2JSZA

Solution structure of tpx in the reduced state
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
167
Chain Sequence
MAEITFKGGPVTLVGQEVKVGDQAPDFTVLTNSLEEKSLADMKGKVTIISVIPSIDTGVCDAQTRRFNEEAAKLGDVNVYTISADLPFAQARWCGANGIDKVETLSDHRDMSFGEAFGVYIKELRLLARSVFVLDENGKVVYAEYVSEATNHPNYEKPIEAAKALVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable thiol peroxidase
publication title Reversible conformational switch revealed by the redox structures of Bacillus subtilis thiol peroxidase
pubmed doi rcsb
source organism Bacillus subtilis
total genus 47
structure length 167
sequence length 167
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2jszA00
2XBQA 1XW6A 2J9HA 2MBSA 2HSHA 4QL9A 1ZOFA 2R3XA 2PBJA 5D9VA 2OKAA 4JR6A 4KSMA 3I9V2 1H4OA 3IHQA 2LQQA 3TKSC 2L4QA 1SL0B 2YV9A 1SL2B 2YN1A 3D22A 3GKNA 3HA9A 4X43A 4EDYA 4TKYA 1U6TA 3HVXA 4OWYA 2VUPA 3TDGA 3H79A 1XWGA 1Z6NA 1NW2A 4POBA 3E0UA 2FWHA 1XFLA 4GLTA 4XRDA 5B6NA 3L9UA 3L9VA 3GX8A 2R37A 3FZAA 2JSZA 2YV7A 3ZIVA 5EVOA 4G2EA 2FNOA 3ERFA 1PSQA 4ZBBA 2JL4A 9GSSA 4NPBA 2VO4A 3FEUA 3LFLA 4XS4A 4OFMA 3IRAA 4J2FA 4DSSB 4GRFA 3ZREA 1DBYA 2ON7A 2I1UA 1V2AA 3CXGA 3EINA 2WCIA 2FA8A 2L57A 1TW9A 2IN3A 2O89A 4AJ7A 1OYJA 2H01A 5J4UA 2LJAA 1SYXA 3P7XA 1V9WA 1DUGA 1LBKA 1BG5A 1PKZA 1V57A 1N2AA 2WFCA 5CRDA 5F06A 2CT6A 2P5RA 4I2TA 2BTOT 3G7YA 5DALA 5ECNB 1ZCPA 3FW2A 4TVEA 5J9CA 5ECLB 2DIZA 3HYPA 2JZTA 3QMXA 5B8BA 4HEA2 3EYTA 3PH9A 4GSSA 5ECIB 3F63A 5A5KA 2H70A 2FLSA 4NV5A 2FWGA 4YQVA 4V1Ag 1E6BA 3P2AA 5H5SA 2H66A 2I9HA 3O3TA 1F3BA 4PNGA 5IO2A 3LXTA 2B5XA 1TXXA 2GSSA 5CRHA 5JWRB 3WGXA 4BWQA 3FZ9A 2H8LA 3C73A 3AY8A 3HVVA 4FIWA 1DE2A 1ERUA 4L0UA 2J23A 2GQKA 4ML6A 2OA7A 1B8XA 2GGTA 1V40A 4O92A 1H75A 4QQ7A 2FY6A 2OE3A 4ECIA 3M1GA 1GSFA 3UL3A 2VD0A 3LSZA 2AYTA 4YH2A 5IPHA 3M0FA 1Z9HA 4IKHA 4PUAA 2HRFA 1XOAA 5C04A 5IOWA 1OC3A 3VI7A 4NXIA 2B6MA 2YZHA 3TRXA 3ZFBA 5HR2A 1TRWA 4JU5A 2YANA 1K3OA 3GH6A 4DSSA 1FVKA 3GL3A 2WZ9A 5FWGA 4XS6A 2VM2A 4MF7A 2EIRA 4F0CA 1QGVA 3QR6A 3JCML 1SJZA 1ERWA 1AQXA 4NWYA 6GSWA 3EVIA 3RBTA 1EEJA 3CSIA 2MMZA 3CSJA 2F8FA 1XOBA 2XHFA 2F8AA 1MD4A 2LS5A 2H1DA 2N5FA 2RUEA 5AGYA 4OO4A 2FD3A 5HR3A 1JLWA 2CAIA 2IIYA 3UAPA 6GSTA 2H73A 1ZYQB 4FO5A 1YKCA 1PN9A 4FH8A 2K6VA 3GIXA 2H0IA 1G6YA 4WETA 4KUNA 3VWVA 1FOVA 22GSA 4AF2A 1K0DA 3IR4A 1PX7A 4Q5FA 4N30A 1GH2A 1R7HA 2HXKA 1ZMAA 4MF6A 3EU4A 3WD6A 1E2YA 3MDKA 3OR5A 3TCOA 4ILFA 3HKRA 17GSA 1YY7A 4YQUA 2B1LA 1GWCA 1PX6A 2C3NA 3H93A 2H30A 3GURA 4OCFA 4KW6A 1R5AA 1SD8A 4K7OA 2MBTA 2WRTA 1ZL9A 2VD1A 3TJGA 5KEJA 4KX4A 3L0HA 2MMNA 2IJYA 1OE7A 1T3BA 2RM6A 1XWAA 2RM5A 5G1KA 5ABRA 2V6KA 2O8VB 2DIYA 4PX1A 1OC9A 3QPMA 3VLNA 1Z5YE 3IAM2 1XPVA 5J9BA 2H1BA 4IJIA 4DEJA 1VF3A 5IPGA 3KH7A 5IM9A 4K9ZA 5ECSA 1YDKA 2PMTA 3DVXA 3F3RA 4XIHA 3MAKA 1GUKA 1X5EA 3GSSA 5ECQB 1EWXA 2QKEA 2LNTA 4NV2A 3QAVA 1M99A 5B6MA 3ZMKA 4XCSA 4TR1B 2LRTA 3M9KA 1DE1A 5GAPD 4EC0A 3GRXA 4GWRA 3Q19A 4Z7XA 3UEMA 2H71A 2PGTA 2JSYA 4MPFA 2WJUA 1JZDA 1THXA 1GP1A 1LJRA 4MP4A 4OFTA 1SJ6A 3TJFA 2GZPA 2MMOA 2B7JA 3HVSA 1GLPA 1U3IA 3KD0A 5ECOB 1GLQA 4HI7A 4KAEA 1K3YA 5CYYA 2AB6A 2EIQA 3QDNA 4EXJA 4N11A 5F05A 4KDUA 3FR3A 2E2MA 5GSTA 3NIVA 2NBSA 4KCAA 3DRNA 2CV4A 1ZYEA 2L4CA 5HFKA 4IP1A 2IFQA 2XPDA 2C4JA 2OBKA 1LU4A 2MYGA 2H1AA 1BJXA 4GTUA 1MDKA 2K9FA 4TW5A 4ULXA 2X99A 1O8XA 1VF2A 4GCIA 4K8MA 5ID2A 2VL3A 3H8QA 2GS3A 4PQHA 1AW9A 13GSA 4HZ2A 2CVKA 2FGXA 2NDOA 1DSBA 2IL3A 3IK7A 3D4TA 3GKKA 1KEBA 4JRRA 3QOUA 1G0TA 4J56E 4MZBA 3LEFA 2QGVA 2ALBA 4TOPA 4IN0A 1R5PA 3KP8A 1Z6MA 4PGTA 3MWHA 1ERVA 3HZ8A 3W6GA 1WMJA 4HU7A 3D6IA 2XPEA 5HQPA 3PR8A 4MABA 1XVWA 3NZNA 4PURA 5B8AA 1NHOA 2KUCA 5ECMB 1EV9A 1MDIA 1SL1B 2B5YA 5ECHB 4JBBA 2V32A 1YEXA 2IMIA 5GSSA 2QC7A 2LJRA 2HRNA 3GA4A 3KTLA 3DMLA 4KDYA 1GSSA 1CQHA 1XIYA 1XCCA 3PGTA 4IJ3A 4J57E 4TR1A 4HJ2A 1T4ZA 2N5AA 4HQSA 4F03A 2HSYA 1SYRA 2O7KA 2YWNA 1TTZA 1WP0A 3P8WA 5CRGA 2HNLA 5JWQB 3F9UA 6GSXA 4ZBDA 20GSA 3D5JA 3M8NA 4CHSA 4IVFA 5AN1A 1QMVA 3UJ1A 5LCZA 1GL8A 5G5EA 1SK0A 5GAND 3NOFA 3LWAA 4Q5QA 1O85A 1GUHA 3DWVA 2M80A 2LRNA 1X9SB 3ZYWA 6GSSA 2WULA 4BVYA 5IO0A 3TOTA 5COHA 2CAQA 4N0VA 2C0FA 1XXUA 2ZUPA 3KP9A 2E2GA 3ZIJA 2PERA 5IMVA 1URMA 2YJHA 3DVWA 1MEKA 2VL2C 1YZXA 1GNWA 2R6KA 2HZEB 2PU9C 1Y6EA 1FB6A 2HE3A 3ZITA 2QSIA 3VURA 2FWFA 2PWJA 1GSYA 2H1GA 4D73A 1EV4A 3KZQA 2AHEA 5G30A 1OAZA 1TRVA 3WGEA 3J7Yk 2B5EA 1QQ2A 1PKWA 3IPZA 4L5LA 5JCWA 2L5OA 4PQIA 4ECCA 1N8JA 3IOSA 5HFGA 5D9XA 5DAKA 4FYBA 3GYKA 4IELA 2GTUA 4WXTA 3ZRDA 19GSA 4OFNA 2AAWA 1Q98A 3FKFA 4HZ4A 2FCHA 2HT9A 2YOIA 4WEYA 2FUG2 5D93A 3KH9A 2PPTA 1KTEA 3CYNA 1EOGA 4JZQA 2MMAA 1K0CA 12GSA 4MCUA 2DJ0A 2H6YA 1G7OA 3ZL5A 1K0BA 5G1LA 3QD9A 4MK3A 4LLRA 4ZB8A 5H5RA 3VFIA 2YCDA 2V41A 1WOUA 3D4MA 2H6XA 2IMFA 1NHYA 5J5NA 1TK8B 1THOA 4JE1A 1F3AA 1FB0A 1JLVA 1UN2A 3DXBA 3UOMA 4ACSA 8GSSA 3G9BA 10GSA 1O8WA 5ENUA 4HOJA 2YZUA 1B4PA 2LTKA 1TI3A 4PUFC 4MJCA 3E3EA 2DJ3A 1GRXA 5AIXA 2HZEA 2N5BA 4ZL7A 4X1UA 4RQXA 2YWMA 1B9YC 1XZOA 3CRTA 4LL4B 1UA5A 2VCTA 4GSNA 3CTGA 4HU9A 4ZIJA 3ERGA 3H4KA 3VPQA 2GLRA 2H0HA 1ABAA 5F8BA 5CNWA 4MMMA 3TRPA 1GUMA 5IQYA 5G31A 1B48A 2AV4A 3R2QA 1QFNA 4DSRA 2M72A 4DVCA 3IA1A 4TR4A 1HNCA 2CQ9A 4RQRA 4G10A 2L59A 1T1VA 4K0NA 2HI7A 1EEMA 1S3DA 3F6DA 2Z9SA 1F2EA 2A4VA 3FR6A 3N9JA 1BEDA 2IPAA 1GSQA 4JEDA 1JZWA 2LJKA 4ZL9A 1TJDA 4MDCA 1PGTA 5C00A 3O6TA 1GTIA 2VOCA 2AJQB 1Q4JA 4N10A 2DJJA 5DDLA 2AUVA 1Y25A 4MLYA 3IDVA 4V2NA 3D0ZA 1RQMA 2DMMA 3A2WA 2WB9A 5IMFA 4I8BA 4BA7A 1OVNA 1SKSB 3C71A 2LUSA 2P31A 1OC8A 3TUEA 5LD0A 2VCQA 2WDUA 4PNFA 1EGRA 2TRXA 2ZNMA 3IV4A 2XBIA 3UBLA 4IBPA 3FZ4A 3GTUB 3GUSA 3ZZXA 2RUFA 5FHIA 4X0XA 3ISOA 2K8VA 4WKWA 5IOXA 1GTBA 1OKDA 4KH7A 5A4UA 4IP6A 1B9XC 3CTFA 3I6AA 2LRCA 4MJEA 14GSA 3IBHA 1SKWB 4ZB9A 4V1Ap 11GSA 3DGQA 3GX0A 4ML1A 4PXOA 1AQWA 4BL7A 3EWLA 2VCXA 2L5LA 3VWUA 3KIJA 1QXHA 4WBRD 5D9WA 3FHKA 2C3QA 2LNSA 3ZFLA 2RLIA 5CAXA 5DJMA 2G2QA 3VK9A 3ZLPA 5LNKe 3RPPA 4KNDA 4PQ1A 3GKXA 3Q6OA 3F4RA 4KDXA 4WF5A 1PMTA 2JACA 2B3SA 1A24A 5CREA 1MDJA 5A4WA 1TP9A 3ZVJD 1QUWA 2L6DA 2C8UA 3H1NA 2EIOA 3M3MA 4K0GA 4GXZA 3DD3A 4TR0A 5CRWA 3TJKA 1A8LA 1PQNA 5DVBA 2KOKA 3EMPA 3US3A 2VAFA 1TRUA 2JADA 2WGRA 5KN2A 2VLUA 3BBYA 3A2XA 1VRSD 4AJ6A 3UBKA 2CVBA 4WF4A 3HHVA 2DMLA 4YAPA 4F0BA 1Z3EA 3GHAA 1EGOA 1NSWA 1ON4A 4I2UA 1W89A 2GZYA 5KN3A 3ZVJA 4GSTA 4K1FA 2GSRA 1GSUA 3F6FA 1YF0A 2WS2A 1PA3A 3IAS2 4RI6A 4EF0A 3WGDA 1IYIA 4EE0A 4WR4A 4POKA 1T8EB 4EDZA 2K8SA 4IQ1A 5D9TA 3IE3A 3GTUA 4MH3A 3PINA 2GDRA 2P5QA 4ZXGA 4DSQA 1SD9A 1YQ1A 3I43A 1TK5B 4POLA 3FR9A 3KXOA 3LXZA 3HZ4A 3UMAA 2LEGA 4G19A 1UC7A 4I5QA 5ECPB 2E7PA 3CMIA 3GNJA 3UVHA 1AAZA 3WT2A 4OO5A 4CW9A 5E4WA 4L0WA 2KLXA 1S3AA 4AJ8A 2JZSA 4ZB6A 4EL1A 3APSA 3ZTLA 4QL7A 4MJAA 1C72A 4O5RA 5D73A 1BX9A 3C1SA 1SJIA 1O81A 1VF1A 3HJMA 4I97A 4WBJA 2GSQA 4MF5A 1KBNA 4TXVA 5DCGA 5DJLA 4I6XA 1TKDB 1U88A 5EPFA 1RW1A 3U6VA 5CO3A 2TIRA 4FYCA 3F3QA 2REMA 3FYGA 2R5GA 1X5DA 3BD2A 3BCKA 1PL2A 4YQMA 1M2AA 1UVZA 1IYHA 2VM1A 1K0AA 3L4NA 3KEBA 4IW9A 4HDEA 1WJKA 1F9MA 2VIMA 1TI1A 3IXRA 1XW9A 3L78A 3G7IA 4K7IA 1AXDA 4XRAA 1FW1A 1XWBA 3RHCA 2HLSA 4ZILA 3LYPA 1EP8A 1YEPA 2B1KA 5IMDA 2PUKC 4F82A 2H75A 3SBCA 4L5OA 4MPGA 5DQSA 3RHBA 3LGCA 5INYA 3Q74A 6GSVA 2PN8A 3TKSA 2F3MA 5IMAA 2F51A 4LMWA 1M9AA 5GZZB 1JFUA 3TKQA 2LSTA 4MZCA 4EKZA 2FA4A 4KA0A 2DJ2A 1TOFA 1ACVA 3EE2A 2VLTA 4TN8A 2VL2A 1FVJA 2EC4A 1HD2A 2GQMA 1J08A 4BWSA 5JWOB 4HQZA 2HZFA 2OJLA 3WYWA 1YJ6A 2IMKA 5EY6A 1JHBA 3LJRA 2A2RA 2TRCP 3L9SA 2I81A 3Q18A 2CZ3A 4NHWA 4EUYA 3C7MA 5HFIA 2OADA 4LA1A 4ZL8A 1K0OA 1HNAA 3D21A 1HNBA 2PVOC 4O7HA 1AIUA 1EOHA 2DJKA 1U87A 1O6JA 5IIZA 1Z7RA 3CBUA 1FO5A 3VWWA 3VPTA 3LORA 2KP2A 4ECBA 5DQYA 1YKAA 3FZ5A 3O76A 18GSA 1ILOA 6GSUA 3FRCA 3TJJA 1PRXA 2VCZA 4EVMA 3FK8A 4K7NA 1ZZYA 3HDCA 5L71A 1SKRB 3ERWA 4L8EA 2RIIA 1GULA 3UIWA 3QFAC 1SENA 3KJYA 3J7Yb 3VI5A 1VF4A 2FHEA 1HQOA 3GKMA 4Q5RA 1F6MC 3GSTA 4MH2A 1TU8A 2XC2A 3TKSE 1O73A 2GVPA 1GTAA 2GT5A 2IMDA 5G2ZA 1T00A 4P3YB 4NAXA 2V6OA 2DBCA 1GNEA 4ISDA 3HJOA 2LQOA 2B7KA 4IGJA 2LV3A 2GQLA 3QCPA 3WT1A 3HJPA 4IQAA 5J41A 3LG6A 2ES7A 2VL9A 4IHUA 3GMFA 2GT6A 1KNGA 1X5CA 4WR5A 1BAYA 1GSEA 3A2VA 4GQCA 1A23A 4JR4A 2X8HA 2CX4A 6GSYA 3GFKA 2ON5A 16GSA 4ECJA 5CP1A 2PVQA 4XHMA 3LYKA 4XS1A 3GV1A 2OACA 3TKPA 1J9BA 4K2DA 4K6XA 2M46A 2V2GA 4E8EA 3E9JB 4BVXA 2CX3A 3RPNA 3W8JA 2DC5A 4KSOA 2E0QA 3QFBC 1K0NA 1A2LA 2ZCTA 1R26A 3ED3A 3U5RE 3TGZA 4N0ZA 2CA8A 1NM3A 2BJXA 2IWTA 3IC4A 3CRUA 2YP6A 3CSHA 2GZZA 5F0GA 4OD7A 1ML6A 4AGSA 1M2BA 3V1WA 5ELGA 1K0MA 2JZRA 4O32A 1M9BA 5KN1A 1HYUA 3DKSA 1BYEA 2O87A 3APOA 5AISA 1OC9B 5HR1A 4G9HA 1WWJA 1XWKA 4HS1A 3DYRA 1X9WB 1XBSA 1AQVA 4BPYA 3I69A 3W8SA 2L6CA 5KN0A 3A5WA 4E8HA 1A0FA 3UVTA 5B7CA 2DJ1A 2C80A 1WRYA 3TOUA 5J3RA 2VCVA 1G7EA 1V58A 1G6WA 7GSSA 4ID0A 1SK1A 2R4VA 3HCZA 2YWOA 3K8NA 3RAZA 3F4SA 2A2SA 2X8GA 4LL1B 3TKRA 2H72A 4GF0A 4TXOB 1V98A 4EO3A 1OE8A 1M0UA 1TU7A 3C8EA 3QAWA 1WIKA 1O7UA 2R2JA 3HY2A 3SWLA 5D96A 3UARA 2CVDA 1QK8A 1EP7A 2IFQB 3RDWA 4V2MA 1XW5A 2V1MA 4KGIA 2LKUA 1FHEA 2C1YA 3EC3A 2YPMA 5HR0A 2O85A 4MA9A 4TRXA 2HYXA 2C0EA 5ID2B 1T4YA 3F4TA 1EZKA 5ECKB 4OCEA 3KCMA 1RK4A 2OE0A 3IK9A 5FT3A 1F37A 5DCHA 1VGLA 1ST9A 2I4AA 4F2IA 1CQGA 3BCIA 1A2MA 3BOAA 3GH9A 2IMEA 2F9SA 4KE3A 2NTOA 3KM6A 5IMZA 5A4VA 1JZOA 5IMCA 2VCWA 5E59A 4OMVA 1XVQA 3N5OA 3GN3A 1BQ7A 3ME8A 4NMUA 2NVLA 4V2LA 1X9MB 1WPIA 4F9ZA 3LQ7A 3G7JA 1USBA 1GTUA 2C3TA 1X0RA 2NPBA 2K18A 3A3TA 1FAAA 2YWIA 2FWEA 1JZRA 2X64A 3C1RA 1XWCA 1I5GA 3APQA 1PL1A 2H76A 4POMA 2VLVA 3KGKA 4TXOA 3MSZA 1T7PB 1ZGNA 2X8CA 1B4QA 1MTCA 2GSTA 2HFDA 3EU3A 4KB3A 4ZBAA 1FG4A 5ELAA 4NHZA 1MD3A 3F8UA 3TB2A 1W4VA 2I3YA 3DEXA 2G0FA 3TRQA 1A0RP 1YF1A 5F07A 2C0GA 1K3LA 4YAVA 3KMNA 2DLXA 1AUCA 2OBIA 1S3CA 1TDIA 4CDOA 2KP1A 2H74A 1PD21 2H0GA 4RUVA 5G5FA 5JCGA 1A8YA 4GQFA 3KMOA 4LMVA 1OKTA 3FY7A 1Z7PA 4H86A 3BJ5A 3QAGA 3VWXA 2YNXA 3MNGA 1R4WA 1TRSA 1J0FA 2H19A 2JU5A 5DBQA 3P90A 5JCUA 4D73B 2CZ2A 2KHPA 1M7TA 4MZWA 5AIVA 2OE1A 5ECRB 2DSAA 3S9FA 4XS4B 1M2DA 4Q5NA 2D2ZA 1I9DA 3GL5A 1A2JA 2C0DA 1ERTA 2MZCA 5DAKB 5D8IA 3ZMLA 1GSDA 3HD5A 3ME7A 1SK2A 3EURA 3HXSA 3EMXA 4RI7A 1TK0B 2P0GA 3F0IA 3DIEA 1SU9A 4TR3A 2YJ7A 4HUAA 3M9JA 5H5QA 1AC1A 1U3AA 2BMXA 5DALB 3TJBA 4KCEA 2H6ZA 4IS0A 4FYUA 5EL8A 3KTBA 4XTSA 1WE0A 4HJMA 4MJBA
chains in the Genus database with same CATH superfamily
2XBQA 1XW6A 2J9HA 2MBSA 2HSHA 4QL9A 1ZOFA 2R3XA 2PBJA 5D9VA 2OKAA 4JR6A 4KSMA 3I9V2 1H4OA 3IHQA 2LQQA 3TKSC 2L4QA 1SL0B 2YV9A 1SL2B 2YN1A 3D22A 3GKNA 3HA9A 4X43A 4EDYA 4TKYA 1U6TA 3HVXA 4OWYA 2VUPA 3TDGA 3H79A 1XWGA 1Z6NA 1NW2A 4POBA 3E0UA 2FWHA 1XFLA 4GLTA 4XRDA 5B6NA 3L9UA 3L9VA 3GX8A 2R37A 3FZAA 2JSZA 2YV7A 3ZIVA 5EVOA 4G2EA 2FNOA 3ERFA 1PSQA 4ZBBA 2JL4A 9GSSA 4NPBA 2VO4A 3FEUA 3LFLA 4XS4A 4OFMA 3IRAA 2QA2A 4J2FA 4DSSB 4GRFA 3ZREA 1DBYA 2ON7A 2I1UA 1V2AA 3CXGA 3EINA 2WCIA 2FA8A 2L57A 1TW9A 2IN3A 2O89A 4AJ7A 1OYJA 2H01A 5J4UA 2LJAA 1SYXA 3P7XA 1V9WA 1DUGA 1LBKA 1BG5A 1PKZA 1V57A 1N2AA 2WFCA 5CRDA 5F06A 2CT6A 2P5RA 4I2TA 2BTOT 3G7YA 5DALA 5ECNB 1ZCPA 3FW2A 4TVEA 5J9CA 5ECLB 2DIZA 3HYPA 2JZTA 3QMXA 5B8BA 4HEA2 3EYTA 3PH9A 4GSSA 5ECIB 3F63A 5A5KA 2H70A 2FLSA 4NV5A 2FWGA 4YQVA 4V1Ag 1E6BA 3P2AA 5H5SA 2H66A 2I9HA 3O3TA 1F3BA 4PNGA 5IO2A 3LXTA 2B5XA 1TXXA 2GSSA 5CRHA 5JWRB 3WGXA 4BWQA 3FZ9A 2H8LA 3C73A 3AY8A 3HVVA 4FIWA 1DE2A 1ERUA 4L0UA 2J23A 2GQKA 4ML6A 2OA7A 1B8XA 2GGTA 1V40A 4O92A 1H75A 4QQ7A 2FY6A 2OE3A 4ECIA 3M1GA 1GSFA 3UL3A 2VD0A 3LSZA 2AYTA 4YH2A 5IPHA 3M0FA 1Z9HA 4IKHA 4PUAA 2HRFA 1XOAA 5C04A 5IOWA 1OC3A 3VI7A 4NXIA 2B6MA 2YZHA 3TRXA 3ZFBA 5HR2A 1TRWA 4JU5A 2YANA 1K3OA 3GH6A 4DSSA 1FVKA 3GL3A 2WZ9A 5FWGA 4XS6A 2VM2A 4MF7A 2EIRA 4F0CA 1QGVA 3QR6A 2X49A 3JCML 1SJZA 1ERWA 1AQXA 4NWYA 6GSWA 2A4HA 3EVIA 3RBTA 1EEJA 3CSIA 2MMZA 3CSJA 2F8FA 1XOBA 4K2XA 1ZYNA 2XHFA 2F8AA 1MD4A 2LS5A 2H1DA 4MNNA 2N5FA 2RUEA 5AGYA 4OO4A 2FD3A 5HR3A 1JLWA 2CAIA 3IHGA 2IIYA 3UAPA 6GSTA 2H73A 2DKHA 1ZYQB 4FO5A 1YKCA 1PN9A 4FH8A 2K6VA 3GIXA 2H0IA 1G6YA 4WETA 4KUNA 3VWVA 1FOVA 22GSA 4AF2A 1K0DA 3IR4A 1PX7A 4Q5FA 4N30A 1GH2A 1R7HA 2HXKA 1ZMAA 4MF6A 3EU4A 3WD6A 1E2YA 3MDKA 3OR5A 3TCOA 4ILFA 3HKRA 17GSA 1YY7A 4YQUA 2B1LA 1GWCA 1PX6A 2C3NA 3H93A 2H30A 3GURA 1M3IA 4OCFA 4KW6A 1R5AA 1SD8A 4K7OA 2MBTA 2WRTA 1ZL9A 2VD1A 3TJGA 5KEJA 4KX4A 3L0HA 2MMNA 2IJYA 1OE7A 1T3BA 2RM6A 1XWAA 2RM5A 5G1KA 5ABRA 2V6KA 2O8VB 2DIYA 4PX1A 1OC9A 3QPMA 3VLNA 1Z5YE 3IAM2 1XPVA 5J9BA 2H1BA 4IJIA 4DEJA 1VF3A 5IPGA 3KH7A 5IM9A 4K9ZA 5ECSA 1YDKA 2PMTA 3DVXA 3F3RA 4XIHA 3MAKA 1GUKA 1X5EA 1S3RA 3GSSA 5ECQB 1EWXA 2QKEA 2LNTA 4NV2A 3QAVA 1M99A 5B6MA 3ZMKA 4XCSA 4TR1B 2LRTA 3M9KA 1DE1A 5GAPD 4EC0A 3GRXA 4GWRA 3Q19A 4Z7XA 3UEMA 2H71A 2PGTA 2JSYA 4MPFA 2WJUA 1JZDA 1THXA 1GP1A 2DKIA 1LJRA 2X4AA 4MP4A 4OFTA 1SJ6A 3TJFA 2GZPA 2MMOA 2B7JA 3HVSA 1GLPA 1U3IA 3KD0A 5ECOB 1GLQA 4HI7A 4KAEA 4YKFA 1K3YA 5CYYA 2AB6A 2EIQA 3QDNA 4EXJA 4N11A 5F05A 4KDUA 3FR3A 2E2MA 5GSTA 3A5IA 3NIVA 2NBSA 4KCAA 3DRNA 4O5UA 2CV4A 1ZYEA 2L4CA 5HFKA 4IP1A 2IFQA 2XPDA 2C4JA 2OBKA 4BVYB 1LU4A 2MYGA 2H1AA 1BJXA 4GTUA 1MDKA 2K9FA 4TW5A 4ULXA 2X99A 1O8XA 1VF2A 4GCIA 4K8MA 5ID2A 2VL3A 3H8QA 2GS3A 4PQHA 1AW9A 13GSA 4HZ2A 2CVKA 2FGXA 2NDOA 1DSBA 2IL3A 3IK7A 3D4TA 3GKKA 1KEBA 4JRRA 3QOUA 1G0TA 4J56E 4MZBA 3LEFA 2QGVA 2ALBA 4TOPA 4IN0A 1R5PA 3KP8A 1Z6MA 4PGTA 3MWHA 1ERVA 3HZ8A 3W6GA 1WMJA 4HU7A 3D6IA 2XPEA 5HQPA 3PR8A 4MABA 1XVWA 3NZNA 4PURA 5B8AA 1NHOA 2KUCA 4PTSA 5ECMB 1EV9A 1MDIA 1SL1B 2B5YA 5ECHB 4JBBA 2V32A 1YEXA 2IMIA 5GSSA 2QC7A 2LJRA 2HRNA 3GA4A 3KTLA 3DMLA 4BIKA 4KDYA 1GSSA 1CQHA 1XIYA 1XCCA 3PGTA 4IJ3A 3R3EA 4J57E 4TR1A 4HJ2A 1T4ZA 2N5AA 4HQSA 4F03A 2HSYA 1SYRA 2O7KA 2YWNA 4ICYA 1TTZA 1WP0A 3P8WA 5CRGA 2HNLA 5JWQB 3F9UA 6GSXA 4ZBDA 20GSA 3D5JA 3M8NA 4CHSA 4IVFA 5AN1A 1QMVA 3UJ1A 5LCZA 1GL8A 5G5EA 1SK0A 5GAND 3NOFA 3LWAA 4Q5QA 1O85A 1GUHA 3DWVA 2M80A 2LRNA 1X9SB 3ZYWA 6GSSA 2WULA 3HVNA 4BVYA 5IO0A 3TOTA 5COHA 2CAQA 4N0VA 2C0FA 1XXUA 2ZUPA 3KP9A 2E2GA 3ZIJA 2PERA 5IMVA 1URMA 2YJHA 3DVWA 1MEKA 2VL2C 1YZXA 1GNWA 2R6KA 2HZEB 2PU9C 1Y6EA 1FB6A 2HE3A 3ZITA 2QSIA 3VURA 2FWFA 2PWJA 1GSYA 2H1GA 4D73A 1EV4A 1PN0A 3KZQA 2AHEA 4BVXB 5G30A 1OAZA 1TRVA 3WGEA 3J7Yk 2B5EA 1QQ2A 1PKWA 3IPZA 4L5LA 5JCWA 2L5OA 4PQIA 4ECCA 1N8JA 3IOSA 5HFGA 4Z2TA 5D9XA 5DAKA 4USSA 4FYBA 3GYKA 4IELA 2GTUA 4WXTA 3ZRDA 19GSA 4OFNA 2AAWA 1Q98A 3FKFA 4HZ4A 2FCHA 2HT9A 2YOIA 4WEYA 2FUG2 5D93A 3KH9A 2PPTA 1KTEA 3CYNA 1EOGA 4JZQA 2MMAA 1K0CA 12GSA 4MCUA 2DJ0A 2H6YA 1G7OA 3ZL5A 1K0BA 5G1LA 3QD9A 4K5SA 4MK3A 4LLRA 4ZB8A 5H5RA 3VFIA 2YCDA 2V41A 1WOUA 3D4MA 4CY6A 2H6XA 2IMFA 1NHYA 5J5NA 1TK8B 1THOA 4JE1A 1F3AA 1FB0A 1JLVA 1UN2A 3MIXA 3DXBA 3UOMA 4ACSA 8GSSA 3G9BA 10GSA 1O8WA 5ENUA 4HOJA 2HSMA 2YZUA 1B4PA 2LTKA 1TI3A 4PUFC 4MJCA 3E3EA 2DJ3A 1GRXA 5AIXA 2HZEA 2N5BA 4ZL7A 4X1UA 4RQXA 2YWMA 1B9YC 1XZOA 3CRTA 4LL4B 1UA5A 2VCTA 4GSNA 3CTGA 3EPTA 4HU9A 4ZIJA 3ERGA 3H4KA 3VPQA 2GLRA 2H0HA 1ABAA 5F8BA 5CNWA 4MMMA 3TRPA 1GUMA 5IQYA 5G31A 1B48A 2AV4A 3R2QA 1QFNA 4BL7B 4DSRA 2M72A 4DVCA 3IA1A 2HRKA 4TR4A 1HNCA 4YKGA 2CQ9A 4RQRA 4G10A 2L59A 2QA1A 1T1VA 4K0NA 2HI7A 1EEMA 1S3DA 3F6DA 2Z9SA 1F2EA 2A4VA 3FR6A 3N9JA 1BEDA 2IPAA 1GSQA 4JEDA 1JZWA 2LJKA 5KOWA 4ZL9A 1TJDA 4MDCA 1PGTA 5C00A 5KOXA 5BRTA 3O6TA 1GTIA 2VOCA 2AJQB 1Q4JA 4N10A 2DJJA 5DDLA 2AUVA 1Y25A 4MLYA 3IDVA 4V2NA 3D0ZA 1RQMA 2DMMA 3A2WA 2WB9A 5IMFA 4I8BA 4BA7A 1OVNA 4G0KA 1SKSB 3C71A 2LUSA 2P31A 1OC8A 3TUEA 5LD0A 2VCQA 2WDUA 4PNFA 1EGRA 2TRXA 2ZNMA 3IV4A 2XBIA 3UBLA 4IBPA 3FZ4A 3GTUB 3GUSA 3ZZXA 2RUFA 5FHIA 4X0XA 3ISOA 2K8VA 4WKWA 5IOXA 1GTBA 1OKDA 4KH7A 5A4UA 4IP6A 1B9XC 3CTFA 3I6AA 2LRCA 4MJEA 14GSA 3IBHA 1SKWB 4ZB9A 4V1Ap 11GSA 3DGQA 3GX0A 4ML1A 4PXOA 1AQWA 4BL7A 3EWLA 3IC8A 2VCXA 2L5LA 3VWUA 3KIJA 4Z2RA 1QXHA 4WBRD 5D9WA 3FHKA 2C3QA 2LNSA 3ZFLA 2RLIA 5CAXA 5DJMA 2G2QA 3VK9A 3ZLPA 5LNKe 3RPPA 4KNDA 4PQ1A 3GKXA 3Q6OA 3F4RA 4KDXA 4WF5A 1PMTA 2JACA 2B3SA 1A24A 5CREA 1MDJA 5A4WA 1TP9A 3ZVJD 1QUWA 2L6DA 2C8UA 3H1NA 2EIOA 3M3MA 4K0GA 4GXZA 3DD3A 4TR0A 5CRWA 3TJKA 1A8LA 1PQNA 5DVBA 2KOKA 3EMPA 3US3A 2VAFA 1TRUA 2JADA 2WGRA 5KN2A 2VLUA 3BBYA 3A2XA 1VRSD 4AJ6A 3UBKA 2CVBA 4WF4A 3HHVA 2DMLA 4YAPA 4F0BA 1Z3EA 3GHAA 1EGOA 1NSWA 1ON4A 4I2UA 1W89A 2GZYA 5KN3A 3ZVJA 4GSTA 4K1FA 2GSRA 1GSUA 3F6FA 1YF0A 2WS2A 1PA3A 3IAS2 4RI6A 4EF0A 3WGDA 1IYIA 4EE0A 4WR4A 4POKA 1T8EB 4EDZA 2K8SA 4IQ1A 5D9TA 3IE3A 3GTUA 4MH3A 3PINA 2GDRA 2P5QA 4ZXGA 4DSQA 1SD9A 1YQ1A 3I43A 1TK5B 4POLA 3FR9A 3KXOA 3LXZA 3HZ4A 3UMAA 2LEGA 4G19A 1UC7A 4I5QA 5ECPB 2E7PA 3CMIA 3GNJA 2R0CA 5BMUA 3UVHA 1AAZA 4K5RA 3WT2A 4OO5A 4CW9A 5E4WA 4L0WA 2KLXA 1S3AA 4AJ8A 2JZSA 4ZB6A 4EL1A 3APSA 3ZTLA 4QL7A 4MJAA 1C72A 4O5RA 5D73A 1BX9A 3C1SA 1SJIA 1O81A 1VF1A 3HJMA 4I97A 4WBJA 2GSQA 4MF5A 1KBNA 4TXVA 5DCGA 5DJLA 4I6XA 1TKDB 1U88A 5EPFA 1RW1A 3U6VA 5CO3A 2TIRA 4FYCA 3F3QA 2REMA 3FYGA 2R5GA 1X5DA 3BD2A 3BCKA 1PL2A 4YQMA 1M2AA 1UVZA 1IYHA 2VM1A 1K0AA 3L4NA 3KEBA 4IW9A 4HDEA 1WJKA 1F9MA 2VIMA 1TI1A 3IXRA 1XW9A 3L78A 3G7IA 4K7IA 1AXDA 4XRAA 1FW1A 1XWBA 3RHCA 2HLSA 4ZILA 3LYPA 1EP8A 1YEPA 2B1KA 5IMDA 2PUKC 4F82A 2H75A 3SBCA 4L5OA 4MPGA 5DQSA 3RHBA 3LGCA 5INYA 3Q74A 6GSVA 2PN8A 3TKSA 2F3MA 5IMAA 2F51A 4LMWA 1M9AA 5GZZB 1JFUA 3TKQA 2LSTA 4MZCA 4EKZA 2FA4A 4KA0A 2DJ2A 1TOFA 1ACVA 3EE2A 2VLTA 4TN8A 2VL2A 1FVJA 2EC4A 1HD2A 2GQMA 1J08A 4BWSA 5JWOB 4HQZA 2HZFA 2OJLA 3WYWA 1YJ6A 2IMKA 5EY6A 1JHBA 3LJRA 2A2RA 2TRCP 3L9SA 2I81A 3Q18A 2CZ3A 4NHWA 4EUYA 3C7MA 5HFIA 2OADA 4LA1A 4ZL8A 1K0OA 2HRAA 1HNAA 3D21A 1HNBA 2PVOC 4O7HA 1AIUA 1EOHA 2DJKA 1U87A 1O6JA 5IIZA 1Z7RA 3LW9A 4KF9A 3CBUA 1FO5A 3VWWA 3VPTA 3LORA 2KP2A 4ECBA 5DQYA 1YKAA 3FZ5A 3O76A 18GSA 1ILOA 6GSUA 3FRCA 3TJJA 1PRXA 2VCZA 4EVMA 3FK8A 4K7NA 1ZZYA 3HDCA 5L71A 1SKRB 3ERWA 4L8EA 2RIIA 1GULA 3UIWA 3QFAC 1SENA 3KJYA 3J7Yb 3VI5A 1VF4A 2FHEA 1HQOA 3GKMA 4Q5RA 1F6MC 3GSTA 4MH2A 1TU8A 2XC2A 3TKSE 1O73A 2GVPA 1GTAA 2GT5A 2IMDA 5G2ZA 1T00A 4P3YB 4NAXA 2V6OA 2DBCA 1GNEA 1XG8A 4ISDA 3HJOA 2LQOA 2B7KA 4IGJA 2LV3A 2GQLA 3QCPA 3WT1A 3HJPA 4IQAA 5J41A 3LG6A 2ES7A 2VL9A 4EIPA 4IHUA 3GMFA 2GT6A 1KNGA 1X5CA 4WR5A 1BAYA 1GSEA 3A2VA 4GQCA 1PFOA 1A23A 4JR4A 2X8HA 2CX4A 6GSYA 3GFKA 2ON5A 16GSA 4ECJA 5CP1A 2PVQA 4XHMA 3LYKA 4XS1A 3GV1A 2OACA 3TKPA 1J9BA 4K2DA 4K6XA 2M46A 2V2GA 4E8EA 3E9JB 4BVXA 2CX3A 3RPNA 3W8JA 2DC5A 4KSOA 2E0QA 3QFBC 1K0NA 1A2LA 2ZCTA 1R26A 3ED3A 3U5RE 3TGZA 4N0ZA 2CA8A 1NM3A 2BJXA 2IWTA 3IC4A 3CRUA 2YP6A 3CSHA 2GZZA 5F0GA 4OD7A 1ML6A 4AGSA 1M2BA 3V1WA 5ELGA 1K0MA 2JZRA 4O32A 1M9BA 5KN1A 1HYUA 3DKSA 1BYEA 2O87A 3APOA 5AISA 1OC9B 5HR1A 4G9HA 1WWJA 1XWKA 4HS1A 3DYRA 1X9WB 1XBSA 1AQVA 4BPYA 3I69A 3W8SA 2L6CA 5KN0A 3A5WA 4E8HA 1A0FA 3UVTA 5B7CA 2DJ1A 2C80A 1WRYA 3TOUA 5J3RA 2VCVA 1FOHA 1G7EA 1V58A 2R0GA 3CQFA 1G6WA 7GSSA 4ID0A 1SK1A 2R4VA 3HCZA 2YWOA 3K8NA 3RAZA 3F4SA 2A2SA 2X8GA 4LL1B 3TKRA 2H72A 4GF0A 4TXOB 1V98A 4EO3A 1OE8A 1M0UA 1TU7A 3C8EA 3QAWA 1WIKA 1O7UA 2R2JA 3HY2A 3SWLA 4Z2UA 5D96A 3UARA 2CVDA 1QK8A 1EP7A 2IFQB 3PPUA 3RDWA 4V2MA 1XW5A 3FMWA 2V1MA 4KGIA 2LKUA 1FHEA 2C1YA 3EC3A 2YPMA 5HR0A 2O85A 4MA9A 4TRXA 2HYXA 2C0EA 5ID2B 1T4YA 3F4TA 1EZKA 5ECKB 4FQUA 4OCEA 4A5PA 3KCMA 1RK4A 2OE0A 3IK9A 4G0IA 5FT3A 1F37A 5DCHA 1VGLA 1ST9A 2I4AA 4F2IA 1CQGA 3BCIA 1A2MA 3BOAA 3GH9A 2IMEA 2F9SA 4KE3A 2NTOA 3KM6A 5IMZA 2UZ8A 5A4VA 1JZOA 5IMCA 2VCWA 5E59A 4OMVA 1XVQA 3N5OA 3GN3A 1BQ7A 3ME8A 4NMUA 2A2PA 2NVLA 4V2LA 1X9MB 1WPIA 4F9ZA 3LQ7A 3G7JA 1USBA 1GTUA 2C3TA 1X0RA 2NPBA 2K18A 4HSCX 3A3TA 1FAAA 2YWIA 2FWEA 1JZRA 2X64A 3C1RA 1XWCA 1I5GA 3APQA 1PL1A 2H76A 4POMA 2VLVA 3KGKA 4TXOA 3MSZA 1T7PB 1ZGNA 4X4JA 2X8CA 1B4QA 1MTCA 4EIQA 2GSTA 2HFDA 3EU3A 3MYDA 4KB3A 4ZBAA 1FG4A 5ELAA 4NHZA 1MD3A 3F8UA 3TB2A 1W4VA 2I3YA 3DEXA 2G0FA 3TRQA 1A0RP 1YF1A 5F07A 2C0GA 1K3LA 1ZYPA 4YAVA 3KMNA 2DLXA 1AUCA 2OBIA 1S3CA 1TDIA 4CDOA 2KP1A 2H74A 1PD21 2H0GA 4RUVA 5G5FA 5JCGA 1A8YA 4GQFA 4LMVA 3KMOA 1OKTA 3FY7A 1Z7PA 4H86A 3BJ5A 3QAGA 3VWXA 2YNXA 3MNGA 1R4WA 1TRSA 1J0FA 2H19A 2JU5A 5DBQA 2R0PA 3P90A 1M3JA 5JCUA 4D73B 2CZ2A 4CY8A 2KHPA 1M7TA 4MZWA 5AIVA 2OE1A 5ECRB 2DSAA 3S9FA 4XS4B 1M2DA 4Q5NA 2D2ZA 1I9DA 3GL5A 1A2JA 2C0DA 1ERTA 2MZCA 5DAKB 5D8IA 3ZMLA 1GSDA 3HD5A 3ME7A 4O5QA 1SK2A 3EURA 3HXSA 3EMXA 4RI7A 1TK0B 2P0GA 3F0IA 3DIEA 1SU9A 4TR3A 2YJ7A 4HUAA 3M9JA 5H5QA 1AC1A 1U3AA 2BMXA 5DALB 3TJBA 4KCEA 2H6ZA 4IS0A 4FYUA 5EL8A 3KTBA 4XTSA 1WE0A 4HJMA 4MJBA 4G0LA
chains in the Genus database with same CATH topology
2XBQA 1XW6A 2J9HA 2MBSA 2HSHA 4QL9A 1ZOFA 2R3XA 2PBJA 5D9VA 2OKAA 4JR6A 4KSMA 3I9V2 1H4OA 3IHQA 2LQQA 3TKSC 2L4QA 1SL0B 2YV9A 1SL2B 2YN1A 3D22A 3GKNA 3HA9A 4X43A 4EDYA 4TKYA 1U6TA 3HVXA 4OWYA 2VUPA 3TDGA 3H79A 1XWGA 1Z6NA 1NW2A 4POBA 3E0UA 2FWHA 1XFLA 4GLTA 4XRDA 5B6NA 3L9UA 3L9VA 3GX8A 2R37A 3FZAA 2JSZA 2YV7A 3ZIVA 5EVOA 4G2EA 2FNOA 3ERFA 1PSQA 4ZBBA 2JL4A 9GSSA 4NPBA 2VO4A 3FEUA 3LFLA 4XS4A 4OFMA 3IRAA 2QA2A 4J2FA 4DSSB 4GRFA 3ZREA 1DBYA 2ON7A 2I1UA 1V2AA 3CXGA 3EINA 2WCIA 2FA8A 2L57A 1TW9A 2IN3A 2O89A 4AJ7A 1OYJA 2H01A 5J4UA 2LJAA 1SYXA 3P7XA 1V9WA 1DUGA 1LBKA 1BG5A 1PKZA 1V57A 1N2AA 2WFCA 5CRDA 5F06A 2CT6A 2P5RA 4I2TA 2BTOT 3G7YA 5DALA 5ECNB 1ZCPA 3FW2A 4TVEA 5J9CA 5ECLB 2DIZA 3HYPA 2JZTA 3QMXA 5B8BA 4HEA2 3EYTA 3PH9A 4GSSA 5ECIB 3F63A 5A5KA 2H70A 2FLSA 4NV5A 2FWGA 4YQVA 4V1Ag 1E6BA 3P2AA 5H5SA 2H66A 2I9HA 3O3TA 1F3BA 4PNGA 5IO2A 3LXTA 2B5XA 1TXXA 2GSSA 5CRHA 5JWRB 3WGXA 4BWQA 3FZ9A 2H8LA 3C73A 3AY8A 3HVVA 4FIWA 1DE2A 1ERUA 4L0UA 2J23A 2GQKA 4ML6A 2OA7A 1B8XA 2GGTA 1V40A 4O92A 1H75A 4QQ7A 2FY6A 2OE3A 4ECIA 3M1GA 1GSFA 3UL3A 2VD0A 3LSZA 2AYTA 4YH2A 5IPHA 3M0FA 1Z9HA 4IKHA 4PUAA 2HRFA 1XOAA 5C04A 5IOWA 1OC3A 3VI7A 4NXIA 2B6MA 2YZHA 3TRXA 3ZFBA 5HR2A 1TRWA 4JU5A 2YANA 1K3OA 3GH6A 4DSSA 1FVKA 3GL3A 2WZ9A 5FWGA 4XS6A 2VM2A 4MF7A 2EIRA 4F0CA 1QGVA 3QR6A 2X49A 3JCML 1SJZA 1ERWA 1AQXA 4NWYA 6GSWA 2A4HA 3EVIA 3RBTA 1EEJA 3CSIA 2MMZA 3CSJA 2F8FA 1XOBA 4K2XA 1ZYNA 2XHFA 2F8AA 1MD4A 2LS5A 2H1DA 4MNNA 2N5FA 2RUEA 5AGYA 4OO4A 2FD3A 5HR3A 1JLWA 2CAIA 3IHGA 2IIYA 3UAPA 6GSTA 2H73A 2DKHA 1ZYQB 4FO5A 1YKCA 1PN9A 4FH8A 2K6VA 3GIXA 2H0IA 1G6YA 4WETA 4KUNA 3VWVA 1FOVA 22GSA 4AF2A 1K0DA 3IR4A 1PX7A 4Q5FA 4N30A 1GH2A 1R7HA 2HXKA 1ZMAA 4MF6A 3EU4A 3WD6A 1E2YA 3MDKA 3OR5A 3TCOA 4ILFA 3HKRA 17GSA 1YY7A 4YQUA 2B1LA 1GWCA 1PX6A 2C3NA 3H93A 2H30A 3GURA 4OCFA 4KW6A 1R5AA 1SD8A 4K7OA 2MBTA 2WRTA 1ZL9A 2VD1A 3TJGA 5KEJA 4KX4A 3L0HA 2MMNA 2IJYA 1OE7A 1T3BA 2RM6A 1XWAA 2RM5A 5G1KA 5ABRA 2V6KA 2O8VB 2DIYA 4PX1A 1OC9A 3QPMA 3VLNA 1Z5YE 3IAM2 1XPVA 5J9BA 2H1BA 4IJIA 4DEJA 1VF3A 5IPGA 3KH7A 5IM9A 4K9ZA 5ECSA 1YDKA 2PMTA 3DVXA 3F3RA 4XIHA 3MAKA 1GUKA 1X5EA 3GSSA 5ECQB 1EWXA 2QKEA 2LNTA 4NV2A 3QAVA 1M99A 5B6MA 3ZMKA 4XCSA 4TR1B 2LRTA 3M9KA 1DE1A 5GAPD 4EC0A 3GRXA 4GWRA 3Q19A 4Z7XA 3UEMA 2H71A 2PGTA 2JSYA 4MPFA 2WJUA 1JZDA 1THXA 1GP1A 2DKIA 1LJRA 2X4AA 4MP4A 4OFTA 1SJ6A 3TJFA 2GZPA 2MMOA 2B7JA 3HVSA 1GLPA 1U3IA 3KD0A 5ECOB 1GLQA 4HI7A 4KAEA 4YKFA 1K3YA 5CYYA 2AB6A 2EIQA 3QDNA 4EXJA 4N11A 5F05A 4KDUA 3FR3A 2E2MA 5GSTA 3A5IA 3NIVA 2NBSA 4KCAA 3DRNA 4O5UA 2CV4A 1ZYEA 2L4CA 5HFKA 4IP1A 2IFQA 2XPDA 2C4JA 2OBKA 4BVYB 1LU4A 2MYGA 2H1AA 1BJXA 4GTUA 1MDKA 2K9FA 4TW5A 4ULXA 2X99A 1O8XA 1VF2A 4GCIA 4K8MA 5ID2A 2VL3A 3H8QA 2GS3A 4PQHA 1AW9A 13GSA 4HZ2A 2CVKA 2FGXA 2NDOA 1DSBA 2IL3A 3IK7A 3D4TA 3GKKA 1KEBA 4JRRA 3QOUA 1G0TA 4J56E 4MZBA 3LEFA 2QGVA 2ALBA 4TOPA 4IN0A 1R5PA 3KP8A 1Z6MA 4PGTA 3MWHA 1ERVA 3HZ8A 3W6GA 1WMJA 4HU7A 3D6IA 2XPEA 5HQPA 3PR8A 4MABA 1XVWA 3NZNA 4PURA 5B8AA 1NHOA 2KUCA 4PTSA 5ECMB 1EV9A 1MDIA 1SL1B 2B5YA 5ECHB 4JBBA 2V32A 1YEXA 2IMIA 5GSSA 2QC7A 2LJRA 2HRNA 3GA4A 3KTLA 3DMLA 4KDYA 1GSSA 1CQHA 1XIYA 1XCCA 3PGTA 4IJ3A 3R3EA 4J57E 4TR1A 4HJ2A 1T4ZA 2N5AA 4HQSA 4F03A 2HSYA 1SYRA 2O7KA 2YWNA 4ICYA 1TTZA 1WP0A 3P8WA 5CRGA 2HNLA 5JWQB 3F9UA 6GSXA 4ZBDA 20GSA 3D5JA 3M8NA 4CHSA 4IVFA 5AN1A 1QMVA 3UJ1A 5LCZA 1GL8A 5G5EA 1SK0A 5GAND 3NOFA 3LWAA 4Q5QA 1O85A 1GUHA 3DWVA 2M80A 2LRNA 1X9SB 3ZYWA 6GSSA 2WULA 4BVYA 5IO0A 3TOTA 5COHA 2CAQA 4N0VA 2C0FA 1XXUA 2ZUPA 3KP9A 2E2GA 3ZIJA 2PERA 5IMVA 1URMA 2YJHA 3DVWA 1MEKA 2VL2C 1YZXA 1GNWA 2R6KA 2HZEB 2PU9C 1Y6EA 1FB6A 2HE3A 3ZITA 2QSIA 3VURA 2FWFA 2PWJA 1GSYA 2H1GA 4D73A 1EV4A 1PN0A 3KZQA 2AHEA 4BVXB 5G30A 1OAZA 1TRVA 3WGEA 3J7Yk 2B5EA 1QQ2A 1PKWA 3IPZA 4L5LA 5JCWA 2L5OA 4PQIA 4ECCA 1N8JA 3IOSA 5HFGA 4Z2TA 5D9XA 5DAKA 4USSA 4FYBA 3GYKA 4IELA 2GTUA 4WXTA 3ZRDA 19GSA 4OFNA 2AAWA 1Q98A 3FKFA 4HZ4A 2FCHA 2HT9A 2YOIA 4WEYA 2FUG2 5D93A 3KH9A 2PPTA 1KTEA 3CYNA 1EOGA 4JZQA 2MMAA 1K0CA 12GSA 4MCUA 2DJ0A 2H6YA 1G7OA 3ZL5A 1K0BA 5G1LA 3QD9A 4K5SA 4MK3A 4LLRA 4ZB8A 5H5RA 3VFIA 2YCDA 2V41A 1WOUA 3D4MA 4CY6A 2H6XA 2IMFA 1NHYA 5J5NA 1TK8B 1THOA 4JE1A 1F3AA 1FB0A 1JLVA 1UN2A 3MIXA 3DXBA 3UOMA 4ACSA 8GSSA 3G9BA 10GSA 1O8WA 5ENUA 4HOJA 2HSMA 2YZUA 1B4PA 2LTKA 1TI3A 4PUFC 4MJCA 3E3EA 2DJ3A 1GRXA 5AIXA 2HZEA 2N5BA 4ZL7A 4X1UA 4RQXA 2YWMA 1B9YC 1XZOA 3CRTA 4LL4B 1UA5A 2VCTA 4GSNA 3CTGA 3EPTA 4HU9A 4ZIJA 3ERGA 3H4KA 3VPQA 2GLRA 2H0HA 1ABAA 5F8BA 5CNWA 4MMMA 3TRPA 1GUMA 5IQYA 5G31A 1B48A 2AV4A 3R2QA 1QFNA 4BL7B 4DSRA 2M72A 4DVCA 3IA1A 2HRKA 4TR4A 1HNCA 4YKGA 2CQ9A 4RQRA 4G10A 2L59A 2QA1A 1T1VA 4K0NA 2HI7A 1EEMA 1S3DA 3F6DA 2Z9SA 1F2EA 2A4VA 3FR6A 3N9JA 1BEDA 2IPAA 1GSQA 4JEDA 1JZWA 2LJKA 5KOWA 4ZL9A 1TJDA 4MDCA 1PGTA 5C00A 5KOXA 5BRTA 3O6TA 1GTIA 2VOCA 2AJQB 1Q4JA 4N10A 2DJJA 5DDLA 2AUVA 1Y25A 4MLYA 3IDVA 4V2NA 3D0ZA 1RQMA 2DMMA 3A2WA 2WB9A 5IMFA 4I8BA 4BA7A 1OVNA 4G0KA 1SKSB 3C71A 2LUSA 2P31A 1OC8A 3TUEA 5LD0A 2VCQA 2WDUA 4PNFA 1EGRA 2TRXA 2ZNMA 3IV4A 2XBIA 3UBLA 4IBPA 3FZ4A 3GTUB 3GUSA 3ZZXA 2RUFA 5FHIA 4X0XA 3ISOA 2K8VA 4WKWA 5IOXA 1GTBA 1OKDA 4KH7A 5A4UA 4IP6A 1B9XC 3CTFA 3I6AA 2LRCA 4MJEA 14GSA 3IBHA 1SKWB 4ZB9A 4V1Ap 11GSA 3DGQA 3GX0A 4ML1A 4PXOA 1AQWA 4BL7A 3EWLA 3IC8A 2VCXA 2L5LA 3VWUA 3KIJA 4Z2RA 1QXHA 4WBRD 5D9WA 3FHKA 2C3QA 2LNSA 3ZFLA 2RLIA 5CAXA 5DJMA 2G2QA 3VK9A 3ZLPA 5LNKe 3RPPA 4KNDA 4PQ1A 3GKXA 3Q6OA 3F4RA 4KDXA 4WF5A 1PMTA 2JACA 2B3SA 1A24A 5CREA 1MDJA 5A4WA 1TP9A 3ZVJD 1QUWA 2L6DA 2C8UA 3H1NA 2EIOA 3M3MA 4K0GA 4GXZA 3DD3A 4TR0A 5CRWA 3TJKA 1A8LA 1PQNA 5DVBA 2KOKA 3EMPA 3US3A 2VAFA 1TRUA 2JADA 2WGRA 5KN2A 2VLUA 3BBYA 3A2XA 1VRSD 4AJ6A 3UBKA 2CVBA 4WF4A 3HHVA 2DMLA 4YAPA 4F0BA 1Z3EA 3GHAA 1EGOA 1NSWA 1ON4A 4I2UA 1W89A 2GZYA 5KN3A 3ZVJA 4GSTA 4K1FA 2GSRA 1GSUA 3F6FA 1YF0A 2WS2A 1PA3A 3IAS2 4RI6A 4EF0A 3WGDA 1IYIA 4EE0A 4WR4A 4POKA 1T8EB 4EDZA 2K8SA 4IQ1A 5D9TA 3IE3A 3GTUA 4MH3A 3PINA 2GDRA 2P5QA 4ZXGA 4DSQA 1SD9A 1YQ1A 3I43A 1TK5B 4POLA 3FR9A 3KXOA 3LXZA 3HZ4A 3UMAA 2LEGA 4G19A 1UC7A 4I5QA 5ECPB 2E7PA 3CMIA 3GNJA 2R0CA 5BMUA 3UVHA 1AAZA 4K5RA 3WT2A 4OO5A 4CW9A 5E4WA 4L0WA 2KLXA 1S3AA 4AJ8A 2JZSA 4ZB6A 4EL1A 3APSA 3ZTLA 4QL7A 4MJAA 1C72A 4O5RA 5D73A 1BX9A 3C1SA 1SJIA 1O81A 1VF1A 3HJMA 4I97A 4WBJA 2GSQA 4MF5A 1KBNA 4TXVA 5DCGA 5DJLA 4I6XA 1TKDB 1U88A 5EPFA 1RW1A 3U6VA 5CO3A 2TIRA 4FYCA 3F3QA 2REMA 3FYGA 2R5GA 1X5DA 3BD2A 3BCKA 1PL2A 4YQMA 1M2AA 1UVZA 1IYHA 2VM1A 1K0AA 3L4NA 3KEBA 4IW9A 4HDEA 1WJKA 1F9MA 2VIMA 1TI1A 3IXRA 1XW9A 3L78A 3G7IA 4K7IA 1AXDA 4XRAA 1FW1A 1XWBA 3RHCA 2HLSA 4ZILA 3LYPA 1EP8A 1YEPA 2B1KA 5IMDA 2PUKC 4F82A 2H75A 3SBCA 4L5OA 4MPGA 5DQSA 3RHBA 3LGCA 5INYA 3Q74A 6GSVA 2PN8A 3TKSA 2F3MA 5IMAA 2F51A 4LMWA 1M9AA 5GZZB 1JFUA 3TKQA 2LSTA 4MZCA 4EKZA 2FA4A 4KA0A 2DJ2A 1TOFA 1ACVA 3EE2A 2VLTA 4TN8A 2VL2A 1FVJA 2EC4A 1HD2A 2GQMA 1J08A 4BWSA 5JWOB 4HQZA 2HZFA 2OJLA 3WYWA 1YJ6A 2IMKA 5EY6A 1JHBA 3LJRA 2A2RA 2TRCP 3L9SA 2I81A 3Q18A 2CZ3A 4NHWA 4EUYA 3C7MA 5HFIA 2OADA 4LA1A 4ZL8A 1K0OA 2HRAA 1HNAA 3D21A 1HNBA 2PVOC 4O7HA 1AIUA 1EOHA 2DJKA 1U87A 1O6JA 5IIZA 1Z7RA 3LW9A 4KF9A 3CBUA 1FO5A 3VWWA 3VPTA 3LORA 2KP2A 4ECBA 5DQYA 1YKAA 3FZ5A 3O76A 18GSA 1ILOA 6GSUA 3FRCA 3TJJA 1PRXA 2VCZA 4EVMA 3FK8A 4K7NA 1ZZYA 3HDCA 5L71A 1SKRB 3ERWA 4L8EA 2RIIA 1GULA 3UIWA 3QFAC 1SENA 3KJYA 3J7Yb 3VI5A 1VF4A 2FHEA 1HQOA 3GKMA 4Q5RA 1F6MC 3GSTA 4MH2A 1TU8A 2XC2A 3TKSE 1O73A 2GVPA 1GTAA 2GT5A 2IMDA 5G2ZA 1T00A 4P3YB 4NAXA 2V6OA 2DBCA 1GNEA 4ISDA 3HJOA 2LQOA 2B7KA 4IGJA 2LV3A 2GQLA 3QCPA 3WT1A 3HJPA 4IQAA 5J41A 3LG6A 2ES7A 2VL9A 4EIPA 4IHUA 3GMFA 2GT6A 1KNGA 1X5CA 4WR5A 1BAYA 1GSEA 3A2VA 4GQCA 1A23A 4JR4A 2X8HA 2CX4A 6GSYA 3GFKA 2ON5A 16GSA 4ECJA 5CP1A 2PVQA 4XHMA 3LYKA 4XS1A 3GV1A 2OACA 3TKPA 1J9BA 4K2DA 4K6XA 2M46A 2V2GA 4E8EA 3E9JB 4BVXA 2CX3A 3RPNA 3W8JA 2DC5A 4KSOA 2E0QA 3QFBC 1K0NA 1A2LA 2ZCTA 1R26A 3ED3A 3U5RE 3TGZA 4N0ZA 2CA8A 1NM3A 2BJXA 2IWTA 3IC4A 3CRUA 2YP6A 3CSHA 2GZZA 5F0GA 4OD7A 1ML6A 4AGSA 1M2BA 3V1WA 5ELGA 1K0MA 2JZRA 4O32A 1M9BA 5KN1A 1HYUA 3DKSA 1BYEA 2O87A 3APOA 5AISA 1OC9B 5HR1A 4G9HA 1WWJA 1XWKA 4HS1A 3DYRA 1X9WB 1XBSA 1AQVA 4BPYA 3I69A 3W8SA 2L6CA 5KN0A 3A5WA 4E8HA 1A0FA 3UVTA 5B7CA 2DJ1A 2C80A 1WRYA 3TOUA 5J3RA 2VCVA 1FOHA 1G7EA 1V58A 2R0GA 1G6WA 7GSSA 4ID0A 1SK1A 2R4VA 3HCZA 2YWOA 3K8NA 3RAZA 3F4SA 2A2SA 2X8GA 4LL1B 3TKRA 2H72A 4GF0A 4TXOB 1V98A 4EO3A 1OE8A 1M0UA 1TU7A 3C8EA 3QAWA 1WIKA 1O7UA 2R2JA 3HY2A 3SWLA 4Z2UA 5D96A 3UARA 2CVDA 1QK8A 1EP7A 2IFQB 3PPUA 3RDWA 4V2MA 1XW5A 3FMWA 2V1MA 4KGIA 2LKUA 1FHEA 2C1YA 3EC3A 2YPMA 5HR0A 2O85A 4MA9A 4TRXA 2HYXA 2C0EA 5ID2B 1T4YA 3F4TA 1EZKA 5ECKB 4FQUA 4OCEA 4A5PA 3KCMA 1RK4A 2OE0A 3IK9A 4G0IA 5FT3A 1F37A 5DCHA 1VGLA 1ST9A 2I4AA 4F2IA 1CQGA 3BCIA 1A2MA 3BOAA 3GH9A 2IMEA 2F9SA 4KE3A 2NTOA 3KM6A 5IMZA 2UZ8A 5A4VA 1JZOA 5IMCA 2VCWA 5E59A 4OMVA 1XVQA 3N5OA 3GN3A 1BQ7A 3ME8A 4NMUA 2A2PA 2NVLA 4V2LA 1X9MB 1WPIA 4F9ZA 3LQ7A 3G7JA 1USBA 1GTUA 2C3TA 1X0RA 2NPBA 2K18A 3A3TA 1FAAA 2YWIA 2FWEA 1JZRA 2X64A 3C1RA 1XWCA 1I5GA 3APQA 1PL1A 2H76A 4POMA 2VLVA 3KGKA 4TXOA 3MSZA 1T7PB 1ZGNA 4X4JA 2X8CA 1B4QA 1MTCA 4EIQA 2GSTA 2HFDA 3EU3A 3MYDA 4KB3A 4ZBAA 1FG4A 5ELAA 4NHZA 1MD3A 3F8UA 3TB2A 1W4VA 2I3YA 3DEXA 2G0FA 3TRQA 1A0RP 1YF1A 5F07A 2C0GA 1K3LA 1ZYPA 4YAVA 3KMNA 2DLXA 1AUCA 2OBIA 1S3CA 1TDIA 4CDOA 2KP1A 2H74A 1PD21 2H0GA 4RUVA 5G5FA 5JCGA 1A8YA 4GQFA 4LMVA 3KMOA 1OKTA 3FY7A 1Z7PA 4H86A 3BJ5A 3QAGA 3VWXA 2YNXA 3MNGA 1R4WA 1TRSA 1J0FA 2H19A 2JU5A 5DBQA 2R0PA 3P90A 5JCUA 4D73B 2CZ2A 4CY8A 2KHPA 1M7TA 4MZWA 5AIVA 2OE1A 5ECRB 2DSAA 3S9FA 4XS4B 1M2DA 4Q5NA 2D2ZA 1I9DA 3GL5A 1A2JA 2C0DA 1ERTA 2MZCA 5DAKB 5D8IA 3ZMLA 1GSDA 3HD5A 3ME7A 4O5QA 1SK2A 3EURA 3HXSA 3EMXA 4RI7A 1TK0B 2P0GA 3F0IA 3DIEA 1SU9A 4TR3A 2YJ7A 4HUAA 3M9JA 5H5QA 1AC1A 1U3AA 2BMXA 5DALB 3TJBA 4KCEA 2H6ZA 4IS0A 4FYUA 5EL8A 3KTBA 4XTSA 1WE0A 4HJMA 4MJBA 4G0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XBQ A;  1XW6 A;  2J9H A;  2MBS A;  2HSH A;  4QL9 A;  1ZOF A;  2R3X A;  2PBJ A;  5D9V A;  2OKA A;  4JR6 A;  4KSM A;  3I9V 2;  1H4O A;  3IHQ A;  2LQQ A;  3TKS C;  2L4Q A;  1SL0 B;  2YV9 A;  1SL2 B;  2YN1 A;  3D22 A;  3GKN A;  3HA9 A;  4X43 A;  4EDY A;  4TKY A;  1U6T A;  3HVX A;  4OWY A;  2VUP A;  3TDG A;  3H79 A;  1XWG A;  1Z6N A;  1NW2 A;  4POB A;  3E0U A;  2FWH A;  1XFL A;  4GLT A;  4XRD A;  5B6N A;  3L9U A;  3L9V A;  3GX8 A;  2R37 A;  3FZA A;  2JSZ A;  2YV7 A;  3ZIV A;  5EVO A;  4G2E A;  2FNO A;  3ERF A;  1PSQ A;  4ZBB A;  2JL4 A;  9GSS A;  4NPB A;  2VO4 A;  3FEU A;  3LFL A;  4XS4 A;  4OFM A;  3IRA A;  4J2F A;  4DSS B;  4GRF A;  3ZRE A;  1DBY A;  2ON7 A;  2I1U A;  1V2A A;  3CXG A;  3EIN A;  2WCI A;  2FA8 A;  2L57 A;  1TW9 A;  2IN3 A;  2O89 A;  4AJ7 A;  1OYJ A;  2H01 A;  5J4U A;  2LJA A;  1SYX A;  3P7X A;  1V9W A;  1DUG A;  1LBK A;  1BG5 A;  1PKZ A;  1V57 A;  1N2A A;  2WFC A;  5CRD A;  5F06 A;  2CT6 A;  2P5R A;  4I2T A;  2BTO T;  3G7Y A;  5DAL A;  5ECN B;  1ZCP A;  3FW2 A;  4TVE A;  5J9C A;  5ECL B;  2DIZ A;  3HYP A;  2JZT A;  3QMX A;  5B8B A;  4HEA 2;  3EYT A;  3PH9 A;  4GSS A;  5ECI B;  3F63 A;  5A5K A;  2H70 A;  2FLS A;  4NV5 A;  2FWG A;  4YQV A;  4V1A g;  1E6B A;  3P2A A;  5H5S A;  2H66 A;  2I9H A;  3O3T A;  1F3B A;  4PNG A;  5IO2 A;  3LXT A;  2B5X A;  1TXX A;  2GSS A;  5CRH A;  5JWR B;  3WGX A;  4BWQ A;  3FZ9 A;  2H8L A;  3C73 A;  3AY8 A;  3HVV A;  4FIW A;  1DE2 A;  1ERU A;  4L0U A;  2J23 A;  2GQK A;  4ML6 A;  2OA7 A;  1B8X A;  2GGT A;  1V40 A;  4O92 A;  1H75 A;  4QQ7 A;  2FY6 A;  2OE3 A;  4ECI A;  3M1G A;  1GSF A;  3UL3 A;  2VD0 A;  3LSZ A;  2AYT A;  4YH2 A;  5IPH A;  3M0F A;  1Z9H A;  4IKH A;  4PUA A;  2HRF A;  1XOA A;  5C04 A;  5IOW A;  1OC3 A;  3VI7 A;  4NXI A;  2B6M A;  2YZH A;  3TRX A;  3ZFB A;  5HR2 A;  1TRW A;  4JU5 A;  2YAN A;  1K3O A;  3GH6 A;  4DSS A;  1FVK A;  3GL3 A;  2WZ9 A;  5FWG A;  4XS6 A;  2VM2 A;  4MF7 A;  2EIR A;  4F0C A;  1QGV A;  3QR6 A;  3JCM L;  1SJZ A;  1ERW A;  1AQX A;  4NWY A;  6GSW A;  3EVI A;  3RBT A;  1EEJ A;  3CSI A;  2MMZ A;  3CSJ A;  2F8F A;  1XOB A;  2XHF A;  2F8A A;  1MD4 A;  2LS5 A;  2H1D A;  2N5F A;  2RUE A;  5AGY A;  4OO4 A;  2FD3 A;  5HR3 A;  1JLW A;  2CAI A;  2IIY A;  3UAP A;  6GST A;  2H73 A;  1ZYQ B;  4FO5 A;  1YKC A;  1PN9 A;  4FH8 A;  2K6V A;  3GIX A;  2H0I A;  1G6Y A;  4WET A;  4KUN A;  3VWV A;  1FOV A;  22GS A;  4AF2 A;  1K0D A;  3IR4 A;  1PX7 A;  4Q5F A;  4N30 A;  1GH2 A;  1R7H A;  2HXK A;  1ZMA A;  4MF6 A;  3EU4 A;  3WD6 A;  1E2Y A;  3MDK A;  3OR5 A;  3TCO A;  4ILF A;  3HKR A;  17GS A;  1YY7 A;  4YQU A;  2B1L A;  1GWC A;  1PX6 A;  2C3N A;  3H93 A;  2H30 A;  3GUR A;  4OCF A;  4KW6 A;  1R5A A;  1SD8 A;  4K7O A;  2MBT A;  2WRT A;  1ZL9 A;  2VD1 A;  3TJG A;  5KEJ A;  4KX4 A;  3L0H A;  2MMN A;  2IJY A;  1OE7 A;  1T3B A;  2RM6 A;  1XWA A;  2RM5 A;  5G1K A;  5ABR A;  2V6K A;  2O8V B;  2DIY A;  4PX1 A;  1OC9 A;  3QPM A;  3VLN A;  1Z5Y E;  3IAM 2;  1XPV A;  5J9B A;  2H1B A;  4IJI A;  4DEJ A;  1VF3 A;  5IPG A;  3KH7 A;  5IM9 A;  4K9Z A;  5ECS A;  1YDK A;  2PMT A;  3DVX A;  3F3R A;  4XIH A;  3MAK A;  1GUK A;  1X5E A;  3GSS A;  5ECQ B;  1EWX A;  2QKE A;  2LNT A;  4NV2 A;  3QAV A;  1M99 A;  5B6M A;  3ZMK A;  4XCS A;  4TR1 B;  2LRT A;  3M9K A;  1DE1 A;  5GAP D;  4EC0 A;  3GRX A;  4GWR A;  3Q19 A;  4Z7X A;  3UEM A;  2H71 A;  2PGT A;  2JSY A;  4MPF A;  2WJU A;  1JZD A;  1THX A;  1GP1 A;  1LJR A;  4MP4 A;  4OFT A;  1SJ6 A;  3TJF A;  2GZP A;  2MMO A;  2B7J A;  3HVS A;  1GLP A;  1U3I A;  3KD0 A;  5ECO B;  1GLQ A;  4HI7 A;  4KAE A;  1K3Y A;  5CYY A;  2AB6 A;  2EIQ A;  3QDN A;  4EXJ A;  4N11 A;  5F05 A;  4KDU A;  3FR3 A;  2E2M A;  5GST A;  3NIV A;  2NBS A;  4KCA A;  3DRN A;  2CV4 A;  1ZYE A;  2L4C A;  5HFK A;  4IP1 A;  2IFQ A;  2XPD A;  2C4J A;  2OBK A;  1LU4 A;  2MYG A;  2H1A A;  1BJX A;  4GTU A;  1MDK A;  2K9F A;  4TW5 A;  4ULX A;  2X99 A;  1O8X A;  1VF2 A;  4GCI A;  4K8M A;  5ID2 A;  2VL3 A;  3H8Q A;  2GS3 A;  4PQH A;  1AW9 A;  13GS A;  4HZ2 A;  2CVK A;  2FGX A;  2NDO A;  1DSB A;  2IL3 A;  3IK7 A;  3D4T A;  3GKK A;  1KEB A;  4JRR A;  3QOU A;  1G0T A;  4J56 E;  4MZB A;  3LEF A;  2QGV A;  2ALB A;  4TOP A;  4IN0 A;  1R5P A;  3KP8 A;  1Z6M A;  4PGT A;  3MWH A;  1ERV A;  3HZ8 A;  3W6G A;  1WMJ A;  4HU7 A;  3D6I A;  2XPE A;  5HQP A;  3PR8 A;  4MAB A;  1XVW A;  3NZN A;  4PUR A;  5B8A A;  1NHO A;  2KUC A;  5ECM B;  1EV9 A;  1MDI A;  1SL1 B;  2B5Y A;  5ECH B;  4JBB A;  2V32 A;  1YEX A;  2IMI A;  5GSS A;  2QC7 A;  2LJR A;  2HRN A;  3GA4 A;  3KTL A;  3DML A;  4KDY A;  1GSS A;  1CQH A;  1XIY A;  1XCC A;  3PGT A;  4IJ3 A;  4J57 E;  4TR1 A;  4HJ2 A;  1T4Z A;  2N5A A;  4HQS A;  4F03 A;  2HSY A;  1SYR A;  2O7K A;  2YWN A;  1TTZ A;  1WP0 A;  3P8W A;  5CRG A;  2HNL A;  5JWQ B;  3F9U A;  6GSX A;  4ZBD A;  20GS A;  3D5J A;  3M8N A;  4CHS A;  4IVF A;  5AN1 A;  1QMV A;  3UJ1 A;  5LCZ A;  1GL8 A;  5G5E A;  1SK0 A;  5GAN D;  3NOF A;  3LWA A;  4Q5Q A;  1O85 A;  1GUH A;  3DWV A;  2M80 A;  2LRN A;  1X9S B;  3ZYW A;  6GSS A;  2WUL A;  4BVY A;  5IO0 A;  3TOT A;  5COH A;  2CAQ A;  4N0V A;  2C0F A;  1XXU A;  2ZUP A;  3KP9 A;  2E2G A;  3ZIJ A;  2PER A;  5IMV A;  1URM A;  2YJH A;  3DVW A;  1MEK A;  2VL2 C;  1YZX A;  1GNW A;  2R6K A;  2HZE B;  2PU9 C;  1Y6E A;  1FB6 A;  2HE3 A;  3ZIT A;  2QSI A;  3VUR A;  2FWF A;  2PWJ A;  1GSY A;  2H1G A;  4D73 A;  1EV4 A;  3KZQ A;  2AHE A;  5G30 A;  1OAZ A;  1TRV A;  3WGE A;  3J7Y k;  2B5E A;  1QQ2 A;  1PKW A;  3IPZ A;  4L5L A;  5JCW A;  2L5O A;  4PQI A;  4ECC A;  1N8J A;  3IOS A;  5HFG A;  5D9X A;  5DAK A;  4FYB A;  3GYK A;  4IEL A;  2GTU A;  4WXT A;  3ZRD A;  19GS A;  4OFN A;  2AAW A;  1Q98 A;  3FKF A;  4HZ4 A;  2FCH A;  2HT9 A;  2YOI A;  4WEY A;  2FUG 2;  5D93 A;  3KH9 A;  2PPT A;  1KTE A;  3CYN A;  1EOG A;  4JZQ A;  2MMA A;  1K0C A;  12GS A;  4MCU A;  2DJ0 A;  2H6Y A;  1G7O A;  3ZL5 A;  1K0B A;  5G1L A;  3QD9 A;  4MK3 A;  4LLR A;  4ZB8 A;  5H5R A;  3VFI A;  2YCD A;  2V41 A;  1WOU A;  3D4M A;  2H6X A;  2IMF A;  1NHY A;  5J5N A;  1TK8 B;  1THO A;  4JE1 A;  1F3A A;  1FB0 A;  1JLV A;  1UN2 A;  3DXB A;  3UOM A;  4ACS A;  8GSS A;  3G9B A;  10GS A;  1O8W A;  5ENU A;  4HOJ A;  2YZU A;  1B4P A;  2LTK A;  1TI3 A;  4PUF C;  4MJC A;  3E3E A;  2DJ3 A;  1GRX A;  5AIX A;  2HZE A;  2N5B A;  4ZL7 A;  4X1U A;  4RQX A;  2YWM A;  1B9Y C;  1XZO A;  3CRT A;  4LL4 B;  1UA5 A;  2VCT A;  4GSN A;  3CTG A;  4HU9 A;  4ZIJ A;  3ERG A;  3H4K A;  3VPQ A;  2GLR A;  2H0H A;  1ABA A;  5F8B A;  5CNW A;  4MMM A;  3TRP A;  1GUM A;  5IQY A;  5G31 A;  1B48 A;  2AV4 A;  3R2Q A;  1QFN A;  4DSR A;  2M72 A;  4DVC A;  3IA1 A;  4TR4 A;  1HNC A;  2CQ9 A;  4RQR A;  4G10 A;  2L59 A;  1T1V A;  4K0N A;  2HI7 A;  1EEM A;  1S3D A;  3F6D A;  2Z9S A;  1F2E A;  2A4V A;  3FR6 A;  3N9J A;  1BED A;  2IPA A;  1GSQ A;  4JED A;  1JZW A;  2LJK A;  4ZL9 A;  1TJD A;  4MDC A;  1PGT A;  5C00 A;  3O6T A;  1GTI A;  2VOC A;  2AJQ B;  1Q4J A;  4N10 A;  2DJJ A;  5DDL A;  2AUV A;  1Y25 A;  4MLY A;  3IDV A;  4V2N A;  3D0Z A;  1RQM A;  2DMM A;  3A2W A;  2WB9 A;  5IMF A;  4I8B A;  4BA7 A;  1OVN A;  1SKS B;  3C71 A;  2LUS A;  2P31 A;  1OC8 A;  3TUE A;  5LD0 A;  2VCQ A;  2WDU A;  4PNF A;  1EGR A;  2TRX A;  2ZNM A;  3IV4 A;  2XBI A;  3UBL A;  4IBP A;  3FZ4 A;  3GTU B;  3GUS A;  3ZZX A;  2RUF A;  5FHI A;  4X0X A;  3ISO A;  2K8V A;  4WKW A;  5IOX A;  1GTB A;  1OKD A;  4KH7 A;  5A4U A;  4IP6 A;  1B9X C;  3CTF A;  3I6A A;  2LRC A;  4MJE A;  14GS A;  3IBH A;  1SKW B;  4ZB9 A;  4V1A p;  11GS A;  3DGQ A;  3GX0 A;  4ML1 A;  4PXO A;  1AQW A;  4BL7 A;  3EWL A;  2VCX A;  2L5L A;  3VWU A;  3KIJ A;  1QXH A;  4WBR D;  5D9W A;  3FHK A;  2C3Q A;  2LNS A;  3ZFL A;  2RLI A;  5CAX A;  5DJM A;  2G2Q A;  3VK9 A;  3ZLP A;  5LNK e;  3RPP A;  4KND A;  4PQ1 A;  3GKX A;  3Q6O A;  3F4R A;  4KDX A;  4WF5 A;  1PMT A;  2JAC A;  2B3S A;  1A24 A;  5CRE A;  1MDJ A;  5A4W A;  1TP9 A;  3ZVJ D;  1QUW A;  2L6D A;  2C8U A;  3H1N A;  2EIO A;  3M3M A;  4K0G A;  4GXZ A;  3DD3 A;  4TR0 A;  5CRW A;  3TJK A;  1A8L A;  1PQN A;  5DVB A;  2KOK A;  3EMP A;  3US3 A;  2VAF A;  1TRU A;  2JAD A;  2WGR A;  5KN2 A;  2VLU A;  3BBY A;  3A2X A;  1VRS D;  4AJ6 A;  3UBK A;  2CVB A;  4WF4 A;  3HHV A;  2DML A;  4YAP A;  4F0B A;  1Z3E A;  3GHA A;  1EGO A;  1NSW A;  1ON4 A;  4I2U A;  1W89 A;  2GZY A;  5KN3 A;  3ZVJ A;  4GST A;  4K1F A;  2GSR A;  1GSU A;  3F6F A;  1YF0 A;  2WS2 A;  1PA3 A;  3IAS 2;  4RI6 A;  4EF0 A;  3WGD A;  1IYI A;  4EE0 A;  4WR4 A;  4POK A;  1T8E B;  4EDZ A;  2K8S A;  4IQ1 A;  5D9T A;  3IE3 A;  3GTU A;  4MH3 A;  3PIN A;  2GDR A;  2P5Q A;  4ZXG A;  4DSQ A;  1SD9 A;  1YQ1 A;  3I43 A;  1TK5 B;  4POL A;  3FR9 A;  3KXO A;  3LXZ A;  3HZ4 A;  3UMA A;  2LEG A;  4G19 A;  1UC7 A;  4I5Q A;  5ECP B;  2E7P A;  3CMI A;  3GNJ A;  3UVH A;  1AAZ A;  3WT2 A;  4OO5 A;  4CW9 A;  5E4W A;  4L0W A;  2KLX A;  1S3A A;  4AJ8 A;  2JZS A;  4ZB6 A;  4EL1 A;  3APS A;  3ZTL A;  4QL7 A;  4MJA A;  1C72 A;  4O5R A;  5D73 A;  1BX9 A;  3C1S A;  1SJI A;  1O81 A;  1VF1 A;  3HJM A;  4I97 A;  4WBJ A;  2GSQ A;  4MF5 A;  1KBN A;  4TXV A;  5DCG A;  5DJL A;  4I6X A;  1TKD B;  1U88 A;  5EPF A;  1RW1 A;  3U6V A;  5CO3 A;  2TIR A;  4FYC A;  3F3Q A;  2REM A;  3FYG A;  2R5G A;  1X5D A;  3BD2 A;  3BCK A;  1PL2 A;  4YQM A;  1M2A A;  1UVZ A;  1IYH A;  2VM1 A;  1K0A A;  3L4N A;  3KEB A;  4IW9 A;  4HDE A;  1WJK A;  1F9M A;  2VIM A;  1TI1 A;  3IXR A;  1XW9 A;  3L78 A;  3G7I A;  4K7I A;  1AXD A;  4XRA A;  1FW1 A;  1XWB A;  3RHC A;  2HLS A;  4ZIL A;  3LYP A;  1EP8 A;  1YEP A;  2B1K A;  5IMD A;  2PUK C;  4F82 A;  2H75 A;  3SBC A;  4L5O A;  4MPG A;  5DQS A;  3RHB A;  3LGC A;  5INY A;  3Q74 A;  6GSV A;  2PN8 A;  3TKS A;  2F3M A;  5IMA A;  2F51 A;  4LMW A;  1M9A A;  5GZZ B;  1JFU A;  3TKQ A;  2LST A;  4MZC A;  4EKZ A;  2FA4 A;  4KA0 A;  2DJ2 A;  1TOF A;  1ACV A;  3EE2 A;  2VLT A;  4TN8 A;  2VL2 A;  1FVJ A;  2EC4 A;  1HD2 A;  2GQM A;  1J08 A;  4BWS A;  5JWO B;  4HQZ A;  2HZF A;  2OJL A;  3WYW A;  1YJ6 A;  2IMK A;  5EY6 A;  1JHB A;  3LJR A;  2A2R A;  2TRC P;  3L9S A;  2I81 A;  3Q18 A;  2CZ3 A;  4NHW A;  4EUY A;  3C7M A;  5HFI A;  2OAD A;  4LA1 A;  4ZL8 A;  1K0O A;  1HNA A;  3D21 A;  1HNB A;  2PVO C;  4O7H A;  1AIU A;  1EOH A;  2DJK A;  1U87 A;  1O6J A;  5IIZ A;  1Z7R A;  3CBU A;  1FO5 A;  3VWW A;  3VPT A;  3LOR A;  2KP2 A;  4ECB A;  5DQY A;  1YKA A;  3FZ5 A;  3O76 A;  18GS A;  1ILO A;  6GSU A;  3FRC A;  3TJJ A;  1PRX A;  2VCZ A;  4EVM A;  3FK8 A;  4K7N A;  1ZZY A;  3HDC A;  5L71 A;  1SKR B;  3ERW A;  4L8E A;  2RII A;  1GUL A;  3UIW A;  3QFA C;  1SEN A;  3KJY A;  3J7Y b;  3VI5 A;  1VF4 A;  2FHE A;  1HQO A;  3GKM A;  4Q5R A;  1F6M C;  3GST A;  4MH2 A;  1TU8 A;  2XC2 A;  3TKS E;  1O73 A;  2GVP A;  1GTA A;  2GT5 A;  2IMD A;  5G2Z A;  1T00 A;  4P3Y B;  4NAX A;  2V6O A;  2DBC A;  1GNE A;  4ISD A;  3HJO A;  2LQO A;  2B7K A;  4IGJ A;  2LV3 A;  2GQL A;  3QCP A;  3WT1 A;  3HJP A;  4IQA A;  5J41 A;  3LG6 A;  2ES7 A;  2VL9 A;  4IHU A;  3GMF A;  2GT6 A;  1KNG A;  1X5C A;  4WR5 A;  1BAY A;  1GSE A;  3A2V A;  4GQC A;  1A23 A;  4JR4 A;  2X8H A;  2CX4 A;  6GSY A;  3GFK A;  2ON5 A;  16GS A;  4ECJ A;  5CP1 A;  2PVQ A;  4XHM A;  3LYK A;  4XS1 A;  3GV1 A;  2OAC A;  3TKP A;  1J9B A;  4K2D A;  4K6X A;  2M46 A;  2V2G A;  4E8E A;  3E9J B;  4BVX A;  2CX3 A;  3RPN A;  3W8J A;  2DC5 A;  4KSO A;  2E0Q A;  3QFB C;  1K0N A;  1A2L A;  2ZCT A;  1R26 A;  3ED3 A;  3U5R E;  3TGZ A;  4N0Z A;  2CA8 A;  1NM3 A;  2BJX A;  2IWT A;  3IC4 A;  3CRU A;  2YP6 A;  3CSH A;  2GZZ A;  5F0G A;  4OD7 A;  1ML6 A;  4AGS A;  1M2B A;  3V1W A;  5ELG A;  1K0M A;  2JZR A;  4O32 A;  1M9B A;  5KN1 A;  1HYU A;  3DKS A;  1BYE A;  2O87 A;  3APO A;  5AIS A;  1OC9 B;  5HR1 A;  4G9H A;  1WWJ A;  1XWK A;  4HS1 A;  3DYR A;  1X9W B;  1XBS A;  1AQV A;  4BPY A;  3I69 A;  3W8S A;  2L6C A;  5KN0 A;  3A5W A;  4E8H A;  1A0F A;  3UVT A;  5B7C A;  2DJ1 A;  2C80 A;  1WRY A;  3TOU A;  5J3R A;  2VCV A;  1G7E A;  1V58 A;  1G6W A;  7GSS A;  4ID0 A;  1SK1 A;  2R4V A;  3HCZ A;  2YWO A;  3K8N A;  3RAZ A;  3F4S A;  2A2S A;  2X8G A;  4LL1 B;  3TKR A;  2H72 A;  4GF0 A;  4TXO B;  1V98 A;  4EO3 A;  1OE8 A;  1M0U A;  1TU7 A;  3C8E A;  3QAW A;  1WIK A;  1O7U A;  2R2J A;  3HY2 A;  3SWL A;  5D96 A;  3UAR A;  2CVD A;  1QK8 A;  1EP7 A;  2IFQ B;  3RDW A;  4V2M A;  1XW5 A;  2V1M A;  4KGI A;  2LKU A;  1FHE A;  2C1Y A;  3EC3 A;  2YPM A;  5HR0 A;  2O85 A;  4MA9 A;  4TRX A;  2HYX A;  2C0E A;  5ID2 B;  1T4Y A;  3F4T A;  1EZK A;  5ECK B;  4OCE A;  3KCM A;  1RK4 A;  2OE0 A;  3IK9 A;  5FT3 A;  1F37 A;  5DCH A;  1VGL A;  1ST9 A;  2I4A A;  4F2I A;  1CQG A;  3BCI A;  1A2M A;  3BOA A;  3GH9 A;  2IME A;  2F9S A;  4KE3 A;  2NTO A;  3KM6 A;  5IMZ A;  5A4V A;  1JZO A;  5IMC A;  2VCW A;  5E59 A;  4OMV A;  1XVQ A;  3N5O A;  3GN3 A;  1BQ7 A;  3ME8 A;  4NMU A;  2NVL A;  4V2L A;  1X9M B;  1WPI A;  4F9Z A;  3LQ7 A;  3G7J A;  1USB A;  1GTU A;  2C3T A;  1X0R A;  2NPB A;  2K18 A;  3A3T A;  1FAA A;  2YWI A;  2FWE A;  1JZR A;  2X64 A;  3C1R A;  1XWC A;  1I5G A;  3APQ A;  1PL1 A;  2H76 A;  4POM A;  2VLV A;  3KGK A;  4TXO A;  3MSZ A;  1T7P B;  1ZGN A;  2X8C A;  1B4Q A;  1MTC A;  2GST A;  2HFD A;  3EU3 A;  4KB3 A;  4ZBA A;  1FG4 A;  5ELA A;  4NHZ A;  1MD3 A;  3F8U A;  3TB2 A;  1W4V A;  2I3Y A;  3DEX A;  2G0F A;  3TRQ A;  1A0R P;  1YF1 A;  5F07 A;  2C0G A;  1K3L A;  4YAV A;  3KMN A;  2DLX A;  1AUC A;  2OBI A;  1S3C A;  1TDI A;  4CDO A;  2KP1 A;  2H74 A;  1PD2 1;  2H0G A;  4RUV A;  5G5F A;  5JCG A;  1A8Y A;  4GQF A;  3KMO A;  4LMV A;  1OKT A;  3FY7 A;  1Z7P A;  4H86 A;  3BJ5 A;  3QAG A;  3VWX A;  2YNX A;  3MNG A;  1R4W A;  1TRS A;  1J0F A;  2H19 A;  2JU5 A;  5DBQ A;  3P90 A;  5JCU A;  4D73 B;  2CZ2 A;  2KHP A;  1M7T A;  4MZW A;  5AIV A;  2OE1 A;  5ECR B;  2DSA A;  3S9F A;  4XS4 B;  1M2D A;  4Q5N A;  2D2Z A;  1I9D A;  3GL5 A;  1A2J A;  2C0D A;  1ERT A;  2MZC A;  5DAK B;  5D8I A;  3ZML A;  1GSD A;  3HD5 A;  3ME7 A;  1SK2 A;  3EUR A;  3HXS A;  3EMX A;  4RI7 A;  1TK0 B;  2P0G A;  3F0I A;  3DIE A;  1SU9 A;  4TR3 A;  2YJ7 A;  4HUA A;  3M9J A;  5H5Q A;  1AC1 A;  1U3A A;  2BMX A;  5DAL B;  3TJB A;  4KCE A;  2H6Z A;  4IS0 A;  4FYU A;  5EL8 A;  3KTB A;  4XTS A;  1WE0 A;  4HJM A;  4MJB A; 
#chains in the Genus database with same CATH topology
 2XBQ A;  1XW6 A;  2J9H A;  2MBS A;  2HSH A;  4QL9 A;  1ZOF A;  2R3X A;  2PBJ A;  5D9V A;  2OKA A;  4JR6 A;  4KSM A;  3I9V 2;  1H4O A;  3IHQ A;  2LQQ A;  3TKS C;  2L4Q A;  1SL0 B;  2YV9 A;  1SL2 B;  2YN1 A;  3D22 A;  3GKN A;  3HA9 A;  4X43 A;  4EDY A;  4TKY A;  1U6T A;  3HVX A;  4OWY A;  2VUP A;  3TDG A;  3H79 A;  1XWG A;  1Z6N A;  1NW2 A;  4POB A;  3E0U A;  2FWH A;  1XFL A;  4GLT A;  4XRD A;  5B6N A;  3L9U A;  3L9V A;  3GX8 A;  2R37 A;  3FZA A;  2JSZ A;  2YV7 A;  3ZIV A;  5EVO A;  4G2E A;  2FNO A;  3ERF A;  1PSQ A;  4ZBB A;  2JL4 A;  9GSS A;  4NPB A;  2VO4 A;  3FEU A;  3LFL A;  4XS4 A;  4OFM A;  3IRA A;  2QA2 A;  4J2F A;  4DSS B;  4GRF A;  3ZRE A;  1DBY A;  2ON7 A;  2I1U A;  1V2A A;  3CXG A;  3EIN A;  2WCI A;  2FA8 A;  2L57 A;  1TW9 A;  2IN3 A;  2O89 A;  4AJ7 A;  1OYJ A;  2H01 A;  5J4U A;  2LJA A;  1SYX A;  3P7X A;  1V9W A;  1DUG A;  1LBK A;  1BG5 A;  1PKZ A;  1V57 A;  1N2A A;  2WFC A;  5CRD A;  5F06 A;  2CT6 A;  2P5R A;  4I2T A;  2BTO T;  3G7Y A;  5DAL A;  5ECN B;  1ZCP A;  3FW2 A;  4TVE A;  5J9C A;  5ECL B;  2DIZ A;  3HYP A;  2JZT A;  3QMX A;  5B8B A;  4HEA 2;  3EYT A;  3PH9 A;  4GSS A;  5ECI B;  3F63 A;  5A5K A;  2H70 A;  2FLS A;  4NV5 A;  2FWG A;  4YQV A;  4V1A g;  1E6B A;  3P2A A;  5H5S A;  2H66 A;  2I9H A;  3O3T A;  1F3B A;  4PNG A;  5IO2 A;  3LXT A;  2B5X A;  1TXX A;  2GSS A;  5CRH A;  5JWR B;  3WGX A;  4BWQ A;  3FZ9 A;  2H8L A;  3C73 A;  3AY8 A;  3HVV A;  4FIW A;  1DE2 A;  1ERU A;  4L0U A;  2J23 A;  2GQK A;  4ML6 A;  2OA7 A;  1B8X A;  2GGT A;  1V40 A;  4O92 A;  1H75 A;  4QQ7 A;  2FY6 A;  2OE3 A;  4ECI A;  3M1G A;  1GSF A;  3UL3 A;  2VD0 A;  3LSZ A;  2AYT A;  4YH2 A;  5IPH A;  3M0F A;  1Z9H A;  4IKH A;  4PUA A;  2HRF A;  1XOA A;  5C04 A;  5IOW A;  1OC3 A;  3VI7 A;  4NXI A;  2B6M A;  2YZH A;  3TRX A;  3ZFB A;  5HR2 A;  1TRW A;  4JU5 A;  2YAN A;  1K3O A;  3GH6 A;  4DSS A;  1FVK A;  3GL3 A;  2WZ9 A;  5FWG A;  4XS6 A;  2VM2 A;  4MF7 A;  2EIR A;  4F0C A;  1QGV A;  3QR6 A;  2X49 A;  3JCM L;  1SJZ A;  1ERW A;  1AQX A;  4NWY A;  6GSW A;  2A4H A;  3EVI A;  3RBT A;  1EEJ A;  3CSI A;  2MMZ A;  3CSJ A;  2F8F A;  1XOB A;  4K2X A;  1ZYN A;  2XHF A;  2F8A A;  1MD4 A;  2LS5 A;  2H1D A;  4MNN A;  2N5F A;  2RUE A;  5AGY A;  4OO4 A;  2FD3 A;  5HR3 A;  1JLW A;  2CAI A;  3IHG A;  2IIY A;  3UAP A;  6GST A;  2H73 A;  2DKH A;  1ZYQ B;  4FO5 A;  1YKC A;  1PN9 A;  4FH8 A;  2K6V A;  3GIX A;  2H0I A;  1G6Y A;  4WET A;  4KUN A;  3VWV A;  1FOV A;  22GS A;  4AF2 A;  1K0D A;  3IR4 A;  1PX7 A;  4Q5F A;  4N30 A;  1GH2 A;  1R7H A;  2HXK A;  1ZMA A;  4MF6 A;  3EU4 A;  3WD6 A;  1E2Y A;  3MDK A;  3OR5 A;  3TCO A;  4ILF A;  3HKR A;  17GS A;  1YY7 A;  4YQU A;  2B1L A;  1GWC A;  1PX6 A;  2C3N A;  3H93 A;  2H30 A;  3GUR A;  1M3I A;  4OCF A;  4KW6 A;  1R5A A;  1SD8 A;  4K7O A;  2MBT A;  2WRT A;  1ZL9 A;  2VD1 A;  3TJG A;  5KEJ A;  4KX4 A;  3L0H A;  2MMN A;  2IJY A;  1OE7 A;  1T3B A;  2RM6 A;  1XWA A;  2RM5 A;  5G1K A;  5ABR A;  2V6K A;  2O8V B;  2DIY A;  4PX1 A;  1OC9 A;  3QPM A;  3VLN A;  1Z5Y E;  3IAM 2;  1XPV A;  5J9B A;  2H1B A;  4IJI A;  4DEJ A;  1VF3 A;  5IPG A;  3KH7 A;  5IM9 A;  4K9Z A;  5ECS A;  1YDK A;  2PMT A;  3DVX A;  3F3R A;  4XIH A;  3MAK A;  1GUK A;  1X5E A;  1S3R A;  3GSS A;  5ECQ B;  1EWX A;  2QKE A;  2LNT A;  4NV2 A;  3QAV A;  1M99 A;  5B6M A;  3ZMK A;  4XCS A;  4TR1 B;  2LRT A;  3M9K A;  1DE1 A;  5GAP D;  4EC0 A;  3GRX A;  4GWR A;  3Q19 A;  4Z7X A;  3UEM A;  2H71 A;  2PGT A;  2JSY A;  4MPF A;  2WJU A;  1JZD A;  1THX A;  1GP1 A;  2DKI A;  1LJR A;  2X4A A;  4MP4 A;  4OFT A;  1SJ6 A;  3TJF A;  2GZP A;  2MMO A;  2B7J A;  3HVS A;  1GLP A;  1U3I A;  3KD0 A;  5ECO B;  1GLQ A;  4HI7 A;  4KAE A;  4YKF A;  1K3Y A;  5CYY A;  2AB6 A;  2EIQ A;  3QDN A;  4EXJ A;  4N11 A;  5F05 A;  4KDU A;  3FR3 A;  2E2M A;  5GST A;  3A5I A;  3NIV A;  2NBS A;  4KCA A;  3DRN A;  4O5U A;  2CV4 A;  1ZYE A;  2L4C A;  5HFK A;  4IP1 A;  2IFQ A;  2XPD A;  2C4J A;  2OBK A;  4BVY B;  1LU4 A;  2MYG A;  2H1A A;  1BJX A;  4GTU A;  1MDK A;  2K9F A;  4TW5 A;  4ULX A;  2X99 A;  1O8X A;  1VF2 A;  4GCI A;  4K8M A;  5ID2 A;  2VL3 A;  3H8Q A;  2GS3 A;  4PQH A;  1AW9 A;  13GS A;  4HZ2 A;  2CVK A;  2FGX A;  2NDO A;  1DSB A;  2IL3 A;  3IK7 A;  3D4T A;  3GKK A;  1KEB A;  4JRR A;  3QOU A;  1G0T A;  4J56 E;  4MZB A;  3LEF A;  2QGV A;  2ALB A;  4TOP A;  4IN0 A;  1R5P A;  3KP8 A;  1Z6M A;  4PGT A;  3MWH A;  1ERV A;  3HZ8 A;  3W6G A;  1WMJ A;  4HU7 A;  3D6I A;  2XPE A;  5HQP A;  3PR8 A;  4MAB A;  1XVW A;  3NZN A;  4PUR A;  5B8A A;  1NHO A;  2KUC A;  4PTS A;  5ECM B;  1EV9 A;  1MDI A;  1SL1 B;  2B5Y A;  5ECH B;  4JBB A;  2V32 A;  1YEX A;  2IMI A;  5GSS A;  2QC7 A;  2LJR A;  2HRN A;  3GA4 A;  3KTL A;  3DML A;  4BIK A;  4KDY A;  1GSS A;  1CQH A;  1XIY A;  1XCC A;  3PGT A;  4IJ3 A;  3R3E A;  4J57 E;  4TR1 A;  4HJ2 A;  1T4Z A;  2N5A A;  4HQS A;  4F03 A;  2HSY A;  1SYR A;  2O7K A;  2YWN A;  4ICY A;  1TTZ A;  1WP0 A;  3P8W A;  5CRG A;  2HNL A;  5JWQ B;  3F9U A;  6GSX A;  4ZBD A;  20GS A;  3D5J A;  3M8N A;  4CHS A;  4IVF A;  5AN1 A;  1QMV A;  3UJ1 A;  5LCZ A;  1GL8 A;  5G5E A;  1SK0 A;  5GAN D;  3NOF A;  3LWA A;  4Q5Q A;  1O85 A;  1GUH A;  3DWV A;  2M80 A;  2LRN A;  1X9S B;  3ZYW A;  6GSS A;  2WUL A;  3HVN A;  4BVY A;  5IO0 A;  3TOT A;  5COH A;  2CAQ A;  4N0V A;  2C0F A;  1XXU A;  2ZUP A;  3KP9 A;  2E2G A;  3ZIJ A;  2PER A;  5IMV A;  1URM A;  2YJH A;  3DVW A;  1MEK A;  2VL2 C;  1YZX A;  1GNW A;  2R6K A;  2HZE B;  2PU9 C;  1Y6E A;  1FB6 A;  2HE3 A;  3ZIT A;  2QSI A;  3VUR A;  2FWF A;  2PWJ A;  1GSY A;  2H1G A;  4D73 A;  1EV4 A;  1PN0 A;  3KZQ A;  2AHE A;  4BVX B;  5G30 A;  1OAZ A;  1TRV A;  3WGE A;  3J7Y k;  2B5E A;  1QQ2 A;  1PKW A;  3IPZ A;  4L5L A;  5JCW A;  2L5O A;  4PQI A;  4ECC A;  1N8J A;  3IOS A;  5HFG A;  4Z2T A;  5D9X A;  5DAK A;  4USS A;  4FYB A;  3GYK A;  4IEL A;  2GTU A;  4WXT A;  3ZRD A;  19GS A;  4OFN A;  2AAW A;  1Q98 A;  3FKF A;  4HZ4 A;  2FCH A;  2HT9 A;  2YOI A;  4WEY A;  2FUG 2;  5D93 A;  3KH9 A;  2PPT A;  1KTE A;  3CYN A;  1EOG A;  4JZQ A;  2MMA A;  1K0C A;  12GS A;  4MCU A;  2DJ0 A;  2H6Y A;  1G7O A;  3ZL5 A;  1K0B A;  5G1L A;  3QD9 A;  4K5S A;  4MK3 A;  4LLR A;  4ZB8 A;  5H5R A;  3VFI A;  2YCD A;  2V41 A;  1WOU A;  3D4M A;  4CY6 A;  2H6X A;  2IMF A;  1NHY A;  5J5N A;  1TK8 B;  1THO A;  4JE1 A;  1F3A A;  1FB0 A;  1JLV A;  1UN2 A;  3MIX A;  3DXB A;  3UOM A;  4ACS A;  8GSS A;  3G9B A;  10GS A;  1O8W A;  5ENU A;  4HOJ A;  2HSM A;  2YZU A;  1B4P A;  2LTK A;  1TI3 A;  4PUF C;  4MJC A;  3E3E A;  2DJ3 A;  1GRX A;  5AIX A;  2HZE A;  2N5B A;  4ZL7 A;  4X1U A;  4RQX A;  2YWM A;  1B9Y C;  1XZO A;  3CRT A;  4LL4 B;  1UA5 A;  2VCT A;  4GSN A;  3CTG A;  3EPT A;  4HU9 A;  4ZIJ A;  3ERG A;  3H4K A;  3VPQ A;  2GLR A;  2H0H A;  1ABA A;  5F8B A;  5CNW A;  4MMM A;  3TRP A;  1GUM A;  5IQY A;  5G31 A;  1B48 A;  2AV4 A;  3R2Q A;  1QFN A;  4BL7 B;  4DSR A;  2M72 A;  4DVC A;  3IA1 A;  2HRK A;  4TR4 A;  1HNC A;  4YKG A;  2CQ9 A;  4RQR A;  4G10 A;  2L59 A;  2QA1 A;  1T1V A;  4K0N A;  2HI7 A;  1EEM A;  1S3D A;  3F6D A;  2Z9S A;  1F2E A;  2A4V A;  3FR6 A;  3N9J A;  1BED A;  2IPA A;  1GSQ A;  4JED A;  1JZW A;  2LJK A;  5KOW A;  4ZL9 A;  1TJD A;  4MDC A;  1PGT A;  5C00 A;  5KOX A;  5BRT A;  3O6T A;  1GTI A;  2VOC A;  2AJQ B;  1Q4J A;  4N10 A;  2DJJ A;  5DDL A;  2AUV A;  1Y25 A;  4MLY A;  3IDV A;  4V2N A;  3D0Z A;  1RQM A;  2DMM A;  3A2W A;  2WB9 A;  5IMF A;  4I8B A;  4BA7 A;  1OVN A;  4G0K A;  1SKS B;  3C71 A;  2LUS A;  2P31 A;  1OC8 A;  3TUE A;  5LD0 A;  2VCQ A;  2WDU A;  4PNF A;  1EGR A;  2TRX A;  2ZNM A;  3IV4 A;  2XBI A;  3UBL A;  4IBP A;  3FZ4 A;  3GTU B;  3GUS A;  3ZZX A;  2RUF A;  5FHI A;  4X0X A;  3ISO A;  2K8V A;  4WKW A;  5IOX A;  1GTB A;  1OKD A;  4KH7 A;  5A4U A;  4IP6 A;  1B9X C;  3CTF A;  3I6A A;  2LRC A;  4MJE A;  14GS A;  3IBH A;  1SKW B;  4ZB9 A;  4V1A p;  11GS A;  3DGQ A;  3GX0 A;  4ML1 A;  4PXO A;  1AQW A;  4BL7 A;  3EWL A;  3IC8 A;  2VCX A;  2L5L A;  3VWU A;  3KIJ A;  4Z2R A;  1QXH A;  4WBR D;  5D9W A;  3FHK A;  2C3Q A;  2LNS A;  3ZFL A;  2RLI A;  5CAX A;  5DJM A;  2G2Q A;  3VK9 A;  3ZLP A;  5LNK e;  3RPP A;  4KND A;  4PQ1 A;  3GKX A;  3Q6O A;  3F4R A;  4KDX A;  4WF5 A;  1PMT A;  2JAC A;  2B3S A;  1A24 A;  5CRE A;  1MDJ A;  5A4W A;  1TP9 A;  3ZVJ D;  1QUW A;  2L6D A;  2C8U A;  3H1N A;  2EIO A;  3M3M A;  4K0G A;  4GXZ A;  3DD3 A;  4TR0 A;  5CRW A;  3TJK A;  1A8L A;  1PQN A;  5DVB A;  2KOK A;  3EMP A;  3US3 A;  2VAF A;  1TRU A;  2JAD A;  2WGR A;  5KN2 A;  2VLU A;  3BBY A;  3A2X A;  1VRS D;  4AJ6 A;  3UBK A;  2CVB A;  4WF4 A;  3HHV A;  2DML A;  4YAP A;  4F0B A;  1Z3E A;  3GHA A;  1EGO A;  1NSW A;  1ON4 A;  4I2U A;  1W89 A;  2GZY A;  5KN3 A;  3ZVJ A;  4GST A;  4K1F A;  2GSR A;  1GSU A;  3F6F A;  1YF0 A;  2WS2 A;  1PA3 A;  3IAS 2;  4RI6 A;  4EF0 A;  3WGD A;  1IYI A;  4EE0 A;  4WR4 A;  4POK A;  1T8E B;  4EDZ A;  2K8S A;  4IQ1 A;  5D9T A;  3IE3 A;  3GTU A;  4MH3 A;  3PIN A;  2GDR A;  2P5Q A;  4ZXG A;  4DSQ A;  1SD9 A;  1YQ1 A;  3I43 A;  1TK5 B;  4POL A;  3FR9 A;  3KXO A;  3LXZ A;  3HZ4 A;  3UMA A;  2LEG A;  4G19 A;  1UC7 A;  4I5Q A;  5ECP B;  2E7P A;  3CMI A;  3GNJ A;  2R0C A;  5BMU A;  3UVH A;  1AAZ A;  4K5R A;  3WT2 A;  4OO5 A;  4CW9 A;  5E4W A;  4L0W A;  2KLX A;  1S3A A;  4AJ8 A;  2JZS A;  4ZB6 A;  4EL1 A;  3APS A;  3ZTL A;  4QL7 A;  4MJA A;  1C72 A;  4O5R A;  5D73 A;  1BX9 A;  3C1S A;  1SJI A;  1O81 A;  1VF1 A;  3HJM A;  4I97 A;  4WBJ A;  2GSQ A;  4MF5 A;  1KBN A;  4TXV A;  5DCG A;  5DJL A;  4I6X A;  1TKD B;  1U88 A;  5EPF A;  1RW1 A;  3U6V A;  5CO3 A;  2TIR A;  4FYC A;  3F3Q A;  2REM A;  3FYG A;  2R5G A;  1X5D A;  3BD2 A;  3BCK A;  1PL2 A;  4YQM A;  1M2A A;  1UVZ A;  1IYH A;  2VM1 A;  1K0A A;  3L4N A;  3KEB A;  4IW9 A;  4HDE A;  1WJK A;  1F9M A;  2VIM A;  1TI1 A;  3IXR A;  1XW9 A;  3L78 A;  3G7I A;  4K7I A;  1AXD A;  4XRA A;  1FW1 A;  1XWB A;  3RHC A;  2HLS A;  4ZIL A;  3LYP A;  1EP8 A;  1YEP A;  2B1K A;  5IMD A;  2PUK C;  4F82 A;  2H75 A;  3SBC A;  4L5O A;  4MPG A;  5DQS A;  3RHB A;  3LGC A;  5INY A;  3Q74 A;  6GSV A;  2PN8 A;  3TKS A;  2F3M A;  5IMA A;  2F51 A;  4LMW A;  1M9A A;  5GZZ B;  1JFU A;  3TKQ A;  2LST A;  4MZC A;  4EKZ A;  2FA4 A;  4KA0 A;  2DJ2 A;  1TOF A;  1ACV A;  3EE2 A;  2VLT A;  4TN8 A;  2VL2 A;  1FVJ A;  2EC4 A;  1HD2 A;  2GQM A;  1J08 A;  4BWS A;  5JWO B;  4HQZ A;  2HZF A;  2OJL A;  3WYW A;  1YJ6 A;  2IMK A;  5EY6 A;  1JHB A;  3LJR A;  2A2R A;  2TRC P;  3L9S A;  2I81 A;  3Q18 A;  2CZ3 A;  4NHW A;  4EUY A;  3C7M A;  5HFI A;  2OAD A;  4LA1 A;  4ZL8 A;  1K0O A;  2HRA A;  1HNA A;  3D21 A;  1HNB A;  2PVO C;  4O7H A;  1AIU A;  1EOH A;  2DJK A;  1U87 A;  1O6J A;  5IIZ A;  1Z7R A;  3LW9 A;  4KF9 A;  3CBU A;  1FO5 A;  3VWW A;  3VPT A;  3LOR A;  2KP2 A;  4ECB A;  5DQY A;  1YKA A;  3FZ5 A;  3O76 A;  18GS A;  1ILO A;  6GSU A;  3FRC A;  3TJJ A;  1PRX A;  2VCZ A;  4EVM A;  3FK8 A;  4K7N A;  1ZZY A;  3HDC A;  5L71 A;  1SKR B;  3ERW A;  4L8E A;  2RII A;  1GUL A;  3UIW A;  3QFA C;  1SEN A;  3KJY A;  3J7Y b;  3VI5 A;  1VF4 A;  2FHE A;  1HQO A;  3GKM A;  4Q5R A;  1F6M C;  3GST A;  4MH2 A;  1TU8 A;  2XC2 A;  3TKS E;  1O73 A;  2GVP A;  1GTA A;  2GT5 A;  2IMD A;  5G2Z A;  1T00 A;  4P3Y B;  4NAX A;  2V6O A;  2DBC A;  1GNE A;  1XG8 A;  4ISD A;  3HJO A;  2LQO A;  2B7K A;  4IGJ A;  2LV3 A;  2GQL A;  3QCP A;  3WT1 A;  3HJP A;  4IQA A;  5J41 A;  3LG6 A;  2ES7 A;  2VL9 A;  4EIP A;  4IHU A;  3GMF A;  2GT6 A;  1KNG A;  1X5C A;  4WR5 A;  1BAY A;  1GSE A;  3A2V A;  4GQC A;  1PFO A;  1A23 A;  4JR4 A;  2X8H A;  2CX4 A;  6GSY A;  3GFK A;  2ON5 A;  16GS A;  4ECJ A;  5CP1 A;  2PVQ A;  4XHM A;  3LYK A;  4XS1 A;  3GV1 A;  2OAC A;  3TKP A;  1J9B A;  4K2D A;  4K6X A;  2M46 A;  2V2G A;  4E8E A;  3E9J B;  4BVX A;  2CX3 A;  3RPN A;  3W8J A;  2DC5 A;  4KSO A;  2E0Q A;  3QFB C;  1K0N A;  1A2L A;  2ZCT A;  1R26 A;  3ED3 A;  3U5R E;  3TGZ A;  4N0Z A;  2CA8 A;  1NM3 A;  2BJX A;  2IWT A;  3IC4 A;  3CRU A;  2YP6 A;  3CSH A;  2GZZ A;  5F0G A;  4OD7 A;  1ML6 A;  4AGS A;  1M2B A;  3V1W A;  5ELG A;  1K0M A;  2JZR A;  4O32 A;  1M9B A;  5KN1 A;  1HYU A;  3DKS A;  1BYE A;  2O87 A;  3APO A;  5AIS A;  1OC9 B;  5HR1 A;  4G9H A;  1WWJ A;  1XWK A;  4HS1 A;  3DYR A;  1X9W B;  1XBS A;  1AQV A;  4BPY A;  3I69 A;  3W8S A;  2L6C A;  5KN0 A;  3A5W A;  4E8H A;  1A0F A;  3UVT A;  5B7C A;  2DJ1 A;  2C80 A;  1WRY A;  3TOU A;  5J3R A;  2VCV A;  1FOH A;  1G7E A;  1V58 A;  2R0G A;  3CQF A;  1G6W A;  7GSS A;  4ID0 A;  1SK1 A;  2R4V A;  3HCZ A;  2YWO A;  3K8N A;  3RAZ A;  3F4S A;  2A2S A;  2X8G A;  4LL1 B;  3TKR A;  2H72 A;  4GF0 A;  4TXO B;  1V98 A;  4EO3 A;  1OE8 A;  1M0U A;  1TU7 A;  3C8E A;  3QAW A;  1WIK A;  1O7U A;  2R2J A;  3HY2 A;  3SWL A;  4Z2U A;  5D96 A;  3UAR A;  2CVD A;  1QK8 A;  1EP7 A;  2IFQ B;  3PPU A;  3RDW A;  4V2M A;  1XW5 A;  3FMW A;  2V1M A;  4KGI A;  2LKU A;  1FHE A;  2C1Y A;  3EC3 A;  2YPM A;  5HR0 A;  2O85 A;  4MA9 A;  4TRX A;  2HYX A;  2C0E A;  5ID2 B;  1T4Y A;  3F4T A;  1EZK A;  5ECK B;  4FQU A;  4OCE A;  4A5P A;  3KCM A;  1RK4 A;  2OE0 A;  3IK9 A;  4G0I A;  5FT3 A;  1F37 A;  5DCH A;  1VGL A;  1ST9 A;  2I4A A;  4F2I A;  1CQG A;  3BCI A;  1A2M A;  3BOA A;  3GH9 A;  2IME A;  2F9S A;  4KE3 A;  2NTO A;  3KM6 A;  5IMZ A;  2UZ8 A;  5A4V A;  1JZO A;  5IMC A;  2VCW A;  5E59 A;  4OMV A;  1XVQ A;  3N5O A;  3GN3 A;  1BQ7 A;  3ME8 A;  4NMU A;  2A2P A;  2NVL A;  4V2L A;  1X9M B;  1WPI A;  4F9Z A;  3LQ7 A;  3G7J A;  1USB A;  1GTU A;  2C3T A;  1X0R A;  2NPB A;  2K18 A;  4HSC X;  3A3T A;  1FAA A;  2YWI A;  2FWE A;  1JZR A;  2X64 A;  3C1R A;  1XWC A;  1I5G A;  3APQ A;  1PL1 A;  2H76 A;  4POM A;  2VLV A;  3KGK A;  4TXO A;  3MSZ A;  1T7P B;  1ZGN A;  4X4J A;  2X8C A;  1B4Q A;  1MTC A;  4EIQ A;  2GST A;  2HFD A;  3EU3 A;  3MYD A;  4KB3 A;  4ZBA A;  1FG4 A;  5ELA A;  4NHZ A;  1MD3 A;  3F8U A;  3TB2 A;  1W4V A;  2I3Y A;  3DEX A;  2G0F A;  3TRQ A;  1A0R P;  1YF1 A;  5F07 A;  2C0G A;  1K3L A;  1ZYP A;  4YAV A;  3KMN A;  2DLX A;  1AUC A;  2OBI A;  1S3C A;  1TDI A;  4CDO A;  2KP1 A;  2H74 A;  1PD2 1;  2H0G A;  4RUV A;  5G5F A;  5JCG A;  1A8Y A;  4GQF A;  4LMV A;  3KMO A;  1OKT A;  3FY7 A;  1Z7P A;  4H86 A;  3BJ5 A;  3QAG A;  3VWX A;  2YNX A;  3MNG A;  1R4W A;  1TRS A;  1J0F A;  2H19 A;  2JU5 A;  5DBQ A;  2R0P A;  3P90 A;  1M3J A;  5JCU A;  4D73 B;  2CZ2 A;  4CY8 A;  2KHP A;  1M7T A;  4MZW A;  5AIV A;  2OE1 A;  5ECR B;  2DSA A;  3S9F A;  4XS4 B;  1M2D A;  4Q5N A;  2D2Z A;  1I9D A;  3GL5 A;  1A2J A;  2C0D A;  1ERT A;  2MZC A;  5DAK B;  5D8I A;  3ZML A;  1GSD A;  3HD5 A;  3ME7 A;  4O5Q A;  1SK2 A;  3EUR A;  3HXS A;  3EMX A;  4RI7 A;  1TK0 B;  2P0G A;  3F0I A;  3DIE A;  1SU9 A;  4TR3 A;  2YJ7 A;  4HUA A;  3M9J A;  5H5Q A;  1AC1 A;  1U3A A;  2BMX A;  5DAL B;  3TJB A;  4KCE A;  2H6Z A;  4IS0 A;  4FYU A;  5EL8 A;  3KTB A;  4XTS A;  1WE0 A;  4HJM A;  4MJB A;  4G0L A; 
#chains in the Genus database with same CATH homology
 2XBQ A;  1XW6 A;  2J9H A;  2MBS A;  2HSH A;  4QL9 A;  1ZOF A;  2R3X A;  2PBJ A;  5D9V A;  2OKA A;  4JR6 A;  4KSM A;  3I9V 2;  1H4O A;  3IHQ A;  2LQQ A;  3TKS C;  2L4Q A;  1SL0 B;  2YV9 A;  1SL2 B;  2YN1 A;  3D22 A;  3GKN A;  3HA9 A;  4X43 A;  4EDY A;  4TKY A;  1U6T A;  3HVX A;  4OWY A;  2VUP A;  3TDG A;  3H79 A;  1XWG A;  1Z6N A;  1NW2 A;  4POB A;  3E0U A;  2FWH A;  1XFL A;  4GLT A;  4XRD A;  5B6N A;  3L9U A;  3L9V A;  3GX8 A;  2R37 A;  3FZA A;  2JSZ A;  2YV7 A;  3ZIV A;  5EVO A;  4G2E A;  2FNO A;  3ERF A;  1PSQ A;  4ZBB A;  2JL4 A;  9GSS A;  4NPB A;  2VO4 A;  3FEU A;  3LFL A;  4XS4 A;  4OFM A;  3IRA A;  2QA2 A;  4J2F A;  4DSS B;  4GRF A;  3ZRE A;  1DBY A;  2ON7 A;  2I1U A;  1V2A A;  3CXG A;  3EIN A;  2WCI A;  2FA8 A;  2L57 A;  1TW9 A;  2IN3 A;  2O89 A;  4AJ7 A;  1OYJ A;  2H01 A;  5J4U A;  2LJA A;  1SYX A;  3P7X A;  1V9W A;  1DUG A;  1LBK A;  1BG5 A;  1PKZ A;  1V57 A;  1N2A A;  2WFC A;  5CRD A;  5F06 A;  2CT6 A;  2P5R A;  4I2T A;  2BTO T;  3G7Y A;  5DAL A;  5ECN B;  1ZCP A;  3FW2 A;  4TVE A;  5J9C A;  5ECL B;  2DIZ A;  3HYP A;  2JZT A;  3QMX A;  5B8B A;  4HEA 2;  3EYT A;  3PH9 A;  4GSS A;  5ECI B;  3F63 A;  5A5K A;  2H70 A;  2FLS A;  4NV5 A;  2FWG A;  4YQV A;  4V1A g;  1E6B A;  3P2A A;  5H5S A;  2H66 A;  2I9H A;  3O3T A;  1F3B A;  4PNG A;  5IO2 A;  3LXT A;  2B5X A;  1TXX A;  2GSS A;  5CRH A;  5JWR B;  3WGX A;  4BWQ A;  3FZ9 A;  2H8L A;  3C73 A;  3AY8 A;  3HVV A;  4FIW A;  1DE2 A;  1ERU A;  4L0U A;  2J23 A;  2GQK A;  4ML6 A;  2OA7 A;  1B8X A;  2GGT A;  1V40 A;  4O92 A;  1H75 A;  4QQ7 A;  2FY6 A;  2OE3 A;  4ECI A;  3M1G A;  1GSF A;  3UL3 A;  2VD0 A;  3LSZ A;  2AYT A;  4YH2 A;  5IPH A;  3M0F A;  1Z9H A;  4IKH A;  4PUA A;  2HRF A;  1XOA A;  5C04 A;  5IOW A;  1OC3 A;  3VI7 A;  4NXI A;  2B6M A;  2YZH A;  3TRX A;  3ZFB A;  5HR2 A;  1TRW A;  4JU5 A;  2YAN A;  1K3O A;  3GH6 A;  4DSS A;  1FVK A;  3GL3 A;  2WZ9 A;  5FWG A;  4XS6 A;  2VM2 A;  4MF7 A;  2EIR A;  4F0C A;  1QGV A;  3QR6 A;  2X49 A;  3JCM L;  1SJZ A;  1ERW A;  1AQX A;  4NWY A;  6GSW A;  2A4H A;  3EVI A;  3RBT A;  1EEJ A;  3CSI A;  2MMZ A;  3CSJ A;  2F8F A;  1XOB A;  4K2X A;  1ZYN A;  2XHF A;  2F8A A;  1MD4 A;  2LS5 A;  2H1D A;  4MNN A;  2N5F A;  2RUE A;  5AGY A;  4OO4 A;  2FD3 A;  5HR3 A;  1JLW A;  2CAI A;  3IHG A;  2IIY A;  3UAP A;  6GST A;  2H73 A;  2DKH A;  1ZYQ B;  4FO5 A;  1YKC A;  1PN9 A;  4FH8 A;  2K6V A;  3GIX A;  2H0I A;  1G6Y A;  4WET A;  4KUN A;  3VWV A;  1FOV A;  22GS A;  4AF2 A;  1K0D A;  3IR4 A;  1PX7 A;  4Q5F A;  4N30 A;  1GH2 A;  1R7H A;  2HXK A;  1ZMA A;  4MF6 A;  3EU4 A;  3WD6 A;  1E2Y A;  3MDK A;  3OR5 A;  3TCO A;  4ILF A;  3HKR A;  17GS A;  1YY7 A;  4YQU A;  2B1L A;  1GWC A;  1PX6 A;  2C3N A;  3H93 A;  2H30 A;  3GUR A;  4OCF A;  4KW6 A;  1R5A A;  1SD8 A;  4K7O A;  2MBT A;  2WRT A;  1ZL9 A;  2VD1 A;  3TJG A;  5KEJ A;  4KX4 A;  3L0H A;  2MMN A;  2IJY A;  1OE7 A;  1T3B A;  2RM6 A;  1XWA A;  2RM5 A;  5G1K A;  5ABR A;  2V6K A;  2O8V B;  2DIY A;  4PX1 A;  1OC9 A;  3QPM A;  3VLN A;  1Z5Y E;  3IAM 2;  1XPV A;  5J9B A;  2H1B A;  4IJI A;  4DEJ A;  1VF3 A;  5IPG A;  3KH7 A;  5IM9 A;  4K9Z A;  5ECS A;  1YDK A;  2PMT A;  3DVX A;  3F3R A;  4XIH A;  3MAK A;  1GUK A;  1X5E A;  3GSS A;  5ECQ B;  1EWX A;  2QKE A;  2LNT A;  4NV2 A;  3QAV A;  1M99 A;  5B6M A;  3ZMK A;  4XCS A;  4TR1 B;  2LRT A;  3M9K A;  1DE1 A;  5GAP D;  4EC0 A;  3GRX A;  4GWR A;  3Q19 A;  4Z7X A;  3UEM A;  2H71 A;  2PGT A;  2JSY A;  4MPF A;  2WJU A;  1JZD A;  1THX A;  1GP1 A;  2DKI A;  1LJR A;  2X4A A;  4MP4 A;  4OFT A;  1SJ6 A;  3TJF A;  2GZP A;  2MMO A;  2B7J A;  3HVS A;  1GLP A;  1U3I A;  3KD0 A;  5ECO B;  1GLQ A;  4HI7 A;  4KAE A;  4YKF A;  1K3Y A;  5CYY A;  2AB6 A;  2EIQ A;  3QDN A;  4EXJ A;  4N11 A;  5F05 A;  4KDU A;  3FR3 A;  2E2M A;  5GST A;  3A5I A;  3NIV A;  2NBS A;  4KCA A;  3DRN A;  4O5U A;  2CV4 A;  1ZYE A;  2L4C A;  5HFK A;  4IP1 A;  2IFQ A;  2XPD A;  2C4J A;  2OBK A;  4BVY B;  1LU4 A;  2MYG A;  2H1A A;  1BJX A;  4GTU A;  1MDK A;  2K9F A;  4TW5 A;  4ULX A;  2X99 A;  1O8X A;  1VF2 A;  4GCI A;  4K8M A;  5ID2 A;  2VL3 A;  3H8Q A;  2GS3 A;  4PQH A;  1AW9 A;  13GS A;  4HZ2 A;  2CVK A;  2FGX A;  2NDO A;  1DSB A;  2IL3 A;  3IK7 A;  3D4T A;  3GKK A;  1KEB A;  4JRR A;  3QOU A;  1G0T A;  4J56 E;  4MZB A;  3LEF A;  2QGV A;  2ALB A;  4TOP A;  4IN0 A;  1R5P A;  3KP8 A;  1Z6M A;  4PGT A;  3MWH A;  1ERV A;  3HZ8 A;  3W6G A;  1WMJ A;  4HU7 A;  3D6I A;  2XPE A;  5HQP A;  3PR8 A;  4MAB A;  1XVW A;  3NZN A;  4PUR A;  5B8A A;  1NHO A;  2KUC A;  4PTS A;  5ECM B;  1EV9 A;  1MDI A;  1SL1 B;  2B5Y A;  5ECH B;  4JBB A;  2V32 A;  1YEX A;  2IMI A;  5GSS A;  2QC7 A;  2LJR A;  2HRN A;  3GA4 A;  3KTL A;  3DML A;  4KDY A;  1GSS A;  1CQH A;  1XIY A;  1XCC A;  3PGT A;  4IJ3 A;  3R3E A;  4J57 E;  4TR1 A;  4HJ2 A;  1T4Z A;  2N5A A;  4HQS A;  4F03 A;  2HSY A;  1SYR A;  2O7K A;  2YWN A;  4ICY A;  1TTZ A;  1WP0 A;  3P8W A;  5CRG A;  2HNL A;  5JWQ B;  3F9U A;  6GSX A;  4ZBD A;  20GS A;  3D5J A;  3M8N A;  4CHS A;  4IVF A;  5AN1 A;  1QMV A;  3UJ1 A;  5LCZ A;  1GL8 A;  5G5E A;  1SK0 A;  5GAN D;  3NOF A;  3LWA A;  4Q5Q A;  1O85 A;  1GUH A;  3DWV A;  2M80 A;  2LRN A;  1X9S B;  3ZYW A;  6GSS A;  2WUL A;  4BVY A;  5IO0 A;  3TOT A;  5COH A;  2CAQ A;  4N0V A;  2C0F A;  1XXU A;  2ZUP A;  3KP9 A;  2E2G A;  3ZIJ A;  2PER A;  5IMV A;  1URM A;  2YJH A;  3DVW A;  1MEK A;  2VL2 C;  1YZX A;  1GNW A;  2R6K A;  2HZE B;  2PU9 C;  1Y6E A;  1FB6 A;  2HE3 A;  3ZIT A;  2QSI A;  3VUR A;  2FWF A;  2PWJ A;  1GSY A;  2H1G A;  4D73 A;  1EV4 A;  1PN0 A;  3KZQ A;  2AHE A;  4BVX B;  5G30 A;  1OAZ A;  1TRV A;  3WGE A;  3J7Y k;  2B5E A;  1QQ2 A;  1PKW A;  3IPZ A;  4L5L A;  5JCW A;  2L5O A;  4PQI A;  4ECC A;  1N8J A;  3IOS A;  5HFG A;  4Z2T A;  5D9X A;  5DAK A;  4USS A;  4FYB A;  3GYK A;  4IEL A;  2GTU A;  4WXT A;  3ZRD A;  19GS A;  4OFN A;  2AAW A;  1Q98 A;  3FKF A;  4HZ4 A;  2FCH A;  2HT9 A;  2YOI A;  4WEY A;  2FUG 2;  5D93 A;  3KH9 A;  2PPT A;  1KTE A;  3CYN A;  1EOG A;  4JZQ A;  2MMA A;  1K0C A;  12GS A;  4MCU A;  2DJ0 A;  2H6Y A;  1G7O A;  3ZL5 A;  1K0B A;  5G1L A;  3QD9 A;  4K5S A;  4MK3 A;  4LLR A;  4ZB8 A;  5H5R A;  3VFI A;  2YCD A;  2V41 A;  1WOU A;  3D4M A;  4CY6 A;  2H6X A;  2IMF A;  1NHY A;  5J5N A;  1TK8 B;  1THO A;  4JE1 A;  1F3A A;  1FB0 A;  1JLV A;  1UN2 A;  3MIX A;  3DXB A;  3UOM A;  4ACS A;  8GSS A;  3G9B A;  10GS A;  1O8W A;  5ENU A;  4HOJ A;  2HSM A;  2YZU A;  1B4P A;  2LTK A;  1TI3 A;  4PUF C;  4MJC A;  3E3E A;  2DJ3 A;  1GRX A;  5AIX A;  2HZE A;  2N5B A;  4ZL7 A;  4X1U A;  4RQX A;  2YWM A;  1B9Y C;  1XZO A;  3CRT A;  4LL4 B;  1UA5 A;  2VCT A;  4GSN A;  3CTG A;  3EPT A;  4HU9 A;  4ZIJ A;  3ERG A;  3H4K A;  3VPQ A;  2GLR A;  2H0H A;  1ABA A;  5F8B A;  5CNW A;  4MMM A;  3TRP A;  1GUM A;  5IQY A;  5G31 A;  1B48 A;  2AV4 A;  3R2Q A;  1QFN A;  4BL7 B;  4DSR A;  2M72 A;  4DVC A;  3IA1 A;  2HRK A;  4TR4 A;  1HNC A;  4YKG A;  2CQ9 A;  4RQR A;  4G10 A;  2L59 A;  2QA1 A;  1T1V A;  4K0N A;  2HI7 A;  1EEM A;  1S3D A;  3F6D A;  2Z9S A;  1F2E A;  2A4V A;  3FR6 A;  3N9J A;  1BED A;  2IPA A;  1GSQ A;  4JED A;  1JZW A;  2LJK A;  5KOW A;  4ZL9 A;  1TJD A;  4MDC A;  1PGT A;  5C00 A;  5KOX A;  5BRT A;  3O6T A;  1GTI A;  2VOC A;  2AJQ B;  1Q4J A;  4N10 A;  2DJJ A;  5DDL A;  2AUV A;  1Y25 A;  4MLY A;  3IDV A;  4V2N A;  3D0Z A;  1RQM A;  2DMM A;  3A2W A;  2WB9 A;  5IMF A;  4I8B A;  4BA7 A;  1OVN A;  4G0K A;  1SKS B;  3C71 A;  2LUS A;  2P31 A;  1OC8 A;  3TUE A;  5LD0 A;  2VCQ A;  2WDU A;  4PNF A;  1EGR A;  2TRX A;  2ZNM A;  3IV4 A;  2XBI A;  3UBL A;  4IBP A;  3FZ4 A;  3GTU B;  3GUS A;  3ZZX A;  2RUF A;  5FHI A;  4X0X A;  3ISO A;  2K8V A;  4WKW A;  5IOX A;  1GTB A;  1OKD A;  4KH7 A;  5A4U A;  4IP6 A;  1B9X C;  3CTF A;  3I6A A;  2LRC A;  4MJE A;  14GS A;  3IBH A;  1SKW B;  4ZB9 A;  4V1A p;  11GS A;  3DGQ A;  3GX0 A;  4ML1 A;  4PXO A;  1AQW A;  4BL7 A;  3EWL A;  3IC8 A;  2VCX A;  2L5L A;  3VWU A;  3KIJ A;  4Z2R A;  1QXH A;  4WBR D;  5D9W A;  3FHK A;  2C3Q A;  2LNS A;  3ZFL A;  2RLI A;  5CAX A;  5DJM A;  2G2Q A;  3VK9 A;  3ZLP A;  5LNK e;  3RPP A;  4KND A;  4PQ1 A;  3GKX A;  3Q6O A;  3F4R A;  4KDX A;  4WF5 A;  1PMT A;  2JAC A;  2B3S A;  1A24 A;  5CRE A;  1MDJ A;  5A4W A;  1TP9 A;  3ZVJ D;  1QUW A;  2L6D A;  2C8U A;  3H1N A;  2EIO A;  3M3M A;  4K0G A;  4GXZ A;  3DD3 A;  4TR0 A;  5CRW A;  3TJK A;  1A8L A;  1PQN A;  5DVB A;  2KOK A;  3EMP A;  3US3 A;  2VAF A;  1TRU A;  2JAD A;  2WGR A;  5KN2 A;  2VLU A;  3BBY A;  3A2X A;  1VRS D;  4AJ6 A;  3UBK A;  2CVB A;  4WF4 A;  3HHV A;  2DML A;  4YAP A;  4F0B A;  1Z3E A;  3GHA A;  1EGO A;  1NSW A;  1ON4 A;  4I2U A;  1W89 A;  2GZY A;  5KN3 A;  3ZVJ A;  4GST A;  4K1F A;  2GSR A;  1GSU A;  3F6F A;  1YF0 A;  2WS2 A;  1PA3 A;  3IAS 2;  4RI6 A;  4EF0 A;  3WGD A;  1IYI A;  4EE0 A;  4WR4 A;  4POK A;  1T8E B;  4EDZ A;  2K8S A;  4IQ1 A;  5D9T A;  3IE3 A;  3GTU A;  4MH3 A;  3PIN A;  2GDR A;  2P5Q A;  4ZXG A;  4DSQ A;  1SD9 A;  1YQ1 A;  3I43 A;  1TK5 B;  4POL A;  3FR9 A;  3KXO A;  3LXZ A;  3HZ4 A;  3UMA A;  2LEG A;  4G19 A;  1UC7 A;  4I5Q A;  5ECP B;  2E7P A;  3CMI A;  3GNJ A;  2R0C A;  5BMU A;  3UVH A;  1AAZ A;  4K5R A;  3WT2 A;  4OO5 A;  4CW9 A;  5E4W A;  4L0W A;  2KLX A;  1S3A A;  4AJ8 A;  2JZS A;  4ZB6 A;  4EL1 A;  3APS A;  3ZTL A;  4QL7 A;  4MJA A;  1C72 A;  4O5R A;  5D73 A;  1BX9 A;  3C1S A;  1SJI A;  1O81 A;  1VF1 A;  3HJM A;  4I97 A;  4WBJ A;  2GSQ A;  4MF5 A;  1KBN A;  4TXV A;  5DCG A;  5DJL A;  4I6X A;  1TKD B;  1U88 A;  5EPF A;  1RW1 A;  3U6V A;  5CO3 A;  2TIR A;  4FYC A;  3F3Q A;  2REM A;  3FYG A;  2R5G A;  1X5D A;  3BD2 A;  3BCK A;  1PL2 A;  4YQM A;  1M2A A;  1UVZ A;  1IYH A;  2VM1 A;  1K0A A;  3L4N A;  3KEB A;  4IW9 A;  4HDE A;  1WJK A;  1F9M A;  2VIM A;  1TI1 A;  3IXR A;  1XW9 A;  3L78 A;  3G7I A;  4K7I A;  1AXD A;  4XRA A;  1FW1 A;  1XWB A;  3RHC A;  2HLS A;  4ZIL A;  3LYP A;  1EP8 A;  1YEP A;  2B1K A;  5IMD A;  2PUK C;  4F82 A;  2H75 A;  3SBC A;  4L5O A;  4MPG A;  5DQS A;  3RHB A;  3LGC A;  5INY A;  3Q74 A;  6GSV A;  2PN8 A;  3TKS A;  2F3M A;  5IMA A;  2F51 A;  4LMW A;  1M9A A;  5GZZ B;  1JFU A;  3TKQ A;  2LST A;  4MZC A;  4EKZ A;  2FA4 A;  4KA0 A;  2DJ2 A;  1TOF A;  1ACV A;  3EE2 A;  2VLT A;  4TN8 A;  2VL2 A;  1FVJ A;  2EC4 A;  1HD2 A;  2GQM A;  1J08 A;  4BWS A;  5JWO B;  4HQZ A;  2HZF A;  2OJL A;  3WYW A;  1YJ6 A;  2IMK A;  5EY6 A;  1JHB A;  3LJR A;  2A2R A;  2TRC P;  3L9S A;  2I81 A;  3Q18 A;  2CZ3 A;  4NHW A;  4EUY A;  3C7M A;  5HFI A;  2OAD A;  4LA1 A;  4ZL8 A;  1K0O A;  2HRA A;  1HNA A;  3D21 A;  1HNB A;  2PVO C;  4O7H A;  1AIU A;  1EOH A;  2DJK A;  1U87 A;  1O6J A;  5IIZ A;  1Z7R A;  3LW9 A;  4KF9 A;  3CBU A;  1FO5 A;  3VWW A;  3VPT A;  3LOR A;  2KP2 A;  4ECB A;  5DQY A;  1YKA A;  3FZ5 A;  3O76 A;  18GS A;  1ILO A;  6GSU A;  3FRC A;  3TJJ A;  1PRX A;  2VCZ A;  4EVM A;  3FK8 A;  4K7N A;  1ZZY A;  3HDC A;  5L71 A;  1SKR B;  3ERW A;  4L8E A;  2RII A;  1GUL A;  3UIW A;  3QFA C;  1SEN A;  3KJY A;  3J7Y b;  3VI5 A;  1VF4 A;  2FHE A;  1HQO A;  3GKM A;  4Q5R A;  1F6M C;  3GST A;  4MH2 A;  1TU8 A;  2XC2 A;  3TKS E;  1O73 A;  2GVP A;  1GTA A;  2GT5 A;  2IMD A;  5G2Z A;  1T00 A;  4P3Y B;  4NAX A;  2V6O A;  2DBC A;  1GNE A;  4ISD A;  3HJO A;  2LQO A;  2B7K A;  4IGJ A;  2LV3 A;  2GQL A;  3QCP A;  3WT1 A;  3HJP A;  4IQA A;  5J41 A;  3LG6 A;  2ES7 A;  2VL9 A;  4EIP A;  4IHU A;  3GMF A;  2GT6 A;  1KNG A;  1X5C A;  4WR5 A;  1BAY A;  1GSE A;  3A2V A;  4GQC A;  1A23 A;  4JR4 A;  2X8H A;  2CX4 A;  6GSY A;  3GFK A;  2ON5 A;  16GS A;  4ECJ A;  5CP1 A;  2PVQ A;  4XHM A;  3LYK A;  4XS1 A;  3GV1 A;  2OAC A;  3TKP A;  1J9B A;  4K2D A;  4K6X A;  2M46 A;  2V2G A;  4E8E A;  3E9J B;  4BVX A;  2CX3 A;  3RPN A;  3W8J A;  2DC5 A;  4KSO A;  2E0Q A;  3QFB C;  1K0N A;  1A2L A;  2ZCT A;  1R26 A;  3ED3 A;  3U5R E;  3TGZ A;  4N0Z A;  2CA8 A;  1NM3 A;  2BJX A;  2IWT A;  3IC4 A;  3CRU A;  2YP6 A;  3CSH A;  2GZZ A;  5F0G A;  4OD7 A;  1ML6 A;  4AGS A;  1M2B A;  3V1W A;  5ELG A;  1K0M A;  2JZR A;  4O32 A;  1M9B A;  5KN1 A;  1HYU A;  3DKS A;  1BYE A;  2O87 A;  3APO A;  5AIS A;  1OC9 B;  5HR1 A;  4G9H A;  1WWJ A;  1XWK A;  4HS1 A;  3DYR A;  1X9W B;  1XBS A;  1AQV A;  4BPY A;  3I69 A;  3W8S A;  2L6C A;  5KN0 A;  3A5W A;  4E8H A;  1A0F A;  3UVT A;  5B7C A;  2DJ1 A;  2C80 A;  1WRY A;  3TOU A;  5J3R A;  2VCV A;  1FOH A;  1G7E A;  1V58 A;  2R0G A;  1G6W A;  7GSS A;  4ID0 A;  1SK1 A;  2R4V A;  3HCZ A;  2YWO A;  3K8N A;  3RAZ A;  3F4S A;  2A2S A;  2X8G A;  4LL1 B;  3TKR A;  2H72 A;  4GF0 A;  4TXO B;  1V98 A;  4EO3 A;  1OE8 A;  1M0U A;  1TU7 A;  3C8E A;  3QAW A;  1WIK A;  1O7U A;  2R2J A;  3HY2 A;  3SWL A;  4Z2U A;  5D96 A;  3UAR A;  2CVD A;  1QK8 A;  1EP7 A;  2IFQ B;  3PPU A;  3RDW A;  4V2M A;  1XW5 A;  3FMW A;  2V1M A;  4KGI A;  2LKU A;  1FHE A;  2C1Y A;  3EC3 A;  2YPM A;  5HR0 A;  2O85 A;  4MA9 A;  4TRX A;  2HYX A;  2C0E A;  5ID2 B;  1T4Y A;  3F4T A;  1EZK A;  5ECK B;  4FQU A;  4OCE A;  4A5P A;  3KCM A;  1RK4 A;  2OE0 A;  3IK9 A;  4G0I A;  5FT3 A;  1F37 A;  5DCH A;  1VGL A;  1ST9 A;  2I4A A;  4F2I A;  1CQG A;  3BCI A;  1A2M A;  3BOA A;  3GH9 A;  2IME A;  2F9S A;  4KE3 A;  2NTO A;  3KM6 A;  5IMZ A;  2UZ8 A;  5A4V A;  1JZO A;  5IMC A;  2VCW A;  5E59 A;  4OMV A;  1XVQ A;  3N5O A;  3GN3 A;  1BQ7 A;  3ME8 A;  4NMU A;  2A2P A;  2NVL A;  4V2L A;  1X9M B;  1WPI A;  4F9Z A;  3LQ7 A;  3G7J A;  1USB A;  1GTU A;  2C3T A;  1X0R A;  2NPB A;  2K18 A;  3A3T A;  1FAA A;  2YWI A;  2FWE A;  1JZR A;  2X64 A;  3C1R A;  1XWC A;  1I5G A;  3APQ A;  1PL1 A;  2H76 A;  4POM A;  2VLV A;  3KGK A;  4TXO A;  3MSZ A;  1T7P B;  1ZGN A;  4X4J A;  2X8C A;  1B4Q A;  1MTC A;  4EIQ A;  2GST A;  2HFD A;  3EU3 A;  3MYD A;  4KB3 A;  4ZBA A;  1FG4 A;  5ELA A;  4NHZ A;  1MD3 A;  3F8U A;  3TB2 A;  1W4V A;  2I3Y A;  3DEX A;  2G0F A;  3TRQ A;  1A0R P;  1YF1 A;  5F07 A;  2C0G A;  1K3L A;  1ZYP A;  4YAV A;  3KMN A;  2DLX A;  1AUC A;  2OBI A;  1S3C A;  1TDI A;  4CDO A;  2KP1 A;  2H74 A;  1PD2 1;  2H0G A;  4RUV A;  5G5F A;  5JCG A;  1A8Y A;  4GQF A;  4LMV A;  3KMO A;  1OKT A;  3FY7 A;  1Z7P A;  4H86 A;  3BJ5 A;  3QAG A;  3VWX A;  2YNX A;  3MNG A;  1R4W A;  1TRS A;  1J0F A;  2H19 A;  2JU5 A;  5DBQ A;  2R0P A;  3P90 A;  5JCU A;  4D73 B;  2CZ2 A;  4CY8 A;  2KHP A;  1M7T A;  4MZW A;  5AIV A;  2OE1 A;  5ECR B;  2DSA A;  3S9F A;  4XS4 B;  1M2D A;  4Q5N A;  2D2Z A;  1I9D A;  3GL5 A;  1A2J A;  2C0D A;  1ERT A;  2MZC A;  5DAK B;  5D8I A;  3ZML A;  1GSD A;  3HD5 A;  3ME7 A;  4O5Q A;  1SK2 A;  3EUR A;  3HXS A;  3EMX A;  4RI7 A;  1TK0 B;  2P0G A;  3F0I A;  3DIE A;  1SU9 A;  4TR3 A;  2YJ7 A;  4HUA A;  3M9J A;  5H5Q A;  1AC1 A;  1U3A A;  2BMX A;  5DAL B;  3TJB A;  4KCE A;  2H6Z A;  4IS0 A;  4FYU A;  5EL8 A;  3KTB A;  4XTS A;  1WE0 A;  4HJM A;  4MJB A;  4G0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...