3GKXA

Crystal structure of putative arsc family related protein from bacteroides fragilis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
MKTLFLQYPACSTCQKAKKWLIENNIEYTNRLIVDDNPTVEELKAWIPLSGLPVKKFFNTSGVVYKELKLSSKLPTMTEEEQIALLATNGKLVKRPLVVTERFVLVGFKPEEWEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ArsC family related protein
publication title Crystal structure of putative ArsC family related protein from Bacteroides fragilis
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 31
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03960 ArsC ArsC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gkxA00
3M8NA 3HJPA 3ED3A 2B1LA 5AGYA 5ELGA 1GSYA 1ZZYA 2H1GA 3UEMA 4V2LA 5JWOB 2PUKC 2LNTA 4KDYA 1WPIA 3OR5A 4OCEA 2VLUA 2ON5A 5ID2A 1GSSA 4MJAA 3H8QA 3QOUA 3FHKA 1BX9A 2AHEA 4AF2A 4ULXA 3EU4A 4I2UA 1FB6A 3VFIA 1EV4A 4NAXA 3APSA 2IMFA 1ON4A 1VF1A 3HZ8A 3FZ4A 1YQ1A 2OACA 3HYPA 4QQ7A 2DJ3A 5IMZA 2C0FA 1EP8A 4XS4B 1SL2B 3DRNA 5INYA 1TI3A 3QFAC 2H0IA 1TK5B 5EY6A 1B4QA 3F0IA 3FW2A 2VCZA 5GAND 3TKSA 1NHOA 3AY8A 2GTUA 3DYRA 1EOHA 2QSIA 1EOGA 1V57A 1RW1A 4WBJA 5D9VA 4V1Ap 2OJLA 3D4MA 3TCOA 4KDXA 1X9SB 4XS6A 1VRSD 1XIYA 2PU9C 1SJZA 4ZL7A 4PUFC 1TW9A 1ABAA 3KMOA 3EC3A 5EVOA 1OC8A 3GKXA 1SJ6A 4BL7A 1SKRB 1IYIA 1TI1A 3IC4A 2CX4A 2H70A 1A0FA 2EIRA 6GSWA 3VURA 1GP1A 5D9TA 4YQMA 2XHFA 3M3MA 1VGLA 3TDGA 1T1VA 4N30A 1SL0B 3FRCA 3P8WA 5F8BA 3I69A 4FIWA 5ENUA 1A23A 3ZFLA 4Q5FA 4Q5NA 2PMTA 2OADA 3ZYWA 3NOFA 4LL1B 1I9DA 3PINA 4TR4A 3LG6A 3A3TA 1EGOA 2GSQA 1GL8A 3D22A 3GTUB 2AV4A 4MH3A 4TXVA 2CA8A 3DGQA 2XPEA 2OE1A 2FWHA 5A4VA 1M9BA 3SWLA 3US3A 4O5RA 3HKRA 2JZRA 4DSSA 1O8WA 5L71A 2V32A 2YN1A 2IMEA 1JLWA 1U87A 1GSUA 2CVDA 4KDUA 3A2VA 4ECCA 2LTKA 4KGIA 5F07A 4EDYA 2DC5A 2JZSA 5D8IA 2NTOA 1AQWA 1JZOA 4Q5QA 3J7Yb 1V2AA 5AIVA 3IAS2 4KE3A 2I9HA 2WB9A 2K18A 1ZYEA 3TKPA 5G5FA 3KTBA 1J9BA 1I5GA 2MMAA 4HUAA 1EEMA 4IJ3A 3QMXA 4BWQA 3UL3A 2IFQB 3QR6A 2L4QA 2F51A 2O8VB 1SK2A 13GSA 2X8GA 4OO5A 4NV2A 2YWNA 4ISDA 3P2AA 5D93A 3QAVA 3HZ4A 1JFUA 1G6WA 1A0RP 3LXTA 2E7PA 2B5YA 4FO5A 1JZDA 1GUMA 2C3QA 3ZREA 1N2AA 5HR1A 4KCEA 4ZL8A 8GSSA 2M46A 4HJMA 2PGTA 4G19A 5DAKA 1YF1A 4LLRA 2C0EA 4F9ZA 1O6JA 2CQ9A 3HHVA 1USBA 3D6IA 4RQXA 2YNXA 4MP4A 4TW5A 2TIRA 1OE8A 4CHSA 2RIIA 5JCGA 3F4TA 1X9WB 1Q98A 1KNGA 1DSBA 3IBHA 3D21A 5DQSA 1THOA 4F0CA 4PNFA 2I81A 2H75A 2L5OA 1YDKA 2JZTA 1BEDA 2GZZA 1KEBA 1CQHA 3ERFA 4MLYA 2C4JA 3KH7A 1VF4A 4JU5A 1O85A 2LSTA 1T8EB 2GGTA 4PGTA 4K7OA 5ECNB 5G5EA 1XCCA 5DALB 1E6BA 1NM3A 1X0RA 2LRNA 3QPMA 5J5NA 3DD3A 2VL2C 1XOAA 2NVLA 1QQ2A 4I5QA 4KCAA 1SL1B 3VI5A 2GVPA 3TJBA 1GSDA 1XWCA 2V2GA 2HXKA 1TRUA 3ERWA 3C1RA 4ZBAA 3IK9A 2GQMA 2L4CA 1GUKA 5B8BA 5A4UA 3P7XA 1A8LA 4EO3A 4PQ1A 2WCIA 2FA4A 3GH9A 3L9VA 3UMAA 1Z3EA 1OVNA 4DSQA 4GF0A 5CREA 1ERVA 2CZ3A 3J7Yk 5J9BA 2L6DA 4X0XA 3D0ZA 2AAWA 4RQRA 5G2ZA 3GA4A 2B5EA 2VCQA 1GNWA 2PBJA 2LS5A 3O3TA 4EUYA 5DCGA 4HU7A 2DIZA 3VWUA 14GSA 1QMVA 3E3EA 3KD0A 2L57A 1SD8A 5CO3A 1K0CA 4WR4A 4MMMA 5J3RA 2H1AA 3HVVA 1T4ZA 2PERA 4F0BA 3ZITA 1XWBA 1HQOA 3M9JA 3W8JA 2HSYA 2ALBA 2R6KA 2I4AA 3LYKA 3TOTA 1G0TA 3VWVA 1K0AA 2MBSA 1MD4A 7GSSA 4MABA 1R5PA 2GDRA 2HZEA 2CVBA 4X43A 1Z7RA 4LMWA 4AGSA 3RDWA 3FZ9A 4FYBA 3KMNA 4L8EA 3GSTA 2WJUA 3IAM2 3HA9A 1NW2A 1ZGNA 2VIMA 2HZFA 4I97A 5IOXA 1XZOA 3A5WA 3NIVA 4AJ8A 3TKSC 1YEXA 1U3AA 2Z9SA 1GSFA 3KH9A 2HE3A 3RHCA 5DJLA 4ID0A 2OA7A 4TR1A 4IQ1A 3F63A 1U88A 3LYPA 5ELAA 1UVZA 1T3BA 4OFNA 4ECBA 2HYXA 2WULA 1PX6A 5B8AA 4KB3A 5FHIA 4DEJA 1FOVA 2VLVA 5LD0A 1F9MA 2FY6A 3VI7A 2GQKA 3F4SA 2OKAA 1K3LA 2H71A 2GT6A 1ZOFA 3TB2A 2DSAA 3GKMA 3ME8A 3C1SA 3Q6OA 4D73A 1H75A 6GSVA 2LJKA 1M0UA 3GX0A 3RPNA 2LQOA 3LJRA 1PRXA 3VPQA 1F3AA 2H66A 2YOIA 3TGZA 3TRQA 1U3IA 2B5XA 4F82A 3M1GA 3L0HA 3F9UA 1F3BA 2RM5A 1GTAA 3EINA 4HU9A 2ES7A 5ID2B 2EIOA 3CRUA 3VPTA 2NPBA 1YZXA 4P3YB 1WP0A 4J56E 4IELA 2P31A 1B48A 2JSZA 5GSSA 2JU5A 3UVTA 5CRHA 4AJ7A 2B3SA 2HRFA 2I3YA 2FHEA 1AXDA 1LJRA 1FAAA 4MA9A 2K6VA 4PX1A 2CV4A 1KBNA 1B9XC 2FA8A 3ZFBA 3BBYA 3GURA 4OFMA 5F05A 1WE0A 4L5LA 1TK0B 1GULA 1V98A 4ECJA 1YKAA 3QDNA 3CSIA 3W8SA 5HR0A 2XBQA 3LEFA 1SYRA 5IOWA 3L9UA 1V58A 1O7UA 3GMFA 1GTUA 2M80A 4O92A 1BJXA 1MTCA 1M99A 4IN0A 3BCIA 3G7YA 4TKYA 2PN8A 3ZIJA 2YZUA 1HNBA 4JE1A 1JHBA 5CRGA 3C8EA 5D73A 2IWTA 4WETA 3WGXA 2IIYA 2CX3A 4HQZA 1MDKA 3H93A 2WS2A 3PR8A 3DKSA 5ABRA 2H8LA 1MDJA 4J2FA 2ZCTA 3EE2A 2DMLA 3IRAA 4HS1A 1Q4JA 2P0GA 3TJJA 2MZCA 1PKWA 1SD9A 1GSEA 4K7NA 5ECPB 1EGRA 1WIKA 2GSRA 2HSHA 2WGRA 1M9AA 4YQUA 2AYTA 2G0FA 2R2JA 5CYYA 3IA1A 2LRTA 3G9BA 3KZQA 5IMDA 1V9WA 4HQSA 3UOMA 4TN8A 2J23A 2VLTA 1AQXA 1AUCA 4IJIA 2VD0A 3IHQA 4WF5A 1SYXA 3QCPA 1TRWA 4DSSB 4ZB9A 4XHMA 5IQYA 1S3CA 1FG4A 2JL4A 4MDCA 3IE3A 3F3QA 5E4WA 2L59A 5FWGA 2QGVA 1OC9A 2K9FA 2PWJA 4MPFA 2DJKA 4K8MA 4G10A 4FYCA 2RUFA 2C0DA 4KH7A 2R3XA 5CRDA 1K0NA 1BQ7A 2N5AA 1XW6A 3EYTA 4PXOA 2DJ1A 3GTUA 1XXUA 2H01A 3I9V2 2KP1A 1GRXA 4JBBA 1TU8A 3WYWA 3H4KA 3TKQA 4HEA2 1PA3A 5C04A 2V6OA 1YF0A 4EKZA 5IMAA 5KN3A 3APQA 5HFGA 3IPZA 4F2IA 4HZ4A 1NHYA 1PL1A 3GHAA 2H30A 3GRXA 3RBTA 2KHPA 1SK1A 1M7TA 3U5RE 2OE3A 3CTFA 1K3YA 2YANA 2IN3A 4MZWA 3HY2A 1W4VA 2JSYA 5EL8A 3N9JA 4MF7A 1AW9A 4V2MA 3UJ1A 2CVKA 4MCUA 5F0GA 2X99A 1GLPA 3VWXA 4ZBBA 2L6CA 3GUSA 5DCHA 3IV4A 17GSA 3EWLA 2HLSA 1ST9A 3EU3A 3LQ7A 4IQAA 2VL3A 2K8VA 6GSXA 5DDLA 4TR3A 2REMA 1R5AA 2VM1A 3CXGA 2KP2A 1F6MC 5JCWA 1PQNA 4MJEA 2N5BA 3G7IA 3GNJA 1EWXA 1QUWA 3MDKA 1OE7A 4JRRA 6GSYA 3CTGA 2VO4A 4N10A 3FK8A 1PL2A 2V41A 3HCZA 1PKZA 3GKKA 4WR5A 3RAZA 2G2QA 4AJ6A 5J4UA 1Z6MA 2H76A 1AC1A 2GSTA 6GSUA 5B6MA 3BOAA 5IPGA 4EVMA 2YV9A 4K6XA 2R37A 2YPMA 3MNGA 1TTZA 1YY7A 5CNWA 9GSSA 3MAKA 4MPGA 3EMPA 1UC7A 2V6KA 3TJKA 3GN3A 5H5QA 1Y25A 5ECQB 4NWYA 2C80A 1ACVA 3FKFA 2H74A 2VCVA 2YCDA 2V1MA 3WT2A 3F6DA 1B9YC 2OBIA 4GSNA 1XOBA 2FLSA 1ERTA 1AIUA 2H1DA 4K0GA 5DALA 20GSA 3ME7A 16GSA 3DXBA 1XPVA 2VOCA 5CRWA 4OWYA 2H72A 3N5OA 3C71A 3UVHA 5H5RA 4JEDA 4HDEA 3ZVJA 1G7EA 1G7OA 1AQVA 2E2GA 1B8XA 2B7KA 3TRXA 3LWAA 2H6XA 1BG5A 3Q18A 1TJDA 3KEBA 5IMCA 1T4YA 2N5FA 5ECLB 1DBYA 2L5LA 3I43A 1T7PB 3S9FA 4K1FA 3IOSA 1JLVA 1HD2A 4QL9A 3MWHA 3FR6A 4WKWA 2P5QA 4YQVA 1SENA 5KN2A 4NV5A 4HOJA 1OYJA 3L4NA 5F06A 3KTLA 1ZMAA 3QD9A 4XTSA 2HZEB 1ILOA 4OO4A 1QGVA 2B6MA 2EC4A 1X5DA 18GSA 2O87A 3BD2A 3Q19A 2MBTA 2J9HA 4GXZA 5GSTA 2HNLA 4XRAA 2TRXA 2DJ0A 4IHUA 4TR0A 5KN0A 2O7KA 2XBIA 1SU9A 5IM9A 2QC7A 4IGJA 1LBKA 5CP1A 1YKCA 2FWFA 4WEYA 4IBPA 2P5RA 2MMOA 3CRTA 3H79A 4POLA 1WMJA 3O76A 4N11A 5G30A 2OE0A 5E59A 3LXZA 3TRPA 2YWIA 1FHEA 2DBCA 3UBLA 4L0UA 4TR1B 2LUSA 3ZMKA 1HYUA 5DJMA 3IK7A 3L78A 3UIWA 4XRDA 2VL2A 4ACSA 5ECOB 5D9XA 4TXOB 2KUCA 1GH2A 1HNCA 2QKEA 3M9KA 4ZL9A 3DMLA 4YAVA 4FH8A 2IMKA 5EPFA 3ZL5A 4ZIJA 5DVBA 1WJKA 2YZHA 2YWOA 4V2NA 2M72A 1GWCA 2TRCP 1O73A 4GTUA 5FT3A 4I2TA 4MJCA 2R4VA 3EMXA 2DJ2A 4IP6A 2MMZA 4ZXGA 4YH2A 5A5KA 4WXTA 3KIJA 3VWWA 4H86A 4POBA 4GRFA 4O32A 3ZRDA 1JZWA 3HD5A 2LQQA 2YJHA 4FYUA 1Y6EA 2H6ZA 3O6TA 4Q5RA 4LL4B 4ZILA 5KN1A 4KUNA 4HZ2A 4N0ZA 2F8AA 3HXSA 1G6YA 3BCKA 4CW9A 4OD7A 2FD3A 2VCXA 1A2LA 3HJOA 1Z5YE 2B1KA 4CDOA 2C3NA 1TU7A 4KX4A 2YWMA 1WRYA 5IPHA 1TXXA 4K9ZA 1ERUA 5G31A 5JCUA 2LRCA 1HNAA 3C73A 2BTOT 1QFNA 1AAZA 4IS0A 4G2EA 1MDIA 4L0WA 3FEUA 5LNKe 1BYEA 3EVIA 4J57E 4I6XA 4BA7A 1X5CA 3NZNA 4OMVA 3GH6A 1QXHA 2LJAA 5J41A 1GUHA 3LGCA 5KEJA 5ECIB 3I6AA 5HQPA 4EDZA 5A4WA 5HFKA 5JWQB 5IO0A 2CZ2A 1OKTA 1A2JA 2FGXA 4ZB6A 4MF6A 1GTIA 3HJMA 2IPAA 1A24A 4PURA 2DIYA 2ON7A 1FW1A 4RI6A 2C3TA 2F3MA 4XS4A 1Z7PA 1OC3A 3W6GA 1R26A 3HVSA 5JWRB 1W89A 1N8JA 3PH9A 4K2DA 3ZLPA 1XFLA 4TVEA 2PVOC 2DMMA 4KW6A 1TRVA 5ECHB 4PNGA 1XWGA 5GZZB 1TRSA 3P90A 3WT1A 2FWEA 1BAYA 2H19A 1E2YA 4IVFA 4EC0A 1TDIA 2LNSA 2VL9A 3R2QA 3BJ5A 1PGTA 3QAWA 4HJ2A 3LORA 1RQMA 2H0GA 1JZRA 1U6TA 3FY7A 4KA0A 1K0DA 1KTEA 3ZTLA 1IYHA 4PQIA 3PGTA 1OC9B 4JR4A 2E2MA 3CBUA 4WBRD 2HFDA 2DLXA 1ZYQB 1FVKA 4POMA 2FNOA 3D4TA 5ECRB 3D5JA 5HFIA 1SK0A 2ZUPA 4F03A 1VF3A 3DVXA 1F2EA 4KSMA 2PPTA 4JR6A 3HVXA 4L5OA 3TKSE 4RI7A 1XW9A 2VD1A 1B4PA 5DQYA 3DWVA 4K7IA 1RK4A 4NHWA 4OFTA 3MSZA 2EIQA 2WRTA 4ML6A 1GLQA 4BVXA 3F8UA 4GQCA 4NMUA 1PD21 3DEXA 1YEPA 2X64A 1T00A 2FCHA 2JADA 4Z7XA 1EEJA 2AB6A 5G1LA 2GLRA 4EL1A 4ZB8A 3VK9A 4NHZA 2AJQB 2WZ9A 2IL3A 5AIXA 2HI7A 4MZBA 4IW9A 5ECKB 2DJJA 3CSJA 5ECSA 1PSQA 1MEKA 5DBQA 4TOPA 4X1UA 1J0FA 1S3AA 4ML1A 3C7MA 1WWJA 2LV3A 5IMFA 1PX7A 2MMNA 3ZVJD 3TUEA 2GZYA 5HR2A 1MD3A 3F6FA 2AUVA 2R5GA 1NSWA 2GSSA 4E8EA 2H0HA 2MYGA 5DAKB 12GSA 4RUVA 2IFQA 4IP1A 1F37A 2D2ZA 2YV7A 1ZCPA 2C0GA 3FZ5A 2XC2A 3WGDA 3H1NA 3KCMA 3TJFA 3FR9A 4EXJA 2BMXA 3GSSA 2FWGA 1XWKA 1M2BA 4YAPA 2CAQA 4XS1A 1SJIA 4EF0A 3E9JB 3KP8A 2NBSA 4ZBDA 1ZL9A 3DIEA 3GFKA 2LKUA 2PVQA 4NPBA 1M2DA 3FZAA 2FUG2 1C72A 3KP9A 4IKHA 1DUGA 2GZPA 2XPDA 4E8HA 1WOUA 2GT5A 3IXRA 1EP7A 1TOFA 1SKWB 3A2XA 5D96A 2F9SA 1XBSA 5IO2A 2ZNMA 3L9SA 2X8CA 1TP9A 1R7HA 5H5SA 3JCML 6GSSA 1GNEA 1XW5A 1URMA 3ERGA 1THXA 3RPPA 3HDCA 1PMTA 2VUPA 4I8BA 1VF2A 2K8SA 3GL5A 1Z6NA 1PN9A 3M0FA 4GCIA 2WDUA 2LEGA 5HR3A 2C8UA 5LCZA 3KM6A 1K0OA 3ZZXA 3UBKA 4HI7A 3K8NA 1UN2A 3ZMLA 5J9CA 2IMDA 3KJYA 4DVCA 2GQLA 3F4RA 2RUEA 4XCSA 6GSTA 3DVWA 3GX8A 4QL7A 4N0VA 2E0QA 2IJYA 1UA5A 3SBCA 5AN1A 4NXIA 4K0NA 2H6YA 4MK3A 3ZIVA 3LFLA 1XVWA 4ILFA 1GTBA 4PQHA 4BVYA 4DSRA 1R4WA 2YP6A 5CAXA 5ECMB 2X8HA 4TRXA 2GS3A 2A4VA 4GSTA 1XVQA 1O81A 4GLTA 2HRNA 3LSZA 4PUAA 3VLNA 4MF5A 3KGKA 4MZCA 4EE0A 2I1UA 5B6NA 1FB0A 11GSA 5IIZA 5B7CA 4ECIA 4MJBA 3A2WA 4JZQA 3WGEA 5D9WA 2A2SA 3G7JA 3FYGA 1SKSB 1LU4A 2B7JA 4V1Ag 3UAPA 4GSSA 3GV1A 3CMIA 3IR4A 1YJ6A 2H1BA 1DE1A 3GL3A 5AISA 3CSHA 3GIXA 3TJGA 4MH2A 4POKA 5C00A 5GAPD 2JACA 5G1KA 3TOUA 2CAIA 3APOA 3FR3A 3WD6A 4G9HA 2H73A 1O8XA 1DE2A 1OAZA 3TKRA 4O7HA 2OBKA 2LJRA 4LA1A 1GSQA 2BJXA 1S3DA 2VCWA 4OCFA 22GSA 3F3RA 5IMVA 3GYKA 1XWAA 2O85A 1M2AA 4BWSA 1TKDB 3GKNA 3ISOA 3KXOA 2KLXA 4KSOA 10GSA 2RM6A 1EV9A 4KAEA 4BPYA 4GWRA 4D73B 2A2RA 3U6VA 1H4OA 3Q74A 1X5EA 3V1WA 4WF4A 2CT6A 1K0BA 3IDVA 3QAGA 2VM2A 2IMIA 1ERWA 4TXOA 1Z9HA 2RLIA 1K0MA 1EZKA 1OKDA 1K3OA 2VAFA 3QFBC 2C1YA 2O89A 1J08A 1TK8B 2WFCA 2KOKA 1A2MA 2F8FA 1V40A 3UARA 1QK8A 4KNDA 2NDOA 3EURA 1CQGA 1A8YA 19GSA 1X9MB 4GQFA 4LMVA 3E0UA 2YJ7A 4XIHA 5COHA 3RHBA 2VCTA 3CYNA 1ML6A 1FO5A 1FVJA 2HT9A
chains in the Genus database with same CATH superfamily
3M8NA 3HJPA 3ED3A 2B1LA 5AGYA 5ELGA 1GSYA 1ZZYA 2H1GA 3UEMA 4V2LA 5JWOB 2PUKC 2LNTA 4KDYA 1WPIA 3OR5A 4OCEA 2VLUA 2ON5A 5ID2A 1GSSA 4MJAA 3H8QA 3QOUA 3FHKA 1BX9A 2AHEA 4AF2A 4ULXA 3EU4A 4I2UA 1FB6A 3VFIA 1EV4A 4NAXA 3APSA 2IMFA 1ON4A 1VF1A 3HZ8A 3FZ4A 1YQ1A 2OACA 3HYPA 4QQ7A 2DJ3A 5IMZA 2C0FA 1EP8A 4XS4B 1SL2B 3DRNA 5INYA 1TI3A 3QFAC 2H0IA 1TK5B 5EY6A 1B4QA 3F0IA 3FW2A 2VCZA 5GAND 3TKSA 1S3RA 1NHOA 3AY8A 2GTUA 3DYRA 1EOHA 2QSIA 1EOGA 1V57A 1RW1A 4WBJA 5D9VA 4V1Ap 2OJLA 3D4MA 3TCOA 4KDXA 1X9SB 4XS6A 1VRSD 1XIYA 2PU9C 1SJZA 4ZL7A 4PUFC 1TW9A 1ABAA 3KMOA 3EC3A 5EVOA 1OC8A 3GKXA 1SJ6A 4BL7A 1SKRB 1IYIA 1TI1A 3IC4A 2CX4A 2H70A 1A0FA 2EIRA 6GSWA 3VURA 1GP1A 5D9TA 4YQMA 2XHFA 3M3MA 1VGLA 3TDGA 1T1VA 4N30A 1SL0B 3FRCA 3P8WA 5F8BA 3I69A 4FIWA 5ENUA 1A23A 3ZFLA 4Q5FA 4Q5NA 2PMTA 2OADA 3ZYWA 3NOFA 4LL1B 1I9DA 3PINA 4TR4A 3LG6A 3A3TA 1EGOA 2GSQA 1GL8A 3D22A 3GTUB 4K5SA 2AV4A 4MH3A 4TXVA 2CA8A 3DGQA 2XPEA 2OE1A 4BIKA 2FWHA 5A4VA 1M9BA 3IHGA 3SWLA 3US3A 4O5RA 3HKRA 2JZRA 4DSSA 1O8WA 5L71A 2V32A 2YN1A 2IMEA 1JLWA 1U87A 1GSUA 2CVDA 4KDUA 3CQFA 3A2VA 4ECCA 2LTKA 4KGIA 5F07A 4EDYA 2DC5A 2JZSA 5D8IA 2NTOA 1AQWA 1JZOA 4Q5QA 3J7Yb 1V2AA 5AIVA 3IAS2 4KE3A 2I9HA 2WB9A 2K18A 1ZYEA 3TKPA 5G5FA 3KTBA 1J9BA 1I5GA 2MMAA 4HUAA 1EEMA 4IJ3A 3QMXA 4BWQA 3UL3A 2IFQB 3QR6A 2L4QA 2F51A 2O8VB 1SK2A 13GSA 2X8GA 4OO5A 4NV2A 2YWNA 4ISDA 3P2AA 5D93A 3QAVA 3HZ4A 1JFUA 1G6WA 1A0RP 3LXTA 2E7PA 2B5YA 4FO5A 1JZDA 1GUMA 2C3QA 3ZREA 1N2AA 5HR1A 4KCEA 4ZL8A 8GSSA 2M46A 4HJMA 2PGTA 4G19A 5DAKA 1YF1A 4LLRA 2C0EA 4F9ZA 1O6JA 2CQ9A 3HHVA 1USBA 3D6IA 1XG8A 4RQXA 2YNXA 4MP4A 4TW5A 2TIRA 1OE8A 4CHSA 2RIIA 5JCGA 3F4TA 1X9WB 1Q98A 1KNGA 1DSBA 3IBHA 3D21A 5DQSA 1THOA 4F0CA 4PNFA 2I81A 2H75A 2DKHA 2L5OA 1YDKA 2JZTA 1BEDA 2GZZA 1KEBA 1CQHA 3ERFA 4MLYA 1M3JA 2C4JA 3KH7A 1VF4A 4JU5A 1O85A 2LSTA 1T8EB 2GGTA 4G0KA 4PGTA 4K7OA 5ECNB 5G5EA 1XCCA 5DALB 1E6BA 1NM3A 1X0RA 2LRNA 3QPMA 5J5NA 3DD3A 2VL2C 1XOAA 2NVLA 1QQ2A 4I5QA 4KCAA 1SL1B 3VI5A 2GVPA 3TJBA 4KF9A 1GSDA 2R0CA 1XWCA 2V2GA 2HXKA 2QA1A 1TRUA 3ERWA 3C1RA 4ZBAA 3IK9A 2GQMA 2L4CA 1GUKA 5B8BA 5A4UA 3P7XA 1A8LA 4EO3A 4PQ1A 2WCIA 2FA4A 3GH9A 3L9VA 3UMAA 1Z3EA 1OVNA 4DSQA 4Z2UA 4GF0A 5CREA 1ERVA 2CZ3A 3J7Yk 5J9BA 2L6DA 4X0XA 3D0ZA 2AAWA 4RQRA 5G2ZA 3GA4A 2B5EA 2VCQA 1GNWA 2PBJA 2LS5A 3O3TA 4EUYA 5DCGA 4HU7A 2DIZA 3VWUA 4PTSA 14GSA 1QMVA 3E3EA 3KD0A 2L57A 1PN0A 1SD8A 5CO3A 1K0CA 4WR4A 4MMMA 5J3RA 2H1AA 3HVVA 1T4ZA 2PERA 4F0BA 3ZITA 1XWBA 1HQOA 3M9JA 3W8JA 2HSYA 2ALBA 2R6KA 2I4AA 3LYKA 3TOTA 1G0TA 3VWVA 1K0AA 2MBSA 1MD4A 7GSSA 4MABA 1R5PA 2GDRA 2HZEA 2CVBA 4X43A 1Z7RA 4LMWA 4AGSA 3RDWA 3FZ9A 4FYBA 3KMNA 4L8EA 3GSTA 2WJUA 3IAM2 3HA9A 1NW2A 1ZGNA 4FQUA 2VIMA 2HZFA 4I97A 5IOXA 1XZOA 3A5WA 3NIVA 4AJ8A 3TKSC 2A4HA 1YEXA 1U3AA 2Z9SA 4K5RA 1GSFA 3KH9A 2HE3A 3RHCA 5DJLA 4ID0A 2OA7A 4TR1A 4IQ1A 3F63A 1U88A 3LYPA 5ELAA 1UVZA 1T3BA 4OFNA 4ECBA 2HYXA 2WULA 1PX6A 5B8AA 4KB3A 5FHIA 4DEJA 1FOVA 2VLVA 5LD0A 1F9MA 2FY6A 3VI7A 2GQKA 3F4SA 2OKAA 1K3LA 2H71A 2GT6A 1ZOFA 3TB2A 2DSAA 3GKMA 3ME8A 3C1SA 3Q6OA 4D73A 1H75A 6GSVA 2LJKA 1M0UA 3GX0A 3MIXA 3RPNA 2LQOA 3LJRA 1PRXA 3VPQA 1F3AA 2H66A 2YOIA 3TGZA 3TRQA 1U3IA 2B5XA 4F82A 3M1GA 3L0HA 3F9UA 1F3BA 2RM5A 1GTAA 3LW9A 3EINA 4HU9A 2ES7A 5ID2B 2EIOA 3CRUA 3VPTA 2NPBA 1YZXA 4P3YB 1WP0A 4J56E 4IELA 2P31A 1B48A 2JSZA 5GSSA 2JU5A 3UVTA 5CRHA 4AJ7A 2B3SA 2HRFA 2I3YA 2FHEA 1AXDA 1LJRA 1FAAA 4MA9A 2K6VA 4PX1A 2CV4A 1KBNA 1B9XC 2FA8A 3ZFBA 3BBYA 3GURA 4OFMA 5F05A 1WE0A 4L5LA 1TK0B 1GULA 1V98A 4ECJA 1YKAA 3QDNA 3CSIA 3W8SA 5HR0A 2XBQA 3LEFA 1SYRA 5IOWA 3L9UA 1V58A 1O7UA 3GMFA 1GTUA 2M80A 4O92A 4YKFA 1BJXA 1MTCA 1M99A 4IN0A 3BCIA 3G7YA 4TKYA 2PN8A 4YKGA 3ZIJA 2YZUA 1HNBA 4BL7B 4JE1A 1JHBA 5CRGA 3C8EA 5D73A 2HSMA 2IWTA 4WETA 3WGXA 2IIYA 2CX3A 4HQZA 2UZ8A 1MDKA 3H93A 2WS2A 3PR8A 3DKSA 5ABRA 2H8LA 1MDJA 4J2FA 2ZCTA 3EE2A 2DMLA 3IRAA 4HS1A 1Q4JA 2P0GA 3TJJA 2MZCA 1PKWA 1SD9A 1GSEA 4K7NA 5ECPB 1EGRA 1WIKA 2GSRA 2HSHA 2WGRA 1M9AA 4YQUA 2AYTA 2G0FA 2R2JA 5CYYA 3IA1A 2LRTA 3G9BA 3KZQA 5IMDA 1V9WA 4HQSA 3UOMA 4TN8A 2J23A 2VLTA 1AQXA 1AUCA 4IJIA 2VD0A 3IHQA 4WF5A 1SYXA 3QCPA 1TRWA 4DSSB 4ZB9A 4BVXB 4XHMA 5IQYA 1S3CA 1FG4A 2JL4A 4MDCA 3IE3A 3F3QA 5E4WA 2L59A 5FWGA 2QGVA 1OC9A 2K9FA 2PWJA 4MPFA 2DJKA 4K8MA 4G10A 4FYCA 2RUFA 2C0DA 4KH7A 2R3XA 5CRDA 2X49A 1K0NA 1BQ7A 2N5AA 1XW6A 3EYTA 4PXOA 2DJ1A 3GTUA 1XXUA 2H01A 3I9V2 2KP1A 1GRXA 4JBBA 1TU8A 3WYWA 3H4KA 3TKQA 1ZYNA 4HEA2 1PA3A 5C04A 2V6OA 1YF0A 4EKZA 5IMAA 5KN3A 3APQA 5HFGA 3IPZA 4F2IA 4HZ4A 1NHYA 1PL1A 3GHAA 2H30A 3GRXA 3RBTA 2KHPA 1SK1A 5BMUA 1M7TA 3U5RE 2OE3A 3CTFA 1K3YA 2YANA 1PFOA 2IN3A 4MZWA 3HY2A 1W4VA 2JSYA 5EL8A 3N9JA 4MF7A 1AW9A 4V2MA 3UJ1A 2CVKA 4MCUA 5F0GA 2X99A 1GLPA 3VWXA 4ZBBA 2L6CA 3GUSA 5DCHA 3IV4A 17GSA 3EWLA 2HLSA 1ST9A 3EU3A 3LQ7A 4IQAA 2VL3A 2K8VA 6GSXA 5DDLA 4TR3A 2REMA 1R5AA 2VM1A 3CXGA 2KP2A 4EIPA 1F6MC 5JCWA 1PQNA 4MJEA 2N5BA 3G7IA 3GNJA 1EWXA 1QUWA 3MDKA 1OE7A 4JRRA 6GSYA 3CTGA 2VO4A 4N10A 3FK8A 4X4JA 1PL2A 2V41A 3HCZA 1PKZA 3GKKA 4WR5A 3RAZA 2G2QA 4AJ6A 5J4UA 1Z6MA 2H76A 1AC1A 2GSTA 6GSUA 5B6MA 3BOAA 5IPGA 4EVMA 2YV9A 4K6XA 2R37A 2YPMA 3MNGA 1TTZA 1YY7A 5CNWA 9GSSA 3MAKA 4MPGA 3EMPA 1UC7A 2V6KA 3TJKA 3GN3A 5H5QA 1Y25A 5ECQB 4NWYA 2C80A 1ACVA 3FKFA 2H74A 2VCVA 2YCDA 2V1MA 3WT2A 3F6DA 1B9YC 2OBIA 4GSNA 1XOBA 2FLSA 1ERTA 1AIUA 2H1DA 4K0GA 5DALA 20GSA 3ME7A 16GSA 3DXBA 4BVYB 1XPVA 2VOCA 5CRWA 4OWYA 2H72A 3N5OA 3C71A 3UVHA 5H5RA 4USSA 4JEDA 4HDEA 3ZVJA 1G7EA 1G7OA 1AQVA 2E2GA 1B8XA 2B7KA 3TRXA 3LWAA 2H6XA 1BG5A 3Q18A 1TJDA 3KEBA 5IMCA 1T4YA 2N5FA 5ECLB 1DBYA 2L5LA 3I43A 1T7PB 3S9FA 4K1FA 3IOSA 4MNNA 1JLVA 1HD2A 4QL9A 3MWHA 3FR6A 4WKWA 2P5QA 4YQVA 1SENA 5KN2A 4NV5A 4HOJA 1OYJA 3L4NA 5F06A 3KTLA 1ZMAA 3QD9A 4XTSA 2HZEB 1ILOA 4OO4A 1FOHA 1QGVA 2B6MA 2EC4A 1X5DA 2X4AA 18GSA 2O87A 3BD2A 3Q19A 2MBTA 2J9HA 4GXZA 5GSTA 2HNLA 4XRAA 2TRXA 2DJ0A 4IHUA 4TR0A 5KN0A 2O7KA 2XBIA 1SU9A 5IM9A 2QC7A 4IGJA 1LBKA 5CP1A 1YKCA 2FWFA 4WEYA 4IBPA 2P5RA 2MMOA 3CRTA 3H79A 4POLA 1WMJA 3O76A 4N11A 5G30A 2OE0A 5E59A 3LXZA 3TRPA 2YWIA 1FHEA 2DBCA 2HRKA 3UBLA 3R3EA 4L0UA 4TR1B 2LUSA 3ZMKA 1HYUA 5DJMA 3IK7A 3L78A 3UIWA 4XRDA 2VL2A 4ACSA 5ECOB 5D9XA 4TXOB 2KUCA 1GH2A 1HNCA 2QKEA 3M9KA 4ZL9A 3DMLA 4YAVA 4FH8A 2IMKA 5EPFA 3ZL5A 4ZIJA 5DVBA 1WJKA 2YZHA 2YWOA 4V2NA 2M72A 1GWCA 2TRCP 1O73A 4GTUA 5FT3A 4I2TA 4MJCA 2R4VA 3EMXA 2DJ2A 4IP6A 2MMZA 4ZXGA 4YH2A 5A5KA 4WXTA 3KIJA 3VWWA 4O5QA 4H86A 4POBA 4GRFA 4O32A 3ZRDA 1JZWA 3HD5A 2LQQA 2YJHA 4FYUA 1Y6EA 2H6ZA 3O6TA 4Q5RA 4LL4B 4ZILA 5KN1A 4KUNA 4HZ2A 4N0ZA 2F8AA 3HXSA 1G6YA 3BCKA 4CW9A 4OD7A 2FD3A 2VCXA 3A5IA 1A2LA 3HJOA 1Z5YE 2B1KA 4CDOA 2C3NA 1TU7A 4KX4A 2YWMA 1WRYA 5IPHA 1TXXA 4K9ZA 1ERUA 5G31A 5JCUA 2LRCA 1HNAA 3C73A 2BTOT 1QFNA 1AAZA 4IS0A 4G2EA 1MDIA 4L0WA 3FEUA 5LNKe 1BYEA 3EVIA 4J57E 4I6XA 4BA7A 1X5CA 3NZNA 4OMVA 3GH6A 1QXHA 2LJAA 5J41A 1GUHA 3LGCA 5KEJA 5ECIB 3I6AA 5HQPA 4EDZA 5A4WA 5HFKA 5JWQB 2HRAA 5IO0A 2CZ2A 1OKTA 5KOWA 1A2JA 2FGXA 4ZB6A 4MF6A 1GTIA 3FMWA 3HJMA 2IPAA 1A24A 4PURA 2DIYA 2ON7A 1FW1A 4RI6A 2C3TA 2F3MA 4XS4A 1Z7PA 1OC3A 3EPTA 3W6GA 1R26A 3HVSA 5BRTA 5JWRB 1W89A 1N8JA 3PH9A 4K2DA 3ZLPA 1XFLA 4TVEA 2PVOC 2DMMA 4KW6A 1TRVA 5ECHB 4PNGA 1XWGA 5GZZB 1TRSA 3P90A 3WT1A 2FWEA 1BAYA 2H19A 5KOXA 1E2YA 4IVFA 4EC0A 1TDIA 2LNSA 2VL9A 3R2QA 3BJ5A 1PGTA 3QAWA 4HJ2A 3LORA 1RQMA 2H0GA 1JZRA 1U6TA 3FY7A 4KA0A 1K0DA 1KTEA 3ZTLA 1IYHA 4A5PA 4PQIA 3PGTA 1OC9B 4JR4A 2E2MA 3CBUA 4WBRD 2HFDA 2DLXA 1ZYQB 1FVKA 4POMA 2FNOA 3D4TA 5ECRB 3D5JA 5HFIA 1SK0A 2ZUPA 4F03A 1VF3A 3DVXA 1F2EA 4KSMA 2PPTA 4JR6A 3HVXA 4L5OA 3TKSE 4RI7A 1XW9A 2VD1A 1B4PA 5DQYA 3DWVA 4K7IA 1RK4A 4NHWA 4OFTA 3MSZA 2A2PA 2EIQA 4O5UA 2WRTA 4ML6A 1GLQA 4BVXA 3F8UA 4GQCA 4NMUA 1PD21 4ICYA 3DEXA 1YEPA 2X64A 1T00A 2FCHA 2JADA 4Z7XA 1EEJA 2AB6A 5G1LA 2GLRA 4EL1A 4ZB8A 3VK9A 4NHZA 2AJQB 2WZ9A 2IL3A 5AIXA 2HI7A 4MZBA 4IW9A 5ECKB 2DJJA 3CSJA 5ECSA 1PSQA 1MEKA 5DBQA 4TOPA 4X1UA 1J0FA 1S3AA 4ML1A 3PPUA 3C7MA 1WWJA 2LV3A 5IMFA 1M3IA 1PX7A 2MMNA 3ZVJD 3TUEA 2GZYA 5HR2A 1MD3A 3F6FA 2AUVA 2R5GA 2QA2A 1NSWA 2GSSA 2R0PA 4K2XA 4E8EA 2H0HA 2MYGA 5DAKB 12GSA 4RUVA 2IFQA 4IP1A 1F37A 2D2ZA 2YV7A 1ZCPA 2C0GA 3FZ5A 2XC2A 3WGDA 3H1NA 3KCMA 3TJFA 3FR9A 4EXJA 2BMXA 3GSSA 2FWGA 1XWKA 1M2BA 4YAPA 2CAQA 4XS1A 4G0LA 1SJIA 2DKIA 4EF0A 4HSCX 3E9JB 3KP8A 4EIQA 2R0GA 2NBSA 4ZBDA 1ZL9A 3DIEA 3GFKA 4G0IA 2LKUA 2PVQA 4NPBA 1M2DA 3FZAA 2FUG2 1C72A 3KP9A 4IKHA 1DUGA 2GZPA 2XPDA 4E8HA 1WOUA 2GT5A 3IXRA 1EP7A 1TOFA 1SKWB 3A2XA 5D96A 2F9SA 1XBSA 5IO2A 2ZNMA 3L9SA 2X8CA 1TP9A 1R7HA 5H5SA 3JCML 6GSSA 1GNEA 1XW5A 1URMA 3ERGA 1THXA 3RPPA 3HDCA 1PMTA 2VUPA 4I8BA 1VF2A 2K8SA 3GL5A 1Z6NA 1PN9A 3M0FA 4GCIA 2WDUA 2LEGA 4CY6A 5HR3A 2C8UA 5LCZA 3KM6A 1K0OA 3ZZXA 3UBKA 4HI7A 3K8NA 1UN2A 3ZMLA 5J9CA 2IMDA 3KJYA 4CY8A 4DVCA 2GQLA 3F4RA 2RUEA 4XCSA 6GSTA 3DVWA 3GX8A 4QL7A 4N0VA 2E0QA 2IJYA 1UA5A 3SBCA 5AN1A 4NXIA 4K0NA 2H6YA 4MK3A 3ZIVA 3LFLA 1XVWA 4ILFA 1GTBA 4PQHA 4BVYA 4DSRA 1R4WA 2YP6A 5CAXA 5ECMB 2X8HA 4TRXA 2GS3A 2A4VA 4GSTA 1XVQA 1O81A 4Z2TA 4GLTA 2HRNA 3LSZA 4PUAA 3VLNA 4MF5A 3KGKA 4MZCA 4EE0A 4Z2RA 2I1UA 5B6NA 1FB0A 11GSA 5IIZA 5B7CA 4ECIA 4MJBA 3A2WA 4JZQA 3WGEA 5D9WA 2A2SA 3G7JA 3FYGA 1SKSB 1LU4A 2B7JA 4V1Ag 3UAPA 4GSSA 3GV1A 3CMIA 3IR4A 1YJ6A 1ZYPA 2H1BA 1DE1A 3GL3A 5AISA 3CSHA 3GIXA 3TJGA 4MH2A 4POKA 5C00A 5GAPD 2JACA 5G1KA 3TOUA 2CAIA 3APOA 3FR3A 3WD6A 4G9HA 2H73A 1O8XA 1DE2A 1OAZA 3TKRA 4O7HA 2OBKA 2LJRA 4LA1A 1GSQA 2BJXA 1S3DA 2VCWA 4OCFA 22GSA 3F3RA 5IMVA 3IC8A 3GYKA 1XWAA 2O85A 1M2AA 4BWSA 3MYDA 1TKDB 3GKNA 3ISOA 3KXOA 2KLXA 4KSOA 10GSA 2RM6A 1EV9A 4KAEA 4BPYA 4GWRA 4D73B 2A2RA 3U6VA 1H4OA 3Q74A 1X5EA 3V1WA 4WF4A 2CT6A 1K0BA 3IDVA 3QAGA 2VM2A 2IMIA 1ERWA 4TXOA 1Z9HA 2RLIA 1K0MA 1EZKA 1OKDA 1K3OA 2VAFA 3QFBC 2C1YA 2O89A 1J08A 1TK8B 2WFCA 2KOKA 1A2MA 2F8FA 1V40A 3UARA 1QK8A 4KNDA 2NDOA 3EURA 1CQGA 1A8YA 19GSA 1X9MB 4GQFA 4LMVA 3E0UA 2YJ7A 4XIHA 5COHA 3HVNA 3RHBA 2VCTA 3CYNA 1ML6A 1FO5A 1FVJA 2HT9A
chains in the Genus database with same CATH topology
3M8NA 3HJPA 3ED3A 2B1LA 5AGYA 5ELGA 1GSYA 1ZZYA 2H1GA 3UEMA 4V2LA 5JWOB 2PUKC 2LNTA 4KDYA 1WPIA 3OR5A 4OCEA 2VLUA 2ON5A 5ID2A 1GSSA 4MJAA 3H8QA 3QOUA 3FHKA 1BX9A 2AHEA 4AF2A 4ULXA 3EU4A 4I2UA 1FB6A 3VFIA 1EV4A 4NAXA 3APSA 2IMFA 1ON4A 1VF1A 3HZ8A 3FZ4A 1YQ1A 2OACA 3HYPA 4QQ7A 2DJ3A 5IMZA 2C0FA 1EP8A 4XS4B 1SL2B 3DRNA 5INYA 1TI3A 3QFAC 2H0IA 1TK5B 5EY6A 1B4QA 3F0IA 3FW2A 2VCZA 5GAND 3TKSA 1NHOA 3AY8A 2GTUA 3DYRA 1EOHA 2QSIA 1EOGA 1V57A 1RW1A 4WBJA 5D9VA 4V1Ap 2OJLA 3D4MA 3TCOA 4KDXA 1X9SB 4XS6A 1VRSD 1XIYA 2PU9C 1SJZA 4ZL7A 4PUFC 1TW9A 1ABAA 3KMOA 3EC3A 5EVOA 1OC8A 3GKXA 1SJ6A 4BL7A 1SKRB 1IYIA 1TI1A 3IC4A 2CX4A 2H70A 1A0FA 2EIRA 6GSWA 3VURA 1GP1A 5D9TA 4YQMA 2XHFA 3M3MA 1VGLA 3TDGA 1T1VA 4N30A 1SL0B 3FRCA 3P8WA 5F8BA 3I69A 4FIWA 5ENUA 1A23A 3ZFLA 4Q5FA 4Q5NA 2PMTA 2OADA 3ZYWA 3NOFA 4LL1B 1I9DA 3PINA 4TR4A 3LG6A 3A3TA 1EGOA 2GSQA 1GL8A 3D22A 3GTUB 4K5SA 2AV4A 4MH3A 4TXVA 2CA8A 3DGQA 2XPEA 2OE1A 2FWHA 5A4VA 1M9BA 3IHGA 3SWLA 3US3A 4O5RA 3HKRA 2JZRA 4DSSA 1O8WA 5L71A 2V32A 2YN1A 2IMEA 1JLWA 1U87A 1GSUA 2CVDA 4KDUA 3A2VA 4ECCA 2LTKA 4KGIA 5F07A 4EDYA 2DC5A 2JZSA 5D8IA 2NTOA 1AQWA 1JZOA 4Q5QA 3J7Yb 1V2AA 5AIVA 3IAS2 4KE3A 2I9HA 2WB9A 2K18A 1ZYEA 3TKPA 5G5FA 3KTBA 1J9BA 1I5GA 2MMAA 4HUAA 1EEMA 4IJ3A 3QMXA 4BWQA 3UL3A 2IFQB 3QR6A 2L4QA 2F51A 2O8VB 1SK2A 13GSA 2X8GA 4OO5A 4NV2A 2YWNA 4ISDA 3P2AA 5D93A 3QAVA 3HZ4A 1JFUA 1G6WA 1A0RP 3LXTA 2E7PA 2B5YA 4FO5A 1JZDA 1GUMA 2C3QA 3ZREA 1N2AA 5HR1A 4KCEA 4ZL8A 8GSSA 2M46A 4HJMA 2PGTA 4G19A 5DAKA 1YF1A 4LLRA 2C0EA 4F9ZA 1O6JA 2CQ9A 3HHVA 1USBA 3D6IA 4RQXA 2YNXA 4MP4A 4TW5A 2TIRA 1OE8A 4CHSA 2RIIA 5JCGA 3F4TA 1X9WB 1Q98A 1KNGA 1DSBA 3IBHA 3D21A 5DQSA 1THOA 4F0CA 4PNFA 2I81A 2H75A 2DKHA 2L5OA 1YDKA 2JZTA 1BEDA 2GZZA 1KEBA 1CQHA 3ERFA 4MLYA 2C4JA 3KH7A 1VF4A 4JU5A 1O85A 2LSTA 1T8EB 2GGTA 4G0KA 4PGTA 4K7OA 5ECNB 5G5EA 1XCCA 5DALB 1E6BA 1NM3A 1X0RA 2LRNA 3QPMA 5J5NA 3DD3A 2VL2C 1XOAA 2NVLA 1QQ2A 4I5QA 4KCAA 1SL1B 3VI5A 2GVPA 3TJBA 4KF9A 1GSDA 2R0CA 1XWCA 2V2GA 2HXKA 2QA1A 1TRUA 3ERWA 3C1RA 4ZBAA 3IK9A 2GQMA 2L4CA 1GUKA 5B8BA 5A4UA 3P7XA 1A8LA 4EO3A 4PQ1A 2WCIA 2FA4A 3GH9A 3L9VA 3UMAA 1Z3EA 1OVNA 4DSQA 4Z2UA 4GF0A 5CREA 1ERVA 2CZ3A 3J7Yk 5J9BA 2L6DA 4X0XA 3D0ZA 2AAWA 4RQRA 5G2ZA 3GA4A 2B5EA 2VCQA 1GNWA 2PBJA 2LS5A 3O3TA 4EUYA 5DCGA 4HU7A 2DIZA 3VWUA 4PTSA 14GSA 1QMVA 3E3EA 3KD0A 2L57A 1PN0A 1SD8A 5CO3A 1K0CA 4WR4A 4MMMA 5J3RA 2H1AA 3HVVA 1T4ZA 2PERA 4F0BA 3ZITA 1XWBA 1HQOA 3M9JA 3W8JA 2HSYA 2ALBA 2R6KA 2I4AA 3LYKA 3TOTA 1G0TA 3VWVA 1K0AA 2MBSA 1MD4A 7GSSA 4MABA 1R5PA 2GDRA 2HZEA 2CVBA 4X43A 1Z7RA 4LMWA 4AGSA 3RDWA 3FZ9A 4FYBA 3KMNA 4L8EA 3GSTA 2WJUA 3IAM2 3HA9A 1NW2A 1ZGNA 4FQUA 2VIMA 2HZFA 4I97A 5IOXA 1XZOA 3A5WA 3NIVA 4AJ8A 3TKSC 2A4HA 1YEXA 1U3AA 2Z9SA 4K5RA 1GSFA 3KH9A 2HE3A 3RHCA 5DJLA 4ID0A 2OA7A 4TR1A 4IQ1A 3F63A 1U88A 3LYPA 5ELAA 1UVZA 1T3BA 4OFNA 4ECBA 2HYXA 2WULA 1PX6A 5B8AA 4KB3A 5FHIA 4DEJA 1FOVA 2VLVA 5LD0A 1F9MA 2FY6A 3VI7A 2GQKA 3F4SA 2OKAA 1K3LA 2H71A 2GT6A 1ZOFA 3TB2A 2DSAA 3GKMA 3ME8A 3C1SA 3Q6OA 4D73A 1H75A 6GSVA 2LJKA 1M0UA 3GX0A 3MIXA 3RPNA 2LQOA 3LJRA 1PRXA 3VPQA 1F3AA 2H66A 2YOIA 3TGZA 3TRQA 1U3IA 2B5XA 4F82A 3M1GA 3L0HA 3F9UA 1F3BA 2RM5A 1GTAA 3LW9A 3EINA 4HU9A 2ES7A 5ID2B 2EIOA 3CRUA 3VPTA 2NPBA 1YZXA 4P3YB 1WP0A 4J56E 4IELA 2P31A 1B48A 2JSZA 5GSSA 2JU5A 3UVTA 5CRHA 4AJ7A 2B3SA 2HRFA 2I3YA 2FHEA 1AXDA 1LJRA 1FAAA 4MA9A 2K6VA 4PX1A 2CV4A 1KBNA 1B9XC 2FA8A 3ZFBA 3BBYA 3GURA 4OFMA 5F05A 1WE0A 4L5LA 1TK0B 1GULA 1V98A 4ECJA 1YKAA 3QDNA 3CSIA 3W8SA 5HR0A 2XBQA 3LEFA 1SYRA 5IOWA 3L9UA 1V58A 1O7UA 3GMFA 1GTUA 2M80A 4O92A 4YKFA 1BJXA 1MTCA 1M99A 4IN0A 3BCIA 3G7YA 4TKYA 2PN8A 4YKGA 3ZIJA 2YZUA 1HNBA 4BL7B 4JE1A 1JHBA 5CRGA 3C8EA 5D73A 2HSMA 2IWTA 4WETA 3WGXA 2IIYA 2CX3A 4HQZA 2UZ8A 1MDKA 3H93A 2WS2A 3PR8A 3DKSA 5ABRA 2H8LA 1MDJA 4J2FA 2ZCTA 3EE2A 2DMLA 3IRAA 4HS1A 1Q4JA 2P0GA 3TJJA 2MZCA 1PKWA 1SD9A 1GSEA 4K7NA 5ECPB 1EGRA 1WIKA 2GSRA 2HSHA 2WGRA 1M9AA 4YQUA 2AYTA 2G0FA 2R2JA 5CYYA 3IA1A 2LRTA 3G9BA 3KZQA 5IMDA 1V9WA 4HQSA 3UOMA 4TN8A 2J23A 2VLTA 1AQXA 1AUCA 4IJIA 2VD0A 3IHQA 4WF5A 1SYXA 3QCPA 1TRWA 4DSSB 4ZB9A 4BVXB 4XHMA 5IQYA 1S3CA 1FG4A 2JL4A 4MDCA 3IE3A 3F3QA 5E4WA 2L59A 5FWGA 2QGVA 1OC9A 2K9FA 2PWJA 4MPFA 2DJKA 4K8MA 4G10A 4FYCA 2RUFA 2C0DA 4KH7A 2R3XA 5CRDA 2X49A 1K0NA 1BQ7A 2N5AA 1XW6A 3EYTA 4PXOA 2DJ1A 3GTUA 1XXUA 2H01A 3I9V2 2KP1A 1GRXA 4JBBA 1TU8A 3WYWA 3H4KA 3TKQA 1ZYNA 4HEA2 1PA3A 5C04A 2V6OA 1YF0A 4EKZA 5IMAA 5KN3A 3APQA 5HFGA 3IPZA 4F2IA 4HZ4A 1NHYA 1PL1A 3GHAA 2H30A 3GRXA 3RBTA 2KHPA 1SK1A 5BMUA 1M7TA 3U5RE 2OE3A 3CTFA 1K3YA 2YANA 2IN3A 4MZWA 3HY2A 1W4VA 2JSYA 5EL8A 3N9JA 4MF7A 1AW9A 4V2MA 3UJ1A 2CVKA 4MCUA 5F0GA 2X99A 1GLPA 3VWXA 4ZBBA 2L6CA 3GUSA 5DCHA 3IV4A 17GSA 3EWLA 2HLSA 1ST9A 3EU3A 3LQ7A 4IQAA 2VL3A 2K8VA 6GSXA 5DDLA 4TR3A 2REMA 1R5AA 2VM1A 3CXGA 2KP2A 4EIPA 1F6MC 5JCWA 1PQNA 4MJEA 2N5BA 3G7IA 3GNJA 1EWXA 1QUWA 3MDKA 1OE7A 4JRRA 6GSYA 3CTGA 2VO4A 4N10A 3FK8A 4X4JA 1PL2A 2V41A 3HCZA 1PKZA 3GKKA 4WR5A 3RAZA 2G2QA 4AJ6A 5J4UA 1Z6MA 2H76A 1AC1A 2GSTA 6GSUA 5B6MA 3BOAA 5IPGA 4EVMA 2YV9A 4K6XA 2R37A 2YPMA 3MNGA 1TTZA 1YY7A 5CNWA 9GSSA 3MAKA 4MPGA 3EMPA 1UC7A 2V6KA 3TJKA 3GN3A 5H5QA 1Y25A 5ECQB 4NWYA 2C80A 1ACVA 3FKFA 2H74A 2VCVA 2YCDA 2V1MA 3WT2A 3F6DA 1B9YC 2OBIA 4GSNA 1XOBA 2FLSA 1ERTA 1AIUA 2H1DA 4K0GA 5DALA 20GSA 3ME7A 16GSA 3DXBA 4BVYB 1XPVA 2VOCA 5CRWA 4OWYA 2H72A 3N5OA 3C71A 3UVHA 5H5RA 4USSA 4JEDA 4HDEA 3ZVJA 1G7EA 1G7OA 1AQVA 2E2GA 1B8XA 2B7KA 3TRXA 3LWAA 2H6XA 1BG5A 3Q18A 1TJDA 3KEBA 5IMCA 1T4YA 2N5FA 5ECLB 1DBYA 2L5LA 3I43A 1T7PB 3S9FA 4K1FA 3IOSA 4MNNA 1JLVA 1HD2A 4QL9A 3MWHA 3FR6A 4WKWA 2P5QA 4YQVA 1SENA 5KN2A 4NV5A 4HOJA 1OYJA 3L4NA 5F06A 3KTLA 1ZMAA 3QD9A 4XTSA 2HZEB 1ILOA 4OO4A 1FOHA 1QGVA 2B6MA 2EC4A 1X5DA 2X4AA 18GSA 2O87A 3BD2A 3Q19A 2MBTA 2J9HA 4GXZA 5GSTA 2HNLA 4XRAA 2TRXA 2DJ0A 4IHUA 4TR0A 5KN0A 2O7KA 2XBIA 1SU9A 5IM9A 2QC7A 4IGJA 1LBKA 5CP1A 1YKCA 2FWFA 4WEYA 4IBPA 2P5RA 2MMOA 3CRTA 3H79A 4POLA 1WMJA 3O76A 4N11A 5G30A 2OE0A 5E59A 3LXZA 3TRPA 2YWIA 1FHEA 2DBCA 2HRKA 3UBLA 3R3EA 4L0UA 4TR1B 2LUSA 3ZMKA 1HYUA 5DJMA 3IK7A 3L78A 3UIWA 4XRDA 2VL2A 4ACSA 5ECOB 5D9XA 4TXOB 2KUCA 1GH2A 1HNCA 2QKEA 3M9KA 4ZL9A 3DMLA 4YAVA 4FH8A 2IMKA 5EPFA 3ZL5A 4ZIJA 5DVBA 1WJKA 2YZHA 2YWOA 4V2NA 2M72A 1GWCA 2TRCP 1O73A 4GTUA 5FT3A 4I2TA 4MJCA 2R4VA 3EMXA 2DJ2A 4IP6A 2MMZA 4ZXGA 4YH2A 5A5KA 4WXTA 3KIJA 3VWWA 4O5QA 4H86A 4POBA 4GRFA 4O32A 3ZRDA 1JZWA 3HD5A 2LQQA 2YJHA 4FYUA 1Y6EA 2H6ZA 3O6TA 4Q5RA 4LL4B 4ZILA 5KN1A 4KUNA 4HZ2A 4N0ZA 2F8AA 3HXSA 1G6YA 3BCKA 4CW9A 4OD7A 2FD3A 2VCXA 3A5IA 1A2LA 3HJOA 1Z5YE 2B1KA 4CDOA 2C3NA 1TU7A 4KX4A 2YWMA 1WRYA 5IPHA 1TXXA 4K9ZA 1ERUA 5G31A 5JCUA 2LRCA 1HNAA 3C73A 2BTOT 1QFNA 1AAZA 4IS0A 4G2EA 1MDIA 4L0WA 3FEUA 5LNKe 1BYEA 3EVIA 4J57E 4I6XA 4BA7A 1X5CA 3NZNA 4OMVA 3GH6A 1QXHA 2LJAA 5J41A 1GUHA 3LGCA 5KEJA 5ECIB 3I6AA 5HQPA 4EDZA 5A4WA 5HFKA 5JWQB 2HRAA 5IO0A 2CZ2A 1OKTA 5KOWA 1A2JA 2FGXA 4ZB6A 4MF6A 1GTIA 3FMWA 3HJMA 2IPAA 1A24A 4PURA 2DIYA 2ON7A 1FW1A 4RI6A 2C3TA 2F3MA 4XS4A 1Z7PA 1OC3A 3EPTA 3W6GA 1R26A 3HVSA 5BRTA 5JWRB 1W89A 1N8JA 3PH9A 4K2DA 3ZLPA 1XFLA 4TVEA 2PVOC 2DMMA 4KW6A 1TRVA 5ECHB 4PNGA 1XWGA 5GZZB 1TRSA 3P90A 3WT1A 2FWEA 1BAYA 2H19A 5KOXA 1E2YA 4IVFA 4EC0A 1TDIA 2LNSA 2VL9A 3R2QA 3BJ5A 1PGTA 3QAWA 4HJ2A 3LORA 1RQMA 2H0GA 1JZRA 1U6TA 3FY7A 4KA0A 1K0DA 1KTEA 3ZTLA 1IYHA 4A5PA 4PQIA 3PGTA 1OC9B 4JR4A 2E2MA 3CBUA 4WBRD 2HFDA 2DLXA 1ZYQB 1FVKA 4POMA 2FNOA 3D4TA 5ECRB 3D5JA 5HFIA 1SK0A 2ZUPA 4F03A 1VF3A 3DVXA 1F2EA 4KSMA 2PPTA 4JR6A 3HVXA 4L5OA 3TKSE 4RI7A 1XW9A 2VD1A 1B4PA 5DQYA 3DWVA 4K7IA 1RK4A 4NHWA 4OFTA 3MSZA 2A2PA 2EIQA 4O5UA 2WRTA 4ML6A 1GLQA 4BVXA 3F8UA 4GQCA 4NMUA 1PD21 4ICYA 3DEXA 1YEPA 2X64A 1T00A 2FCHA 2JADA 4Z7XA 1EEJA 2AB6A 5G1LA 2GLRA 4EL1A 4ZB8A 3VK9A 4NHZA 2AJQB 2WZ9A 2IL3A 5AIXA 2HI7A 4MZBA 4IW9A 5ECKB 2DJJA 3CSJA 5ECSA 1PSQA 1MEKA 5DBQA 4TOPA 4X1UA 1J0FA 1S3AA 4ML1A 3PPUA 3C7MA 1WWJA 2LV3A 5IMFA 1PX7A 2MMNA 3ZVJD 3TUEA 2GZYA 5HR2A 1MD3A 3F6FA 2AUVA 2R5GA 2QA2A 1NSWA 2GSSA 2R0PA 4K2XA 4E8EA 2H0HA 2MYGA 5DAKB 12GSA 4RUVA 2IFQA 4IP1A 1F37A 2D2ZA 2YV7A 1ZCPA 2C0GA 3FZ5A 2XC2A 3WGDA 3H1NA 3KCMA 3TJFA 3FR9A 4EXJA 2BMXA 3GSSA 2FWGA 1XWKA 1M2BA 4YAPA 2CAQA 4XS1A 4G0LA 1SJIA 2DKIA 4EF0A 3E9JB 3KP8A 4EIQA 2R0GA 2NBSA 4ZBDA 1ZL9A 3DIEA 3GFKA 4G0IA 2LKUA 2PVQA 4NPBA 1M2DA 3FZAA 2FUG2 1C72A 3KP9A 4IKHA 1DUGA 2GZPA 2XPDA 4E8HA 1WOUA 2GT5A 3IXRA 1EP7A 1TOFA 1SKWB 3A2XA 5D96A 2F9SA 1XBSA 5IO2A 2ZNMA 3L9SA 2X8CA 1TP9A 1R7HA 5H5SA 3JCML 6GSSA 1GNEA 1XW5A 1URMA 3ERGA 1THXA 3RPPA 3HDCA 1PMTA 2VUPA 4I8BA 1VF2A 2K8SA 3GL5A 1Z6NA 1PN9A 3M0FA 4GCIA 2WDUA 2LEGA 4CY6A 5HR3A 2C8UA 5LCZA 3KM6A 1K0OA 3ZZXA 3UBKA 4HI7A 3K8NA 1UN2A 3ZMLA 5J9CA 2IMDA 3KJYA 4CY8A 4DVCA 2GQLA 3F4RA 2RUEA 4XCSA 6GSTA 3DVWA 3GX8A 4QL7A 4N0VA 2E0QA 2IJYA 1UA5A 3SBCA 5AN1A 4NXIA 4K0NA 2H6YA 4MK3A 3ZIVA 3LFLA 1XVWA 4ILFA 1GTBA 4PQHA 4BVYA 4DSRA 1R4WA 2YP6A 5CAXA 5ECMB 2X8HA 4TRXA 2GS3A 2A4VA 4GSTA 1XVQA 1O81A 4Z2TA 4GLTA 2HRNA 3LSZA 4PUAA 3VLNA 4MF5A 3KGKA 4MZCA 4EE0A 4Z2RA 2I1UA 5B6NA 1FB0A 11GSA 5IIZA 5B7CA 4ECIA 4MJBA 3A2WA 4JZQA 3WGEA 5D9WA 2A2SA 3G7JA 3FYGA 1SKSB 1LU4A 2B7JA 4V1Ag 3UAPA 4GSSA 3GV1A 3CMIA 3IR4A 1YJ6A 1ZYPA 2H1BA 1DE1A 3GL3A 5AISA 3CSHA 3GIXA 3TJGA 4MH2A 4POKA 5C00A 5GAPD 2JACA 5G1KA 3TOUA 2CAIA 3APOA 3FR3A 3WD6A 4G9HA 2H73A 1O8XA 1DE2A 1OAZA 3TKRA 4O7HA 2OBKA 2LJRA 4LA1A 1GSQA 2BJXA 1S3DA 2VCWA 4OCFA 22GSA 3F3RA 5IMVA 3IC8A 3GYKA 1XWAA 2O85A 1M2AA 4BWSA 3MYDA 1TKDB 3GKNA 3ISOA 3KXOA 2KLXA 4KSOA 10GSA 2RM6A 1EV9A 4KAEA 4BPYA 4GWRA 4D73B 2A2RA 3U6VA 1H4OA 3Q74A 1X5EA 3V1WA 4WF4A 2CT6A 1K0BA 3IDVA 3QAGA 2VM2A 2IMIA 1ERWA 4TXOA 1Z9HA 2RLIA 1K0MA 1EZKA 1OKDA 1K3OA 2VAFA 3QFBC 2C1YA 2O89A 1J08A 1TK8B 2WFCA 2KOKA 1A2MA 2F8FA 1V40A 3UARA 1QK8A 4KNDA 2NDOA 3EURA 1CQGA 1A8YA 19GSA 1X9MB 4GQFA 4LMVA 3E0UA 2YJ7A 4XIHA 5COHA 3RHBA 2VCTA 3CYNA 1ML6A 1FO5A 1FVJA 2HT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8N A;  3HJP A;  3ED3 A;  2B1L A;  5AGY A;  5ELG A;  1GSY A;  1ZZY A;  2H1G A;  3UEM A;  4V2L A;  5JWO B;  2PUK C;  2LNT A;  4KDY A;  1WPI A;  3OR5 A;  4OCE A;  2VLU A;  2ON5 A;  5ID2 A;  1GSS A;  4MJA A;  3H8Q A;  3QOU A;  3FHK A;  1BX9 A;  2AHE A;  4AF2 A;  4ULX A;  3EU4 A;  4I2U A;  1FB6 A;  3VFI A;  1EV4 A;  4NAX A;  3APS A;  2IMF A;  1ON4 A;  1VF1 A;  3HZ8 A;  3FZ4 A;  1YQ1 A;  2OAC A;  3HYP A;  4QQ7 A;  2DJ3 A;  5IMZ A;  2C0F A;  1EP8 A;  4XS4 B;  1SL2 B;  3DRN A;  5INY A;  1TI3 A;  3QFA C;  2H0I A;  1TK5 B;  5EY6 A;  1B4Q A;  3F0I A;  3FW2 A;  2VCZ A;  5GAN D;  3TKS A;  1NHO A;  3AY8 A;  2GTU A;  3DYR A;  1EOH A;  2QSI A;  1EOG A;  1V57 A;  1RW1 A;  4WBJ A;  5D9V A;  4V1A p;  2OJL A;  3D4M A;  3TCO A;  4KDX A;  1X9S B;  4XS6 A;  1VRS D;  1XIY A;  2PU9 C;  1SJZ A;  4ZL7 A;  4PUF C;  1TW9 A;  1ABA A;  3KMO A;  3EC3 A;  5EVO A;  1OC8 A;  3GKX A;  1SJ6 A;  4BL7 A;  1SKR B;  1IYI A;  1TI1 A;  3IC4 A;  2CX4 A;  2H70 A;  1A0F A;  2EIR A;  6GSW A;  3VUR A;  1GP1 A;  5D9T A;  4YQM A;  2XHF A;  3M3M A;  1VGL A;  3TDG A;  1T1V A;  4N30 A;  1SL0 B;  3FRC A;  3P8W A;  5F8B A;  3I69 A;  4FIW A;  5ENU A;  1A23 A;  3ZFL A;  4Q5F A;  4Q5N A;  2PMT A;  2OAD A;  3ZYW A;  3NOF A;  4LL1 B;  1I9D A;  3PIN A;  4TR4 A;  3LG6 A;  3A3T A;  1EGO A;  2GSQ A;  1GL8 A;  3D22 A;  3GTU B;  2AV4 A;  4MH3 A;  4TXV A;  2CA8 A;  3DGQ A;  2XPE A;  2OE1 A;  2FWH A;  5A4V A;  1M9B A;  3SWL A;  3US3 A;  4O5R A;  3HKR A;  2JZR A;  4DSS A;  1O8W A;  5L71 A;  2V32 A;  2YN1 A;  2IME A;  1JLW A;  1U87 A;  1GSU A;  2CVD A;  4KDU A;  3A2V A;  4ECC A;  2LTK A;  4KGI A;  5F07 A;  4EDY A;  2DC5 A;  2JZS A;  5D8I A;  2NTO A;  1AQW A;  1JZO A;  4Q5Q A;  3J7Y b;  1V2A A;  5AIV A;  3IAS 2;  4KE3 A;  2I9H A;  2WB9 A;  2K18 A;  1ZYE A;  3TKP A;  5G5F A;  3KTB A;  1J9B A;  1I5G A;  2MMA A;  4HUA A;  1EEM A;  4IJ3 A;  3QMX A;  4BWQ A;  3UL3 A;  2IFQ B;  3QR6 A;  2L4Q A;  2F51 A;  2O8V B;  1SK2 A;  13GS A;  2X8G A;  4OO5 A;  4NV2 A;  2YWN A;  4ISD A;  3P2A A;  5D93 A;  3QAV A;  3HZ4 A;  1JFU A;  1G6W A;  1A0R P;  3LXT A;  2E7P A;  2B5Y A;  4FO5 A;  1JZD A;  1GUM A;  2C3Q A;  3ZRE A;  1N2A A;  5HR1 A;  4KCE A;  4ZL8 A;  8GSS A;  2M46 A;  4HJM A;  2PGT A;  4G19 A;  5DAK A;  1YF1 A;  4LLR A;  2C0E A;  4F9Z A;  1O6J A;  2CQ9 A;  3HHV A;  1USB A;  3D6I A;  4RQX A;  2YNX A;  4MP4 A;  4TW5 A;  2TIR A;  1OE8 A;  4CHS A;  2RII A;  5JCG A;  3F4T A;  1X9W B;  1Q98 A;  1KNG A;  1DSB A;  3IBH A;  3D21 A;  5DQS A;  1THO A;  4F0C A;  4PNF A;  2I81 A;  2H75 A;  2L5O A;  1YDK A;  2JZT A;  1BED A;  2GZZ A;  1KEB A;  1CQH A;  3ERF A;  4MLY A;  2C4J A;  3KH7 A;  1VF4 A;  4JU5 A;  1O85 A;  2LST A;  1T8E B;  2GGT A;  4PGT A;  4K7O A;  5ECN B;  5G5E A;  1XCC A;  5DAL B;  1E6B A;  1NM3 A;  1X0R A;  2LRN A;  3QPM A;  5J5N A;  3DD3 A;  2VL2 C;  1XOA A;  2NVL A;  1QQ2 A;  4I5Q A;  4KCA A;  1SL1 B;  3VI5 A;  2GVP A;  3TJB A;  1GSD A;  1XWC A;  2V2G A;  2HXK A;  1TRU A;  3ERW A;  3C1R A;  4ZBA A;  3IK9 A;  2GQM A;  2L4C A;  1GUK A;  5B8B A;  5A4U A;  3P7X A;  1A8L A;  4EO3 A;  4PQ1 A;  2WCI A;  2FA4 A;  3GH9 A;  3L9V A;  3UMA A;  1Z3E A;  1OVN A;  4DSQ A;  4GF0 A;  5CRE A;  1ERV A;  2CZ3 A;  3J7Y k;  5J9B A;  2L6D A;  4X0X A;  3D0Z A;  2AAW A;  4RQR A;  5G2Z A;  3GA4 A;  2B5E A;  2VCQ A;  1GNW A;  2PBJ A;  2LS5 A;  3O3T A;  4EUY A;  5DCG A;  4HU7 A;  2DIZ A;  3VWU A;  14GS A;  1QMV A;  3E3E A;  3KD0 A;  2L57 A;  1SD8 A;  5CO3 A;  1K0C A;  4WR4 A;  4MMM A;  5J3R A;  2H1A A;  3HVV A;  1T4Z A;  2PER A;  4F0B A;  3ZIT A;  1XWB A;  1HQO A;  3M9J A;  3W8J A;  2HSY A;  2ALB A;  2R6K A;  2I4A A;  3LYK A;  3TOT A;  1G0T A;  3VWV A;  1K0A A;  2MBS A;  1MD4 A;  7GSS A;  4MAB A;  1R5P A;  2GDR A;  2HZE A;  2CVB A;  4X43 A;  1Z7R A;  4LMW A;  4AGS A;  3RDW A;  3FZ9 A;  4FYB A;  3KMN A;  4L8E A;  3GST A;  2WJU A;  3IAM 2;  3HA9 A;  1NW2 A;  1ZGN A;  2VIM A;  2HZF A;  4I97 A;  5IOX A;  1XZO A;  3A5W A;  3NIV A;  4AJ8 A;  3TKS C;  1YEX A;  1U3A A;  2Z9S A;  1GSF A;  3KH9 A;  2HE3 A;  3RHC A;  5DJL A;  4ID0 A;  2OA7 A;  4TR1 A;  4IQ1 A;  3F63 A;  1U88 A;  3LYP A;  5ELA A;  1UVZ A;  1T3B A;  4OFN A;  4ECB A;  2HYX A;  2WUL A;  1PX6 A;  5B8A A;  4KB3 A;  5FHI A;  4DEJ A;  1FOV A;  2VLV A;  5LD0 A;  1F9M A;  2FY6 A;  3VI7 A;  2GQK A;  3F4S A;  2OKA A;  1K3L A;  2H71 A;  2GT6 A;  1ZOF A;  3TB2 A;  2DSA A;  3GKM A;  3ME8 A;  3C1S A;  3Q6O A;  4D73 A;  1H75 A;  6GSV A;  2LJK A;  1M0U A;  3GX0 A;  3RPN A;  2LQO A;  3LJR A;  1PRX A;  3VPQ A;  1F3A A;  2H66 A;  2YOI A;  3TGZ A;  3TRQ A;  1U3I A;  2B5X A;  4F82 A;  3M1G A;  3L0H A;  3F9U A;  1F3B A;  2RM5 A;  1GTA A;  3EIN A;  4HU9 A;  2ES7 A;  5ID2 B;  2EIO A;  3CRU A;  3VPT A;  2NPB A;  1YZX A;  4P3Y B;  1WP0 A;  4J56 E;  4IEL A;  2P31 A;  1B48 A;  2JSZ A;  5GSS A;  2JU5 A;  3UVT A;  5CRH A;  4AJ7 A;  2B3S A;  2HRF A;  2I3Y A;  2FHE A;  1AXD A;  1LJR A;  1FAA A;  4MA9 A;  2K6V A;  4PX1 A;  2CV4 A;  1KBN A;  1B9X C;  2FA8 A;  3ZFB A;  3BBY A;  3GUR A;  4OFM A;  5F05 A;  1WE0 A;  4L5L A;  1TK0 B;  1GUL A;  1V98 A;  4ECJ A;  1YKA A;  3QDN A;  3CSI A;  3W8S A;  5HR0 A;  2XBQ A;  3LEF A;  1SYR A;  5IOW A;  3L9U A;  1V58 A;  1O7U A;  3GMF A;  1GTU A;  2M80 A;  4O92 A;  1BJX A;  1MTC A;  1M99 A;  4IN0 A;  3BCI A;  3G7Y A;  4TKY A;  2PN8 A;  3ZIJ A;  2YZU A;  1HNB A;  4JE1 A;  1JHB A;  5CRG A;  3C8E A;  5D73 A;  2IWT A;  4WET A;  3WGX A;  2IIY A;  2CX3 A;  4HQZ A;  1MDK A;  3H93 A;  2WS2 A;  3PR8 A;  3DKS A;  5ABR A;  2H8L A;  1MDJ A;  4J2F A;  2ZCT A;  3EE2 A;  2DML A;  3IRA A;  4HS1 A;  1Q4J A;  2P0G A;  3TJJ A;  2MZC A;  1PKW A;  1SD9 A;  1GSE A;  4K7N A;  5ECP B;  1EGR A;  1WIK A;  2GSR A;  2HSH A;  2WGR A;  1M9A A;  4YQU A;  2AYT A;  2G0F A;  2R2J A;  5CYY A;  3IA1 A;  2LRT A;  3G9B A;  3KZQ A;  5IMD A;  1V9W A;  4HQS A;  3UOM A;  4TN8 A;  2J23 A;  2VLT A;  1AQX A;  1AUC A;  4IJI A;  2VD0 A;  3IHQ A;  4WF5 A;  1SYX A;  3QCP A;  1TRW A;  4DSS B;  4ZB9 A;  4XHM A;  5IQY A;  1S3C A;  1FG4 A;  2JL4 A;  4MDC A;  3IE3 A;  3F3Q A;  5E4W A;  2L59 A;  5FWG A;  2QGV A;  1OC9 A;  2K9F A;  2PWJ A;  4MPF A;  2DJK A;  4K8M A;  4G10 A;  4FYC A;  2RUF A;  2C0D A;  4KH7 A;  2R3X A;  5CRD A;  1K0N A;  1BQ7 A;  2N5A A;  1XW6 A;  3EYT A;  4PXO A;  2DJ1 A;  3GTU A;  1XXU A;  2H01 A;  3I9V 2;  2KP1 A;  1GRX A;  4JBB A;  1TU8 A;  3WYW A;  3H4K A;  3TKQ A;  4HEA 2;  1PA3 A;  5C04 A;  2V6O A;  1YF0 A;  4EKZ A;  5IMA A;  5KN3 A;  3APQ A;  5HFG A;  3IPZ A;  4F2I A;  4HZ4 A;  1NHY A;  1PL1 A;  3GHA A;  2H30 A;  3GRX A;  3RBT A;  2KHP A;  1SK1 A;  1M7T A;  3U5R E;  2OE3 A;  3CTF A;  1K3Y A;  2YAN A;  2IN3 A;  4MZW A;  3HY2 A;  1W4V A;  2JSY A;  5EL8 A;  3N9J A;  4MF7 A;  1AW9 A;  4V2M A;  3UJ1 A;  2CVK A;  4MCU A;  5F0G A;  2X99 A;  1GLP A;  3VWX A;  4ZBB A;  2L6C A;  3GUS A;  5DCH A;  3IV4 A;  17GS A;  3EWL A;  2HLS A;  1ST9 A;  3EU3 A;  3LQ7 A;  4IQA A;  2VL3 A;  2K8V A;  6GSX A;  5DDL A;  4TR3 A;  2REM A;  1R5A A;  2VM1 A;  3CXG A;  2KP2 A;  1F6M C;  5JCW A;  1PQN A;  4MJE A;  2N5B A;  3G7I A;  3GNJ A;  1EWX A;  1QUW A;  3MDK A;  1OE7 A;  4JRR A;  6GSY A;  3CTG A;  2VO4 A;  4N10 A;  3FK8 A;  1PL2 A;  2V41 A;  3HCZ A;  1PKZ A;  3GKK A;  4WR5 A;  3RAZ A;  2G2Q A;  4AJ6 A;  5J4U A;  1Z6M A;  2H76 A;  1AC1 A;  2GST A;  6GSU A;  5B6M A;  3BOA A;  5IPG A;  4EVM A;  2YV9 A;  4K6X A;  2R37 A;  2YPM A;  3MNG A;  1TTZ A;  1YY7 A;  5CNW A;  9GSS A;  3MAK A;  4MPG A;  3EMP A;  1UC7 A;  2V6K A;  3TJK A;  3GN3 A;  5H5Q A;  1Y25 A;  5ECQ B;  4NWY A;  2C80 A;  1ACV A;  3FKF A;  2H74 A;  2VCV A;  2YCD A;  2V1M A;  3WT2 A;  3F6D A;  1B9Y C;  2OBI A;  4GSN A;  1XOB A;  2FLS A;  1ERT A;  1AIU A;  2H1D A;  4K0G A;  5DAL A;  20GS A;  3ME7 A;  16GS A;  3DXB A;  1XPV A;  2VOC A;  5CRW A;  4OWY A;  2H72 A;  3N5O A;  3C71 A;  3UVH A;  5H5R A;  4JED A;  4HDE A;  3ZVJ A;  1G7E A;  1G7O A;  1AQV A;  2E2G A;  1B8X A;  2B7K A;  3TRX A;  3LWA A;  2H6X A;  1BG5 A;  3Q18 A;  1TJD A;  3KEB A;  5IMC A;  1T4Y A;  2N5F A;  5ECL B;  1DBY A;  2L5L A;  3I43 A;  1T7P B;  3S9F A;  4K1F A;  3IOS A;  1JLV A;  1HD2 A;  4QL9 A;  3MWH A;  3FR6 A;  4WKW A;  2P5Q A;  4YQV A;  1SEN A;  5KN2 A;  4NV5 A;  4HOJ A;  1OYJ A;  3L4N A;  5F06 A;  3KTL A;  1ZMA A;  3QD9 A;  4XTS A;  2HZE B;  1ILO A;  4OO4 A;  1QGV A;  2B6M A;  2EC4 A;  1X5D A;  18GS A;  2O87 A;  3BD2 A;  3Q19 A;  2MBT A;  2J9H A;  4GXZ A;  5GST A;  2HNL A;  4XRA A;  2TRX A;  2DJ0 A;  4IHU A;  4TR0 A;  5KN0 A;  2O7K A;  2XBI A;  1SU9 A;  5IM9 A;  2QC7 A;  4IGJ A;  1LBK A;  5CP1 A;  1YKC A;  2FWF A;  4WEY A;  4IBP A;  2P5R A;  2MMO A;  3CRT A;  3H79 A;  4POL A;  1WMJ A;  3O76 A;  4N11 A;  5G30 A;  2OE0 A;  5E59 A;  3LXZ A;  3TRP A;  2YWI A;  1FHE A;  2DBC A;  3UBL A;  4L0U A;  4TR1 B;  2LUS A;  3ZMK A;  1HYU A;  5DJM A;  3IK7 A;  3L78 A;  3UIW A;  4XRD A;  2VL2 A;  4ACS A;  5ECO B;  5D9X A;  4TXO B;  2KUC A;  1GH2 A;  1HNC A;  2QKE A;  3M9K A;  4ZL9 A;  3DML A;  4YAV A;  4FH8 A;  2IMK A;  5EPF A;  3ZL5 A;  4ZIJ A;  5DVB A;  1WJK A;  2YZH A;  2YWO A;  4V2N A;  2M72 A;  1GWC A;  2TRC P;  1O73 A;  4GTU A;  5FT3 A;  4I2T A;  4MJC A;  2R4V A;  3EMX A;  2DJ2 A;  4IP6 A;  2MMZ A;  4ZXG A;  4YH2 A;  5A5K A;  4WXT A;  3KIJ A;  3VWW A;  4H86 A;  4POB A;  4GRF A;  4O32 A;  3ZRD A;  1JZW A;  3HD5 A;  2LQQ A;  2YJH A;  4FYU A;  1Y6E A;  2H6Z A;  3O6T A;  4Q5R A;  4LL4 B;  4ZIL A;  5KN1 A;  4KUN A;  4HZ2 A;  4N0Z A;  2F8A A;  3HXS A;  1G6Y A;  3BCK A;  4CW9 A;  4OD7 A;  2FD3 A;  2VCX A;  1A2L A;  3HJO A;  1Z5Y E;  2B1K A;  4CDO A;  2C3N A;  1TU7 A;  4KX4 A;  2YWM A;  1WRY A;  5IPH A;  1TXX A;  4K9Z A;  1ERU A;  5G31 A;  5JCU A;  2LRC A;  1HNA A;  3C73 A;  2BTO T;  1QFN A;  1AAZ A;  4IS0 A;  4G2E A;  1MDI A;  4L0W A;  3FEU A;  5LNK e;  1BYE A;  3EVI A;  4J57 E;  4I6X A;  4BA7 A;  1X5C A;  3NZN A;  4OMV A;  3GH6 A;  1QXH A;  2LJA A;  5J41 A;  1GUH A;  3LGC A;  5KEJ A;  5ECI B;  3I6A A;  5HQP A;  4EDZ A;  5A4W A;  5HFK A;  5JWQ B;  5IO0 A;  2CZ2 A;  1OKT A;  1A2J A;  2FGX A;  4ZB6 A;  4MF6 A;  1GTI A;  3HJM A;  2IPA A;  1A24 A;  4PUR A;  2DIY A;  2ON7 A;  1FW1 A;  4RI6 A;  2C3T A;  2F3M A;  4XS4 A;  1Z7P A;  1OC3 A;  3W6G A;  1R26 A;  3HVS A;  5JWR B;  1W89 A;  1N8J A;  3PH9 A;  4K2D A;  3ZLP A;  1XFL A;  4TVE A;  2PVO C;  2DMM A;  4KW6 A;  1TRV A;  5ECH B;  4PNG A;  1XWG A;  5GZZ B;  1TRS A;  3P90 A;  3WT1 A;  2FWE A;  1BAY A;  2H19 A;  1E2Y A;  4IVF A;  4EC0 A;  1TDI A;  2LNS A;  2VL9 A;  3R2Q A;  3BJ5 A;  1PGT A;  3QAW A;  4HJ2 A;  3LOR A;  1RQM A;  2H0G A;  1JZR A;  1U6T A;  3FY7 A;  4KA0 A;  1K0D A;  1KTE A;  3ZTL A;  1IYH A;  4PQI A;  3PGT A;  1OC9 B;  4JR4 A;  2E2M A;  3CBU A;  4WBR D;  2HFD A;  2DLX A;  1ZYQ B;  1FVK A;  4POM A;  2FNO A;  3D4T A;  5ECR B;  3D5J A;  5HFI A;  1SK0 A;  2ZUP A;  4F03 A;  1VF3 A;  3DVX A;  1F2E A;  4KSM A;  2PPT A;  4JR6 A;  3HVX A;  4L5O A;  3TKS E;  4RI7 A;  1XW9 A;  2VD1 A;  1B4P A;  5DQY A;  3DWV A;  4K7I A;  1RK4 A;  4NHW A;  4OFT A;  3MSZ A;  2EIQ A;  2WRT A;  4ML6 A;  1GLQ A;  4BVX A;  3F8U A;  4GQC A;  4NMU A;  1PD2 1;  3DEX A;  1YEP A;  2X64 A;  1T00 A;  2FCH A;  2JAD A;  4Z7X A;  1EEJ A;  2AB6 A;  5G1L A;  2GLR A;  4EL1 A;  4ZB8 A;  3VK9 A;  4NHZ A;  2AJQ B;  2WZ9 A;  2IL3 A;  5AIX A;  2HI7 A;  4MZB A;  4IW9 A;  5ECK B;  2DJJ A;  3CSJ A;  5ECS A;  1PSQ A;  1MEK A;  5DBQ A;  4TOP A;  4X1U A;  1J0F A;  1S3A A;  4ML1 A;  3C7M A;  1WWJ A;  2LV3 A;  5IMF A;  1PX7 A;  2MMN A;  3ZVJ D;  3TUE A;  2GZY A;  5HR2 A;  1MD3 A;  3F6F A;  2AUV A;  2R5G A;  1NSW A;  2GSS A;  4E8E A;  2H0H A;  2MYG A;  5DAK B;  12GS A;  4RUV A;  2IFQ A;  4IP1 A;  1F37 A;  2D2Z A;  2YV7 A;  1ZCP A;  2C0G A;  3FZ5 A;  2XC2 A;  3WGD A;  3H1N A;  3KCM A;  3TJF A;  3FR9 A;  4EXJ A;  2BMX A;  3GSS A;  2FWG A;  1XWK A;  1M2B A;  4YAP A;  2CAQ A;  4XS1 A;  1SJI A;  4EF0 A;  3E9J B;  3KP8 A;  2NBS A;  4ZBD A;  1ZL9 A;  3DIE A;  3GFK A;  2LKU A;  2PVQ A;  4NPB A;  1M2D A;  3FZA A;  2FUG 2;  1C72 A;  3KP9 A;  4IKH A;  1DUG A;  2GZP A;  2XPD A;  4E8H A;  1WOU A;  2GT5 A;  3IXR A;  1EP7 A;  1TOF A;  1SKW B;  3A2X A;  5D96 A;  2F9S A;  1XBS A;  5IO2 A;  2ZNM A;  3L9S A;  2X8C A;  1TP9 A;  1R7H A;  5H5S A;  3JCM L;  6GSS A;  1GNE A;  1XW5 A;  1URM A;  3ERG A;  1THX A;  3RPP A;  3HDC A;  1PMT A;  2VUP A;  4I8B A;  1VF2 A;  2K8S A;  3GL5 A;  1Z6N A;  1PN9 A;  3M0F A;  4GCI A;  2WDU A;  2LEG A;  5HR3 A;  2C8U A;  5LCZ A;  3KM6 A;  1K0O A;  3ZZX A;  3UBK A;  4HI7 A;  3K8N A;  1UN2 A;  3ZML A;  5J9C A;  2IMD A;  3KJY A;  4DVC A;  2GQL A;  3F4R A;  2RUE A;  4XCS A;  6GST A;  3DVW A;  3GX8 A;  4QL7 A;  4N0V A;  2E0Q A;  2IJY A;  1UA5 A;  3SBC A;  5AN1 A;  4NXI A;  4K0N A;  2H6Y A;  4MK3 A;  3ZIV A;  3LFL A;  1XVW A;  4ILF A;  1GTB A;  4PQH A;  4BVY A;  4DSR A;  1R4W A;  2YP6 A;  5CAX A;  5ECM B;  2X8H A;  4TRX A;  2GS3 A;  2A4V A;  4GST A;  1XVQ A;  1O81 A;  4GLT A;  2HRN A;  3LSZ A;  4PUA A;  3VLN A;  4MF5 A;  3KGK A;  4MZC A;  4EE0 A;  2I1U A;  5B6N A;  1FB0 A;  11GS A;  5IIZ A;  5B7C A;  4ECI A;  4MJB A;  3A2W A;  4JZQ A;  3WGE A;  5D9W A;  2A2S A;  3G7J A;  3FYG A;  1SKS B;  1LU4 A;  2B7J A;  4V1A g;  3UAP A;  4GSS A;  3GV1 A;  3CMI A;  3IR4 A;  1YJ6 A;  2H1B A;  1DE1 A;  3GL3 A;  5AIS A;  3CSH A;  3GIX A;  3TJG A;  4MH2 A;  4POK A;  5C00 A;  5GAP D;  2JAC A;  5G1K A;  3TOU A;  2CAI A;  3APO A;  3FR3 A;  3WD6 A;  4G9H A;  2H73 A;  1O8X A;  1DE2 A;  1OAZ A;  3TKR A;  4O7H A;  2OBK A;  2LJR A;  4LA1 A;  1GSQ A;  2BJX A;  1S3D A;  2VCW A;  4OCF A;  22GS A;  3F3R A;  5IMV A;  3GYK A;  1XWA A;  2O85 A;  1M2A A;  4BWS A;  1TKD B;  3GKN A;  3ISO A;  3KXO A;  2KLX A;  4KSO A;  10GS A;  2RM6 A;  1EV9 A;  4KAE A;  4BPY A;  4GWR A;  4D73 B;  2A2R A;  3U6V A;  1H4O A;  3Q74 A;  1X5E A;  3V1W A;  4WF4 A;  2CT6 A;  1K0B A;  3IDV A;  3QAG A;  2VM2 A;  2IMI A;  1ERW A;  4TXO A;  1Z9H A;  2RLI A;  1K0M A;  1EZK A;  1OKD A;  1K3O A;  2VAF A;  3QFB C;  2C1Y A;  2O89 A;  1J08 A;  1TK8 B;  2WFC A;  2KOK A;  1A2M A;  2F8F A;  1V40 A;  3UAR A;  1QK8 A;  4KND A;  2NDO A;  3EUR A;  1CQG A;  1A8Y A;  19GS A;  1X9M B;  4GQF A;  4LMV A;  3E0U A;  2YJ7 A;  4XIH A;  5COH A;  3RHB A;  2VCT A;  3CYN A;  1ML6 A;  1FO5 A;  1FVJ A;  2HT9 A; 
#chains in the Genus database with same CATH topology
 3M8N A;  3HJP A;  3ED3 A;  2B1L A;  5AGY A;  5ELG A;  1GSY A;  1ZZY A;  2H1G A;  3UEM A;  4V2L A;  5JWO B;  2PUK C;  2LNT A;  4KDY A;  1WPI A;  3OR5 A;  4OCE A;  2VLU A;  2ON5 A;  5ID2 A;  1GSS A;  4MJA A;  3H8Q A;  3QOU A;  3FHK A;  1BX9 A;  2AHE A;  4AF2 A;  4ULX A;  3EU4 A;  4I2U A;  1FB6 A;  3VFI A;  1EV4 A;  4NAX A;  3APS A;  2IMF A;  1ON4 A;  1VF1 A;  3HZ8 A;  3FZ4 A;  1YQ1 A;  2OAC A;  3HYP A;  4QQ7 A;  2DJ3 A;  5IMZ A;  2C0F A;  1EP8 A;  4XS4 B;  1SL2 B;  3DRN A;  5INY A;  1TI3 A;  3QFA C;  2H0I A;  1TK5 B;  5EY6 A;  1B4Q A;  3F0I A;  3FW2 A;  2VCZ A;  5GAN D;  3TKS A;  1S3R A;  1NHO A;  3AY8 A;  2GTU A;  3DYR A;  1EOH A;  2QSI A;  1EOG A;  1V57 A;  1RW1 A;  4WBJ A;  5D9V A;  4V1A p;  2OJL A;  3D4M A;  3TCO A;  4KDX A;  1X9S B;  4XS6 A;  1VRS D;  1XIY A;  2PU9 C;  1SJZ A;  4ZL7 A;  4PUF C;  1TW9 A;  1ABA A;  3KMO A;  3EC3 A;  5EVO A;  1OC8 A;  3GKX A;  1SJ6 A;  4BL7 A;  1SKR B;  1IYI A;  1TI1 A;  3IC4 A;  2CX4 A;  2H70 A;  1A0F A;  2EIR A;  6GSW A;  3VUR A;  1GP1 A;  5D9T A;  4YQM A;  2XHF A;  3M3M A;  1VGL A;  3TDG A;  1T1V A;  4N30 A;  1SL0 B;  3FRC A;  3P8W A;  5F8B A;  3I69 A;  4FIW A;  5ENU A;  1A23 A;  3ZFL A;  4Q5F A;  4Q5N A;  2PMT A;  2OAD A;  3ZYW A;  3NOF A;  4LL1 B;  1I9D A;  3PIN A;  4TR4 A;  3LG6 A;  3A3T A;  1EGO A;  2GSQ A;  1GL8 A;  3D22 A;  3GTU B;  4K5S A;  2AV4 A;  4MH3 A;  4TXV A;  2CA8 A;  3DGQ A;  2XPE A;  2OE1 A;  4BIK A;  2FWH A;  5A4V A;  1M9B A;  3IHG A;  3SWL A;  3US3 A;  4O5R A;  3HKR A;  2JZR A;  4DSS A;  1O8W A;  5L71 A;  2V32 A;  2YN1 A;  2IME A;  1JLW A;  1U87 A;  1GSU A;  2CVD A;  4KDU A;  3CQF A;  3A2V A;  4ECC A;  2LTK A;  4KGI A;  5F07 A;  4EDY A;  2DC5 A;  2JZS A;  5D8I A;  2NTO A;  1AQW A;  1JZO A;  4Q5Q A;  3J7Y b;  1V2A A;  5AIV A;  3IAS 2;  4KE3 A;  2I9H A;  2WB9 A;  2K18 A;  1ZYE A;  3TKP A;  5G5F A;  3KTB A;  1J9B A;  1I5G A;  2MMA A;  4HUA A;  1EEM A;  4IJ3 A;  3QMX A;  4BWQ A;  3UL3 A;  2IFQ B;  3QR6 A;  2L4Q A;  2F51 A;  2O8V B;  1SK2 A;  13GS A;  2X8G A;  4OO5 A;  4NV2 A;  2YWN A;  4ISD A;  3P2A A;  5D93 A;  3QAV A;  3HZ4 A;  1JFU A;  1G6W A;  1A0R P;  3LXT A;  2E7P A;  2B5Y A;  4FO5 A;  1JZD A;  1GUM A;  2C3Q A;  3ZRE A;  1N2A A;  5HR1 A;  4KCE A;  4ZL8 A;  8GSS A;  2M46 A;  4HJM A;  2PGT A;  4G19 A;  5DAK A;  1YF1 A;  4LLR A;  2C0E A;  4F9Z A;  1O6J A;  2CQ9 A;  3HHV A;  1USB A;  3D6I A;  1XG8 A;  4RQX A;  2YNX A;  4MP4 A;  4TW5 A;  2TIR A;  1OE8 A;  4CHS A;  2RII A;  5JCG A;  3F4T A;  1X9W B;  1Q98 A;  1KNG A;  1DSB A;  3IBH A;  3D21 A;  5DQS A;  1THO A;  4F0C A;  4PNF A;  2I81 A;  2H75 A;  2DKH A;  2L5O A;  1YDK A;  2JZT A;  1BED A;  2GZZ A;  1KEB A;  1CQH A;  3ERF A;  4MLY A;  1M3J A;  2C4J A;  3KH7 A;  1VF4 A;  4JU5 A;  1O85 A;  2LST A;  1T8E B;  2GGT A;  4G0K A;  4PGT A;  4K7O A;  5ECN B;  5G5E A;  1XCC A;  5DAL B;  1E6B A;  1NM3 A;  1X0R A;  2LRN A;  3QPM A;  5J5N A;  3DD3 A;  2VL2 C;  1XOA A;  2NVL A;  1QQ2 A;  4I5Q A;  4KCA A;  1SL1 B;  3VI5 A;  2GVP A;  3TJB A;  4KF9 A;  1GSD A;  2R0C A;  1XWC A;  2V2G A;  2HXK A;  2QA1 A;  1TRU A;  3ERW A;  3C1R A;  4ZBA A;  3IK9 A;  2GQM A;  2L4C A;  1GUK A;  5B8B A;  5A4U A;  3P7X A;  1A8L A;  4EO3 A;  4PQ1 A;  2WCI A;  2FA4 A;  3GH9 A;  3L9V A;  3UMA A;  1Z3E A;  1OVN A;  4DSQ A;  4Z2U A;  4GF0 A;  5CRE A;  1ERV A;  2CZ3 A;  3J7Y k;  5J9B A;  2L6D A;  4X0X A;  3D0Z A;  2AAW A;  4RQR A;  5G2Z A;  3GA4 A;  2B5E A;  2VCQ A;  1GNW A;  2PBJ A;  2LS5 A;  3O3T A;  4EUY A;  5DCG A;  4HU7 A;  2DIZ A;  3VWU A;  4PTS A;  14GS A;  1QMV A;  3E3E A;  3KD0 A;  2L57 A;  1PN0 A;  1SD8 A;  5CO3 A;  1K0C A;  4WR4 A;  4MMM A;  5J3R A;  2H1A A;  3HVV A;  1T4Z A;  2PER A;  4F0B A;  3ZIT A;  1XWB A;  1HQO A;  3M9J A;  3W8J A;  2HSY A;  2ALB A;  2R6K A;  2I4A A;  3LYK A;  3TOT A;  1G0T A;  3VWV A;  1K0A A;  2MBS A;  1MD4 A;  7GSS A;  4MAB A;  1R5P A;  2GDR A;  2HZE A;  2CVB A;  4X43 A;  1Z7R A;  4LMW A;  4AGS A;  3RDW A;  3FZ9 A;  4FYB A;  3KMN A;  4L8E A;  3GST A;  2WJU A;  3IAM 2;  3HA9 A;  1NW2 A;  1ZGN A;  4FQU A;  2VIM A;  2HZF A;  4I97 A;  5IOX A;  1XZO A;  3A5W A;  3NIV A;  4AJ8 A;  3TKS C;  2A4H A;  1YEX A;  1U3A A;  2Z9S A;  4K5R A;  1GSF A;  3KH9 A;  2HE3 A;  3RHC A;  5DJL A;  4ID0 A;  2OA7 A;  4TR1 A;  4IQ1 A;  3F63 A;  1U88 A;  3LYP A;  5ELA A;  1UVZ A;  1T3B A;  4OFN A;  4ECB A;  2HYX A;  2WUL A;  1PX6 A;  5B8A A;  4KB3 A;  5FHI A;  4DEJ A;  1FOV A;  2VLV A;  5LD0 A;  1F9M A;  2FY6 A;  3VI7 A;  2GQK A;  3F4S A;  2OKA A;  1K3L A;  2H71 A;  2GT6 A;  1ZOF A;  3TB2 A;  2DSA A;  3GKM A;  3ME8 A;  3C1S A;  3Q6O A;  4D73 A;  1H75 A;  6GSV A;  2LJK A;  1M0U A;  3GX0 A;  3MIX A;  3RPN A;  2LQO A;  3LJR A;  1PRX A;  3VPQ A;  1F3A A;  2H66 A;  2YOI A;  3TGZ A;  3TRQ A;  1U3I A;  2B5X A;  4F82 A;  3M1G A;  3L0H A;  3F9U A;  1F3B A;  2RM5 A;  1GTA A;  3LW9 A;  3EIN A;  4HU9 A;  2ES7 A;  5ID2 B;  2EIO A;  3CRU A;  3VPT A;  2NPB A;  1YZX A;  4P3Y B;  1WP0 A;  4J56 E;  4IEL A;  2P31 A;  1B48 A;  2JSZ A;  5GSS A;  2JU5 A;  3UVT A;  5CRH A;  4AJ7 A;  2B3S A;  2HRF A;  2I3Y A;  2FHE A;  1AXD A;  1LJR A;  1FAA A;  4MA9 A;  2K6V A;  4PX1 A;  2CV4 A;  1KBN A;  1B9X C;  2FA8 A;  3ZFB A;  3BBY A;  3GUR A;  4OFM A;  5F05 A;  1WE0 A;  4L5L A;  1TK0 B;  1GUL A;  1V98 A;  4ECJ A;  1YKA A;  3QDN A;  3CSI A;  3W8S A;  5HR0 A;  2XBQ A;  3LEF A;  1SYR A;  5IOW A;  3L9U A;  1V58 A;  1O7U A;  3GMF A;  1GTU A;  2M80 A;  4O92 A;  4YKF A;  1BJX A;  1MTC A;  1M99 A;  4IN0 A;  3BCI A;  3G7Y A;  4TKY A;  2PN8 A;  4YKG A;  3ZIJ A;  2YZU A;  1HNB A;  4BL7 B;  4JE1 A;  1JHB A;  5CRG A;  3C8E A;  5D73 A;  2HSM A;  2IWT A;  4WET A;  3WGX A;  2IIY A;  2CX3 A;  4HQZ A;  2UZ8 A;  1MDK A;  3H93 A;  2WS2 A;  3PR8 A;  3DKS A;  5ABR A;  2H8L A;  1MDJ A;  4J2F A;  2ZCT A;  3EE2 A;  2DML A;  3IRA A;  4HS1 A;  1Q4J A;  2P0G A;  3TJJ A;  2MZC A;  1PKW A;  1SD9 A;  1GSE A;  4K7N A;  5ECP B;  1EGR A;  1WIK A;  2GSR A;  2HSH A;  2WGR A;  1M9A A;  4YQU A;  2AYT A;  2G0F A;  2R2J A;  5CYY A;  3IA1 A;  2LRT A;  3G9B A;  3KZQ A;  5IMD A;  1V9W A;  4HQS A;  3UOM A;  4TN8 A;  2J23 A;  2VLT A;  1AQX A;  1AUC A;  4IJI A;  2VD0 A;  3IHQ A;  4WF5 A;  1SYX A;  3QCP A;  1TRW A;  4DSS B;  4ZB9 A;  4BVX B;  4XHM A;  5IQY A;  1S3C A;  1FG4 A;  2JL4 A;  4MDC A;  3IE3 A;  3F3Q A;  5E4W A;  2L59 A;  5FWG A;  2QGV A;  1OC9 A;  2K9F A;  2PWJ A;  4MPF A;  2DJK A;  4K8M A;  4G10 A;  4FYC A;  2RUF A;  2C0D A;  4KH7 A;  2R3X A;  5CRD A;  2X49 A;  1K0N A;  1BQ7 A;  2N5A A;  1XW6 A;  3EYT A;  4PXO A;  2DJ1 A;  3GTU A;  1XXU A;  2H01 A;  3I9V 2;  2KP1 A;  1GRX A;  4JBB A;  1TU8 A;  3WYW A;  3H4K A;  3TKQ A;  1ZYN A;  4HEA 2;  1PA3 A;  5C04 A;  2V6O A;  1YF0 A;  4EKZ A;  5IMA A;  5KN3 A;  3APQ A;  5HFG A;  3IPZ A;  4F2I A;  4HZ4 A;  1NHY A;  1PL1 A;  3GHA A;  2H30 A;  3GRX A;  3RBT A;  2KHP A;  1SK1 A;  5BMU A;  1M7T A;  3U5R E;  2OE3 A;  3CTF A;  1K3Y A;  2YAN A;  1PFO A;  2IN3 A;  4MZW A;  3HY2 A;  1W4V A;  2JSY A;  5EL8 A;  3N9J A;  4MF7 A;  1AW9 A;  4V2M A;  3UJ1 A;  2CVK A;  4MCU A;  5F0G A;  2X99 A;  1GLP A;  3VWX A;  4ZBB A;  2L6C A;  3GUS A;  5DCH A;  3IV4 A;  17GS A;  3EWL A;  2HLS A;  1ST9 A;  3EU3 A;  3LQ7 A;  4IQA A;  2VL3 A;  2K8V A;  6GSX A;  5DDL A;  4TR3 A;  2REM A;  1R5A A;  2VM1 A;  3CXG A;  2KP2 A;  4EIP A;  1F6M C;  5JCW A;  1PQN A;  4MJE A;  2N5B A;  3G7I A;  3GNJ A;  1EWX A;  1QUW A;  3MDK A;  1OE7 A;  4JRR A;  6GSY A;  3CTG A;  2VO4 A;  4N10 A;  3FK8 A;  4X4J A;  1PL2 A;  2V41 A;  3HCZ A;  1PKZ A;  3GKK A;  4WR5 A;  3RAZ A;  2G2Q A;  4AJ6 A;  5J4U A;  1Z6M A;  2H76 A;  1AC1 A;  2GST A;  6GSU A;  5B6M A;  3BOA A;  5IPG A;  4EVM A;  2YV9 A;  4K6X A;  2R37 A;  2YPM A;  3MNG A;  1TTZ A;  1YY7 A;  5CNW A;  9GSS A;  3MAK A;  4MPG A;  3EMP A;  1UC7 A;  2V6K A;  3TJK A;  3GN3 A;  5H5Q A;  1Y25 A;  5ECQ B;  4NWY A;  2C80 A;  1ACV A;  3FKF A;  2H74 A;  2VCV A;  2YCD A;  2V1M A;  3WT2 A;  3F6D A;  1B9Y C;  2OBI A;  4GSN A;  1XOB A;  2FLS A;  1ERT A;  1AIU A;  2H1D A;  4K0G A;  5DAL A;  20GS A;  3ME7 A;  16GS A;  3DXB A;  4BVY B;  1XPV A;  2VOC A;  5CRW A;  4OWY A;  2H72 A;  3N5O A;  3C71 A;  3UVH A;  5H5R A;  4USS A;  4JED A;  4HDE A;  3ZVJ A;  1G7E A;  1G7O A;  1AQV A;  2E2G A;  1B8X A;  2B7K A;  3TRX A;  3LWA A;  2H6X A;  1BG5 A;  3Q18 A;  1TJD A;  3KEB A;  5IMC A;  1T4Y A;  2N5F A;  5ECL B;  1DBY A;  2L5L A;  3I43 A;  1T7P B;  3S9F A;  4K1F A;  3IOS A;  4MNN A;  1JLV A;  1HD2 A;  4QL9 A;  3MWH A;  3FR6 A;  4WKW A;  2P5Q A;  4YQV A;  1SEN A;  5KN2 A;  4NV5 A;  4HOJ A;  1OYJ A;  3L4N A;  5F06 A;  3KTL A;  1ZMA A;  3QD9 A;  4XTS A;  2HZE B;  1ILO A;  4OO4 A;  1FOH A;  1QGV A;  2B6M A;  2EC4 A;  1X5D A;  2X4A A;  18GS A;  2O87 A;  3BD2 A;  3Q19 A;  2MBT A;  2J9H A;  4GXZ A;  5GST A;  2HNL A;  4XRA A;  2TRX A;  2DJ0 A;  4IHU A;  4TR0 A;  5KN0 A;  2O7K A;  2XBI A;  1SU9 A;  5IM9 A;  2QC7 A;  4IGJ A;  1LBK A;  5CP1 A;  1YKC A;  2FWF A;  4WEY A;  4IBP A;  2P5R A;  2MMO A;  3CRT A;  3H79 A;  4POL A;  1WMJ A;  3O76 A;  4N11 A;  5G30 A;  2OE0 A;  5E59 A;  3LXZ A;  3TRP A;  2YWI A;  1FHE A;  2DBC A;  2HRK A;  3UBL A;  3R3E A;  4L0U A;  4TR1 B;  2LUS A;  3ZMK A;  1HYU A;  5DJM A;  3IK7 A;  3L78 A;  3UIW A;  4XRD A;  2VL2 A;  4ACS A;  5ECO B;  5D9X A;  4TXO B;  2KUC A;  1GH2 A;  1HNC A;  2QKE A;  3M9K A;  4ZL9 A;  3DML A;  4YAV A;  4FH8 A;  2IMK A;  5EPF A;  3ZL5 A;  4ZIJ A;  5DVB A;  1WJK A;  2YZH A;  2YWO A;  4V2N A;  2M72 A;  1GWC A;  2TRC P;  1O73 A;  4GTU A;  5FT3 A;  4I2T A;  4MJC A;  2R4V A;  3EMX A;  2DJ2 A;  4IP6 A;  2MMZ A;  4ZXG A;  4YH2 A;  5A5K A;  4WXT A;  3KIJ A;  3VWW A;  4O5Q A;  4H86 A;  4POB A;  4GRF A;  4O32 A;  3ZRD A;  1JZW A;  3HD5 A;  2LQQ A;  2YJH A;  4FYU A;  1Y6E A;  2H6Z A;  3O6T A;  4Q5R A;  4LL4 B;  4ZIL A;  5KN1 A;  4KUN A;  4HZ2 A;  4N0Z A;  2F8A A;  3HXS A;  1G6Y A;  3BCK A;  4CW9 A;  4OD7 A;  2FD3 A;  2VCX A;  3A5I A;  1A2L A;  3HJO A;  1Z5Y E;  2B1K A;  4CDO A;  2C3N A;  1TU7 A;  4KX4 A;  2YWM A;  1WRY A;  5IPH A;  1TXX A;  4K9Z A;  1ERU A;  5G31 A;  5JCU A;  2LRC A;  1HNA A;  3C73 A;  2BTO T;  1QFN A;  1AAZ A;  4IS0 A;  4G2E A;  1MDI A;  4L0W A;  3FEU A;  5LNK e;  1BYE A;  3EVI A;  4J57 E;  4I6X A;  4BA7 A;  1X5C A;  3NZN A;  4OMV A;  3GH6 A;  1QXH A;  2LJA A;  5J41 A;  1GUH A;  3LGC A;  5KEJ A;  5ECI B;  3I6A A;  5HQP A;  4EDZ A;  5A4W A;  5HFK A;  5JWQ B;  2HRA A;  5IO0 A;  2CZ2 A;  1OKT A;  5KOW A;  1A2J A;  2FGX A;  4ZB6 A;  4MF6 A;  1GTI A;  3FMW A;  3HJM A;  2IPA A;  1A24 A;  4PUR A;  2DIY A;  2ON7 A;  1FW1 A;  4RI6 A;  2C3T A;  2F3M A;  4XS4 A;  1Z7P A;  1OC3 A;  3EPT A;  3W6G A;  1R26 A;  3HVS A;  5BRT A;  5JWR B;  1W89 A;  1N8J A;  3PH9 A;  4K2D A;  3ZLP A;  1XFL A;  4TVE A;  2PVO C;  2DMM A;  4KW6 A;  1TRV A;  5ECH B;  4PNG A;  1XWG A;  5GZZ B;  1TRS A;  3P90 A;  3WT1 A;  2FWE A;  1BAY A;  2H19 A;  5KOX A;  1E2Y A;  4IVF A;  4EC0 A;  1TDI A;  2LNS A;  2VL9 A;  3R2Q A;  3BJ5 A;  1PGT A;  3QAW A;  4HJ2 A;  3LOR A;  1RQM A;  2H0G A;  1JZR A;  1U6T A;  3FY7 A;  4KA0 A;  1K0D A;  1KTE A;  3ZTL A;  1IYH A;  4A5P A;  4PQI A;  3PGT A;  1OC9 B;  4JR4 A;  2E2M A;  3CBU A;  4WBR D;  2HFD A;  2DLX A;  1ZYQ B;  1FVK A;  4POM A;  2FNO A;  3D4T A;  5ECR B;  3D5J A;  5HFI A;  1SK0 A;  2ZUP A;  4F03 A;  1VF3 A;  3DVX A;  1F2E A;  4KSM A;  2PPT A;  4JR6 A;  3HVX A;  4L5O A;  3TKS E;  4RI7 A;  1XW9 A;  2VD1 A;  1B4P A;  5DQY A;  3DWV A;  4K7I A;  1RK4 A;  4NHW A;  4OFT A;  3MSZ A;  2A2P A;  2EIQ A;  4O5U A;  2WRT A;  4ML6 A;  1GLQ A;  4BVX A;  3F8U A;  4GQC A;  4NMU A;  1PD2 1;  4ICY A;  3DEX A;  1YEP A;  2X64 A;  1T00 A;  2FCH A;  2JAD A;  4Z7X A;  1EEJ A;  2AB6 A;  5G1L A;  2GLR A;  4EL1 A;  4ZB8 A;  3VK9 A;  4NHZ A;  2AJQ B;  2WZ9 A;  2IL3 A;  5AIX A;  2HI7 A;  4MZB A;  4IW9 A;  5ECK B;  2DJJ A;  3CSJ A;  5ECS A;  1PSQ A;  1MEK A;  5DBQ A;  4TOP A;  4X1U A;  1J0F A;  1S3A A;  4ML1 A;  3PPU A;  3C7M A;  1WWJ A;  2LV3 A;  5IMF A;  1M3I A;  1PX7 A;  2MMN A;  3ZVJ D;  3TUE A;  2GZY A;  5HR2 A;  1MD3 A;  3F6F A;  2AUV A;  2R5G A;  2QA2 A;  1NSW A;  2GSS A;  2R0P A;  4K2X A;  4E8E A;  2H0H A;  2MYG A;  5DAK B;  12GS A;  4RUV A;  2IFQ A;  4IP1 A;  1F37 A;  2D2Z A;  2YV7 A;  1ZCP A;  2C0G A;  3FZ5 A;  2XC2 A;  3WGD A;  3H1N A;  3KCM A;  3TJF A;  3FR9 A;  4EXJ A;  2BMX A;  3GSS A;  2FWG A;  1XWK A;  1M2B A;  4YAP A;  2CAQ A;  4XS1 A;  4G0L A;  1SJI A;  2DKI A;  4EF0 A;  4HSC X;  3E9J B;  3KP8 A;  4EIQ A;  2R0G A;  2NBS A;  4ZBD A;  1ZL9 A;  3DIE A;  3GFK A;  4G0I A;  2LKU A;  2PVQ A;  4NPB A;  1M2D A;  3FZA A;  2FUG 2;  1C72 A;  3KP9 A;  4IKH A;  1DUG A;  2GZP A;  2XPD A;  4E8H A;  1WOU A;  2GT5 A;  3IXR A;  1EP7 A;  1TOF A;  1SKW B;  3A2X A;  5D96 A;  2F9S A;  1XBS A;  5IO2 A;  2ZNM A;  3L9S A;  2X8C A;  1TP9 A;  1R7H A;  5H5S A;  3JCM L;  6GSS A;  1GNE A;  1XW5 A;  1URM A;  3ERG A;  1THX A;  3RPP A;  3HDC A;  1PMT A;  2VUP A;  4I8B A;  1VF2 A;  2K8S A;  3GL5 A;  1Z6N A;  1PN9 A;  3M0F A;  4GCI A;  2WDU A;  2LEG A;  4CY6 A;  5HR3 A;  2C8U A;  5LCZ A;  3KM6 A;  1K0O A;  3ZZX A;  3UBK A;  4HI7 A;  3K8N A;  1UN2 A;  3ZML A;  5J9C A;  2IMD A;  3KJY A;  4CY8 A;  4DVC A;  2GQL A;  3F4R A;  2RUE A;  4XCS A;  6GST A;  3DVW A;  3GX8 A;  4QL7 A;  4N0V A;  2E0Q A;  2IJY A;  1UA5 A;  3SBC A;  5AN1 A;  4NXI A;  4K0N A;  2H6Y A;  4MK3 A;  3ZIV A;  3LFL A;  1XVW A;  4ILF A;  1GTB A;  4PQH A;  4BVY A;  4DSR A;  1R4W A;  2YP6 A;  5CAX A;  5ECM B;  2X8H A;  4TRX A;  2GS3 A;  2A4V A;  4GST A;  1XVQ A;  1O81 A;  4Z2T A;  4GLT A;  2HRN A;  3LSZ A;  4PUA A;  3VLN A;  4MF5 A;  3KGK A;  4MZC A;  4EE0 A;  4Z2R A;  2I1U A;  5B6N A;  1FB0 A;  11GS A;  5IIZ A;  5B7C A;  4ECI A;  4MJB A;  3A2W A;  4JZQ A;  3WGE A;  5D9W A;  2A2S A;  3G7J A;  3FYG A;  1SKS B;  1LU4 A;  2B7J A;  4V1A g;  3UAP A;  4GSS A;  3GV1 A;  3CMI A;  3IR4 A;  1YJ6 A;  1ZYP A;  2H1B A;  1DE1 A;  3GL3 A;  5AIS A;  3CSH A;  3GIX A;  3TJG A;  4MH2 A;  4POK A;  5C00 A;  5GAP D;  2JAC A;  5G1K A;  3TOU A;  2CAI A;  3APO A;  3FR3 A;  3WD6 A;  4G9H A;  2H73 A;  1O8X A;  1DE2 A;  1OAZ A;  3TKR A;  4O7H A;  2OBK A;  2LJR A;  4LA1 A;  1GSQ A;  2BJX A;  1S3D A;  2VCW A;  4OCF A;  22GS A;  3F3R A;  5IMV A;  3IC8 A;  3GYK A;  1XWA A;  2O85 A;  1M2A A;  4BWS A;  3MYD A;  1TKD B;  3GKN A;  3ISO A;  3KXO A;  2KLX A;  4KSO A;  10GS A;  2RM6 A;  1EV9 A;  4KAE A;  4BPY A;  4GWR A;  4D73 B;  2A2R A;  3U6V A;  1H4O A;  3Q74 A;  1X5E A;  3V1W A;  4WF4 A;  2CT6 A;  1K0B A;  3IDV A;  3QAG A;  2VM2 A;  2IMI A;  1ERW A;  4TXO A;  1Z9H A;  2RLI A;  1K0M A;  1EZK A;  1OKD A;  1K3O A;  2VAF A;  3QFB C;  2C1Y A;  2O89 A;  1J08 A;  1TK8 B;  2WFC A;  2KOK A;  1A2M A;  2F8F A;  1V40 A;  3UAR A;  1QK8 A;  4KND A;  2NDO A;  3EUR A;  1CQG A;  1A8Y A;  19GS A;  1X9M B;  4GQF A;  4LMV A;  3E0U A;  2YJ7 A;  4XIH A;  5COH A;  3HVN A;  3RHB A;  2VCT A;  3CYN A;  1ML6 A;  1FO5 A;  1FVJ A;  2HT9 A; 
#chains in the Genus database with same CATH homology
 3M8N A;  3HJP A;  3ED3 A;  2B1L A;  5AGY A;  5ELG A;  1GSY A;  1ZZY A;  2H1G A;  3UEM A;  4V2L A;  5JWO B;  2PUK C;  2LNT A;  4KDY A;  1WPI A;  3OR5 A;  4OCE A;  2VLU A;  2ON5 A;  5ID2 A;  1GSS A;  4MJA A;  3H8Q A;  3QOU A;  3FHK A;  1BX9 A;  2AHE A;  4AF2 A;  4ULX A;  3EU4 A;  4I2U A;  1FB6 A;  3VFI A;  1EV4 A;  4NAX A;  3APS A;  2IMF A;  1ON4 A;  1VF1 A;  3HZ8 A;  3FZ4 A;  1YQ1 A;  2OAC A;  3HYP A;  4QQ7 A;  2DJ3 A;  5IMZ A;  2C0F A;  1EP8 A;  4XS4 B;  1SL2 B;  3DRN A;  5INY A;  1TI3 A;  3QFA C;  2H0I A;  1TK5 B;  5EY6 A;  1B4Q A;  3F0I A;  3FW2 A;  2VCZ A;  5GAN D;  3TKS A;  1NHO A;  3AY8 A;  2GTU A;  3DYR A;  1EOH A;  2QSI A;  1EOG A;  1V57 A;  1RW1 A;  4WBJ A;  5D9V A;  4V1A p;  2OJL A;  3D4M A;  3TCO A;  4KDX A;  1X9S B;  4XS6 A;  1VRS D;  1XIY A;  2PU9 C;  1SJZ A;  4ZL7 A;  4PUF C;  1TW9 A;  1ABA A;  3KMO A;  3EC3 A;  5EVO A;  1OC8 A;  3GKX A;  1SJ6 A;  4BL7 A;  1SKR B;  1IYI A;  1TI1 A;  3IC4 A;  2CX4 A;  2H70 A;  1A0F A;  2EIR A;  6GSW A;  3VUR A;  1GP1 A;  5D9T A;  4YQM A;  2XHF A;  3M3M A;  1VGL A;  3TDG A;  1T1V A;  4N30 A;  1SL0 B;  3FRC A;  3P8W A;  5F8B A;  3I69 A;  4FIW A;  5ENU A;  1A23 A;  3ZFL A;  4Q5F A;  4Q5N A;  2PMT A;  2OAD A;  3ZYW A;  3NOF A;  4LL1 B;  1I9D A;  3PIN A;  4TR4 A;  3LG6 A;  3A3T A;  1EGO A;  2GSQ A;  1GL8 A;  3D22 A;  3GTU B;  4K5S A;  2AV4 A;  4MH3 A;  4TXV A;  2CA8 A;  3DGQ A;  2XPE A;  2OE1 A;  2FWH A;  5A4V A;  1M9B A;  3IHG A;  3SWL A;  3US3 A;  4O5R A;  3HKR A;  2JZR A;  4DSS A;  1O8W A;  5L71 A;  2V32 A;  2YN1 A;  2IME A;  1JLW A;  1U87 A;  1GSU A;  2CVD A;  4KDU A;  3A2V A;  4ECC A;  2LTK A;  4KGI A;  5F07 A;  4EDY A;  2DC5 A;  2JZS A;  5D8I A;  2NTO A;  1AQW A;  1JZO A;  4Q5Q A;  3J7Y b;  1V2A A;  5AIV A;  3IAS 2;  4KE3 A;  2I9H A;  2WB9 A;  2K18 A;  1ZYE A;  3TKP A;  5G5F A;  3KTB A;  1J9B A;  1I5G A;  2MMA A;  4HUA A;  1EEM A;  4IJ3 A;  3QMX A;  4BWQ A;  3UL3 A;  2IFQ B;  3QR6 A;  2L4Q A;  2F51 A;  2O8V B;  1SK2 A;  13GS A;  2X8G A;  4OO5 A;  4NV2 A;  2YWN A;  4ISD A;  3P2A A;  5D93 A;  3QAV A;  3HZ4 A;  1JFU A;  1G6W A;  1A0R P;  3LXT A;  2E7P A;  2B5Y A;  4FO5 A;  1JZD A;  1GUM A;  2C3Q A;  3ZRE A;  1N2A A;  5HR1 A;  4KCE A;  4ZL8 A;  8GSS A;  2M46 A;  4HJM A;  2PGT A;  4G19 A;  5DAK A;  1YF1 A;  4LLR A;  2C0E A;  4F9Z A;  1O6J A;  2CQ9 A;  3HHV A;  1USB A;  3D6I A;  4RQX A;  2YNX A;  4MP4 A;  4TW5 A;  2TIR A;  1OE8 A;  4CHS A;  2RII A;  5JCG A;  3F4T A;  1X9W B;  1Q98 A;  1KNG A;  1DSB A;  3IBH A;  3D21 A;  5DQS A;  1THO A;  4F0C A;  4PNF A;  2I81 A;  2H75 A;  2DKH A;  2L5O A;  1YDK A;  2JZT A;  1BED A;  2GZZ A;  1KEB A;  1CQH A;  3ERF A;  4MLY A;  2C4J A;  3KH7 A;  1VF4 A;  4JU5 A;  1O85 A;  2LST A;  1T8E B;  2GGT A;  4G0K A;  4PGT A;  4K7O A;  5ECN B;  5G5E A;  1XCC A;  5DAL B;  1E6B A;  1NM3 A;  1X0R A;  2LRN A;  3QPM A;  5J5N A;  3DD3 A;  2VL2 C;  1XOA A;  2NVL A;  1QQ2 A;  4I5Q A;  4KCA A;  1SL1 B;  3VI5 A;  2GVP A;  3TJB A;  4KF9 A;  1GSD A;  2R0C A;  1XWC A;  2V2G A;  2HXK A;  2QA1 A;  1TRU A;  3ERW A;  3C1R A;  4ZBA A;  3IK9 A;  2GQM A;  2L4C A;  1GUK A;  5B8B A;  5A4U A;  3P7X A;  1A8L A;  4EO3 A;  4PQ1 A;  2WCI A;  2FA4 A;  3GH9 A;  3L9V A;  3UMA A;  1Z3E A;  1OVN A;  4DSQ A;  4Z2U A;  4GF0 A;  5CRE A;  1ERV A;  2CZ3 A;  3J7Y k;  5J9B A;  2L6D A;  4X0X A;  3D0Z A;  2AAW A;  4RQR A;  5G2Z A;  3GA4 A;  2B5E A;  2VCQ A;  1GNW A;  2PBJ A;  2LS5 A;  3O3T A;  4EUY A;  5DCG A;  4HU7 A;  2DIZ A;  3VWU A;  4PTS A;  14GS A;  1QMV A;  3E3E A;  3KD0 A;  2L57 A;  1PN0 A;  1SD8 A;  5CO3 A;  1K0C A;  4WR4 A;  4MMM A;  5J3R A;  2H1A A;  3HVV A;  1T4Z A;  2PER A;  4F0B A;  3ZIT A;  1XWB A;  1HQO A;  3M9J A;  3W8J A;  2HSY A;  2ALB A;  2R6K A;  2I4A A;  3LYK A;  3TOT A;  1G0T A;  3VWV A;  1K0A A;  2MBS A;  1MD4 A;  7GSS A;  4MAB A;  1R5P A;  2GDR A;  2HZE A;  2CVB A;  4X43 A;  1Z7R A;  4LMW A;  4AGS A;  3RDW A;  3FZ9 A;  4FYB A;  3KMN A;  4L8E A;  3GST A;  2WJU A;  3IAM 2;  3HA9 A;  1NW2 A;  1ZGN A;  4FQU A;  2VIM A;  2HZF A;  4I97 A;  5IOX A;  1XZO A;  3A5W A;  3NIV A;  4AJ8 A;  3TKS C;  2A4H A;  1YEX A;  1U3A A;  2Z9S A;  4K5R A;  1GSF A;  3KH9 A;  2HE3 A;  3RHC A;  5DJL A;  4ID0 A;  2OA7 A;  4TR1 A;  4IQ1 A;  3F63 A;  1U88 A;  3LYP A;  5ELA A;  1UVZ A;  1T3B A;  4OFN A;  4ECB A;  2HYX A;  2WUL A;  1PX6 A;  5B8A A;  4KB3 A;  5FHI A;  4DEJ A;  1FOV A;  2VLV A;  5LD0 A;  1F9M A;  2FY6 A;  3VI7 A;  2GQK A;  3F4S A;  2OKA A;  1K3L A;  2H71 A;  2GT6 A;  1ZOF A;  3TB2 A;  2DSA A;  3GKM A;  3ME8 A;  3C1S A;  3Q6O A;  4D73 A;  1H75 A;  6GSV A;  2LJK A;  1M0U A;  3GX0 A;  3MIX A;  3RPN A;  2LQO A;  3LJR A;  1PRX A;  3VPQ A;  1F3A A;  2H66 A;  2YOI A;  3TGZ A;  3TRQ A;  1U3I A;  2B5X A;  4F82 A;  3M1G A;  3L0H A;  3F9U A;  1F3B A;  2RM5 A;  1GTA A;  3LW9 A;  3EIN A;  4HU9 A;  2ES7 A;  5ID2 B;  2EIO A;  3CRU A;  3VPT A;  2NPB A;  1YZX A;  4P3Y B;  1WP0 A;  4J56 E;  4IEL A;  2P31 A;  1B48 A;  2JSZ A;  5GSS A;  2JU5 A;  3UVT A;  5CRH A;  4AJ7 A;  2B3S A;  2HRF A;  2I3Y A;  2FHE A;  1AXD A;  1LJR A;  1FAA A;  4MA9 A;  2K6V A;  4PX1 A;  2CV4 A;  1KBN A;  1B9X C;  2FA8 A;  3ZFB A;  3BBY A;  3GUR A;  4OFM A;  5F05 A;  1WE0 A;  4L5L A;  1TK0 B;  1GUL A;  1V98 A;  4ECJ A;  1YKA A;  3QDN A;  3CSI A;  3W8S A;  5HR0 A;  2XBQ A;  3LEF A;  1SYR A;  5IOW A;  3L9U A;  1V58 A;  1O7U A;  3GMF A;  1GTU A;  2M80 A;  4O92 A;  4YKF A;  1BJX A;  1MTC A;  1M99 A;  4IN0 A;  3BCI A;  3G7Y A;  4TKY A;  2PN8 A;  4YKG A;  3ZIJ A;  2YZU A;  1HNB A;  4BL7 B;  4JE1 A;  1JHB A;  5CRG A;  3C8E A;  5D73 A;  2HSM A;  2IWT A;  4WET A;  3WGX A;  2IIY A;  2CX3 A;  4HQZ A;  2UZ8 A;  1MDK A;  3H93 A;  2WS2 A;  3PR8 A;  3DKS A;  5ABR A;  2H8L A;  1MDJ A;  4J2F A;  2ZCT A;  3EE2 A;  2DML A;  3IRA A;  4HS1 A;  1Q4J A;  2P0G A;  3TJJ A;  2MZC A;  1PKW A;  1SD9 A;  1GSE A;  4K7N A;  5ECP B;  1EGR A;  1WIK A;  2GSR A;  2HSH A;  2WGR A;  1M9A A;  4YQU A;  2AYT A;  2G0F A;  2R2J A;  5CYY A;  3IA1 A;  2LRT A;  3G9B A;  3KZQ A;  5IMD A;  1V9W A;  4HQS A;  3UOM A;  4TN8 A;  2J23 A;  2VLT A;  1AQX A;  1AUC A;  4IJI A;  2VD0 A;  3IHQ A;  4WF5 A;  1SYX A;  3QCP A;  1TRW A;  4DSS B;  4ZB9 A;  4BVX B;  4XHM A;  5IQY A;  1S3C A;  1FG4 A;  2JL4 A;  4MDC A;  3IE3 A;  3F3Q A;  5E4W A;  2L59 A;  5FWG A;  2QGV A;  1OC9 A;  2K9F A;  2PWJ A;  4MPF A;  2DJK A;  4K8M A;  4G10 A;  4FYC A;  2RUF A;  2C0D A;  4KH7 A;  2R3X A;  5CRD A;  2X49 A;  1K0N A;  1BQ7 A;  2N5A A;  1XW6 A;  3EYT A;  4PXO A;  2DJ1 A;  3GTU A;  1XXU A;  2H01 A;  3I9V 2;  2KP1 A;  1GRX A;  4JBB A;  1TU8 A;  3WYW A;  3H4K A;  3TKQ A;  1ZYN A;  4HEA 2;  1PA3 A;  5C04 A;  2V6O A;  1YF0 A;  4EKZ A;  5IMA A;  5KN3 A;  3APQ A;  5HFG A;  3IPZ A;  4F2I A;  4HZ4 A;  1NHY A;  1PL1 A;  3GHA A;  2H30 A;  3GRX A;  3RBT A;  2KHP A;  1SK1 A;  5BMU A;  1M7T A;  3U5R E;  2OE3 A;  3CTF A;  1K3Y A;  2YAN A;  2IN3 A;  4MZW A;  3HY2 A;  1W4V A;  2JSY A;  5EL8 A;  3N9J A;  4MF7 A;  1AW9 A;  4V2M A;  3UJ1 A;  2CVK A;  4MCU A;  5F0G A;  2X99 A;  1GLP A;  3VWX A;  4ZBB A;  2L6C A;  3GUS A;  5DCH A;  3IV4 A;  17GS A;  3EWL A;  2HLS A;  1ST9 A;  3EU3 A;  3LQ7 A;  4IQA A;  2VL3 A;  2K8V A;  6GSX A;  5DDL A;  4TR3 A;  2REM A;  1R5A A;  2VM1 A;  3CXG A;  2KP2 A;  4EIP A;  1F6M C;  5JCW A;  1PQN A;  4MJE A;  2N5B A;  3G7I A;  3GNJ A;  1EWX A;  1QUW A;  3MDK A;  1OE7 A;  4JRR A;  6GSY A;  3CTG A;  2VO4 A;  4N10 A;  3FK8 A;  4X4J A;  1PL2 A;  2V41 A;  3HCZ A;  1PKZ A;  3GKK A;  4WR5 A;  3RAZ A;  2G2Q A;  4AJ6 A;  5J4U A;  1Z6M A;  2H76 A;  1AC1 A;  2GST A;  6GSU A;  5B6M A;  3BOA A;  5IPG A;  4EVM A;  2YV9 A;  4K6X A;  2R37 A;  2YPM A;  3MNG A;  1TTZ A;  1YY7 A;  5CNW A;  9GSS A;  3MAK A;  4MPG A;  3EMP A;  1UC7 A;  2V6K A;  3TJK A;  3GN3 A;  5H5Q A;  1Y25 A;  5ECQ B;  4NWY A;  2C80 A;  1ACV A;  3FKF A;  2H74 A;  2VCV A;  2YCD A;  2V1M A;  3WT2 A;  3F6D A;  1B9Y C;  2OBI A;  4GSN A;  1XOB A;  2FLS A;  1ERT A;  1AIU A;  2H1D A;  4K0G A;  5DAL A;  20GS A;  3ME7 A;  16GS A;  3DXB A;  4BVY B;  1XPV A;  2VOC A;  5CRW A;  4OWY A;  2H72 A;  3N5O A;  3C71 A;  3UVH A;  5H5R A;  4USS A;  4JED A;  4HDE A;  3ZVJ A;  1G7E A;  1G7O A;  1AQV A;  2E2G A;  1B8X A;  2B7K A;  3TRX A;  3LWA A;  2H6X A;  1BG5 A;  3Q18 A;  1TJD A;  3KEB A;  5IMC A;  1T4Y A;  2N5F A;  5ECL B;  1DBY A;  2L5L A;  3I43 A;  1T7P B;  3S9F A;  4K1F A;  3IOS A;  4MNN A;  1JLV A;  1HD2 A;  4QL9 A;  3MWH A;  3FR6 A;  4WKW A;  2P5Q A;  4YQV A;  1SEN A;  5KN2 A;  4NV5 A;  4HOJ A;  1OYJ A;  3L4N A;  5F06 A;  3KTL A;  1ZMA A;  3QD9 A;  4XTS A;  2HZE B;  1ILO A;  4OO4 A;  1FOH A;  1QGV A;  2B6M A;  2EC4 A;  1X5D A;  2X4A A;  18GS A;  2O87 A;  3BD2 A;  3Q19 A;  2MBT A;  2J9H A;  4GXZ A;  5GST A;  2HNL A;  4XRA A;  2TRX A;  2DJ0 A;  4IHU A;  4TR0 A;  5KN0 A;  2O7K A;  2XBI A;  1SU9 A;  5IM9 A;  2QC7 A;  4IGJ A;  1LBK A;  5CP1 A;  1YKC A;  2FWF A;  4WEY A;  4IBP A;  2P5R A;  2MMO A;  3CRT A;  3H79 A;  4POL A;  1WMJ A;  3O76 A;  4N11 A;  5G30 A;  2OE0 A;  5E59 A;  3LXZ A;  3TRP A;  2YWI A;  1FHE A;  2DBC A;  2HRK A;  3UBL A;  3R3E A;  4L0U A;  4TR1 B;  2LUS A;  3ZMK A;  1HYU A;  5DJM A;  3IK7 A;  3L78 A;  3UIW A;  4XRD A;  2VL2 A;  4ACS A;  5ECO B;  5D9X A;  4TXO B;  2KUC A;  1GH2 A;  1HNC A;  2QKE A;  3M9K A;  4ZL9 A;  3DML A;  4YAV A;  4FH8 A;  2IMK A;  5EPF A;  3ZL5 A;  4ZIJ A;  5DVB A;  1WJK A;  2YZH A;  2YWO A;  4V2N A;  2M72 A;  1GWC A;  2TRC P;  1O73 A;  4GTU A;  5FT3 A;  4I2T A;  4MJC A;  2R4V A;  3EMX A;  2DJ2 A;  4IP6 A;  2MMZ A;  4ZXG A;  4YH2 A;  5A5K A;  4WXT A;  3KIJ A;  3VWW A;  4O5Q A;  4H86 A;  4POB A;  4GRF A;  4O32 A;  3ZRD A;  1JZW A;  3HD5 A;  2LQQ A;  2YJH A;  4FYU A;  1Y6E A;  2H6Z A;  3O6T A;  4Q5R A;  4LL4 B;  4ZIL A;  5KN1 A;  4KUN A;  4HZ2 A;  4N0Z A;  2F8A A;  3HXS A;  1G6Y A;  3BCK A;  4CW9 A;  4OD7 A;  2FD3 A;  2VCX A;  3A5I A;  1A2L A;  3HJO A;  1Z5Y E;  2B1K A;  4CDO A;  2C3N A;  1TU7 A;  4KX4 A;  2YWM A;  1WRY A;  5IPH A;  1TXX A;  4K9Z A;  1ERU A;  5G31 A;  5JCU A;  2LRC A;  1HNA A;  3C73 A;  2BTO T;  1QFN A;  1AAZ A;  4IS0 A;  4G2E A;  1MDI A;  4L0W A;  3FEU A;  5LNK e;  1BYE A;  3EVI A;  4J57 E;  4I6X A;  4BA7 A;  1X5C A;  3NZN A;  4OMV A;  3GH6 A;  1QXH A;  2LJA A;  5J41 A;  1GUH A;  3LGC A;  5KEJ A;  5ECI B;  3I6A A;  5HQP A;  4EDZ A;  5A4W A;  5HFK A;  5JWQ B;  2HRA A;  5IO0 A;  2CZ2 A;  1OKT A;  5KOW A;  1A2J A;  2FGX A;  4ZB6 A;  4MF6 A;  1GTI A;  3FMW A;  3HJM A;  2IPA A;  1A24 A;  4PUR A;  2DIY A;  2ON7 A;  1FW1 A;  4RI6 A;  2C3T A;  2F3M A;  4XS4 A;  1Z7P A;  1OC3 A;  3EPT A;  3W6G A;  1R26 A;  3HVS A;  5BRT A;  5JWR B;  1W89 A;  1N8J A;  3PH9 A;  4K2D A;  3ZLP A;  1XFL A;  4TVE A;  2PVO C;  2DMM A;  4KW6 A;  1TRV A;  5ECH B;  4PNG A;  1XWG A;  5GZZ B;  1TRS A;  3P90 A;  3WT1 A;  2FWE A;  1BAY A;  2H19 A;  5KOX A;  1E2Y A;  4IVF A;  4EC0 A;  1TDI A;  2LNS A;  2VL9 A;  3R2Q A;  3BJ5 A;  1PGT A;  3QAW A;  4HJ2 A;  3LOR A;  1RQM A;  2H0G A;  1JZR A;  1U6T A;  3FY7 A;  4KA0 A;  1K0D A;  1KTE A;  3ZTL A;  1IYH A;  4A5P A;  4PQI A;  3PGT A;  1OC9 B;  4JR4 A;  2E2M A;  3CBU A;  4WBR D;  2HFD A;  2DLX A;  1ZYQ B;  1FVK A;  4POM A;  2FNO A;  3D4T A;  5ECR B;  3D5J A;  5HFI A;  1SK0 A;  2ZUP A;  4F03 A;  1VF3 A;  3DVX A;  1F2E A;  4KSM A;  2PPT A;  4JR6 A;  3HVX A;  4L5O A;  3TKS E;  4RI7 A;  1XW9 A;  2VD1 A;  1B4P A;  5DQY A;  3DWV A;  4K7I A;  1RK4 A;  4NHW A;  4OFT A;  3MSZ A;  2A2P A;  2EIQ A;  4O5U A;  2WRT A;  4ML6 A;  1GLQ A;  4BVX A;  3F8U A;  4GQC A;  4NMU A;  1PD2 1;  4ICY A;  3DEX A;  1YEP A;  2X64 A;  1T00 A;  2FCH A;  2JAD A;  4Z7X A;  1EEJ A;  2AB6 A;  5G1L A;  2GLR A;  4EL1 A;  4ZB8 A;  3VK9 A;  4NHZ A;  2AJQ B;  2WZ9 A;  2IL3 A;  5AIX A;  2HI7 A;  4MZB A;  4IW9 A;  5ECK B;  2DJJ A;  3CSJ A;  5ECS A;  1PSQ A;  1MEK A;  5DBQ A;  4TOP A;  4X1U A;  1J0F A;  1S3A A;  4ML1 A;  3PPU A;  3C7M A;  1WWJ A;  2LV3 A;  5IMF A;  1PX7 A;  2MMN A;  3ZVJ D;  3TUE A;  2GZY A;  5HR2 A;  1MD3 A;  3F6F A;  2AUV A;  2R5G A;  2QA2 A;  1NSW A;  2GSS A;  2R0P A;  4K2X A;  4E8E A;  2H0H A;  2MYG A;  5DAK B;  12GS A;  4RUV A;  2IFQ A;  4IP1 A;  1F37 A;  2D2Z A;  2YV7 A;  1ZCP A;  2C0G A;  3FZ5 A;  2XC2 A;  3WGD A;  3H1N A;  3KCM A;  3TJF A;  3FR9 A;  4EXJ A;  2BMX A;  3GSS A;  2FWG A;  1XWK A;  1M2B A;  4YAP A;  2CAQ A;  4XS1 A;  4G0L A;  1SJI A;  2DKI A;  4EF0 A;  3E9J B;  3KP8 A;  4EIQ A;  2R0G A;  2NBS A;  4ZBD A;  1ZL9 A;  3DIE A;  3GFK A;  4G0I A;  2LKU A;  2PVQ A;  4NPB A;  1M2D A;  3FZA A;  2FUG 2;  1C72 A;  3KP9 A;  4IKH A;  1DUG A;  2GZP A;  2XPD A;  4E8H A;  1WOU A;  2GT5 A;  3IXR A;  1EP7 A;  1TOF A;  1SKW B;  3A2X A;  5D96 A;  2F9S A;  1XBS A;  5IO2 A;  2ZNM A;  3L9S A;  2X8C A;  1TP9 A;  1R7H A;  5H5S A;  3JCM L;  6GSS A;  1GNE A;  1XW5 A;  1URM A;  3ERG A;  1THX A;  3RPP A;  3HDC A;  1PMT A;  2VUP A;  4I8B A;  1VF2 A;  2K8S A;  3GL5 A;  1Z6N A;  1PN9 A;  3M0F A;  4GCI A;  2WDU A;  2LEG A;  4CY6 A;  5HR3 A;  2C8U A;  5LCZ A;  3KM6 A;  1K0O A;  3ZZX A;  3UBK A;  4HI7 A;  3K8N A;  1UN2 A;  3ZML A;  5J9C A;  2IMD A;  3KJY A;  4CY8 A;  4DVC A;  2GQL A;  3F4R A;  2RUE A;  4XCS A;  6GST A;  3DVW A;  3GX8 A;  4QL7 A;  4N0V A;  2E0Q A;  2IJY A;  1UA5 A;  3SBC A;  5AN1 A;  4NXI A;  4K0N A;  2H6Y A;  4MK3 A;  3ZIV A;  3LFL A;  1XVW A;  4ILF A;  1GTB A;  4PQH A;  4BVY A;  4DSR A;  1R4W A;  2YP6 A;  5CAX A;  5ECM B;  2X8H A;  4TRX A;  2GS3 A;  2A4V A;  4GST A;  1XVQ A;  1O81 A;  4Z2T A;  4GLT A;  2HRN A;  3LSZ A;  4PUA A;  3VLN A;  4MF5 A;  3KGK A;  4MZC A;  4EE0 A;  4Z2R A;  2I1U A;  5B6N A;  1FB0 A;  11GS A;  5IIZ A;  5B7C A;  4ECI A;  4MJB A;  3A2W A;  4JZQ A;  3WGE A;  5D9W A;  2A2S A;  3G7J A;  3FYG A;  1SKS B;  1LU4 A;  2B7J A;  4V1A g;  3UAP A;  4GSS A;  3GV1 A;  3CMI A;  3IR4 A;  1YJ6 A;  1ZYP A;  2H1B A;  1DE1 A;  3GL3 A;  5AIS A;  3CSH A;  3GIX A;  3TJG A;  4MH2 A;  4POK A;  5C00 A;  5GAP D;  2JAC A;  5G1K A;  3TOU A;  2CAI A;  3APO A;  3FR3 A;  3WD6 A;  4G9H A;  2H73 A;  1O8X A;  1DE2 A;  1OAZ A;  3TKR A;  4O7H A;  2OBK A;  2LJR A;  4LA1 A;  1GSQ A;  2BJX A;  1S3D A;  2VCW A;  4OCF A;  22GS A;  3F3R A;  5IMV A;  3IC8 A;  3GYK A;  1XWA A;  2O85 A;  1M2A A;  4BWS A;  3MYD A;  1TKD B;  3GKN A;  3ISO A;  3KXO A;  2KLX A;  4KSO A;  10GS A;  2RM6 A;  1EV9 A;  4KAE A;  4BPY A;  4GWR A;  4D73 B;  2A2R A;  3U6V A;  1H4O A;  3Q74 A;  1X5E A;  3V1W A;  4WF4 A;  2CT6 A;  1K0B A;  3IDV A;  3QAG A;  2VM2 A;  2IMI A;  1ERW A;  4TXO A;  1Z9H A;  2RLI A;  1K0M A;  1EZK A;  1OKD A;  1K3O A;  2VAF A;  3QFB C;  2C1Y A;  2O89 A;  1J08 A;  1TK8 B;  2WFC A;  2KOK A;  1A2M A;  2F8F A;  1V40 A;  3UAR A;  1QK8 A;  4KND A;  2NDO A;  3EUR A;  1CQG A;  1A8Y A;  19GS A;  1X9M B;  4GQF A;  4LMV A;  3E0U A;  2YJ7 A;  4XIH A;  5COH A;  3RHB A;  2VCT A;  3CYN A;  1ML6 A;  1FO5 A;  1FVJ A;  2HT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...