3GKXA

Crystal structure of putative arsc family related protein from bacteroides fragilis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
MKTLFLQYPACSTCQKAKKWLIENNIEYTNRLIVDDNPTVEELKAWIPLSGLPVKKFFNTSGVVYKELKLSSKLPTMTEEEQIALLATNGKLVKRPLVVTERFVLVGFKPEEWEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative ArsC family related protein from Bacteroides fragilis
rcsb
molecule keywords Putative ArsC family related protein
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 31
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03960 ArsC ArsC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gkxA00
4EDZA 5HQPA 2V6KA 5AIVA 4N30A 4F9ZA 2AHEA 3KP9A 3WGXA 3LORA 3KIJA 2GSSA 4I2UA 2KLXA 3DYRA 2B5XA 1NSWA 4KB3A 1Z5YE 3Q74A 3F63A 3ZREA 1EOGA 3UVHA 1ZZYA 1ON4A 3VWVA 1XWGA 1OKTA 2IMKA 2LTKA 5L71A 4Q5FA 1M99A 3VPTA 3J7Yb 4H86A 3GMFA 3F6FA 4NPBA 2GT6A 2TRCP 4L8EA 1DSBA 3LFLA 6GSVA 2P31A 2R5GA 2WGRA 4RQRA 2VD0A 4MH3A 1F6MC 3IOSA 5H5QA 4IELA 3JCML 1CQGA 5DALA 4PQ1A 3HZ4A 3KTBA 2DMMA 2H66A 4MPGA 2H6XA 4MJBA 22GSA 1T7PB 5IO2A 2FY6A 1Z9HA 2G2QA 1GLPA 2GS3A 3S9FA 2DIZA 1PGTA 1JFUA 2JU5A 2DLXA 3HZ8A 5DDLA 4HJ2A 4TVEA 4MZCA 3GSSA 2HSYA 3F6DA 1Y25A 4FYUA 2PPTA 3KGKA 4MZBA 5G1KA 3GN3A 2IWTA 1T00A 2V2GA 4JR4A 5IMDA 3QPMA 2C4JA 4TR1A 1GNEA 1J9BA 2HT9A 2RUFA 3E3EA 4GQCA 2YPMA 3C71A 5D9XA 4IVFA 1K0NA 3A3TA 3W8SA 4KDXA 2OA7A 4HZ4A 5FHIA 2REMA 2H1GA 3GUSA 2XBQA 1GUKA 2L5LA 5AIXA 4D73B 1BG5A 5HFIA 5G5EA 4XIHA 2GDRA 1SL2B 3IAM2 3VWXA 4RI7A 5IO0A 1TDIA 2C0EA 1A8LA 2JZSA 2VLVA 2GSQA 2H75A 4K0GA 4EC0A 2HZEB 4OFNA 2PUKC 1HNCA 3ED3A 5A4VA 5CO3A 3I6AA 4IJ3A 1MEKA 3RPPA 2JZRA 2XPDA 1G7OA 4ZL7A 1CQHA 2DSAA 3TJFA 4K2DA 1JZOA 2PVOC 3LWAA 1TRSA 2MBTA 4EXJA 3UBKA 4K7IA 5ECOB 5CP1A 3DEXA 2FGXA 4X1UA 2RUEA 1EOHA 3U5RE 2X99A 3UIWA 1TU8A 2FWHA 5F05A 2YJ7A 5A5KA 3IXRA 1A23A 5ECPB 5LD0A 1VF3A 2VL3A 4ECJA 4EE0A 2LRCA 1XZOA 2CAIA 2GZZA 4ZL9A 5J4UA 2GSTA 5H5SA 3FRCA 3HYPA 4POBA 1H75A 4XTSA 1HQOA 2N5BA 5FT3A 1V2AA 1GTIA 5LNKe 2VCQA 3MAKA 2IN3A 4TXOB 1OC3A 4NHZA 1F9MA 2GQMA 1M2BA 2OE3A 4ECIA 5GAPD 3D22A 4HU7A 2JACA 3IAS2 3CXGA 3ZMLA 3R2QA 5DQSA 1YJ6A 3P2AA 2R2JA 1QUWA 2HSHA 1GSSA 5DBQA 3FHKA 1C72A 4AJ7A 5HR3A 4XRAA 1BX9A 1M7TA 4G10A 2YJHA 2DJ1A 4BL7A 1EWXA 2H0GA 1AIUA 2B7KA 4YH2A 3HY2A 3RAZA 1R26A 1YZXA 2Z9SA 3F4RA 1EEJA 1O6JA 4LLRA 1XVQA 4X43A 2BJXA 3GH6A 2FD3A 1SK2A 3ZRDA 1X9WB 4QL7A 1JZRA 3KXOA 3TRPA 2BMXA 3DVWA 3KMNA 4ZBBA 3TDGA 1O81A 1E6BA 2EIRA 3TUEA 2IJYA 2LUSA 3WGDA 5IPHA 4FH8A 1T8EB 4Z7XA 3E0UA 3QFBC 3EURA 4AJ8A 1TI3A 1R4WA 4PGTA 3EVIA 5F0GA 1MDIA 2L4CA 1WRYA 2I3YA 4KE3A 4V2MA 2ZUPA 3GURA 1G6YA 5KN3A 4IP1A 2OADA 2PMTA 1ERUA 1GSYA 3ZL5A 2A2RA 2HFDA 1X5EA 2WDUA 5IM9A 1FB6A 4EUYA 1IYIA 1G6WA 1TP9A 1KBNA 4V2NA 5FWGA 4DSRA 4MJEA 2L4QA 3TKSA 3O3TA 5DCHA 4MMMA 2J23A 4HU9A 1GSUA 1GL8A 2CA8A 2IMEA 4IJIA 4LA1A 1OYJA 1USBA 2HE3A 2RLIA 1K0CA 1DE1A 2EC4A 2C3NA 4XS4A 1A24A 3G7IA 4IBPA 1GTBA 2OKAA 2VOCA 3VI5A 2RM6A 4FYCA 5A4UA 4AJ6A 2TIRA 1XVWA 3DKSA 4XCSA 1PX7A 4L0WA 4DSQA 1T1VA 3M9KA 2AUVA 1N2AA 1U88A 4K0NA 1PMTA 2FWFA 2F51A 4WBJA 4Q5QA 4N0VA 2VAFA 2FWGA 8GSSA 4PX1A 2PGTA 3TCOA 1FVKA 2DC5A 4I6XA 2RIIA 4MP4A 3TOTA 5ID2A 2CVDA 5D9TA 2H74A 3LJRA 2ON7A 1XWBA 3UJ1A 3KM6A 3UMAA 4WBRD 1RW1A 1F37A 4GLTA 5IMZA 4ILFA 1F3AA 2HRNA 3KZQA 2V6OA 2YWNA 3GYKA 1SJ6A 4Q5NA 4E8HA 6GSUA 2H6YA 1ZGNA 2H1AA 4JEDA 3FYGA 4XS6A 2H73A 3TJJA 1LJRA 3MSZA 5ELAA 2JL4A 4HS1A 4RQXA 4N10A 2B5YA 1MD3A 3GFKA 1ERVA 4J57E 1TI1A 3MNGA 5CRDA 1EV9A 5B8AA 2E0QA 5DVBA 3HJPA 3L9SA 1XW6A 4WXTA 2YOIA 4KGIA 3IDVA 5B7CA 2L57A 3D4TA 3F4SA 2H76A 2V41A 1SYXA 3LYPA 2LJAA 2QKEA 1AQXA 2H70A 2JSZA 3ZTLA 4FYBA 3DIEA 1O8XA 3GKKA 1S3DA 1WPIA 3BOAA 3IK9A 4JZQA 4GRFA 3FZAA 2XC2A 1K0BA 5HR2A 2AYTA 3PH9A 3ZVJA 4F03A 1A2JA 3O6TA 3QMXA 4EL1A 2TRXA 2VCXA 5DJMA 3L9VA 4KCAA 1M0UA 4OFTA 5DAKB 2FCHA 1W4VA 6GSYA 3N5OA 2M72A 1F3BA 3VWUA 2MMAA 4TR4A 2LV3A 3UVTA 1U3IA 5ECIB 2YWMA 4ZB8A 3MDKA 3M1GA 3M9JA 4PNFA 3GHAA 2NBSA 1SK1A 2LSTA 3WYWA 2GGTA 1U3AA 5KN1A 2H01A 2LQQA 2O7KA 3HDCA 1DBYA 2WCIA 1ZYQB 4PUFC 2CVBA 1TKDB 17GSA 5ECNB 3GX0A 1M2DA 3BD2A 5CRGA 1XWKA 2IFQA 1EP8A 1OAZA 4KA0A 3BBYA 2JZTA 4DEJA 4LMVA 1WMJA 4KCEA 3TKQA 3NIVA 3RHCA 4MF7A 1XFLA 2FUG2 1E2YA 6GSXA 5E4WA 1A2LA 4ZL8A 4XHMA 3GTUA 3I69A 3L4NA 4P3YB 1K3YA 2D2ZA 3CTFA 3DGQA 4HUAA 1SK0A 3HKRA 2AAWA 2PN8A 1SKWB 4QQ7A 1GWCA 3LXZA 1GUHA 1JZWA 1KEBA 6GSTA 2C0FA 2DJKA 1PL2A 3DWVA 4KSMA 1YQ1A 2OBIA 3KJYA 4IQ1A 4G2EA 3ERWA 1PN9A 2YWOA 2LQOA 4OO5A 2F3MA 2VUPA 3ERGA 2WS2A 1PA3A 1HYUA 5IQYA 2CQ9A 5DQYA 4YAPA 3D5JA 2ZNMA 1ML6A 1X5CA 2MMOA 1XOBA 2OE1A 3FR9A 1NHOA 1Q4JA 4F0BA 1UC7A 2CX3A 1Q98A 2L5OA 3TOUA 5C04A 3WT2A 1MDKA 3L78A 1G0TA 3ZIJA 4AGSA 2VL2C 1DE2A 4MH2A 3FZ9A 4JBBA 2C0GA 2B1KA 4I5QA 5D9WA 1SD8A 1TK0B 2F8AA 1RQMA 4RI6A 2YZHA 3EMXA 3PR8A 3LEFA 4ML1A 2OJLA 4BVXA 2VM1A 1RK4A 4PURA 3DMLA 1HNAA 3A5WA 1SJZA 3QR6A 4HZ2A 4K7OA 2V1MA 4K9ZA 3J7Yk 2IMFA 2XBIA 4MF6A 4WETA 4FO5A 4V1Ap 1EEMA 2MMZA 1M9BA 3QD9A 5JWRB 1YF0A 1XOAA 2P5QA 4IHUA 3HXSA 4WF4A 4K6XA 1HD2A 4PNGA 3KCMA 2LNTA 2H6ZA 4YQVA 12GSA 1GSQA 1M9AA 4TOPA 4F2IA 2MBSA 4GWRA 1ERTA 3GRXA 3RPNA 5JCGA 3DXBA 3FEUA 2C8UA 4GTUA 4GXZA 2L59A 5G1LA 4IS0A 5EY6A 1OC9B 3C8EA 6GSWA 1Z6MA 2QGVA 1PX6A 2IMIA 5ECHB 1QQ2A 3F8UA 2EIOA 5H5RA 1F2EA 2H72A 3NZNA 3L9UA 1O8WA 1X9SB 2ALBA 4J56E 1A2MA 2PU9C 1WP0A 4G9HA 1SL0B 9GSSA 5ECLB 4WR5A 1MTCA 1A8YA 1PRXA 2KUCA 3O76A 1B8XA 3H4KA 2WULA 3CSHA 5IOWA 3QAVA 2XHFA 5IMAA 1AQVA 2G0FA 4D73A 2GZYA 4K8MA 3CSJA 4KH7A 2LRTA 4EKZA 4BWQA 3IBHA 4ZBDA 5G2ZA 1VGLA 1Z7PA 4O32A 1EGRA 1VRSD 4DSSB 3QFAC 4HDEA 2FA4A 4WEYA 2WRTA 1B48A 4O5RA 4HQSA 4ULXA 5CYYA 1XW5A 4MPFA 2B6MA 5D96A 1BYEA 2HZEA 2P5RA 2I9HA 3GKNA 2K8VA 3TGZA 2VIMA 2J9HA 3ZZXA 2PBJA 4GSNA 4LL1B 2YZUA 2VCZA 3KMOA 3U6VA 2MMNA 1EZKA 5F8BA 1T4YA 4MABA 3VURA 1H4OA 1S3AA 13GSA 5IMVA 1QGVA 1OC8A 4GSTA 3FR3A 3IE3A 2R4VA 5CAXA 1UN2A 3D0ZA 1THXA 4WF5A 1VF2A 1AC1A 2H0HA 3ME7A 5CNWA 1PL1A 1V40A 1SD9A 3KH7A 2A4VA 2C1YA 4LMWA 4YQUA 2PWJA 3EU3A 1YY7A 2QSIA 1AXDA 2YNXA 4POLA 5A4WA 2KHPA 5COHA 1FO5A 3P8WA 4OD7A 4BA7A 5D8IA 2X8CA 1JHBA 2MYGA 1K3OA 3FK8A 3RDWA 1K3LA 4TR3A 5IIZA 2YN1A 2NPBA 4FIWA 3WGEA 5HFGA 5IPGA 4DVCA 2QC7A 5GAND 3W6GA 3Q18A 1V9WA 1U87A 2NDOA 3UOMA 2O87A 4ECBA 1O85A 3F4TA 1GTUA 1A0RP 4MLYA 5D9VA 1ERWA 4OFMA 2L6CA 3KD0A 3D6IA 1SJIA 3RBTA 3H1NA 4F82A 4ML6A 3UAPA 5DALB 4KAEA 1TXXA 1B4QA 4F0CA 2LJKA 4O92A 1TRUA 3TJBA 4K7NA 5ENUA 4NXIA 4MCUA 3M0FA 3I9V2 1NW2A 4AF2A 2H1DA 1B9XC 1WOUA 1UVZA 2H71A 4K1FA 2GT5A 2CT6A 3EE2A 4YQMA 1Z6NA 1J08A 2FA8A 2YP6A 4TXVA 4G19A 3GKMA 3I43A 2GQLA 3IPZA 1V57A 1R5AA 5IMCA 4NMUA 1MDJA 2IMDA 3H93A 2LRNA 4TR1B 2B1LA 1NHYA 1ABAA 3HJOA 3A2XA 1T4ZA 2DIYA 2HZFA 5J5NA 1SKRB 3EC3A 2VCTA 5IMFA 3VI7A 3ZIVA 1ZOFA 1BAYA 1OKDA 2AV4A 1XCCA 2O8VB 1MD4A 4IP6A 2R6KA 2BTOT 3GH9A 1QMVA 3CBUA 2ES7A 2H19A 3GA4A 2ZCTA 1XWCA 2KP1A 5ABRA 1OE7A 4XS1A 4V1Ag 2DJ0A 3A2VA 2HI7A 2YCDA 4NV2A 3HD5A 4PXOA 1OE8A 4IKHA 3DRNA 5HR1A 2I4AA 1AAZA 1XW9A 1B4PA 2OBKA 3TJGA 1V58A 3V1WA 2KP2A 2P0GA 2K9FA 1V98A 3US3A 4N0ZA 3GL5A 14GSA 1WWJA 3HCZA 1N8JA 1I5GA 1SL1B 1HNBA 1ILOA 3A2WA 3UL3A 2YWIA 3LG6A 2VLUA 4XRDA 3VPQA 2PVQA 19GSA 2DJJA 3C1SA 3IV4A 2B3SA 5G30A 1EV4A 2K18A 3FY7A 2WFCA 2I1UA 2FWEA 1XXUA 2CZ2A 2LJRA 1PKZA 5J9CA 2L6DA 1TK8B 1LU4A 3KP8A 3FR6A 2YANA 2HXKA 4X0XA 1TOFA 2WJUA 2M46A 3UARA 3LYKA 3KEBA 2H0IA 3ZLPA 2MZCA 2X64A 3CSIA 4OMVA 4TW5A 1XBSA 2VCWA 3FZ4A 4NWYA 3D4MA 2WB9A 4HEA2 4POMA 3APOA 1TRVA 2HNLA 4NHWA 4TKYA 5CRWA 3W8JA 1PSQA 3SBCA 1TK5B 3BJ5A 1FW1A 1TRWA 4JR6A 3LSZA 3ERFA 3H8QA 1A0FA 3TRQA 4IW9A 4MK3A 4EDYA 6GSSA 1FAAA 2GSRA 2E2MA 2DJ3A 3QDNA 1S3CA 2VD1A 3K8NA 3EU4A 4OO4A 4HOJA 2K6VA 4MDCA 2DBCA 3G9BA 4CW9A 1X0RA 4IGJA 5HR0A 4V2LA 5GSSA 5KN0A 3GL3A 3ME8A 3C7MA 5DAKA 5AGYA 1O7UA 5IOXA 1QFNA 5B8BA 2VLTA 4KDUA 4NAXA 1GUMA 11GSA 3HVVA 4J2FA 3ZMKA 2IPAA 1EGOA 3CYNA 5ECRB 2VCVA 4EF0A 2IIYA 1FB0A 4E8EA 3APSA 3QCPA 1QK8A 2VO4A 5EVOA 1GH2A 4CDOA 2K8SA 4ZB9A 3HVSA 20GSA 1TW9A 2FHEA 4MZWA 3ZITA 3TKRA 2I81A 1DUGA 2N5AA 4NV5A 1K0AA 1GTAA 5EPFA 3VWWA 3D21A 2GZPA 2ON5A 5EL8A 2F9SA 2VL2A 1VF1A 1BQ7A 4XS4B 1VF4A 3HVXA 4MF5A 1OVNA 1FVJA 3OR5A 3TKSE 2E2GA 4HJMA 1PQNA 3G7JA 1BJXA 2CVKA 1SKSB 1GP1A 1R5PA 1FOVA 3ISOA 4BVYA 1O73A 5AISA 3M8NA 1YF1A 4OWYA 1JLWA 3ZFBA 3AY8A 3E9JB 1B9YC 2GLRA 5C00A 5J9BA 2E7PA 3LQ7A 3VLNA 5KEJA 1M2AA 4OCFA 5JWQB 5F06A 5ID2B 3FW2A 2AB6A 4KW6A 1Y6EA 2EIQA 1SU9A 1ACVA 3VFIA 2AJQB 3IA1A 1JZDA 2GQKA 5D93A 3TJKA 3NOFA 4L0UA 5ECKB 1K0MA 2B5EA 2PERA 5JCUA 2NTOA 2C3TA 2CAQA 2GVPA 3IHQA 4CHSA 4ACSA 1U6TA 3LGCA 1XPVA 2CZ3A 2RM5A 5DJLA 4KNDA 3DD3A 1X5DA 1TTZA 2LKUA 1LBKA 2F8FA 2LNSA 1GSFA 2X8GA 3F3RA 4EVMA 1X9MB 3QAWA 4ZBAA 3TKSC 3M3MA 3N9JA 3Q19A 4JRRA 1K0DA 1Z7RA 2HLSA 4WR4A 4ZILA 3L0HA 3EMPA 2JSYA 4GF0A 4KX4A 3HHVA 4PUAA 5HFKA 3C73A 3PINA 4JE1A 3P90A 3BCIA 4ID0A 3ZFLA 1IYHA 4POKA 4KDYA 1SYRA 1UA5A 2LS5A 4O7HA 5ECSA 1I9DA 4KUNA 5JWOB 4ZIJA 3ZYWA 2B7JA 1Z3EA 4IN0A 3IRAA 3UEMA 1PKWA 1J0FA 4KSOA 4HQZA 3CMIA 3FZ5A 1R7HA 4BPYA 3SWLA 3GV1A 2H30A 3EWLA 3GKXA 4L5OA 4MA9A 5CREA 1K0OA 1GNWA 4I2TA 4TR0A 4GQFA 2OE0A 3UBLA 1AW9A 1KTEA 1NM3A 5J41A 4L5LA 5ECMB 1ZYEA 3C1RA 5ELGA 2C0DA 3QAGA 1YDKA 3H79A 5G5FA 3CTGA 3HJMA 4EO3A 3F3QA 1WIKA 5LCZA 1W89A 5INYA 4TXOA 4ZB6A 5GZZB 5ECQB 3EYTA 3IC4A 2N5FA 3VK9A 3PGTA 3GX8A 5GSTA 1GRXA 5JCWA 1FG4A 1TJDA 1XWAA 3MWHA 1GSEA 3FKFA 3GSTA 4Q5RA 1QXHA 5DCGA 2WZ9A 3HA9A 1OC9A 4ISDA 5G31A 7GSSA 2M80A 4RUVA 2V32A 3WT1A 3F0IA 3KTLA 1T3BA 2H1BA 2HYXA 1SENA 3P7XA 4OCEA 4WKWA 2CV4A 3IK7A 3IR4A 2CX4A 1KNGA 4GCIA 10GSA 2HRFA 2IFQB 3ZVJD 1AQWA 1ZCPA 3TKPA 5B6MA 4HI7A 4MJCA 2VM2A 3KH9A 2NVLA 2C3QA 1GLQA 2FNOA 1TU7A 1GSDA 5F07A 3EINA 1YEPA 1WE0A 3TRXA 4QL9A 4PQIA 4DSSA 1JLVA 3GTUB 4JU5A 1ZL9A 1EP7A 1GULA 2XPEA 18GSA 5CRHA 2IL3A 1URMA 4GSSA 2DMLA 1BEDA 2FLSA 2GTUA 2VL9A 1PD21 3TB2A 1YKAA 2X8HA 4PQHA 2R3XA 5E59A 2R37A 5KN2A 3APQA 3Q6OA 2YV9A 1WJKA 1AUCA 2O85A 1ST9A 5B6NA 4BWSA 4LL4B 3CRTA 2O89A 3LXTA 2KOKA 1THOA 3GNJA 4I8BA 3BCKA 2H8LA 5AN1A 3RHBA 4IQAA 4N11A 4YAVA 1YKCA 2JADA 1XIYA 3GIXA 5D73A 3CRUA 4ECCA 2LEGA 3QOUA 2OACA 5J3RA 3WD6A 2YV7A 4TRXA 2C80A 3F9UA 2A2SA 1G7EA 4TN8A 1FHEA 4ZXGA 4MJAA 2DJ2A 3G7YA 16GSA 4I97A 1YEXA 1ZMAA 3DVXA
chains in the Genus database with same CATH superfamily
4EDZA 5HQPA 2V6KA 5AIVA 4N30A 4F9ZA 2AHEA 3KP9A 3WGXA 3LORA 3KIJA 2GSSA 4I2UA 2KLXA 3DYRA 2B5XA 1NSWA 4KB3A 1Z5YE 3Q74A 3F63A 3ZREA 1EOGA 3UVHA 1ZZYA 2UZ8A 1ON4A 3VWVA 1XWGA 1OKTA 2IMKA 2LTKA 5L71A 4Q5FA 1M99A 3VPTA 3J7Yb 4H86A 3GMFA 3F6FA 4NPBA 2GT6A 2TRCP 4L8EA 1DSBA 3LFLA 6GSVA 2P31A 3MIXA 2R5GA 2WGRA 4RQRA 2VD0A 4MH3A 1F6MC 4O5QA 3IOSA 5H5QA 4IELA 3JCML 1CQGA 4HSCX 5DALA 4PQ1A 3HZ4A 3KTBA 2DMMA 2H66A 4MPGA 2H6XA 4MJBA 22GSA 1T7PB 5IO2A 2FY6A 1Z9HA 2G2QA 1GLPA 2GS3A 3S9FA 2DIZA 1PGTA 1JFUA 2JU5A 2DLXA 3HZ8A 5DDLA 4HJ2A 4TVEA 4MZCA 3GSSA 2HSYA 3F6DA 1Y25A 4FYUA 2PPTA 5KOXA 3KGKA 4MZBA 5G1KA 3GN3A 2IWTA 1T00A 2V2GA 4JR4A 5IMDA 3QPMA 2C4JA 4TR1A 1GNEA 1J9BA 2HT9A 2RUFA 3E3EA 4GQCA 2YPMA 3C71A 5D9XA 4IVFA 1K0NA 3A3TA 3W8SA 4KDXA 4FQUA 2OA7A 4HZ4A 5FHIA 2REMA 2H1GA 3GUSA 2XBQA 1GUKA 2L5LA 5AIXA 4D73B 1BG5A 5HFIA 5G5EA 4XIHA 2GDRA 1SL2B 3IAM2 3VWXA 4RI7A 5IO0A 1TDIA 2C0EA 1A8LA 2JZSA 2VLVA 2GSQA 2H75A 4K0GA 4EC0A 2HZEB 4OFNA 2PUKC 1HNCA 3ED3A 5A4VA 5CO3A 3I6AA 4IJ3A 1MEKA 3RPPA 2JZRA 2XPDA 1G7OA 4ZL7A 1CQHA 2DSAA 3TJFA 4K2DA 1JZOA 2PVOC 3LWAA 1TRSA 2MBTA 3A5IA 4EXJA 3UBKA 4K7IA 5ECOB 5CP1A 3DEXA 2FGXA 4X1UA 2RUEA 1EOHA 3U5RE 2X99A 3UIWA 1TU8A 2FWHA 5F05A 2YJ7A 5A5KA 3IXRA 1A23A 5ECPB 5LD0A 1VF3A 2VL3A 4ECJA 4EE0A 2LRCA 1XZOA 2CAIA 2GZZA 4ZL9A 5J4UA 2GSTA 5H5SA 1PFOA 3FRCA 3HYPA 4POBA 1H75A 4XTSA 1HQOA 4O5UA 2N5BA 5FT3A 1V2AA 1GTIA 5LNKe 2VCQA 3MAKA 2IN3A 4TXOB 1OC3A 4NHZA 1F9MA 2GQMA 1M2BA 2OE3A 4ECIA 5GAPD 3D22A 4HU7A 2JACA 4CY6A 3IAS2 3CXGA 3ZMLA 3R2QA 5DQSA 1YJ6A 3P2AA 2R2JA 5BMUA 1QUWA 2HSHA 1GSSA 5KOWA 5DBQA 3FHKA 1C72A 4AJ7A 5HR3A 4XRAA 3R3EA 1BX9A 1M7TA 4G10A 2YJHA 2DJ1A 4BL7A 1EWXA 2H0GA 1AIUA 2B7KA 4YH2A 3HY2A 3RAZA 1R26A 1YZXA 2Z9SA 3F4RA 1EEJA 1O6JA 4LLRA 1XVQA 4X43A 2BJXA 3GH6A 2FD3A 1SK2A 3ZRDA 1X9WB 4QL7A 1JZRA 4G0LA 3KXOA 3TRPA 2BMXA 3DVWA 3KMNA 4ZBBA 3TDGA 1O81A 1E6BA 2EIRA 3TUEA 2IJYA 2HRKA 2LUSA 3WGDA 5IPHA 4FH8A 1T8EB 4Z7XA 3E0UA 3QFBC 3EURA 4AJ8A 1TI3A 1R4WA 4PGTA 3EVIA 5F0GA 1MDIA 2L4CA 1WRYA 2I3YA 4KE3A 4V2MA 2ZUPA 3GURA 1G6YA 5KN3A 4IP1A 2OADA 2PMTA 1ERUA 1GSYA 3ZL5A 2A2RA 2HFDA 1X5EA 2WDUA 5IM9A 1FB6A 4EUYA 1IYIA 1G6WA 1TP9A 1KBNA 4V2NA 5FWGA 4DSRA 4MJEA 2L4QA 3TKSA 3O3TA 5DCHA 4MMMA 2J23A 4HU9A 1GSUA 1GL8A 2CA8A 2IMEA 3EPTA 4IJIA 4LA1A 1OYJA 1USBA 2HE3A 2RLIA 1K0CA 1DE1A 2EC4A 2C3NA 4XS4A 1A24A 3G7IA 4IBPA 1GTBA 2OKAA 2VOCA 3VI5A 2RM6A 1M3IA 4FYCA 5A4UA 4AJ6A 2TIRA 1XVWA 3DKSA 4XCSA 1PX7A 4L0WA 4DSQA 1T1VA 3M9KA 2AUVA 1N2AA 1U88A 4K0NA 1PMTA 2FWFA 2F51A 4WBJA 4Q5QA 4N0VA 2VAFA 2FWGA 8GSSA 4PX1A 2PGTA 3TCOA 1FVKA 2DC5A 4I6XA 2RIIA 4MP4A 3TOTA 4G0KA 4K5SA 5ID2A 2CVDA 4YKFA 5D9TA 2H74A 3LJRA 2ON7A 1XWBA 3UJ1A 3KM6A 3UMAA 4WBRD 1RW1A 1F37A 4GLTA 5IMZA 4ILFA 1F3AA 2HRNA 3KZQA 2V6OA 2YWNA 3GYKA 1SJ6A 4Q5NA 4E8HA 6GSUA 2H6YA 1ZGNA 2H1AA 4JEDA 3FYGA 4XS6A 2H73A 3TJJA 1LJRA 3MSZA 5ELAA 2JL4A 4HS1A 4RQXA 4N10A 2B5YA 1MD3A 3GFKA 1ERVA 4J57E 1TI1A 3MNGA 5CRDA 4G0IA 1EV9A 5B8AA 2E0QA 5DVBA 3HJPA 3L9SA 1XW6A 4WXTA 2YOIA 4KGIA 3IDVA 5B7CA 2L57A 3D4TA 3F4SA 2H76A 2V41A 1SYXA 3LYPA 2LJAA 2QKEA 1AQXA 2H70A 2JSZA 3ZTLA 4FYBA 3DIEA 1O8XA 3GKKA 1S3DA 1WPIA 3BOAA 3IK9A 4JZQA 4GRFA 3FZAA 2XC2A 1K0BA 5HR2A 2AYTA 3PH9A 3ZVJA 4F03A 1A2JA 3O6TA 3QMXA 4EL1A 2TRXA 2VCXA 5DJMA 3L9VA 4KCAA 1M0UA 4OFTA 5DAKB 2FCHA 1W4VA 6GSYA 3N5OA 2M72A 1F3BA 3VWUA 2MMAA 4TR4A 2LV3A 3UVTA 1U3IA 5ECIB 2YWMA 4ZB8A 3MDKA 3M1GA 3M9JA 4PNFA 3GHAA 2NBSA 1SK1A 2LSTA 3WYWA 2GGTA 1U3AA 5KN1A 2H01A 2LQQA 2O7KA 3HDCA 1DBYA 2WCIA 1ZYQB 4PUFC 2CVBA 1TKDB 17GSA 5ECNB 3GX0A 1M2DA 3BD2A 5CRGA 1XWKA 2IFQA 1EP8A 1OAZA 4KA0A 3BBYA 2JZTA 4DEJA 4LMVA 1WMJA 4KCEA 3TKQA 3NIVA 3RHCA 4MF7A 1XFLA 2FUG2 1E2YA 6GSXA 5E4WA 1A2LA 4ZL8A 4XHMA 3GTUA 3I69A 3L4NA 4P3YB 1K3YA 2D2ZA 3CTFA 4BVYB 3DGQA 4HUAA 1SK0A 3HKRA 2AAWA 2PN8A 1SKWB 4QQ7A 1GWCA 3LXZA 1GUHA 1JZWA 2QA2A 1KEBA 6GSTA 2C0FA 2DJKA 1PL2A 3DWVA 4KSMA 1YQ1A 2OBIA 3KJYA 4IQ1A 2A2PA 4G2EA 3ERWA 1PN9A 2YWOA 2LQOA 4OO5A 2F3MA 2VUPA 3ERGA 2WS2A 1PA3A 1HYUA 5IQYA 2CQ9A 5DQYA 4YAPA 3D5JA 2ZNMA 1ML6A 1X5CA 1M3JA 2MMOA 1XOBA 1PN0A 2OE1A 2HSMA 3FR9A 1NHOA 1Q4JA 4YKGA 4F0BA 1UC7A 2CX3A 1Q98A 2L5OA 3TOUA 5C04A 3WT2A 1MDKA 3L78A 1G0TA 3ZIJA 4AGSA 2VL2C 1DE2A 4MH2A 3FZ9A 4JBBA 2C0GA 2B1KA 4I5QA 5D9WA 1SD8A 1TK0B 2F8AA 1RQMA 4RI6A 2YZHA 3EMXA 3PR8A 3LEFA 4ML1A 2OJLA 4BVXA 2VM1A 1RK4A 4PURA 3DMLA 1HNAA 3A5WA 1SJZA 3QR6A 4HZ2A 4K7OA 2V1MA 4K9ZA 3J7Yk 2IMFA 2XBIA 4MF6A 4WETA 4FO5A 4V1Ap 1EEMA 2MMZA 1M9BA 3QD9A 5JWRB 1YF0A 1XOAA 2P5QA 4IHUA 3HXSA 4WF4A 4K6XA 1HD2A 4PNGA 3KCMA 2LNTA 2H6ZA 4YQVA 12GSA 1GSQA 1M9AA 4TOPA 4F2IA 2MBSA 4GWRA 1ERTA 3GRXA 3RPNA 3IHGA 5JCGA 3DXBA 3FEUA 2C8UA 4GTUA 4GXZA 2L59A 5G1LA 4IS0A 5EY6A 1OC9B 3C8EA 6GSWA 1Z6MA 2QGVA 1PX6A 3FMWA 2IMIA 5ECHB 1QQ2A 3F8UA 2EIOA 5H5RA 1F2EA 2H72A 3NZNA 3L9UA 1O8WA 1X9SB 2ALBA 4J56E 1A2MA 2PU9C 1WP0A 4G9HA 1SL0B 4USSA 9GSSA 5ECLB 4WR5A 1MTCA 1A8YA 1PRXA 2KUCA 3O76A 1B8XA 3H4KA 2WULA 3CSHA 5IOWA 3QAVA 2XHFA 5IMAA 1AQVA 2G0FA 4D73A 2GZYA 4K8MA 3CSJA 4KH7A 2LRTA 4EKZA 4BWQA 3IBHA 4ZBDA 5G2ZA 1VGLA 1Z7PA 4O32A 1EGRA 1VRSD 4DSSB 3QFAC 4HDEA 2FA4A 2HRAA 4WEYA 4EIQA 2WRTA 1B48A 4O5RA 4HQSA 4ULXA 5CYYA 1XW5A 4MPFA 2B6MA 5D96A 1BYEA 2HZEA 2P5RA 2I9HA 3GKNA 2K8VA 3TGZA 2VIMA 2J9HA 3ZZXA 2PBJA 4GSNA 4LL1B 2YZUA 2X4AA 2VCZA 3KMOA 3U6VA 2MMNA 1EZKA 5F8BA 2R0GA 1T4YA 4MABA 3VURA 1H4OA 1S3AA 13GSA 5IMVA 1QGVA 1OC8A 4GSTA 3FR3A 3IE3A 2R4VA 5CAXA 1UN2A 3D0ZA 1THXA 4ICYA 2DKHA 4WF5A 1VF2A 1AC1A 2H0HA 3ME7A 5CNWA 2R0CA 1PL1A 1V40A 1SD9A 3KH7A 2A4VA 2C1YA 4LMWA 4YQUA 2PWJA 3EU3A 1YY7A 2QSIA 1AXDA 2YNXA 4POLA 5A4WA 2KHPA 5COHA 1FO5A 3P8WA 4OD7A 4BA7A 5D8IA 2X8CA 1JHBA 2MYGA 1K3OA 3FK8A 3RDWA 1K3LA 4TR3A 5IIZA 2YN1A 1ZYPA 2NPBA 4FIWA 3WGEA 5HFGA 5IPGA 4DVCA 2QC7A 5GAND 3W6GA 3Q18A 1V9WA 1U87A 2NDOA 3UOMA 2O87A 4ECBA 1O85A 3F4TA 1XG8A 1GTUA 1A0RP 4MLYA 5D9VA 1ERWA 4OFMA 2L6CA 3KD0A 3D6IA 1SJIA 3RBTA 3H1NA 4F82A 4EIPA 4ML6A 3UAPA 5DALB 4KAEA 1TXXA 1B4QA 4F0CA 2LJKA 4O92A 1TRUA 3TJBA 4K7NA 5ENUA 4NXIA 4MCUA 3M0FA 3I9V2 1NW2A 4AF2A 2H1DA 1B9XC 1WOUA 1UVZA 2H71A 4K1FA 2GT5A 2CT6A 3EE2A 4YQMA 2DKIA 1Z6NA 1J08A 2FA8A 2YP6A 4TXVA 4G19A 3GKMA 3I43A 2GQLA 3IPZA 1V57A 1R5AA 5IMCA 4NMUA 1MDJA 2IMDA 3H93A 2LRNA 4TR1B 2B1LA 1NHYA 1ABAA 3HJOA 3A2XA 1T4ZA 2DIYA 2HZFA 5J5NA 1SKRB 3EC3A 2VCTA 5IMFA 3VI7A 3ZIVA 1ZOFA 1BAYA 1OKDA 2AV4A 1XCCA 2O8VB 1MD4A 4IP6A 2R6KA 2BTOT 3GH9A 1QMVA 3CBUA 2ES7A 2H19A 3GA4A 2ZCTA 1XWCA 2KP1A 5ABRA 1OE7A 4XS1A 4V1Ag 2DJ0A 3A2VA 2HI7A 2YCDA 4NV2A 3HD5A 4PXOA 1OE8A 4IKHA 3DRNA 5HR1A 2I4AA 2X49A 1AAZA 1XW9A 1B4PA 2OBKA 3TJGA 1V58A 3V1WA 2KP2A 2P0GA 2K9FA 1V98A 3US3A 4N0ZA 2QA1A 3GL5A 14GSA 1WWJA 3HCZA 1N8JA 1I5GA 1SL1B 1HNBA 3LW9A 2A4HA 1ILOA 3A2WA 3UL3A 2YWIA 3LG6A 2VLUA 4XRDA 3VPQA 2PVQA 4BVXB 19GSA 2DJJA 3C1SA 3IV4A 4K5RA 2B3SA 5G30A 1EV4A 2K18A 3FY7A 2WFCA 2I1UA 2FWEA 1XXUA 2CZ2A 2LJRA 1PKZA 5J9CA 2L6DA 1TK8B 1LU4A 3KP8A 3FR6A 2YANA 2HXKA 4X0XA 1TOFA 2WJUA 2M46A 3UARA 3LYKA 3KEBA 2H0IA 3ZLPA 2MZCA 2X64A 3CSIA 4OMVA 4TW5A 1XBSA 2VCWA 3FZ4A 4NWYA 3D4MA 2WB9A 4HEA2 4POMA 3APOA 1TRVA 2HNLA 4NHWA 4TKYA 5CRWA 3W8JA 3HVNA 1PSQA 3SBCA 1TK5B 3BJ5A 1FW1A 1TRWA 4JR6A 3LSZA 3ERFA 3H8QA 4BL7B 1A0FA 3TRQA 4IW9A 3PPUA 4MK3A 4EDYA 6GSSA 1FAAA 2GSRA 2E2MA 2DJ3A 3QDNA 1S3CA 2VD1A 3K8NA 3EU4A 4OO4A 4HOJA 2K6VA 4MDCA 2DBCA 3G9BA 4CW9A 1X0RA 4IGJA 5HR0A 4V2LA 5GSSA 5KN0A 3GL3A 3ME8A 3C7MA 5DAKA 5AGYA 1O7UA 4BIKA 5IOXA 4Z2RA 1QFNA 5B8BA 2VLTA 4KDUA 4NAXA 5BRTA 1GUMA 11GSA 3HVVA 4J2FA 3ZMKA 2IPAA 1EGOA 3CYNA 5ECRB 2VCVA 4EF0A 2IIYA 1FB0A 4E8EA 3APSA 3QCPA 1QK8A 2VO4A 5EVOA 1GH2A 4CDOA 2K8SA 4ZB9A 3HVSA 20GSA 1TW9A 1FOHA 2FHEA 4MZWA 3ZITA 3TKRA 2I81A 1DUGA 2N5AA 4NV5A 1K0AA 4A5PA 1GTAA 5EPFA 3VWWA 3D21A 2GZPA 2R0PA 2ON5A 5EL8A 2F9SA 2VL2A 1VF1A 1BQ7A 4XS4B 1VF4A 3HVXA 4MF5A 1OVNA 1FVJA 3OR5A 3TKSE 2E2GA 4HJMA 1PQNA 3G7JA 1BJXA 2CVKA 1SKSB 1GP1A 1R5PA 1FOVA 3ISOA 4BVYA 1O73A 5AISA 3M8NA 1YF1A 4OWYA 1JLWA 3ZFBA 3AY8A 3E9JB 1B9YC 2GLRA 5C00A 5J9BA 2E7PA 3LQ7A 3VLNA 5KEJA 1M2AA 4OCFA 5JWQB 5F06A 5ID2B 3FW2A 2AB6A 4KW6A 1Y6EA 2EIQA 1SU9A 1ACVA 3VFIA 2AJQB 3IA1A 1JZDA 2GQKA 5D93A 3TJKA 3NOFA 4L0UA 5ECKB 1K0MA 2B5EA 2PERA 5JCUA 2NTOA 2C3TA 4X4JA 2CAQA 2GVPA 3IHQA 4CHSA 4ACSA 1U6TA 3LGCA 1XPVA 2CZ3A 2RM5A 1ZYNA 5DJLA 4KNDA 3DD3A 1X5DA 1TTZA 2LKUA 1LBKA 2F8FA 2LNSA 1GSFA 2X8GA 3F3RA 4EVMA 1X9MB 3QAWA 4ZBAA 3TKSC 3M3MA 3N9JA 3Q19A 4JRRA 1K0DA 4CY8A 1Z7RA 2HLSA 4WR4A 4ZILA 3L0HA 4K2XA 3EMPA 2JSYA 4GF0A 4KX4A 3HHVA 4PUAA 5HFKA 3C73A 3PINA 4JE1A 3P90A 3BCIA 4ID0A 3ZFLA 1IYHA 4POKA 4KDYA 1SYRA 1UA5A 2LS5A 3MYDA 4O7HA 5ECSA 1I9DA 4KUNA 5JWOB 4ZIJA 3ZYWA 2B7JA 4Z2UA 1Z3EA 4IN0A 3IRAA 3UEMA 1PKWA 1J0FA 4KSOA 4HQZA 3CMIA 3FZ5A 1R7HA 4BPYA 3SWLA 3GV1A 2H30A 3EWLA 3GKXA 4L5OA 4MA9A 5CREA 1K0OA 1GNWA 4I2TA 4TR0A 4GQFA 2OE0A 3UBLA 1AW9A 1KTEA 1NM3A 5J41A 4L5LA 5ECMB 1ZYEA 3C1RA 5ELGA 2C0DA 3QAGA 1YDKA 3H79A 5G5FA 3CTGA 3HJMA 4EO3A 3F3QA 1WIKA 5LCZA 1W89A 5INYA 4TXOA 4ZB6A 5GZZB 5ECQB 3EYTA 3IC4A 4KF9A 2N5FA 3VK9A 3PGTA 3GX8A 5GSTA 1GRXA 5JCWA 1FG4A 1TJDA 1XWAA 3MWHA 1GSEA 3FKFA 3GSTA 4Q5RA 1QXHA 5DCGA 3IC8A 2WZ9A 3CQFA 3HA9A 1OC9A 4ISDA 5G31A 7GSSA 2M80A 4RUVA 2V32A 3WT1A 3F0IA 3KTLA 1T3BA 2H1BA 2HYXA 1SENA 4PTSA 3P7XA 4OCEA 1S3RA 4WKWA 2CV4A 3IK7A 3IR4A 2CX4A 1KNGA 4GCIA 10GSA 2HRFA 2IFQB 3ZVJD 1AQWA 1ZCPA 3TKPA 4Z2TA 4MNNA 5B6MA 4HI7A 4MJCA 2VM2A 3KH9A 2NVLA 2C3QA 1GLQA 2FNOA 1TU7A 1GSDA 5F07A 3EINA 1YEPA 1WE0A 3TRXA 4QL9A 4PQIA 4DSSA 1JLVA 3GTUB 4JU5A 1ZL9A 1EP7A 1GULA 2XPEA 18GSA 5CRHA 2IL3A 1URMA 4GSSA 2DMLA 1BEDA 2FLSA 2GTUA 2VL9A 1PD21 3TB2A 1YKAA 2X8HA 4PQHA 2R3XA 5E59A 2R37A 5KN2A 3APQA 3Q6OA 2YV9A 1WJKA 1AUCA 2O85A 1ST9A 5B6NA 4BWSA 4LL4B 3CRTA 2O89A 3LXTA 2KOKA 1THOA 3GNJA 4I8BA 3BCKA 2H8LA 5AN1A 3RHBA 4IQAA 4N11A 4YAVA 1YKCA 2JADA 1XIYA 3GIXA 5D73A 3CRUA 4ECCA 2LEGA 3QOUA 2OACA 5J3RA 3WD6A 2YV7A 4TRXA 2C80A 3F9UA 2A2SA 1G7EA 4TN8A 1FHEA 4ZXGA 4MJAA 2DJ2A 3G7YA 16GSA 4I97A 1YEXA 1ZMAA 3DVXA
chains in the Genus database with same CATH topology
4EDZA 5HQPA 2V6KA 5AIVA 4N30A 4F9ZA 2AHEA 3KP9A 3WGXA 3LORA 3KIJA 2GSSA 4I2UA 2KLXA 3DYRA 2B5XA 1NSWA 4KB3A 1Z5YE 3Q74A 3F63A 3ZREA 1EOGA 3UVHA 1ZZYA 2UZ8A 1ON4A 3VWVA 1XWGA 1OKTA 2IMKA 2LTKA 5L71A 4Q5FA 1M99A 3VPTA 3J7Yb 4H86A 3GMFA 3F6FA 4NPBA 2GT6A 2TRCP 4L8EA 1DSBA 3LFLA 6GSVA 2P31A 3MIXA 2R5GA 2WGRA 4RQRA 2VD0A 4MH3A 1F6MC 4O5QA 3IOSA 5H5QA 4IELA 3JCML 1CQGA 5DALA 4PQ1A 3HZ4A 3KTBA 2DMMA 2H66A 4MPGA 2H6XA 4MJBA 22GSA 1T7PB 5IO2A 2FY6A 1Z9HA 2G2QA 1GLPA 2GS3A 3S9FA 2DIZA 1PGTA 1JFUA 2JU5A 2DLXA 3HZ8A 5DDLA 4HJ2A 4TVEA 4MZCA 3GSSA 2HSYA 3F6DA 1Y25A 4FYUA 2PPTA 5KOXA 3KGKA 4MZBA 5G1KA 3GN3A 2IWTA 1T00A 2V2GA 4JR4A 5IMDA 3QPMA 2C4JA 4TR1A 1GNEA 1J9BA 2HT9A 2RUFA 3E3EA 4GQCA 2YPMA 3C71A 5D9XA 4IVFA 1K0NA 3A3TA 3W8SA 4KDXA 4FQUA 2OA7A 4HZ4A 5FHIA 2REMA 2H1GA 3GUSA 2XBQA 1GUKA 2L5LA 5AIXA 4D73B 1BG5A 5HFIA 5G5EA 4XIHA 2GDRA 1SL2B 3IAM2 3VWXA 4RI7A 5IO0A 1TDIA 2C0EA 1A8LA 2JZSA 2VLVA 2GSQA 2H75A 4K0GA 4EC0A 2HZEB 4OFNA 2PUKC 1HNCA 3ED3A 5A4VA 5CO3A 3I6AA 4IJ3A 1MEKA 3RPPA 2JZRA 2XPDA 1G7OA 4ZL7A 1CQHA 2DSAA 3TJFA 4K2DA 1JZOA 2PVOC 3LWAA 1TRSA 2MBTA 3A5IA 4EXJA 3UBKA 4K7IA 5ECOB 5CP1A 3DEXA 2FGXA 4X1UA 2RUEA 1EOHA 3U5RE 2X99A 3UIWA 1TU8A 2FWHA 5F05A 2YJ7A 5A5KA 3IXRA 1A23A 5ECPB 5LD0A 1VF3A 2VL3A 4ECJA 4EE0A 2LRCA 1XZOA 2CAIA 2GZZA 4ZL9A 5J4UA 2GSTA 5H5SA 3FRCA 3HYPA 4POBA 1H75A 4XTSA 1HQOA 4O5UA 2N5BA 5FT3A 1V2AA 1GTIA 5LNKe 2VCQA 3MAKA 2IN3A 4TXOB 1OC3A 4NHZA 1F9MA 2GQMA 1M2BA 2OE3A 4ECIA 5GAPD 3D22A 4HU7A 2JACA 4CY6A 3IAS2 3CXGA 3ZMLA 3R2QA 5DQSA 1YJ6A 3P2AA 2R2JA 5BMUA 1QUWA 2HSHA 1GSSA 5KOWA 5DBQA 3FHKA 1C72A 4AJ7A 5HR3A 4XRAA 3R3EA 1BX9A 1M7TA 4G10A 2YJHA 2DJ1A 4BL7A 1EWXA 2H0GA 1AIUA 2B7KA 4YH2A 3HY2A 3RAZA 1R26A 1YZXA 2Z9SA 3F4RA 1EEJA 1O6JA 4LLRA 1XVQA 4X43A 2BJXA 3GH6A 2FD3A 1SK2A 3ZRDA 1X9WB 4QL7A 1JZRA 4G0LA 3KXOA 3TRPA 2BMXA 3DVWA 3KMNA 4ZBBA 3TDGA 1O81A 1E6BA 2EIRA 3TUEA 2IJYA 2HRKA 2LUSA 3WGDA 5IPHA 4FH8A 1T8EB 4Z7XA 3E0UA 3QFBC 3EURA 4AJ8A 1TI3A 1R4WA 4PGTA 3EVIA 5F0GA 1MDIA 2L4CA 1WRYA 2I3YA 4KE3A 4V2MA 2ZUPA 3GURA 1G6YA 5KN3A 4IP1A 2OADA 2PMTA 1ERUA 1GSYA 3ZL5A 2A2RA 2HFDA 1X5EA 2WDUA 5IM9A 1FB6A 4EUYA 1IYIA 1G6WA 1TP9A 1KBNA 4V2NA 5FWGA 4DSRA 4MJEA 2L4QA 3TKSA 3O3TA 5DCHA 4MMMA 2J23A 4HU9A 1GSUA 1GL8A 2CA8A 2IMEA 3EPTA 4IJIA 4LA1A 1OYJA 1USBA 2HE3A 2RLIA 1K0CA 1DE1A 2EC4A 2C3NA 4XS4A 1A24A 3G7IA 4IBPA 1GTBA 2OKAA 2VOCA 3VI5A 2RM6A 4FYCA 5A4UA 4AJ6A 2TIRA 1XVWA 3DKSA 4XCSA 1PX7A 4L0WA 4DSQA 1T1VA 3M9KA 2AUVA 1N2AA 1U88A 4K0NA 1PMTA 2FWFA 2F51A 4WBJA 4Q5QA 4N0VA 2VAFA 2FWGA 8GSSA 4PX1A 2PGTA 3TCOA 1FVKA 2DC5A 4I6XA 2RIIA 4MP4A 3TOTA 4G0KA 4K5SA 5ID2A 2CVDA 4YKFA 5D9TA 2H74A 3LJRA 2ON7A 1XWBA 3UJ1A 3KM6A 3UMAA 4WBRD 1RW1A 1F37A 4GLTA 5IMZA 4ILFA 1F3AA 2HRNA 3KZQA 2V6OA 2YWNA 3GYKA 1SJ6A 4Q5NA 4E8HA 6GSUA 2H6YA 1ZGNA 2H1AA 4JEDA 3FYGA 4XS6A 2H73A 3TJJA 1LJRA 3MSZA 5ELAA 2JL4A 4HS1A 4RQXA 4N10A 2B5YA 1MD3A 3GFKA 1ERVA 4J57E 1TI1A 3MNGA 5CRDA 4G0IA 1EV9A 5B8AA 2E0QA 5DVBA 3HJPA 3L9SA 1XW6A 4WXTA 2YOIA 4KGIA 3IDVA 5B7CA 2L57A 3D4TA 3F4SA 2H76A 2V41A 1SYXA 3LYPA 2LJAA 2QKEA 1AQXA 2H70A 2JSZA 3ZTLA 4FYBA 3DIEA 1O8XA 3GKKA 1S3DA 1WPIA 3BOAA 3IK9A 4JZQA 4GRFA 3FZAA 2XC2A 1K0BA 5HR2A 2AYTA 3PH9A 3ZVJA 4F03A 1A2JA 3O6TA 3QMXA 4EL1A 2TRXA 2VCXA 5DJMA 3L9VA 4KCAA 1M0UA 4OFTA 5DAKB 2FCHA 1W4VA 6GSYA 3N5OA 2M72A 1F3BA 3VWUA 2MMAA 4TR4A 2LV3A 3UVTA 1U3IA 5ECIB 2YWMA 4ZB8A 3MDKA 3M1GA 3M9JA 4PNFA 3GHAA 2NBSA 1SK1A 2LSTA 3WYWA 2GGTA 1U3AA 5KN1A 2H01A 2LQQA 2O7KA 3HDCA 1DBYA 2WCIA 1ZYQB 4PUFC 2CVBA 1TKDB 17GSA 5ECNB 3GX0A 1M2DA 3BD2A 5CRGA 1XWKA 2IFQA 1EP8A 1OAZA 4KA0A 3BBYA 2JZTA 4DEJA 4LMVA 1WMJA 4KCEA 3TKQA 3NIVA 3RHCA 4MF7A 1XFLA 2FUG2 1E2YA 6GSXA 5E4WA 1A2LA 4ZL8A 4XHMA 3GTUA 3I69A 3L4NA 4P3YB 1K3YA 2D2ZA 3CTFA 4BVYB 3DGQA 4HUAA 1SK0A 3HKRA 2AAWA 2PN8A 1SKWB 4QQ7A 1GWCA 3LXZA 1GUHA 1JZWA 2QA2A 1KEBA 6GSTA 2C0FA 2DJKA 1PL2A 3DWVA 4KSMA 1YQ1A 2OBIA 3KJYA 4IQ1A 2A2PA 4G2EA 3ERWA 1PN9A 2YWOA 2LQOA 4OO5A 2F3MA 2VUPA 3ERGA 2WS2A 1PA3A 1HYUA 5IQYA 2CQ9A 5DQYA 4YAPA 3D5JA 2ZNMA 1ML6A 1X5CA 2MMOA 1XOBA 1PN0A 2OE1A 2HSMA 3FR9A 1NHOA 1Q4JA 4YKGA 4F0BA 1UC7A 2CX3A 1Q98A 2L5OA 3TOUA 5C04A 3WT2A 1MDKA 3L78A 1G0TA 3ZIJA 4AGSA 2VL2C 1DE2A 4MH2A 3FZ9A 4JBBA 2C0GA 2B1KA 4I5QA 5D9WA 1SD8A 1TK0B 2F8AA 1RQMA 4RI6A 2YZHA 3EMXA 3PR8A 3LEFA 4ML1A 2OJLA 4BVXA 2VM1A 1RK4A 4PURA 3DMLA 1HNAA 3A5WA 1SJZA 3QR6A 4HZ2A 4K7OA 2V1MA 4K9ZA 3J7Yk 2IMFA 2XBIA 4MF6A 4WETA 4FO5A 4V1Ap 1EEMA 2MMZA 1M9BA 3QD9A 5JWRB 1YF0A 1XOAA 2P5QA 4IHUA 3HXSA 4WF4A 4K6XA 1HD2A 4PNGA 3KCMA 2LNTA 2H6ZA 4YQVA 12GSA 1GSQA 1M9AA 4TOPA 4F2IA 2MBSA 4GWRA 1ERTA 3GRXA 3RPNA 3IHGA 5JCGA 3DXBA 3FEUA 2C8UA 4GTUA 4GXZA 2L59A 5G1LA 4IS0A 5EY6A 1OC9B 3C8EA 6GSWA 1Z6MA 2QGVA 1PX6A 3FMWA 2IMIA 5ECHB 1QQ2A 3F8UA 2EIOA 5H5RA 1F2EA 2H72A 3NZNA 3L9UA 1O8WA 1X9SB 2ALBA 4J56E 1A2MA 2PU9C 1WP0A 4G9HA 1SL0B 4USSA 9GSSA 5ECLB 4WR5A 1MTCA 1A8YA 1PRXA 2KUCA 3O76A 1B8XA 3H4KA 2WULA 3CSHA 5IOWA 3QAVA 2XHFA 5IMAA 1AQVA 2G0FA 4D73A 2GZYA 4K8MA 3CSJA 4KH7A 2LRTA 4EKZA 4BWQA 3IBHA 4ZBDA 5G2ZA 1VGLA 1Z7PA 4O32A 1EGRA 1VRSD 4DSSB 3QFAC 4HDEA 2FA4A 2HRAA 4WEYA 4EIQA 2WRTA 1B48A 4O5RA 4HQSA 4ULXA 5CYYA 1XW5A 4MPFA 2B6MA 5D96A 1BYEA 2HZEA 2P5RA 2I9HA 3GKNA 2K8VA 3TGZA 2VIMA 2J9HA 3ZZXA 2PBJA 4GSNA 4LL1B 2YZUA 2X4AA 2VCZA 3KMOA 3U6VA 2MMNA 1EZKA 5F8BA 2R0GA 1T4YA 4MABA 3VURA 1H4OA 1S3AA 13GSA 5IMVA 1QGVA 1OC8A 4GSTA 3FR3A 3IE3A 2R4VA 5CAXA 1UN2A 3D0ZA 1THXA 4ICYA 2DKHA 4WF5A 1VF2A 1AC1A 2H0HA 3ME7A 5CNWA 2R0CA 1PL1A 1V40A 1SD9A 3KH7A 2A4VA 2C1YA 4LMWA 4YQUA 2PWJA 3EU3A 1YY7A 2QSIA 1AXDA 2YNXA 4POLA 5A4WA 2KHPA 5COHA 1FO5A 3P8WA 4OD7A 4BA7A 5D8IA 2X8CA 1JHBA 2MYGA 1K3OA 3FK8A 3RDWA 1K3LA 4TR3A 5IIZA 2YN1A 1ZYPA 2NPBA 4FIWA 3WGEA 5HFGA 5IPGA 4DVCA 2QC7A 5GAND 3W6GA 3Q18A 1V9WA 1U87A 2NDOA 3UOMA 2O87A 4ECBA 1O85A 3F4TA 1GTUA 1A0RP 4MLYA 5D9VA 1ERWA 4OFMA 2L6CA 3KD0A 3D6IA 1SJIA 3RBTA 3H1NA 4F82A 4EIPA 4ML6A 3UAPA 5DALB 4KAEA 1TXXA 1B4QA 4F0CA 2LJKA 4O92A 1TRUA 3TJBA 4K7NA 5ENUA 4NXIA 4MCUA 3M0FA 3I9V2 1NW2A 4AF2A 2H1DA 1B9XC 1WOUA 1UVZA 2H71A 4K1FA 2GT5A 2CT6A 3EE2A 4YQMA 2DKIA 1Z6NA 1J08A 2FA8A 2YP6A 4TXVA 4G19A 3GKMA 3I43A 2GQLA 3IPZA 1V57A 1R5AA 5IMCA 4NMUA 1MDJA 2IMDA 3H93A 2LRNA 4TR1B 2B1LA 1NHYA 1ABAA 3HJOA 3A2XA 1T4ZA 2DIYA 2HZFA 5J5NA 1SKRB 3EC3A 2VCTA 5IMFA 3VI7A 3ZIVA 1ZOFA 1BAYA 1OKDA 2AV4A 1XCCA 2O8VB 1MD4A 4IP6A 2R6KA 2BTOT 3GH9A 1QMVA 3CBUA 2ES7A 2H19A 3GA4A 2ZCTA 1XWCA 2KP1A 5ABRA 1OE7A 4XS1A 4V1Ag 2DJ0A 3A2VA 2HI7A 2YCDA 4NV2A 3HD5A 4PXOA 1OE8A 4IKHA 3DRNA 5HR1A 2I4AA 2X49A 1AAZA 1XW9A 1B4PA 2OBKA 3TJGA 1V58A 3V1WA 2KP2A 2P0GA 2K9FA 1V98A 3US3A 4N0ZA 2QA1A 3GL5A 14GSA 1WWJA 3HCZA 1N8JA 1I5GA 1SL1B 1HNBA 3LW9A 2A4HA 1ILOA 3A2WA 3UL3A 2YWIA 3LG6A 2VLUA 4XRDA 3VPQA 2PVQA 4BVXB 19GSA 2DJJA 3C1SA 3IV4A 4K5RA 2B3SA 5G30A 1EV4A 2K18A 3FY7A 2WFCA 2I1UA 2FWEA 1XXUA 2CZ2A 2LJRA 1PKZA 5J9CA 2L6DA 1TK8B 1LU4A 3KP8A 3FR6A 2YANA 2HXKA 4X0XA 1TOFA 2WJUA 2M46A 3UARA 3LYKA 3KEBA 2H0IA 3ZLPA 2MZCA 2X64A 3CSIA 4OMVA 4TW5A 1XBSA 2VCWA 3FZ4A 4NWYA 3D4MA 2WB9A 4HEA2 4POMA 3APOA 1TRVA 2HNLA 4NHWA 4TKYA 5CRWA 3W8JA 1PSQA 3SBCA 1TK5B 3BJ5A 1FW1A 1TRWA 4JR6A 3LSZA 3ERFA 3H8QA 4BL7B 1A0FA 3TRQA 4IW9A 3PPUA 4MK3A 4EDYA 6GSSA 1FAAA 2GSRA 2E2MA 2DJ3A 3QDNA 1S3CA 2VD1A 3K8NA 3EU4A 4OO4A 4HOJA 2K6VA 4MDCA 2DBCA 3G9BA 4CW9A 1X0RA 4IGJA 5HR0A 4V2LA 5GSSA 5KN0A 3GL3A 3ME8A 3C7MA 5DAKA 5AGYA 1O7UA 5IOXA 4Z2RA 1QFNA 5B8BA 2VLTA 4KDUA 4NAXA 5BRTA 1GUMA 11GSA 3HVVA 4J2FA 3ZMKA 2IPAA 1EGOA 3CYNA 5ECRB 2VCVA 4EF0A 2IIYA 1FB0A 4E8EA 3APSA 3QCPA 1QK8A 2VO4A 5EVOA 1GH2A 4CDOA 2K8SA 4ZB9A 3HVSA 20GSA 1TW9A 1FOHA 2FHEA 4MZWA 3ZITA 3TKRA 2I81A 1DUGA 2N5AA 4NV5A 1K0AA 4A5PA 1GTAA 5EPFA 3VWWA 3D21A 2GZPA 2R0PA 2ON5A 5EL8A 2F9SA 2VL2A 1VF1A 1BQ7A 4XS4B 1VF4A 3HVXA 4MF5A 1OVNA 1FVJA 3OR5A 3TKSE 2E2GA 4HJMA 1PQNA 3G7JA 1BJXA 2CVKA 1SKSB 1GP1A 1R5PA 1FOVA 3ISOA 4BVYA 1O73A 5AISA 3M8NA 1YF1A 4OWYA 1JLWA 3ZFBA 3AY8A 3E9JB 1B9YC 2GLRA 5C00A 5J9BA 2E7PA 3LQ7A 3VLNA 5KEJA 1M2AA 4OCFA 5JWQB 5F06A 5ID2B 3FW2A 2AB6A 4KW6A 1Y6EA 2EIQA 1SU9A 1ACVA 3VFIA 2AJQB 3IA1A 1JZDA 2GQKA 5D93A 3TJKA 3NOFA 4L0UA 5ECKB 1K0MA 2B5EA 2PERA 5JCUA 2NTOA 2C3TA 4X4JA 2CAQA 2GVPA 3IHQA 4CHSA 4ACSA 1U6TA 3LGCA 1XPVA 2CZ3A 2RM5A 1ZYNA 5DJLA 4KNDA 3DD3A 1X5DA 1TTZA 2LKUA 1LBKA 2F8FA 2LNSA 1GSFA 2X8GA 3F3RA 4EVMA 1X9MB 3QAWA 4ZBAA 3TKSC 3M3MA 3N9JA 3Q19A 4JRRA 1K0DA 4CY8A 1Z7RA 2HLSA 4WR4A 4ZILA 3L0HA 4K2XA 3EMPA 2JSYA 4GF0A 4KX4A 3HHVA 4PUAA 5HFKA 3C73A 3PINA 4JE1A 3P90A 3BCIA 4ID0A 3ZFLA 1IYHA 4POKA 4KDYA 1SYRA 1UA5A 2LS5A 3MYDA 4O7HA 5ECSA 1I9DA 4KUNA 5JWOB 4ZIJA 3ZYWA 2B7JA 4Z2UA 1Z3EA 4IN0A 3IRAA 3UEMA 1PKWA 1J0FA 4KSOA 4HQZA 3CMIA 3FZ5A 1R7HA 4BPYA 3SWLA 3GV1A 2H30A 3EWLA 3GKXA 4L5OA 4MA9A 5CREA 1K0OA 1GNWA 4I2TA 4TR0A 4GQFA 2OE0A 3UBLA 1AW9A 1KTEA 1NM3A 5J41A 4L5LA 5ECMB 1ZYEA 3C1RA 5ELGA 2C0DA 3QAGA 1YDKA 3H79A 5G5FA 3CTGA 3HJMA 4EO3A 3F3QA 1WIKA 5LCZA 1W89A 5INYA 4TXOA 4ZB6A 5GZZB 5ECQB 3EYTA 3IC4A 4KF9A 2N5FA 3VK9A 3PGTA 3GX8A 5GSTA 1GRXA 5JCWA 1FG4A 1TJDA 1XWAA 3MWHA 1GSEA 3FKFA 3GSTA 4Q5RA 1QXHA 5DCGA 3IC8A 2WZ9A 3HA9A 1OC9A 4ISDA 5G31A 7GSSA 2M80A 4RUVA 2V32A 3WT1A 3F0IA 3KTLA 1T3BA 2H1BA 2HYXA 1SENA 4PTSA 3P7XA 4OCEA 4WKWA 2CV4A 3IK7A 3IR4A 2CX4A 1KNGA 4GCIA 10GSA 2HRFA 2IFQB 3ZVJD 1AQWA 1ZCPA 3TKPA 4Z2TA 4MNNA 5B6MA 4HI7A 4MJCA 2VM2A 3KH9A 2NVLA 2C3QA 1GLQA 2FNOA 1TU7A 1GSDA 5F07A 3EINA 1YEPA 1WE0A 3TRXA 4QL9A 4PQIA 4DSSA 1JLVA 3GTUB 4JU5A 1ZL9A 1EP7A 1GULA 2XPEA 18GSA 5CRHA 2IL3A 1URMA 4GSSA 2DMLA 1BEDA 2FLSA 2GTUA 2VL9A 1PD21 3TB2A 1YKAA 2X8HA 4PQHA 2R3XA 5E59A 2R37A 5KN2A 3APQA 3Q6OA 2YV9A 1WJKA 1AUCA 2O85A 1ST9A 5B6NA 4BWSA 4LL4B 3CRTA 2O89A 3LXTA 2KOKA 1THOA 3GNJA 4I8BA 3BCKA 2H8LA 5AN1A 3RHBA 4IQAA 4N11A 4YAVA 1YKCA 2JADA 1XIYA 3GIXA 5D73A 3CRUA 4ECCA 2LEGA 3QOUA 2OACA 5J3RA 3WD6A 2YV7A 4TRXA 2C80A 3F9UA 2A2SA 1G7EA 4TN8A 1FHEA 4ZXGA 4MJAA 2DJ2A 3G7YA 16GSA 4I97A 1YEXA 1ZMAA 3DVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EDZ A;  5HQP A;  2V6K A;  5AIV A;  4N30 A;  4F9Z A;  2AHE A;  3KP9 A;  3WGX A;  3LOR A;  3KIJ A;  2GSS A;  4I2U A;  2KLX A;  3DYR A;  2B5X A;  1NSW A;  4KB3 A;  1Z5Y E;  3Q74 A;  3F63 A;  3ZRE A;  1EOG A;  3UVH A;  1ZZY A;  1ON4 A;  3VWV A;  1XWG A;  1OKT A;  2IMK A;  2LTK A;  5L71 A;  4Q5F A;  1M99 A;  3VPT A;  3J7Y b;  4H86 A;  3GMF A;  3F6F A;  4NPB A;  2GT6 A;  2TRC P;  4L8E A;  1DSB A;  3LFL A;  6GSV A;  2P31 A;  2R5G A;  2WGR A;  4RQR A;  2VD0 A;  4MH3 A;  1F6M C;  3IOS A;  5H5Q A;  4IEL A;  3JCM L;  1CQG A;  5DAL A;  4PQ1 A;  3HZ4 A;  3KTB A;  2DMM A;  2H66 A;  4MPG A;  2H6X A;  4MJB A;  22GS A;  1T7P B;  5IO2 A;  2FY6 A;  1Z9H A;  2G2Q A;  1GLP A;  2GS3 A;  3S9F A;  2DIZ A;  1PGT A;  1JFU A;  2JU5 A;  2DLX A;  3HZ8 A;  5DDL A;  4HJ2 A;  4TVE A;  4MZC A;  3GSS A;  2HSY A;  3F6D A;  1Y25 A;  4FYU A;  2PPT A;  3KGK A;  4MZB A;  5G1K A;  3GN3 A;  2IWT A;  1T00 A;  2V2G A;  4JR4 A;  5IMD A;  3QPM A;  2C4J A;  4TR1 A;  1GNE A;  1J9B A;  2HT9 A;  2RUF A;  3E3E A;  4GQC A;  2YPM A;  3C71 A;  5D9X A;  4IVF A;  1K0N A;  3A3T A;  3W8S A;  4KDX A;  2OA7 A;  4HZ4 A;  5FHI A;  2REM A;  2H1G A;  3GUS A;  2XBQ A;  1GUK A;  2L5L A;  5AIX A;  4D73 B;  1BG5 A;  5HFI A;  5G5E A;  4XIH A;  2GDR A;  1SL2 B;  3IAM 2;  3VWX A;  4RI7 A;  5IO0 A;  1TDI A;  2C0E A;  1A8L A;  2JZS A;  2VLV A;  2GSQ A;  2H75 A;  4K0G A;  4EC0 A;  2HZE B;  4OFN A;  2PUK C;  1HNC A;  3ED3 A;  5A4V A;  5CO3 A;  3I6A A;  4IJ3 A;  1MEK A;  3RPP A;  2JZR A;  2XPD A;  1G7O A;  4ZL7 A;  1CQH A;  2DSA A;  3TJF A;  4K2D A;  1JZO A;  2PVO C;  3LWA A;  1TRS A;  2MBT A;  4EXJ A;  3UBK A;  4K7I A;  5ECO B;  5CP1 A;  3DEX A;  2FGX A;  4X1U A;  2RUE A;  1EOH A;  3U5R E;  2X99 A;  3UIW A;  1TU8 A;  2FWH A;  5F05 A;  2YJ7 A;  5A5K A;  3IXR A;  1A23 A;  5ECP B;  5LD0 A;  1VF3 A;  2VL3 A;  4ECJ A;  4EE0 A;  2LRC A;  1XZO A;  2CAI A;  2GZZ A;  4ZL9 A;  5J4U A;  2GST A;  5H5S A;  3FRC A;  3HYP A;  4POB A;  1H75 A;  4XTS A;  1HQO A;  2N5B A;  5FT3 A;  1V2A A;  1GTI A;  5LNK e;  2VCQ A;  3MAK A;  2IN3 A;  4TXO B;  1OC3 A;  4NHZ A;  1F9M A;  2GQM A;  1M2B A;  2OE3 A;  4ECI A;  5GAP D;  3D22 A;  4HU7 A;  2JAC A;  3IAS 2;  3CXG A;  3ZML A;  3R2Q A;  5DQS A;  1YJ6 A;  3P2A A;  2R2J A;  1QUW A;  2HSH A;  1GSS A;  5DBQ A;  3FHK A;  1C72 A;  4AJ7 A;  5HR3 A;  4XRA A;  1BX9 A;  1M7T A;  4G10 A;  2YJH A;  2DJ1 A;  4BL7 A;  1EWX A;  2H0G A;  1AIU A;  2B7K A;  4YH2 A;  3HY2 A;  3RAZ A;  1R26 A;  1YZX A;  2Z9S A;  3F4R A;  1EEJ A;  1O6J A;  4LLR A;  1XVQ A;  4X43 A;  2BJX A;  3GH6 A;  2FD3 A;  1SK2 A;  3ZRD A;  1X9W B;  4QL7 A;  1JZR A;  3KXO A;  3TRP A;  2BMX A;  3DVW A;  3KMN A;  4ZBB A;  3TDG A;  1O81 A;  1E6B A;  2EIR A;  3TUE A;  2IJY A;  2LUS A;  3WGD A;  5IPH A;  4FH8 A;  1T8E B;  4Z7X A;  3E0U A;  3QFB C;  3EUR A;  4AJ8 A;  1TI3 A;  1R4W A;  4PGT A;  3EVI A;  5F0G A;  1MDI A;  2L4C A;  1WRY A;  2I3Y A;  4KE3 A;  4V2M A;  2ZUP A;  3GUR A;  1G6Y A;  5KN3 A;  4IP1 A;  2OAD A;  2PMT A;  1ERU A;  1GSY A;  3ZL5 A;  2A2R A;  2HFD A;  1X5E A;  2WDU A;  5IM9 A;  1FB6 A;  4EUY A;  1IYI A;  1G6W A;  1TP9 A;  1KBN A;  4V2N A;  5FWG A;  4DSR A;  4MJE A;  2L4Q A;  3TKS A;  3O3T A;  5DCH A;  4MMM A;  2J23 A;  4HU9 A;  1GSU A;  1GL8 A;  2CA8 A;  2IME A;  4IJI A;  4LA1 A;  1OYJ A;  1USB A;  2HE3 A;  2RLI A;  1K0C A;  1DE1 A;  2EC4 A;  2C3N A;  4XS4 A;  1A24 A;  3G7I A;  4IBP A;  1GTB A;  2OKA A;  2VOC A;  3VI5 A;  2RM6 A;  4FYC A;  5A4U A;  4AJ6 A;  2TIR A;  1XVW A;  3DKS A;  4XCS A;  1PX7 A;  4L0W A;  4DSQ A;  1T1V A;  3M9K A;  2AUV A;  1N2A A;  1U88 A;  4K0N A;  1PMT A;  2FWF A;  2F51 A;  4WBJ A;  4Q5Q A;  4N0V A;  2VAF A;  2FWG A;  8GSS A;  4PX1 A;  2PGT A;  3TCO A;  1FVK A;  2DC5 A;  4I6X A;  2RII A;  4MP4 A;  3TOT A;  5ID2 A;  2CVD A;  5D9T A;  2H74 A;  3LJR A;  2ON7 A;  1XWB A;  3UJ1 A;  3KM6 A;  3UMA A;  4WBR D;  1RW1 A;  1F37 A;  4GLT A;  5IMZ A;  4ILF A;  1F3A A;  2HRN A;  3KZQ A;  2V6O A;  2YWN A;  3GYK A;  1SJ6 A;  4Q5N A;  4E8H A;  6GSU A;  2H6Y A;  1ZGN A;  2H1A A;  4JED A;  3FYG A;  4XS6 A;  2H73 A;  3TJJ A;  1LJR A;  3MSZ A;  5ELA A;  2JL4 A;  4HS1 A;  4RQX A;  4N10 A;  2B5Y A;  1MD3 A;  3GFK A;  1ERV A;  4J57 E;  1TI1 A;  3MNG A;  5CRD A;  1EV9 A;  5B8A A;  2E0Q A;  5DVB A;  3HJP A;  3L9S A;  1XW6 A;  4WXT A;  2YOI A;  4KGI A;  3IDV A;  5B7C A;  2L57 A;  3D4T A;  3F4S A;  2H76 A;  2V41 A;  1SYX A;  3LYP A;  2LJA A;  2QKE A;  1AQX A;  2H70 A;  2JSZ A;  3ZTL A;  4FYB A;  3DIE A;  1O8X A;  3GKK A;  1S3D A;  1WPI A;  3BOA A;  3IK9 A;  4JZQ A;  4GRF A;  3FZA A;  2XC2 A;  1K0B A;  5HR2 A;  2AYT A;  3PH9 A;  3ZVJ A;  4F03 A;  1A2J A;  3O6T A;  3QMX A;  4EL1 A;  2TRX A;  2VCX A;  5DJM A;  3L9V A;  4KCA A;  1M0U A;  4OFT A;  5DAK B;  2FCH A;  1W4V A;  6GSY A;  3N5O A;  2M72 A;  1F3B A;  3VWU A;  2MMA A;  4TR4 A;  2LV3 A;  3UVT A;  1U3I A;  5ECI B;  2YWM A;  4ZB8 A;  3MDK A;  3M1G A;  3M9J A;  4PNF A;  3GHA A;  2NBS A;  1SK1 A;  2LST A;  3WYW A;  2GGT A;  1U3A A;  5KN1 A;  2H01 A;  2LQQ A;  2O7K A;  3HDC A;  1DBY A;  2WCI A;  1ZYQ B;  4PUF C;  2CVB A;  1TKD B;  17GS A;  5ECN B;  3GX0 A;  1M2D A;  3BD2 A;  5CRG A;  1XWK A;  2IFQ A;  1EP8 A;  1OAZ A;  4KA0 A;  3BBY A;  2JZT A;  4DEJ A;  4LMV A;  1WMJ A;  4KCE A;  3TKQ A;  3NIV A;  3RHC A;  4MF7 A;  1XFL A;  2FUG 2;  1E2Y A;  6GSX A;  5E4W A;  1A2L A;  4ZL8 A;  4XHM A;  3GTU A;  3I69 A;  3L4N A;  4P3Y B;  1K3Y A;  2D2Z A;  3CTF A;  3DGQ A;  4HUA A;  1SK0 A;  3HKR A;  2AAW A;  2PN8 A;  1SKW B;  4QQ7 A;  1GWC A;  3LXZ A;  1GUH A;  1JZW A;  1KEB A;  6GST A;  2C0F A;  2DJK A;  1PL2 A;  3DWV A;  4KSM A;  1YQ1 A;  2OBI A;  3KJY A;  4IQ1 A;  4G2E A;  3ERW A;  1PN9 A;  2YWO A;  2LQO A;  4OO5 A;  2F3M A;  2VUP A;  3ERG A;  2WS2 A;  1PA3 A;  1HYU A;  5IQY A;  2CQ9 A;  5DQY A;  4YAP A;  3D5J A;  2ZNM A;  1ML6 A;  1X5C A;  2MMO A;  1XOB A;  2OE1 A;  3FR9 A;  1NHO A;  1Q4J A;  4F0B A;  1UC7 A;  2CX3 A;  1Q98 A;  2L5O A;  3TOU A;  5C04 A;  3WT2 A;  1MDK A;  3L78 A;  1G0T A;  3ZIJ A;  4AGS A;  2VL2 C;  1DE2 A;  4MH2 A;  3FZ9 A;  4JBB A;  2C0G A;  2B1K A;  4I5Q A;  5D9W A;  1SD8 A;  1TK0 B;  2F8A A;  1RQM A;  4RI6 A;  2YZH A;  3EMX A;  3PR8 A;  3LEF A;  4ML1 A;  2OJL A;  4BVX A;  2VM1 A;  1RK4 A;  4PUR A;  3DML A;  1HNA A;  3A5W A;  1SJZ A;  3QR6 A;  4HZ2 A;  4K7O A;  2V1M A;  4K9Z A;  3J7Y k;  2IMF A;  2XBI A;  4MF6 A;  4WET A;  4FO5 A;  4V1A p;  1EEM A;  2MMZ A;  1M9B A;  3QD9 A;  5JWR B;  1YF0 A;  1XOA A;  2P5Q A;  4IHU A;  3HXS A;  4WF4 A;  4K6X A;  1HD2 A;  4PNG A;  3KCM A;  2LNT A;  2H6Z A;  4YQV A;  12GS A;  1GSQ A;  1M9A A;  4TOP A;  4F2I A;  2MBS A;  4GWR A;  1ERT A;  3GRX A;  3RPN A;  5JCG A;  3DXB A;  3FEU A;  2C8U A;  4GTU A;  4GXZ A;  2L59 A;  5G1L A;  4IS0 A;  5EY6 A;  1OC9 B;  3C8E A;  6GSW A;  1Z6M A;  2QGV A;  1PX6 A;  2IMI A;  5ECH B;  1QQ2 A;  3F8U A;  2EIO A;  5H5R A;  1F2E A;  2H72 A;  3NZN A;  3L9U A;  1O8W A;  1X9S B;  2ALB A;  4J56 E;  1A2M A;  2PU9 C;  1WP0 A;  4G9H A;  1SL0 B;  9GSS A;  5ECL B;  4WR5 A;  1MTC A;  1A8Y A;  1PRX A;  2KUC A;  3O76 A;  1B8X A;  3H4K A;  2WUL A;  3CSH A;  5IOW A;  3QAV A;  2XHF A;  5IMA A;  1AQV A;  2G0F A;  4D73 A;  2GZY A;  4K8M A;  3CSJ A;  4KH7 A;  2LRT A;  4EKZ A;  4BWQ A;  3IBH A;  4ZBD A;  5G2Z A;  1VGL A;  1Z7P A;  4O32 A;  1EGR A;  1VRS D;  4DSS B;  3QFA C;  4HDE A;  2FA4 A;  4WEY A;  2WRT A;  1B48 A;  4O5R A;  4HQS A;  4ULX A;  5CYY A;  1XW5 A;  4MPF A;  2B6M A;  5D96 A;  1BYE A;  2HZE A;  2P5R A;  2I9H A;  3GKN A;  2K8V A;  3TGZ A;  2VIM A;  2J9H A;  3ZZX A;  2PBJ A;  4GSN A;  4LL1 B;  2YZU A;  2VCZ A;  3KMO A;  3U6V A;  2MMN A;  1EZK A;  5F8B A;  1T4Y A;  4MAB A;  3VUR A;  1H4O A;  1S3A A;  13GS A;  5IMV A;  1QGV A;  1OC8 A;  4GST A;  3FR3 A;  3IE3 A;  2R4V A;  5CAX A;  1UN2 A;  3D0Z A;  1THX A;  4WF5 A;  1VF2 A;  1AC1 A;  2H0H A;  3ME7 A;  5CNW A;  1PL1 A;  1V40 A;  1SD9 A;  3KH7 A;  2A4V A;  2C1Y A;  4LMW A;  4YQU A;  2PWJ A;  3EU3 A;  1YY7 A;  2QSI A;  1AXD A;  2YNX A;  4POL A;  5A4W A;  2KHP A;  5COH A;  1FO5 A;  3P8W A;  4OD7 A;  4BA7 A;  5D8I A;  2X8C A;  1JHB A;  2MYG A;  1K3O A;  3FK8 A;  3RDW A;  1K3L A;  4TR3 A;  5IIZ A;  2YN1 A;  2NPB A;  4FIW A;  3WGE A;  5HFG A;  5IPG A;  4DVC A;  2QC7 A;  5GAN D;  3W6G A;  3Q18 A;  1V9W A;  1U87 A;  2NDO A;  3UOM A;  2O87 A;  4ECB A;  1O85 A;  3F4T A;  1GTU A;  1A0R P;  4MLY A;  5D9V A;  1ERW A;  4OFM A;  2L6C A;  3KD0 A;  3D6I A;  1SJI A;  3RBT A;  3H1N A;  4F82 A;  4ML6 A;  3UAP A;  5DAL B;  4KAE A;  1TXX A;  1B4Q A;  4F0C A;  2LJK A;  4O92 A;  1TRU A;  3TJB A;  4K7N A;  5ENU A;  4NXI A;  4MCU A;  3M0F A;  3I9V 2;  1NW2 A;  4AF2 A;  2H1D A;  1B9X C;  1WOU A;  1UVZ A;  2H71 A;  4K1F A;  2GT5 A;  2CT6 A;  3EE2 A;  4YQM A;  1Z6N A;  1J08 A;  2FA8 A;  2YP6 A;  4TXV A;  4G19 A;  3GKM A;  3I43 A;  2GQL A;  3IPZ A;  1V57 A;  1R5A A;  5IMC A;  4NMU A;  1MDJ A;  2IMD A;  3H93 A;  2LRN A;  4TR1 B;  2B1L A;  1NHY A;  1ABA A;  3HJO A;  3A2X A;  1T4Z A;  2DIY A;  2HZF A;  5J5N A;  1SKR B;  3EC3 A;  2VCT A;  5IMF A;  3VI7 A;  3ZIV A;  1ZOF A;  1BAY A;  1OKD A;  2AV4 A;  1XCC A;  2O8V B;  1MD4 A;  4IP6 A;  2R6K A;  2BTO T;  3GH9 A;  1QMV A;  3CBU A;  2ES7 A;  2H19 A;  3GA4 A;  2ZCT A;  1XWC A;  2KP1 A;  5ABR A;  1OE7 A;  4XS1 A;  4V1A g;  2DJ0 A;  3A2V A;  2HI7 A;  2YCD A;  4NV2 A;  3HD5 A;  4PXO A;  1OE8 A;  4IKH A;  3DRN A;  5HR1 A;  2I4A A;  1AAZ A;  1XW9 A;  1B4P A;  2OBK A;  3TJG A;  1V58 A;  3V1W A;  2KP2 A;  2P0G A;  2K9F A;  1V98 A;  3US3 A;  4N0Z A;  3GL5 A;  14GS A;  1WWJ A;  3HCZ A;  1N8J A;  1I5G A;  1SL1 B;  1HNB A;  1ILO A;  3A2W A;  3UL3 A;  2YWI A;  3LG6 A;  2VLU A;  4XRD A;  3VPQ A;  2PVQ A;  19GS A;  2DJJ A;  3C1S A;  3IV4 A;  2B3S A;  5G30 A;  1EV4 A;  2K18 A;  3FY7 A;  2WFC A;  2I1U A;  2FWE A;  1XXU A;  2CZ2 A;  2LJR A;  1PKZ A;  5J9C A;  2L6D A;  1TK8 B;  1LU4 A;  3KP8 A;  3FR6 A;  2YAN A;  2HXK A;  4X0X A;  1TOF A;  2WJU A;  2M46 A;  3UAR A;  3LYK A;  3KEB A;  2H0I A;  3ZLP A;  2MZC A;  2X64 A;  3CSI A;  4OMV A;  4TW5 A;  1XBS A;  2VCW A;  3FZ4 A;  4NWY A;  3D4M A;  2WB9 A;  4HEA 2;  4POM A;  3APO A;  1TRV A;  2HNL A;  4NHW A;  4TKY A;  5CRW A;  3W8J A;  1PSQ A;  3SBC A;  1TK5 B;  3BJ5 A;  1FW1 A;  1TRW A;  4JR6 A;  3LSZ A;  3ERF A;  3H8Q A;  1A0F A;  3TRQ A;  4IW9 A;  4MK3 A;  4EDY A;  6GSS A;  1FAA A;  2GSR A;  2E2M A;  2DJ3 A;  3QDN A;  1S3C A;  2VD1 A;  3K8N A;  3EU4 A;  4OO4 A;  4HOJ A;  2K6V A;  4MDC A;  2DBC A;  3G9B A;  4CW9 A;  1X0R A;  4IGJ A;  5HR0 A;  4V2L A;  5GSS A;  5KN0 A;  3GL3 A;  3ME8 A;  3C7M A;  5DAK A;  5AGY A;  1O7U A;  5IOX A;  1QFN A;  5B8B A;  2VLT A;  4KDU A;  4NAX A;  1GUM A;  11GS A;  3HVV A;  4J2F A;  3ZMK A;  2IPA A;  1EGO A;  3CYN A;  5ECR B;  2VCV A;  4EF0 A;  2IIY A;  1FB0 A;  4E8E A;  3APS A;  3QCP A;  1QK8 A;  2VO4 A;  5EVO A;  1GH2 A;  4CDO A;  2K8S A;  4ZB9 A;  3HVS A;  20GS A;  1TW9 A;  2FHE A;  4MZW A;  3ZIT A;  3TKR A;  2I81 A;  1DUG A;  2N5A A;  4NV5 A;  1K0A A;  1GTA A;  5EPF A;  3VWW A;  3D21 A;  2GZP A;  2ON5 A;  5EL8 A;  2F9S A;  2VL2 A;  1VF1 A;  1BQ7 A;  4XS4 B;  1VF4 A;  3HVX A;  4MF5 A;  1OVN A;  1FVJ A;  3OR5 A;  3TKS E;  2E2G A;  4HJM A;  1PQN A;  3G7J A;  1BJX A;  2CVK A;  1SKS B;  1GP1 A;  1R5P A;  1FOV A;  3ISO A;  4BVY A;  1O73 A;  5AIS A;  3M8N A;  1YF1 A;  4OWY A;  1JLW A;  3ZFB A;  3AY8 A;  3E9J B;  1B9Y C;  2GLR A;  5C00 A;  5J9B A;  2E7P A;  3LQ7 A;  3VLN A;  5KEJ A;  1M2A A;  4OCF A;  5JWQ B;  5F06 A;  5ID2 B;  3FW2 A;  2AB6 A;  4KW6 A;  1Y6E A;  2EIQ A;  1SU9 A;  1ACV A;  3VFI A;  2AJQ B;  3IA1 A;  1JZD A;  2GQK A;  5D93 A;  3TJK A;  3NOF A;  4L0U A;  5ECK B;  1K0M A;  2B5E A;  2PER A;  5JCU A;  2NTO A;  2C3T A;  2CAQ A;  2GVP A;  3IHQ A;  4CHS A;  4ACS A;  1U6T A;  3LGC A;  1XPV A;  2CZ3 A;  2RM5 A;  5DJL A;  4KND A;  3DD3 A;  1X5D A;  1TTZ A;  2LKU A;  1LBK A;  2F8F A;  2LNS A;  1GSF A;  2X8G A;  3F3R A;  4EVM A;  1X9M B;  3QAW A;  4ZBA A;  3TKS C;  3M3M A;  3N9J A;  3Q19 A;  4JRR A;  1K0D A;  1Z7R A;  2HLS A;  4WR4 A;  4ZIL A;  3L0H A;  3EMP A;  2JSY A;  4GF0 A;  4KX4 A;  3HHV A;  4PUA A;  5HFK A;  3C73 A;  3PIN A;  4JE1 A;  3P90 A;  3BCI A;  4ID0 A;  3ZFL A;  1IYH A;  4POK A;  4KDY A;  1SYR A;  1UA5 A;  2LS5 A;  4O7H A;  5ECS A;  1I9D A;  4KUN A;  5JWO B;  4ZIJ A;  3ZYW A;  2B7J A;  1Z3E A;  4IN0 A;  3IRA A;  3UEM A;  1PKW A;  1J0F A;  4KSO A;  4HQZ A;  3CMI A;  3FZ5 A;  1R7H A;  4BPY A;  3SWL A;  3GV1 A;  2H30 A;  3EWL A;  3GKX A;  4L5O A;  4MA9 A;  5CRE A;  1K0O A;  1GNW A;  4I2T A;  4TR0 A;  4GQF A;  2OE0 A;  3UBL A;  1AW9 A;  1KTE A;  1NM3 A;  5J41 A;  4L5L A;  5ECM B;  1ZYE A;  3C1R A;  5ELG A;  2C0D A;  3QAG A;  1YDK A;  3H79 A;  5G5F A;  3CTG A;  3HJM A;  4EO3 A;  3F3Q A;  1WIK A;  5LCZ A;  1W89 A;  5INY A;  4TXO A;  4ZB6 A;  5GZZ B;  5ECQ B;  3EYT A;  3IC4 A;  2N5F A;  3VK9 A;  3PGT A;  3GX8 A;  5GST A;  1GRX A;  5JCW A;  1FG4 A;  1TJD A;  1XWA A;  3MWH A;  1GSE A;  3FKF A;  3GST A;  4Q5R A;  1QXH A;  5DCG A;  2WZ9 A;  3HA9 A;  1OC9 A;  4ISD A;  5G31 A;  7GSS A;  2M80 A;  4RUV A;  2V32 A;  3WT1 A;  3F0I A;  3KTL A;  1T3B A;  2H1B A;  2HYX A;  1SEN A;  3P7X A;  4OCE A;  4WKW A;  2CV4 A;  3IK7 A;  3IR4 A;  2CX4 A;  1KNG A;  4GCI A;  10GS A;  2HRF A;  2IFQ B;  3ZVJ D;  1AQW A;  1ZCP A;  3TKP A;  5B6M A;  4HI7 A;  4MJC A;  2VM2 A;  3KH9 A;  2NVL A;  2C3Q A;  1GLQ A;  2FNO A;  1TU7 A;  1GSD A;  5F07 A;  3EIN A;  1YEP A;  1WE0 A;  3TRX A;  4QL9 A;  4PQI A;  4DSS A;  1JLV A;  3GTU B;  4JU5 A;  1ZL9 A;  1EP7 A;  1GUL A;  2XPE A;  18GS A;  5CRH A;  2IL3 A;  1URM A;  4GSS A;  2DML A;  1BED A;  2FLS A;  2GTU A;  2VL9 A;  1PD2 1;  3TB2 A;  1YKA A;  2X8H A;  4PQH A;  2R3X A;  5E59 A;  2R37 A;  5KN2 A;  3APQ A;  3Q6O A;  2YV9 A;  1WJK A;  1AUC A;  2O85 A;  1ST9 A;  5B6N A;  4BWS A;  4LL4 B;  3CRT A;  2O89 A;  3LXT A;  2KOK A;  1THO A;  3GNJ A;  4I8B A;  3BCK A;  2H8L A;  5AN1 A;  3RHB A;  4IQA A;  4N11 A;  4YAV A;  1YKC A;  2JAD A;  1XIY A;  3GIX A;  5D73 A;  3CRU A;  4ECC A;  2LEG A;  3QOU A;  2OAC A;  5J3R A;  3WD6 A;  2YV7 A;  4TRX A;  2C80 A;  3F9U A;  2A2S A;  1G7E A;  4TN8 A;  1FHE A;  4ZXG A;  4MJA A;  2DJ2 A;  3G7Y A;  16GS A;  4I97 A;  1YEX A;  1ZMA A;  3DVX A; 
#chains in the Genus database with same CATH topology
 4EDZ A;  5HQP A;  2V6K A;  5AIV A;  4N30 A;  4F9Z A;  2AHE A;  3KP9 A;  3WGX A;  3LOR A;  3KIJ A;  2GSS A;  4I2U A;  2KLX A;  3DYR A;  2B5X A;  1NSW A;  4KB3 A;  1Z5Y E;  3Q74 A;  3F63 A;  3ZRE A;  1EOG A;  3UVH A;  1ZZY A;  2UZ8 A;  1ON4 A;  3VWV A;  1XWG A;  1OKT A;  2IMK A;  2LTK A;  5L71 A;  4Q5F A;  1M99 A;  3VPT A;  3J7Y b;  4H86 A;  3GMF A;  3F6F A;  4NPB A;  2GT6 A;  2TRC P;  4L8E A;  1DSB A;  3LFL A;  6GSV A;  2P31 A;  3MIX A;  2R5G A;  2WGR A;  4RQR A;  2VD0 A;  4MH3 A;  1F6M C;  4O5Q A;  3IOS A;  5H5Q A;  4IEL A;  3JCM L;  1CQG A;  4HSC X;  5DAL A;  4PQ1 A;  3HZ4 A;  3KTB A;  2DMM A;  2H66 A;  4MPG A;  2H6X A;  4MJB A;  22GS A;  1T7P B;  5IO2 A;  2FY6 A;  1Z9H A;  2G2Q A;  1GLP A;  2GS3 A;  3S9F A;  2DIZ A;  1PGT A;  1JFU A;  2JU5 A;  2DLX A;  3HZ8 A;  5DDL A;  4HJ2 A;  4TVE A;  4MZC A;  3GSS A;  2HSY A;  3F6D A;  1Y25 A;  4FYU A;  2PPT A;  5KOX A;  3KGK A;  4MZB A;  5G1K A;  3GN3 A;  2IWT A;  1T00 A;  2V2G A;  4JR4 A;  5IMD A;  3QPM A;  2C4J A;  4TR1 A;  1GNE A;  1J9B A;  2HT9 A;  2RUF A;  3E3E A;  4GQC A;  2YPM A;  3C71 A;  5D9X A;  4IVF A;  1K0N A;  3A3T A;  3W8S A;  4KDX A;  4FQU A;  2OA7 A;  4HZ4 A;  5FHI A;  2REM A;  2H1G A;  3GUS A;  2XBQ A;  1GUK A;  2L5L A;  5AIX A;  4D73 B;  1BG5 A;  5HFI A;  5G5E A;  4XIH A;  2GDR A;  1SL2 B;  3IAM 2;  3VWX A;  4RI7 A;  5IO0 A;  1TDI A;  2C0E A;  1A8L A;  2JZS A;  2VLV A;  2GSQ A;  2H75 A;  4K0G A;  4EC0 A;  2HZE B;  4OFN A;  2PUK C;  1HNC A;  3ED3 A;  5A4V A;  5CO3 A;  3I6A A;  4IJ3 A;  1MEK A;  3RPP A;  2JZR A;  2XPD A;  1G7O A;  4ZL7 A;  1CQH A;  2DSA A;  3TJF A;  4K2D A;  1JZO A;  2PVO C;  3LWA A;  1TRS A;  2MBT A;  3A5I A;  4EXJ A;  3UBK A;  4K7I A;  5ECO B;  5CP1 A;  3DEX A;  2FGX A;  4X1U A;  2RUE A;  1EOH A;  3U5R E;  2X99 A;  3UIW A;  1TU8 A;  2FWH A;  5F05 A;  2YJ7 A;  5A5K A;  3IXR A;  1A23 A;  5ECP B;  5LD0 A;  1VF3 A;  2VL3 A;  4ECJ A;  4EE0 A;  2LRC A;  1XZO A;  2CAI A;  2GZZ A;  4ZL9 A;  5J4U A;  2GST A;  5H5S A;  1PFO A;  3FRC A;  3HYP A;  4POB A;  1H75 A;  4XTS A;  1HQO A;  4O5U A;  2N5B A;  5FT3 A;  1V2A A;  1GTI A;  5LNK e;  2VCQ A;  3MAK A;  2IN3 A;  4TXO B;  1OC3 A;  4NHZ A;  1F9M A;  2GQM A;  1M2B A;  2OE3 A;  4ECI A;  5GAP D;  3D22 A;  4HU7 A;  2JAC A;  4CY6 A;  3IAS 2;  3CXG A;  3ZML A;  3R2Q A;  5DQS A;  1YJ6 A;  3P2A A;  2R2J A;  5BMU A;  1QUW A;  2HSH A;  1GSS A;  5KOW A;  5DBQ A;  3FHK A;  1C72 A;  4AJ7 A;  5HR3 A;  4XRA A;  3R3E A;  1BX9 A;  1M7T A;  4G10 A;  2YJH A;  2DJ1 A;  4BL7 A;  1EWX A;  2H0G A;  1AIU A;  2B7K A;  4YH2 A;  3HY2 A;  3RAZ A;  1R26 A;  1YZX A;  2Z9S A;  3F4R A;  1EEJ A;  1O6J A;  4LLR A;  1XVQ A;  4X43 A;  2BJX A;  3GH6 A;  2FD3 A;  1SK2 A;  3ZRD A;  1X9W B;  4QL7 A;  1JZR A;  4G0L A;  3KXO A;  3TRP A;  2BMX A;  3DVW A;  3KMN A;  4ZBB A;  3TDG A;  1O81 A;  1E6B A;  2EIR A;  3TUE A;  2IJY A;  2HRK A;  2LUS A;  3WGD A;  5IPH A;  4FH8 A;  1T8E B;  4Z7X A;  3E0U A;  3QFB C;  3EUR A;  4AJ8 A;  1TI3 A;  1R4W A;  4PGT A;  3EVI A;  5F0G A;  1MDI A;  2L4C A;  1WRY A;  2I3Y A;  4KE3 A;  4V2M A;  2ZUP A;  3GUR A;  1G6Y A;  5KN3 A;  4IP1 A;  2OAD A;  2PMT A;  1ERU A;  1GSY A;  3ZL5 A;  2A2R A;  2HFD A;  1X5E A;  2WDU A;  5IM9 A;  1FB6 A;  4EUY A;  1IYI A;  1G6W A;  1TP9 A;  1KBN A;  4V2N A;  5FWG A;  4DSR A;  4MJE A;  2L4Q A;  3TKS A;  3O3T A;  5DCH A;  4MMM A;  2J23 A;  4HU9 A;  1GSU A;  1GL8 A;  2CA8 A;  2IME A;  3EPT A;  4IJI A;  4LA1 A;  1OYJ A;  1USB A;  2HE3 A;  2RLI A;  1K0C A;  1DE1 A;  2EC4 A;  2C3N A;  4XS4 A;  1A24 A;  3G7I A;  4IBP A;  1GTB A;  2OKA A;  2VOC A;  3VI5 A;  2RM6 A;  1M3I A;  4FYC A;  5A4U A;  4AJ6 A;  2TIR A;  1XVW A;  3DKS A;  4XCS A;  1PX7 A;  4L0W A;  4DSQ A;  1T1V A;  3M9K A;  2AUV A;  1N2A A;  1U88 A;  4K0N A;  1PMT A;  2FWF A;  2F51 A;  4WBJ A;  4Q5Q A;  4N0V A;  2VAF A;  2FWG A;  8GSS A;  4PX1 A;  2PGT A;  3TCO A;  1FVK A;  2DC5 A;  4I6X A;  2RII A;  4MP4 A;  3TOT A;  4G0K A;  4K5S A;  5ID2 A;  2CVD A;  4YKF A;  5D9T A;  2H74 A;  3LJR A;  2ON7 A;  1XWB A;  3UJ1 A;  3KM6 A;  3UMA A;  4WBR D;  1RW1 A;  1F37 A;  4GLT A;  5IMZ A;  4ILF A;  1F3A A;  2HRN A;  3KZQ A;  2V6O A;  2YWN A;  3GYK A;  1SJ6 A;  4Q5N A;  4E8H A;  6GSU A;  2H6Y A;  1ZGN A;  2H1A A;  4JED A;  3FYG A;  4XS6 A;  2H73 A;  3TJJ A;  1LJR A;  3MSZ A;  5ELA A;  2JL4 A;  4HS1 A;  4RQX A;  4N10 A;  2B5Y A;  1MD3 A;  3GFK A;  1ERV A;  4J57 E;  1TI1 A;  3MNG A;  5CRD A;  4G0I A;  1EV9 A;  5B8A A;  2E0Q A;  5DVB A;  3HJP A;  3L9S A;  1XW6 A;  4WXT A;  2YOI A;  4KGI A;  3IDV A;  5B7C A;  2L57 A;  3D4T A;  3F4S A;  2H76 A;  2V41 A;  1SYX A;  3LYP A;  2LJA A;  2QKE A;  1AQX A;  2H70 A;  2JSZ A;  3ZTL A;  4FYB A;  3DIE A;  1O8X A;  3GKK A;  1S3D A;  1WPI A;  3BOA A;  3IK9 A;  4JZQ A;  4GRF A;  3FZA A;  2XC2 A;  1K0B A;  5HR2 A;  2AYT A;  3PH9 A;  3ZVJ A;  4F03 A;  1A2J A;  3O6T A;  3QMX A;  4EL1 A;  2TRX A;  2VCX A;  5DJM A;  3L9V A;  4KCA A;  1M0U A;  4OFT A;  5DAK B;  2FCH A;  1W4V A;  6GSY A;  3N5O A;  2M72 A;  1F3B A;  3VWU A;  2MMA A;  4TR4 A;  2LV3 A;  3UVT A;  1U3I A;  5ECI B;  2YWM A;  4ZB8 A;  3MDK A;  3M1G A;  3M9J A;  4PNF A;  3GHA A;  2NBS A;  1SK1 A;  2LST A;  3WYW A;  2GGT A;  1U3A A;  5KN1 A;  2H01 A;  2LQQ A;  2O7K A;  3HDC A;  1DBY A;  2WCI A;  1ZYQ B;  4PUF C;  2CVB A;  1TKD B;  17GS A;  5ECN B;  3GX0 A;  1M2D A;  3BD2 A;  5CRG A;  1XWK A;  2IFQ A;  1EP8 A;  1OAZ A;  4KA0 A;  3BBY A;  2JZT A;  4DEJ A;  4LMV A;  1WMJ A;  4KCE A;  3TKQ A;  3NIV A;  3RHC A;  4MF7 A;  1XFL A;  2FUG 2;  1E2Y A;  6GSX A;  5E4W A;  1A2L A;  4ZL8 A;  4XHM A;  3GTU A;  3I69 A;  3L4N A;  4P3Y B;  1K3Y A;  2D2Z A;  3CTF A;  4BVY B;  3DGQ A;  4HUA A;  1SK0 A;  3HKR A;  2AAW A;  2PN8 A;  1SKW B;  4QQ7 A;  1GWC A;  3LXZ A;  1GUH A;  1JZW A;  2QA2 A;  1KEB A;  6GST A;  2C0F A;  2DJK A;  1PL2 A;  3DWV A;  4KSM A;  1YQ1 A;  2OBI A;  3KJY A;  4IQ1 A;  2A2P A;  4G2E A;  3ERW A;  1PN9 A;  2YWO A;  2LQO A;  4OO5 A;  2F3M A;  2VUP A;  3ERG A;  2WS2 A;  1PA3 A;  1HYU A;  5IQY A;  2CQ9 A;  5DQY A;  4YAP A;  3D5J A;  2ZNM A;  1ML6 A;  1X5C A;  1M3J A;  2MMO A;  1XOB A;  1PN0 A;  2OE1 A;  2HSM A;  3FR9 A;  1NHO A;  1Q4J A;  4YKG A;  4F0B A;  1UC7 A;  2CX3 A;  1Q98 A;  2L5O A;  3TOU A;  5C04 A;  3WT2 A;  1MDK A;  3L78 A;  1G0T A;  3ZIJ A;  4AGS A;  2VL2 C;  1DE2 A;  4MH2 A;  3FZ9 A;  4JBB A;  2C0G A;  2B1K A;  4I5Q A;  5D9W A;  1SD8 A;  1TK0 B;  2F8A A;  1RQM A;  4RI6 A;  2YZH A;  3EMX A;  3PR8 A;  3LEF A;  4ML1 A;  2OJL A;  4BVX A;  2VM1 A;  1RK4 A;  4PUR A;  3DML A;  1HNA A;  3A5W A;  1SJZ A;  3QR6 A;  4HZ2 A;  4K7O A;  2V1M A;  4K9Z A;  3J7Y k;  2IMF A;  2XBI A;  4MF6 A;  4WET A;  4FO5 A;  4V1A p;  1EEM A;  2MMZ A;  1M9B A;  3QD9 A;  5JWR B;  1YF0 A;  1XOA A;  2P5Q A;  4IHU A;  3HXS A;  4WF4 A;  4K6X A;  1HD2 A;  4PNG A;  3KCM A;  2LNT A;  2H6Z A;  4YQV A;  12GS A;  1GSQ A;  1M9A A;  4TOP A;  4F2I A;  2MBS A;  4GWR A;  1ERT A;  3GRX A;  3RPN A;  3IHG A;  5JCG A;  3DXB A;  3FEU A;  2C8U A;  4GTU A;  4GXZ A;  2L59 A;  5G1L A;  4IS0 A;  5EY6 A;  1OC9 B;  3C8E A;  6GSW A;  1Z6M A;  2QGV A;  1PX6 A;  3FMW A;  2IMI A;  5ECH B;  1QQ2 A;  3F8U A;  2EIO A;  5H5R A;  1F2E A;  2H72 A;  3NZN A;  3L9U A;  1O8W A;  1X9S B;  2ALB A;  4J56 E;  1A2M A;  2PU9 C;  1WP0 A;  4G9H A;  1SL0 B;  4USS A;  9GSS A;  5ECL B;  4WR5 A;  1MTC A;  1A8Y A;  1PRX A;  2KUC A;  3O76 A;  1B8X A;  3H4K A;  2WUL A;  3CSH A;  5IOW A;  3QAV A;  2XHF A;  5IMA A;  1AQV A;  2G0F A;  4D73 A;  2GZY A;  4K8M A;  3CSJ A;  4KH7 A;  2LRT A;  4EKZ A;  4BWQ A;  3IBH A;  4ZBD A;  5G2Z A;  1VGL A;  1Z7P A;  4O32 A;  1EGR A;  1VRS D;  4DSS B;  3QFA C;  4HDE A;  2FA4 A;  2HRA A;  4WEY A;  4EIQ A;  2WRT A;  1B48 A;  4O5R A;  4HQS A;  4ULX A;  5CYY A;  1XW5 A;  4MPF A;  2B6M A;  5D96 A;  1BYE A;  2HZE A;  2P5R A;  2I9H A;  3GKN A;  2K8V A;  3TGZ A;  2VIM A;  2J9H A;  3ZZX A;  2PBJ A;  4GSN A;  4LL1 B;  2YZU A;  2X4A A;  2VCZ A;  3KMO A;  3U6V A;  2MMN A;  1EZK A;  5F8B A;  2R0G A;  1T4Y A;  4MAB A;  3VUR A;  1H4O A;  1S3A A;  13GS A;  5IMV A;  1QGV A;  1OC8 A;  4GST A;  3FR3 A;  3IE3 A;  2R4V A;  5CAX A;  1UN2 A;  3D0Z A;  1THX A;  4ICY A;  2DKH A;  4WF5 A;  1VF2 A;  1AC1 A;  2H0H A;  3ME7 A;  5CNW A;  2R0C A;  1PL1 A;  1V40 A;  1SD9 A;  3KH7 A;  2A4V A;  2C1Y A;  4LMW A;  4YQU A;  2PWJ A;  3EU3 A;  1YY7 A;  2QSI A;  1AXD A;  2YNX A;  4POL A;  5A4W A;  2KHP A;  5COH A;  1FO5 A;  3P8W A;  4OD7 A;  4BA7 A;  5D8I A;  2X8C A;  1JHB A;  2MYG A;  1K3O A;  3FK8 A;  3RDW A;  1K3L A;  4TR3 A;  5IIZ A;  2YN1 A;  1ZYP A;  2NPB A;  4FIW A;  3WGE A;  5HFG A;  5IPG A;  4DVC A;  2QC7 A;  5GAN D;  3W6G A;  3Q18 A;  1V9W A;  1U87 A;  2NDO A;  3UOM A;  2O87 A;  4ECB A;  1O85 A;  3F4T A;  1XG8 A;  1GTU A;  1A0R P;  4MLY A;  5D9V A;  1ERW A;  4OFM A;  2L6C A;  3KD0 A;  3D6I A;  1SJI A;  3RBT A;  3H1N A;  4F82 A;  4EIP A;  4ML6 A;  3UAP A;  5DAL B;  4KAE A;  1TXX A;  1B4Q A;  4F0C A;  2LJK A;  4O92 A;  1TRU A;  3TJB A;  4K7N A;  5ENU A;  4NXI A;  4MCU A;  3M0F A;  3I9V 2;  1NW2 A;  4AF2 A;  2H1D A;  1B9X C;  1WOU A;  1UVZ A;  2H71 A;  4K1F A;  2GT5 A;  2CT6 A;  3EE2 A;  4YQM A;  2DKI A;  1Z6N A;  1J08 A;  2FA8 A;  2YP6 A;  4TXV A;  4G19 A;  3GKM A;  3I43 A;  2GQL A;  3IPZ A;  1V57 A;  1R5A A;  5IMC A;  4NMU A;  1MDJ A;  2IMD A;  3H93 A;  2LRN A;  4TR1 B;  2B1L A;  1NHY A;  1ABA A;  3HJO A;  3A2X A;  1T4Z A;  2DIY A;  2HZF A;  5J5N A;  1SKR B;  3EC3 A;  2VCT A;  5IMF A;  3VI7 A;  3ZIV A;  1ZOF A;  1BAY A;  1OKD A;  2AV4 A;  1XCC A;  2O8V B;  1MD4 A;  4IP6 A;  2R6K A;  2BTO T;  3GH9 A;  1QMV A;  3CBU A;  2ES7 A;  2H19 A;  3GA4 A;  2ZCT A;  1XWC A;  2KP1 A;  5ABR A;  1OE7 A;  4XS1 A;  4V1A g;  2DJ0 A;  3A2V A;  2HI7 A;  2YCD A;  4NV2 A;  3HD5 A;  4PXO A;  1OE8 A;  4IKH A;  3DRN A;  5HR1 A;  2I4A A;  2X49 A;  1AAZ A;  1XW9 A;  1B4P A;  2OBK A;  3TJG A;  1V58 A;  3V1W A;  2KP2 A;  2P0G A;  2K9F A;  1V98 A;  3US3 A;  4N0Z A;  2QA1 A;  3GL5 A;  14GS A;  1WWJ A;  3HCZ A;  1N8J A;  1I5G A;  1SL1 B;  1HNB A;  3LW9 A;  2A4H A;  1ILO A;  3A2W A;  3UL3 A;  2YWI A;  3LG6 A;  2VLU A;  4XRD A;  3VPQ A;  2PVQ A;  4BVX B;  19GS A;  2DJJ A;  3C1S A;  3IV4 A;  4K5R A;  2B3S A;  5G30 A;  1EV4 A;  2K18 A;  3FY7 A;  2WFC A;  2I1U A;  2FWE A;  1XXU A;  2CZ2 A;  2LJR A;  1PKZ A;  5J9C A;  2L6D A;  1TK8 B;  1LU4 A;  3KP8 A;  3FR6 A;  2YAN A;  2HXK A;  4X0X A;  1TOF A;  2WJU A;  2M46 A;  3UAR A;  3LYK A;  3KEB A;  2H0I A;  3ZLP A;  2MZC A;  2X64 A;  3CSI A;  4OMV A;  4TW5 A;  1XBS A;  2VCW A;  3FZ4 A;  4NWY A;  3D4M A;  2WB9 A;  4HEA 2;  4POM A;  3APO A;  1TRV A;  2HNL A;  4NHW A;  4TKY A;  5CRW A;  3W8J A;  3HVN A;  1PSQ A;  3SBC A;  1TK5 B;  3BJ5 A;  1FW1 A;  1TRW A;  4JR6 A;  3LSZ A;  3ERF A;  3H8Q A;  4BL7 B;  1A0F A;  3TRQ A;  4IW9 A;  3PPU A;  4MK3 A;  4EDY A;  6GSS A;  1FAA A;  2GSR A;  2E2M A;  2DJ3 A;  3QDN A;  1S3C A;  2VD1 A;  3K8N A;  3EU4 A;  4OO4 A;  4HOJ A;  2K6V A;  4MDC A;  2DBC A;  3G9B A;  4CW9 A;  1X0R A;  4IGJ A;  5HR0 A;  4V2L A;  5GSS A;  5KN0 A;  3GL3 A;  3ME8 A;  3C7M A;  5DAK A;  5AGY A;  1O7U A;  4BIK A;  5IOX A;  4Z2R A;  1QFN A;  5B8B A;  2VLT A;  4KDU A;  4NAX A;  5BRT A;  1GUM A;  11GS A;  3HVV A;  4J2F A;  3ZMK A;  2IPA A;  1EGO A;  3CYN A;  5ECR B;  2VCV A;  4EF0 A;  2IIY A;  1FB0 A;  4E8E A;  3APS A;  3QCP A;  1QK8 A;  2VO4 A;  5EVO A;  1GH2 A;  4CDO A;  2K8S A;  4ZB9 A;  3HVS A;  20GS A;  1TW9 A;  1FOH A;  2FHE A;  4MZW A;  3ZIT A;  3TKR A;  2I81 A;  1DUG A;  2N5A A;  4NV5 A;  1K0A A;  4A5P A;  1GTA A;  5EPF A;  3VWW A;  3D21 A;  2GZP A;  2R0P A;  2ON5 A;  5EL8 A;  2F9S A;  2VL2 A;  1VF1 A;  1BQ7 A;  4XS4 B;  1VF4 A;  3HVX A;  4MF5 A;  1OVN A;  1FVJ A;  3OR5 A;  3TKS E;  2E2G A;  4HJM A;  1PQN A;  3G7J A;  1BJX A;  2CVK A;  1SKS B;  1GP1 A;  1R5P A;  1FOV A;  3ISO A;  4BVY A;  1O73 A;  5AIS A;  3M8N A;  1YF1 A;  4OWY A;  1JLW A;  3ZFB A;  3AY8 A;  3E9J B;  1B9Y C;  2GLR A;  5C00 A;  5J9B A;  2E7P A;  3LQ7 A;  3VLN A;  5KEJ A;  1M2A A;  4OCF A;  5JWQ B;  5F06 A;  5ID2 B;  3FW2 A;  2AB6 A;  4KW6 A;  1Y6E A;  2EIQ A;  1SU9 A;  1ACV A;  3VFI A;  2AJQ B;  3IA1 A;  1JZD A;  2GQK A;  5D93 A;  3TJK A;  3NOF A;  4L0U A;  5ECK B;  1K0M A;  2B5E A;  2PER A;  5JCU A;  2NTO A;  2C3T A;  4X4J A;  2CAQ A;  2GVP A;  3IHQ A;  4CHS A;  4ACS A;  1U6T A;  3LGC A;  1XPV A;  2CZ3 A;  2RM5 A;  1ZYN A;  5DJL A;  4KND A;  3DD3 A;  1X5D A;  1TTZ A;  2LKU A;  1LBK A;  2F8F A;  2LNS A;  1GSF A;  2X8G A;  3F3R A;  4EVM A;  1X9M B;  3QAW A;  4ZBA A;  3TKS C;  3M3M A;  3N9J A;  3Q19 A;  4JRR A;  1K0D A;  4CY8 A;  1Z7R A;  2HLS A;  4WR4 A;  4ZIL A;  3L0H A;  4K2X A;  3EMP A;  2JSY A;  4GF0 A;  4KX4 A;  3HHV A;  4PUA A;  5HFK A;  3C73 A;  3PIN A;  4JE1 A;  3P90 A;  3BCI A;  4ID0 A;  3ZFL A;  1IYH A;  4POK A;  4KDY A;  1SYR A;  1UA5 A;  2LS5 A;  3MYD A;  4O7H A;  5ECS A;  1I9D A;  4KUN A;  5JWO B;  4ZIJ A;  3ZYW A;  2B7J A;  4Z2U A;  1Z3E A;  4IN0 A;  3IRA A;  3UEM A;  1PKW A;  1J0F A;  4KSO A;  4HQZ A;  3CMI A;  3FZ5 A;  1R7H A;  4BPY A;  3SWL A;  3GV1 A;  2H30 A;  3EWL A;  3GKX A;  4L5O A;  4MA9 A;  5CRE A;  1K0O A;  1GNW A;  4I2T A;  4TR0 A;  4GQF A;  2OE0 A;  3UBL A;  1AW9 A;  1KTE A;  1NM3 A;  5J41 A;  4L5L A;  5ECM B;  1ZYE A;  3C1R A;  5ELG A;  2C0D A;  3QAG A;  1YDK A;  3H79 A;  5G5F A;  3CTG A;  3HJM A;  4EO3 A;  3F3Q A;  1WIK A;  5LCZ A;  1W89 A;  5INY A;  4TXO A;  4ZB6 A;  5GZZ B;  5ECQ B;  3EYT A;  3IC4 A;  4KF9 A;  2N5F A;  3VK9 A;  3PGT A;  3GX8 A;  5GST A;  1GRX A;  5JCW A;  1FG4 A;  1TJD A;  1XWA A;  3MWH A;  1GSE A;  3FKF A;  3GST A;  4Q5R A;  1QXH A;  5DCG A;  3IC8 A;  2WZ9 A;  3CQF A;  3HA9 A;  1OC9 A;  4ISD A;  5G31 A;  7GSS A;  2M80 A;  4RUV A;  2V32 A;  3WT1 A;  3F0I A;  3KTL A;  1T3B A;  2H1B A;  2HYX A;  1SEN A;  4PTS A;  3P7X A;  4OCE A;  1S3R A;  4WKW A;  2CV4 A;  3IK7 A;  3IR4 A;  2CX4 A;  1KNG A;  4GCI A;  10GS A;  2HRF A;  2IFQ B;  3ZVJ D;  1AQW A;  1ZCP A;  3TKP A;  4Z2T A;  4MNN A;  5B6M A;  4HI7 A;  4MJC A;  2VM2 A;  3KH9 A;  2NVL A;  2C3Q A;  1GLQ A;  2FNO A;  1TU7 A;  1GSD A;  5F07 A;  3EIN A;  1YEP A;  1WE0 A;  3TRX A;  4QL9 A;  4PQI A;  4DSS A;  1JLV A;  3GTU B;  4JU5 A;  1ZL9 A;  1EP7 A;  1GUL A;  2XPE A;  18GS A;  5CRH A;  2IL3 A;  1URM A;  4GSS A;  2DML A;  1BED A;  2FLS A;  2GTU A;  2VL9 A;  1PD2 1;  3TB2 A;  1YKA A;  2X8H A;  4PQH A;  2R3X A;  5E59 A;  2R37 A;  5KN2 A;  3APQ A;  3Q6O A;  2YV9 A;  1WJK A;  1AUC A;  2O85 A;  1ST9 A;  5B6N A;  4BWS A;  4LL4 B;  3CRT A;  2O89 A;  3LXT A;  2KOK A;  1THO A;  3GNJ A;  4I8B A;  3BCK A;  2H8L A;  5AN1 A;  3RHB A;  4IQA A;  4N11 A;  4YAV A;  1YKC A;  2JAD A;  1XIY A;  3GIX A;  5D73 A;  3CRU A;  4ECC A;  2LEG A;  3QOU A;  2OAC A;  5J3R A;  3WD6 A;  2YV7 A;  4TRX A;  2C80 A;  3F9U A;  2A2S A;  1G7E A;  4TN8 A;  1FHE A;  4ZXG A;  4MJA A;  2DJ2 A;  3G7Y A;  16GS A;  4I97 A;  1YEX A;  1ZMA A;  3DVX A; 
#chains in the Genus database with same CATH homology
 4EDZ A;  5HQP A;  2V6K A;  5AIV A;  4N30 A;  4F9Z A;  2AHE A;  3KP9 A;  3WGX A;  3LOR A;  3KIJ A;  2GSS A;  4I2U A;  2KLX A;  3DYR A;  2B5X A;  1NSW A;  4KB3 A;  1Z5Y E;  3Q74 A;  3F63 A;  3ZRE A;  1EOG A;  3UVH A;  1ZZY A;  2UZ8 A;  1ON4 A;  3VWV A;  1XWG A;  1OKT A;  2IMK A;  2LTK A;  5L71 A;  4Q5F A;  1M99 A;  3VPT A;  3J7Y b;  4H86 A;  3GMF A;  3F6F A;  4NPB A;  2GT6 A;  2TRC P;  4L8E A;  1DSB A;  3LFL A;  6GSV A;  2P31 A;  3MIX A;  2R5G A;  2WGR A;  4RQR A;  2VD0 A;  4MH3 A;  1F6M C;  4O5Q A;  3IOS A;  5H5Q A;  4IEL A;  3JCM L;  1CQG A;  5DAL A;  4PQ1 A;  3HZ4 A;  3KTB A;  2DMM A;  2H66 A;  4MPG A;  2H6X A;  4MJB A;  22GS A;  1T7P B;  5IO2 A;  2FY6 A;  1Z9H A;  2G2Q A;  1GLP A;  2GS3 A;  3S9F A;  2DIZ A;  1PGT A;  1JFU A;  2JU5 A;  2DLX A;  3HZ8 A;  5DDL A;  4HJ2 A;  4TVE A;  4MZC A;  3GSS A;  2HSY A;  3F6D A;  1Y25 A;  4FYU A;  2PPT A;  5KOX A;  3KGK A;  4MZB A;  5G1K A;  3GN3 A;  2IWT A;  1T00 A;  2V2G A;  4JR4 A;  5IMD A;  3QPM A;  2C4J A;  4TR1 A;  1GNE A;  1J9B A;  2HT9 A;  2RUF A;  3E3E A;  4GQC A;  2YPM A;  3C71 A;  5D9X A;  4IVF A;  1K0N A;  3A3T A;  3W8S A;  4KDX A;  4FQU A;  2OA7 A;  4HZ4 A;  5FHI A;  2REM A;  2H1G A;  3GUS A;  2XBQ A;  1GUK A;  2L5L A;  5AIX A;  4D73 B;  1BG5 A;  5HFI A;  5G5E A;  4XIH A;  2GDR A;  1SL2 B;  3IAM 2;  3VWX A;  4RI7 A;  5IO0 A;  1TDI A;  2C0E A;  1A8L A;  2JZS A;  2VLV A;  2GSQ A;  2H75 A;  4K0G A;  4EC0 A;  2HZE B;  4OFN A;  2PUK C;  1HNC A;  3ED3 A;  5A4V A;  5CO3 A;  3I6A A;  4IJ3 A;  1MEK A;  3RPP A;  2JZR A;  2XPD A;  1G7O A;  4ZL7 A;  1CQH A;  2DSA A;  3TJF A;  4K2D A;  1JZO A;  2PVO C;  3LWA A;  1TRS A;  2MBT A;  3A5I A;  4EXJ A;  3UBK A;  4K7I A;  5ECO B;  5CP1 A;  3DEX A;  2FGX A;  4X1U A;  2RUE A;  1EOH A;  3U5R E;  2X99 A;  3UIW A;  1TU8 A;  2FWH A;  5F05 A;  2YJ7 A;  5A5K A;  3IXR A;  1A23 A;  5ECP B;  5LD0 A;  1VF3 A;  2VL3 A;  4ECJ A;  4EE0 A;  2LRC A;  1XZO A;  2CAI A;  2GZZ A;  4ZL9 A;  5J4U A;  2GST A;  5H5S A;  3FRC A;  3HYP A;  4POB A;  1H75 A;  4XTS A;  1HQO A;  4O5U A;  2N5B A;  5FT3 A;  1V2A A;  1GTI A;  5LNK e;  2VCQ A;  3MAK A;  2IN3 A;  4TXO B;  1OC3 A;  4NHZ A;  1F9M A;  2GQM A;  1M2B A;  2OE3 A;  4ECI A;  5GAP D;  3D22 A;  4HU7 A;  2JAC A;  4CY6 A;  3IAS 2;  3CXG A;  3ZML A;  3R2Q A;  5DQS A;  1YJ6 A;  3P2A A;  2R2J A;  5BMU A;  1QUW A;  2HSH A;  1GSS A;  5KOW A;  5DBQ A;  3FHK A;  1C72 A;  4AJ7 A;  5HR3 A;  4XRA A;  3R3E A;  1BX9 A;  1M7T A;  4G10 A;  2YJH A;  2DJ1 A;  4BL7 A;  1EWX A;  2H0G A;  1AIU A;  2B7K A;  4YH2 A;  3HY2 A;  3RAZ A;  1R26 A;  1YZX A;  2Z9S A;  3F4R A;  1EEJ A;  1O6J A;  4LLR A;  1XVQ A;  4X43 A;  2BJX A;  3GH6 A;  2FD3 A;  1SK2 A;  3ZRD A;  1X9W B;  4QL7 A;  1JZR A;  4G0L A;  3KXO A;  3TRP A;  2BMX A;  3DVW A;  3KMN A;  4ZBB A;  3TDG A;  1O81 A;  1E6B A;  2EIR A;  3TUE A;  2IJY A;  2HRK A;  2LUS A;  3WGD A;  5IPH A;  4FH8 A;  1T8E B;  4Z7X A;  3E0U A;  3QFB C;  3EUR A;  4AJ8 A;  1TI3 A;  1R4W A;  4PGT A;  3EVI A;  5F0G A;  1MDI A;  2L4C A;  1WRY A;  2I3Y A;  4KE3 A;  4V2M A;  2ZUP A;  3GUR A;  1G6Y A;  5KN3 A;  4IP1 A;  2OAD A;  2PMT A;  1ERU A;  1GSY A;  3ZL5 A;  2A2R A;  2HFD A;  1X5E A;  2WDU A;  5IM9 A;  1FB6 A;  4EUY A;  1IYI A;  1G6W A;  1TP9 A;  1KBN A;  4V2N A;  5FWG A;  4DSR A;  4MJE A;  2L4Q A;  3TKS A;  3O3T A;  5DCH A;  4MMM A;  2J23 A;  4HU9 A;  1GSU A;  1GL8 A;  2CA8 A;  2IME A;  3EPT A;  4IJI A;  4LA1 A;  1OYJ A;  1USB A;  2HE3 A;  2RLI A;  1K0C A;  1DE1 A;  2EC4 A;  2C3N A;  4XS4 A;  1A24 A;  3G7I A;  4IBP A;  1GTB A;  2OKA A;  2VOC A;  3VI5 A;  2RM6 A;  4FYC A;  5A4U A;  4AJ6 A;  2TIR A;  1XVW A;  3DKS A;  4XCS A;  1PX7 A;  4L0W A;  4DSQ A;  1T1V A;  3M9K A;  2AUV A;  1N2A A;  1U88 A;  4K0N A;  1PMT A;  2FWF A;  2F51 A;  4WBJ A;  4Q5Q A;  4N0V A;  2VAF A;  2FWG A;  8GSS A;  4PX1 A;  2PGT A;  3TCO A;  1FVK A;  2DC5 A;  4I6X A;  2RII A;  4MP4 A;  3TOT A;  4G0K A;  4K5S A;  5ID2 A;  2CVD A;  4YKF A;  5D9T A;  2H74 A;  3LJR A;  2ON7 A;  1XWB A;  3UJ1 A;  3KM6 A;  3UMA A;  4WBR D;  1RW1 A;  1F37 A;  4GLT A;  5IMZ A;  4ILF A;  1F3A A;  2HRN A;  3KZQ A;  2V6O A;  2YWN A;  3GYK A;  1SJ6 A;  4Q5N A;  4E8H A;  6GSU A;  2H6Y A;  1ZGN A;  2H1A A;  4JED A;  3FYG A;  4XS6 A;  2H73 A;  3TJJ A;  1LJR A;  3MSZ A;  5ELA A;  2JL4 A;  4HS1 A;  4RQX A;  4N10 A;  2B5Y A;  1MD3 A;  3GFK A;  1ERV A;  4J57 E;  1TI1 A;  3MNG A;  5CRD A;  4G0I A;  1EV9 A;  5B8A A;  2E0Q A;  5DVB A;  3HJP A;  3L9S A;  1XW6 A;  4WXT A;  2YOI A;  4KGI A;  3IDV A;  5B7C A;  2L57 A;  3D4T A;  3F4S A;  2H76 A;  2V41 A;  1SYX A;  3LYP A;  2LJA A;  2QKE A;  1AQX A;  2H70 A;  2JSZ A;  3ZTL A;  4FYB A;  3DIE A;  1O8X A;  3GKK A;  1S3D A;  1WPI A;  3BOA A;  3IK9 A;  4JZQ A;  4GRF A;  3FZA A;  2XC2 A;  1K0B A;  5HR2 A;  2AYT A;  3PH9 A;  3ZVJ A;  4F03 A;  1A2J A;  3O6T A;  3QMX A;  4EL1 A;  2TRX A;  2VCX A;  5DJM A;  3L9V A;  4KCA A;  1M0U A;  4OFT A;  5DAK B;  2FCH A;  1W4V A;  6GSY A;  3N5O A;  2M72 A;  1F3B A;  3VWU A;  2MMA A;  4TR4 A;  2LV3 A;  3UVT A;  1U3I A;  5ECI B;  2YWM A;  4ZB8 A;  3MDK A;  3M1G A;  3M9J A;  4PNF A;  3GHA A;  2NBS A;  1SK1 A;  2LST A;  3WYW A;  2GGT A;  1U3A A;  5KN1 A;  2H01 A;  2LQQ A;  2O7K A;  3HDC A;  1DBY A;  2WCI A;  1ZYQ B;  4PUF C;  2CVB A;  1TKD B;  17GS A;  5ECN B;  3GX0 A;  1M2D A;  3BD2 A;  5CRG A;  1XWK A;  2IFQ A;  1EP8 A;  1OAZ A;  4KA0 A;  3BBY A;  2JZT A;  4DEJ A;  4LMV A;  1WMJ A;  4KCE A;  3TKQ A;  3NIV A;  3RHC A;  4MF7 A;  1XFL A;  2FUG 2;  1E2Y A;  6GSX A;  5E4W A;  1A2L A;  4ZL8 A;  4XHM A;  3GTU A;  3I69 A;  3L4N A;  4P3Y B;  1K3Y A;  2D2Z A;  3CTF A;  4BVY B;  3DGQ A;  4HUA A;  1SK0 A;  3HKR A;  2AAW A;  2PN8 A;  1SKW B;  4QQ7 A;  1GWC A;  3LXZ A;  1GUH A;  1JZW A;  2QA2 A;  1KEB A;  6GST A;  2C0F A;  2DJK A;  1PL2 A;  3DWV A;  4KSM A;  1YQ1 A;  2OBI A;  3KJY A;  4IQ1 A;  2A2P A;  4G2E A;  3ERW A;  1PN9 A;  2YWO A;  2LQO A;  4OO5 A;  2F3M A;  2VUP A;  3ERG A;  2WS2 A;  1PA3 A;  1HYU A;  5IQY A;  2CQ9 A;  5DQY A;  4YAP A;  3D5J A;  2ZNM A;  1ML6 A;  1X5C A;  2MMO A;  1XOB A;  1PN0 A;  2OE1 A;  2HSM A;  3FR9 A;  1NHO A;  1Q4J A;  4YKG A;  4F0B A;  1UC7 A;  2CX3 A;  1Q98 A;  2L5O A;  3TOU A;  5C04 A;  3WT2 A;  1MDK A;  3L78 A;  1G0T A;  3ZIJ A;  4AGS A;  2VL2 C;  1DE2 A;  4MH2 A;  3FZ9 A;  4JBB A;  2C0G A;  2B1K A;  4I5Q A;  5D9W A;  1SD8 A;  1TK0 B;  2F8A A;  1RQM A;  4RI6 A;  2YZH A;  3EMX A;  3PR8 A;  3LEF A;  4ML1 A;  2OJL A;  4BVX A;  2VM1 A;  1RK4 A;  4PUR A;  3DML A;  1HNA A;  3A5W A;  1SJZ A;  3QR6 A;  4HZ2 A;  4K7O A;  2V1M A;  4K9Z A;  3J7Y k;  2IMF A;  2XBI A;  4MF6 A;  4WET A;  4FO5 A;  4V1A p;  1EEM A;  2MMZ A;  1M9B A;  3QD9 A;  5JWR B;  1YF0 A;  1XOA A;  2P5Q A;  4IHU A;  3HXS A;  4WF4 A;  4K6X A;  1HD2 A;  4PNG A;  3KCM A;  2LNT A;  2H6Z A;  4YQV A;  12GS A;  1GSQ A;  1M9A A;  4TOP A;  4F2I A;  2MBS A;  4GWR A;  1ERT A;  3GRX A;  3RPN A;  3IHG A;  5JCG A;  3DXB A;  3FEU A;  2C8U A;  4GTU A;  4GXZ A;  2L59 A;  5G1L A;  4IS0 A;  5EY6 A;  1OC9 B;  3C8E A;  6GSW A;  1Z6M A;  2QGV A;  1PX6 A;  3FMW A;  2IMI A;  5ECH B;  1QQ2 A;  3F8U A;  2EIO A;  5H5R A;  1F2E A;  2H72 A;  3NZN A;  3L9U A;  1O8W A;  1X9S B;  2ALB A;  4J56 E;  1A2M A;  2PU9 C;  1WP0 A;  4G9H A;  1SL0 B;  4USS A;  9GSS A;  5ECL B;  4WR5 A;  1MTC A;  1A8Y A;  1PRX A;  2KUC A;  3O76 A;  1B8X A;  3H4K A;  2WUL A;  3CSH A;  5IOW A;  3QAV A;  2XHF A;  5IMA A;  1AQV A;  2G0F A;  4D73 A;  2GZY A;  4K8M A;  3CSJ A;  4KH7 A;  2LRT A;  4EKZ A;  4BWQ A;  3IBH A;  4ZBD A;  5G2Z A;  1VGL A;  1Z7P A;  4O32 A;  1EGR A;  1VRS D;  4DSS B;  3QFA C;  4HDE A;  2FA4 A;  2HRA A;  4WEY A;  4EIQ A;  2WRT A;  1B48 A;  4O5R A;  4HQS A;  4ULX A;  5CYY A;  1XW5 A;  4MPF A;  2B6M A;  5D96 A;  1BYE A;  2HZE A;  2P5R A;  2I9H A;  3GKN A;  2K8V A;  3TGZ A;  2VIM A;  2J9H A;  3ZZX A;  2PBJ A;  4GSN A;  4LL1 B;  2YZU A;  2X4A A;  2VCZ A;  3KMO A;  3U6V A;  2MMN A;  1EZK A;  5F8B A;  2R0G A;  1T4Y A;  4MAB A;  3VUR A;  1H4O A;  1S3A A;  13GS A;  5IMV A;  1QGV A;  1OC8 A;  4GST A;  3FR3 A;  3IE3 A;  2R4V A;  5CAX A;  1UN2 A;  3D0Z A;  1THX A;  4ICY A;  2DKH A;  4WF5 A;  1VF2 A;  1AC1 A;  2H0H A;  3ME7 A;  5CNW A;  2R0C A;  1PL1 A;  1V40 A;  1SD9 A;  3KH7 A;  2A4V A;  2C1Y A;  4LMW A;  4YQU A;  2PWJ A;  3EU3 A;  1YY7 A;  2QSI A;  1AXD A;  2YNX A;  4POL A;  5A4W A;  2KHP A;  5COH A;  1FO5 A;  3P8W A;  4OD7 A;  4BA7 A;  5D8I A;  2X8C A;  1JHB A;  2MYG A;  1K3O A;  3FK8 A;  3RDW A;  1K3L A;  4TR3 A;  5IIZ A;  2YN1 A;  1ZYP A;  2NPB A;  4FIW A;  3WGE A;  5HFG A;  5IPG A;  4DVC A;  2QC7 A;  5GAN D;  3W6G A;  3Q18 A;  1V9W A;  1U87 A;  2NDO A;  3UOM A;  2O87 A;  4ECB A;  1O85 A;  3F4T A;  1GTU A;  1A0R P;  4MLY A;  5D9V A;  1ERW A;  4OFM A;  2L6C A;  3KD0 A;  3D6I A;  1SJI A;  3RBT A;  3H1N A;  4F82 A;  4EIP A;  4ML6 A;  3UAP A;  5DAL B;  4KAE A;  1TXX A;  1B4Q A;  4F0C A;  2LJK A;  4O92 A;  1TRU A;  3TJB A;  4K7N A;  5ENU A;  4NXI A;  4MCU A;  3M0F A;  3I9V 2;  1NW2 A;  4AF2 A;  2H1D A;  1B9X C;  1WOU A;  1UVZ A;  2H71 A;  4K1F A;  2GT5 A;  2CT6 A;  3EE2 A;  4YQM A;  2DKI A;  1Z6N A;  1J08 A;  2FA8 A;  2YP6 A;  4TXV A;  4G19 A;  3GKM A;  3I43 A;  2GQL A;  3IPZ A;  1V57 A;  1R5A A;  5IMC A;  4NMU A;  1MDJ A;  2IMD A;  3H93 A;  2LRN A;  4TR1 B;  2B1L A;  1NHY A;  1ABA A;  3HJO A;  3A2X A;  1T4Z A;  2DIY A;  2HZF A;  5J5N A;  1SKR B;  3EC3 A;  2VCT A;  5IMF A;  3VI7 A;  3ZIV A;  1ZOF A;  1BAY A;  1OKD A;  2AV4 A;  1XCC A;  2O8V B;  1MD4 A;  4IP6 A;  2R6K A;  2BTO T;  3GH9 A;  1QMV A;  3CBU A;  2ES7 A;  2H19 A;  3GA4 A;  2ZCT A;  1XWC A;  2KP1 A;  5ABR A;  1OE7 A;  4XS1 A;  4V1A g;  2DJ0 A;  3A2V A;  2HI7 A;  2YCD A;  4NV2 A;  3HD5 A;  4PXO A;  1OE8 A;  4IKH A;  3DRN A;  5HR1 A;  2I4A A;  2X49 A;  1AAZ A;  1XW9 A;  1B4P A;  2OBK A;  3TJG A;  1V58 A;  3V1W A;  2KP2 A;  2P0G A;  2K9F A;  1V98 A;  3US3 A;  4N0Z A;  2QA1 A;  3GL5 A;  14GS A;  1WWJ A;  3HCZ A;  1N8J A;  1I5G A;  1SL1 B;  1HNB A;  3LW9 A;  2A4H A;  1ILO A;  3A2W A;  3UL3 A;  2YWI A;  3LG6 A;  2VLU A;  4XRD A;  3VPQ A;  2PVQ A;  4BVX B;  19GS A;  2DJJ A;  3C1S A;  3IV4 A;  4K5R A;  2B3S A;  5G30 A;  1EV4 A;  2K18 A;  3FY7 A;  2WFC A;  2I1U A;  2FWE A;  1XXU A;  2CZ2 A;  2LJR A;  1PKZ A;  5J9C A;  2L6D A;  1TK8 B;  1LU4 A;  3KP8 A;  3FR6 A;  2YAN A;  2HXK A;  4X0X A;  1TOF A;  2WJU A;  2M46 A;  3UAR A;  3LYK A;  3KEB A;  2H0I A;  3ZLP A;  2MZC A;  2X64 A;  3CSI A;  4OMV A;  4TW5 A;  1XBS A;  2VCW A;  3FZ4 A;  4NWY A;  3D4M A;  2WB9 A;  4HEA 2;  4POM A;  3APO A;  1TRV A;  2HNL A;  4NHW A;  4TKY A;  5CRW A;  3W8J A;  1PSQ A;  3SBC A;  1TK5 B;  3BJ5 A;  1FW1 A;  1TRW A;  4JR6 A;  3LSZ A;  3ERF A;  3H8Q A;  4BL7 B;  1A0F A;  3TRQ A;  4IW9 A;  3PPU A;  4MK3 A;  4EDY A;  6GSS A;  1FAA A;  2GSR A;  2E2M A;  2DJ3 A;  3QDN A;  1S3C A;  2VD1 A;  3K8N A;  3EU4 A;  4OO4 A;  4HOJ A;  2K6V A;  4MDC A;  2DBC A;  3G9B A;  4CW9 A;  1X0R A;  4IGJ A;  5HR0 A;  4V2L A;  5GSS A;  5KN0 A;  3GL3 A;  3ME8 A;  3C7M A;  5DAK A;  5AGY A;  1O7U A;  5IOX A;  4Z2R A;  1QFN A;  5B8B A;  2VLT A;  4KDU A;  4NAX A;  5BRT A;  1GUM A;  11GS A;  3HVV A;  4J2F A;  3ZMK A;  2IPA A;  1EGO A;  3CYN A;  5ECR B;  2VCV A;  4EF0 A;  2IIY A;  1FB0 A;  4E8E A;  3APS A;  3QCP A;  1QK8 A;  2VO4 A;  5EVO A;  1GH2 A;  4CDO A;  2K8S A;  4ZB9 A;  3HVS A;  20GS A;  1TW9 A;  1FOH A;  2FHE A;  4MZW A;  3ZIT A;  3TKR A;  2I81 A;  1DUG A;  2N5A A;  4NV5 A;  1K0A A;  4A5P A;  1GTA A;  5EPF A;  3VWW A;  3D21 A;  2GZP A;  2R0P A;  2ON5 A;  5EL8 A;  2F9S A;  2VL2 A;  1VF1 A;  1BQ7 A;  4XS4 B;  1VF4 A;  3HVX A;  4MF5 A;  1OVN A;  1FVJ A;  3OR5 A;  3TKS E;  2E2G A;  4HJM A;  1PQN A;  3G7J A;  1BJX A;  2CVK A;  1SKS B;  1GP1 A;  1R5P A;  1FOV A;  3ISO A;  4BVY A;  1O73 A;  5AIS A;  3M8N A;  1YF1 A;  4OWY A;  1JLW A;  3ZFB A;  3AY8 A;  3E9J B;  1B9Y C;  2GLR A;  5C00 A;  5J9B A;  2E7P A;  3LQ7 A;  3VLN A;  5KEJ A;  1M2A A;  4OCF A;  5JWQ B;  5F06 A;  5ID2 B;  3FW2 A;  2AB6 A;  4KW6 A;  1Y6E A;  2EIQ A;  1SU9 A;  1ACV A;  3VFI A;  2AJQ B;  3IA1 A;  1JZD A;  2GQK A;  5D93 A;  3TJK A;  3NOF A;  4L0U A;  5ECK B;  1K0M A;  2B5E A;  2PER A;  5JCU A;  2NTO A;  2C3T A;  4X4J A;  2CAQ A;  2GVP A;  3IHQ A;  4CHS A;  4ACS A;  1U6T A;  3LGC A;  1XPV A;  2CZ3 A;  2RM5 A;  1ZYN A;  5DJL A;  4KND A;  3DD3 A;  1X5D A;  1TTZ A;  2LKU A;  1LBK A;  2F8F A;  2LNS A;  1GSF A;  2X8G A;  3F3R A;  4EVM A;  1X9M B;  3QAW A;  4ZBA A;  3TKS C;  3M3M A;  3N9J A;  3Q19 A;  4JRR A;  1K0D A;  4CY8 A;  1Z7R A;  2HLS A;  4WR4 A;  4ZIL A;  3L0H A;  4K2X A;  3EMP A;  2JSY A;  4GF0 A;  4KX4 A;  3HHV A;  4PUA A;  5HFK A;  3C73 A;  3PIN A;  4JE1 A;  3P90 A;  3BCI A;  4ID0 A;  3ZFL A;  1IYH A;  4POK A;  4KDY A;  1SYR A;  1UA5 A;  2LS5 A;  3MYD A;  4O7H A;  5ECS A;  1I9D A;  4KUN A;  5JWO B;  4ZIJ A;  3ZYW A;  2B7J A;  4Z2U A;  1Z3E A;  4IN0 A;  3IRA A;  3UEM A;  1PKW A;  1J0F A;  4KSO A;  4HQZ A;  3CMI A;  3FZ5 A;  1R7H A;  4BPY A;  3SWL A;  3GV1 A;  2H30 A;  3EWL A;  3GKX A;  4L5O A;  4MA9 A;  5CRE A;  1K0O A;  1GNW A;  4I2T A;  4TR0 A;  4GQF A;  2OE0 A;  3UBL A;  1AW9 A;  1KTE A;  1NM3 A;  5J41 A;  4L5L A;  5ECM B;  1ZYE A;  3C1R A;  5ELG A;  2C0D A;  3QAG A;  1YDK A;  3H79 A;  5G5F A;  3CTG A;  3HJM A;  4EO3 A;  3F3Q A;  1WIK A;  5LCZ A;  1W89 A;  5INY A;  4TXO A;  4ZB6 A;  5GZZ B;  5ECQ B;  3EYT A;  3IC4 A;  4KF9 A;  2N5F A;  3VK9 A;  3PGT A;  3GX8 A;  5GST A;  1GRX A;  5JCW A;  1FG4 A;  1TJD A;  1XWA A;  3MWH A;  1GSE A;  3FKF A;  3GST A;  4Q5R A;  1QXH A;  5DCG A;  3IC8 A;  2WZ9 A;  3HA9 A;  1OC9 A;  4ISD A;  5G31 A;  7GSS A;  2M80 A;  4RUV A;  2V32 A;  3WT1 A;  3F0I A;  3KTL A;  1T3B A;  2H1B A;  2HYX A;  1SEN A;  4PTS A;  3P7X A;  4OCE A;  4WKW A;  2CV4 A;  3IK7 A;  3IR4 A;  2CX4 A;  1KNG A;  4GCI A;  10GS A;  2HRF A;  2IFQ B;  3ZVJ D;  1AQW A;  1ZCP A;  3TKP A;  4Z2T A;  4MNN A;  5B6M A;  4HI7 A;  4MJC A;  2VM2 A;  3KH9 A;  2NVL A;  2C3Q A;  1GLQ A;  2FNO A;  1TU7 A;  1GSD A;  5F07 A;  3EIN A;  1YEP A;  1WE0 A;  3TRX A;  4QL9 A;  4PQI A;  4DSS A;  1JLV A;  3GTU B;  4JU5 A;  1ZL9 A;  1EP7 A;  1GUL A;  2XPE A;  18GS A;  5CRH A;  2IL3 A;  1URM A;  4GSS A;  2DML A;  1BED A;  2FLS A;  2GTU A;  2VL9 A;  1PD2 1;  3TB2 A;  1YKA A;  2X8H A;  4PQH A;  2R3X A;  5E59 A;  2R37 A;  5KN2 A;  3APQ A;  3Q6O A;  2YV9 A;  1WJK A;  1AUC A;  2O85 A;  1ST9 A;  5B6N A;  4BWS A;  4LL4 B;  3CRT A;  2O89 A;  3LXT A;  2KOK A;  1THO A;  3GNJ A;  4I8B A;  3BCK A;  2H8L A;  5AN1 A;  3RHB A;  4IQA A;  4N11 A;  4YAV A;  1YKC A;  2JAD A;  1XIY A;  3GIX A;  5D73 A;  3CRU A;  4ECC A;  2LEG A;  3QOU A;  2OAC A;  5J3R A;  3WD6 A;  2YV7 A;  4TRX A;  2C80 A;  3F9U A;  2A2S A;  1G7E A;  4TN8 A;  1FHE A;  4ZXG A;  4MJA A;  2DJ2 A;  3G7Y A;  16GS A;  4I97 A;  1YEX A;  1ZMA A;  3DVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...