5G30A

Crystallographic structure of mutant d60s of thioredoxin from litopenaeus vannamei
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
105
structure length
105
Chain Sequence
MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVSECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN
publication title Is dimerization a common feature in thioredoxins? The case of thioredoxin from Litopenaeus vannamei.
pubmed doi rcsb
source organism Litopenaeus vannamei
total genus 32
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g30A00
3H4KA 2CT6A 5IMCA 4K7IA 2R2JA 2YANA 4AF2A 1AXDA 1O8WA 4TR3A 1EEMA 1M2AA 3QFBC 4POLA 3GX0A 3IOSA 1SK0A 1A8LA 1QUWA 1M2DA 2C0EA 4HDEA 2EC4A 3CXGA 4PNGA 2VD1A 2VL9A 1WOUA 3TJFA 3IHQA 1EWXA 2CVKA 3KM6A 5B8BA 3IPZA 5DBQA 2VCQA 2CAQA 4RQXA 3KTBA 4XCSA 4GSSA 4X1UA 2ALBA 4KNDA 5CP1A 2L59A 3LYPA 5ABRA 2QC7A 3ZMKA 1J08A 4I2UA 2H70A 1Z7PA 3IV4A 2IL3A 2JU5A 4ILFA 3QCPA 1USBA 3TKRA 1JZWA 2JACA 2YV9A 4HEA2 1MTCA 3L0HA 3BOAA 2MZCA 2FD3A 5CYYA 2A4VA 1AW9A 5ECRB 3QPMA 4YQUA 2GS3A 1BG5A 1F9MA 4X43A 1OE8A 2AAWA 3D0ZA 3GSTA 4Q5FA 4ML6A 2VAFA 1KBNA 1OAZA 5JWRB 3GSSA 5J9CA 1TU8A 5E4WA 2G0FA 5H5SA 3APSA 4KSMA 3C1SA 4EXJA 4F82A 1DE2A 1YKAA 2CV4A 5E59A 1X9WB 3N5OA 1GULA 2ZUPA 2LS5A 4HOJA 3UVHA 3UOMA 2WDUA 2C8UA 4XIHA 3F9UA 1K0CA 2RUFA 4EO3A 3GYKA 4WETA 5AGYA 1EV4A 4KA0A 3MDKA 2H6YA 1PMTA 3LXZA 3QMXA 2DIZA 4TRXA 1O6JA 3D4MA 4JR4A 2GSQA 2L5LA 3D5JA 2H73A 1GUKA 1SKWB 3QAVA 1OVNA 4WKWA 4MPFA 4V2LA 2GLRA 1T4YA 4PXOA 1K0DA 1GUMA 1N2AA 3GUSA 3UBKA 1TDIA 1G6WA 2OE3A 2XC2A 1E2YA 5CRHA 2WULA 1OE7A 5CO3A 3TB2A 1K3YA 3KXOA 2FWFA 1Y6EA 4IQ1A 3FHKA 2BTOT 2OE1A 1EOGA 3VI7A 1AQVA 2H1DA 5HFIA 2AV4A 2OBKA 3IBHA 2PWJA 1BQ7A 3BCKA 5H5RA 2MMOA 5HR3A 2B1KA 3HXSA 2VOCA 1F3BA 3TJBA 4MZBA 4O5RA 2H0IA 20GSA 3F3RA 4PUFC 2O89A 4WF4A 4K0NA 3SBCA 4GRFA 4TR1A 3EU3A 3U6VA 4TN8A 4EUYA 2RLIA 1FVKA 1J9BA 2NDOA 2CA8A 3BBYA 1HNAA 5CRGA 3M3MA 4AGSA 1SD9A 2L4QA 5DALA 4ECJA 1R7HA 2R6KA 1OC8A 1VF2A 2WFCA 4MF5A 4JBBA 3DVXA 4PQHA 4TXOA 2CZ3A 4MH3A 3FW2A 1TI3A 1X5DA 2GT6A 1O85A 5HR1A 1I5GA 2WJUA 2L57A 1B8XA 1EGRA 3E9JB 2C0FA 4CDOA 3MAKA 3F6DA 5INYA 1MD3A 3DGQA 3TRQA 1WRYA 3ISOA 4HU7A 4FYBA 3TRPA 2PN8A 1YY7A 2YWNA 2HRFA 3D22A 2K8SA 5HR0A 3TKSE 5DCHA 2VLTA 5COHA 3QAWA 5KN0A 1V57A 2HZFA 2X8CA 3RPNA 5IM9A 1X5EA 4NPBA 2OADA 4KX4A 1GSDA 3FZ5A 1K0BA 2R37A 1J0FA 1AAZA 4KGIA 3LXTA 3MWHA 4AJ7A 5A4WA 3LSZA 2I3YA 1ZCPA 3Q74A 2NVLA 4QL7A 5CREA 2GZPA 4XS1A 3EINA 2GDRA 3FEUA 3GRXA 1TRVA 3L9VA 2VCXA 2IJYA 3ZL5A 2OBIA 3VLNA 1TTZA 2H1BA 3FZAA 1BAYA 3ZYWA 1B9YC 4G9HA 1RQMA 3F0IA 2WZ9A 1LBKA 5IMDA 5IQYA 3EYTA 1T3BA 2VL2A 4V2MA 2E7PA 4K9ZA 3WT2A 3M9KA 4I8BA 4G19A 1U3AA 2V32A 2L6DA 2B3SA 2PMTA 3CTFA 1JZOA 3DD3A 1H4OA 2FWEA 2GSSA 1RK4A 3ZITA 3KH7A 5F06A 2HE3A 4IP1A 3QFAC 1GNEA 2V2GA 1R5PA 1ZMAA 4OFTA 2E0QA 4PUAA 5IMFA 3P2AA 4RQRA 1V40A 1SD8A 3LGCA 2R3XA 1SL0B 3F4RA 4DEJA 2PPTA 4O92A 2LKUA 2REMA 1GSUA 3WYWA 1WE0A 1PL1A 3VWXA 2FA4A 2VIMA 1T00A 3UARA 1OC9A 2GQLA 3PGTA 3KH9A 4YAVA 2WRTA 3IXRA 17GSA 2JL4A 4Q5NA 5D9VA 4HZ4A 2PGTA 3NIVA 2B1LA 4NV2A 3QD9A 5A4UA 2IFQA 4ID0A 5JCUA 2B7JA 1WWJA 1AQXA 2BJXA 2GSRA 1VF3A 4IN0A 5DDLA 5B8AA 3C7MA 2XPDA 2I1UA 3O3TA 1YDKA 2DJJA 4QQ7A 1QXHA 2HSHA 2J23A 1GTUA 1KNGA 4OMVA 3GKKA 3ZFBA 2CAIA 5IOXA 3V1WA 3EMPA 2AYTA 2CVBA 5C04A 2QGVA 5GZZB 1U87A 3LYKA 5C00A 5LNKe 2JSZA 2YWIA 4NXIA 2FY6A 2K9FA 4MH2A 3WGDA 3PINA 22GSA 3A3TA 5IO2A 2HNLA 1PX7A 3ZRDA 3US3A 3GN3A 1XFLA 3EMXA 2LSTA 3CMIA 1NHOA 4MA9A 3FYGA 4ZB6A 2M80A 4HJ2A 4OCFA 4POBA 1JZRA 5GSSA 1THOA 4FO5A 2A2RA 3I43A 1K3OA 3KP9A 5B6MA 2IPAA 1MD4A 5HQPA 3DVWA 1XW5A 14GSA 5KN3A 3P7XA 1FOVA 3P8WA 1O7UA 4RI6A 3WGEA 2AHEA 2G2QA 4CHSA 2H71A 1NW2A 2CQ9A 3HY2A 3GH9A 3HDCA 2LQQA 3M0FA 2IFQB 2A2SA 5J5NA 2K18A 4OWYA 4JZQA 5GAPD 1M9BA 3AY8A 3UMAA 2D2ZA 3UVTA 5CRDA 4N10A 4XHMA 1TRWA 2LQOA 2ZCTA 4YH2A 3G7YA 3LG6A 1WP0A 2ON5A 1UC7A 3GL3A 4PQIA 1XXUA 2H74A 3GKMA 4F9ZA 5J3RA 2C3NA 5D96A 3UIWA 3H1NA 2HZEA 4GTUA 1M7TA 2DIYA 1K3LA 4YQVA 1FW1A 4XRDA 1DE1A 1B4QA 5ECSA 3M9JA 5ELAA 3VI5A 3HKRA 3LEFA 3TOTA 4GSTA 3VPQA 4DVCA 4OCEA 4IS0A 1O81A 3A2VA 1GSFA 2H1AA 1YZXA 4BVXA 2XBIA 1PA3A 4NHZA 2IMIA 2P5QA 2RM6A 4K8MA 1A24A 2TIRA 4HU9A 2OE0A 3D21A 1QK8A 3CSHA 3ME8A 6GSVA 1OYJA 5CRWA 4HZ2A 1HNCA 5IMVA 4L5OA 4RI7A 2NTOA 2LUSA 5JWQB 2I81A 3H79A 3CTGA 5G5EA 1TK5B 2KP1A 1XZOA 2X8GA 5EY6A 3ZFLA 3TJJA 1SKRB 4OFMA 2P0GA 2VCTA 3TUEA 6GSTA 3RPPA 4OD7A 3TRXA 3C8EA 1Z7RA 2YNXA 4MF7A 5ID2A 2MYGA 1TK0B 2IMFA 2E2MA 4N0VA 4EL1A 1QFNA 3CRUA 1TKDB 1ZL9A 2HYXA 3HHVA 4XS4A 4BL7A 2CX3A 1GNWA 3VPTA 1YF0A 4V2NA 1KTEA 2KLXA 4PGTA 4ZBBA 5F8BA 4GF0A 4L0UA 1A2MA 3GTUA 3O6TA 3FKFA 4I6XA 4DSSA 4KSOA 4BWSA 4WR5A 3HD5A 3ZZXA 3ZVJA 2V6OA 1DBYA 3A5WA 3Q6OA 2YJHA 3D6IA 2WS2A 1XWCA 5DJMA 3L78A 5DAKA 4HS1A 4ULXA 2TRXA 2C4JA 2GZYA 2P5RA 3QOUA 4TXVA 2YV7A 2I4AA 1M99A 4TW5A 5D73A 5L71A 3TJGA 4ZL9A 4NAXA 5D93A 3KEBA 4GXZA 1B48A 2FUG2 4YAPA 3NZNA 1S3AA 4O7HA 4DSQA 3CSJA 1K0NA 4F2IA 1ERVA 1XOAA 3EC3A 3IDVA 3DIEA 1EP8A 3GH6A 4BWQA 4MCUA 2YJ7A 1U6TA 2LEGA 2LJKA 2FHEA 2IMKA 3GA4A 2EIQA 3IAS2 3QAGA 4O32A 3M1GA 1UN2A 1V2AA 3A2XA 4GLTA 5ECIB 4IVFA 4XS4B 2YPMA 2VUPA 3P90A 4IKHA 3KP8A 4MPGA 2PERA 3GTUB 2DBCA 1BYEA 2YCDA 4K2DA 5B6NA 4JE1A 4TR4A 4ML1A 3F4TA 2F51A 3GHAA 1YEXA 5EVOA 3QR6A 3APOA 2L4CA 1X0RA 2MBTA 2J9HA 3HA9A 1NSWA 2H8LA 1TOFA 1ILOA 2AUVA 4POMA 1EZKA 1WIKA 5DAKB 4HJMA 3CYNA 8GSSA 4HQZA 3GX8A 4ZILA 1XIYA 3O76A 3DYRA 4ISDA 1ON4A 2YWMA 4F03A 1JLWA 4TR1B 4YQMA 4WEYA 3HVSA 1FO5A 3VWUA 5J4UA 5D9WA 3RHCA 2V1MA 3GNJA 4E8EA 4D73A 5DALB 3TKSA 4MF6A 2CZ2A 4FYCA 1O73A 4IJIA 2JZSA 2XPEA 1XOBA 4LA1A 4LMVA 4IJ3A 5CAXA 4TXOB 1ERTA 1XVWA 3ZMLA 9GSSA 5F07A 2H01A 3E0UA 1XWKA 2NBSA 3CRTA 3F8UA 1M0UA 13GSA 2PBJA 1WJKA 1OKTA 19GSA 4MJAA 5IMAA 5IMZA 4IQAA 2F3MA 1TI1A 5ECLB 5J9BA 3PR8A 1V98A 2CX4A 5G30A 2IN3A 4EC0A 2O87A 3KMNA 1TP9A 3KGKA 4WBRD 2PVQA 2C1YA 5J41A 6GSWA 4N0ZA 4IP6A 4MJEA 3FK8A 4FH8A 1R4WA 1S3CA 1N8JA 3SWLA 5AN1A 1MDIA 1SK2A 1EGOA 3IC4A 2OKAA 3KIJA 4OO5A 2LRTA 1R26A 3R2QA 1URMA 2ON7A 2GT5A 3ME7A 4I2TA 3TJKA 1I9DA 3GKXA 2EIRA 1OC3A 3CSIA 1A0RP 5HFKA 2B5YA 4GWRA 1PL2A 1VRSD 2M46A 3QDNA 5D8IA 3ERFA 2B6MA 1ML6A 1VGLA 3IRAA 2MBSA 3IAM2 1AUCA 4J57E 3HJMA 4I97A 1FB0A 4G10A 5A5KA 1PKWA 1LU4A 1QGVA 2BMXA 1ERUA 1AIUA 4EDYA 2DMMA 4MMMA 3G9BA 1TJDA 3I9V2 1A8YA 4L8EA 5DJLA 6GSSA 4F0CA 2VCVA 2VLUA 1T4ZA 3VK9A 4JEDA 2FWGA 2FCHA 4OFNA 3DRNA 2DSAA 1ZYQB 2H0GA 1U3IA 1O8XA 1SJIA 5DCGA 1ZGNA 1ZOFA 2HI7A 4N30A 3ERWA 5AIXA 3HZ4A 3WT1A 3VURA 4TOPA 2C3TA 3E3EA 2EIOA 4WBJA 2JADA 2ES7A 4MLYA 1IYHA 2N5AA 1PX6A 1XPVA 3F6FA 3FR3A 3ZIJA 2QKEA 4NHWA 3FR9A 3HJOA 1U88A 2V6KA 1XW6A 1SKSB 2DJ0A 4Q5RA 2H76A 1JHBA 2VM1A 3ZLPA 1OC9B 2H1GA 1GWCA 3LQ7A 1MEKA 5D9XA 3FY7A 2DJ2A 3RAZA 1OKDA 2RUEA 2GSTA 4JRRA 5ENUA 3D4TA 4IBPA 4BA7A 3S9FA 1IYIA 1Z9HA 1G7OA 2E2GA 1PKZA 2M72A 1W4VA 1GTAA 1GP1A 3KTLA 1BEDA 2RM5A 5A4VA 1SJ6A 4AJ6A 3C1RA 1E6BA 3K8NA 4PNFA 1YF1A 5F0GA 4ECCA 4ZB9A 2LV3A 3LWAA 3PH9A 1GTBA 1WPIA 2F9SA 4TKYA 3UAPA 1XCCA 2VO4A 2V41A 1SYRA 2YOIA 3GMFA 3TOUA 4ZL7A 1SL2B 3IE3A 3BCIA 3DXBA 4LL1B 1A0FA 2H0HA 1LJRA 2MMAA 4GQFA 5ECHB 1B9XC 1SYXA 1ABAA 2XBQA 3HYPA 2H6ZA 2YWOA 3GFKA 2C0DA 3GURA 4KDYA 2H6XA 1X9SB 1ST9A 1EEJA 4PQ1A 2B5XA 5KN2A 1GLPA 3FRCA 1B4PA 4LL4B 4MJCA 3GKNA 4KDUA 2Z9SA 1YEPA 5G1LA 6GSYA 1SU9A 1GSYA 2IWTA 2MMNA 5EPFA 3TKSC 4ECIA 4WF5A 2AB6A 3HZ8A 3J7Yk 2IIYA 1CQGA 3UL3A 1H75A 4HUAA 1A2LA 1TRSA 1UA5A 1NHYA 1SENA 4K7NA 2OJLA 3GL5A 2VL2C 1T1VA 1GH2A 1M2BA 2JZRA 1G6YA 2O85A 2C3QA 4KE3A 1Q4JA 4GQCA 2WB9A 5ECNB 2CVDA 2LJAA 1FG4A 1MDJA 1GSQA 4J56E 12GSA 4ZXGA 3UJ1A 3C73A 2GGTA 3IR4A 2KP2A 2VCWA 4MZCA 1GUHA 1SJZA 5B7CA 4HQSA 2HZEB 4ZBDA 5LCZA 5FT3A 4MJBA 3TKPA 3RDWA 4MABA 2MMZA 1BX9A 2FA8A 1EP7A 1T8EB 4MDCA 4FIWA 4HI7A 4V1Ag 5DVBA 11GSA 4XS6A 3J7Yb 1Q98A 3OR5A 4KH7A 4H86A 4IELA 1CQHA 1M9AA 3EE2A 2AJQB 2YZUA 5G1KA 2P31A 5HFGA 2F8FA 3RBTA 1X5CA 2DJ1A 1TRUA 2C0GA 2WCIA 3KMOA 4G2EA 3EU4A 2K8VA 1K0MA 2O7KA 2PU9C 1HNBA 3F4SA 4OO4A 5ECMB 3F63A 2FNOA 4EE0A 4ZL8A 1EV9A 4ZB8A 1SK1A 5F05A 1S3DA 1Y25A 3TKQA 3I6AA 3I69A 4J2FA 2GQMA 3VFIA 5JCWA 1FAAA 5ECQB 4CW9A 1EOHA 1FB6A 1F3AA 1TXXA 1X9MB 2B7KA 3DWVA 1MDKA 2DLXA 1UVZA 4JU5A 5KN1A 5ID2B 1PQNA 4EF0A 1DUGA 2HXKA 5GAND 1PRXA 4K7OA 1ACVA 2NPBA 3GIXA 3JCML 5IPHA 4MZWA 3TCOA 1F37A 4NV5A 5AISA 1GTIA 5G5FA 1YJ6A 1PN9A 4N11A 1TK8B 2DMLA 2H30A 1YKCA 5IOWA 2KOKA 1SL1B 2JSYA 2GVPA 4X0XA 4DSSB 5G31A 4IHUA 3L9SA 1K0AA 4XTSA 2VD0A 2LRCA 5H5QA 3U5RE 1R5AA 3VWVA 2FGXA 5FHIA 2HFDA 2VLVA 3BD2A 2H72A 5DQSA 1GLQA 2IMDA 3L4NA 2DC5A 1V9WA 4DSRA 4F0BA 5AIVA 1BJXA 5JCGA 1TU7A 4P3YB 5ECPB 1WMJA 2K6VA 3LJRA 3W6GA 2LRNA 10GSA 3HJPA 1XW9A 2FLSA 4JR6A 4FYUA 4IW9A 1TW9A 1PD21 3HVVA 4ZIJA 1JFUA 4XRAA 3LORA 2L5OA 2KHPA 5IIZA 1FVJA 1JLVA 4KW6A 4KUNA 1A23A 1RW1A 4MK3A 5GSTA 3WGXA 5JWOB 3FZ4A 4IGJA 3DMLA 2N5FA 1XBSA 5LD0A 6GSUA 2DJKA 3H8QA 4EDZA 1KEBA 2L6CA 4ECBA 1THXA 2OACA 1QMVA 3ZTLA 3A2WA 4K0GA 16GSA 1Z3EA 2F8AA 4NMUA 2H75A 1G0TA 4KCEA 1T7PB 4AJ8A 5EL8A 5HR2A 4K1FA 4WXTA 2N5BA 3FZ9A 2IMEA 3DKSA 3IK7A 5KEJA 1AQWA 5D9TA 3HVXA 2C80A 3CBUA 1GRXA 2HSYA 2R4VA 3KJYA 3F3QA 4KDXA 3ED3A 2QSIA 1PGTA 4L0WA 2PUKC 3ZIVA 1XWAA 2LJRA 3MSZA 4Z7XA 2X8HA 2LNSA 4KAEA 1F6MC 3GV1A 2VL3A 2VM2A 3BJ5A 1K0OA 3ZREA 1XWBA 2FWHA 5ELGA 3Q18A 2R5GA 1NM3A 3WD6A 4KB3A 4PURA 2YN1A 4LLRA 4BVYA 4D73B 1Z6NA 1ZYEA 2B5EA 2X64A 3HCZA 1ZZYA 4PX1A 2I9HA 3IK9A 4KCAA 3C71A 3ZVJD 4RUVA 5DQYA 1Z6MA 1GSEA 1HYUA 4ACSA 4EKZA 2YZHA 4BPYA 3H93A 4WR4A 2HT9A 1ERWA 2GZZA 4QL9A 4V1Ap 2OA7A 3UBLA 2DJ3A 3M8NA 3UEMA 2O8VB 4GSNA 5CNWA 1W89A 2GTUA 3G7JA 4GCIA 2XHFA 1AC1A 1QQ2A 2HRNA 4NWYA 4K6XA 4E8HA 5IO0A 3KZQA 1C72A 4TVEA 2X99A 2H66A 3TDGA 1JZDA 5ECOB 4MP4A 4TR0A 4L5LA 3MNGA 3KD0A 1GL8A 1VF4A 3EWLA 3RHBA 5ECKB 3W8JA 3L9UA 3IA1A 2H19A 3EVIA 3KCMA 2KUCA 6GSXA 1VF1A 2LNTA 2YP6A 3FR6A 3ERGA 1GSSA 1A2JA 3DEXA 4POKA 3Q19A 5G2ZA 1V58A 1DSBA 5IPGA 4ZBAA 1XVQA 1HD2A 4Q5QA 2HLSA 3NOFA 3W8SA 4I5QA 2VCZA 1XWGA 1HQOA 3VWWA 3N9JA 18GSA 2RIIA 2TRCP 4EVMA 2GQKA 2LTKA 7GSSA 1G7EA 5FWGA 3EURA 1YQ1A 1PSQA 2WGRA 2JZTA 4LMWA 1F2EA 2PVOC 1Z5YE 3APQA 3LFLA 2ZNMA 3G7IA 3TGZA 1FHEA
chains in the Genus database with same CATH superfamily
3H4KA 2CT6A 5IMCA 4K7IA 2R2JA 2YANA 4AF2A 1AXDA 1O8WA 4TR3A 1EEMA 1M2AA 3QFBC 4POLA 3GX0A 3IOSA 1SK0A 3FMWA 1A8LA 1QUWA 1M2DA 2C0EA 4HDEA 2EC4A 3CXGA 4PNGA 2VD1A 2VL9A 1WOUA 3TJFA 3IHQA 1EWXA 2CVKA 3KM6A 5B8BA 3IPZA 5DBQA 2VCQA 2CAQA 4RQXA 3KTBA 4XCSA 4GSSA 4X1UA 2ALBA 4KNDA 5CP1A 2L59A 3LYPA 5ABRA 2QC7A 3ZMKA 1J08A 4I2UA 2H70A 1Z7PA 3IV4A 2IL3A 2JU5A 4ILFA 3QCPA 1USBA 3TKRA 1JZWA 1XG8A 2JACA 2YV9A 4HEA2 1MTCA 3L0HA 3BOAA 2MZCA 2FD3A 5CYYA 2A4VA 1AW9A 5ECRB 3QPMA 4YQUA 2GS3A 1BG5A 1F9MA 4X43A 1OE8A 2AAWA 3D0ZA 3GSTA 4Q5FA 4ML6A 2VAFA 1KBNA 1OAZA 5JWRB 3GSSA 5J9CA 1TU8A 5E4WA 2G0FA 5H5SA 3APSA 4KSMA 2HRAA 3C1SA 4EXJA 4F82A 1DE2A 1YKAA 2CV4A 5E59A 1X9WB 3N5OA 1GULA 2ZUPA 2LS5A 4HOJA 3UVHA 3UOMA 2WDUA 2C8UA 4XIHA 3F9UA 1K0CA 2RUFA 4EO3A 3GYKA 4WETA 5AGYA 1EV4A 4KA0A 3MDKA 2H6YA 1PMTA 3LXZA 3QMXA 2DIZA 4TRXA 1O6JA 3D4MA 4JR4A 2GSQA 2L5LA 3D5JA 2H73A 1GUKA 1SKWB 3QAVA 1OVNA 4WKWA 1M3JA 4MPFA 4V2LA 2GLRA 1T4YA 4PXOA 1K0DA 1GUMA 1N2AA 3GUSA 3UBKA 1TDIA 1G6WA 2OE3A 2XC2A 1E2YA 5CRHA 2WULA 1OE7A 5CO3A 3TB2A 1K3YA 3KXOA 2FWFA 1Y6EA 4IQ1A 3FHKA 2BTOT 2OE1A 1EOGA 3VI7A 1AQVA 2H1DA 5HFIA 2AV4A 2OBKA 3IBHA 2PWJA 1BQ7A 3BCKA 5H5RA 2MMOA 5HR3A 2B1KA 3HXSA 2VOCA 1F3BA 3TJBA 4MZBA 4O5RA 2H0IA 20GSA 3F3RA 4PUFC 2O89A 4WF4A 4K0NA 4KF9A 3SBCA 4GRFA 4TR1A 3EU3A 3U6VA 4TN8A 4EUYA 2RLIA 1FVKA 1J9BA 2NDOA 2CA8A 3BBYA 1HNAA 4Z2RA 5CRGA 3M3MA 4AGSA 1SD9A 2L4QA 5DALA 4ECJA 1R7HA 2R6KA 1OC8A 1VF2A 2WFCA 4MF5A 4JBBA 3DVXA 4PQHA 4TXOA 2CZ3A 4MH3A 3FW2A 1TI3A 1X5DA 2GT6A 1O85A 5HR1A 1I5GA 2WJUA 2L57A 1B8XA 1EGRA 2QA2A 3E9JB 2C0FA 4CDOA 2HSMA 2X49A 3MAKA 3F6DA 5INYA 1MD3A 3DGQA 3TRQA 1WRYA 3ISOA 4HU7A 4FYBA 3TRPA 2PN8A 1YY7A 2YWNA 2HRFA 3D22A 2K8SA 5HR0A 3TKSE 1S3RA 5DCHA 2VLTA 5COHA 3QAWA 4FQUA 5KN0A 1V57A 2HZFA 2X8CA 3RPNA 5IM9A 1X5EA 4NPBA 2OADA 4KX4A 1GSDA 3FZ5A 1K0BA 2R37A 1J0FA 1AAZA 4KGIA 5KOXA 3LXTA 3MWHA 4AJ7A 5A4WA 3LSZA 2I3YA 4G0LA 1ZCPA 3Q74A 2NVLA 4QL7A 5CREA 2GZPA 4XS1A 3EINA 2GDRA 3FEUA 3GRXA 1TRVA 3L9VA 2VCXA 2IJYA 3ZL5A 2OBIA 3VLNA 1TTZA 2H1BA 3FZAA 1BAYA 3ZYWA 1B9YC 4G9HA 1RQMA 3F0IA 2WZ9A 1LBKA 5IMDA 5IQYA 3EYTA 1T3BA 2VL2A 4V2MA 2E7PA 4K9ZA 3WT2A 3M9KA 4I8BA 4G19A 1U3AA 2V32A 2L6DA 2B3SA 2PMTA 3CTFA 1JZOA 4G0KA 3DD3A 1PN0A 1H4OA 2FWEA 2GSSA 1RK4A 3ZITA 3KH7A 5F06A 2HE3A 4IP1A 3QFAC 1GNEA 2V2GA 1R5PA 1ZMAA 4OFTA 2E0QA 4PUAA 5IMFA 3P2AA 4RQRA 1V40A 1SD8A 3LGCA 2R3XA 1SL0B 3F4RA 4DEJA 3LW9A 2PPTA 4O92A 2LKUA 2REMA 1GSUA 3WYWA 1WE0A 1PL1A 3VWXA 2FA4A 2VIMA 1T00A 3UARA 1OC9A 2GQLA 3PGTA 3KH9A 4YAVA 2WRTA 3IXRA 17GSA 2JL4A 4Q5NA 5D9VA 3IHGA 2PGTA 4HZ4A 3NIVA 2B1LA 4NV2A 3QD9A 5A4UA 2IFQA 4ID0A 5JCUA 2B7JA 1WWJA 1AQXA 2BJXA 2GSRA 1VF3A 4IN0A 5DDLA 5B8AA 3C7MA 2XPDA 2I1UA 3O3TA 1YDKA 2DJJA 4QQ7A 1QXHA 2HSHA 2J23A 1GTUA 1KNGA 4CY8A 4OMVA 3GKKA 3ZFBA 2CAIA 5IOXA 3V1WA 3EMPA 2AYTA 2CVBA 5C04A 2QGVA 5GZZB 1U87A 3LYKA 5C00A 5LNKe 2JSZA 2YWIA 4NXIA 4G0IA 2FY6A 2K9FA 4MH2A 3WGDA 3PINA 22GSA 3A3TA 5IO2A 2HNLA 1PX7A 3ZRDA 3US3A 3GN3A 1XFLA 3EMXA 2LSTA 3CMIA 1NHOA 4MA9A 3FYGA 4ZB6A 2M80A 4HJ2A 4OCFA 4POBA 1JZRA 5GSSA 1THOA 4FO5A 2A2RA 3I43A 4BVYB 1K3OA 3KP9A 5B6MA 5KOWA 2IPAA 5BRTA 1MD4A 5HQPA 3DVWA 1XW5A 14GSA 5KN3A 3P7XA 1FOVA 3P8WA 1O7UA 4RI6A 3WGEA 2AHEA 2G2QA 4CHSA 2H71A 1NW2A 2CQ9A 3HY2A 3GH9A 3HDCA 2LQQA 3M0FA 2IFQB 2A2SA 5J5NA 2K18A 4OWYA 4JZQA 5GAPD 1M9BA 3AY8A 3UMAA 2D2ZA 3UVTA 5CRDA 4N10A 4XHMA 1TRWA 2LQOA 2ZCTA 4YH2A 1M3IA 3G7YA 3LG6A 1WP0A 2ON5A 1UC7A 1ZYNA 3GL3A 4PQIA 1XXUA 2H74A 3GKMA 4F9ZA 5J3RA 2C3NA 5D96A 3UIWA 3H1NA 2HZEA 4GTUA 1M7TA 2DIYA 1K3LA 4YQVA 1FW1A 4XRDA 1DE1A 1B4QA 5ECSA 3M9JA 5ELAA 3VI5A 3HKRA 3LEFA 3TOTA 4GSTA 3VPQA 4DVCA 2X4AA 4OCEA 4IS0A 2HRKA 1O81A 3A2VA 1GSFA 2H1AA 1YZXA 4BVXA 2XBIA 1PA3A 4NHZA 3EPTA 2IMIA 2P5QA 2RM6A 4K8MA 1A24A 2TIRA 4HU9A 2OE0A 3D21A 1QK8A 3CSHA 3ME8A 6GSVA 1OYJA 2QA1A 5CRWA 4HZ2A 1HNCA 5IMVA 4L5OA 4RI7A 2NTOA 2LUSA 5JWQB 2I81A 3H79A 3CTGA 5G5EA 1TK5B 2KP1A 1XZOA 2X8GA 4K5RA 5EY6A 3ZFLA 3TJJA 1SKRB 4OFMA 2P0GA 2VCTA 3TUEA 6GSTA 3RPPA 4OD7A 3TRXA 3C8EA 1Z7RA 2YNXA 4MF7A 5ID2A 2MYGA 1TK0B 2IMFA 2E2MA 4N0VA 4EL1A 1QFNA 3CRUA 1TKDB 1ZL9A 2HYXA 3HHVA 4XS4A 4BL7A 2CX3A 1GNWA 3VPTA 1YF0A 4V2NA 1FOHA 1KTEA 2KLXA 4PGTA 4ZBBA 4GF0A 4L0UA 5F8BA 1A2MA 3GTUA 3O6TA 3FKFA 4I6XA 4DSSA 4KSOA 3CQFA 4BWSA 4WR5A 3HD5A 3ZZXA 3ZVJA 2V6OA 1DBYA 3A5WA 3Q6OA 2YJHA 3D6IA 2WS2A 1XWCA 5DJMA 3L78A 5DAKA 4HS1A 4ULXA 4YKGA 2TRXA 2C4JA 2GZYA 2P5RA 3QOUA 4TXVA 2YV7A 2I4AA 1M99A 4TW5A 5D73A 5L71A 3TJGA 4ZL9A 4NAXA 5D93A 3KEBA 4GXZA 1B48A 2FUG2 4YAPA 3NZNA 1S3AA 4O7HA 4DSQA 3CSJA 1K0NA 4F2IA 1ERVA 1XOAA 3EC3A 3IDVA 3DIEA 1EP8A 3GH6A 4BWQA 4MCUA 2YJ7A 1U6TA 2LEGA 2LJKA 2FHEA 2IMKA 3GA4A 2EIQA 4O32A 3IAS2 3QAGA 3M1GA 1UN2A 1V2AA 3A2XA 4GLTA 5ECIB 4IVFA 4XS4B 2YPMA 2VUPA 4BL7B 3P90A 4IKHA 3KP8A 4MPGA 2PERA 3GTUB 2DBCA 2A2PA 1BYEA 2YCDA 4K2DA 5B6NA 4JE1A 4TR4A 4ML1A 3F4TA 2F51A 3GHAA 1YEXA 5EVOA 3QR6A 3APOA 2L4CA 1X0RA 2MBTA 2J9HA 3HA9A 1NSWA 2H8LA 1TOFA 1ILOA 2AUVA 4POMA 1EZKA 1WIKA 5DAKB 4HJMA 3CYNA 8GSSA 4HQZA 3GX8A 4ZILA 1XIYA 3O76A 3DYRA 4ISDA 1ON4A 2YWMA 4F03A 1JLWA 4TR1B 4YQMA 3HVNA 4Z2UA 4WEYA 3HVSA 1FO5A 3VWUA 5J4UA 4YKFA 5D9WA 3RHCA 2V1MA 3GNJA 4E8EA 4D73A 5DALB 3TKSA 4MF6A 2CZ2A 4FYCA 1O73A 4IJIA 2JZSA 2XPEA 1XOBA 4LA1A 4LMVA 4IJ3A 5CAXA 4TXOB 1ERTA 1XVWA 3ZMLA 9GSSA 5F07A 2H01A 3E0UA 1XWKA 2NBSA 3CRTA 3F8UA 2R0GA 3A5IA 1M0UA 13GSA 2PBJA 1WJKA 1OKTA 19GSA 4MJAA 5IMAA 4EIPA 5IMZA 4IQAA 2F3MA 1TI1A 5ECLB 5J9BA 3PR8A 1V98A 2CX4A 5G30A 2IN3A 4EC0A 2O87A 3KMNA 1TP9A 3KGKA 4WBRD 2PVQA 2C1YA 5J41A 6GSWA 4N0ZA 4IP6A 4MJEA 3FK8A 4FH8A 1R4WA 1S3CA 1N8JA 3SWLA 5AN1A 1MDIA 1SK2A 1EGOA 3IC4A 2OKAA 3KIJA 4OO5A 2LRTA 1R26A 3R2QA 1URMA 4BIKA 2ON7A 2GT5A 3ME7A 4I2TA 3TJKA 1I9DA 3GKXA 2EIRA 1OC3A 3CSIA 1A0RP 5HFKA 2B5YA 1ZYPA 4GWRA 1PL2A 1VRSD 2M46A 3QDNA 5D8IA 3ERFA 2B6MA 1ML6A 1VGLA 3IRAA 2MBSA 3IAM2 1AUCA 4J57E 3HJMA 4I97A 1FB0A 4G10A 5A5KA 1PKWA 1LU4A 1QGVA 2BMXA 1ERUA 1AIUA 4EDYA 2DMMA 4MMMA 3G9BA 1TJDA 3I9V2 1A8YA 4L8EA 5DJLA 6GSSA 4F0CA 4CY6A 2VCVA 2VLUA 3PPUA 1T4ZA 3VK9A 4JEDA 2FWGA 2FCHA 4OFNA 3DRNA 2DSAA 1ZYQB 4EIQA 2H0GA 1U3IA 1O8XA 1SJIA 5DCGA 1ZGNA 1ZOFA 2HI7A 4N30A 3ERWA 5AIXA 3HZ4A 3WT1A 3VURA 4TOPA 2C3TA 3E3EA 2EIOA 4WBJA 2JADA 2ES7A 4MLYA 1IYHA 2N5AA 1PX6A 1XPVA 3F6FA 3FR3A 3ZIJA 2QKEA 4NHWA 3FR9A 3HJOA 1U88A 2V6KA 1XW6A 1SKSB 2DJ0A 4Q5RA 2H76A 1JHBA 2VM1A 3ZLPA 1OC9B 2H1GA 1GWCA 3LQ7A 1MEKA 3R3EA 5D9XA 3FY7A 2DJ2A 3MYDA 3RAZA 1OKDA 2RUEA 2GSTA 4JRRA 5ENUA 3D4TA 4IBPA 4BA7A 3S9FA 1IYIA 1Z9HA 1G7OA 2E2GA 1PKZA 2M72A 1W4VA 1GTAA 1GP1A 3KTLA 1BEDA 2RM5A 5A4VA 1SJ6A 4AJ6A 3C1RA 1E6BA 3K8NA 4PNFA 1YF1A 5F0GA 4ECCA 4ZB9A 2LV3A 3LWAA 3PH9A 1GTBA 1WPIA 2F9SA 4TKYA 3UAPA 1XCCA 2VO4A 2V41A 1SYRA 2YOIA 3GMFA 3TOUA 4ZL7A 1SL2B 3IE3A 3BCIA 3DXBA 4LL1B 1A0FA 2H0HA 1LJRA 2MMAA 4GQFA 5ECHB 1B9XC 1SYXA 1ABAA 2XBQA 3HYPA 2H6ZA 2YWOA 3GFKA 2C0DA 3GURA 4KDYA 2H6XA 1X9SB 1ST9A 1EEJA 4PQ1A 2B5XA 5KN2A 1GLPA 3FRCA 1B4PA 4LL4B 4MJCA 3GKNA 4KDUA 2Z9SA 1YEPA 5G1LA 6GSYA 1SU9A 1GSYA 2IWTA 2MMNA 5EPFA 3TKSC 4ECIA 4WF5A 2AB6A 3HZ8A 3J7Yk 2IIYA 1CQGA 3UL3A 1H75A 4HUAA 4O5QA 5BMUA 1A2LA 1TRSA 1UA5A 1NHYA 1SENA 4K7NA 2OJLA 3GL5A 2VL2C 1T1VA 1GH2A 1M2BA 2JZRA 1G6YA 2O85A 2C3QA 4KE3A 1Q4JA 4GQCA 2WB9A 5ECNB 2CVDA 2LJAA 1FG4A 1MDJA 1GSQA 4J56E 12GSA 4ZXGA 3UJ1A 3C73A 2GGTA 3IR4A 4PTSA 2KP2A 2VCWA 4MZCA 1GUHA 1SJZA 5B7CA 4HQSA 2HZEB 4ZBDA 5LCZA 5FT3A 4MJBA 3TKPA 2R0CA 3RDWA 4MABA 2MMZA 1BX9A 2FA8A 1EP7A 1T8EB 4MDCA 4FIWA 4HI7A 4V1Ag 5DVBA 4HSCX 11GSA 4XS6A 3J7Yb 1Q98A 3OR5A 4KH7A 4H86A 4IELA 1CQHA 1M9AA 3EE2A 4BVXB 2AJQB 2YZUA 5G1KA 4X4JA 2P31A 5HFGA 2F8FA 3RBTA 4O5UA 1X5CA 2DJ1A 1TRUA 2C0GA 2WCIA 3KMOA 4G2EA 3EU4A 2K8VA 1K0MA 2O7KA 2PU9C 1HNBA 3F4SA 4OO4A 5ECMB 3F63A 2FNOA 4EE0A 4ZL8A 1EV9A 4MNNA 4ZB8A 1SK1A 5F05A 1S3DA 1Y25A 3TKQA 3I6AA 3I69A 4J2FA 2GQMA 2DKIA 3VFIA 5JCWA 1FAAA 5ECQB 4CW9A 1EOHA 1FB6A 1F3AA 1TXXA 3MIXA 1X9MB 2B7KA 3DWVA 1MDKA 2DLXA 1UVZA 4JU5A 5KN1A 5ID2B 1PQNA 4EF0A 1DUGA 4ICYA 2HXKA 5GAND 1PRXA 4K7OA 1ACVA 2NPBA 3GIXA 3JCML 5IPHA 4MZWA 3TCOA 2UZ8A 1F37A 4NV5A 5AISA 1GTIA 5G5FA 2A4HA 1YJ6A 1PN9A 4N11A 1TK8B 2DMLA 2H30A 1YKCA 5IOWA 2KOKA 1SL1B 2JSYA 2GVPA 4X0XA 4DSSB 5G31A 4IHUA 3L9SA 1K0AA 4XTSA 2VD0A 2LRCA 5H5QA 3U5RE 1R5AA 3VWVA 2FGXA 5FHIA 2HFDA 2VLVA 3BD2A 2H72A 5DQSA 1GLQA 2IMDA 3L4NA 4Z2TA 2DC5A 1V9WA 4DSRA 4F0BA 5AIVA 1BJXA 5JCGA 1TU7A 4P3YB 5ECPB 1WMJA 2K6VA 3LJRA 3W6GA 2LRNA 10GSA 3HJPA 1XW9A 2FLSA 4JR6A 4FYUA 4IW9A 4K2XA 1TW9A 1PD21 3HVVA 4ZIJA 1JFUA 4K5SA 3LORA 4XRAA 2L5OA 3IC8A 2KHPA 5IIZA 1FVJA 1JLVA 4KW6A 4KUNA 1A23A 1RW1A 4MK3A 5GSTA 3WGXA 5JWOB 3FZ4A 4IGJA 3DMLA 2N5FA 1XBSA 5LD0A 6GSUA 2DJKA 3H8QA 4EDZA 1KEBA 2L6CA 4ECBA 1THXA 2OACA 1QMVA 3ZTLA 3A2WA 4K0GA 16GSA 1Z3EA 2F8AA 4NMUA 2H75A 4A5PA 1G0TA 4KCEA 1T7PB 4AJ8A 5EL8A 5HR2A 4K1FA 4WXTA 2N5BA 3FZ9A 2IMEA 3DKSA 3IK7A 5KEJA 1AQWA 5D9TA 3HVXA 2C80A 3CBUA 1GRXA 2HSYA 2R4VA 3KJYA 3F3QA 1PFOA 4KDXA 3ED3A 2QSIA 1PGTA 4L0WA 2PUKC 3ZIVA 1XWAA 2LJRA 3MSZA 4Z7XA 2X8HA 2LNSA 4KAEA 1F6MC 3GV1A 2VL3A 2VM2A 3BJ5A 1K0OA 3ZREA 1XWBA 2FWHA 5ELGA 3Q18A 2R5GA 1NM3A 3WD6A 4KB3A 4PURA 2YN1A 4LLRA 4BVYA 4D73B 2DKHA 1Z6NA 1ZYEA 2B5EA 2X64A 3HCZA 1ZZYA 4PX1A 2I9HA 3IK9A 4KCAA 3C71A 3ZVJD 4RUVA 5DQYA 1Z6MA 1GSEA 1HYUA 4ACSA 4EKZA 2YZHA 4BPYA 3H93A 4WR4A 2R0PA 2HT9A 1ERWA 2GZZA 4QL9A 4V1Ap 4USSA 2OA7A 3UBLA 2DJ3A 3M8NA 3UEMA 2O8VB 4GSNA 5CNWA 1W89A 2GTUA 3G7JA 4GCIA 2XHFA 1AC1A 1QQ2A 2HRNA 4NWYA 4K6XA 4E8HA 5IO0A 3KZQA 1C72A 4TVEA 2X99A 2H66A 3TDGA 1JZDA 5ECOB 4MP4A 4TR0A 4L5LA 3MNGA 3KD0A 1GL8A 1VF4A 3EWLA 3RHBA 5ECKB 3W8JA 3L9UA 3IA1A 2H19A 3EVIA 3KCMA 2KUCA 6GSXA 1VF1A 2LNTA 2YP6A 3FR6A 3ERGA 1GSSA 1A2JA 3DEXA 4POKA 3Q19A 5G2ZA 1V58A 1DSBA 5IPGA 4ZBAA 1XVQA 1HD2A 4Q5QA 2HLSA 3NOFA 3W8SA 4I5QA 2VCZA 1XWGA 1HQOA 3VWWA 3N9JA 18GSA 2RIIA 2TRCP 4EVMA 2GQKA 2LTKA 7GSSA 1G7EA 5FWGA 3EURA 1YQ1A 1PSQA 2WGRA 2JZTA 4LMWA 1F2EA 2PVOC 1Z5YE 3APQA 3LFLA 2ZNMA 3G7IA 3TGZA 1FHEA
chains in the Genus database with same CATH topology
3H4KA 2CT6A 5IMCA 4K7IA 2R2JA 2YANA 4AF2A 1AXDA 1O8WA 4TR3A 1EEMA 1M2AA 3QFBC 4POLA 3GX0A 3IOSA 1SK0A 3FMWA 1A8LA 1QUWA 1M2DA 2C0EA 4HDEA 2EC4A 3CXGA 4PNGA 2VD1A 2VL9A 1WOUA 3TJFA 3IHQA 1EWXA 2CVKA 3KM6A 5B8BA 3IPZA 5DBQA 2VCQA 2CAQA 4RQXA 3KTBA 4XCSA 4GSSA 4X1UA 2ALBA 4KNDA 5CP1A 2L59A 3LYPA 5ABRA 2QC7A 3ZMKA 1J08A 4I2UA 2H70A 1Z7PA 3IV4A 2IL3A 2JU5A 4ILFA 3QCPA 1USBA 3TKRA 1JZWA 2JACA 2YV9A 4HEA2 1MTCA 3L0HA 3BOAA 2MZCA 2FD3A 5CYYA 2A4VA 1AW9A 5ECRB 3QPMA 4YQUA 2GS3A 1BG5A 1F9MA 4X43A 1OE8A 2AAWA 3D0ZA 3GSTA 4Q5FA 4ML6A 2VAFA 1KBNA 1OAZA 5JWRB 3GSSA 5J9CA 1TU8A 5E4WA 2G0FA 5H5SA 3APSA 4KSMA 2HRAA 3C1SA 4EXJA 4F82A 1DE2A 1YKAA 2CV4A 5E59A 1X9WB 3N5OA 1GULA 2ZUPA 2LS5A 4HOJA 3UVHA 3UOMA 2WDUA 2C8UA 4XIHA 3F9UA 1K0CA 2RUFA 4EO3A 3GYKA 4WETA 5AGYA 1EV4A 4KA0A 3MDKA 2H6YA 1PMTA 3LXZA 3QMXA 2DIZA 4TRXA 1O6JA 3D4MA 4JR4A 2GSQA 2L5LA 3D5JA 2H73A 1GUKA 1SKWB 3QAVA 1OVNA 4WKWA 4MPFA 4V2LA 2GLRA 1T4YA 4PXOA 1K0DA 1GUMA 1N2AA 3GUSA 3UBKA 1TDIA 1G6WA 2OE3A 2XC2A 1E2YA 5CRHA 2WULA 1OE7A 5CO3A 3TB2A 1K3YA 3KXOA 2FWFA 1Y6EA 4IQ1A 3FHKA 2BTOT 2OE1A 1EOGA 3VI7A 1AQVA 2H1DA 5HFIA 2AV4A 2OBKA 3IBHA 2PWJA 1BQ7A 3BCKA 5H5RA 2MMOA 5HR3A 2B1KA 3HXSA 2VOCA 1F3BA 3TJBA 4MZBA 4O5RA 2H0IA 20GSA 3F3RA 4PUFC 2O89A 4WF4A 4K0NA 4KF9A 3SBCA 4GRFA 4TR1A 3EU3A 3U6VA 4TN8A 4EUYA 2RLIA 1FVKA 1J9BA 2NDOA 2CA8A 3BBYA 1HNAA 4Z2RA 5CRGA 3M3MA 4AGSA 1SD9A 2L4QA 5DALA 4ECJA 1R7HA 2R6KA 1OC8A 1VF2A 2WFCA 4MF5A 4JBBA 3DVXA 4PQHA 4TXOA 2CZ3A 4MH3A 3FW2A 1TI3A 1X5DA 2GT6A 1O85A 5HR1A 1I5GA 2WJUA 2L57A 1B8XA 1EGRA 2QA2A 3E9JB 2C0FA 4CDOA 2HSMA 2X49A 3MAKA 3F6DA 5INYA 1MD3A 3DGQA 3TRQA 1WRYA 3ISOA 4HU7A 4FYBA 3TRPA 2PN8A 1YY7A 2YWNA 2HRFA 3D22A 2K8SA 5HR0A 3TKSE 5DCHA 2VLTA 5COHA 3QAWA 4FQUA 5KN0A 1V57A 2HZFA 2X8CA 3RPNA 5IM9A 1X5EA 4NPBA 2OADA 4KX4A 1GSDA 3FZ5A 1K0BA 2R37A 1J0FA 1AAZA 4KGIA 5KOXA 3LXTA 3MWHA 4AJ7A 5A4WA 3LSZA 2I3YA 4G0LA 1ZCPA 3Q74A 2NVLA 4QL7A 5CREA 2GZPA 4XS1A 3EINA 2GDRA 3FEUA 3GRXA 1TRVA 3L9VA 2VCXA 2IJYA 3ZL5A 2OBIA 3VLNA 1TTZA 2H1BA 3FZAA 1BAYA 3ZYWA 1B9YC 4G9HA 1RQMA 3F0IA 2WZ9A 1LBKA 5IMDA 5IQYA 3EYTA 1T3BA 2VL2A 4V2MA 2E7PA 4K9ZA 3WT2A 3M9KA 4I8BA 4G19A 1U3AA 2V32A 2L6DA 2B3SA 2PMTA 3CTFA 1JZOA 4G0KA 3DD3A 1PN0A 1H4OA 2FWEA 2GSSA 1RK4A 3ZITA 3KH7A 5F06A 2HE3A 4IP1A 3QFAC 1GNEA 2V2GA 1R5PA 1ZMAA 4OFTA 2E0QA 4PUAA 5IMFA 3P2AA 4RQRA 1V40A 1SD8A 3LGCA 2R3XA 1SL0B 3F4RA 4DEJA 3LW9A 2PPTA 4O92A 2LKUA 2REMA 1GSUA 3WYWA 1WE0A 1PL1A 3VWXA 2FA4A 2VIMA 1T00A 3UARA 1OC9A 2GQLA 3PGTA 3KH9A 4YAVA 2WRTA 3IXRA 17GSA 2JL4A 4Q5NA 5D9VA 3IHGA 2PGTA 4HZ4A 3NIVA 2B1LA 4NV2A 3QD9A 5A4UA 2IFQA 4ID0A 5JCUA 2B7JA 1WWJA 1AQXA 2BJXA 2GSRA 1VF3A 4IN0A 5DDLA 5B8AA 3C7MA 2XPDA 2I1UA 3O3TA 1YDKA 2DJJA 4QQ7A 1QXHA 2HSHA 2J23A 1GTUA 1KNGA 4CY8A 4OMVA 3GKKA 3ZFBA 2CAIA 5IOXA 3V1WA 3EMPA 2AYTA 2CVBA 5C04A 2QGVA 5GZZB 1U87A 3LYKA 5C00A 5LNKe 2JSZA 2YWIA 4NXIA 4G0IA 2FY6A 2K9FA 4MH2A 3WGDA 3PINA 22GSA 3A3TA 5IO2A 2HNLA 1PX7A 3ZRDA 3US3A 3GN3A 1XFLA 3EMXA 2LSTA 3CMIA 1NHOA 4MA9A 3FYGA 4ZB6A 2M80A 4HJ2A 4OCFA 4POBA 1JZRA 5GSSA 1THOA 4FO5A 2A2RA 3I43A 4BVYB 1K3OA 3KP9A 5B6MA 5KOWA 2IPAA 5BRTA 1MD4A 5HQPA 3DVWA 1XW5A 14GSA 5KN3A 3P7XA 1FOVA 3P8WA 1O7UA 4RI6A 3WGEA 2AHEA 2G2QA 4CHSA 2H71A 1NW2A 2CQ9A 3HY2A 3GH9A 3HDCA 2LQQA 3M0FA 2IFQB 2A2SA 5J5NA 2K18A 4OWYA 4JZQA 5GAPD 1M9BA 3AY8A 3UMAA 2D2ZA 3UVTA 5CRDA 4N10A 4XHMA 1TRWA 2LQOA 2ZCTA 4YH2A 3G7YA 3LG6A 1WP0A 2ON5A 1UC7A 1ZYNA 3GL3A 4PQIA 1XXUA 2H74A 3GKMA 4F9ZA 5J3RA 2C3NA 5D96A 3UIWA 3H1NA 2HZEA 4GTUA 1M7TA 2DIYA 1K3LA 4YQVA 1FW1A 4XRDA 1DE1A 1B4QA 5ECSA 3M9JA 5ELAA 3VI5A 3HKRA 3LEFA 3TOTA 4GSTA 3VPQA 4DVCA 2X4AA 4OCEA 4IS0A 2HRKA 1O81A 3A2VA 1GSFA 2H1AA 1YZXA 4BVXA 2XBIA 1PA3A 4NHZA 3EPTA 2IMIA 2P5QA 2RM6A 4K8MA 1A24A 2TIRA 4HU9A 2OE0A 3D21A 1QK8A 3CSHA 3ME8A 6GSVA 1OYJA 2QA1A 5CRWA 4HZ2A 1HNCA 5IMVA 4L5OA 4RI7A 2NTOA 2LUSA 5JWQB 2I81A 3H79A 3CTGA 5G5EA 1TK5B 2KP1A 1XZOA 2X8GA 4K5RA 5EY6A 3ZFLA 3TJJA 1SKRB 4OFMA 2P0GA 2VCTA 3TUEA 6GSTA 3RPPA 4OD7A 3TRXA 3C8EA 1Z7RA 2YNXA 4MF7A 5ID2A 2MYGA 1TK0B 2IMFA 2E2MA 4N0VA 4EL1A 1QFNA 3CRUA 1TKDB 1ZL9A 2HYXA 3HHVA 4XS4A 4BL7A 2CX3A 1GNWA 3VPTA 1YF0A 4V2NA 1FOHA 1KTEA 2KLXA 4PGTA 4ZBBA 4GF0A 4L0UA 5F8BA 1A2MA 3GTUA 3O6TA 3FKFA 4I6XA 4DSSA 4KSOA 4BWSA 4WR5A 3HD5A 3ZZXA 3ZVJA 2V6OA 1DBYA 3A5WA 3Q6OA 2YJHA 3D6IA 2WS2A 1XWCA 5DJMA 3L78A 5DAKA 4HS1A 4ULXA 4YKGA 2TRXA 2C4JA 2GZYA 2P5RA 3QOUA 4TXVA 2YV7A 2I4AA 1M99A 4TW5A 5D73A 5L71A 3TJGA 4ZL9A 4NAXA 5D93A 3KEBA 4GXZA 1B48A 2FUG2 4YAPA 3NZNA 1S3AA 4O7HA 4DSQA 3CSJA 1K0NA 4F2IA 1ERVA 1XOAA 3EC3A 3IDVA 3DIEA 1EP8A 3GH6A 4BWQA 4MCUA 2YJ7A 1U6TA 2LEGA 2LJKA 2FHEA 2IMKA 3GA4A 2EIQA 4O32A 3IAS2 3QAGA 3M1GA 1UN2A 1V2AA 3A2XA 4GLTA 5ECIB 4IVFA 4XS4B 2YPMA 2VUPA 4BL7B 3P90A 4IKHA 3KP8A 4MPGA 2PERA 3GTUB 2DBCA 2A2PA 1BYEA 2YCDA 4K2DA 5B6NA 4JE1A 4TR4A 4ML1A 3F4TA 2F51A 3GHAA 1YEXA 5EVOA 3QR6A 3APOA 2L4CA 1X0RA 2MBTA 2J9HA 3HA9A 1NSWA 2H8LA 1TOFA 1ILOA 2AUVA 4POMA 1EZKA 1WIKA 5DAKB 4HJMA 3CYNA 8GSSA 4HQZA 3GX8A 4ZILA 1XIYA 3O76A 3DYRA 4ISDA 1ON4A 2YWMA 4F03A 1JLWA 4TR1B 4YQMA 4Z2UA 4WEYA 3HVSA 1FO5A 3VWUA 5J4UA 4YKFA 5D9WA 3RHCA 2V1MA 3GNJA 4E8EA 4D73A 5DALB 3TKSA 4MF6A 2CZ2A 4FYCA 1O73A 4IJIA 2JZSA 2XPEA 1XOBA 4LA1A 4LMVA 4IJ3A 5CAXA 4TXOB 1ERTA 1XVWA 3ZMLA 9GSSA 5F07A 2H01A 3E0UA 1XWKA 2NBSA 3CRTA 3F8UA 2R0GA 3A5IA 1M0UA 13GSA 2PBJA 1WJKA 1OKTA 19GSA 4MJAA 5IMAA 4EIPA 5IMZA 4IQAA 2F3MA 1TI1A 5ECLB 5J9BA 3PR8A 1V98A 2CX4A 5G30A 2IN3A 4EC0A 2O87A 3KMNA 1TP9A 3KGKA 4WBRD 2PVQA 2C1YA 5J41A 6GSWA 4N0ZA 4IP6A 4MJEA 3FK8A 4FH8A 1R4WA 1S3CA 1N8JA 3SWLA 5AN1A 1MDIA 1SK2A 1EGOA 3IC4A 2OKAA 3KIJA 4OO5A 2LRTA 1R26A 3R2QA 1URMA 2ON7A 2GT5A 3ME7A 4I2TA 3TJKA 1I9DA 3GKXA 2EIRA 1OC3A 3CSIA 1A0RP 5HFKA 2B5YA 1ZYPA 4GWRA 1PL2A 1VRSD 2M46A 3QDNA 5D8IA 3ERFA 2B6MA 1ML6A 1VGLA 3IRAA 2MBSA 3IAM2 1AUCA 4J57E 3HJMA 4I97A 1FB0A 4G10A 5A5KA 1PKWA 1LU4A 1QGVA 2BMXA 1ERUA 1AIUA 4EDYA 2DMMA 4MMMA 3G9BA 1TJDA 3I9V2 1A8YA 4L8EA 5DJLA 6GSSA 4F0CA 4CY6A 2VCVA 2VLUA 3PPUA 1T4ZA 3VK9A 4JEDA 2FWGA 2FCHA 4OFNA 3DRNA 2DSAA 1ZYQB 4EIQA 2H0GA 1U3IA 1O8XA 1SJIA 5DCGA 1ZGNA 1ZOFA 2HI7A 4N30A 3ERWA 5AIXA 3HZ4A 3WT1A 3VURA 4TOPA 2C3TA 3E3EA 2EIOA 4WBJA 2JADA 2ES7A 4MLYA 1IYHA 2N5AA 1PX6A 1XPVA 3F6FA 3FR3A 3ZIJA 2QKEA 4NHWA 3FR9A 3HJOA 1U88A 2V6KA 1XW6A 1SKSB 2DJ0A 4Q5RA 2H76A 1JHBA 2VM1A 3ZLPA 1OC9B 2H1GA 1GWCA 3LQ7A 1MEKA 3R3EA 5D9XA 3FY7A 2DJ2A 3MYDA 3RAZA 1OKDA 2RUEA 2GSTA 4JRRA 5ENUA 3D4TA 4IBPA 4BA7A 3S9FA 1IYIA 1Z9HA 1G7OA 2E2GA 1PKZA 2M72A 1W4VA 1GTAA 1GP1A 3KTLA 1BEDA 2RM5A 5A4VA 1SJ6A 4AJ6A 3C1RA 1E6BA 3K8NA 4PNFA 1YF1A 5F0GA 4ECCA 4ZB9A 2LV3A 3LWAA 3PH9A 1GTBA 1WPIA 2F9SA 4TKYA 3UAPA 1XCCA 2VO4A 2V41A 1SYRA 2YOIA 3GMFA 3TOUA 4ZL7A 1SL2B 3IE3A 3BCIA 3DXBA 4LL1B 1A0FA 2H0HA 1LJRA 2MMAA 4GQFA 5ECHB 1B9XC 1SYXA 1ABAA 2XBQA 3HYPA 2H6ZA 2YWOA 3GFKA 2C0DA 3GURA 4KDYA 2H6XA 1X9SB 1ST9A 1EEJA 4PQ1A 2B5XA 5KN2A 1GLPA 3FRCA 1B4PA 4LL4B 4MJCA 3GKNA 4KDUA 2Z9SA 1YEPA 5G1LA 6GSYA 1SU9A 1GSYA 2IWTA 2MMNA 5EPFA 3TKSC 4ECIA 4WF5A 2AB6A 3HZ8A 3J7Yk 2IIYA 1CQGA 3UL3A 1H75A 4HUAA 4O5QA 5BMUA 1A2LA 1TRSA 1UA5A 1NHYA 1SENA 4K7NA 2OJLA 3GL5A 2VL2C 1T1VA 1GH2A 1M2BA 2JZRA 1G6YA 2O85A 2C3QA 4KE3A 1Q4JA 4GQCA 2WB9A 5ECNB 2CVDA 2LJAA 1FG4A 1MDJA 1GSQA 4J56E 12GSA 4ZXGA 3UJ1A 3C73A 2GGTA 3IR4A 4PTSA 2KP2A 2VCWA 4MZCA 1GUHA 1SJZA 5B7CA 4HQSA 2HZEB 4ZBDA 5LCZA 5FT3A 4MJBA 3TKPA 2R0CA 3RDWA 4MABA 2MMZA 1BX9A 2FA8A 1EP7A 1T8EB 4MDCA 4FIWA 4HI7A 4V1Ag 5DVBA 11GSA 4XS6A 3J7Yb 1Q98A 3OR5A 4KH7A 4H86A 4IELA 1CQHA 1M9AA 3EE2A 4BVXB 2AJQB 2YZUA 5G1KA 4X4JA 2P31A 5HFGA 2F8FA 3RBTA 4O5UA 1X5CA 2DJ1A 1TRUA 2C0GA 2WCIA 3KMOA 4G2EA 3EU4A 2K8VA 1K0MA 2O7KA 2PU9C 1HNBA 3F4SA 4OO4A 5ECMB 3F63A 2FNOA 4EE0A 4ZL8A 1EV9A 4MNNA 4ZB8A 1SK1A 5F05A 1S3DA 1Y25A 3TKQA 3I6AA 3I69A 4J2FA 2GQMA 2DKIA 3VFIA 5JCWA 1FAAA 5ECQB 4CW9A 1EOHA 1FB6A 1F3AA 1TXXA 3MIXA 1X9MB 2B7KA 3DWVA 1MDKA 2DLXA 1UVZA 4JU5A 5KN1A 5ID2B 1PQNA 4EF0A 1DUGA 4ICYA 2HXKA 5GAND 1PRXA 4K7OA 1ACVA 2NPBA 3GIXA 3JCML 5IPHA 4MZWA 3TCOA 2UZ8A 1F37A 4NV5A 5AISA 1GTIA 5G5FA 2A4HA 1YJ6A 1PN9A 4N11A 1TK8B 2DMLA 2H30A 1YKCA 5IOWA 2KOKA 1SL1B 2JSYA 2GVPA 4X0XA 4DSSB 5G31A 4IHUA 3L9SA 1K0AA 4XTSA 2VD0A 2LRCA 5H5QA 3U5RE 1R5AA 3VWVA 2FGXA 5FHIA 2HFDA 2VLVA 3BD2A 2H72A 5DQSA 1GLQA 2IMDA 3L4NA 4Z2TA 2DC5A 1V9WA 4DSRA 4F0BA 5AIVA 1BJXA 5JCGA 1TU7A 4P3YB 5ECPB 1WMJA 2K6VA 3LJRA 3W6GA 2LRNA 10GSA 3HJPA 1XW9A 2FLSA 4JR6A 4FYUA 4IW9A 4K2XA 1TW9A 1PD21 3HVVA 4ZIJA 1JFUA 4K5SA 3LORA 4XRAA 2L5OA 3IC8A 2KHPA 5IIZA 1FVJA 1JLVA 4KW6A 4KUNA 1A23A 1RW1A 4MK3A 5GSTA 3WGXA 5JWOB 3FZ4A 4IGJA 3DMLA 2N5FA 1XBSA 5LD0A 6GSUA 2DJKA 3H8QA 4EDZA 1KEBA 2L6CA 4ECBA 1THXA 2OACA 1QMVA 3ZTLA 3A2WA 4K0GA 16GSA 1Z3EA 2F8AA 4NMUA 2H75A 4A5PA 1G0TA 4KCEA 1T7PB 4AJ8A 5EL8A 5HR2A 4K1FA 4WXTA 2N5BA 3FZ9A 2IMEA 3DKSA 3IK7A 5KEJA 1AQWA 5D9TA 3HVXA 2C80A 3CBUA 1GRXA 2HSYA 2R4VA 3KJYA 3F3QA 4KDXA 3ED3A 2QSIA 1PGTA 4L0WA 2PUKC 3ZIVA 1XWAA 2LJRA 3MSZA 4Z7XA 2X8HA 2LNSA 4KAEA 1F6MC 3GV1A 2VL3A 2VM2A 3BJ5A 1K0OA 3ZREA 1XWBA 2FWHA 5ELGA 3Q18A 2R5GA 1NM3A 3WD6A 4KB3A 4PURA 2YN1A 4LLRA 4BVYA 4D73B 2DKHA 1Z6NA 1ZYEA 2B5EA 2X64A 3HCZA 1ZZYA 4PX1A 2I9HA 3IK9A 4KCAA 3C71A 3ZVJD 4RUVA 5DQYA 1Z6MA 1GSEA 1HYUA 4ACSA 4EKZA 2YZHA 4BPYA 3H93A 4WR4A 2R0PA 2HT9A 1ERWA 2GZZA 4QL9A 4V1Ap 4USSA 2OA7A 3UBLA 2DJ3A 3M8NA 3UEMA 2O8VB 4GSNA 5CNWA 1W89A 2GTUA 3G7JA 4GCIA 2XHFA 1AC1A 1QQ2A 2HRNA 4NWYA 4K6XA 4E8HA 5IO0A 3KZQA 1C72A 4TVEA 2X99A 2H66A 3TDGA 1JZDA 5ECOB 4MP4A 4TR0A 4L5LA 3MNGA 3KD0A 1GL8A 1VF4A 3EWLA 3RHBA 5ECKB 3W8JA 3L9UA 3IA1A 2H19A 3EVIA 3KCMA 2KUCA 6GSXA 1VF1A 2LNTA 2YP6A 3FR6A 3ERGA 1GSSA 1A2JA 3DEXA 4POKA 3Q19A 5G2ZA 1V58A 1DSBA 5IPGA 4ZBAA 1XVQA 1HD2A 4Q5QA 2HLSA 3NOFA 3W8SA 4I5QA 2VCZA 1XWGA 1HQOA 3VWWA 3N9JA 18GSA 2RIIA 2TRCP 4EVMA 2GQKA 2LTKA 7GSSA 1G7EA 5FWGA 3EURA 1YQ1A 1PSQA 2WGRA 2JZTA 4LMWA 1F2EA 2PVOC 1Z5YE 3APQA 3LFLA 2ZNMA 3G7IA 3TGZA 1FHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4K A;  2CT6 A;  5IMC A;  4K7I A;  2R2J A;  2YAN A;  4AF2 A;  1AXD A;  1O8W A;  4TR3 A;  1EEM A;  1M2A A;  3QFB C;  4POL A;  3GX0 A;  3IOS A;  1SK0 A;  1A8L A;  1QUW A;  1M2D A;  2C0E A;  4HDE A;  2EC4 A;  3CXG A;  4PNG A;  2VD1 A;  2VL9 A;  1WOU A;  3TJF A;  3IHQ A;  1EWX A;  2CVK A;  3KM6 A;  5B8B A;  3IPZ A;  5DBQ A;  2VCQ A;  2CAQ A;  4RQX A;  3KTB A;  4XCS A;  4GSS A;  4X1U A;  2ALB A;  4KND A;  5CP1 A;  2L59 A;  3LYP A;  5ABR A;  2QC7 A;  3ZMK A;  1J08 A;  4I2U A;  2H70 A;  1Z7P A;  3IV4 A;  2IL3 A;  2JU5 A;  4ILF A;  3QCP A;  1USB A;  3TKR A;  1JZW A;  2JAC A;  2YV9 A;  4HEA 2;  1MTC A;  3L0H A;  3BOA A;  2MZC A;  2FD3 A;  5CYY A;  2A4V A;  1AW9 A;  5ECR B;  3QPM A;  4YQU A;  2GS3 A;  1BG5 A;  1F9M A;  4X43 A;  1OE8 A;  2AAW A;  3D0Z A;  3GST A;  4Q5F A;  4ML6 A;  2VAF A;  1KBN A;  1OAZ A;  5JWR B;  3GSS A;  5J9C A;  1TU8 A;  5E4W A;  2G0F A;  5H5S A;  3APS A;  4KSM A;  3C1S A;  4EXJ A;  4F82 A;  1DE2 A;  1YKA A;  2CV4 A;  5E59 A;  1X9W B;  3N5O A;  1GUL A;  2ZUP A;  2LS5 A;  4HOJ A;  3UVH A;  3UOM A;  2WDU A;  2C8U A;  4XIH A;  3F9U A;  1K0C A;  2RUF A;  4EO3 A;  3GYK A;  4WET A;  5AGY A;  1EV4 A;  4KA0 A;  3MDK A;  2H6Y A;  1PMT A;  3LXZ A;  3QMX A;  2DIZ A;  4TRX A;  1O6J A;  3D4M A;  4JR4 A;  2GSQ A;  2L5L A;  3D5J A;  2H73 A;  1GUK A;  1SKW B;  3QAV A;  1OVN A;  4WKW A;  4MPF A;  4V2L A;  2GLR A;  1T4Y A;  4PXO A;  1K0D A;  1GUM A;  1N2A A;  3GUS A;  3UBK A;  1TDI A;  1G6W A;  2OE3 A;  2XC2 A;  1E2Y A;  5CRH A;  2WUL A;  1OE7 A;  5CO3 A;  3TB2 A;  1K3Y A;  3KXO A;  2FWF A;  1Y6E A;  4IQ1 A;  3FHK A;  2BTO T;  2OE1 A;  1EOG A;  3VI7 A;  1AQV A;  2H1D A;  5HFI A;  2AV4 A;  2OBK A;  3IBH A;  2PWJ A;  1BQ7 A;  3BCK A;  5H5R A;  2MMO A;  5HR3 A;  2B1K A;  3HXS A;  2VOC A;  1F3B A;  3TJB A;  4MZB A;  4O5R A;  2H0I A;  20GS A;  3F3R A;  4PUF C;  2O89 A;  4WF4 A;  4K0N A;  3SBC A;  4GRF A;  4TR1 A;  3EU3 A;  3U6V A;  4TN8 A;  4EUY A;  2RLI A;  1FVK A;  1J9B A;  2NDO A;  2CA8 A;  3BBY A;  1HNA A;  5CRG A;  3M3M A;  4AGS A;  1SD9 A;  2L4Q A;  5DAL A;  4ECJ A;  1R7H A;  2R6K A;  1OC8 A;  1VF2 A;  2WFC A;  4MF5 A;  4JBB A;  3DVX A;  4PQH A;  4TXO A;  2CZ3 A;  4MH3 A;  3FW2 A;  1TI3 A;  1X5D A;  2GT6 A;  1O85 A;  5HR1 A;  1I5G A;  2WJU A;  2L57 A;  1B8X A;  1EGR A;  3E9J B;  2C0F A;  4CDO A;  3MAK A;  3F6D A;  5INY A;  1MD3 A;  3DGQ A;  3TRQ A;  1WRY A;  3ISO A;  4HU7 A;  4FYB A;  3TRP A;  2PN8 A;  1YY7 A;  2YWN A;  2HRF A;  3D22 A;  2K8S A;  5HR0 A;  3TKS E;  5DCH A;  2VLT A;  5COH A;  3QAW A;  5KN0 A;  1V57 A;  2HZF A;  2X8C A;  3RPN A;  5IM9 A;  1X5E A;  4NPB A;  2OAD A;  4KX4 A;  1GSD A;  3FZ5 A;  1K0B A;  2R37 A;  1J0F A;  1AAZ A;  4KGI A;  3LXT A;  3MWH A;  4AJ7 A;  5A4W A;  3LSZ A;  2I3Y A;  1ZCP A;  3Q74 A;  2NVL A;  4QL7 A;  5CRE A;  2GZP A;  4XS1 A;  3EIN A;  2GDR A;  3FEU A;  3GRX A;  1TRV A;  3L9V A;  2VCX A;  2IJY A;  3ZL5 A;  2OBI A;  3VLN A;  1TTZ A;  2H1B A;  3FZA A;  1BAY A;  3ZYW A;  1B9Y C;  4G9H A;  1RQM A;  3F0I A;  2WZ9 A;  1LBK A;  5IMD A;  5IQY A;  3EYT A;  1T3B A;  2VL2 A;  4V2M A;  2E7P A;  4K9Z A;  3WT2 A;  3M9K A;  4I8B A;  4G19 A;  1U3A A;  2V32 A;  2L6D A;  2B3S A;  2PMT A;  3CTF A;  1JZO A;  3DD3 A;  1H4O A;  2FWE A;  2GSS A;  1RK4 A;  3ZIT A;  3KH7 A;  5F06 A;  2HE3 A;  4IP1 A;  3QFA C;  1GNE A;  2V2G A;  1R5P A;  1ZMA A;  4OFT A;  2E0Q A;  4PUA A;  5IMF A;  3P2A A;  4RQR A;  1V40 A;  1SD8 A;  3LGC A;  2R3X A;  1SL0 B;  3F4R A;  4DEJ A;  2PPT A;  4O92 A;  2LKU A;  2REM A;  1GSU A;  3WYW A;  1WE0 A;  1PL1 A;  3VWX A;  2FA4 A;  2VIM A;  1T00 A;  3UAR A;  1OC9 A;  2GQL A;  3PGT A;  3KH9 A;  4YAV A;  2WRT A;  3IXR A;  17GS A;  2JL4 A;  4Q5N A;  5D9V A;  4HZ4 A;  2PGT A;  3NIV A;  2B1L A;  4NV2 A;  3QD9 A;  5A4U A;  2IFQ A;  4ID0 A;  5JCU A;  2B7J A;  1WWJ A;  1AQX A;  2BJX A;  2GSR A;  1VF3 A;  4IN0 A;  5DDL A;  5B8A A;  3C7M A;  2XPD A;  2I1U A;  3O3T A;  1YDK A;  2DJJ A;  4QQ7 A;  1QXH A;  2HSH A;  2J23 A;  1GTU A;  1KNG A;  4OMV A;  3GKK A;  3ZFB A;  2CAI A;  5IOX A;  3V1W A;  3EMP A;  2AYT A;  2CVB A;  5C04 A;  2QGV A;  5GZZ B;  1U87 A;  3LYK A;  5C00 A;  5LNK e;  2JSZ A;  2YWI A;  4NXI A;  2FY6 A;  2K9F A;  4MH2 A;  3WGD A;  3PIN A;  22GS A;  3A3T A;  5IO2 A;  2HNL A;  1PX7 A;  3ZRD A;  3US3 A;  3GN3 A;  1XFL A;  3EMX A;  2LST A;  3CMI A;  1NHO A;  4MA9 A;  3FYG A;  4ZB6 A;  2M80 A;  4HJ2 A;  4OCF A;  4POB A;  1JZR A;  5GSS A;  1THO A;  4FO5 A;  2A2R A;  3I43 A;  1K3O A;  3KP9 A;  5B6M A;  2IPA A;  1MD4 A;  5HQP A;  3DVW A;  1XW5 A;  14GS A;  5KN3 A;  3P7X A;  1FOV A;  3P8W A;  1O7U A;  4RI6 A;  3WGE A;  2AHE A;  2G2Q A;  4CHS A;  2H71 A;  1NW2 A;  2CQ9 A;  3HY2 A;  3GH9 A;  3HDC A;  2LQQ A;  3M0F A;  2IFQ B;  2A2S A;  5J5N A;  2K18 A;  4OWY A;  4JZQ A;  5GAP D;  1M9B A;  3AY8 A;  3UMA A;  2D2Z A;  3UVT A;  5CRD A;  4N10 A;  4XHM A;  1TRW A;  2LQO A;  2ZCT A;  4YH2 A;  3G7Y A;  3LG6 A;  1WP0 A;  2ON5 A;  1UC7 A;  3GL3 A;  4PQI A;  1XXU A;  2H74 A;  3GKM A;  4F9Z A;  5J3R A;  2C3N A;  5D96 A;  3UIW A;  3H1N A;  2HZE A;  4GTU A;  1M7T A;  2DIY A;  1K3L A;  4YQV A;  1FW1 A;  4XRD A;  1DE1 A;  1B4Q A;  5ECS A;  3M9J A;  5ELA A;  3VI5 A;  3HKR A;  3LEF A;  3TOT A;  4GST A;  3VPQ A;  4DVC A;  4OCE A;  4IS0 A;  1O81 A;  3A2V A;  1GSF A;  2H1A A;  1YZX A;  4BVX A;  2XBI A;  1PA3 A;  4NHZ A;  2IMI A;  2P5Q A;  2RM6 A;  4K8M A;  1A24 A;  2TIR A;  4HU9 A;  2OE0 A;  3D21 A;  1QK8 A;  3CSH A;  3ME8 A;  6GSV A;  1OYJ A;  5CRW A;  4HZ2 A;  1HNC A;  5IMV A;  4L5O A;  4RI7 A;  2NTO A;  2LUS A;  5JWQ B;  2I81 A;  3H79 A;  3CTG A;  5G5E A;  1TK5 B;  2KP1 A;  1XZO A;  2X8G A;  5EY6 A;  3ZFL A;  3TJJ A;  1SKR B;  4OFM A;  2P0G A;  2VCT A;  3TUE A;  6GST A;  3RPP A;  4OD7 A;  3TRX A;  3C8E A;  1Z7R A;  2YNX A;  4MF7 A;  5ID2 A;  2MYG A;  1TK0 B;  2IMF A;  2E2M A;  4N0V A;  4EL1 A;  1QFN A;  3CRU A;  1TKD B;  1ZL9 A;  2HYX A;  3HHV A;  4XS4 A;  4BL7 A;  2CX3 A;  1GNW A;  3VPT A;  1YF0 A;  4V2N A;  1KTE A;  2KLX A;  4PGT A;  4ZBB A;  5F8B A;  4GF0 A;  4L0U A;  1A2M A;  3GTU A;  3O6T A;  3FKF A;  4I6X A;  4DSS A;  4KSO A;  4BWS A;  4WR5 A;  3HD5 A;  3ZZX A;  3ZVJ A;  2V6O A;  1DBY A;  3A5W A;  3Q6O A;  2YJH A;  3D6I A;  2WS2 A;  1XWC A;  5DJM A;  3L78 A;  5DAK A;  4HS1 A;  4ULX A;  2TRX A;  2C4J A;  2GZY A;  2P5R A;  3QOU A;  4TXV A;  2YV7 A;  2I4A A;  1M99 A;  4TW5 A;  5D73 A;  5L71 A;  3TJG A;  4ZL9 A;  4NAX A;  5D93 A;  3KEB A;  4GXZ A;  1B48 A;  2FUG 2;  4YAP A;  3NZN A;  1S3A A;  4O7H A;  4DSQ A;  3CSJ A;  1K0N A;  4F2I A;  1ERV A;  1XOA A;  3EC3 A;  3IDV A;  3DIE A;  1EP8 A;  3GH6 A;  4BWQ A;  4MCU A;  2YJ7 A;  1U6T A;  2LEG A;  2LJK A;  2FHE A;  2IMK A;  3GA4 A;  2EIQ A;  3IAS 2;  3QAG A;  4O32 A;  3M1G A;  1UN2 A;  1V2A A;  3A2X A;  4GLT A;  5ECI B;  4IVF A;  4XS4 B;  2YPM A;  2VUP A;  3P90 A;  4IKH A;  3KP8 A;  4MPG A;  2PER A;  3GTU B;  2DBC A;  1BYE A;  2YCD A;  4K2D A;  5B6N A;  4JE1 A;  4TR4 A;  4ML1 A;  3F4T A;  2F51 A;  3GHA A;  1YEX A;  5EVO A;  3QR6 A;  3APO A;  2L4C A;  1X0R A;  2MBT A;  2J9H A;  3HA9 A;  1NSW A;  2H8L A;  1TOF A;  1ILO A;  2AUV A;  4POM A;  1EZK A;  1WIK A;  5DAK B;  4HJM A;  3CYN A;  8GSS A;  4HQZ A;  3GX8 A;  4ZIL A;  1XIY A;  3O76 A;  3DYR A;  4ISD A;  1ON4 A;  2YWM A;  4F03 A;  1JLW A;  4TR1 B;  4YQM A;  4WEY A;  3HVS A;  1FO5 A;  3VWU A;  5J4U A;  5D9W A;  3RHC A;  2V1M A;  3GNJ A;  4E8E A;  4D73 A;  5DAL B;  3TKS A;  4MF6 A;  2CZ2 A;  4FYC A;  1O73 A;  4IJI A;  2JZS A;  2XPE A;  1XOB A;  4LA1 A;  4LMV A;  4IJ3 A;  5CAX A;  4TXO B;  1ERT A;  1XVW A;  3ZML A;  9GSS A;  5F07 A;  2H01 A;  3E0U A;  1XWK A;  2NBS A;  3CRT A;  3F8U A;  1M0U A;  13GS A;  2PBJ A;  1WJK A;  1OKT A;  19GS A;  4MJA A;  5IMA A;  5IMZ A;  4IQA A;  2F3M A;  1TI1 A;  5ECL B;  5J9B A;  3PR8 A;  1V98 A;  2CX4 A;  5G30 A;  2IN3 A;  4EC0 A;  2O87 A;  3KMN A;  1TP9 A;  3KGK A;  4WBR D;  2PVQ A;  2C1Y A;  5J41 A;  6GSW A;  4N0Z A;  4IP6 A;  4MJE A;  3FK8 A;  4FH8 A;  1R4W A;  1S3C A;  1N8J A;  3SWL A;  5AN1 A;  1MDI A;  1SK2 A;  1EGO A;  3IC4 A;  2OKA A;  3KIJ A;  4OO5 A;  2LRT A;  1R26 A;  3R2Q A;  1URM A;  2ON7 A;  2GT5 A;  3ME7 A;  4I2T A;  3TJK A;  1I9D A;  3GKX A;  2EIR A;  1OC3 A;  3CSI A;  1A0R P;  5HFK A;  2B5Y A;  4GWR A;  1PL2 A;  1VRS D;  2M46 A;  3QDN A;  5D8I A;  3ERF A;  2B6M A;  1ML6 A;  1VGL A;  3IRA A;  2MBS A;  3IAM 2;  1AUC A;  4J57 E;  3HJM A;  4I97 A;  1FB0 A;  4G10 A;  5A5K A;  1PKW A;  1LU4 A;  1QGV A;  2BMX A;  1ERU A;  1AIU A;  4EDY A;  2DMM A;  4MMM A;  3G9B A;  1TJD A;  3I9V 2;  1A8Y A;  4L8E A;  5DJL A;  6GSS A;  4F0C A;  2VCV A;  2VLU A;  1T4Z A;  3VK9 A;  4JED A;  2FWG A;  2FCH A;  4OFN A;  3DRN A;  2DSA A;  1ZYQ B;  2H0G A;  1U3I A;  1O8X A;  1SJI A;  5DCG A;  1ZGN A;  1ZOF A;  2HI7 A;  4N30 A;  3ERW A;  5AIX A;  3HZ4 A;  3WT1 A;  3VUR A;  4TOP A;  2C3T A;  3E3E A;  2EIO A;  4WBJ A;  2JAD A;  2ES7 A;  4MLY A;  1IYH A;  2N5A A;  1PX6 A;  1XPV A;  3F6F A;  3FR3 A;  3ZIJ A;  2QKE A;  4NHW A;  3FR9 A;  3HJO A;  1U88 A;  2V6K A;  1XW6 A;  1SKS B;  2DJ0 A;  4Q5R A;  2H76 A;  1JHB A;  2VM1 A;  3ZLP A;  1OC9 B;  2H1G A;  1GWC A;  3LQ7 A;  1MEK A;  5D9X A;  3FY7 A;  2DJ2 A;  3RAZ A;  1OKD A;  2RUE A;  2GST A;  4JRR A;  5ENU A;  3D4T A;  4IBP A;  4BA7 A;  3S9F A;  1IYI A;  1Z9H A;  1G7O A;  2E2G A;  1PKZ A;  2M72 A;  1W4V A;  1GTA A;  1GP1 A;  3KTL A;  1BED A;  2RM5 A;  5A4V A;  1SJ6 A;  4AJ6 A;  3C1R A;  1E6B A;  3K8N A;  4PNF A;  1YF1 A;  5F0G A;  4ECC A;  4ZB9 A;  2LV3 A;  3LWA A;  3PH9 A;  1GTB A;  1WPI A;  2F9S A;  4TKY A;  3UAP A;  1XCC A;  2VO4 A;  2V41 A;  1SYR A;  2YOI A;  3GMF A;  3TOU A;  4ZL7 A;  1SL2 B;  3IE3 A;  3BCI A;  3DXB A;  4LL1 B;  1A0F A;  2H0H A;  1LJR A;  2MMA A;  4GQF A;  5ECH B;  1B9X C;  1SYX A;  1ABA A;  2XBQ A;  3HYP A;  2H6Z A;  2YWO A;  3GFK A;  2C0D A;  3GUR A;  4KDY A;  2H6X A;  1X9S B;  1ST9 A;  1EEJ A;  4PQ1 A;  2B5X A;  5KN2 A;  1GLP A;  3FRC A;  1B4P A;  4LL4 B;  4MJC A;  3GKN A;  4KDU A;  2Z9S A;  1YEP A;  5G1L A;  6GSY A;  1SU9 A;  1GSY A;  2IWT A;  2MMN A;  5EPF A;  3TKS C;  4ECI A;  4WF5 A;  2AB6 A;  3HZ8 A;  3J7Y k;  2IIY A;  1CQG A;  3UL3 A;  1H75 A;  4HUA A;  1A2L A;  1TRS A;  1UA5 A;  1NHY A;  1SEN A;  4K7N A;  2OJL A;  3GL5 A;  2VL2 C;  1T1V A;  1GH2 A;  1M2B A;  2JZR A;  1G6Y A;  2O85 A;  2C3Q A;  4KE3 A;  1Q4J A;  4GQC A;  2WB9 A;  5ECN B;  2CVD A;  2LJA A;  1FG4 A;  1MDJ A;  1GSQ A;  4J56 E;  12GS A;  4ZXG A;  3UJ1 A;  3C73 A;  2GGT A;  3IR4 A;  2KP2 A;  2VCW A;  4MZC A;  1GUH A;  1SJZ A;  5B7C A;  4HQS A;  2HZE B;  4ZBD A;  5LCZ A;  5FT3 A;  4MJB A;  3TKP A;  3RDW A;  4MAB A;  2MMZ A;  1BX9 A;  2FA8 A;  1EP7 A;  1T8E B;  4MDC A;  4FIW A;  4HI7 A;  4V1A g;  5DVB A;  11GS A;  4XS6 A;  3J7Y b;  1Q98 A;  3OR5 A;  4KH7 A;  4H86 A;  4IEL A;  1CQH A;  1M9A A;  3EE2 A;  2AJQ B;  2YZU A;  5G1K A;  2P31 A;  5HFG A;  2F8F A;  3RBT A;  1X5C A;  2DJ1 A;  1TRU A;  2C0G A;  2WCI A;  3KMO A;  4G2E A;  3EU4 A;  2K8V A;  1K0M A;  2O7K A;  2PU9 C;  1HNB A;  3F4S A;  4OO4 A;  5ECM B;  3F63 A;  2FNO A;  4EE0 A;  4ZL8 A;  1EV9 A;  4ZB8 A;  1SK1 A;  5F05 A;  1S3D A;  1Y25 A;  3TKQ A;  3I6A A;  3I69 A;  4J2F A;  2GQM A;  3VFI A;  5JCW A;  1FAA A;  5ECQ B;  4CW9 A;  1EOH A;  1FB6 A;  1F3A A;  1TXX A;  1X9M B;  2B7K A;  3DWV A;  1MDK A;  2DLX A;  1UVZ A;  4JU5 A;  5KN1 A;  5ID2 B;  1PQN A;  4EF0 A;  1DUG A;  2HXK A;  5GAN D;  1PRX A;  4K7O A;  1ACV A;  2NPB A;  3GIX A;  3JCM L;  5IPH A;  4MZW A;  3TCO A;  1F37 A;  4NV5 A;  5AIS A;  1GTI A;  5G5F A;  1YJ6 A;  1PN9 A;  4N11 A;  1TK8 B;  2DML A;  2H30 A;  1YKC A;  5IOW A;  2KOK A;  1SL1 B;  2JSY A;  2GVP A;  4X0X A;  4DSS B;  5G31 A;  4IHU A;  3L9S A;  1K0A A;  4XTS A;  2VD0 A;  2LRC A;  5H5Q A;  3U5R E;  1R5A A;  3VWV A;  2FGX A;  5FHI A;  2HFD A;  2VLV A;  3BD2 A;  2H72 A;  5DQS A;  1GLQ A;  2IMD A;  3L4N A;  2DC5 A;  1V9W A;  4DSR A;  4F0B A;  5AIV A;  1BJX A;  5JCG A;  1TU7 A;  4P3Y B;  5ECP B;  1WMJ A;  2K6V A;  3LJR A;  3W6G A;  2LRN A;  10GS A;  3HJP A;  1XW9 A;  2FLS A;  4JR6 A;  4FYU A;  4IW9 A;  1TW9 A;  1PD2 1;  3HVV A;  4ZIJ A;  1JFU A;  4XRA A;  3LOR A;  2L5O A;  2KHP A;  5IIZ A;  1FVJ A;  1JLV A;  4KW6 A;  4KUN A;  1A23 A;  1RW1 A;  4MK3 A;  5GST A;  3WGX A;  5JWO B;  3FZ4 A;  4IGJ A;  3DML A;  2N5F A;  1XBS A;  5LD0 A;  6GSU A;  2DJK A;  3H8Q A;  4EDZ A;  1KEB A;  2L6C A;  4ECB A;  1THX A;  2OAC A;  1QMV A;  3ZTL A;  3A2W A;  4K0G A;  16GS A;  1Z3E A;  2F8A A;  4NMU A;  2H75 A;  1G0T A;  4KCE A;  1T7P B;  4AJ8 A;  5EL8 A;  5HR2 A;  4K1F A;  4WXT A;  2N5B A;  3FZ9 A;  2IME A;  3DKS A;  3IK7 A;  5KEJ A;  1AQW A;  5D9T A;  3HVX A;  2C80 A;  3CBU A;  1GRX A;  2HSY A;  2R4V A;  3KJY A;  3F3Q A;  4KDX A;  3ED3 A;  2QSI A;  1PGT A;  4L0W A;  2PUK C;  3ZIV A;  1XWA A;  2LJR A;  3MSZ A;  4Z7X A;  2X8H A;  2LNS A;  4KAE A;  1F6M C;  3GV1 A;  2VL3 A;  2VM2 A;  3BJ5 A;  1K0O A;  3ZRE A;  1XWB A;  2FWH A;  5ELG A;  3Q18 A;  2R5G A;  1NM3 A;  3WD6 A;  4KB3 A;  4PUR A;  2YN1 A;  4LLR A;  4BVY A;  4D73 B;  1Z6N A;  1ZYE A;  2B5E A;  2X64 A;  3HCZ A;  1ZZY A;  4PX1 A;  2I9H A;  3IK9 A;  4KCA A;  3C71 A;  3ZVJ D;  4RUV A;  5DQY A;  1Z6M A;  1GSE A;  1HYU A;  4ACS A;  4EKZ A;  2YZH A;  4BPY A;  3H93 A;  4WR4 A;  2HT9 A;  1ERW A;  2GZZ A;  4QL9 A;  4V1A p;  2OA7 A;  3UBL A;  2DJ3 A;  3M8N A;  3UEM A;  2O8V B;  4GSN A;  5CNW A;  1W89 A;  2GTU A;  3G7J A;  4GCI A;  2XHF A;  1AC1 A;  1QQ2 A;  2HRN A;  4NWY A;  4K6X A;  4E8H A;  5IO0 A;  3KZQ A;  1C72 A;  4TVE A;  2X99 A;  2H66 A;  3TDG A;  1JZD A;  5ECO B;  4MP4 A;  4TR0 A;  4L5L A;  3MNG A;  3KD0 A;  1GL8 A;  1VF4 A;  3EWL A;  3RHB A;  5ECK B;  3W8J A;  3L9U A;  3IA1 A;  2H19 A;  3EVI A;  3KCM A;  2KUC A;  6GSX A;  1VF1 A;  2LNT A;  2YP6 A;  3FR6 A;  3ERG A;  1GSS A;  1A2J A;  3DEX A;  4POK A;  3Q19 A;  5G2Z A;  1V58 A;  1DSB A;  5IPG A;  4ZBA A;  1XVQ A;  1HD2 A;  4Q5Q A;  2HLS A;  3NOF A;  3W8S A;  4I5Q A;  2VCZ A;  1XWG A;  1HQO A;  3VWW A;  3N9J A;  18GS A;  2RII A;  2TRC P;  4EVM A;  2GQK A;  2LTK A;  7GSS A;  1G7E A;  5FWG A;  3EUR A;  1YQ1 A;  1PSQ A;  2WGR A;  2JZT A;  4LMW A;  1F2E A;  2PVO C;  1Z5Y E;  3APQ A;  3LFL A;  2ZNM A;  3G7I A;  3TGZ A;  1FHE A; 
#chains in the Genus database with same CATH topology
 3H4K A;  2CT6 A;  5IMC A;  4K7I A;  2R2J A;  2YAN A;  4AF2 A;  1AXD A;  1O8W A;  4TR3 A;  1EEM A;  1M2A A;  3QFB C;  4POL A;  3GX0 A;  3IOS A;  1SK0 A;  3FMW A;  1A8L A;  1QUW A;  1M2D A;  2C0E A;  4HDE A;  2EC4 A;  3CXG A;  4PNG A;  2VD1 A;  2VL9 A;  1WOU A;  3TJF A;  3IHQ A;  1EWX A;  2CVK A;  3KM6 A;  5B8B A;  3IPZ A;  5DBQ A;  2VCQ A;  2CAQ A;  4RQX A;  3KTB A;  4XCS A;  4GSS A;  4X1U A;  2ALB A;  4KND A;  5CP1 A;  2L59 A;  3LYP A;  5ABR A;  2QC7 A;  3ZMK A;  1J08 A;  4I2U A;  2H70 A;  1Z7P A;  3IV4 A;  2IL3 A;  2JU5 A;  4ILF A;  3QCP A;  1USB A;  3TKR A;  1JZW A;  1XG8 A;  2JAC A;  2YV9 A;  4HEA 2;  1MTC A;  3L0H A;  3BOA A;  2MZC A;  2FD3 A;  5CYY A;  2A4V A;  1AW9 A;  5ECR B;  3QPM A;  4YQU A;  2GS3 A;  1BG5 A;  1F9M A;  4X43 A;  1OE8 A;  2AAW A;  3D0Z A;  3GST A;  4Q5F A;  4ML6 A;  2VAF A;  1KBN A;  1OAZ A;  5JWR B;  3GSS A;  5J9C A;  1TU8 A;  5E4W A;  2G0F A;  5H5S A;  3APS A;  4KSM A;  2HRA A;  3C1S A;  4EXJ A;  4F82 A;  1DE2 A;  1YKA A;  2CV4 A;  5E59 A;  1X9W B;  3N5O A;  1GUL A;  2ZUP A;  2LS5 A;  4HOJ A;  3UVH A;  3UOM A;  2WDU A;  2C8U A;  4XIH A;  3F9U A;  1K0C A;  2RUF A;  4EO3 A;  3GYK A;  4WET A;  5AGY A;  1EV4 A;  4KA0 A;  3MDK A;  2H6Y A;  1PMT A;  3LXZ A;  3QMX A;  2DIZ A;  4TRX A;  1O6J A;  3D4M A;  4JR4 A;  2GSQ A;  2L5L A;  3D5J A;  2H73 A;  1GUK A;  1SKW B;  3QAV A;  1OVN A;  4WKW A;  1M3J A;  4MPF A;  4V2L A;  2GLR A;  1T4Y A;  4PXO A;  1K0D A;  1GUM A;  1N2A A;  3GUS A;  3UBK A;  1TDI A;  1G6W A;  2OE3 A;  2XC2 A;  1E2Y A;  5CRH A;  2WUL A;  1OE7 A;  5CO3 A;  3TB2 A;  1K3Y A;  3KXO A;  2FWF A;  1Y6E A;  4IQ1 A;  3FHK A;  2BTO T;  2OE1 A;  1EOG A;  3VI7 A;  1AQV A;  2H1D A;  5HFI A;  2AV4 A;  2OBK A;  3IBH A;  2PWJ A;  1BQ7 A;  3BCK A;  5H5R A;  2MMO A;  5HR3 A;  2B1K A;  3HXS A;  2VOC A;  1F3B A;  3TJB A;  4MZB A;  4O5R A;  2H0I A;  20GS A;  3F3R A;  4PUF C;  2O89 A;  4WF4 A;  4K0N A;  4KF9 A;  3SBC A;  4GRF A;  4TR1 A;  3EU3 A;  3U6V A;  4TN8 A;  4EUY A;  2RLI A;  1FVK A;  1J9B A;  2NDO A;  2CA8 A;  3BBY A;  1HNA A;  4Z2R A;  5CRG A;  3M3M A;  4AGS A;  1SD9 A;  2L4Q A;  5DAL A;  4ECJ A;  1R7H A;  2R6K A;  1OC8 A;  1VF2 A;  2WFC A;  4MF5 A;  4JBB A;  3DVX A;  4PQH A;  4TXO A;  2CZ3 A;  4MH3 A;  3FW2 A;  1TI3 A;  1X5D A;  2GT6 A;  1O85 A;  5HR1 A;  1I5G A;  2WJU A;  2L57 A;  1B8X A;  1EGR A;  2QA2 A;  3E9J B;  2C0F A;  4CDO A;  2HSM A;  2X49 A;  3MAK A;  3F6D A;  5INY A;  1MD3 A;  3DGQ A;  3TRQ A;  1WRY A;  3ISO A;  4HU7 A;  4FYB A;  3TRP A;  2PN8 A;  1YY7 A;  2YWN A;  2HRF A;  3D22 A;  2K8S A;  5HR0 A;  3TKS E;  1S3R A;  5DCH A;  2VLT A;  5COH A;  3QAW A;  4FQU A;  5KN0 A;  1V57 A;  2HZF A;  2X8C A;  3RPN A;  5IM9 A;  1X5E A;  4NPB A;  2OAD A;  4KX4 A;  1GSD A;  3FZ5 A;  1K0B A;  2R37 A;  1J0F A;  1AAZ A;  4KGI A;  5KOX A;  3LXT A;  3MWH A;  4AJ7 A;  5A4W A;  3LSZ A;  2I3Y A;  4G0L A;  1ZCP A;  3Q74 A;  2NVL A;  4QL7 A;  5CRE A;  2GZP A;  4XS1 A;  3EIN A;  2GDR A;  3FEU A;  3GRX A;  1TRV A;  3L9V A;  2VCX A;  2IJY A;  3ZL5 A;  2OBI A;  3VLN A;  1TTZ A;  2H1B A;  3FZA A;  1BAY A;  3ZYW A;  1B9Y C;  4G9H A;  1RQM A;  3F0I A;  2WZ9 A;  1LBK A;  5IMD A;  5IQY A;  3EYT A;  1T3B A;  2VL2 A;  4V2M A;  2E7P A;  4K9Z A;  3WT2 A;  3M9K A;  4I8B A;  4G19 A;  1U3A A;  2V32 A;  2L6D A;  2B3S A;  2PMT A;  3CTF A;  1JZO A;  4G0K A;  3DD3 A;  1PN0 A;  1H4O A;  2FWE A;  2GSS A;  1RK4 A;  3ZIT A;  3KH7 A;  5F06 A;  2HE3 A;  4IP1 A;  3QFA C;  1GNE A;  2V2G A;  1R5P A;  1ZMA A;  4OFT A;  2E0Q A;  4PUA A;  5IMF A;  3P2A A;  4RQR A;  1V40 A;  1SD8 A;  3LGC A;  2R3X A;  1SL0 B;  3F4R A;  4DEJ A;  3LW9 A;  2PPT A;  4O92 A;  2LKU A;  2REM A;  1GSU A;  3WYW A;  1WE0 A;  1PL1 A;  3VWX A;  2FA4 A;  2VIM A;  1T00 A;  3UAR A;  1OC9 A;  2GQL A;  3PGT A;  3KH9 A;  4YAV A;  2WRT A;  3IXR A;  17GS A;  2JL4 A;  4Q5N A;  5D9V A;  3IHG A;  2PGT A;  4HZ4 A;  3NIV A;  2B1L A;  4NV2 A;  3QD9 A;  5A4U A;  2IFQ A;  4ID0 A;  5JCU A;  2B7J A;  1WWJ A;  1AQX A;  2BJX A;  2GSR A;  1VF3 A;  4IN0 A;  5DDL A;  5B8A A;  3C7M A;  2XPD A;  2I1U A;  3O3T A;  1YDK A;  2DJJ A;  4QQ7 A;  1QXH A;  2HSH A;  2J23 A;  1GTU A;  1KNG A;  4CY8 A;  4OMV A;  3GKK A;  3ZFB A;  2CAI A;  5IOX A;  3V1W A;  3EMP A;  2AYT A;  2CVB A;  5C04 A;  2QGV A;  5GZZ B;  1U87 A;  3LYK A;  5C00 A;  5LNK e;  2JSZ A;  2YWI A;  4NXI A;  4G0I A;  2FY6 A;  2K9F A;  4MH2 A;  3WGD A;  3PIN A;  22GS A;  3A3T A;  5IO2 A;  2HNL A;  1PX7 A;  3ZRD A;  3US3 A;  3GN3 A;  1XFL A;  3EMX A;  2LST A;  3CMI A;  1NHO A;  4MA9 A;  3FYG A;  4ZB6 A;  2M80 A;  4HJ2 A;  4OCF A;  4POB A;  1JZR A;  5GSS A;  1THO A;  4FO5 A;  2A2R A;  3I43 A;  4BVY B;  1K3O A;  3KP9 A;  5B6M A;  5KOW A;  2IPA A;  5BRT A;  1MD4 A;  5HQP A;  3DVW A;  1XW5 A;  14GS A;  5KN3 A;  3P7X A;  1FOV A;  3P8W A;  1O7U A;  4RI6 A;  3WGE A;  2AHE A;  2G2Q A;  4CHS A;  2H71 A;  1NW2 A;  2CQ9 A;  3HY2 A;  3GH9 A;  3HDC A;  2LQQ A;  3M0F A;  2IFQ B;  2A2S A;  5J5N A;  2K18 A;  4OWY A;  4JZQ A;  5GAP D;  1M9B A;  3AY8 A;  3UMA A;  2D2Z A;  3UVT A;  5CRD A;  4N10 A;  4XHM A;  1TRW A;  2LQO A;  2ZCT A;  4YH2 A;  1M3I A;  3G7Y A;  3LG6 A;  1WP0 A;  2ON5 A;  1UC7 A;  1ZYN A;  3GL3 A;  4PQI A;  1XXU A;  2H74 A;  3GKM A;  4F9Z A;  5J3R A;  2C3N A;  5D96 A;  3UIW A;  3H1N A;  2HZE A;  4GTU A;  1M7T A;  2DIY A;  1K3L A;  4YQV A;  1FW1 A;  4XRD A;  1DE1 A;  1B4Q A;  5ECS A;  3M9J A;  5ELA A;  3VI5 A;  3HKR A;  3LEF A;  3TOT A;  4GST A;  3VPQ A;  4DVC A;  2X4A A;  4OCE A;  4IS0 A;  2HRK A;  1O81 A;  3A2V A;  1GSF A;  2H1A A;  1YZX A;  4BVX A;  2XBI A;  1PA3 A;  4NHZ A;  3EPT A;  2IMI A;  2P5Q A;  2RM6 A;  4K8M A;  1A24 A;  2TIR A;  4HU9 A;  2OE0 A;  3D21 A;  1QK8 A;  3CSH A;  3ME8 A;  6GSV A;  1OYJ A;  2QA1 A;  5CRW A;  4HZ2 A;  1HNC A;  5IMV A;  4L5O A;  4RI7 A;  2NTO A;  2LUS A;  5JWQ B;  2I81 A;  3H79 A;  3CTG A;  5G5E A;  1TK5 B;  2KP1 A;  1XZO A;  2X8G A;  4K5R A;  5EY6 A;  3ZFL A;  3TJJ A;  1SKR B;  4OFM A;  2P0G A;  2VCT A;  3TUE A;  6GST A;  3RPP A;  4OD7 A;  3TRX A;  3C8E A;  1Z7R A;  2YNX A;  4MF7 A;  5ID2 A;  2MYG A;  1TK0 B;  2IMF A;  2E2M A;  4N0V A;  4EL1 A;  1QFN A;  3CRU A;  1TKD B;  1ZL9 A;  2HYX A;  3HHV A;  4XS4 A;  4BL7 A;  2CX3 A;  1GNW A;  3VPT A;  1YF0 A;  4V2N A;  1FOH A;  1KTE A;  2KLX A;  4PGT A;  4ZBB A;  4GF0 A;  4L0U A;  5F8B A;  1A2M A;  3GTU A;  3O6T A;  3FKF A;  4I6X A;  4DSS A;  4KSO A;  3CQF A;  4BWS A;  4WR5 A;  3HD5 A;  3ZZX A;  3ZVJ A;  2V6O A;  1DBY A;  3A5W A;  3Q6O A;  2YJH A;  3D6I A;  2WS2 A;  1XWC A;  5DJM A;  3L78 A;  5DAK A;  4HS1 A;  4ULX A;  4YKG A;  2TRX A;  2C4J A;  2GZY A;  2P5R A;  3QOU A;  4TXV A;  2YV7 A;  2I4A A;  1M99 A;  4TW5 A;  5D73 A;  5L71 A;  3TJG A;  4ZL9 A;  4NAX A;  5D93 A;  3KEB A;  4GXZ A;  1B48 A;  2FUG 2;  4YAP A;  3NZN A;  1S3A A;  4O7H A;  4DSQ A;  3CSJ A;  1K0N A;  4F2I A;  1ERV A;  1XOA A;  3EC3 A;  3IDV A;  3DIE A;  1EP8 A;  3GH6 A;  4BWQ A;  4MCU A;  2YJ7 A;  1U6T A;  2LEG A;  2LJK A;  2FHE A;  2IMK A;  3GA4 A;  2EIQ A;  4O32 A;  3IAS 2;  3QAG A;  3M1G A;  1UN2 A;  1V2A A;  3A2X A;  4GLT A;  5ECI B;  4IVF A;  4XS4 B;  2YPM A;  2VUP A;  4BL7 B;  3P90 A;  4IKH A;  3KP8 A;  4MPG A;  2PER A;  3GTU B;  2DBC A;  2A2P A;  1BYE A;  2YCD A;  4K2D A;  5B6N A;  4JE1 A;  4TR4 A;  4ML1 A;  3F4T A;  2F51 A;  3GHA A;  1YEX A;  5EVO A;  3QR6 A;  3APO A;  2L4C A;  1X0R A;  2MBT A;  2J9H A;  3HA9 A;  1NSW A;  2H8L A;  1TOF A;  1ILO A;  2AUV A;  4POM A;  1EZK A;  1WIK A;  5DAK B;  4HJM A;  3CYN A;  8GSS A;  4HQZ A;  3GX8 A;  4ZIL A;  1XIY A;  3O76 A;  3DYR A;  4ISD A;  1ON4 A;  2YWM A;  4F03 A;  1JLW A;  4TR1 B;  4YQM A;  3HVN A;  4Z2U A;  4WEY A;  3HVS A;  1FO5 A;  3VWU A;  5J4U A;  4YKF A;  5D9W A;  3RHC A;  2V1M A;  3GNJ A;  4E8E A;  4D73 A;  5DAL B;  3TKS A;  4MF6 A;  2CZ2 A;  4FYC A;  1O73 A;  4IJI A;  2JZS A;  2XPE A;  1XOB A;  4LA1 A;  4LMV A;  4IJ3 A;  5CAX A;  4TXO B;  1ERT A;  1XVW A;  3ZML A;  9GSS A;  5F07 A;  2H01 A;  3E0U A;  1XWK A;  2NBS A;  3CRT A;  3F8U A;  2R0G A;  3A5I A;  1M0U A;  13GS A;  2PBJ A;  1WJK A;  1OKT A;  19GS A;  4MJA A;  5IMA A;  4EIP A;  5IMZ A;  4IQA A;  2F3M A;  1TI1 A;  5ECL B;  5J9B A;  3PR8 A;  1V98 A;  2CX4 A;  5G30 A;  2IN3 A;  4EC0 A;  2O87 A;  3KMN A;  1TP9 A;  3KGK A;  4WBR D;  2PVQ A;  2C1Y A;  5J41 A;  6GSW A;  4N0Z A;  4IP6 A;  4MJE A;  3FK8 A;  4FH8 A;  1R4W A;  1S3C A;  1N8J A;  3SWL A;  5AN1 A;  1MDI A;  1SK2 A;  1EGO A;  3IC4 A;  2OKA A;  3KIJ A;  4OO5 A;  2LRT A;  1R26 A;  3R2Q A;  1URM A;  4BIK A;  2ON7 A;  2GT5 A;  3ME7 A;  4I2T A;  3TJK A;  1I9D A;  3GKX A;  2EIR A;  1OC3 A;  3CSI A;  1A0R P;  5HFK A;  2B5Y A;  1ZYP A;  4GWR A;  1PL2 A;  1VRS D;  2M46 A;  3QDN A;  5D8I A;  3ERF A;  2B6M A;  1ML6 A;  1VGL A;  3IRA A;  2MBS A;  3IAM 2;  1AUC A;  4J57 E;  3HJM A;  4I97 A;  1FB0 A;  4G10 A;  5A5K A;  1PKW A;  1LU4 A;  1QGV A;  2BMX A;  1ERU A;  1AIU A;  4EDY A;  2DMM A;  4MMM A;  3G9B A;  1TJD A;  3I9V 2;  1A8Y A;  4L8E A;  5DJL A;  6GSS A;  4F0C A;  4CY6 A;  2VCV A;  2VLU A;  3PPU A;  1T4Z A;  3VK9 A;  4JED A;  2FWG A;  2FCH A;  4OFN A;  3DRN A;  2DSA A;  1ZYQ B;  4EIQ A;  2H0G A;  1U3I A;  1O8X A;  1SJI A;  5DCG A;  1ZGN A;  1ZOF A;  2HI7 A;  4N30 A;  3ERW A;  5AIX A;  3HZ4 A;  3WT1 A;  3VUR A;  4TOP A;  2C3T A;  3E3E A;  2EIO A;  4WBJ A;  2JAD A;  2ES7 A;  4MLY A;  1IYH A;  2N5A A;  1PX6 A;  1XPV A;  3F6F A;  3FR3 A;  3ZIJ A;  2QKE A;  4NHW A;  3FR9 A;  3HJO A;  1U88 A;  2V6K A;  1XW6 A;  1SKS B;  2DJ0 A;  4Q5R A;  2H76 A;  1JHB A;  2VM1 A;  3ZLP A;  1OC9 B;  2H1G A;  1GWC A;  3LQ7 A;  1MEK A;  3R3E A;  5D9X A;  3FY7 A;  2DJ2 A;  3MYD A;  3RAZ A;  1OKD A;  2RUE A;  2GST A;  4JRR A;  5ENU A;  3D4T A;  4IBP A;  4BA7 A;  3S9F A;  1IYI A;  1Z9H A;  1G7O A;  2E2G A;  1PKZ A;  2M72 A;  1W4V A;  1GTA A;  1GP1 A;  3KTL A;  1BED A;  2RM5 A;  5A4V A;  1SJ6 A;  4AJ6 A;  3C1R A;  1E6B A;  3K8N A;  4PNF A;  1YF1 A;  5F0G A;  4ECC A;  4ZB9 A;  2LV3 A;  3LWA A;  3PH9 A;  1GTB A;  1WPI A;  2F9S A;  4TKY A;  3UAP A;  1XCC A;  2VO4 A;  2V41 A;  1SYR A;  2YOI A;  3GMF A;  3TOU A;  4ZL7 A;  1SL2 B;  3IE3 A;  3BCI A;  3DXB A;  4LL1 B;  1A0F A;  2H0H A;  1LJR A;  2MMA A;  4GQF A;  5ECH B;  1B9X C;  1SYX A;  1ABA A;  2XBQ A;  3HYP A;  2H6Z A;  2YWO A;  3GFK A;  2C0D A;  3GUR A;  4KDY A;  2H6X A;  1X9S B;  1ST9 A;  1EEJ A;  4PQ1 A;  2B5X A;  5KN2 A;  1GLP A;  3FRC A;  1B4P A;  4LL4 B;  4MJC A;  3GKN A;  4KDU A;  2Z9S A;  1YEP A;  5G1L A;  6GSY A;  1SU9 A;  1GSY A;  2IWT A;  2MMN A;  5EPF A;  3TKS C;  4ECI A;  4WF5 A;  2AB6 A;  3HZ8 A;  3J7Y k;  2IIY A;  1CQG A;  3UL3 A;  1H75 A;  4HUA A;  4O5Q A;  5BMU A;  1A2L A;  1TRS A;  1UA5 A;  1NHY A;  1SEN A;  4K7N A;  2OJL A;  3GL5 A;  2VL2 C;  1T1V A;  1GH2 A;  1M2B A;  2JZR A;  1G6Y A;  2O85 A;  2C3Q A;  4KE3 A;  1Q4J A;  4GQC A;  2WB9 A;  5ECN B;  2CVD A;  2LJA A;  1FG4 A;  1MDJ A;  1GSQ A;  4J56 E;  12GS A;  4ZXG A;  3UJ1 A;  3C73 A;  2GGT A;  3IR4 A;  4PTS A;  2KP2 A;  2VCW A;  4MZC A;  1GUH A;  1SJZ A;  5B7C A;  4HQS A;  2HZE B;  4ZBD A;  5LCZ A;  5FT3 A;  4MJB A;  3TKP A;  2R0C A;  3RDW A;  4MAB A;  2MMZ A;  1BX9 A;  2FA8 A;  1EP7 A;  1T8E B;  4MDC A;  4FIW A;  4HI7 A;  4V1A g;  5DVB A;  4HSC X;  11GS A;  4XS6 A;  3J7Y b;  1Q98 A;  3OR5 A;  4KH7 A;  4H86 A;  4IEL A;  1CQH A;  1M9A A;  3EE2 A;  4BVX B;  2AJQ B;  2YZU A;  5G1K A;  4X4J A;  2P31 A;  5HFG A;  2F8F A;  3RBT A;  4O5U A;  1X5C A;  2DJ1 A;  1TRU A;  2C0G A;  2WCI A;  3KMO A;  4G2E A;  3EU4 A;  2K8V A;  1K0M A;  2O7K A;  2PU9 C;  1HNB A;  3F4S A;  4OO4 A;  5ECM B;  3F63 A;  2FNO A;  4EE0 A;  4ZL8 A;  1EV9 A;  4MNN A;  4ZB8 A;  1SK1 A;  5F05 A;  1S3D A;  1Y25 A;  3TKQ A;  3I6A A;  3I69 A;  4J2F A;  2GQM A;  2DKI A;  3VFI A;  5JCW A;  1FAA A;  5ECQ B;  4CW9 A;  1EOH A;  1FB6 A;  1F3A A;  1TXX A;  3MIX A;  1X9M B;  2B7K A;  3DWV A;  1MDK A;  2DLX A;  1UVZ A;  4JU5 A;  5KN1 A;  5ID2 B;  1PQN A;  4EF0 A;  1DUG A;  4ICY A;  2HXK A;  5GAN D;  1PRX A;  4K7O A;  1ACV A;  2NPB A;  3GIX A;  3JCM L;  5IPH A;  4MZW A;  3TCO A;  2UZ8 A;  1F37 A;  4NV5 A;  5AIS A;  1GTI A;  5G5F A;  2A4H A;  1YJ6 A;  1PN9 A;  4N11 A;  1TK8 B;  2DML A;  2H30 A;  1YKC A;  5IOW A;  2KOK A;  1SL1 B;  2JSY A;  2GVP A;  4X0X A;  4DSS B;  5G31 A;  4IHU A;  3L9S A;  1K0A A;  4XTS A;  2VD0 A;  2LRC A;  5H5Q A;  3U5R E;  1R5A A;  3VWV A;  2FGX A;  5FHI A;  2HFD A;  2VLV A;  3BD2 A;  2H72 A;  5DQS A;  1GLQ A;  2IMD A;  3L4N A;  4Z2T A;  2DC5 A;  1V9W A;  4DSR A;  4F0B A;  5AIV A;  1BJX A;  5JCG A;  1TU7 A;  4P3Y B;  5ECP B;  1WMJ A;  2K6V A;  3LJR A;  3W6G A;  2LRN A;  10GS A;  3HJP A;  1XW9 A;  2FLS A;  4JR6 A;  4FYU A;  4IW9 A;  4K2X A;  1TW9 A;  1PD2 1;  3HVV A;  4ZIJ A;  1JFU A;  4K5S A;  3LOR A;  4XRA A;  2L5O A;  3IC8 A;  2KHP A;  5IIZ A;  1FVJ A;  1JLV A;  4KW6 A;  4KUN A;  1A23 A;  1RW1 A;  4MK3 A;  5GST A;  3WGX A;  5JWO B;  3FZ4 A;  4IGJ A;  3DML A;  2N5F A;  1XBS A;  5LD0 A;  6GSU A;  2DJK A;  3H8Q A;  4EDZ A;  1KEB A;  2L6C A;  4ECB A;  1THX A;  2OAC A;  1QMV A;  3ZTL A;  3A2W A;  4K0G A;  16GS A;  1Z3E A;  2F8A A;  4NMU A;  2H75 A;  4A5P A;  1G0T A;  4KCE A;  1T7P B;  4AJ8 A;  5EL8 A;  5HR2 A;  4K1F A;  4WXT A;  2N5B A;  3FZ9 A;  2IME A;  3DKS A;  3IK7 A;  5KEJ A;  1AQW A;  5D9T A;  3HVX A;  2C80 A;  3CBU A;  1GRX A;  2HSY A;  2R4V A;  3KJY A;  3F3Q A;  1PFO A;  4KDX A;  3ED3 A;  2QSI A;  1PGT A;  4L0W A;  2PUK C;  3ZIV A;  1XWA A;  2LJR A;  3MSZ A;  4Z7X A;  2X8H A;  2LNS A;  4KAE A;  1F6M C;  3GV1 A;  2VL3 A;  2VM2 A;  3BJ5 A;  1K0O A;  3ZRE A;  1XWB A;  2FWH A;  5ELG A;  3Q18 A;  2R5G A;  1NM3 A;  3WD6 A;  4KB3 A;  4PUR A;  2YN1 A;  4LLR A;  4BVY A;  4D73 B;  2DKH A;  1Z6N A;  1ZYE A;  2B5E A;  2X64 A;  3HCZ A;  1ZZY A;  4PX1 A;  2I9H A;  3IK9 A;  4KCA A;  3C71 A;  3ZVJ D;  4RUV A;  5DQY A;  1Z6M A;  1GSE A;  1HYU A;  4ACS A;  4EKZ A;  2YZH A;  4BPY A;  3H93 A;  4WR4 A;  2R0P A;  2HT9 A;  1ERW A;  2GZZ A;  4QL9 A;  4V1A p;  4USS A;  2OA7 A;  3UBL A;  2DJ3 A;  3M8N A;  3UEM A;  2O8V B;  4GSN A;  5CNW A;  1W89 A;  2GTU A;  3G7J A;  4GCI A;  2XHF A;  1AC1 A;  1QQ2 A;  2HRN A;  4NWY A;  4K6X A;  4E8H A;  5IO0 A;  3KZQ A;  1C72 A;  4TVE A;  2X99 A;  2H66 A;  3TDG A;  1JZD A;  5ECO B;  4MP4 A;  4TR0 A;  4L5L A;  3MNG A;  3KD0 A;  1GL8 A;  1VF4 A;  3EWL A;  3RHB A;  5ECK B;  3W8J A;  3L9U A;  3IA1 A;  2H19 A;  3EVI A;  3KCM A;  2KUC A;  6GSX A;  1VF1 A;  2LNT A;  2YP6 A;  3FR6 A;  3ERG A;  1GSS A;  1A2J A;  3DEX A;  4POK A;  3Q19 A;  5G2Z A;  1V58 A;  1DSB A;  5IPG A;  4ZBA A;  1XVQ A;  1HD2 A;  4Q5Q A;  2HLS A;  3NOF A;  3W8S A;  4I5Q A;  2VCZ A;  1XWG A;  1HQO A;  3VWW A;  3N9J A;  18GS A;  2RII A;  2TRC P;  4EVM A;  2GQK A;  2LTK A;  7GSS A;  1G7E A;  5FWG A;  3EUR A;  1YQ1 A;  1PSQ A;  2WGR A;  2JZT A;  4LMW A;  1F2E A;  2PVO C;  1Z5Y E;  3APQ A;  3LFL A;  2ZNM A;  3G7I A;  3TGZ A;  1FHE A; 
#chains in the Genus database with same CATH homology
 3H4K A;  2CT6 A;  5IMC A;  4K7I A;  2R2J A;  2YAN A;  4AF2 A;  1AXD A;  1O8W A;  4TR3 A;  1EEM A;  1M2A A;  3QFB C;  4POL A;  3GX0 A;  3IOS A;  1SK0 A;  3FMW A;  1A8L A;  1QUW A;  1M2D A;  2C0E A;  4HDE A;  2EC4 A;  3CXG A;  4PNG A;  2VD1 A;  2VL9 A;  1WOU A;  3TJF A;  3IHQ A;  1EWX A;  2CVK A;  3KM6 A;  5B8B A;  3IPZ A;  5DBQ A;  2VCQ A;  2CAQ A;  4RQX A;  3KTB A;  4XCS A;  4GSS A;  4X1U A;  2ALB A;  4KND A;  5CP1 A;  2L59 A;  3LYP A;  5ABR A;  2QC7 A;  3ZMK A;  1J08 A;  4I2U A;  2H70 A;  1Z7P A;  3IV4 A;  2IL3 A;  2JU5 A;  4ILF A;  3QCP A;  1USB A;  3TKR A;  1JZW A;  2JAC A;  2YV9 A;  4HEA 2;  1MTC A;  3L0H A;  3BOA A;  2MZC A;  2FD3 A;  5CYY A;  2A4V A;  1AW9 A;  5ECR B;  3QPM A;  4YQU A;  2GS3 A;  1BG5 A;  1F9M A;  4X43 A;  1OE8 A;  2AAW A;  3D0Z A;  3GST A;  4Q5F A;  4ML6 A;  2VAF A;  1KBN A;  1OAZ A;  5JWR B;  3GSS A;  5J9C A;  1TU8 A;  5E4W A;  2G0F A;  5H5S A;  3APS A;  4KSM A;  2HRA A;  3C1S A;  4EXJ A;  4F82 A;  1DE2 A;  1YKA A;  2CV4 A;  5E59 A;  1X9W B;  3N5O A;  1GUL A;  2ZUP A;  2LS5 A;  4HOJ A;  3UVH A;  3UOM A;  2WDU A;  2C8U A;  4XIH A;  3F9U A;  1K0C A;  2RUF A;  4EO3 A;  3GYK A;  4WET A;  5AGY A;  1EV4 A;  4KA0 A;  3MDK A;  2H6Y A;  1PMT A;  3LXZ A;  3QMX A;  2DIZ A;  4TRX A;  1O6J A;  3D4M A;  4JR4 A;  2GSQ A;  2L5L A;  3D5J A;  2H73 A;  1GUK A;  1SKW B;  3QAV A;  1OVN A;  4WKW A;  4MPF A;  4V2L A;  2GLR A;  1T4Y A;  4PXO A;  1K0D A;  1GUM A;  1N2A A;  3GUS A;  3UBK A;  1TDI A;  1G6W A;  2OE3 A;  2XC2 A;  1E2Y A;  5CRH A;  2WUL A;  1OE7 A;  5CO3 A;  3TB2 A;  1K3Y A;  3KXO A;  2FWF A;  1Y6E A;  4IQ1 A;  3FHK A;  2BTO T;  2OE1 A;  1EOG A;  3VI7 A;  1AQV A;  2H1D A;  5HFI A;  2AV4 A;  2OBK A;  3IBH A;  2PWJ A;  1BQ7 A;  3BCK A;  5H5R A;  2MMO A;  5HR3 A;  2B1K A;  3HXS A;  2VOC A;  1F3B A;  3TJB A;  4MZB A;  4O5R A;  2H0I A;  20GS A;  3F3R A;  4PUF C;  2O89 A;  4WF4 A;  4K0N A;  4KF9 A;  3SBC A;  4GRF A;  4TR1 A;  3EU3 A;  3U6V A;  4TN8 A;  4EUY A;  2RLI A;  1FVK A;  1J9B A;  2NDO A;  2CA8 A;  3BBY A;  1HNA A;  4Z2R A;  5CRG A;  3M3M A;  4AGS A;  1SD9 A;  2L4Q A;  5DAL A;  4ECJ A;  1R7H A;  2R6K A;  1OC8 A;  1VF2 A;  2WFC A;  4MF5 A;  4JBB A;  3DVX A;  4PQH A;  4TXO A;  2CZ3 A;  4MH3 A;  3FW2 A;  1TI3 A;  1X5D A;  2GT6 A;  1O85 A;  5HR1 A;  1I5G A;  2WJU A;  2L57 A;  1B8X A;  1EGR A;  2QA2 A;  3E9J B;  2C0F A;  4CDO A;  2HSM A;  2X49 A;  3MAK A;  3F6D A;  5INY A;  1MD3 A;  3DGQ A;  3TRQ A;  1WRY A;  3ISO A;  4HU7 A;  4FYB A;  3TRP A;  2PN8 A;  1YY7 A;  2YWN A;  2HRF A;  3D22 A;  2K8S A;  5HR0 A;  3TKS E;  5DCH A;  2VLT A;  5COH A;  3QAW A;  4FQU A;  5KN0 A;  1V57 A;  2HZF A;  2X8C A;  3RPN A;  5IM9 A;  1X5E A;  4NPB A;  2OAD A;  4KX4 A;  1GSD A;  3FZ5 A;  1K0B A;  2R37 A;  1J0F A;  1AAZ A;  4KGI A;  5KOX A;  3LXT A;  3MWH A;  4AJ7 A;  5A4W A;  3LSZ A;  2I3Y A;  4G0L A;  1ZCP A;  3Q74 A;  2NVL A;  4QL7 A;  5CRE A;  2GZP A;  4XS1 A;  3EIN A;  2GDR A;  3FEU A;  3GRX A;  1TRV A;  3L9V A;  2VCX A;  2IJY A;  3ZL5 A;  2OBI A;  3VLN A;  1TTZ A;  2H1B A;  3FZA A;  1BAY A;  3ZYW A;  1B9Y C;  4G9H A;  1RQM A;  3F0I A;  2WZ9 A;  1LBK A;  5IMD A;  5IQY A;  3EYT A;  1T3B A;  2VL2 A;  4V2M A;  2E7P A;  4K9Z A;  3WT2 A;  3M9K A;  4I8B A;  4G19 A;  1U3A A;  2V32 A;  2L6D A;  2B3S A;  2PMT A;  3CTF A;  1JZO A;  4G0K A;  3DD3 A;  1PN0 A;  1H4O A;  2FWE A;  2GSS A;  1RK4 A;  3ZIT A;  3KH7 A;  5F06 A;  2HE3 A;  4IP1 A;  3QFA C;  1GNE A;  2V2G A;  1R5P A;  1ZMA A;  4OFT A;  2E0Q A;  4PUA A;  5IMF A;  3P2A A;  4RQR A;  1V40 A;  1SD8 A;  3LGC A;  2R3X A;  1SL0 B;  3F4R A;  4DEJ A;  3LW9 A;  2PPT A;  4O92 A;  2LKU A;  2REM A;  1GSU A;  3WYW A;  1WE0 A;  1PL1 A;  3VWX A;  2FA4 A;  2VIM A;  1T00 A;  3UAR A;  1OC9 A;  2GQL A;  3PGT A;  3KH9 A;  4YAV A;  2WRT A;  3IXR A;  17GS A;  2JL4 A;  4Q5N A;  5D9V A;  3IHG A;  2PGT A;  4HZ4 A;  3NIV A;  2B1L A;  4NV2 A;  3QD9 A;  5A4U A;  2IFQ A;  4ID0 A;  5JCU A;  2B7J A;  1WWJ A;  1AQX A;  2BJX A;  2GSR A;  1VF3 A;  4IN0 A;  5DDL A;  5B8A A;  3C7M A;  2XPD A;  2I1U A;  3O3T A;  1YDK A;  2DJJ A;  4QQ7 A;  1QXH A;  2HSH A;  2J23 A;  1GTU A;  1KNG A;  4CY8 A;  4OMV A;  3GKK A;  3ZFB A;  2CAI A;  5IOX A;  3V1W A;  3EMP A;  2AYT A;  2CVB A;  5C04 A;  2QGV A;  5GZZ B;  1U87 A;  3LYK A;  5C00 A;  5LNK e;  2JSZ A;  2YWI A;  4NXI A;  4G0I A;  2FY6 A;  2K9F A;  4MH2 A;  3WGD A;  3PIN A;  22GS A;  3A3T A;  5IO2 A;  2HNL A;  1PX7 A;  3ZRD A;  3US3 A;  3GN3 A;  1XFL A;  3EMX A;  2LST A;  3CMI A;  1NHO A;  4MA9 A;  3FYG A;  4ZB6 A;  2M80 A;  4HJ2 A;  4OCF A;  4POB A;  1JZR A;  5GSS A;  1THO A;  4FO5 A;  2A2R A;  3I43 A;  4BVY B;  1K3O A;  3KP9 A;  5B6M A;  5KOW A;  2IPA A;  5BRT A;  1MD4 A;  5HQP A;  3DVW A;  1XW5 A;  14GS A;  5KN3 A;  3P7X A;  1FOV A;  3P8W A;  1O7U A;  4RI6 A;  3WGE A;  2AHE A;  2G2Q A;  4CHS A;  2H71 A;  1NW2 A;  2CQ9 A;  3HY2 A;  3GH9 A;  3HDC A;  2LQQ A;  3M0F A;  2IFQ B;  2A2S A;  5J5N A;  2K18 A;  4OWY A;  4JZQ A;  5GAP D;  1M9B A;  3AY8 A;  3UMA A;  2D2Z A;  3UVT A;  5CRD A;  4N10 A;  4XHM A;  1TRW A;  2LQO A;  2ZCT A;  4YH2 A;  3G7Y A;  3LG6 A;  1WP0 A;  2ON5 A;  1UC7 A;  1ZYN A;  3GL3 A;  4PQI A;  1XXU A;  2H74 A;  3GKM A;  4F9Z A;  5J3R A;  2C3N A;  5D96 A;  3UIW A;  3H1N A;  2HZE A;  4GTU A;  1M7T A;  2DIY A;  1K3L A;  4YQV A;  1FW1 A;  4XRD A;  1DE1 A;  1B4Q A;  5ECS A;  3M9J A;  5ELA A;  3VI5 A;  3HKR A;  3LEF A;  3TOT A;  4GST A;  3VPQ A;  4DVC A;  2X4A A;  4OCE A;  4IS0 A;  2HRK A;  1O81 A;  3A2V A;  1GSF A;  2H1A A;  1YZX A;  4BVX A;  2XBI A;  1PA3 A;  4NHZ A;  3EPT A;  2IMI A;  2P5Q A;  2RM6 A;  4K8M A;  1A24 A;  2TIR A;  4HU9 A;  2OE0 A;  3D21 A;  1QK8 A;  3CSH A;  3ME8 A;  6GSV A;  1OYJ A;  2QA1 A;  5CRW A;  4HZ2 A;  1HNC A;  5IMV A;  4L5O A;  4RI7 A;  2NTO A;  2LUS A;  5JWQ B;  2I81 A;  3H79 A;  3CTG A;  5G5E A;  1TK5 B;  2KP1 A;  1XZO A;  2X8G A;  4K5R A;  5EY6 A;  3ZFL A;  3TJJ A;  1SKR B;  4OFM A;  2P0G A;  2VCT A;  3TUE A;  6GST A;  3RPP A;  4OD7 A;  3TRX A;  3C8E A;  1Z7R A;  2YNX A;  4MF7 A;  5ID2 A;  2MYG A;  1TK0 B;  2IMF A;  2E2M A;  4N0V A;  4EL1 A;  1QFN A;  3CRU A;  1TKD B;  1ZL9 A;  2HYX A;  3HHV A;  4XS4 A;  4BL7 A;  2CX3 A;  1GNW A;  3VPT A;  1YF0 A;  4V2N A;  1FOH A;  1KTE A;  2KLX A;  4PGT A;  4ZBB A;  4GF0 A;  4L0U A;  5F8B A;  1A2M A;  3GTU A;  3O6T A;  3FKF A;  4I6X A;  4DSS A;  4KSO A;  4BWS A;  4WR5 A;  3HD5 A;  3ZZX A;  3ZVJ A;  2V6O A;  1DBY A;  3A5W A;  3Q6O A;  2YJH A;  3D6I A;  2WS2 A;  1XWC A;  5DJM A;  3L78 A;  5DAK A;  4HS1 A;  4ULX A;  4YKG A;  2TRX A;  2C4J A;  2GZY A;  2P5R A;  3QOU A;  4TXV A;  2YV7 A;  2I4A A;  1M99 A;  4TW5 A;  5D73 A;  5L71 A;  3TJG A;  4ZL9 A;  4NAX A;  5D93 A;  3KEB A;  4GXZ A;  1B48 A;  2FUG 2;  4YAP A;  3NZN A;  1S3A A;  4O7H A;  4DSQ A;  3CSJ A;  1K0N A;  4F2I A;  1ERV A;  1XOA A;  3EC3 A;  3IDV A;  3DIE A;  1EP8 A;  3GH6 A;  4BWQ A;  4MCU A;  2YJ7 A;  1U6T A;  2LEG A;  2LJK A;  2FHE A;  2IMK A;  3GA4 A;  2EIQ A;  4O32 A;  3IAS 2;  3QAG A;  3M1G A;  1UN2 A;  1V2A A;  3A2X A;  4GLT A;  5ECI B;  4IVF A;  4XS4 B;  2YPM A;  2VUP A;  4BL7 B;  3P90 A;  4IKH A;  3KP8 A;  4MPG A;  2PER A;  3GTU B;  2DBC A;  2A2P A;  1BYE A;  2YCD A;  4K2D A;  5B6N A;  4JE1 A;  4TR4 A;  4ML1 A;  3F4T A;  2F51 A;  3GHA A;  1YEX A;  5EVO A;  3QR6 A;  3APO A;  2L4C A;  1X0R A;  2MBT A;  2J9H A;  3HA9 A;  1NSW A;  2H8L A;  1TOF A;  1ILO A;  2AUV A;  4POM A;  1EZK A;  1WIK A;  5DAK B;  4HJM A;  3CYN A;  8GSS A;  4HQZ A;  3GX8 A;  4ZIL A;  1XIY A;  3O76 A;  3DYR A;  4ISD A;  1ON4 A;  2YWM A;  4F03 A;  1JLW A;  4TR1 B;  4YQM A;  4Z2U A;  4WEY A;  3HVS A;  1FO5 A;  3VWU A;  5J4U A;  4YKF A;  5D9W A;  3RHC A;  2V1M A;  3GNJ A;  4E8E A;  4D73 A;  5DAL B;  3TKS A;  4MF6 A;  2CZ2 A;  4FYC A;  1O73 A;  4IJI A;  2JZS A;  2XPE A;  1XOB A;  4LA1 A;  4LMV A;  4IJ3 A;  5CAX A;  4TXO B;  1ERT A;  1XVW A;  3ZML A;  9GSS A;  5F07 A;  2H01 A;  3E0U A;  1XWK A;  2NBS A;  3CRT A;  3F8U A;  2R0G A;  3A5I A;  1M0U A;  13GS A;  2PBJ A;  1WJK A;  1OKT A;  19GS A;  4MJA A;  5IMA A;  4EIP A;  5IMZ A;  4IQA A;  2F3M A;  1TI1 A;  5ECL B;  5J9B A;  3PR8 A;  1V98 A;  2CX4 A;  5G30 A;  2IN3 A;  4EC0 A;  2O87 A;  3KMN A;  1TP9 A;  3KGK A;  4WBR D;  2PVQ A;  2C1Y A;  5J41 A;  6GSW A;  4N0Z A;  4IP6 A;  4MJE A;  3FK8 A;  4FH8 A;  1R4W A;  1S3C A;  1N8J A;  3SWL A;  5AN1 A;  1MDI A;  1SK2 A;  1EGO A;  3IC4 A;  2OKA A;  3KIJ A;  4OO5 A;  2LRT A;  1R26 A;  3R2Q A;  1URM A;  2ON7 A;  2GT5 A;  3ME7 A;  4I2T A;  3TJK A;  1I9D A;  3GKX A;  2EIR A;  1OC3 A;  3CSI A;  1A0R P;  5HFK A;  2B5Y A;  1ZYP A;  4GWR A;  1PL2 A;  1VRS D;  2M46 A;  3QDN A;  5D8I A;  3ERF A;  2B6M A;  1ML6 A;  1VGL A;  3IRA A;  2MBS A;  3IAM 2;  1AUC A;  4J57 E;  3HJM A;  4I97 A;  1FB0 A;  4G10 A;  5A5K A;  1PKW A;  1LU4 A;  1QGV A;  2BMX A;  1ERU A;  1AIU A;  4EDY A;  2DMM A;  4MMM A;  3G9B A;  1TJD A;  3I9V 2;  1A8Y A;  4L8E A;  5DJL A;  6GSS A;  4F0C A;  4CY6 A;  2VCV A;  2VLU A;  3PPU A;  1T4Z A;  3VK9 A;  4JED A;  2FWG A;  2FCH A;  4OFN A;  3DRN A;  2DSA A;  1ZYQ B;  4EIQ A;  2H0G A;  1U3I A;  1O8X A;  1SJI A;  5DCG A;  1ZGN A;  1ZOF A;  2HI7 A;  4N30 A;  3ERW A;  5AIX A;  3HZ4 A;  3WT1 A;  3VUR A;  4TOP A;  2C3T A;  3E3E A;  2EIO A;  4WBJ A;  2JAD A;  2ES7 A;  4MLY A;  1IYH A;  2N5A A;  1PX6 A;  1XPV A;  3F6F A;  3FR3 A;  3ZIJ A;  2QKE A;  4NHW A;  3FR9 A;  3HJO A;  1U88 A;  2V6K A;  1XW6 A;  1SKS B;  2DJ0 A;  4Q5R A;  2H76 A;  1JHB A;  2VM1 A;  3ZLP A;  1OC9 B;  2H1G A;  1GWC A;  3LQ7 A;  1MEK A;  3R3E A;  5D9X A;  3FY7 A;  2DJ2 A;  3MYD A;  3RAZ A;  1OKD A;  2RUE A;  2GST A;  4JRR A;  5ENU A;  3D4T A;  4IBP A;  4BA7 A;  3S9F A;  1IYI A;  1Z9H A;  1G7O A;  2E2G A;  1PKZ A;  2M72 A;  1W4V A;  1GTA A;  1GP1 A;  3KTL A;  1BED A;  2RM5 A;  5A4V A;  1SJ6 A;  4AJ6 A;  3C1R A;  1E6B A;  3K8N A;  4PNF A;  1YF1 A;  5F0G A;  4ECC A;  4ZB9 A;  2LV3 A;  3LWA A;  3PH9 A;  1GTB A;  1WPI A;  2F9S A;  4TKY A;  3UAP A;  1XCC A;  2VO4 A;  2V41 A;  1SYR A;  2YOI A;  3GMF A;  3TOU A;  4ZL7 A;  1SL2 B;  3IE3 A;  3BCI A;  3DXB A;  4LL1 B;  1A0F A;  2H0H A;  1LJR A;  2MMA A;  4GQF A;  5ECH B;  1B9X C;  1SYX A;  1ABA A;  2XBQ A;  3HYP A;  2H6Z A;  2YWO A;  3GFK A;  2C0D A;  3GUR A;  4KDY A;  2H6X A;  1X9S B;  1ST9 A;  1EEJ A;  4PQ1 A;  2B5X A;  5KN2 A;  1GLP A;  3FRC A;  1B4P A;  4LL4 B;  4MJC A;  3GKN A;  4KDU A;  2Z9S A;  1YEP A;  5G1L A;  6GSY A;  1SU9 A;  1GSY A;  2IWT A;  2MMN A;  5EPF A;  3TKS C;  4ECI A;  4WF5 A;  2AB6 A;  3HZ8 A;  3J7Y k;  2IIY A;  1CQG A;  3UL3 A;  1H75 A;  4HUA A;  4O5Q A;  5BMU A;  1A2L A;  1TRS A;  1UA5 A;  1NHY A;  1SEN A;  4K7N A;  2OJL A;  3GL5 A;  2VL2 C;  1T1V A;  1GH2 A;  1M2B A;  2JZR A;  1G6Y A;  2O85 A;  2C3Q A;  4KE3 A;  1Q4J A;  4GQC A;  2WB9 A;  5ECN B;  2CVD A;  2LJA A;  1FG4 A;  1MDJ A;  1GSQ A;  4J56 E;  12GS A;  4ZXG A;  3UJ1 A;  3C73 A;  2GGT A;  3IR4 A;  4PTS A;  2KP2 A;  2VCW A;  4MZC A;  1GUH A;  1SJZ A;  5B7C A;  4HQS A;  2HZE B;  4ZBD A;  5LCZ A;  5FT3 A;  4MJB A;  3TKP A;  2R0C A;  3RDW A;  4MAB A;  2MMZ A;  1BX9 A;  2FA8 A;  1EP7 A;  1T8E B;  4MDC A;  4FIW A;  4HI7 A;  4V1A g;  5DVB A;  11GS A;  4XS6 A;  3J7Y b;  1Q98 A;  3OR5 A;  4KH7 A;  4H86 A;  4IEL A;  1CQH A;  1M9A A;  3EE2 A;  4BVX B;  2AJQ B;  2YZU A;  5G1K A;  4X4J A;  2P31 A;  5HFG A;  2F8F A;  3RBT A;  4O5U A;  1X5C A;  2DJ1 A;  1TRU A;  2C0G A;  2WCI A;  3KMO A;  4G2E A;  3EU4 A;  2K8V A;  1K0M A;  2O7K A;  2PU9 C;  1HNB A;  3F4S A;  4OO4 A;  5ECM B;  3F63 A;  2FNO A;  4EE0 A;  4ZL8 A;  1EV9 A;  4MNN A;  4ZB8 A;  1SK1 A;  5F05 A;  1S3D A;  1Y25 A;  3TKQ A;  3I6A A;  3I69 A;  4J2F A;  2GQM A;  2DKI A;  3VFI A;  5JCW A;  1FAA A;  5ECQ B;  4CW9 A;  1EOH A;  1FB6 A;  1F3A A;  1TXX A;  3MIX A;  1X9M B;  2B7K A;  3DWV A;  1MDK A;  2DLX A;  1UVZ A;  4JU5 A;  5KN1 A;  5ID2 B;  1PQN A;  4EF0 A;  1DUG A;  4ICY A;  2HXK A;  5GAN D;  1PRX A;  4K7O A;  1ACV A;  2NPB A;  3GIX A;  3JCM L;  5IPH A;  4MZW A;  3TCO A;  2UZ8 A;  1F37 A;  4NV5 A;  5AIS A;  1GTI A;  5G5F A;  2A4H A;  1YJ6 A;  1PN9 A;  4N11 A;  1TK8 B;  2DML A;  2H30 A;  1YKC A;  5IOW A;  2KOK A;  1SL1 B;  2JSY A;  2GVP A;  4X0X A;  4DSS B;  5G31 A;  4IHU A;  3L9S A;  1K0A A;  4XTS A;  2VD0 A;  2LRC A;  5H5Q A;  3U5R E;  1R5A A;  3VWV A;  2FGX A;  5FHI A;  2HFD A;  2VLV A;  3BD2 A;  2H72 A;  5DQS A;  1GLQ A;  2IMD A;  3L4N A;  4Z2T A;  2DC5 A;  1V9W A;  4DSR A;  4F0B A;  5AIV A;  1BJX A;  5JCG A;  1TU7 A;  4P3Y B;  5ECP B;  1WMJ A;  2K6V A;  3LJR A;  3W6G A;  2LRN A;  10GS A;  3HJP A;  1XW9 A;  2FLS A;  4JR6 A;  4FYU A;  4IW9 A;  4K2X A;  1TW9 A;  1PD2 1;  3HVV A;  4ZIJ A;  1JFU A;  4K5S A;  3LOR A;  4XRA A;  2L5O A;  3IC8 A;  2KHP A;  5IIZ A;  1FVJ A;  1JLV A;  4KW6 A;  4KUN A;  1A23 A;  1RW1 A;  4MK3 A;  5GST A;  3WGX A;  5JWO B;  3FZ4 A;  4IGJ A;  3DML A;  2N5F A;  1XBS A;  5LD0 A;  6GSU A;  2DJK A;  3H8Q A;  4EDZ A;  1KEB A;  2L6C A;  4ECB A;  1THX A;  2OAC A;  1QMV A;  3ZTL A;  3A2W A;  4K0G A;  16GS A;  1Z3E A;  2F8A A;  4NMU A;  2H75 A;  4A5P A;  1G0T A;  4KCE A;  1T7P B;  4AJ8 A;  5EL8 A;  5HR2 A;  4K1F A;  4WXT A;  2N5B A;  3FZ9 A;  2IME A;  3DKS A;  3IK7 A;  5KEJ A;  1AQW A;  5D9T A;  3HVX A;  2C80 A;  3CBU A;  1GRX A;  2HSY A;  2R4V A;  3KJY A;  3F3Q A;  4KDX A;  3ED3 A;  2QSI A;  1PGT A;  4L0W A;  2PUK C;  3ZIV A;  1XWA A;  2LJR A;  3MSZ A;  4Z7X A;  2X8H A;  2LNS A;  4KAE A;  1F6M C;  3GV1 A;  2VL3 A;  2VM2 A;  3BJ5 A;  1K0O A;  3ZRE A;  1XWB A;  2FWH A;  5ELG A;  3Q18 A;  2R5G A;  1NM3 A;  3WD6 A;  4KB3 A;  4PUR A;  2YN1 A;  4LLR A;  4BVY A;  4D73 B;  2DKH A;  1Z6N A;  1ZYE A;  2B5E A;  2X64 A;  3HCZ A;  1ZZY A;  4PX1 A;  2I9H A;  3IK9 A;  4KCA A;  3C71 A;  3ZVJ D;  4RUV A;  5DQY A;  1Z6M A;  1GSE A;  1HYU A;  4ACS A;  4EKZ A;  2YZH A;  4BPY A;  3H93 A;  4WR4 A;  2R0P A;  2HT9 A;  1ERW A;  2GZZ A;  4QL9 A;  4V1A p;  4USS A;  2OA7 A;  3UBL A;  2DJ3 A;  3M8N A;  3UEM A;  2O8V B;  4GSN A;  5CNW A;  1W89 A;  2GTU A;  3G7J A;  4GCI A;  2XHF A;  1AC1 A;  1QQ2 A;  2HRN A;  4NWY A;  4K6X A;  4E8H A;  5IO0 A;  3KZQ A;  1C72 A;  4TVE A;  2X99 A;  2H66 A;  3TDG A;  1JZD A;  5ECO B;  4MP4 A;  4TR0 A;  4L5L A;  3MNG A;  3KD0 A;  1GL8 A;  1VF4 A;  3EWL A;  3RHB A;  5ECK B;  3W8J A;  3L9U A;  3IA1 A;  2H19 A;  3EVI A;  3KCM A;  2KUC A;  6GSX A;  1VF1 A;  2LNT A;  2YP6 A;  3FR6 A;  3ERG A;  1GSS A;  1A2J A;  3DEX A;  4POK A;  3Q19 A;  5G2Z A;  1V58 A;  1DSB A;  5IPG A;  4ZBA A;  1XVQ A;  1HD2 A;  4Q5Q A;  2HLS A;  3NOF A;  3W8S A;  4I5Q A;  2VCZ A;  1XWG A;  1HQO A;  3VWW A;  3N9J A;  18GS A;  2RII A;  2TRC P;  4EVM A;  2GQK A;  2LTK A;  7GSS A;  1G7E A;  5FWG A;  3EUR A;  1YQ1 A;  1PSQ A;  2WGR A;  2JZT A;  4LMW A;  1F2E A;  2PVO C;  1Z5Y E;  3APQ A;  3LFL A;  2ZNM A;  3G7I A;  3TGZ A;  1FHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...