VA 2HRFA 3KH9A 1TRUA 1MD3A 5KN0A 4HU7A 2YWIA 1XOAA 4QL7A 4HQSA 3CSIA 4MABA 5F06A 5D9XA 5D96A 2XPDA 4MK3A 3CRUA 1K0AA 3VI5A 5ECOB 3P2AA 4ZB8A 3IE3A 2IFQA 1F6MC 4TKYA 1TKDB 2YZHA 4RUVA 3RHCA 1ILOA 1YKCA 4KDXA 4EC0A 1BQ7A 2AAWA 3PPUA 3IA1A 1WWJA 2LJAA 3KP9A 1PRXA 2K6VA 1QMVA 2J23A 4XS1A 1W4VA 1ZMAA 4N0ZA 3IV4A 3QAGA 1TOFA 2HZFA 4KDYA 5ID2A 1S3RA 2PPTA 2NTOA 2JZRA 3LORA 1ABAA 2VCWA 4O7HA 3TB2A 1HNBA 2RUFA 1ERVA 2LTKA 2B7KA 3IC8A 3MNGA 3V1WA 4LMVA 2RUEA 2AB6A 2KP2A 4ZILA 1TK0B 2KUCA 3A5WA 5C00A 1X5DA 1H4OA 2DMMA 5EPFA 3M8NA 4BVXB 4L0WA 5AN1A 1T00A 5HR0A 4NPBA 2N5AA 4ACSA 4J56E 1SJ6A 2ON5A 3H4KA 5CRWA 3J7Yk 4Z2RA 3KEBA 4IVFA 3I6AA 3GTUB 2NVLA 5B8AA 3QFAC 4K1FA 4BA7A 1XXUA 5F8BA 4YQMA 4WEYA 3WYWA 2OKAA 4K7IA 1X9SB 1F3BA 1PKWA 5IPHA 1BJXA 2G2QA 4ID0A 3FMWA 2E0QA 3BJ5A 4LA1A 5FHIA 1T1VA 5G30A 1F2EA 4HI7A 2YANA 2YPMA 2H70A 1SYRA 4HDEA 1X9WB 3R3EA 3L4NA 3I9V2 2C0EA 4KCEA 5DALB 1T8EB 1JLVA 1ST9A 2FWFA 1URMA 3DVWA 2C3NA 4RI6A 1RW1A 2ZUPA 4HZ4A 2L5LA 3GH6A 1G7OA 1HYUA 4OFTA 2VL2C 4GSSA 1TI3A 4AGSA 4EDZA 1OKTA 2HSMA 3GRXA 1EP7A 3EU4A 1IYHA 3F6FA 1ZZYA 3M0FA 2CT6A 4BWSA 2RM5A 1DE1A 3HVNA 4TXOA 2ZCTA 5AGYA 1N2AA 1V57A 2LUSA 2GVPA 4HUAA 3FK8A 1V58A 1B48A 1ERTA 4OCEA 5GAPD 2JZTA 4MJEA 1EEJA 1GNEA 2FWEA 1K0OA 2IMKA 4KUNA 4OD7A 2H1BA 5AIVA 2VCQA 1QQ2A 5GZZB 2PMTA 1M2AA 2O7KA 2A2PA 3LWAA 4BL7A 3Q19A 2L6DA 3E9JB 2JSYA 5IMDA 3ZIVA 4KDUA 1PA3A 3RPNA 2K18A 3VI7A 3DIEA 4DEJA 4MZWA 1B4PA 3FEUA 2LSTA 2DIYA 1KBNA 4XRDA 3EC3A 1FOHA 3QFBC 4KGIA 1NM3A 4O32A 1Z7RA 1FOVA 4MJCA 5JCGA 4XS4A 3ZIJA 2CA8A 1WPIA 4KCAA 1A8YA 1WRYA 20GSA 3F8UA 4PQ1A 5EL8A 3GURA 3FR9A 2A2RA 5CNWA 1PMTA 1OC3A 3GFKA 4NHWA 3U6VA 4NWYA 2DJJA 2X4AA 2LRTA 4ECIA 3ERFA 2LJRA 2Z9SA 10GSA 1PQNA 1PL2A 4JBBA 5DVBA 3F4TA 2HLSA 3D21A 2YN1A 2DLXA 2YJ7A 2CQ9A 4TR1A 5KN1A 2VLVA 2FA8A 2IL3A 1FVJA 2JL4A 1TK8B 1SL1B 4GLTA 3NIVA 3IC4A 1ERWA 2H1AA 2D2ZA 3EINA 4Q5NA 1XVWA 1QFNA 18GSA 3Q74A 2DBCA 1N8JA 2GDRA 4GTUA 2OE0A 5J3RA 1T4YA 3KJYA 4G0KA 4BVYA 1WMJA 2YJHA 4HJ2A 1GLPA 1V2AA 5GAND 5J5NA 3KMOA 2MMNA 3IOSA 2HFDA 1GSSA 5HR3A 2GZZA 2WFCA 2P5RA 1HNCA 1BEDA 2O89A 3FW2A 3CSJA 1ON4A 1GTAA 4CY8A 1GTBA 1O8XA 4IQ1A 3IBHA 1VRSD 2HSHA 4G0IA 1A2MA 2PWJA 2R2JA 2CAIA 1EV4A 2VL2A 2IJYA 4FQUA 2HT9A 4PNGA 2H1DA 2R0CA 2H74A 5ELAA 4F82A 1VF4A 4V1Ap 5IMAA 1R26A 1ZCPA 1AQWA 1XFLA 5DAKA 3KCMA 4MH3A 2VIMA 1MDIA 1GNWA
chains in the Genus database with same CATH topology
4EIQA 4GRFA 1TTZA 4AJ8A 2LV3A 1TI1A 3TKPA 2B5XA 2JACA 4HU9A 3ZVJA 1J0FA 1K3LA 2GSQA 1GRXA 2DIZA 2YP6A 2X49A 4MPGA 4WETA 3I43A 3D6IA 3EPTA 1T3BA 5ECSA 3CYNA 1TP9A 2L6CA 3M9KA 4MMMA 3GSSA 3A2XA 4HOJA 3W8JA 2WB9A 2VCZA 5ECQB 1USBA 1EZKA 2MMZA 5CRGA 2JZSA 3UBKA 2MMOA 2A2SA 2VL3A 3KIJA 2DJ0A 4KE3A 1KEBA 3CXGA 5DDLA 2P31A 4L5OA 1TU7A 3ME8A 3HD5A 3MIXA 2H76A 1J08A 3G7JA 3O3TA 1TK5B 4N30A 2RM6A 2C80A 1Z6NA 3HZ8A 1KNGA 2EIRA 4G2EA 3P7XA 1GTUA 2V6OA 5IQYA 2NBSA 3G9BA 1I9DA 4EXJA 4MZCA 4ZB9A 3APSA 1SU9A 1Z7PA 1OAZA 5KOXA 2YCDA 1DE2A 4L5LA 3KTLA 5IMVA 4MJAA 3IPZA 3TJGA 2R0GA 2M80A 3GIXA 4IP1A 2CVKA 2LNSA 3DVXA 2L5OA 1UVZA 2H6ZA 3ED3A 1FG4A 3GA4A 2VD1A 3Q18A 1V40A 4GF0A 3GNJA 4ZXGA 3A2WA 6GSTA 1A2JA 1GSYA 1YF0A 1V9WA 2CVBA 3ME7A 1U6TA 5KOWA 4X43A 5DCHA 4YKGA 2H1GA 5CYYA 3EURA 3TJBA 4OMVA 2G0FA 1A24A 3LYPA 1Y6EA 3ERWA 4J2FA 2R4VA 1Q4JA 3EU3A 3GKMA 4E8EA 1OC9B 4EL1A 3ZFBA 6GSXA 1EOGA 3HJOA 3LGCA 3KZQA 5IIZA 4WR5A 2HXKA 4YAPA 2H71A 3H79A 2GZPA 3H93A 1K0MA 6GSSA 5JWOB 3ISOA 4DVCA 2LRCA 4IGJA 3GHAA 1JZOA 2VLTA 5A4UA 3LXZA 2AJQB 2ZNMA 3D22A 3FHKA 2R5GA 2IWTA 2B1LA 4F2IA 2H0HA 2HZEA 1Z5YE 4LL4B 4NXIA 1Z6MA 1YJ6A 2WJUA 1XW9A 1TXXA 3O6TA 3QPMA 4F0BA 4AF2A 3TKSA 2MYGA 1OE8A 1PX6A 2GS3A 2WDUA 2I4AA 1LJRA 4TR4A 2UZ8A 2XC2A 3C71A 5G2ZA 3DGQA 1U3IA 4TXVA 2N5FA 2DSAA 1AC1A 2YOIA 3A5IA 3N9JA 3TOTA 1PSQA 2QGVA 1K0CA 5IMZA 3VPTA 3VWUA 1KTEA 2CZ2A 3PR8A 3RBTA 3LW9A 4TN8A 5F0GA 2MMAA 3C1SA 2PN8A 3MWHA 5DQSA 2WZ9A 3GKNA 3IR4A 2WCIA 3UVHA 3FZAA 5D93A 3IK9A 3A3TA 4P3YB 4I2TA 6GSVA 1AAZA 1XWAA 4E8HA 5ECRB 1M7TA 1TU8A 1Z3EA 1C72A 4DSSB 3O76A 3IRAA 2YV9A 4ZL9A 4HEA2 1FO5A 3F6DA 1ZL9A 1GL8A 4TR3A 1JFUA 1JZWA 4ZIJA 1SD8A 3DXBA 1G6YA 3U5RE 1U87A 1MDJA 1ZOFA 2VL9A 2WULA 4FYCA 1S3DA 1SKWB 2VD0A 4KSOA 3ERGA 1CQGA 2FY6A 1HD2A 5G5EA 2IMEA 1TDIA 4NMUA 1EWXA 2IFQB 3DWVA 2V41A 1OYJA 3HKRA 4GCIA 3HYPA 4PNFA 4GSNA 2C1YA 4POKA 5IOWA 4OWYA 2C0FA 4MCUA 2B7JA 3BBYA 1UC7A 2BJXA 1PL1A 4MP4A 4AJ6A 1EGOA 3GKXA 5ID2B 3HXSA 2F9SA 4NHZA 1JLWA 1SK0A 3CSHA 5F07A 2QSIA 1TJDA 5HR1A 5IMCA 8GSSA 2FA4A 2RLIA 1M2BA 4FYBA 5ECLB 1M9AA 1YZXA 4USSA 2P5QA 4TR0A 4RI7A 3TKSE 4N11A 1XIYA 2E2GA 1BAYA 1FAAA 3IDVA 3TOUA 1XVQA 4Z2TA 2V2GA 1B8XA 1A0RP 2K8VA 3ZITA 3VPQA 2OBIA 3EWLA 3GL3A 4YH2A 1ZGNA 2XBQA 3PINA 3QAWA 4OO5A 3W8SA 2DKIA 2OACA 3KXOA 4BWQA 2VCXA 3HJPA 5CRHA 1K0DA 5G5FA 5KN3A 4IQAA 1R4WA 4K0NA 5G1LA 4K8MA 1XBSA 1ZYEA 3ZTLA 1F9MA 1B9YC 1YDKA 3M1GA 4OFMA 2HE3A 1M2DA 3UEMA 2VCTA 5J9BA 17GSA 1TW9A 1WP0A 5B6NA 2C3QA 5LNKe 2AV4A 3WD6A 1UA5A 4HJMA 4XS6A 1XZOA 5AISA 3G7IA 2H6XA 2LS5A 3HZ4A 3TRPA 4OFNA 3F4SA 4YQUA 2FGXA 2I1UA 5CP1A 13GSA 3M9JA 4RQXA 4K0GA 3BOAA 2KHPA 4FH8A 5BMUA 3VWVA 1GP1A 1SJZA 1K0BA 1SL0B 5HR2A 5H5QA 5KEJA 3Q6OA 1OC8A 1BX9A 1GLQA 5AIXA 4ISDA 4ZBAA 1GSUA 3DYRA 1S3CA 2V32A 2H0IA 2GQLA 5ECKB 3UOMA 5J4UA 1PN0A 2VM2A 4TXOB 4EO3A 3GSTA 2BMXA 4EKZA 3TJKA 4RQRA 1YQ1A 4JEDA 2I3YA 1EV9A 3P90A 4V2LA 4Z2UA 3DRNA 4D73A 3H1NA 2XHFA 1SYXA 4JZQA 3GUSA 3F3QA 2M46A 1DUGA 5GSSA 2H72A 4EIPA 3UL3A 2P0GA 1SD9A 1GSQA 4GSTA 5D9WA 1R5AA 4JU5A 3C7MA 2L59A 4ZL8A 4IJIA 1THXA 5HFGA 3TRXA 5A5KA 1AIUA 1BG5A 4I97A 2PERA 3ZL5A 4JR6A 1ZYNA 3L9UA 1W89A 3IAM2 4KB3A 3VLNA 4JRRA 1EP8A 4X4JA 4N10A 4XTSA 2H6YA 5DJLA 2DJ2A 4MLYA 3VK9A 3DEXA 4TVEA 1XW5A 3UJ1A 3TKSC 4G19A 1NHYA 3SWLA 2A4HA 1M99A 1R7HA 4L0UA 4GQCA 1CQHA 4MA9A 2X99A 2AYTA 4IBPA 2V1MA 4GWRA 4XS4B 3HA9A 4N0VA 4K5SA 2K9FA 2H73A 5C04A 4PUFC 3RAZA 2I81A 4F03A 4WF5A 5HQPA 1WE0A 1O85A 4ML6A 2LEGA 5CAXA 2GTUA 3VWXA 4POMA 4K7NA 2R6KA 4WR4A 1GULA 1A0FA 2YWMA 1ZYQB 1GWCA 3FR3A 2A4VA 4ICYA 4ZB6A 4O92A 4JR4A 2EIQA 1WJKA 1G0TA 2IPAA 5J41A 3BD2A 3L0HA 2MBSA 3W6GA 2DJ1A 4TR1B 5H5RA 5D9VA 2L4CA 2CAQA 3GH9A 2XBIA 3APOA 3CBUA 4K9ZA 5FWGA 1VF1A 4GXZA 6GSYA 2C0DA 5DCGA 5E59A 2LRNA 1U88A 1X0RA 4A5PA 1X9MB 4PURA 1VF3A 2KLXA 5B8BA 1FB6A 5A4WA 1A8LA 4BVYB 4BVXA 3EMPA 5L71A 4IS0A 3ZZXA 4MNNA 3IK7A 2LQQA 4PXOA 1K0NA 2VAFA 4V1Ag 5CRDA 4XHMA 4FYUA 3SBCA 3CMIA 2QKEA 3FZ5A 3QMXA 3KM6A 3GTUA 3L78A 2YV7A 4GQFA 1B9XC 5E4WA 1EOHA 3WT2A 5CREA 3IHGA 3R2QA 2H30A 3F4RA 1VGLA 4EE0A 3HJMA 1PX7A 3EE2A 3A2VA 1QUWA 2OE3A 3TDGA 5KN2A 3N5OA 1M9BA 3HDCA 3CTFA 2HI7A 3CTGA 4G0LA 4KX4A 3K8NA 2GSRA 5DALA 4X1UA 3F0IA 4I6XA 1V98A 3DMLA 5DAKB 4WBJA 1R5PA 1GTIA 3F63A 4MJBA 1QK8A 4Q5FA 2O87A 1MEKA 3MAKA 1I5GA 2QC7A 1Q98A 5GSTA 2B5EA 1Y25A 2GSTA 3VWWA 1O73A 2C0GA 2ON7A 2VOCA 2IN3A 1F37A 4YKFA 5G1KA 1XWKA 3LSZA 2JADA 2X8GA 3G7YA 1FHEA 2DKHA 4PTSA 19GSA 4WKWA 1FW1A 1VF2A 1NW2A 4KAEA 4X0XA 5ELGA 3TKRA 3BCIA 3WT1A 3FR6A 4MZBA 2YNXA 3FY7A 4MH2A 2VLUA 2B1KA 2CX3A 4I8BA 4K7OA 1QGVA 4ILFA 4TW5A 2FUG2 2CVDA 3C73A 1AQXA 3DKSA 2ALBA 4CDOA 4EDYA 3FZ4A 3HCZA 1A2LA 5LD0A 1T7PB 4O5UA 1O7UA 3EYTA 1K3OA 4G10A 2R3XA 4QL9A 5JCWA 2BTOT 2FHEA 4YAVA 4MF6A 2I9HA 3TUEA 2WS2A 5COHA 2E7PA 1GH2A 3D5JA 1TRVA 1AUCA 3DD3A 5G31A 1M0UA 4DSRA 4PQHA 3C1RA 2F3MA 3GKKA 2LNTA 2F8FA 4TRXA 5EY6A 3WGEA 3UBLA 1AXDA 3CRTA 2H66A 4OO4A 3FRCA 4EF0A 4KW6A 3BCKA 2FWHA 5IM9A 3D0ZA 3QDNA 2GSSA 4G9HA 1DSBA 3APQA 1ACVA 1O81A 3M3MA 5HFKA 4TOPA 4KA0A 1YF1A 2TRCP 1XWBA 1MDKA 5B7CA 1MD4A 2CZ3A 1PGTA 3RHBA 3US3A 2AHEA 2LJKA 2REMA 3LJRA 3UAPA 4K5RA 6GSWA 5D8IA 3ZRDA 12GSA 3EMXA 3FYGA 4DSQA 4IJ3A 5HFIA 1DBYA 3F3RA 5ENUA 4AJ7A 4I2UA 4NAXA 4KF9A 3UMAA 1IYIA 1JZDA 2HYXA 3ZREA 1SENA 4POLA 4BPYA 2H75A 6GSUA 1GSEA 1TRWA 3HY2A 1XWGA 3OR5A 3E0UA 3LFLA 14GSA 5IO0A 2M72A 2DMLA 1O8WA 3GL5A 4KH7A 4F9ZA 3NZNA 1RQMA 3GV1A 2JSZA 4Q5QA 5H5SA 2HRNA 4CY6A 4NV2A 2HZEB 5B6MA 3TGZA 4EUYA 3UVTA 1K3YA 4ZL7A 4ECCA 2IIYA 2AUVA 5ECNB 3EVIA 1NSWA 5IMFA 5DBQA 3UARA 2LKUA 3D4MA 2DJ3A 1HQOA 3QR6A 4HS1A 3AY8A 2GGTA 1U3AA 3RDWA 4J57E 4ZBDA 1WIKA 4ECBA 2B6MA 1Z9HA 3PH9A 4K2XA 3ZLPA 4JE1A 1E6BA 4IW9A 2OBKA 3RPPA 2X8HA 2GLRA 1A23A 3C8EA 4IELA 1SK1A 1B4QA 2IMFA 2GQMA 2FNOA 1S3AA 2JU5A 2NPBA 4O5QA 2NDOA 2GZYA 3LYKA 2HRKA 4WXTA 4LL1B 3ZMKA 4XRAA 2IMDA 3IHQA 3QAVA 5D9TA 7GSSA 1OKDA 5DJMA 2PVOC 3H8QA 4MF5A 5IOXA 3KMNA 1XCCA 3ZMLA 4LLRA 2TRXA 3ZFLA 2GQKA 3MDKA 1EGRA 2MBTA 5LCZA 4PUAA 2DC5A 5ABRA 2CX4A 2O85A 4F0CA 2FLSA 3J7Yb 3UIWA 1LBKA 1NHOA 2H19A 3HVVA 4PGTA 2PBJA 5BRTA 3TCOA 2C8UA 3HVSA 3F9UA 5D73A 5IPGA 2OE1A 4PX1A 2EIOA 5EVOA 4LMWA 1J9BA 4WF4A 2K8SA 2C3TA 2E2MA 3MSZA 1BYEA 4ML1A 3TJFA 1X5EA 4MPFA 2HNLA 2YWNA 3GX0A 4MDCA 9GSSA 4K6XA 2LQOA 3GN3A 2WRTA 1YKAA 3QCPA 2OA7A 2WGRA 11GSA 4YQVA 1XWCA 3IAS2 2ES7A 4POBA 4ULXA 2DJKA 4CHSA 3IXRA 3KP8A 3KH7A 3WGDA 3QOUA 2HRAA 3LG6A 5CO3A 1GUKA 2L4QA 1RK4A 1AQVA 1G6WA 1GUMA 1HNAA 3FZ9A 2B5YA 1T4ZA 4BL7B 1ZYPA 4Z7XA 2QA2A 4O5RA 4NV5A 4MF7A 2X64A 2H8LA 3KGKA 4V2NA 2OADA 4CW9A 3L9SA 1FB0A 2FCHA 3WGXA 4QQ7A 3I69A 16GSA 3LXTA 2VO4A 2KOKA 3FKFA 3GX8A 4V2MA 5J9CA 3P8WA 4FO5A 2YWOA 2H0GA 2XPEA 3LQ7A 3ZVJD 4HZ2A 4ZBBA 5ECHB 1OC9A 5JCUA 2HSYA 1XPVA 2J9HA 2FWGA 1ML6A 1OVNA 5DQYA 1OE7A 5JWQB 1GUHA 4L8EA 1MTCA 3KTBA 2O8VB 4H86A 3KD0A 5ECPB 3D4TA 1SJIA 2PVQA 3LEFA 2B3SA 2GT5A 4HQZA 1YEPA 2PU9C 1SKSB 2PUKC 1UN2A 1SKRB 1F3AA 4IP6A 1TRSA 5INYA 1EEMA 5JWRB 3E3EA 1GSDA 2X8CA 1SK2A 3GYKA 2H01A 1G7EA 1GSFA 3NOFA 1FVKA 2RIIA 4WBRD 2OJLA 3JCML 2YZUA 1PKZA 4XIHA 5ECIB 3HHVA 3L9VA 2TIRA 1H75A 4ECJA 22GSA 1PD21 4KSMA 5ECMB 1JHBA 3VURA 2EC4A 4OCFA 1XOBA 1AW9A 2KP1A 1PN9A 1ERUA 2VCVA 2C4JA 2N5BA 4D73B 3QD9A 1WOUA 1SL2B 1QXHA 2R0PA 2VUPA 4Q5RA 4PQIA 1E2YA 4KNDA 3ZYWA 2CV4A 2MZCA 2F8AA 4K2DA 2QA1A 1O6JA 4IKHA 3S9FA 2PGTA 3TRQA 4IN0A 1YEXA 2GT6A 3MYDA 5F05A 4DSSA 2FD3A 4FIWA 4IHUA 3TKQA 4XCSA 1THOA 1YY7A 2L57A 2VM1A 1XW6A 3GMFA 1JZRA 1LU4A 3TJJA 2R37A 3VFIA 2F51A 5FT3A 5IO2A 4EVMA 3PGTA 3HVXA 2V6KA 1X5CA 2IMIA 4I5QA 5A4VA 2HRFA 3KH9A 1TRUA 1MD3A 5KN0A 4HU7A 2YWIA 1XOAA 4QL7A 4HQSA 3CSIA 4MABA 5F06A 5D9XA 5D96A 2XPDA 4MK3A 3CRUA 1K0AA 3VI5A 5ECOB 3P2AA 4ZB8A 3IE3A 2IFQA 1F6MC 4TKYA 1TKDB 2YZHA 4RUVA 3RHCA 1ILOA 1YKCA 4KDXA 4EC0A 1BQ7A 2AAWA 3PPUA 3IA1A 1WWJA 2LJAA 3KP9A 1PRXA 2K6VA 1QMVA 2J23A 4XS1A 1W4VA 1ZMAA 4N0ZA 3IV4A 3QAGA 1TOFA 2HZFA 4KDYA 5ID2A 2PPTA 2NTOA 2JZRA 3LORA 1ABAA 2VCWA 4O7HA 3TB2A 1HNBA 2RUFA 1ERVA 2LTKA 2B7KA 3IC8A 3MNGA 3V1WA 4LMVA 2RUEA 2AB6A 2KP2A 4ZILA 1TK0B 2KUCA 3A5WA 5C00A 1X5DA 1H4OA 2DMMA 5EPFA 3M8NA 4BVXB 4L0WA 5AN1A 1T00A 5HR0A 4NPBA 2N5AA 4ACSA 4J56E 1SJ6A 2ON5A 3H4KA 5CRWA 3J7Yk 4Z2RA 3KEBA 4IVFA 3I6AA 3GTUB 2NVLA 5B8AA 3QFAC 4K1FA 4BA7A 1XXUA 5F8BA 4YQMA 4WEYA 3WYWA 2OKAA 4K7IA 1X9SB 1F3BA 1PKWA 5IPHA 1BJXA 2G2QA 4ID0A 3FMWA 2E0QA 3BJ5A 4LA1A 5FHIA 1T1VA 5G30A 1F2EA 4HI7A 2YANA 2YPMA 2H70A 1SYRA 4HDEA 1X9WB 3R3EA 3L4NA 3I9V2 2C0EA 4KCEA 5DALB 1T8EB 1JLVA 1ST9A 2FWFA 1URMA 3DVWA 2C3NA 4RI6A 1RW1A 2ZUPA 4HZ4A 2L5LA 3GH6A 1G7OA 1HYUA 4OFTA 2VL2C 4GSSA 1TI3A 4AGSA 4EDZA 1OKTA 2HSMA 3GRXA 1EP7A 3EU4A 1IYHA 3F6FA 1ZZYA 3M0FA 2CT6A 4BWSA 2RM5A 1DE1A 4TXOA 2ZCTA 5AGYA 1N2AA 1V57A 2LUSA 2GVPA 4HUAA 3FK8A 1V58A 1B48A 1ERTA 4OCEA 5GAPD 2JZTA 4MJEA 1EEJA 1GNEA 2FWEA 1K0OA 2IMKA 4KUNA 4OD7A 2H1BA 5AIVA 2VCQA 1QQ2A 5GZZB 2PMTA 1M2AA 2O7KA 2A2PA 3LWAA 4BL7A 3Q19A 2L6DA 3E9JB 2JSYA 5IMDA 3ZIVA 4KDUA 1PA3A 3RPNA 2K18A 3VI7A 3DIEA 4DEJA 4MZWA 1B4PA 3FEUA 2LSTA 2DIYA 1KBNA 4XRDA 3EC3A 1FOHA 3QFBC 4KGIA 1NM3A 4O32A 1Z7RA 1FOVA 4MJCA 5JCGA 4XS4A 3ZIJA 2CA8A 1WPIA 4KCAA 1A8YA 1WRYA 20GSA 3F8UA 4PQ1A 5EL8A 3GURA 3FR9A 2A2RA 5CNWA 1PMTA 1OC3A 3GFKA 4NHWA 3U6VA 4NWYA 2DJJA 2X4AA 2LRTA 4ECIA 3ERFA 2LJRA 2Z9SA 10GSA 1PQNA 1PL2A 4JBBA 5DVBA 3F4TA 2HLSA 3D21A 2YN1A 2DLXA 2YJ7A 2CQ9A 4TR1A 5KN1A 2VLVA 2FA8A 2IL3A 1FVJA 2JL4A 1TK8B 1SL1B 4GLTA 3NIVA 3IC4A 1ERWA 2H1AA 2D2ZA 3EINA 4Q5NA 1XVWA 1QFNA 18GSA 3Q74A 2DBCA 1N8JA 2GDRA 4GTUA 2OE0A 5J3RA 1T4YA 3KJYA 4G0KA 4BVYA 1WMJA 2YJHA 4HJ2A 1GLPA 1V2AA 5GAND 5J5NA 3KMOA 2MMNA 3IOSA 2HFDA 1GSSA 5HR3A 2GZZA 2WFCA 2P5RA 1HNCA 1BEDA 2O89A 3FW2A 3CSJA 1ON4A 1GTAA 4CY8A 1GTBA 1O8XA 4IQ1A 3IBHA 1VRSD 2HSHA 4G0IA 1A2MA 2PWJA 2R2JA 2CAIA 1EV4A 2VL2A 2IJYA 4FQUA 2HT9A 4PNGA 2H1DA 2R0CA 2H74A 5ELAA 4F82A 1VF4A 4V1Ap 5IMAA 1R26A 1ZCPA 1AQWA 1XFLA 5DAKA 3KCMA 4MH3A 2VIMA 1MDIA 1GNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GRF A;  1TTZ A;  4AJ8 A;  2LV3 A;  1TI1 A;  3TKP A;  2B5X A;  2JAC A;  4HU9 A;  3ZVJ A;  1J0F A;  1K3L A;  2GSQ A;  1GRX A;  2DIZ A;  2YP6 A;  4MPG A;  4WET A;  3I43 A;  3D6I A;  1T3B A;  5ECS A;  3CYN A;  1TP9 A;  2L6C A;  3M9K A;  4MMM A;  3GSS A;  3A2X A;  4HOJ A;  3W8J A;  2WB9 A;  2VCZ A;  5ECQ B;  1USB A;  1EZK A;  2MMZ A;  5CRG A;  2JZS A;  3UBK A;  2MMO A;  2A2S A;  2VL3 A;  3KIJ A;  2DJ0 A;  4KE3 A;  1KEB A;  3CXG A;  5DDL A;  2P31 A;  4L5O A;  1TU7 A;  3ME8 A;  3HD5 A;  2H76 A;  1J08 A;  3G7J A;  3O3T A;  1TK5 B;  4N30 A;  2RM6 A;  2C80 A;  1Z6N A;  3HZ8 A;  1KNG A;  2EIR A;  4G2E A;  3P7X A;  1GTU A;  2V6O A;  5IQY A;  2NBS A;  3G9B A;  1I9D A;  4EXJ A;  4MZC A;  4ZB9 A;  3APS A;  1SU9 A;  1Z7P A;  1OAZ A;  2YCD A;  1DE2 A;  4L5L A;  3KTL A;  5IMV A;  4MJA A;  3IPZ A;  3TJG A;  2M80 A;  3GIX A;  4IP1 A;  2CVK A;  2LNS A;  3DVX A;  2L5O A;  1UVZ A;  2H6Z A;  3ED3 A;  1FG4 A;  3GA4 A;  2VD1 A;  3Q18 A;  1V40 A;  4GF0 A;  3GNJ A;  4ZXG A;  3A2W A;  6GST A;  1A2J A;  1GSY A;  1YF0 A;  1V9W A;  2CVB A;  3ME7 A;  1U6T A;  4X43 A;  5DCH A;  2H1G A;  5CYY A;  3EUR A;  3TJB A;  4OMV A;  2G0F A;  1A24 A;  3LYP A;  1Y6E A;  3ERW A;  4J2F A;  2R4V A;  1Q4J A;  3EU3 A;  3GKM A;  4E8E A;  1OC9 B;  4EL1 A;  3ZFB A;  6GSX A;  1EOG A;  3HJO A;  3LGC A;  3KZQ A;  5IIZ A;  4WR5 A;  2HXK A;  4YAP A;  2H71 A;  3H79 A;  2GZP A;  3H93 A;  1K0M A;  6GSS A;  5JWO B;  3ISO A;  4DVC A;  2LRC A;  4IGJ A;  3GHA A;  1JZO A;  2VLT A;  5A4U A;  3LXZ A;  2AJQ B;  2ZNM A;  3D22 A;  3FHK A;  2R5G A;  2IWT A;  2B1L A;  4F2I A;  2H0H A;  2HZE A;  1Z5Y E;  4LL4 B;  4NXI A;  1Z6M A;  1YJ6 A;  2WJU A;  1XW9 A;  1TXX A;  3O6T A;  3QPM A;  4F0B A;  4AF2 A;  3TKS A;  2MYG A;  1OE8 A;  1PX6 A;  2GS3 A;  2WDU A;  2I4A A;  1LJR A;  4TR4 A;  2XC2 A;  3C71 A;  5G2Z A;  3DGQ A;  1U3I A;  4TXV A;  2N5F A;  2DSA A;  1AC1 A;  2YOI A;  3N9J A;  3TOT A;  1PSQ A;  2QGV A;  1K0C A;  5IMZ A;  3VPT A;  3VWU A;  1KTE A;  2CZ2 A;  3PR8 A;  3RBT A;  4TN8 A;  5F0G A;  2MMA A;  3C1S A;  2PN8 A;  3MWH A;  5DQS A;  2WZ9 A;  3GKN A;  3IR4 A;  2WCI A;  3UVH A;  3FZA A;  5D93 A;  3IK9 A;  3A3T A;  4P3Y B;  4I2T A;  6GSV A;  1AAZ A;  1XWA A;  4E8H A;  5ECR B;  1M7T A;  1TU8 A;  1Z3E A;  1C72 A;  4DSS B;  3O76 A;  3IRA A;  2YV9 A;  4ZL9 A;  4HEA 2;  1FO5 A;  3F6D A;  1ZL9 A;  1GL8 A;  4TR3 A;  1JFU A;  1JZW A;  4ZIJ A;  1SD8 A;  3DXB A;  1G6Y A;  3U5R E;  1U87 A;  1MDJ A;  1ZOF A;  2VL9 A;  2WUL A;  4FYC A;  1S3D A;  1SKW B;  2VD0 A;  4KSO A;  3ERG A;  1CQG A;  2FY6 A;  1HD2 A;  5G5E A;  2IME A;  1TDI A;  4NMU A;  1EWX A;  2IFQ B;  3DWV A;  2V41 A;  1OYJ A;  3HKR A;  4GCI A;  3HYP A;  4PNF A;  4GSN A;  2C1Y A;  4POK A;  5IOW A;  4OWY A;  2C0F A;  4MCU A;  2B7J A;  3BBY A;  1UC7 A;  2BJX A;  1PL1 A;  4MP4 A;  4AJ6 A;  1EGO A;  3GKX A;  5ID2 B;  3HXS A;  2F9S A;  4NHZ A;  1JLW A;  1SK0 A;  3CSH A;  5F07 A;  2QSI A;  1TJD A;  5HR1 A;  5IMC A;  8GSS A;  2FA4 A;  2RLI A;  1M2B A;  4FYB A;  5ECL B;  1M9A A;  1YZX A;  2P5Q A;  4TR0 A;  4RI7 A;  3TKS E;  4N11 A;  1XIY A;  2E2G A;  1BAY A;  1FAA A;  3IDV A;  3TOU A;  1XVQ A;  2V2G A;  1B8X A;  1A0R P;  2K8V A;  3ZIT A;  3VPQ A;  2OBI A;  3EWL A;  3GL3 A;  4YH2 A;  1ZGN A;  2XBQ A;  3PIN A;  3QAW A;  4OO5 A;  3W8S A;  2OAC A;  3KXO A;  4BWQ A;  2VCX A;  3HJP A;  5CRH A;  1K0D A;  5G5F A;  5KN3 A;  4IQA A;  1R4W A;  4K0N A;  5G1L A;  4K8M A;  1XBS A;  1ZYE A;  3ZTL A;  1F9M A;  1B9Y C;  1YDK A;  3M1G A;  4OFM A;  2HE3 A;  1M2D A;  3UEM A;  2VCT A;  5J9B A;  17GS A;  1TW9 A;  1WP0 A;  5B6N A;  2C3Q A;  5LNK e;  2AV4 A;  3WD6 A;  1UA5 A;  4HJM A;  4XS6 A;  1XZO A;  5AIS A;  3G7I A;  2H6X A;  2LS5 A;  3HZ4 A;  3TRP A;  4OFN A;  3F4S A;  4YQU A;  2FGX A;  2I1U A;  5CP1 A;  13GS A;  3M9J A;  4RQX A;  4K0G A;  3BOA A;  2KHP A;  4FH8 A;  3VWV A;  1GP1 A;  1SJZ A;  1K0B A;  1SL0 B;  5HR2 A;  5H5Q A;  5KEJ A;  3Q6O A;  1OC8 A;  1BX9 A;  1GLQ A;  5AIX A;  4ISD A;  4ZBA A;  1GSU A;  3DYR A;  1S3C A;  2V32 A;  2H0I A;  2GQL A;  5ECK B;  3UOM A;  5J4U A;  2VM2 A;  4TXO B;  4EO3 A;  3GST A;  2BMX A;  4EKZ A;  3TJK A;  4RQR A;  1YQ1 A;  4JED A;  2I3Y A;  1EV9 A;  3P90 A;  4V2L A;  3DRN A;  4D73 A;  3H1N A;  2XHF A;  1SYX A;  4JZQ A;  3GUS A;  3F3Q A;  2M46 A;  1DUG A;  5GSS A;  2H72 A;  3UL3 A;  2P0G A;  1SD9 A;  1GSQ A;  4GST A;  5D9W A;  1R5A A;  4JU5 A;  3C7M A;  2L59 A;  4ZL8 A;  4IJI A;  1THX A;  5HFG A;  3TRX A;  5A5K A;  1AIU A;  1BG5 A;  4I97 A;  2PER A;  3ZL5 A;  4JR6 A;  3L9U A;  1W89 A;  3IAM 2;  4KB3 A;  3VLN A;  4JRR A;  1EP8 A;  4N10 A;  4XTS A;  2H6Y A;  5DJL A;  2DJ2 A;  4MLY A;  3VK9 A;  3DEX A;  4TVE A;  1XW5 A;  3UJ1 A;  3TKS C;  4G19 A;  1NHY A;  3SWL A;  1M99 A;  1R7H A;  4L0U A;  4GQC A;  1CQH A;  4MA9 A;  2X99 A;  2AYT A;  4IBP A;  2V1M A;  4GWR A;  4XS4 B;  3HA9 A;  4N0V A;  2K9F A;  2H73 A;  5C04 A;  4PUF C;  3RAZ A;  2I81 A;  4F03 A;  4WF5 A;  5HQP A;  1WE0 A;  1O85 A;  4ML6 A;  2LEG A;  5CAX A;  2GTU A;  3VWX A;  4POM A;  4K7N A;  2R6K A;  4WR4 A;  1GUL A;  1A0F A;  2YWM A;  1ZYQ B;  1GWC A;  3FR3 A;  2A4V A;  4ZB6 A;  4O92 A;  4JR4 A;  2EIQ A;  1WJK A;  1G0T A;  2IPA A;  5J41 A;  3BD2 A;  3L0H A;  2MBS A;  3W6G A;  2DJ1 A;  4TR1 B;  5H5R A;  5D9V A;  2L4C A;  2CAQ A;  3GH9 A;  2XBI A;  3APO A;  3CBU A;  4K9Z A;  5FWG A;  1VF1 A;  4GXZ A;  6GSY A;  2C0D A;  5DCG A;  5E59 A;  2LRN A;  1U88 A;  1X0R A;  1X9M B;  4PUR A;  1VF3 A;  2KLX A;  5B8B A;  1FB6 A;  5A4W A;  1A8L A;  4BVX A;  3EMP A;  5L71 A;  4IS0 A;  3ZZX A;  3IK7 A;  2LQQ A;  4PXO A;  1K0N A;  2VAF A;  4V1A g;  5CRD A;  4XHM A;  4FYU A;  3SBC A;  3CMI A;  2QKE A;  3FZ5 A;  3QMX A;  3KM6 A;  3GTU A;  3L78 A;  2YV7 A;  4GQF A;  1B9X C;  5E4W A;  1EOH A;  3WT2 A;  5CRE A;  3R2Q A;  2H30 A;  3F4R A;  1VGL A;  4EE0 A;  3HJM A;  1PX7 A;  3EE2 A;  3A2V A;  1QUW A;  2OE3 A;  3TDG A;  5KN2 A;  3N5O A;  1M9B A;  3HDC A;  3CTF A;  2HI7 A;  3CTG A;  4KX4 A;  3K8N A;  2GSR A;  5DAL A;  4X1U A;  3F0I A;  4I6X A;  1V98 A;  3DML A;  5DAK B;  4WBJ A;  1R5P A;  1GTI A;  3F63 A;  4MJB A;  1QK8 A;  4Q5F A;  2O87 A;  1MEK A;  3MAK A;  1I5G A;  2QC7 A;  1Q98 A;  5GST A;  2B5E A;  1Y25 A;  2GST A;  3VWW A;  1O73 A;  2C0G A;  2ON7 A;  2VOC A;  2IN3 A;  1F37 A;  5G1K A;  1XWK A;  3LSZ A;  2JAD A;  2X8G A;  3G7Y A;  1FHE A;  19GS A;  4WKW A;  1FW1 A;  1VF2 A;  1NW2 A;  4KAE A;  4X0X A;  5ELG A;  3TKR A;  3BCI A;  3WT1 A;  3FR6 A;  4MZB A;  2YNX A;  3FY7 A;  4MH2 A;  2VLU A;  2B1K A;  2CX3 A;  4I8B A;  4K7O A;  1QGV A;  4ILF A;  4TW5 A;  2FUG 2;  2CVD A;  3C73 A;  1AQX A;  3DKS A;  2ALB A;  4CDO A;  4EDY A;  3FZ4 A;  3HCZ A;  1A2L A;  5LD0 A;  1T7P B;  1O7U A;  3EYT A;  1K3O A;  4G10 A;  2R3X A;  4QL9 A;  5JCW A;  2BTO T;  2FHE A;  4YAV A;  4MF6 A;  2I9H A;  3TUE A;  2WS2 A;  5COH A;  2E7P A;  1GH2 A;  3D5J A;  1TRV A;  1AUC A;  3DD3 A;  5G31 A;  1M0U A;  4DSR A;  4PQH A;  3C1R A;  2F3M A;  3GKK A;  2LNT A;  2F8F A;  4TRX A;  5EY6 A;  3WGE A;  3UBL A;  1AXD A;  3CRT A;  2H66 A;  4OO4 A;  3FRC A;  4EF0 A;  4KW6 A;  3BCK A;  2FWH A;  5IM9 A;  3D0Z A;  3QDN A;  2GSS A;  4G9H A;  1DSB A;  3APQ A;  1ACV A;  1O81 A;  3M3M A;  5HFK A;  4TOP A;  4KA0 A;  1YF1 A;  2TRC P;  1XWB A;  1MDK A;  5B7C A;  1MD4 A;  2CZ3 A;  1PGT A;  3RHB A;  3US3 A;  2AHE A;  2LJK A;  2REM A;  3LJR A;  3UAP A;  6GSW A;  5D8I A;  3ZRD A;  12GS A;  3EMX A;  3FYG A;  4DSQ A;  4IJ3 A;  5HFI A;  1DBY A;  3F3R A;  5ENU A;  4AJ7 A;  4I2U A;  4NAX A;  3UMA A;  1IYI A;  1JZD A;  2HYX A;  3ZRE A;  1SEN A;  4POL A;  4BPY A;  2H75 A;  6GSU A;  1GSE A;  1TRW A;  3HY2 A;  1XWG A;  3OR5 A;  3E0U A;  3LFL A;  14GS A;  5IO0 A;  2M72 A;  2DML A;  1O8W A;  3GL5 A;  4KH7 A;  4F9Z A;  3NZN A;  1RQM A;  3GV1 A;  2JSZ A;  4Q5Q A;  5H5S A;  2HRN A;  4NV2 A;  2HZE B;  5B6M A;  3TGZ A;  4EUY A;  3UVT A;  1K3Y A;  4ZL7 A;  4ECC A;  2IIY A;  2AUV A;  5ECN B;  3EVI A;  1NSW A;  5IMF A;  5DBQ A;  3UAR A;  2LKU A;  3D4M A;  2DJ3 A;  1HQO A;  3QR6 A;  4HS1 A;  3AY8 A;  2GGT A;  1U3A A;  3RDW A;  4J57 E;  4ZBD A;  1WIK A;  4ECB A;  2B6M A;  1Z9H A;  3PH9 A;  3ZLP A;  4JE1 A;  1E6B A;  4IW9 A;  2OBK A;  3RPP A;  2X8H A;  2GLR A;  1A23 A;  3C8E A;  4IEL A;  1SK1 A;  1B4Q A;  2IMF A;  2GQM A;  2FNO A;  1S3A A;  2JU5 A;  2NPB A;  2NDO A;  2GZY A;  3LYK A;  4WXT A;  4LL1 B;  3ZMK A;  4XRA A;  2IMD A;  3IHQ A;  3QAV A;  5D9T A;  7GSS A;  1OKD A;  5DJM A;  2PVO C;  3H8Q A;  4MF5 A;  5IOX A;  3KMN A;  1XCC A;  3ZML A;  4LLR A;  2TRX A;  3ZFL A;  2GQK A;  3MDK A;  1EGR A;  2MBT A;  5LCZ A;  4PUA A;  2DC5 A;  5ABR A;  2CX4 A;  2O85 A;  4F0C A;  2FLS A;  3J7Y b;  3UIW A;  1LBK A;  1NHO A;  2H19 A;  3HVV A;  4PGT A;  2PBJ A;  3TCO A;  2C8U A;  3HVS A;  3F9U A;  5D73 A;  5IPG A;  2OE1 A;  4PX1 A;  2EIO A;  5EVO A;  4LMW A;  1J9B A;  4WF4 A;  2K8S A;  2C3T A;  2E2M A;  3MSZ A;  1BYE A;  4ML1 A;  3TJF A;  1X5E A;  4MPF A;  2HNL A;  2YWN A;  3GX0 A;  4MDC A;  9GSS A;  4K6X A;  2LQO A;  3GN3 A;  2WRT A;  1YKA A;  3QCP A;  2OA7 A;  2WGR A;  11GS A;  4YQV A;  1XWC A;  3IAS 2;  2ES7 A;  4POB A;  4ULX A;  2DJK A;  4CHS A;  3IXR A;  3KP8 A;  3KH7 A;  3WGD A;  3QOU A;  3LG6 A;  5CO3 A;  1GUK A;  2L4Q A;  1RK4 A;  1AQV A;  1G6W A;  1GUM A;  1HNA A;  3FZ9 A;  2B5Y A;  1T4Z A;  4Z7X A;  4O5R A;  4NV5 A;  4MF7 A;  2X64 A;  2H8L A;  3KGK A;  4V2N A;  2OAD A;  4CW9 A;  3L9S A;  1FB0 A;  2FCH A;  3WGX A;  4QQ7 A;  3I69 A;  16GS A;  3LXT A;  2VO4 A;  2KOK A;  3FKF A;  3GX8 A;  4V2M A;  5J9C A;  3P8W A;  4FO5 A;  2YWO A;  2H0G A;  2XPE A;  3LQ7 A;  3ZVJ D;  4HZ2 A;  4ZBB A;  5ECH B;  1OC9 A;  5JCU A;  2HSY A;  1XPV A;  2J9H A;  2FWG A;  1ML6 A;  1OVN A;  5DQY A;  1OE7 A;  5JWQ B;  1GUH A;  4L8E A;  1MTC A;  3KTB A;  2O8V B;  4H86 A;  3KD0 A;  5ECP B;  3D4T A;  1SJI A;  2PVQ A;  3LEF A;  2B3S A;  2GT5 A;  4HQZ A;  1YEP A;  2PU9 C;  1SKS B;  2PUK C;  1UN2 A;  1SKR B;  1F3A A;  4IP6 A;  1TRS A;  5INY A;  1EEM A;  5JWR B;  3E3E A;  1GSD A;  2X8C A;  1SK2 A;  3GYK A;  2H01 A;  1G7E A;  1GSF A;  3NOF A;  1FVK A;  2RII A;  4WBR D;  2OJL A;  3JCM L;  2YZU A;  1PKZ A;  4XIH A;  5ECI B;  3HHV A;  3L9V A;  2TIR A;  1H75 A;  4ECJ A;  22GS A;  1PD2 1;  4KSM A;  5ECM B;  1JHB A;  3VUR A;  2EC4 A;  4OCF A;  1XOB A;  1AW9 A;  2KP1 A;  1PN9 A;  1ERU A;  2VCV A;  2C4J A;  2N5B A;  4D73 B;  3QD9 A;  1WOU A;  1SL2 B;  1QXH A;  2VUP A;  4Q5R A;  4PQI A;  1E2Y A;  4KND A;  3ZYW A;  2CV4 A;  2MZC A;  2F8A A;  4K2D A;  1O6J A;  4IKH A;  3S9F A;  2PGT A;  3TRQ A;  4IN0 A;  1YEX A;  2GT6 A;  5F05 A;  4DSS A;  2FD3 A;  4FIW A;  4IHU A;  3TKQ A;  4XCS A;  1THO A;  1YY7 A;  2L57 A;  2VM1 A;  1XW6 A;  3GMF A;  1JZR A;  1LU4 A;  3TJJ A;  2R37 A;  3VFI A;  2F51 A;  5FT3 A;  5IO2 A;  4EVM A;  3PGT A;  3HVX A;  2V6K A;  1X5C A;  2IMI A;  4I5Q A;  5A4V A;  2HRF A;  3KH9 A;  1TRU A;  1MD3 A;  5KN0 A;  4HU7 A;  2YWI A;  1XOA A;  4QL7 A;  4HQS A;  3CSI A;  4MAB A;  5F06 A;  5D9X A;  5D96 A;  2XPD A;  4MK3 A;  3CRU A;  1K0A A;  3VI5 A;  5ECO B;  3P2A A;  4ZB8 A;  3IE3 A;  2IFQ A;  1F6M C;  4TKY A;  1TKD B;  2YZH A;  4RUV A;  3RHC A;  1ILO A;  1YKC A;  4KDX A;  4EC0 A;  1BQ7 A;  2AAW A;  3IA1 A;  1WWJ A;  2LJA A;  3KP9 A;  1PRX A;  2K6V A;  1QMV A;  2J23 A;  4XS1 A;  1W4V A;  1ZMA A;  4N0Z A;  3IV4 A;  3QAG A;  1TOF A;  2HZF A;  4KDY A;  5ID2 A;  2PPT A;  2NTO A;  2JZR A;  3LOR A;  1ABA A;  2VCW A;  4O7H A;  3TB2 A;  1HNB A;  2RUF A;  1ERV A;  2LTK A;  2B7K A;  3MNG A;  3V1W A;  4LMV A;  2RUE A;  2AB6 A;  2KP2 A;  4ZIL A;  1TK0 B;  2KUC A;  3A5W A;  5C00 A;  1X5D A;  1H4O A;  2DMM A;  5EPF A;  3M8N A;  4L0W A;  5AN1 A;  1T00 A;  5HR0 A;  4NPB A;  2N5A A;  4ACS A;  4J56 E;  1SJ6 A;  2ON5 A;  3H4K A;  5CRW A;  3J7Y k;  3KEB A;  4IVF A;  3I6A A;  3GTU B;  2NVL A;  5B8A A;  3QFA C;  4K1F A;  4BA7 A;  1XXU A;  5F8B A;  4YQM A;  4WEY A;  3WYW A;  2OKA A;  4K7I A;  1X9S B;  1F3B A;  1PKW A;  5IPH A;  1BJX A;  2G2Q A;  4ID0 A;  2E0Q A;  3BJ5 A;  4LA1 A;  5FHI A;  1T1V A;  5G30 A;  1F2E A;  4HI7 A;  2YAN A;  2YPM A;  2H70 A;  1SYR A;  4HDE A;  1X9W B;  3L4N A;  3I9V 2;  2C0E A;  4KCE A;  5DAL B;  1T8E B;  1JLV A;  1ST9 A;  2FWF A;  1URM A;  3DVW A;  2C3N A;  4RI6 A;  1RW1 A;  2ZUP A;  4HZ4 A;  2L5L A;  3GH6 A;  1G7O A;  1HYU A;  4OFT A;  2VL2 C;  4GSS A;  1TI3 A;  4AGS A;  4EDZ A;  1OKT A;  3GRX A;  1EP7 A;  3EU4 A;  1IYH A;  3F6F A;  1ZZY A;  3M0F A;  2CT6 A;  4BWS A;  2RM5 A;  1DE1 A;  4TXO A;  2ZCT A;  5AGY A;  1N2A A;  1V57 A;  2LUS A;  2GVP A;  4HUA A;  3FK8 A;  1V58 A;  1B48 A;  1ERT A;  4OCE A;  5GAP D;  2JZT A;  4MJE A;  1EEJ A;  1GNE A;  2FWE A;  1K0O A;  2IMK A;  4KUN A;  4OD7 A;  2H1B A;  5AIV A;  2VCQ A;  1QQ2 A;  5GZZ B;  2PMT A;  1M2A A;  2O7K A;  3LWA A;  4BL7 A;  3Q19 A;  2L6D A;  3E9J B;  2JSY A;  5IMD A;  3ZIV A;  4KDU A;  1PA3 A;  3RPN A;  2K18 A;  3VI7 A;  3DIE A;  4DEJ A;  4MZW A;  1B4P A;  3FEU A;  2LST A;  2DIY A;  1KBN A;  4XRD A;  3EC3 A;  3QFB C;  4KGI A;  1NM3 A;  4O32 A;  1Z7R A;  1FOV A;  4MJC A;  5JCG A;  4XS4 A;  3ZIJ A;  2CA8 A;  1WPI A;  4KCA A;  1A8Y A;  1WRY A;  20GS A;  3F8U A;  4PQ1 A;  5EL8 A;  3GUR A;  3FR9 A;  2A2R A;  5CNW A;  1PMT A;  1OC3 A;  3GFK A;  4NHW A;  3U6V A;  4NWY A;  2DJJ A;  2LRT A;  4ECI A;  3ERF A;  2LJR A;  2Z9S A;  10GS A;  1PQN A;  1PL2 A;  4JBB A;  5DVB A;  3F4T A;  2HLS A;  3D21 A;  2YN1 A;  2DLX A;  2YJ7 A;  2CQ9 A;  4TR1 A;  5KN1 A;  2VLV A;  2FA8 A;  2IL3 A;  1FVJ A;  2JL4 A;  1TK8 B;  1SL1 B;  4GLT A;  3NIV A;  3IC4 A;  1ERW A;  2H1A A;  2D2Z A;  3EIN A;  4Q5N A;  1XVW A;  1QFN A;  18GS A;  3Q74 A;  2DBC A;  1N8J A;  2GDR A;  4GTU A;  2OE0 A;  5J3R A;  1T4Y A;  3KJY A;  4BVY A;  1WMJ A;  2YJH A;  4HJ2 A;  1GLP A;  1V2A A;  5GAN D;  5J5N A;  3KMO A;  2MMN A;  3IOS A;  2HFD A;  1GSS A;  5HR3 A;  2GZZ A;  2WFC A;  2P5R A;  1HNC A;  1BED A;  2O89 A;  3FW2 A;  3CSJ A;  1ON4 A;  1GTA A;  1GTB A;  1O8X A;  4IQ1 A;  3IBH A;  1VRS D;  2HSH A;  1A2M A;  2PWJ A;  2R2J A;  2CAI A;  1EV4 A;  2VL2 A;  2IJY A;  2HT9 A;  4PNG A;  2H1D A;  2H74 A;  5ELA A;  4F82 A;  1VF4 A;  4V1A p;  5IMA A;  1R26 A;  1ZCP A;  1AQW A;  1XFL A;  5DAK A;  3KCM A;  4MH3 A;  2VIM A;  1MDI A;  1GNW A; 
#chains in the Genus database with same CATH topology
 4EIQ A;  4GRF A;  1TTZ A;  4AJ8 A;  2LV3 A;  1TI1 A;  3TKP A;  2B5X A;  2JAC A;  4HU9 A;  3ZVJ A;  1J0F A;  1K3L A;  2GSQ A;  1GRX A;  2DIZ A;  2YP6 A;  2X49 A;  4MPG A;  4WET A;  3I43 A;  3D6I A;  3EPT A;  1T3B A;  5ECS A;  3CYN A;  1TP9 A;  2L6C A;  3M9K A;  4MMM A;  3GSS A;  3A2X A;  4HOJ A;  3W8J A;  2WB9 A;  2VCZ A;  5ECQ B;  1USB A;  1EZK A;  2MMZ A;  5CRG A;  2JZS A;  3UBK A;  2MMO A;  2A2S A;  2VL3 A;  3KIJ A;  2DJ0 A;  4KE3 A;  1KEB A;  3CXG A;  5DDL A;  2P31 A;  4L5O A;  1TU7 A;  3ME8 A;  3HD5 A;  3MIX A;  2H76 A;  1J08 A;  3G7J A;  3O3T A;  1TK5 B;  4N30 A;  2RM6 A;  2C80 A;  1Z6N A;  3HZ8 A;  1KNG A;  2EIR A;  4G2E A;  3P7X A;  1GTU A;  2V6O A;  5IQY A;  2NBS A;  3G9B A;  1I9D A;  4EXJ A;  4MZC A;  4ZB9 A;  3APS A;  1SU9 A;  1Z7P A;  1OAZ A;  5KOX A;  2YCD A;  1DE2 A;  4L5L A;  3KTL A;  5IMV A;  4MJA A;  3IPZ A;  3TJG A;  2R0G A;  2M80 A;  3GIX A;  4IP1 A;  2CVK A;  2LNS A;  3DVX A;  2L5O A;  1UVZ A;  2H6Z A;  3ED3 A;  1FG4 A;  3GA4 A;  2VD1 A;  3Q18 A;  1V40 A;  4GF0 A;  3GNJ A;  4ZXG A;  3A2W A;  6GST A;  1A2J A;  1GSY A;  1YF0 A;  1V9W A;  2CVB A;  3ME7 A;  1U6T A;  5KOW A;  4X43 A;  5DCH A;  4YKG A;  2H1G A;  5CYY A;  3EUR A;  3TJB A;  4OMV A;  2G0F A;  1A24 A;  3LYP A;  1Y6E A;  3ERW A;  4J2F A;  2R4V A;  1Q4J A;  3EU3 A;  3GKM A;  4E8E A;  1OC9 B;  4EL1 A;  3ZFB A;  6GSX A;  1EOG A;  3HJO A;  3LGC A;  3KZQ A;  5IIZ A;  4WR5 A;  2HXK A;  4YAP A;  2H71 A;  3H79 A;  2GZP A;  3H93 A;  1PFO A;  1K0M A;  6GSS A;  5JWO B;  3ISO A;  4DVC A;  2LRC A;  4IGJ A;  3GHA A;  1JZO A;  2VLT A;  5A4U A;  3LXZ A;  2AJQ B;  2ZNM A;  3D22 A;  3FHK A;  2R5G A;  2IWT A;  2B1L A;  4F2I A;  2H0H A;  2HZE A;  1Z5Y E;  4LL4 B;  4NXI A;  1Z6M A;  1YJ6 A;  2WJU A;  1XW9 A;  1TXX A;  3O6T A;  3QPM A;  4F0B A;  4AF2 A;  3TKS A;  2MYG A;  1OE8 A;  1PX6 A;  2GS3 A;  2WDU A;  2I4A A;  1LJR A;  4TR4 A;  2UZ8 A;  2XC2 A;  3C71 A;  5G2Z A;  3DGQ A;  1U3I A;  4TXV A;  2N5F A;  2DSA A;  1AC1 A;  2YOI A;  3A5I A;  3N9J A;  3TOT A;  1PSQ A;  2QGV A;  1K0C A;  5IMZ A;  3VPT A;  3VWU A;  1KTE A;  2CZ2 A;  3PR8 A;  3RBT A;  3LW9 A;  4TN8 A;  5F0G A;  2MMA A;  3C1S A;  2PN8 A;  3MWH A;  5DQS A;  2WZ9 A;  3GKN A;  3IR4 A;  2WCI A;  3UVH A;  3FZA A;  5D93 A;  3IK9 A;  3A3T A;  4P3Y B;  4I2T A;  6GSV A;  1AAZ A;  1XWA A;  4E8H A;  5ECR B;  1M7T A;  1TU8 A;  1Z3E A;  1C72 A;  4DSS B;  3O76 A;  3IRA A;  2YV9 A;  4ZL9 A;  4HEA 2;  1FO5 A;  3F6D A;  1ZL9 A;  1GL8 A;  4TR3 A;  1JFU A;  1JZW A;  4ZIJ A;  1SD8 A;  3DXB A;  1G6Y A;  3U5R E;  1U87 A;  1MDJ A;  1ZOF A;  2VL9 A;  2WUL A;  4FYC A;  1S3D A;  1SKW B;  2VD0 A;  4KSO A;  3ERG A;  1CQG A;  2FY6 A;  1HD2 A;  5G5E A;  2IME A;  4HSC X;  1TDI A;  4NMU A;  1EWX A;  2IFQ B;  3DWV A;  2V41 A;  1OYJ A;  3HKR A;  4GCI A;  3HYP A;  4PNF A;  4GSN A;  2C1Y A;  4POK A;  5IOW A;  4OWY A;  2C0F A;  4MCU A;  2B7J A;  3BBY A;  1UC7 A;  2BJX A;  1PL1 A;  4MP4 A;  4AJ6 A;  1EGO A;  3GKX A;  5ID2 B;  3HXS A;  2F9S A;  4NHZ A;  1JLW A;  1SK0 A;  3CSH A;  5F07 A;  2QSI A;  1TJD A;  5HR1 A;  5IMC A;  8GSS A;  2FA4 A;  2RLI A;  1M2B A;  4FYB A;  5ECL B;  1M9A A;  1YZX A;  4USS A;  2P5Q A;  4TR0 A;  4RI7 A;  3TKS E;  4N11 A;  1XIY A;  2E2G A;  1BAY A;  1FAA A;  3IDV A;  3TOU A;  1XVQ A;  4Z2T A;  2V2G A;  1B8X A;  1A0R P;  2K8V A;  3ZIT A;  3VPQ A;  2OBI A;  3EWL A;  3GL3 A;  1M3I A;  4YH2 A;  1ZGN A;  2XBQ A;  3PIN A;  3QAW A;  4OO5 A;  3W8S A;  2DKI A;  2OAC A;  3KXO A;  4BWQ A;  2VCX A;  3HJP A;  5CRH A;  1K0D A;  5G5F A;  5KN3 A;  4IQA A;  1R4W A;  4K0N A;  5G1L A;  4K8M A;  1XBS A;  1ZYE A;  3ZTL A;  1F9M A;  1B9Y C;  1YDK A;  3M1G A;  4OFM A;  2HE3 A;  1M2D A;  3UEM A;  2VCT A;  5J9B A;  17GS A;  1TW9 A;  1WP0 A;  5B6N A;  2C3Q A;  5LNK e;  2AV4 A;  3WD6 A;  1UA5 A;  4HJM A;  4XS6 A;  1XZO A;  5AIS A;  3G7I A;  2H6X A;  2LS5 A;  3HZ4 A;  3TRP A;  4OFN A;  3F4S A;  4YQU A;  2FGX A;  2I1U A;  5CP1 A;  13GS A;  3M9J A;  4RQX A;  4K0G A;  3BOA A;  2KHP A;  4FH8 A;  5BMU A;  3VWV A;  1GP1 A;  1SJZ A;  1K0B A;  1SL0 B;  5HR2 A;  5H5Q A;  5KEJ A;  3Q6O A;  1OC8 A;  1BX9 A;  1GLQ A;  5AIX A;  4ISD A;  4ZBA A;  1GSU A;  3DYR A;  1S3C A;  2V32 A;  2H0I A;  2GQL A;  5ECK B;  3UOM A;  5J4U A;  1PN0 A;  2VM2 A;  4TXO B;  4EO3 A;  3GST A;  2BMX A;  4EKZ A;  3TJK A;  4RQR A;  1YQ1 A;  4JED A;  2I3Y A;  1EV9 A;  3P90 A;  4V2L A;  4Z2U A;  3DRN A;  4D73 A;  3H1N A;  2XHF A;  1SYX A;  4JZQ A;  3GUS A;  3F3Q A;  2M46 A;  1DUG A;  5GSS A;  2H72 A;  4EIP A;  3UL3 A;  2P0G A;  1SD9 A;  1GSQ A;  4GST A;  5D9W A;  1R5A A;  4JU5 A;  3C7M A;  2L59 A;  4ZL8 A;  4IJI A;  1THX A;  5HFG A;  3TRX A;  5A5K A;  1AIU A;  1BG5 A;  4I97 A;  2PER A;  3ZL5 A;  4JR6 A;  1ZYN A;  3L9U A;  1W89 A;  3IAM 2;  4KB3 A;  3VLN A;  4JRR A;  1EP8 A;  4X4J A;  4N10 A;  4XTS A;  2H6Y A;  5DJL A;  2DJ2 A;  4MLY A;  3VK9 A;  3DEX A;  4TVE A;  1XW5 A;  3UJ1 A;  3TKS C;  4G19 A;  1NHY A;  3SWL A;  2A4H A;  1M99 A;  1R7H A;  4L0U A;  4GQC A;  1CQH A;  4MA9 A;  2X99 A;  2AYT A;  4IBP A;  2V1M A;  4GWR A;  4XS4 B;  3HA9 A;  4N0V A;  4K5S A;  2K9F A;  2H73 A;  5C04 A;  4PUF C;  3RAZ A;  2I81 A;  4F03 A;  4WF5 A;  5HQP A;  1WE0 A;  1O85 A;  4ML6 A;  2LEG A;  5CAX A;  2GTU A;  3VWX A;  4POM A;  4K7N A;  2R6K A;  4WR4 A;  1GUL A;  1A0F A;  2YWM A;  1ZYQ B;  1GWC A;  3FR3 A;  2A4V A;  4ICY A;  4ZB6 A;  4O92 A;  4JR4 A;  2EIQ A;  1WJK A;  1G0T A;  2IPA A;  5J41 A;  3BD2 A;  3L0H A;  2MBS A;  3W6G A;  2DJ1 A;  4TR1 B;  5H5R A;  5D9V A;  2L4C A;  2CAQ A;  3GH9 A;  2XBI A;  3APO A;  3CBU A;  4K9Z A;  5FWG A;  1VF1 A;  4GXZ A;  6GSY A;  2C0D A;  5DCG A;  5E59 A;  2LRN A;  1U88 A;  1X0R A;  4A5P A;  1X9M B;  4PUR A;  1VF3 A;  2KLX A;  5B8B A;  1FB6 A;  5A4W A;  1A8L A;  4BVY B;  4BVX A;  3EMP A;  5L71 A;  4IS0 A;  3ZZX A;  4MNN A;  3IK7 A;  2LQQ A;  4PXO A;  1K0N A;  2VAF A;  4V1A g;  5CRD A;  4XHM A;  4FYU A;  3SBC A;  3CMI A;  2QKE A;  3FZ5 A;  3QMX A;  3KM6 A;  3GTU A;  3L78 A;  2YV7 A;  4GQF A;  1B9X C;  5E4W A;  1EOH A;  3WT2 A;  5CRE A;  3IHG A;  3R2Q A;  2H30 A;  3F4R A;  1VGL A;  4EE0 A;  3HJM A;  1PX7 A;  3EE2 A;  3A2V A;  4BIK A;  1QUW A;  2OE3 A;  3TDG A;  5KN2 A;  3N5O A;  1M9B A;  3HDC A;  3CTF A;  2HI7 A;  3CTG A;  4G0L A;  4KX4 A;  3K8N A;  2GSR A;  5DAL A;  4X1U A;  3F0I A;  4I6X A;  1V98 A;  3DML A;  5DAK B;  4WBJ A;  1R5P A;  1GTI A;  3F63 A;  4MJB A;  1QK8 A;  4Q5F A;  2O87 A;  1MEK A;  3MAK A;  1I5G A;  2QC7 A;  1Q98 A;  3CQF A;  5GST A;  2B5E A;  1Y25 A;  2GST A;  3VWW A;  1O73 A;  2C0G A;  2ON7 A;  2VOC A;  2IN3 A;  1F37 A;  4YKF A;  5G1K A;  1XWK A;  3LSZ A;  2JAD A;  2X8G A;  3G7Y A;  1FHE A;  2DKH A;  4PTS A;  19GS A;  4WKW A;  1FW1 A;  1VF2 A;  1NW2 A;  4KAE A;  4X0X A;  5ELG A;  3TKR A;  3BCI A;  3WT1 A;  3FR6 A;  4MZB A;  2YNX A;  3FY7 A;  4MH2 A;  2VLU A;  2B1K A;  2CX3 A;  4I8B A;  4K7O A;  1QGV A;  4ILF A;  4TW5 A;  2FUG 2;  2CVD A;  3C73 A;  1AQX A;  3DKS A;  2ALB A;  4CDO A;  4EDY A;  3FZ4 A;  3HCZ A;  1A2L A;  5LD0 A;  1T7P B;  4O5U A;  1O7U A;  3EYT A;  1K3O A;  4G10 A;  2R3X A;  4QL9 A;  5JCW A;  2BTO T;  2FHE A;  4YAV A;  4MF6 A;  2I9H A;  3TUE A;  2WS2 A;  5COH A;  2E7P A;  1GH2 A;  3D5J A;  1TRV A;  1AUC A;  3DD3 A;  5G31 A;  1M0U A;  4DSR A;  4PQH A;  3C1R A;  2F3M A;  3GKK A;  2LNT A;  2F8F A;  4TRX A;  5EY6 A;  3WGE A;  3UBL A;  1AXD A;  3CRT A;  2H66 A;  4OO4 A;  3FRC A;  4EF0 A;  4KW6 A;  3BCK A;  2FWH A;  5IM9 A;  3D0Z A;  3QDN A;  2GSS A;  4G9H A;  1DSB A;  3APQ A;  1ACV A;  1O81 A;  3M3M A;  5HFK A;  4TOP A;  4KA0 A;  1YF1 A;  2TRC P;  1XWB A;  1MDK A;  5B7C A;  1MD4 A;  2CZ3 A;  1PGT A;  3RHB A;  3US3 A;  2AHE A;  2LJK A;  2REM A;  3LJR A;  3UAP A;  4K5R A;  6GSW A;  5D8I A;  3ZRD A;  12GS A;  3EMX A;  3FYG A;  4DSQ A;  4IJ3 A;  5HFI A;  1DBY A;  3F3R A;  5ENU A;  4AJ7 A;  4I2U A;  4NAX A;  4KF9 A;  3UMA A;  1IYI A;  1JZD A;  2HYX A;  1M3J A;  3ZRE A;  1SEN A;  4POL A;  4BPY A;  2H75 A;  6GSU A;  1GSE A;  1TRW A;  3HY2 A;  1XWG A;  3OR5 A;  3E0U A;  3LFL A;  14GS A;  5IO0 A;  2M72 A;  2DML A;  1O8W A;  3GL5 A;  4KH7 A;  4F9Z A;  3NZN A;  1RQM A;  3GV1 A;  2JSZ A;  4Q5Q A;  5H5S A;  2HRN A;  4CY6 A;  4NV2 A;  2HZE B;  5B6M A;  3TGZ A;  4EUY A;  3UVT A;  1K3Y A;  4ZL7 A;  4ECC A;  2IIY A;  2AUV A;  5ECN B;  3EVI A;  1NSW A;  5IMF A;  5DBQ A;  3UAR A;  2LKU A;  3D4M A;  2DJ3 A;  1HQO A;  3QR6 A;  4HS1 A;  3AY8 A;  2GGT A;  1U3A A;  3RDW A;  4J57 E;  4ZBD A;  1WIK A;  4ECB A;  2B6M A;  1Z9H A;  3PH9 A;  4K2X A;  3ZLP A;  4JE1 A;  1E6B A;  4IW9 A;  2OBK A;  3RPP A;  2X8H A;  2GLR A;  1A23 A;  3C8E A;  4IEL A;  1SK1 A;  1B4Q A;  2IMF A;  2GQM A;  2FNO A;  1S3A A;  2JU5 A;  2NPB A;  4O5Q A;  2NDO A;  2GZY A;  3LYK A;  2HRK A;  4WXT A;  4LL1 B;  3ZMK A;  4XRA A;  2IMD A;  3IHQ A;  3QAV A;  5D9T A;  7GSS A;  1OKD A;  5DJM A;  2PVO C;  3H8Q A;  4MF5 A;  5IOX A;  3KMN A;  1XCC A;  3ZML A;  4LLR A;  2TRX A;  3ZFL A;  2GQK A;  3MDK A;  1EGR A;  2MBT A;  5LCZ A;  4PUA A;  2DC5 A;  5ABR A;  2CX4 A;  2O85 A;  1XG8 A;  4F0C A;  2FLS A;  3J7Y b;  3UIW A;  1LBK A;  1NHO A;  2H19 A;  3HVV A;  4PGT A;  2PBJ A;  5BRT A;  3TCO A;  2C8U A;  3HVS A;  3F9U A;  5D73 A;  5IPG A;  2OE1 A;  4PX1 A;  2EIO A;  5EVO A;  4LMW A;  1J9B A;  4WF4 A;  2K8S A;  2C3T A;  2E2M A;  3MSZ A;  1BYE A;  4ML1 A;  3TJF A;  1X5E A;  4MPF A;  2HNL A;  2YWN A;  3GX0 A;  4MDC A;  9GSS A;  4K6X A;  2LQO A;  3GN3 A;  2WRT A;  1YKA A;  3QCP A;  2OA7 A;  2WGR A;  11GS A;  4YQV A;  1XWC A;  3IAS 2;  2ES7 A;  4POB A;  4ULX A;  2DJK A;  4CHS A;  3IXR A;  3KP8 A;  3KH7 A;  3WGD A;  3QOU A;  2HRA A;  3LG6 A;  5CO3 A;  1GUK A;  2L4Q A;  1RK4 A;  1AQV A;  1G6W A;  1GUM A;  1HNA A;  3FZ9 A;  2B5Y A;  1T4Z A;  4BL7 B;  1ZYP A;  4Z7X A;  2QA2 A;  4O5R A;  4NV5 A;  4MF7 A;  2X64 A;  2H8L A;  3KGK A;  4V2N A;  2OAD A;  4CW9 A;  3L9S A;  1FB0 A;  2FCH A;  3WGX A;  4QQ7 A;  3I69 A;  16GS A;  3LXT A;  2VO4 A;  2KOK A;  3FKF A;  3GX8 A;  4V2M A;  5J9C A;  3P8W A;  4FO5 A;  2YWO A;  2H0G A;  2XPE A;  3LQ7 A;  3ZVJ D;  4HZ2 A;  4ZBB A;  5ECH B;  1OC9 A;  5JCU A;  2HSY A;  1XPV A;  2J9H A;  2FWG A;  1ML6 A;  1OVN A;  5DQY A;  1OE7 A;  5JWQ B;  1GUH A;  4L8E A;  1MTC A;  3KTB A;  2O8V B;  4H86 A;  3KD0 A;  5ECP B;  3D4T A;  1SJI A;  2PVQ A;  3LEF A;  2B3S A;  2GT5 A;  4HQZ A;  1YEP A;  2PU9 C;  1SKS B;  2PUK C;  1UN2 A;  1SKR B;  1F3A A;  4IP6 A;  1TRS A;  5INY A;  1EEM A;  5JWR B;  3E3E A;  1GSD A;  2X8C A;  1SK2 A;  3GYK A;  2H01 A;  1G7E A;  1GSF A;  3NOF A;  1FVK A;  2RII A;  4WBR D;  2OJL A;  3JCM L;  2YZU A;  1PKZ A;  4XIH A;  5ECI B;  3HHV A;  3L9V A;  2TIR A;  1H75 A;  4ECJ A;  22GS A;  1PD2 1;  4KSM A;  5ECM B;  1JHB A;  3VUR A;  2EC4 A;  4OCF A;  1XOB A;  1AW9 A;  2KP1 A;  1PN9 A;  1ERU A;  2VCV A;  2C4J A;  2N5B A;  4D73 B;  3QD9 A;  1WOU A;  1SL2 B;  1QXH A;  2R0P A;  2VUP A;  4Q5R A;  4PQI A;  1E2Y A;  4KND A;  3ZYW A;  2CV4 A;  2MZC A;  2F8A A;  4K2D A;  2QA1 A;  1O6J A;  4IKH A;  3S9F A;  2PGT A;  3TRQ A;  4IN0 A;  1YEX A;  2GT6 A;  3MYD A;  5F05 A;  4DSS A;  2FD3 A;  4FIW A;  4IHU A;  3TKQ A;  4XCS A;  1THO A;  1YY7 A;  2L57 A;  2VM1 A;  1XW6 A;  3GMF A;  1JZR A;  1LU4 A;  3TJJ A;  2R37 A;  3VFI A;  2F51 A;  5FT3 A;  5IO2 A;  4EVM A;  3PGT A;  3HVX A;  2V6K A;  1X5C A;  2IMI A;  4I5Q A;  5A4V A;  2HRF A;  3KH9 A;  1TRU A;  1MD3 A;  5KN0 A;  4HU7 A;  2YWI A;  1XOA A;  4QL7 A;  4HQS A;  3CSI A;  4MAB A;  5F06 A;  5D9X A;  5D96 A;  2XPD A;  4MK3 A;  3CRU A;  1K0A A;  3VI5 A;  5ECO B;  3P2A A;  4ZB8 A;  3IE3 A;  2IFQ A;  1F6M C;  4TKY A;  1TKD B;  2YZH A;  4RUV A;  3RHC A;  1ILO A;  1YKC A;  4KDX A;  4EC0 A;  1BQ7 A;  2AAW A;  3PPU A;  3IA1 A;  1WWJ A;  2LJA A;  3KP9 A;  1PRX A;  2K6V A;  1QMV A;  2J23 A;  4XS1 A;  1W4V A;  1ZMA A;  4N0Z A;  3IV4 A;  3QAG A;  1TOF A;  2HZF A;  4KDY A;  5ID2 A;  1S3R A;  2PPT A;  2NTO A;  2JZR A;  3LOR A;  1ABA A;  2VCW A;  4O7H A;  3TB2 A;  1HNB A;  2RUF A;  1ERV A;  2LTK A;  2B7K A;  3IC8 A;  3MNG A;  3V1W A;  4LMV A;  2RUE A;  2AB6 A;  2KP2 A;  4ZIL A;  1TK0 B;  2KUC A;  3A5W A;  5C00 A;  1X5D A;  1H4O A;  2DMM A;  5EPF A;  3M8N A;  4BVX B;  4L0W A;  5AN1 A;  1T00 A;  5HR0 A;  4NPB A;  2N5A A;  4ACS A;  4J56 E;  1SJ6 A;  2ON5 A;  3H4K A;  5CRW A;  3J7Y k;  4Z2R A;  3KEB A;  4IVF A;  3I6A A;  3GTU B;  2NVL A;  5B8A A;  3QFA C;  4K1F A;  4BA7 A;  1XXU A;  5F8B A;  4YQM A;  4WEY A;  3WYW A;  2OKA A;  4K7I A;  1X9S B;  1F3B A;  1PKW A;  5IPH A;  1BJX A;  2G2Q A;  4ID0 A;  3FMW A;  2E0Q A;  3BJ5 A;  4LA1 A;  5FHI A;  1T1V A;  5G30 A;  1F2E A;  4HI7 A;  2YAN A;  2YPM A;  2H70 A;  1SYR A;  4HDE A;  1X9W B;  3R3E A;  3L4N A;  3I9V 2;  2C0E A;  4KCE A;  5DAL B;  1T8E B;  1JLV A;  1ST9 A;  2FWF A;  1URM A;  3DVW A;  2C3N A;  4RI6 A;  1RW1 A;  2ZUP A;  4HZ4 A;  2L5L A;  3GH6 A;  1G7O A;  1HYU A;  4OFT A;  2VL2 C;  4GSS A;  1TI3 A;  4AGS A;  4EDZ A;  1OKT A;  2HSM A;  3GRX A;  1EP7 A;  3EU4 A;  1IYH A;  3F6F A;  1ZZY A;  3M0F A;  2CT6 A;  4BWS A;  2RM5 A;  1DE1 A;  3HVN A;  4TXO A;  2ZCT A;  5AGY A;  1N2A A;  1V57 A;  2LUS A;  2GVP A;  4HUA A;  3FK8 A;  1V58 A;  1B48 A;  1ERT A;  4OCE A;  5GAP D;  2JZT A;  4MJE A;  1EEJ A;  1GNE A;  2FWE A;  1K0O A;  2IMK A;  4KUN A;  4OD7 A;  2H1B A;  5AIV A;  2VCQ A;  1QQ2 A;  5GZZ B;  2PMT A;  1M2A A;  2O7K A;  2A2P A;  3LWA A;  4BL7 A;  3Q19 A;  2L6D A;  3E9J B;  2JSY A;  5IMD A;  3ZIV A;  4KDU A;  1PA3 A;  3RPN A;  2K18 A;  3VI7 A;  3DIE A;  4DEJ A;  4MZW A;  1B4P A;  3FEU A;  2LST A;  2DIY A;  1KBN A;  4XRD A;  3EC3 A;  1FOH A;  3QFB C;  4KGI A;  1NM3 A;  4O32 A;  1Z7R A;  1FOV A;  4MJC A;  5JCG A;  4XS4 A;  3ZIJ A;  2CA8 A;  1WPI A;  4KCA A;  1A8Y A;  1WRY A;  20GS A;  3F8U A;  4PQ1 A;  5EL8 A;  3GUR A;  3FR9 A;  2A2R A;  5CNW A;  1PMT A;  1OC3 A;  3GFK A;  4NHW A;  3U6V A;  4NWY A;  2DJJ A;  2X4A A;  2LRT A;  4ECI A;  3ERF A;  2LJR A;  2Z9S A;  10GS A;  1PQN A;  1PL2 A;  4JBB A;  5DVB A;  3F4T A;  2HLS A;  3D21 A;  2YN1 A;  2DLX A;  2YJ7 A;  2CQ9 A;  4TR1 A;  5KN1 A;  2VLV A;  2FA8 A;  2IL3 A;  1FVJ A;  2JL4 A;  1TK8 B;  1SL1 B;  4GLT A;  3NIV A;  3IC4 A;  1ERW A;  2H1A A;  2D2Z A;  3EIN A;  4Q5N A;  1XVW A;  1QFN A;  18GS A;  3Q74 A;  2DBC A;  1N8J A;  2GDR A;  4GTU A;  2OE0 A;  5J3R A;  1T4Y A;  3KJY A;  4G0K A;  4BVY A;  1WMJ A;  2YJH A;  4HJ2 A;  1GLP A;  1V2A A;  5GAN D;  5J5N A;  3KMO A;  2MMN A;  3IOS A;  2HFD A;  1GSS A;  5HR3 A;  2GZZ A;  2WFC A;  2P5R A;  1HNC A;  1BED A;  2O89 A;  3FW2 A;  3CSJ A;  1ON4 A;  1GTA A;  4CY8 A;  1GTB A;  1O8X A;  4IQ1 A;  3IBH A;  1VRS D;  2HSH A;  4G0I A;  1A2M A;  2PWJ A;  2R2J A;  2CAI A;  1EV4 A;  2VL2 A;  2IJY A;  4FQU A;  2HT9 A;  4PNG A;  2H1D A;  2R0C A;  2H74 A;  5ELA A;  4F82 A;  1VF4 A;  4V1A p;  5IMA A;  1R26 A;  1ZCP A;  1AQW A;  1XFL A;  5DAK A;  3KCM A;  4MH3 A;  2VIM A;  1MDI A;  1GNW A; 
#chains in the Genus database with same CATH homology
 4EIQ A;  4GRF A;  1TTZ A;  4AJ8 A;  2LV3 A;  1TI1 A;  3TKP A;  2B5X A;  2JAC A;  4HU9 A;  3ZVJ A;  1J0F A;  1K3L A;  2GSQ A;  1GRX A;  2DIZ A;  2YP6 A;  2X49 A;  4MPG A;  4WET A;  3I43 A;  3D6I A;  3EPT A;  1T3B A;  5ECS A;  3CYN A;  1TP9 A;  2L6C A;  3M9K A;  4MMM A;  3GSS A;  3A2X A;  4HOJ A;  3W8J A;  2WB9 A;  2VCZ A;  5ECQ B;  1USB A;  1EZK A;  2MMZ A;  5CRG A;  2JZS A;  3UBK A;  2MMO A;  2A2S A;  2VL3 A;  3KIJ A;  2DJ0 A;  4KE3 A;  1KEB A;  3CXG A;  5DDL A;  2P31 A;  4L5O A;  1TU7 A;  3ME8 A;  3HD5 A;  3MIX A;  2H76 A;  1J08 A;  3G7J A;  3O3T A;  1TK5 B;  4N30 A;  2RM6 A;  2C80 A;  1Z6N A;  3HZ8 A;  1KNG A;  2EIR A;  4G2E A;  3P7X A;  1GTU A;  2V6O A;  5IQY A;  2NBS A;  3G9B A;  1I9D A;  4EXJ A;  4MZC A;  4ZB9 A;  3APS A;  1SU9 A;  1Z7P A;  1OAZ A;  5KOX A;  2YCD A;  1DE2 A;  4L5L A;  3KTL A;  5IMV A;  4MJA A;  3IPZ A;  3TJG A;  2R0G A;  2M80 A;  3GIX A;  4IP1 A;  2CVK A;  2LNS A;  3DVX A;  2L5O A;  1UVZ A;  2H6Z A;  3ED3 A;  1FG4 A;  3GA4 A;  2VD1 A;  3Q18 A;  1V40 A;  4GF0 A;  3GNJ A;  4ZXG A;  3A2W A;  6GST A;  1A2J A;  1GSY A;  1YF0 A;  1V9W A;  2CVB A;  3ME7 A;  1U6T A;  5KOW A;  4X43 A;  5DCH A;  4YKG A;  2H1G A;  5CYY A;  3EUR A;  3TJB A;  4OMV A;  2G0F A;  1A24 A;  3LYP A;  1Y6E A;  3ERW A;  4J2F A;  2R4V A;  1Q4J A;  3EU3 A;  3GKM A;  4E8E A;  1OC9 B;  4EL1 A;  3ZFB A;  6GSX A;  1EOG A;  3HJO A;  3LGC A;  3KZQ A;  5IIZ A;  4WR5 A;  2HXK A;  4YAP A;  2H71 A;  3H79 A;  2GZP A;  3H93 A;  1K0M A;  6GSS A;  5JWO B;  3ISO A;  4DVC A;  2LRC A;  4IGJ A;  3GHA A;  1JZO A;  2VLT A;  5A4U A;  3LXZ A;  2AJQ B;  2ZNM A;  3D22 A;  3FHK A;  2R5G A;  2IWT A;  2B1L A;  4F2I A;  2H0H A;  2HZE A;  1Z5Y E;  4LL4 B;  4NXI A;  1Z6M A;  1YJ6 A;  2WJU A;  1XW9 A;  1TXX A;  3O6T A;  3QPM A;  4F0B A;  4AF2 A;  3TKS A;  2MYG A;  1OE8 A;  1PX6 A;  2GS3 A;  2WDU A;  2I4A A;  1LJR A;  4TR4 A;  2UZ8 A;  2XC2 A;  3C71 A;  5G2Z A;  3DGQ A;  1U3I A;  4TXV A;  2N5F A;  2DSA A;  1AC1 A;  2YOI A;  3A5I A;  3N9J A;  3TOT A;  1PSQ A;  2QGV A;  1K0C A;  5IMZ A;  3VPT A;  3VWU A;  1KTE A;  2CZ2 A;  3PR8 A;  3RBT A;  3LW9 A;  4TN8 A;  5F0G A;  2MMA A;  3C1S A;  2PN8 A;  3MWH A;  5DQS A;  2WZ9 A;  3GKN A;  3IR4 A;  2WCI A;  3UVH A;  3FZA A;  5D93 A;  3IK9 A;  3A3T A;  4P3Y B;  4I2T A;  6GSV A;  1AAZ A;  1XWA A;  4E8H A;  5ECR B;  1M7T A;  1TU8 A;  1Z3E A;  1C72 A;  4DSS B;  3O76 A;  3IRA A;  2YV9 A;  4ZL9 A;  4HEA 2;  1FO5 A;  3F6D A;  1ZL9 A;  1GL8 A;  4TR3 A;  1JFU A;  1JZW A;  4ZIJ A;  1SD8 A;  3DXB A;  1G6Y A;  3U5R E;  1U87 A;  1MDJ A;  1ZOF A;  2VL9 A;  2WUL A;  4FYC A;  1S3D A;  1SKW B;  2VD0 A;  4KSO A;  3ERG A;  1CQG A;  2FY6 A;  1HD2 A;  5G5E A;  2IME A;  1TDI A;  4NMU A;  1EWX A;  2IFQ B;  3DWV A;  2V41 A;  1OYJ A;  3HKR A;  4GCI A;  3HYP A;  4PNF A;  4GSN A;  2C1Y A;  4POK A;  5IOW A;  4OWY A;  2C0F A;  4MCU A;  2B7J A;  3BBY A;  1UC7 A;  2BJX A;  1PL1 A;  4MP4 A;  4AJ6 A;  1EGO A;  3GKX A;  5ID2 B;  3HXS A;  2F9S A;  4NHZ A;  1JLW A;  1SK0 A;  3CSH A;  5F07 A;  2QSI A;  1TJD A;  5HR1 A;  5IMC A;  8GSS A;  2FA4 A;  2RLI A;  1M2B A;  4FYB A;  5ECL B;  1M9A A;  1YZX A;  4USS A;  2P5Q A;  4TR0 A;  4RI7 A;  3TKS E;  4N11 A;  1XIY A;  2E2G A;  1BAY A;  1FAA A;  3IDV A;  3TOU A;  1XVQ A;  4Z2T A;  2V2G A;  1B8X A;  1A0R P;  2K8V A;  3ZIT A;  3VPQ A;  2OBI A;  3EWL A;  3GL3 A;  4YH2 A;  1ZGN A;  2XBQ A;  3PIN A;  3QAW A;  4OO5 A;  3W8S A;  2DKI A;  2OAC A;  3KXO A;  4BWQ A;  2VCX A;  3HJP A;  5CRH A;  1K0D A;  5G5F A;  5KN3 A;  4IQA A;  1R4W A;  4K0N A;  5G1L A;  4K8M A;  1XBS A;  1ZYE A;  3ZTL A;  1F9M A;  1B9Y C;  1YDK A;  3M1G A;  4OFM A;  2HE3 A;  1M2D A;  3UEM A;  2VCT A;  5J9B A;  17GS A;  1TW9 A;  1WP0 A;  5B6N A;  2C3Q A;  5LNK e;  2AV4 A;  3WD6 A;  1UA5 A;  4HJM A;  4XS6 A;  1XZO A;  5AIS A;  3G7I A;  2H6X A;  2LS5 A;  3HZ4 A;  3TRP A;  4OFN A;  3F4S A;  4YQU A;  2FGX A;  2I1U A;  5CP1 A;  13GS A;  3M9J A;  4RQX A;  4K0G A;  3BOA A;  2KHP A;  4FH8 A;  5BMU A;  3VWV A;  1GP1 A;  1SJZ A;  1K0B A;  1SL0 B;  5HR2 A;  5H5Q A;  5KEJ A;  3Q6O A;  1OC8 A;  1BX9 A;  1GLQ A;  5AIX A;  4ISD A;  4ZBA A;  1GSU A;  3DYR A;  1S3C A;  2V32 A;  2H0I A;  2GQL A;  5ECK B;  3UOM A;  5J4U A;  1PN0 A;  2VM2 A;  4TXO B;  4EO3 A;  3GST A;  2BMX A;  4EKZ A;  3TJK A;  4RQR A;  1YQ1 A;  4JED A;  2I3Y A;  1EV9 A;  3P90 A;  4V2L A;  4Z2U A;  3DRN A;  4D73 A;  3H1N A;  2XHF A;  1SYX A;  4JZQ A;  3GUS A;  3F3Q A;  2M46 A;  1DUG A;  5GSS A;  2H72 A;  4EIP A;  3UL3 A;  2P0G A;  1SD9 A;  1GSQ A;  4GST A;  5D9W A;  1R5A A;  4JU5 A;  3C7M A;  2L59 A;  4ZL8 A;  4IJI A;  1THX A;  5HFG A;  3TRX A;  5A5K A;  1AIU A;  1BG5 A;  4I97 A;  2PER A;  3ZL5 A;  4JR6 A;  1ZYN A;  3L9U A;  1W89 A;  3IAM 2;  4KB3 A;  3VLN A;  4JRR A;  1EP8 A;  4X4J A;  4N10 A;  4XTS A;  2H6Y A;  5DJL A;  2DJ2 A;  4MLY A;  3VK9 A;  3DEX A;  4TVE A;  1XW5 A;  3UJ1 A;  3TKS C;  4G19 A;  1NHY A;  3SWL A;  2A4H A;  1M99 A;  1R7H A;  4L0U A;  4GQC A;  1CQH A;  4MA9 A;  2X99 A;  2AYT A;  4IBP A;  2V1M A;  4GWR A;  4XS4 B;  3HA9 A;  4N0V A;  4K5S A;  2K9F A;  2H73 A;  5C04 A;  4PUF C;  3RAZ A;  2I81 A;  4F03 A;  4WF5 A;  5HQP A;  1WE0 A;  1O85 A;  4ML6 A;  2LEG A;  5CAX A;  2GTU A;  3VWX A;  4POM A;  4K7N A;  2R6K A;  4WR4 A;  1GUL A;  1A0F A;  2YWM A;  1ZYQ B;  1GWC A;  3FR3 A;  2A4V A;  4ICY A;  4ZB6 A;  4O92 A;  4JR4 A;  2EIQ A;  1WJK A;  1G0T A;  2IPA A;  5J41 A;  3BD2 A;  3L0H A;  2MBS A;  3W6G A;  2DJ1 A;  4TR1 B;  5H5R A;  5D9V A;  2L4C A;  2CAQ A;  3GH9 A;  2XBI A;  3APO A;  3CBU A;  4K9Z A;  5FWG A;  1VF1 A;  4GXZ A;  6GSY A;  2C0D A;  5DCG A;  5E59 A;  2LRN A;  1U88 A;  1X0R A;  4A5P A;  1X9M B;  4PUR A;  1VF3 A;  2KLX A;  5B8B A;  1FB6 A;  5A4W A;  1A8L A;  4BVY B;  4BVX A;  3EMP A;  5L71 A;  4IS0 A;  3ZZX A;  4MNN A;  3IK7 A;  2LQQ A;  4PXO A;  1K0N A;  2VAF A;  4V1A g;  5CRD A;  4XHM A;  4FYU A;  3SBC A;  3CMI A;  2QKE A;  3FZ5 A;  3QMX A;  3KM6 A;  3GTU A;  3L78 A;  2YV7 A;  4GQF A;  1B9X C;  5E4W A;  1EOH A;  3WT2 A;  5CRE A;  3IHG A;  3R2Q A;  2H30 A;  3F4R A;  1VGL A;  4EE0 A;  3HJM A;  1PX7 A;  3EE2 A;  3A2V A;  1QUW A;  2OE3 A;  3TDG A;  5KN2 A;  3N5O A;  1M9B A;  3HDC A;  3CTF A;  2HI7 A;  3CTG A;  4G0L A;  4KX4 A;  3K8N A;  2GSR A;  5DAL A;  4X1U A;  3F0I A;  4I6X A;  1V98 A;  3DML A;  5DAK B;  4WBJ A;  1R5P A;  1GTI A;  3F63 A;  4MJB A;  1QK8 A;  4Q5F A;  2O87 A;  1MEK A;  3MAK A;  1I5G A;  2QC7 A;  1Q98 A;  5GST A;  2B5E A;  1Y25 A;  2GST A;  3VWW A;  1O73 A;  2C0G A;  2ON7 A;  2VOC A;  2IN3 A;  1F37 A;  4YKF A;  5G1K A;  1XWK A;  3LSZ A;  2JAD A;  2X8G A;  3G7Y A;  1FHE A;  2DKH A;  4PTS A;  19GS A;  4WKW A;  1FW1 A;  1VF2 A;  1NW2 A;  4KAE A;  4X0X A;  5ELG A;  3TKR A;  3BCI A;  3WT1 A;  3FR6 A;  4MZB A;  2YNX A;  3FY7 A;  4MH2 A;  2VLU A;  2B1K A;  2CX3 A;  4I8B A;  4K7O A;  1QGV A;  4ILF A;  4TW5 A;  2FUG 2;  2CVD A;  3C73 A;  1AQX A;  3DKS A;  2ALB A;  4CDO A;  4EDY A;  3FZ4 A;  3HCZ A;  1A2L A;  5LD0 A;  1T7P B;  4O5U A;  1O7U A;  3EYT A;  1K3O A;  4G10 A;  2R3X A;  4QL9 A;  5JCW A;  2BTO T;  2FHE A;  4YAV A;  4MF6 A;  2I9H A;  3TUE A;  2WS2 A;  5COH A;  2E7P A;  1GH2 A;  3D5J A;  1TRV A;  1AUC A;  3DD3 A;  5G31 A;  1M0U A;  4DSR A;  4PQH A;  3C1R A;  2F3M A;  3GKK A;  2LNT A;  2F8F A;  4TRX A;  5EY6 A;  3WGE A;  3UBL A;  1AXD A;  3CRT A;  2H66 A;  4OO4 A;  3FRC A;  4EF0 A;  4KW6 A;  3BCK A;  2FWH A;  5IM9 A;  3D0Z A;  3QDN A;  2GSS A;  4G9H A;  1DSB A;  3APQ A;  1ACV A;  1O81 A;  3M3M A;  5HFK A;  4TOP A;  4KA0 A;  1YF1 A;  2TRC P;  1XWB A;  1MDK A;  5B7C A;  1MD4 A;  2CZ3 A;  1PGT A;  3RHB A;  3US3 A;  2AHE A;  2LJK A;  2REM A;  3LJR A;  3UAP A;  4K5R A;  6GSW A;  5D8I A;  3ZRD A;  12GS A;  3EMX A;  3FYG A;  4DSQ A;  4IJ3 A;  5HFI A;  1DBY A;  3F3R A;  5ENU A;  4AJ7 A;  4I2U A;  4NAX A;  4KF9 A;  3UMA A;  1IYI A;  1JZD A;  2HYX A;  3ZRE A;  1SEN A;  4POL A;  4BPY A;  2H75 A;  6GSU A;  1GSE A;  1TRW A;  3HY2 A;  1XWG A;  3OR5 A;  3E0U A;  3LFL A;  14GS A;  5IO0 A;  2M72 A;  2DML A;  1O8W A;  3GL5 A;  4KH7 A;  4F9Z A;  3NZN A;  1RQM A;  3GV1 A;  2JSZ A;  4Q5Q A;  5H5S A;  2HRN A;  4CY6 A;  4NV2 A;  2HZE B;  5B6M A;  3TGZ A;  4EUY A;  3UVT A;  1K3Y A;  4ZL7 A;  4ECC A;  2IIY A;  2AUV A;  5ECN B;  3EVI A;  1NSW A;  5IMF A;  5DBQ A;  3UAR A;  2LKU A;  3D4M A;  2DJ3 A;  1HQO A;  3QR6 A;  4HS1 A;  3AY8 A;  2GGT A;  1U3A A;  3RDW A;  4J57 E;  4ZBD A;  1WIK A;  4ECB A;  2B6M A;  1Z9H A;  3PH9 A;  4K2X A;  3ZLP A;  4JE1 A;  1E6B A;  4IW9 A;  2OBK A;  3RPP A;  2X8H A;  2GLR A;  1A23 A;  3C8E A;  4IEL A;  1SK1 A;  1B4Q A;  2IMF A;  2GQM A;  2FNO A;  1S3A A;  2JU5 A;  2NPB A;  4O5Q A;  2NDO A;  2GZY A;  3LYK A;  2HRK A;  4WXT A;  4LL1 B;  3ZMK A;  4XRA A;  2IMD A;  3IHQ A;  3QAV A;  5D9T A;  7GSS A;  1OKD A;  5DJM A;  2PVO C;  3H8Q A;  4MF5 A;  5IOX A;  3KMN A;  1XCC A;  3ZML A;  4LLR A;  2TRX A;  3ZFL A;  2GQK A;  3MDK A;  1EGR A;  2MBT A;  5LCZ A;  4PUA A;  2DC5 A;  5ABR A;  2CX4 A;  2O85 A;  4F0C A;  2FLS A;  3J7Y b;  3UIW A;  1LBK A;  1NHO A;  2H19 A;  3HVV A;  4PGT A;  2PBJ A;  5BRT A;  3TCO A;  2C8U A;  3HVS A;  3F9U A;  5D73 A;  5IPG A;  2OE1 A;  4PX1 A;  2EIO A;  5EVO A;  4LMW A;  1J9B A;  4WF4 A;  2K8S A;  2C3T A;  2E2M A;  3MSZ A;  1BYE A;  4ML1 A;  3TJF A;  1X5E A;  4MPF A;  2HNL A;  2YWN A;  3GX0 A;  4MDC A;  9GSS A;  4K6X A;  2LQO A;  3GN3 A;  2WRT A;  1YKA A;  3QCP A;  2OA7 A;  2WGR A;  11GS A;  4YQV A;  1XWC A;  3IAS 2;  2ES7 A;  4POB A;  4ULX A;  2DJK A;  4CHS A;  3IXR A;  3KP8 A;  3KH7 A;  3WGD A;  3QOU A;  2HRA A;  3LG6 A;  5CO3 A;  1GUK A;  2L4Q A;  1RK4 A;  1AQV A;  1G6W A;  1GUM A;  1HNA A;  3FZ9 A;  2B5Y A;  1T4Z A;  4BL7 B;  1ZYP A;  4Z7X A;  2QA2 A;  4O5R A;  4NV5 A;  4MF7 A;  2X64 A;  2H8L A;  3KGK A;  4V2N A;  2OAD A;  4CW9 A;  3L9S A;  1FB0 A;  2FCH A;  3WGX A;  4QQ7 A;  3I69 A;  16GS A;  3LXT A;  2VO4 A;  2KOK A;  3FKF A;  3GX8 A;  4V2M A;  5J9C A;  3P8W A;  4FO5 A;  2YWO A;  2H0G A;  2XPE A;  3LQ7 A;  3ZVJ D;  4HZ2 A;  4ZBB A;  5ECH B;  1OC9 A;  5JCU A;  2HSY A;  1XPV A;  2J9H A;  2FWG A;  1ML6 A;  1OVN A;  5DQY A;  1OE7 A;  5JWQ B;  1GUH A;  4L8E A;  1MTC A;  3KTB A;  2O8V B;  4H86 A;  3KD0 A;  5ECP B;  3D4T A;  1SJI A;  2PVQ A;  3LEF A;  2B3S A;  2GT5 A;  4HQZ A;  1YEP A;  2PU9 C;  1SKS B;  2PUK C;  1UN2 A;  1SKR B;  1F3A A;  4IP6 A;  1TRS A;  5INY A;  1EEM A;  5JWR B;  3E3E A;  1GSD A;  2X8C A;  1SK2 A;  3GYK A;  2H01 A;  1G7E A;  1GSF A;  3NOF A;  1FVK A;  2RII A;  4WBR D;  2OJL A;  3JCM L;  2YZU A;  1PKZ A;  4XIH A;  5ECI B;  3HHV A;  3L9V A;  2TIR A;  1H75 A;  4ECJ A;  22GS A;  1PD2 1;  4KSM A;  5ECM B;  1JHB A;  3VUR A;  2EC4 A;  4OCF A;  1XOB A;  1AW9 A;  2KP1 A;  1PN9 A;  1ERU A;  2VCV A;  2C4J A;  2N5B A;  4D73 B;  3QD9 A;  1WOU A;  1SL2 B;  1QXH A;  2R0P A;  2VUP A;  4Q5R A;  4PQI A;  1E2Y A;  4KND A;  3ZYW A;  2CV4 A;  2MZC A;  2F8A A;  4K2D A;  2QA1 A;  1O6J A;  4IKH A;  3S9F A;  2PGT A;  3TRQ A;  4IN0 A;  1YEX A;  2GT6 A;  3MYD A;  5F05 A;  4DSS A;  2FD3 A;  4FIW A;  4IHU A;  3TKQ A;  4XCS A;  1THO A;  1YY7 A;  2L57 A;  2VM1 A;  1XW6 A;  3GMF A;  1JZR A;  1LU4 A;  3TJJ A;  2R37 A;  3VFI A;  2F51 A;  5FT3 A;  5IO2 A;  4EVM A;  3PGT A;  3HVX A;  2V6K A;  1X5C A;  2IMI A;  4I5Q A;  5A4V A;  2HRF A;  3KH9 A;  1TRU A;  1MD3 A;  5KN0 A;  4HU7 A;  2YWI A;  1XOA A;  4QL7 A;  4HQS A;  3CSI A;  4MAB A;  5F06 A;  5D9X A;  5D96 A;  2XPD A;  4MK3 A;  3CRU A;  1K0A A;  3VI5 A;  5ECO B;  3P2A A;  4ZB8 A;  3IE3 A;  2IFQ A;  1F6M C;  4TKY A;  1TKD B;  2YZH A;  4RUV A;  3RHC A;  1ILO A;  1YKC A;  4KDX A;  4EC0 A;  1BQ7 A;  2AAW A;  3PPU A;  3IA1 A;  1WWJ A;  2LJA A;  3KP9 A;  1PRX A;  2K6V A;  1QMV A;  2J23 A;  4XS1 A;  1W4V A;  1ZMA A;  4N0Z A;  3IV4 A;  3QAG A;  1TOF A;  2HZF A;  4KDY A;  5ID2 A;  2PPT A;  2NTO A;  2JZR A;  3LOR A;  1ABA A;  2VCW A;  4O7H A;  3TB2 A;  1HNB A;  2RUF A;  1ERV A;  2LTK A;  2B7K A;  3IC8 A;  3MNG A;  3V1W A;  4LMV A;  2RUE A;  2AB6 A;  2KP2 A;  4ZIL A;  1TK0 B;  2KUC A;  3A5W A;  5C00 A;  1X5D A;  1H4O A;  2DMM A;  5EPF A;  3M8N A;  4BVX B;  4L0W A;  5AN1 A;  1T00 A;  5HR0 A;  4NPB A;  2N5A A;  4ACS A;  4J56 E;  1SJ6 A;  2ON5 A;  3H4K A;  5CRW A;  3J7Y k;  4Z2R A;  3KEB A;  4IVF A;  3I6A A;  3GTU B;  2NVL A;  5B8A A;  3QFA C;  4K1F A;  4BA7 A;  1XXU A;  5F8B A;  4YQM A;  4WEY A;  3WYW A;  2OKA A;  4K7I A;  1X9S B;  1F3B A;  1PKW A;  5IPH A;  1BJX A;  2G2Q A;  4ID0 A;  3FMW A;  2E0Q A;  3BJ5 A;  4LA1 A;  5FHI A;  1T1V A;  5G30 A;  1F2E A;  4HI7 A;  2YAN A;  2YPM A;  2H70 A;  1SYR A;  4HDE A;  1X9W B;  3R3E A;  3L4N A;  3I9V 2;  2C0E A;  4KCE A;  5DAL B;  1T8E B;  1JLV A;  1ST9 A;  2FWF A;  1URM A;  3DVW A;  2C3N A;  4RI6 A;  1RW1 A;  2ZUP A;  4HZ4 A;  2L5L A;  3GH6 A;  1G7O A;  1HYU A;  4OFT A;  2VL2 C;  4GSS A;  1TI3 A;  4AGS A;  4EDZ A;  1OKT A;  2HSM A;  3GRX A;  1EP7 A;  3EU4 A;  1IYH A;  3F6F A;  1ZZY A;  3M0F A;  2CT6 A;  4BWS A;  2RM5 A;  1DE1 A;  4TXO A;  2ZCT A;  5AGY A;  1N2A A;  1V57 A;  2LUS A;  2GVP A;  4HUA A;  3FK8 A;  1V58 A;  1B48 A;  1ERT A;  4OCE A;  5GAP D;  2JZT A;  4MJE A;  1EEJ A;  1GNE A;  2FWE A;  1K0O A;  2IMK A;  4KUN A;  4OD7 A;  2H1B A;  5AIV A;  2VCQ A;  1QQ2 A;  5GZZ B;  2PMT A;  1M2A A;  2O7K A;  2A2P A;  3LWA A;  4BL7 A;  3Q19 A;  2L6D A;  3E9J B;  2JSY A;  5IMD A;  3ZIV A;  4KDU A;  1PA3 A;  3RPN A;  2K18 A;  3VI7 A;  3DIE A;  4DEJ A;  4MZW A;  1B4P A;  3FEU A;  2LST A;  2DIY A;  1KBN A;  4XRD A;  3EC3 A;  1FOH A;  3QFB C;  4KGI A;  1NM3 A;  4O32 A;  1Z7R A;  1FOV A;  4MJC A;  5JCG A;  4XS4 A;  3ZIJ A;  2CA8 A;  1WPI A;  4KCA A;  1A8Y A;  1WRY A;  20GS A;  3F8U A;  4PQ1 A;  5EL8 A;  3GUR A;  3FR9 A;  2A2R A;  5CNW A;  1PMT A;  1OC3 A;  3GFK A;  4NHW A;  3U6V A;  4NWY A;  2DJJ A;  2X4A A;  2LRT A;  4ECI A;  3ERF A;  2LJR A;  2Z9S A;  10GS A;  1PQN A;  1PL2 A;  4JBB A;  5DVB A;  3F4T A;  2HLS A;  3D21 A;  2YN1 A;  2DLX A;  2YJ7 A;  2CQ9 A;  4TR1 A;  5KN1 A;  2VLV A;  2FA8 A;  2IL3 A;  1FVJ A;  2JL4 A;  1TK8 B;  1SL1 B;  4GLT A;  3NIV A;  3IC4 A;  1ERW A;  2H1A A;  2D2Z A;  3EIN A;  4Q5N A;  1XVW A;  1QFN A;  18GS A;  3Q74 A;  2DBC A;  1N8J A;  2GDR A;  4GTU A;  2OE0 A;  5J3R A;  1T4Y A;  3KJY A;  4G0K A;  4BVY A;  1WMJ A;  2YJH A;  4HJ2 A;  1GLP A;  1V2A A;  5GAN D;  5J5N A;  3KMO A;  2MMN A;  3IOS A;  2HFD A;  1GSS A;  5HR3 A;  2GZZ A;  2WFC A;  2P5R A;  1HNC A;  1BED A;  2O89 A;  3FW2 A;  3CSJ A;  1ON4 A;  1GTA A;  4CY8 A;  1GTB A;  1O8X A;  4IQ1 A;  3IBH A;  1VRS D;  2HSH A;  4G0I A;  1A2M A;  2PWJ A;  2R2J A;  2CAI A;  1EV4 A;  2VL2 A;  2IJY A;  4FQU A;  2HT9 A;  4PNG A;  2H1D A;  2R0C A;  2H74 A;  5ELA A;  4F82 A;  1VF4 A;  4V1A p;  5IMA A;  1R26 A;  1ZCP A;  1AQW A;  1XFL A;  5DAK A;  3KCM A;  4MH3 A;  2VIM A;  1MDI A;  1GNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...