1EWXA

Crystal structure of native tryparedoxin i from crithidia fasciculata
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
144
Chain Sequence
b'SGLDKYLPGIEKLRRGDGEVEVKSLAGKLVFFYFSASWCPPCRGFTPQLIEFYDKFHESKNFEVVFCTWDEEEDGFAGYFAKMPWLAVPFAQSEAVQKLSKHFNVESIPTLIGVDADSGDVVTTRARATLVKDPEGEQFPWKDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPAREDOXIN I
publication title Structures of tryparedoxins revealing interaction with trypanothione.
pubmed doi rcsb
molecule tags Electron transport
total genus 43
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ewxA00
2KP2A 3O76A 5DALB 4NWYA 5JWRB 1EWXA 4XRDA 2YWNA 4V1Ag 4DSSB 2F8AA 3G9BA 1ABAA 4OCEA 5H5SA 2OACA 4V2MA 4GSTA 1GUMA 4F03A 5GAND 4OWYA 1A24A 1R7HA 2L57A 3HZ4A 5DVBA 3WGXA 2B6MA 4PGTA 1DE2A 2HSHA 3BCIA 2FUG2 3EWLA 2GSTA 1SJ6A 4FYCA 2YWIA 5LCZA 2O85A 2XPDA 4BVYA 5ECMB 4CDOA 2H70A 2QSIA 2JSZA 3IRAA 5FHIA 2MMZA 2OKAA 1XWBA 3H93A 4IP1A 4HQSA 3UOMA 4FH8A 1A2JA 1PA3A 1I5GA 2VIMA 5DCHA 3RDWA 4ZL7A 3VPTA 3GFKA 2PMTA 3Q74A 2OJLA 2ON7A 2HZFA 1H75A 3HHVA 4K0GA 5IMCA 1BQ7A 1EOHA 2DLXA 3HKRA 1HNAA 2XC2A 4IGJA 1V40A 2CZ3A 2AYTA 2O87A 4KAEA 1Z6NA 3TCOA 1GLPA 5KN1A 5CNWA 3UBLA 4EL1A 1G6YA 3F4TA 2LSTA 1SKWB 1HD2A 4Q5QA 1A2LA 1OC8A 3ZFBA 4TR1A 3US3A 5JCWA 3ZIJA 4RQXA 2EIOA 3GKKA 5CAXA 4I2UA 1K0AA 1M9AA 1O8XA 3WD6A 1YKAA 3EMPA 1F37A 1K3OA 4ID0A 3BJ5A 1B9YC 1BG5A 4X0XA 2B1KA 3RBTA 2H0IA 3O6TA 5D96A 2CQ9A 4LL1B 2H6YA 4I5QA 1GTIA 3APQA 4BL7A 2CZ2A 5DCGA 3F63A 3CYNA 3D22A 5IMVA 1XVQA 1OAZA 3MWHA 1YJ6A 3FK8A 1VRSD 1EGOA 1O8WA 4EKZA 1Z9HA 4TRXA 1XXUA 2HT9A 1SD9A 2GDRA 2H73A 5INYA 3LYKA 1PL2A 3KGKA 1B4QA 4FIWA 3ERWA 1XOAA 3GNJA 3G7YA 1A0FA 2WB9A 1THXA 1OE7A 4IN0A 1EEJA 4KCEA 2DIZA 4MJAA 4G2EA 3GKNA 2TRXA 5JWQB 3TKSC 1B8XA 1V2AA 4JZQA 2VCXA 3F0IA 4XCSA 3TGZA 4MLYA 5A4UA 2IIYA 3TKRA 3ZVJA 1GSUA 2WS2A 1X9SB 1WP0A 5IPGA 4V2LA 2H74A 2VAFA 4AGSA 2VM2A 2AUVA 2P31A 4AJ7A 2FHEA 3P2AA 2AAWA 3HJOA 2DJ2A 3EVIA 5IQYA 1K3LA 2VCTA 4HUAA 1DSBA 6GSXA 4PUAA 3E3EA 3ZLPA 1AQVA 5IMFA 4HS1A 3CRUA 2WDUA 1K3YA 3AY8A 2OBKA 2M80A 1TDIA 3O3TA 4IHUA 1KBNA 3GH6A 1EEMA 1AW9A 1K0OA 3EMXA 4GQCA 2A2RA 5B6MA 3QMXA 3LEFA 3F6DA 2F8FA 1TK8B 2MYGA 2C0DA 2I1UA 3KP8A 2M72A 3QCPA 2DSAA 4ZB6A 4PNFA 5JCGA 2O8VB 2XHFA 5HR1A 2LV3A 1R4WA 2CT6A 3WGDA 1QQ2A 2EC4A 5A4WA 3JCML 4IELA 1ILOA 1W4VA 2X64A 5IOWA 4MCUA 1PX6A 4TR1B 4NMUA 4DSQA 3VLNA 5ENUA 1J0FA 4EDZA 3DIEA 4K7OA 1X0RA 5G5FA 2P0GA 4GLTA 13GSA 3LQ7A 4YQMA 1SKSB 1K0MA 2AV4A 2VCQA 4MF6A 7GSSA 3J7Yk 4FYUA 1G6WA 2GSSA 2IFQA 3IR4A 2GGTA 3E9JB 3M8NA 3QD9A 1U3IA 1THOA 1I9DA 2YOIA 3W8SA 3VWWA 2RM6A 4Q5NA 1SENA 4XTSA 1XCCA 5GZZB 3G7JA 4E8EA 2JL4A 18GSA 5DALA 1SK2A 5HR0A 2L4QA 2LTKA 5CRWA 2Z9SA 4ZBBA 2K8VA 5ECHB 4DSSA 4V2NA 1BEDA 2XBQA 1Q98A 3M0FA 4HDEA 1FW1A 1MD4A 2PERA 5AN1A 3ZITA 5CP1A 4BPYA 1WJKA 2YZHA 1MTCA 1NHOA 2FLSA 1URMA 2LJAA 1Z5YE 1F2EA 1RQMA 4ECCA 2HRNA 4HEA2 1Q4JA 1CQGA 2MBTA 4KCAA 2KHPA 2FWGA 2WJUA 4D73A 3DXBA 1OKDA 2F9SA 1ON4A 2R4VA 4LMWA 4TXOB 1NM3A 2DMMA 4YQVA 1ZOFA 1F9MA 5DQYA 2P5RA 1LU4A 5J9CA 3HCZA 3FZ4A 3C1SA 2A2SA 3ZRDA 3GA4A 4LMVA 1U87A 3DYRA 4WEYA 5ABRA 4PQ1A 4L5LA 3ERGA 1QMVA 3UL3A 2V1MA 3BOAA 5AISA 1ERTA 1B9XC 3K8NA 3HVSA 2B5XA 2R5GA 1GH2A 2LRTA 4KSMA 4RUVA 4TR0A 2VCVA 1YEXA 5ELGA 2TRCP 4BA7A 3W8JA 4KDUA 3BBYA 1AQWA 2JU5A 1BJXA 4MF5A 1PX7A 2H19A 2PGTA 3KMNA 1U6TA 3QAWA 2FA4A 3TOUA 5J4UA 1VGLA 4Z7XA 3BD2A 4O7HA 3TUEA 2KP1A 3IBHA 4N11A 1GTBA 2LUSA 1RW1A 4TXVA 4FO5A 2VUPA 3LYPA 2CX4A 1GSQA 2H76A 1SYRA 1GSYA 3RHBA 1DE1A 1KNGA 2B7KA 1AUCA 2RUEA 3ERFA 4ZBDA 1XFLA 4WBRD 5IMDA 2HE3A 2X8HA 5CRGA 4K6XA 3UEMA 3HZ8A 3DWVA 1G7EA 4L0WA 2HSYA 4LLRA 3MDKA 1TRUA 5F8BA 2EIRA 1N8JA 3VFIA 2PPTA 2DBCA 4NHZA 5DJMA 4HI7A 4GRFA 4WF4A 5EL8A 1PRXA 4F9ZA 3RPNA 4YAVA 1TI3A 1WIKA 1YZXA 1GSEA 1ERVA 5D8IA 2H6ZA 4ISDA 1GSSA 1R5AA 5D9VA 3L4NA 2GZYA 2JSYA 5COHA 1TKDB 3F6FA 2IFQB 1TI1A 4TR4A 3GYKA 1XVWA 2F3MA 2OADA 1CQHA 20GSA 3IK9A 5ECRB 1SL0B 2V6OA 3M9JA 5IMAA 4JEDA 3GN3A 2BTOT 2ES7A 5B8BA 1MD3A 4K2DA 4I6XA 3UVHA 1O73A 1GSDA 3G7IA 3GIXA 4CHSA 1G0TA 2WULA 2B1LA 2FA8A 3GHAA 3P8WA 4KUNA 1AC1A 3DVWA 3R2QA 3GSTA 4H86A 2HI7A 1SD8A 1VF4A 5KN0A 5IO0A 1YEPA 3PR8A 4I2TA 3UIWA 3IV4A 5G5EA 4D73B 2CA8A 1O7UA 3M3MA 4I97A 2HRFA 5KN2A 1EP8A 3CMIA 3KIJA 3KEBA 4FYBA 2YV9A 2K6VA 2PWJA 1WWJA 1M2BA 3GTUB 3J7Yb 2YNXA 1YY7A 1V98A 1V58A 3IOSA 2E2MA 2BJXA 2YJHA 1YF0A 3WT2A 4N0VA 4F0CA 2RM5A 1A23A 1T7PB 4OO5A 2IWTA 2GS3A 3DKSA 1A0RP 2VLUA 1BX9A 4PQIA 5DJLA 4TVEA 1WRYA 2AB6A 4L0UA 2H01A 5CYYA 4ZILA 4ILFA 4L5OA 1Z7RA 2E0QA 4RQRA 2FCHA 1XBSA 17GSA 2IMIA 2JZRA 1U3AA 3A3TA 3A2VA 1WOUA 4MJBA 2ZCTA 2MMOA 2O7KA 1BAYA 4POKA 1SYXA 2YP6A 5H5QA 1JZRA 5DQSA 1H4OA 2IPAA 2MMAA 1S3DA 3DD3A 4ECBA 1HYUA 4BVXA 1WMJA 3H8QA 1QXHA 1EZKA 4MF7A 1WPIA 1TU8A 4IP6A 10GSA 3HVXA 1AIUA 4F2IA 9GSSA 3TRXA 4ZXGA 2LEGA 5AIVA 1MDKA 3C8EA 3EURA 3FR3A 4NPBA 5E4WA 2WGRA 2DJKA 3D5JA 1V57A 2BMXA 4DVCA 4WR5A 3KTLA 1T1VA 1C72A 1FB6A 1ACVA 1ML6A 4IJIA 4KX4A 4G19A 4YH2A 2PU9C 3FYGA 3C73A 4L8EA 4KE3A 3C7MA 1TJDA 3FZ5A 1MEKA 2H72A 1SJZA 4AJ6A 1GP1A 1PMTA 4MABA 4TXOA 5F05A 2D2ZA 4HU9A 2B5YA 3LG6A 2VCZA 1GSFA 1FG4A 6GSYA 1Z6MA 1XWGA 4YQUA 1X9WB 4PQHA 4KDXA 5ECKB 3M1GA 3QFAC 3GKXA 5AIXA 4MH2A 1XW6A 3TKSE 6GSTA 2H1AA 2A4VA 3TKPA 5ECLB 1AQXA 1GUHA 1FB0A 3UJ1A 3ZMKA 1R26A 1SU9A 3RHCA 6GSSA 2YCDA 1VF2A 3HDCA 1GWCA 1K0CA 2L6CA 1QGVA 2KLXA 2L4CA 3L9SA 3H79A 1K0NA 5AGYA 3HVVA 3GX8A 4MPGA 2NBSA 2AHEA 3N9JA 4XRAA 4HU7A 3TOTA 3U6VA 3FZ9A 1RK4A 2QC7A 2I81A 2GT6A 1E6BA 4KDYA 3RPPA 3FEUA 3TJKA 4KSOA 3KD0A 5FWGA 1JZWA 1S3AA 1XPVA 1A8LA 3ME7A 1M2AA 2IN3A 1GUKA 1WE0A 1TW9A 1TOFA 2LJRA 5DDLA 4YAPA 4EE0A 5ECIB 3TDGA 2GVPA 1UN2A 4N0ZA 2GSQA 2OE1A 3IE3A 3Q6OA 1NW2A 3UBKA 4ZL9A 3FHKA 3ZYWA 4MJEA 2H30A 1E2YA 5GAPD 4JE1A 5B8AA 3GV1A 3VI7A 1W89A 6GSUA 2V6KA 4POBA 4ML6A 1KTEA 5ECSA 11GSA 2LKUA 5CO3A 3VURA 4HZ4A 3UAPA 5J41A 3I6AA 3TJBA 5B6NA 1JHBA 2PVOC 2YV7A 5GSTA 3KTBA 2B5EA 4K7IA 3VWVA 4OFTA 4K8MA 2X8GA 1YDKA 2CX3A 12GSA 2CV4A 4I8BA 2X99A 3DMLA 3ZMLA 3CSHA 1ST9A 1IYHA 5IIZA 3IC4A 3QR6A 1ZMAA 3VI5A 3PGTA 2FWEA 3DGQA 3TJJA 1ZCPA 1ERUA 2HYXA 3KJYA 1MDIA 1SL1B 1Z7PA 2FY6A 4N10A 1Z3EA 4EUYA 3GTUA 5E59A 5A4VA 1XIYA 3F4SA 5D9TA 4P3YB 4GSNA 4IKHA 1JLWA 3ED3A 2VL2C 2R3XA 1GNWA 1GLQA 4KGIA 2ALBA 2LQOA 2WFCA 4ECJA 3HD5A 1DUGA 2C1YA 4ZB9A 4POMA 3GX0A 2ZNMA 4PUFC 1FO5A 2VD0A 1PGTA 2OE3A 4NV5A 5ID2B 4IVFA 4E8HA 1MDJA 3S9FA 3P7XA 1SK0A 4JU5A 4F82A 3F3QA 1GULA 3KZQA 3WGEA 1Y25A 1O85A 4RI6A 3CBUA 1YQ1A 1X5DA 4NV2A 2VO4A 2DJ3A 3GMFA 4JR6A 2GQKA 5DBQA 4EDYA 2J23A 2GTUA 2H75A 5A5KA 19GSA 4MZCA 2OA7A 5F0GA 3GH9A 1O6JA 1GL8A 3C71A 2NPBA 4HOJA 3FW2A 2RLIA 4LA1A 3ZTLA 2GSRA 4K0NA 4OCFA 2FWHA 4PXOA 1XOBA 1ZL9A 1BYEA 2H6XA 3CTGA 3NIVA 5G2ZA 4PNGA 3WT1A 1M7TA 4MPFA 4XHMA 3KMOA 2PBJA 1QUWA 4HQZA 1EV4A 2C4JA 1PKZA 4ULXA 1YF1A 3N5OA 2QKEA 5EY6A 5IMZA 1LJRA 5J9BA 3D6IA 4WKWA 4O92A 4IQAA 4WR4A 2HFDA 1EV9A 2K18A 3SBCA 2QGVA 3F9UA 5B7CA 3L78A 4BWQA 3GKMA 2OBIA 3E0UA 5ELAA 1JZDA 1TK0B 5G30A 2OE0A 2LS5A 4IJ3A 1GTAA 1OC9A 1YKCA 3L9VA 4K9ZA 2MZCA 2LNSA 3IK7A 4GXZA 4XIHA 2C0FA 4ML1A 2P5QA 3EE2A 1FAAA 3LFLA 4Q5RA 5D73A 1J08A 1JZOA 3GL3A 1AXDA 2VL3A 3FY7A 2HXKA 1T8EB 2REMA 4IQ1A 1F3AA 3KM6A 4EC0A 1M2DA 1U88A 3HXSA 4JBBA 4KB3A 4MH3A 2R6KA 5C00A 3A2XA 4NXIA 5ECPB 2WRTA 3TB2A 3D0ZA 3TJFA 5G1KA 1K0DA 4DSRA 5D93A 2IL3A 1SK1A 2E7PA 1XWCA 4JRRA 3ZVJD 3DEXA 3UMAA 3TRPA 3FKFA 3I9V2 2CVKA 2JADA 2C80A 4KA0A 2E2GA 3LWAA 1TRWA 1TRVA 5EVOA 1EP7A 3VPQA 1PQNA 1NSWA 1FVKA 1N2AA 2H1DA 2GZZA 5HR3A 2C3QA 2L59A 3D4TA 4NAXA 2EIQA 3F8UA 2H0HA 3LGCA 2B3SA 3OR5A 5HFKA 3TRQA 3LXZA 2DIYA 4GQFA 2PUKC 3QDNA 1QK8A 1R5PA 3HA9A 1DBYA 4DEJA 4X43A 3F3RA 2VL9A 1M9BA 3PH9A 5IPHA 1GRXA 2IMDA 1ZGNA 2C0GA 4K1FA 1A8YA 5HQPA 2WZ9A 3TKQA 3FR9A 3MNGA 3FRCA 4XS6A 5J5NA 1OYJA 3M9KA 4OMVA 2H0GA 1HNBA 5C04A 5KEJA 2I4AA 3LORA 2DJ0A 4EO3A 5CREA 4MK3A 4PURA 3IHQA 2MBSA 4OFMA 3ZREA 2O89A 4TW5A 4WETA 1AAZA 2DC5A 5D9XA 5IOXA 5IM9A 1SL2B 5J3RA 3CSIA 1X5CA 2X8CA 3CTFA 5F06A 2L5LA 4TKYA 5HFGA 2NDOA 4CW9A 4GF0A 2R37A 3GUSA 1PD21 4KH7A 2VOCA 3CXGA 1T3BA 4AJ8A 2JZSA 2B7JA 2YPMA 5ECOB 1F3BA 1M99A 1OC9B 2GZPA 1SKRB 2MMNA 1GNEA 5GSSA 1Y6EA 4QL7A 1PKWA 4LL4B 4KW6A 1PL1A 2KOKA 2VL2A 3VWXA 4TN8A 5KN3A 4K7NA 3QOUA 3EINA 2LJKA 2ZUPA 4GWRA 3L0HA 3QAVA 5JWOB 3ZZXA 3D21A 4MJCA 1OVNA 2M46A 1XWAA 3KCMA 2C3TA 3W6GA 1EOGA 2LRNA 5CRHA 1B4PA 4BWSA 3MSZA 2R2JA 3EU3A 3APSA 5IO2A 4JR4A 2TIRA 2CVBA 3GRXA 2GQMA 2CAQA 1TRSA 3NZNA 5ID2A 2C0EA 2KUCA 2PN8A 5FT3A 2YWOA 2RIIA 1NHYA 3GL5A 3IAS2 5HFIA 3SWLA 2J9HA 4MP4A 2FD3A 5G31A 6GSWA 2DJ1A 2H8LA 1ZZYA 3KH9A 2IMFA 3IA1A 2HLSA 4WF5A 1VF3A 1TU7A 4GSSA 3H4KA 2DMLA 3LJRA 4HJMA 4MA9A 2YN1A 1B48A 2V32A 4GTUA 2H1BA 2H71A 3UARA 3QFBC 3NOFA 1TTZA 4N30A 4OO4A 5DAKA 3CRTA 2HZEA 1UVZA 1USBA 3APOA 3FZAA 3LXTA 1PSQA 2CVDA 4GCIA 4QQ7A 1O81A 4EVMA 2YWMA 3WYWA 5ECNB 5JCUA 1TK5B 3HJMA 2ON5A 1J9BA 1F6MC 3FR6A 2JACA 3HYPA 2VLTA 1FVJA 3DVXA 1FHEA 4KNDA 2G0FA 4XS4A 5G1LA 1S3CA 4F0BA 3HJPA 2XBIA 2K8SA 1XWKA 3V1WA 4MZBA 4POLA 2FNOA 3D4MA 2VLVA 5CRDA 4PX1A 4O32A 3VWUA 3RAZA 1IYIA 2FWFA 3IDVA 4MMMA 3MAKA 4ZL8A 4EXJA 1T00A 1UA5A 4XS1A 5D9WA 3IPZA 2C8UA 2HNLA 2N5BA 3BCKA 2VM1A 2V2GA 1ZYEA 1LBKA 3C1RA 16GSA 3GURA 4J2FA 3ZL5A 1JLVA 2H1GA 3IAM2 3EYTA 3DRNA 3H1NA 1K0BA 14GSA 3I69A 2F51A 1XZOA 2YANA 1PN9A 2XPEA 1T4YA 4V1Ap 3QAGA 4OD7A 3UVTA 3Q19A 5L71A 4ZBAA 2WCIA 1HQOA 1A2MA 2RUFA 5EPFA 3PINA 3ME8A 4ECIA 2I3YA 3VK9A 5ECQB 2C3NA 2I9HA 2K9FA 5LD0A 2NVLA 4Q5FA 2LNTA 4EF0A 3IXRA 2PVQA 2GLRA 2VCWA 1XW9A 2L6DA 1GTUA 1HNCA 4MZWA 4TR3A 3TJGA 4X1UA 2N5AA 3CSJA 1ERWA 3L9UA 4WBJA 4ZB8A 2NTOA 4ZIJA 1SJIA 4WXTA 2N5FA 1QFNA 3QPMA 1M0UA 3I43A 1TXXA 1V9WA 1X5EA 22GSA 2DJJA 1JFUA 2GQLA 3A5WA 3ZFLA 1KEBA 1OE8A 2IMEA 3EC3A 1OC3A 3P90A 3ZIVA 1ZYQB 1UC7A 4QL9A 5HR2A 1T4ZA 3GSSA 4IS0A 2GT5A 5LNKe 4G10A 5DAKB 3EU4A 1OKTA 3KH7A 2HZEB 3ISOA 3KXOA 2CAIA 2YZUA 4HZ2A 5F07A 4O5RA 2IJYA 4RI7A 4HJ2A 1EGRA 3KP9A 2VD1A 5H5RA 1G7OA 4IW9A 2V41A 2JZTA 3HY2A 2AJQB 3F4RA 4J57E 1FOVA 4TOPA 4AF2A 1TP9A 1X9MB 1VF1A 2H66A 6GSVA 3TKSA 2G2QA 4G9HA 4NHWA 3U5RE 8GSSA 2IMKA 2L5OA 2YJ7A 3Q18A 2FGXA 2LRCA 4MDCA 4XS4B 3LSZA 2LQQA 4OFNA 3A2WA 4ACSA 1XW5A 4J56E 4IBPA
chains in the Genus database with same CATH superfamily
2KP2A 3O76A 5DALB 4NWYA 5JWRB 1EWXA 4XRDA 2YWNA 4V1Ag 4DSSB 3MIXA 2F8AA 2DKIA 3G9BA 1ABAA 4OCEA 5H5SA 2OACA 4V2MA 4GSTA 1GUMA 4F03A 5GAND 4OWYA 1A24A 1R7HA 2L57A 3HZ4A 5DVBA 3WGXA 2B6MA 4PGTA 1DE2A 2HSHA 3BCIA 2FUG2 3EWLA 2GSTA 1SJ6A 4FYCA 2YWIA 5LCZA 2O85A 2XPDA 4BVYA 5ECMB 4CDOA 2H70A 2QSIA 2JSZA 3IRAA 5FHIA 2MMZA 2OKAA 4USSA 1XWBA 3H93A 4IP1A 4HQSA 3UOMA 4FH8A 1A2JA 1PA3A 1I5GA 2VIMA 5DCHA 3RDWA 4ZL7A 3VPTA 3GFKA 2PMTA 3Q74A 2OJLA 2ON7A 2HZFA 4G0KA 1H75A 4K0GA 3HHVA 1ZYNA 5IMCA 1BQ7A 1EOHA 2DLXA 3HKRA 1HNAA 2XC2A 4IGJA 1V40A 2CZ3A 2AYTA 2O87A 3LW9A 4Z2UA 4KAEA 1Z6NA 3TCOA 1GLPA 5KN1A 5CNWA 3UBLA 4EL1A 1G6YA 4EIPA 3F4TA 2LSTA 4O5QA 1SKWB 1HD2A 4Q5QA 1A2LA 1OC8A 3ZFBA 4TR1A 3US3A 5JCWA 3ZIJA 4RQXA 2EIOA 3GKKA 4K5SA 5CAXA 4I2UA 1K0AA 1M9AA 1O8XA 3WD6A 1YKAA 3EMPA 1F37A 1K3OA 4ID0A 3BJ5A 1B9YC 1BG5A 4X0XA 2B1KA 3RBTA 2H0IA 3O6TA 5D96A 2CQ9A 4LL1B 2H6YA 4I5QA 1GTIA 3APQA 4BL7A 2CZ2A 5DCGA 3F63A 3CYNA 3D22A 5IMVA 1XVQA 1OAZA 3EPTA 3MWHA 1YJ6A 3FK8A 1VRSD 1EGOA 1O8WA 4EKZA 1Z9HA 4TRXA 1XXUA 2HT9A 1SD9A 2GDRA 2H73A 5INYA 3LYKA 1PL2A 3KGKA 1B4QA 4FIWA 3ERWA 1XOAA 3GNJA 1XG8A 3G7YA 1A0FA 2WB9A 1THXA 1OE7A 4IN0A 1EEJA 4KCEA 2DIZA 4MJAA 4G2EA 3GKNA 2TRXA 2HRAA 5JWQB 3TKSC 1B8XA 4G0LA 1V2AA 4JZQA 2VCXA 3F0IA 4XCSA 3TGZA 4MLYA 5A4UA 2IIYA 3TKRA 3ZVJA 1GSUA 2WS2A 4CY6A 1X9SB 1WP0A 5IPGA 2X49A 4V2LA 2H74A 2VAFA 4AGSA 2VM2A 2AUVA 2P31A 4AJ7A 2FHEA 3P2AA 2AAWA 3HJOA 2DJ2A 3EVIA 5IQYA 1K3LA 2VCTA 4HUAA 1DSBA 6GSXA 4PUAA 3E3EA 3ZLPA 1AQVA 5IMFA 4HS1A 1M3JA 3CRUA 2WDUA 1K3YA 3AY8A 2OBKA 2M80A 1TDIA 3O3TA 4IHUA 1KBNA 3GH6A 1EEMA 1AW9A 1K0OA 3EMXA 4GQCA 2A2RA 5B6MA 3QMXA 3LEFA 3F6DA 2F8FA 1TK8B 2MYGA 2C0DA 2I1UA 3KP8A 2M72A 3QCPA 2UZ8A 2DSAA 4ZB6A 4PNFA 5JCGA 2O8VB 2XHFA 5HR1A 2LV3A 4YKFA 1R4WA 2CT6A 3WGDA 1QQ2A 2EC4A 5A4WA 3JCML 4IELA 1ILOA 4YKGA 1W4VA 2X64A 5IOWA 4MCUA 1PX6A 4TR1B 4NMUA 4DSQA 3VLNA 5ENUA 1J0FA 4EDZA 3DIEA 4K7OA 1X0RA 5G5FA 2P0GA 4GLTA 13GSA 3LQ7A 4YQMA 1SKSB 1K0MA 2AV4A 2VCQA 4MF6A 7GSSA 3J7Yk 4BL7B 4FYUA 1G6WA 2GSSA 2IFQA 3IHGA 3IR4A 2GGTA 3E9JB 3M8NA 3QD9A 1U3IA 1THOA 1I9DA 2YOIA 3W8SA 3VWWA 2RM6A 4Q5NA 1SENA 4XTSA 1XCCA 5GZZB 3G7JA 4E8EA 2JL4A 18GSA 5DALA 1SK2A 5HR0A 2L4QA 2LTKA 5CRWA 2Z9SA 4ZBBA 2K8VA 5ECHB 4DSSA 4V2NA 1BEDA 2XBQA 1Q98A 3M0FA 4HDEA 1FW1A 1MD4A 2PERA 5AN1A 3ZITA 5CP1A 4BPYA 1WJKA 2YZHA 1MTCA 1NHOA 2FLSA 1URMA 2LJAA 1Z5YE 1F2EA 1RQMA 4ECCA 2HRNA 4HEA2 1Q4JA 1CQGA 2MBTA 4KCAA 2KHPA 2FWGA 2WJUA 4D73A 1ZYPA 3DXBA 1OKDA 2F9SA 1ON4A 2R4VA 4LMWA 4TXOB 1NM3A 2DMMA 4YQVA 1ZOFA 1F9MA 5DQYA 2P5RA 1LU4A 5J9CA 3HCZA 3FZ4A 3C1SA 2A2SA 3ZRDA 3GA4A 4LMVA 1U87A 3DYRA 4WEYA 5ABRA 4PQ1A 4L5LA 3ERGA 1QMVA 3UL3A 2V1MA 3BOAA 5AISA 1ERTA 1B9XC 3K8NA 3HVSA 2B5XA 2R5GA 1GH2A 2LRTA 4KSMA 4RUVA 4TR0A 2VCVA 1YEXA 5ELGA 2TRCP 4BA7A 3W8JA 4KDUA 3BBYA 1AQWA 2JU5A 1BJXA 4MF5A 1PX7A 2H19A 2PGTA 3KMNA 1U6TA 3QAWA 2FA4A 3TOUA 5J4UA 1VGLA 4Z7XA 3BD2A 4O7HA 3TUEA 2KP1A 3IBHA 4N11A 1GTBA 2LUSA 1RW1A 4TXVA 4FO5A 2VUPA 3LYPA 2CX4A 1GSQA 2H76A 1SYRA 1GSYA 1FOHA 3RHBA 1DE1A 1KNGA 2B7KA 1AUCA 2RUEA 3ERFA 4ZBDA 1XFLA 4WBRD 5IMDA 2HE3A 2X8HA 5CRGA 4K6XA 3UEMA 3HZ8A 3DWVA 1G7EA 4L0WA 2HSYA 4LLRA 3MDKA 1TRUA 5F8BA 2EIRA 1N8JA 3VFIA 2PPTA 2DBCA 4NHZA 5DJMA 4HI7A 4GRFA 4WF4A 5EL8A 1PRXA 4F9ZA 3RPNA 4YAVA 1TI3A 1WIKA 1YZXA 1GSEA 1ERVA 5D8IA 2H6ZA 4ISDA 1GSSA 1R5AA 5D9VA 3L4NA 2GZYA 2JSYA 5COHA 3FMWA 1TKDB 3F6FA 2IFQB 1TI1A 4TR4A 3GYKA 1XVWA 2F3MA 2OADA 1CQHA 20GSA 3IK9A 5ECRB 1SL0B 2V6OA 3M9JA 5IMAA 4JEDA 3GN3A 2BTOT 2ES7A 5B8BA 1MD3A 4K2DA 4I6XA 3UVHA 1O73A 1GSDA 3G7IA 3GIXA 4CHSA 1G0TA 2WULA 2B1LA 2FA8A 3GHAA 3P8WA 4KUNA 1AC1A 3DVWA 3R2QA 3GSTA 4H86A 2HI7A 1SD8A 1VF4A 5KN0A 5IO0A 1YEPA 3PR8A 4I2TA 3UIWA 3IV4A 5G5EA 4D73B 2CA8A 1O7UA 3M3MA 4I97A 2HRFA 5KN2A 1EP8A 3CMIA 3KIJA 3KEBA 4FYBA 2YV9A 2K6VA 2PWJA 1WWJA 1M2BA 3GTUB 3J7Yb 2YNXA 1YY7A 1V98A 1V58A 3IOSA 2E2MA 2BJXA 2YJHA 1YF0A 3WT2A 4N0VA 4F0CA 2RM5A 1A23A 1T7PB 4OO5A 5BRTA 2IWTA 2GS3A 3DKSA 1A0RP 2VLUA 1BX9A 4PQIA 5DJLA 4TVEA 1WRYA 2AB6A 4L0UA 2H01A 5CYYA 1PFOA 4ZILA 4ILFA 4L5OA 1Z7RA 2E0QA 4RQRA 2FCHA 1XBSA 17GSA 2IMIA 2JZRA 1U3AA 3A3TA 3A2VA 1WOUA 4MJBA 2ZCTA 2MMOA 2O7KA 1BAYA 4POKA 1SYXA 2YP6A 5H5QA 1JZRA 5DQSA 3PPUA 1H4OA 2IPAA 2MMAA 1S3DA 3DD3A 4ECBA 1HYUA 4BVXA 1WMJA 3H8QA 1QXHA 1EZKA 4MF7A 1WPIA 1TU8A 4IP6A 10GSA 3HVXA 1AIUA 4F2IA 9GSSA 1M3IA 3TRXA 4ZXGA 2LEGA 5AIVA 1MDKA 3C8EA 3EURA 3FR3A 4NPBA 5E4WA 2WGRA 2DJKA 3D5JA 1V57A 2BMXA 4DVCA 4WR5A 3KTLA 1T1VA 1C72A 1FB6A 1ACVA 1ML6A 4IJIA 4KX4A 4G19A 4YH2A 2PU9C 3FYGA 3C73A 4L8EA 4KE3A 3C7MA 1TJDA 3FZ5A 1MEKA 2H72A 1SJZA 4AJ6A 1GP1A 1PMTA 4MABA 4TXOA 5F05A 2D2ZA 4HU9A 4ICYA 2B5YA 3LG6A 2VCZA 1GSFA 1FG4A 6GSYA 1Z6MA 1XWGA 4YQUA 1X9WB 4PQHA 4KDXA 5ECKB 3M1GA 3QFAC 3GKXA 5AIXA 4MH2A 1XW6A 3TKSE 6GSTA 2H1AA 2A4VA 3TKPA 5ECLB 3IC8A 1AQXA 4Z2TA 1GUHA 1FB0A 3UJ1A 3ZMKA 1R26A 1SU9A 3RHCA 6GSSA 2YCDA 4O5UA 1VF2A 3HDCA 1GWCA 1K0CA 2L6CA 1QGVA 2KLXA 2L4CA 3L9SA 3H79A 1K0NA 5AGYA 3HVVA 3GX8A 4MPGA 2NBSA 2AHEA 3N9JA 4XRAA 4HU7A 3TOTA 3U6VA 3FZ9A 4HSCX 4CY8A 1RK4A 2QC7A 2I81A 2GT6A 1E6BA 4KDYA 3RPPA 3FEUA 3TJKA 4X4JA 4KSOA 3KD0A 5FWGA 1JZWA 1S3AA 3CQFA 1XPVA 1A8LA 3ME7A 1M2AA 2IN3A 1GUKA 1WE0A 1TW9A 1TOFA 2LJRA 5DDLA 4YAPA 4EE0A 5ECIB 3TDGA 2GVPA 1UN2A 4N0ZA 2GSQA 2OE1A 3IE3A 3Q6OA 1NW2A 3UBKA 4ZL9A 3FHKA 3ZYWA 4BVXB 4MJEA 2H30A 1E2YA 5GAPD 4JE1A 5B8AA 3GV1A 3VI7A 1W89A 6GSUA 2V6KA 4POBA 4ML6A 1KTEA 5ECSA 11GSA 2LKUA 5CO3A 3VURA 4HZ4A 3UAPA 5J41A 3I6AA 3TJBA 5B6NA 1JHBA 2PVOC 2YV7A 5GSTA 3KTBA 2B5EA 4K7IA 3VWVA 4OFTA 4K8MA 2X8GA 1YDKA 2CX3A 12GSA 2CV4A 4I8BA 2X99A 3DMLA 3ZMLA 3CSHA 1ST9A 1IYHA 5IIZA 3IC4A 3QR6A 1ZMAA 3VI5A 3PGTA 2FWEA 3DGQA 3TJJA 1ZCPA 1ERUA 2HYXA 3KJYA 4K5RA 1MDIA 1SL1B 1Z7PA 2FY6A 4N10A 1Z3EA 2R0PA 4EUYA 3GTUA 5E59A 5A4VA 1XIYA 3F4SA 5D9TA 4P3YB 4GSNA 4IKHA 1JLWA 3ED3A 5KOWA 2VL2C 2R3XA 1GNWA 1GLQA 4KGIA 2ALBA 2LQOA 2WFCA 4FQUA 4ECJA 3HD5A 1DUGA 4EIQA 2C1YA 4ZB9A 4POMA 3GX0A 2ZNMA 4PUFC 1FO5A 2VD0A 1PGTA 2OE3A 4NV5A 5ID2B 4IVFA 4E8HA 1MDJA 3S9FA 3P7XA 1SK0A 4JU5A 4F82A 3F3QA 1GULA 3KZQA 3WGEA 1Y25A 1O85A 4RI6A 3CBUA 1YQ1A 1X5DA 4NV2A 2VO4A 2DJ3A 3GMFA 4JR6A 2GQKA 5DBQA 4EDYA 2J23A 2GTUA 2H75A 5A5KA 19GSA 4MZCA 2OA7A 5F0GA 3GH9A 1O6JA 1GL8A 3C71A 2NPBA 4HOJA 3FW2A 2RLIA 4LA1A 3ZTLA 2QA1A 2GSRA 4K0NA 4OCFA 2FWHA 4PXOA 1XOBA 1ZL9A 1BYEA 2H6XA 3CTGA 3NIVA 5G2ZA 4PNGA 3WT1A 1M7TA 4MPFA 4XHMA 3KMOA 2PBJA 1QUWA 4HQZA 1EV4A 2C4JA 1PKZA 4ULXA 1YF1A 3N5OA 2QKEA 5EY6A 5IMZA 1LJRA 5J9BA 3D6IA 4WKWA 4O92A 4IQAA 4WR4A 2HFDA 1EV9A 2K18A 3SBCA 2QGVA 3F9UA 5B7CA 3L78A 4BWQA 3GKMA 2OBIA 3E0UA 5ELAA 1JZDA 1TK0B 5G30A 2OE0A 2LS5A 4IJ3A 1GTAA 1OC9A 1YKCA 3L9VA 4K9ZA 2MZCA 2LNSA 3IK7A 4GXZA 4XIHA 2C0FA 5BMUA 4ML1A 2P5QA 3EE2A 1FAAA 2DKHA 3LFLA 4Q5RA 5D73A 1J08A 2R0GA 1JZOA 3GL3A 1AXDA 2VL3A 3FY7A 2HXKA 2X4AA 1T8EB 2REMA 4IQ1A 1F3AA 3KM6A 4EC0A 1M2DA 1U88A 3HXSA 4JBBA 4KB3A 4MH3A 2R6KA 5C00A 3A2XA 4NXIA 5ECPB 2WRTA 3TB2A 3D0ZA 3TJFA 4Z2RA 5G1KA 1K0DA 4DSRA 5D93A 2IL3A 1SK1A 2E7PA 1XWCA 4JRRA 3ZVJD 3DEXA 3UMAA 3TRPA 3FKFA 3I9V2 2CVKA 2JADA 2C80A 4KA0A 2E2GA 3LWAA 1TRWA 1TRVA 5EVOA 1EP7A 3VPQA 1PQNA 1NSWA 1FVKA 1N2AA 2H1DA 2GZZA 5HR3A 2C3QA 2L59A 3D4TA 4NAXA 2EIQA 3F8UA 2H0HA 3LGCA 2B3SA 3OR5A 5HFKA 4G0IA 3TRQA 3LXZA 2DIYA 4GQFA 2PUKC 3QDNA 1QK8A 1R5PA 3HA9A 1DBYA 4DEJA 4X43A 3F3RA 2VL9A 1M9BA 3PH9A 2HSMA 5IPHA 1GRXA 2IMDA 1ZGNA 2C0GA 4K1FA 1A8YA 5HQPA 2WZ9A 3TKQA 3FR9A 3MNGA 3FRCA 4XS6A 5J5NA 1OYJA 3M9KA 4OMVA 2H0GA 1HNBA 5C04A 5KEJA 2I4AA 3LORA 2DJ0A 4EO3A 5CREA 4MK3A 4PURA 3IHQA 2MBSA 4OFMA 3ZREA 2O89A 4TW5A 4WETA 1AAZA 2DC5A 5D9XA 5IOXA 4A5PA 5IM9A 1SL2B 5J3RA 3CSIA 1X5CA 2X8CA 3CTFA 5F06A 2L5LA 4TKYA 5HFGA 2NDOA 4CW9A 4GF0A 2R37A 3GUSA 1PD21 4KH7A 2VOCA 3CXGA 1T3BA 4AJ8A 2JZSA 2B7JA 2YPMA 1S3RA 5ECOB 1F3BA 1M99A 1OC9B 2GZPA 1SKRB 4KF9A 2MMNA 1GNEA 5GSSA 1Y6EA 4QL7A 1PKWA 4LL4B 4KW6A 1PL1A 2KOKA 2VL2A 3VWXA 4TN8A 5KN3A 4K7NA 3QOUA 3EINA 2LJKA 2ZUPA 4GWRA 3L0HA 3QAVA 5JWOB 3ZZXA 3D21A 4MJCA 1OVNA 2M46A 1XWAA 3HVNA 3KCMA 2C3TA 3W6GA 1EOGA 2LRNA 5CRHA 1B4PA 3R3EA 4BWSA 3MSZA 2R2JA 3EU3A 3APSA 5IO2A 4JR4A 2TIRA 2CVBA 3GRXA 2GQMA 2CAQA 4BVYB 1TRSA 3NZNA 5ID2A 2C0EA 2KUCA 2PN8A 5FT3A 2YWOA 4PTSA 2RIIA 1NHYA 3GL5A 3IAS2 5HFIA 3SWLA 1PN0A 2J9HA 4MP4A 2FD3A 5G31A 6GSWA 2DJ1A 2H8LA 1ZZYA 3KH9A 2IMFA 3IA1A 2HLSA 4WF5A 1VF3A 1TU7A 4GSSA 3H4KA 2DMLA 3LJRA 4HJMA 4MA9A 2YN1A 1B48A 2V32A 4GTUA 2H1BA 2H71A 3UARA 3QFBC 3NOFA 1TTZA 4N30A 5KOXA 4OO4A 5DAKA 3CRTA 4MNNA 2HZEA 1UVZA 1USBA 3APOA 3FZAA 3LXTA 1PSQA 2CVDA 4GCIA 4QQ7A 1O81A 4EVMA 2YWMA 3WYWA 5ECNB 5JCUA 1TK5B 3HJMA 2ON5A 1J9BA 1F6MC 3FR6A 2JACA 3HYPA 2VLTA 1FVJA 3DVXA 1FHEA 4KNDA 2G0FA 4XS4A 5G1LA 1S3CA 4F0BA 3HJPA 2XBIA 2K8SA 1XWKA 3V1WA 4MZBA 4POLA 2FNOA 3D4MA 2VLVA 4BIKA 5CRDA 4PX1A 4O32A 3VWUA 3RAZA 1IYIA 2FWFA 3IDVA 4MMMA 3MAKA 4ZL8A 4EXJA 1T00A 1UA5A 4XS1A 5D9WA 3IPZA 2C8UA 2HNLA 2N5BA 3BCKA 2VM1A 2V2GA 1ZYEA 1LBKA 3C1RA 4K2XA 16GSA 3GURA 4J2FA 3ZL5A 1JLVA 2H1GA 3IAM2 3EYTA 3DRNA 3H1NA 1K0BA 14GSA 3I69A 2F51A 1XZOA 2YANA 1PN9A 2XPEA 1T4YA 4V1Ap 3QAGA 4OD7A 3UVTA 3Q19A 2R0CA 5L71A 4ZBAA 2WCIA 1HQOA 1A2MA 2RUFA 5EPFA 3PINA 3ME8A 4ECIA 2I3YA 3VK9A 5ECQB 2C3NA 2I9HA 2K9FA 5LD0A 2NVLA 4Q5FA 2A2PA 2LNTA 4EF0A 3IXRA 2PVQA 2GLRA 2VCWA 1XW9A 2L6DA 1GTUA 1HNCA 4MZWA 4TR3A 3TJGA 4X1UA 2N5AA 3A5IA 1ERWA 3CSJA 3L9UA 4WBJA 4ZB8A 2NTOA 4ZIJA 1SJIA 4WXTA 2N5FA 1QFNA 3QPMA 1M0UA 3MYDA 3I43A 1TXXA 1V9WA 1X5EA 22GSA 2DJJA 1JFUA 2GQLA 3A5WA 3ZFLA 1KEBA 1OE8A 2IMEA 2QA2A 3EC3A 1OC3A 3P90A 3ZIVA 1ZYQB 1UC7A 4QL9A 5HR2A 1T4ZA 3GSSA 4IS0A 2GT5A 5LNKe 4G10A 5DAKB 3EU4A 1OKTA 3KH7A 2HZEB 3ISOA 3KXOA 2CAIA 2YZUA 4HZ2A 5F07A 4O5RA 2IJYA 4RI7A 4HJ2A 1EGRA 3KP9A 2VD1A 5H5RA 1G7OA 4IW9A 2V41A 2JZTA 3HY2A 2AJQB 3F4RA 4J57E 1FOVA 4TOPA 4AF2A 1TP9A 1X9MB 1VF1A 2H66A 6GSVA 3TKSA 2G2QA 4G9HA 4NHWA 3U5RE 8GSSA 2IMKA 2L5OA 2YJ7A 3Q18A 2FGXA 2LRCA 4MDCA 4XS4B 3LSZA 2LQQA 4OFNA 3A2WA 4ACSA 2HRKA 1XW5A 4J56E 4IBPA 2A4HA
chains in the Genus database with same CATH topology
2KP2A 3O76A 5DALB 4NWYA 5JWRB 1EWXA 4XRDA 2YWNA 4V1Ag 4DSSB 3MIXA 2F8AA 2DKIA 3G9BA 1ABAA 4OCEA 5H5SA 2OACA 4V2MA 4GSTA 1GUMA 4F03A 5GAND 4OWYA 1A24A 1R7HA 2L57A 3HZ4A 5DVBA 3WGXA 2B6MA 4PGTA 1DE2A 2HSHA 3BCIA 2FUG2 3EWLA 2GSTA 1SJ6A 4FYCA 2YWIA 5LCZA 2O85A 2XPDA 4BVYA 5ECMB 4CDOA 2H70A 2QSIA 2JSZA 3IRAA 5FHIA 2MMZA 2OKAA 4USSA 1XWBA 3H93A 4IP1A 4HQSA 3UOMA 4FH8A 1A2JA 1PA3A 1I5GA 2VIMA 5DCHA 3RDWA 4ZL7A 3VPTA 3GFKA 2PMTA 3Q74A 2OJLA 2ON7A 2HZFA 4G0KA 1H75A 4K0GA 3HHVA 1ZYNA 5IMCA 1BQ7A 1EOHA 2DLXA 3HKRA 1HNAA 2XC2A 4IGJA 1V40A 2CZ3A 2AYTA 2O87A 3LW9A 4Z2UA 4KAEA 1Z6NA 3TCOA 1GLPA 5KN1A 5CNWA 3UBLA 4EL1A 1G6YA 4EIPA 3F4TA 2LSTA 4O5QA 1SKWB 1HD2A 4Q5QA 1A2LA 1OC8A 3ZFBA 4TR1A 3US3A 5JCWA 3ZIJA 4RQXA 2EIOA 3GKKA 4K5SA 5CAXA 4I2UA 1K0AA 1M9AA 1O8XA 3WD6A 1YKAA 3EMPA 1F37A 1K3OA 4ID0A 3BJ5A 1B9YC 1BG5A 4X0XA 2B1KA 3RBTA 2H0IA 3O6TA 5D96A 2CQ9A 4LL1B 2H6YA 4I5QA 1GTIA 3APQA 4BL7A 2CZ2A 5DCGA 3F63A 3CYNA 3D22A 5IMVA 1XVQA 1OAZA 3EPTA 3MWHA 1YJ6A 3FK8A 1VRSD 1EGOA 1O8WA 4EKZA 1Z9HA 4TRXA 1XXUA 2HT9A 1SD9A 2GDRA 2H73A 5INYA 3LYKA 1PL2A 3KGKA 1B4QA 4FIWA 3ERWA 1XOAA 3GNJA 3G7YA 1A0FA 2WB9A 1THXA 1OE7A 4IN0A 1EEJA 4KCEA 2DIZA 4MJAA 4G2EA 3GKNA 2TRXA 2HRAA 5JWQB 3TKSC 1B8XA 4G0LA 1V2AA 4JZQA 2VCXA 3F0IA 4XCSA 3TGZA 4MLYA 5A4UA 2IIYA 3TKRA 3ZVJA 1GSUA 2WS2A 4CY6A 1X9SB 1WP0A 5IPGA 2X49A 4V2LA 2H74A 2VAFA 4AGSA 2VM2A 2AUVA 2P31A 4AJ7A 2FHEA 3P2AA 2AAWA 3HJOA 2DJ2A 3EVIA 5IQYA 1K3LA 2VCTA 4HUAA 1DSBA 6GSXA 4PUAA 3E3EA 3ZLPA 1AQVA 5IMFA 4HS1A 3CRUA 2WDUA 1K3YA 3AY8A 2OBKA 2M80A 1TDIA 3O3TA 4IHUA 1KBNA 3GH6A 1EEMA 1AW9A 1K0OA 3EMXA 4GQCA 2A2RA 5B6MA 3QMXA 3LEFA 3F6DA 2F8FA 1TK8B 2MYGA 2C0DA 2I1UA 3KP8A 2M72A 3QCPA 2UZ8A 2DSAA 4ZB6A 4PNFA 5JCGA 2O8VB 2XHFA 5HR1A 2LV3A 4YKFA 1R4WA 2CT6A 3WGDA 1QQ2A 2EC4A 5A4WA 3JCML 4IELA 1ILOA 4YKGA 1W4VA 2X64A 5IOWA 4MCUA 1PX6A 4TR1B 4NMUA 4DSQA 3VLNA 5ENUA 1J0FA 4EDZA 3DIEA 4K7OA 1X0RA 5G5FA 2P0GA 4GLTA 13GSA 3LQ7A 4YQMA 1SKSB 1K0MA 2AV4A 2VCQA 4MF6A 7GSSA 3J7Yk 4BL7B 4FYUA 1G6WA 2GSSA 2IFQA 3IHGA 3IR4A 2GGTA 3E9JB 3M8NA 3QD9A 1U3IA 1THOA 1I9DA 2YOIA 3W8SA 3VWWA 2RM6A 4Q5NA 1SENA 4XTSA 1XCCA 5GZZB 3G7JA 4E8EA 2JL4A 18GSA 5DALA 1SK2A 5HR0A 2L4QA 2LTKA 5CRWA 2Z9SA 4ZBBA 2K8VA 5ECHB 4DSSA 4V2NA 1BEDA 2XBQA 1Q98A 3M0FA 4HDEA 1FW1A 1MD4A 2PERA 5AN1A 3ZITA 5CP1A 4BPYA 1WJKA 2YZHA 1MTCA 1NHOA 2FLSA 1URMA 2LJAA 1Z5YE 1F2EA 1RQMA 4ECCA 2HRNA 4HEA2 1Q4JA 1CQGA 2MBTA 4KCAA 2KHPA 2FWGA 2WJUA 4D73A 1ZYPA 3DXBA 1OKDA 2F9SA 1ON4A 2R4VA 4LMWA 4TXOB 1NM3A 2DMMA 4YQVA 1ZOFA 1F9MA 5DQYA 2P5RA 1LU4A 5J9CA 3HCZA 3FZ4A 3C1SA 2A2SA 3ZRDA 3GA4A 4LMVA 1U87A 3DYRA 4WEYA 5ABRA 4PQ1A 4L5LA 3ERGA 1QMVA 3UL3A 2V1MA 3BOAA 5AISA 1ERTA 1B9XC 3K8NA 3HVSA 2B5XA 2R5GA 1GH2A 2LRTA 4KSMA 4RUVA 4TR0A 2VCVA 1YEXA 5ELGA 2TRCP 4BA7A 3W8JA 4KDUA 3BBYA 1AQWA 2JU5A 1BJXA 4MF5A 1PX7A 2H19A 2PGTA 3KMNA 1U6TA 3QAWA 2FA4A 3TOUA 5J4UA 1VGLA 4Z7XA 3BD2A 4O7HA 3TUEA 2KP1A 3IBHA 4N11A 1GTBA 2LUSA 1RW1A 4TXVA 4FO5A 2VUPA 3LYPA 2CX4A 1GSQA 2H76A 1SYRA 1GSYA 1FOHA 3RHBA 1DE1A 1KNGA 2B7KA 1AUCA 2RUEA 3ERFA 4ZBDA 1XFLA 4WBRD 5IMDA 2HE3A 2X8HA 5CRGA 4K6XA 3UEMA 3HZ8A 3DWVA 1G7EA 4L0WA 2HSYA 4LLRA 3MDKA 1TRUA 5F8BA 2EIRA 1N8JA 3VFIA 2PPTA 2DBCA 4NHZA 5DJMA 4HI7A 4GRFA 4WF4A 5EL8A 1PRXA 4F9ZA 3RPNA 4YAVA 1TI3A 1WIKA 1YZXA 1GSEA 1ERVA 5D8IA 2H6ZA 4ISDA 1GSSA 1R5AA 5D9VA 3L4NA 2GZYA 2JSYA 5COHA 3FMWA 1TKDB 3F6FA 2IFQB 1TI1A 4TR4A 3GYKA 1XVWA 2F3MA 2OADA 1CQHA 20GSA 3IK9A 5ECRB 1SL0B 2V6OA 3M9JA 5IMAA 4JEDA 3GN3A 2BTOT 2ES7A 5B8BA 1MD3A 4K2DA 4I6XA 3UVHA 1O73A 1GSDA 3G7IA 3GIXA 4CHSA 1G0TA 2WULA 2B1LA 2FA8A 3GHAA 3P8WA 4KUNA 1AC1A 3DVWA 3R2QA 3GSTA 4H86A 2HI7A 1SD8A 1VF4A 5KN0A 5IO0A 1YEPA 3PR8A 4I2TA 3UIWA 3IV4A 5G5EA 4D73B 2CA8A 1O7UA 3M3MA 4I97A 2HRFA 5KN2A 1EP8A 3CMIA 3KIJA 3KEBA 4FYBA 2YV9A 2K6VA 2PWJA 1WWJA 1M2BA 3GTUB 3J7Yb 2YNXA 1YY7A 1V98A 1V58A 3IOSA 2E2MA 2BJXA 2YJHA 1YF0A 3WT2A 4N0VA 4F0CA 2RM5A 1A23A 1T7PB 4OO5A 5BRTA 2IWTA 2GS3A 3DKSA 1A0RP 2VLUA 1BX9A 4PQIA 5DJLA 4TVEA 1WRYA 2AB6A 4L0UA 2H01A 5CYYA 4ZILA 4ILFA 4L5OA 1Z7RA 2E0QA 4RQRA 2FCHA 1XBSA 17GSA 2IMIA 2JZRA 1U3AA 3A3TA 3A2VA 1WOUA 4MJBA 2ZCTA 2MMOA 2O7KA 1BAYA 4POKA 1SYXA 2YP6A 5H5QA 1JZRA 5DQSA 3PPUA 1H4OA 2IPAA 2MMAA 1S3DA 3DD3A 4ECBA 1HYUA 4BVXA 1WMJA 3H8QA 1QXHA 1EZKA 4MF7A 1WPIA 1TU8A 4IP6A 10GSA 3HVXA 1AIUA 4F2IA 9GSSA 3TRXA 4ZXGA 2LEGA 5AIVA 1MDKA 3C8EA 3EURA 3FR3A 4NPBA 5E4WA 2WGRA 2DJKA 3D5JA 1V57A 2BMXA 4DVCA 4WR5A 3KTLA 1T1VA 1C72A 1FB6A 1ACVA 1ML6A 4IJIA 4KX4A 4G19A 4YH2A 2PU9C 3FYGA 3C73A 4L8EA 4KE3A 3C7MA 1TJDA 3FZ5A 1MEKA 2H72A 1SJZA 4AJ6A 1GP1A 1PMTA 4MABA 4TXOA 5F05A 2D2ZA 4HU9A 4ICYA 2B5YA 3LG6A 2VCZA 1GSFA 1FG4A 6GSYA 1Z6MA 1XWGA 4YQUA 1X9WB 4PQHA 4KDXA 5ECKB 3M1GA 3QFAC 3GKXA 5AIXA 4MH2A 1XW6A 3TKSE 6GSTA 2H1AA 2A4VA 3TKPA 5ECLB 3IC8A 1AQXA 4Z2TA 1GUHA 1FB0A 3UJ1A 3ZMKA 1R26A 1SU9A 3RHCA 6GSSA 2YCDA 4O5UA 1VF2A 3HDCA 1GWCA 1K0CA 2L6CA 1QGVA 2KLXA 2L4CA 3L9SA 3H79A 1K0NA 5AGYA 3HVVA 3GX8A 4MPGA 2NBSA 2AHEA 3N9JA 4XRAA 4HU7A 3TOTA 3U6VA 3FZ9A 4CY8A 1RK4A 2QC7A 2I81A 2GT6A 1E6BA 4KDYA 3RPPA 3FEUA 3TJKA 4X4JA 4KSOA 3KD0A 5FWGA 1JZWA 1S3AA 1XPVA 1A8LA 3ME7A 1M2AA 2IN3A 1GUKA 1WE0A 1TW9A 1TOFA 2LJRA 5DDLA 4YAPA 4EE0A 5ECIB 3TDGA 2GVPA 1UN2A 4N0ZA 2GSQA 2OE1A 3IE3A 3Q6OA 1NW2A 3UBKA 4ZL9A 3FHKA 3ZYWA 4BVXB 4MJEA 2H30A 1E2YA 5GAPD 4JE1A 5B8AA 3GV1A 3VI7A 1W89A 6GSUA 2V6KA 4POBA 4ML6A 1KTEA 5ECSA 11GSA 2LKUA 5CO3A 3VURA 4HZ4A 3UAPA 5J41A 3I6AA 3TJBA 5B6NA 1JHBA 2PVOC 2YV7A 5GSTA 3KTBA 2B5EA 4K7IA 3VWVA 4OFTA 4K8MA 2X8GA 1YDKA 2CX3A 12GSA 2CV4A 4I8BA 2X99A 3DMLA 3ZMLA 3CSHA 1ST9A 1IYHA 5IIZA 3IC4A 3QR6A 1ZMAA 3VI5A 3PGTA 2FWEA 3DGQA 3TJJA 1ZCPA 1ERUA 2HYXA 3KJYA 4K5RA 1MDIA 1SL1B 1Z7PA 2FY6A 4N10A 1Z3EA 2R0PA 4EUYA 3GTUA 5E59A 5A4VA 1XIYA 3F4SA 5D9TA 4P3YB 4GSNA 4IKHA 1JLWA 3ED3A 5KOWA 2VL2C 2R3XA 1GNWA 1GLQA 4KGIA 2ALBA 2LQOA 2WFCA 4FQUA 4ECJA 3HD5A 1DUGA 4EIQA 2C1YA 4ZB9A 4POMA 3GX0A 2ZNMA 4PUFC 1FO5A 2VD0A 1PGTA 2OE3A 4NV5A 5ID2B 4IVFA 4E8HA 1MDJA 3S9FA 3P7XA 1SK0A 4JU5A 4F82A 3F3QA 1GULA 3KZQA 3WGEA 1Y25A 1O85A 4RI6A 3CBUA 1YQ1A 1X5DA 4NV2A 2VO4A 2DJ3A 3GMFA 4JR6A 2GQKA 5DBQA 4EDYA 2J23A 2GTUA 2H75A 5A5KA 19GSA 4MZCA 2OA7A 5F0GA 3GH9A 1O6JA 1GL8A 3C71A 2NPBA 4HOJA 3FW2A 2RLIA 4LA1A 3ZTLA 2QA1A 2GSRA 4K0NA 4OCFA 2FWHA 4PXOA 1XOBA 1ZL9A 1BYEA 2H6XA 3CTGA 3NIVA 5G2ZA 4PNGA 3WT1A 1M7TA 4MPFA 4XHMA 3KMOA 2PBJA 1QUWA 4HQZA 1EV4A 2C4JA 1PKZA 4ULXA 1YF1A 3N5OA 2QKEA 5EY6A 5IMZA 1LJRA 5J9BA 3D6IA 4WKWA 4O92A 4IQAA 4WR4A 2HFDA 1EV9A 2K18A 3SBCA 2QGVA 3F9UA 5B7CA 3L78A 4BWQA 3GKMA 2OBIA 3E0UA 5ELAA 1JZDA 1TK0B 5G30A 2OE0A 2LS5A 4IJ3A 1GTAA 1OC9A 1YKCA 3L9VA 4K9ZA 2MZCA 2LNSA 3IK7A 4GXZA 4XIHA 2C0FA 5BMUA 4ML1A 2P5QA 3EE2A 1FAAA 2DKHA 3LFLA 4Q5RA 5D73A 1J08A 2R0GA 1JZOA 3GL3A 1AXDA 2VL3A 3FY7A 2HXKA 2X4AA 1T8EB 2REMA 4IQ1A 1F3AA 3KM6A 4EC0A 1M2DA 1U88A 3HXSA 4JBBA 4KB3A 4MH3A 2R6KA 5C00A 3A2XA 4NXIA 5ECPB 2WRTA 3TB2A 3D0ZA 3TJFA 4Z2RA 5G1KA 1K0DA 4DSRA 5D93A 2IL3A 1SK1A 2E7PA 1XWCA 4JRRA 3ZVJD 3DEXA 3UMAA 3TRPA 3FKFA 3I9V2 2CVKA 2JADA 2C80A 4KA0A 2E2GA 3LWAA 1TRWA 1TRVA 5EVOA 1EP7A 3VPQA 1PQNA 1NSWA 1FVKA 1N2AA 2H1DA 2GZZA 5HR3A 2C3QA 2L59A 3D4TA 4NAXA 2EIQA 3F8UA 2H0HA 3LGCA 2B3SA 3OR5A 5HFKA 4G0IA 3TRQA 3LXZA 2DIYA 4GQFA 2PUKC 3QDNA 1QK8A 1R5PA 3HA9A 1DBYA 4DEJA 4X43A 3F3RA 2VL9A 1M9BA 3PH9A 2HSMA 5IPHA 1GRXA 2IMDA 1ZGNA 2C0GA 4K1FA 1A8YA 5HQPA 2WZ9A 3TKQA 3FR9A 3MNGA 3FRCA 4XS6A 5J5NA 1OYJA 3M9KA 4OMVA 2H0GA 1HNBA 5C04A 5KEJA 2I4AA 3LORA 2DJ0A 4EO3A 5CREA 4MK3A 4PURA 3IHQA 2MBSA 4OFMA 3ZREA 2O89A 4TW5A 4WETA 1AAZA 2DC5A 5D9XA 5IOXA 4A5PA 5IM9A 1SL2B 5J3RA 3CSIA 1X5CA 2X8CA 3CTFA 5F06A 2L5LA 4TKYA 5HFGA 2NDOA 4CW9A 4GF0A 2R37A 3GUSA 1PD21 4KH7A 2VOCA 3CXGA 1T3BA 4AJ8A 2JZSA 2B7JA 2YPMA 5ECOB 1F3BA 1M99A 1OC9B 2GZPA 1SKRB 4KF9A 2MMNA 1GNEA 5GSSA 1Y6EA 4QL7A 1PKWA 4LL4B 4KW6A 1PL1A 2KOKA 2VL2A 3VWXA 4TN8A 5KN3A 4K7NA 3QOUA 3EINA 2LJKA 2ZUPA 4GWRA 3L0HA 3QAVA 5JWOB 3ZZXA 3D21A 4MJCA 1OVNA 2M46A 1XWAA 3KCMA 2C3TA 3W6GA 1EOGA 2LRNA 5CRHA 1B4PA 3R3EA 4BWSA 3MSZA 2R2JA 3EU3A 3APSA 5IO2A 4JR4A 2TIRA 2CVBA 3GRXA 2GQMA 2CAQA 4BVYB 1TRSA 3NZNA 5ID2A 2C0EA 2KUCA 2PN8A 5FT3A 2YWOA 4PTSA 2RIIA 1NHYA 3GL5A 3IAS2 5HFIA 3SWLA 1PN0A 2J9HA 4MP4A 2FD3A 5G31A 6GSWA 2DJ1A 2H8LA 1ZZYA 3KH9A 2IMFA 3IA1A 2HLSA 4WF5A 1VF3A 1TU7A 4GSSA 3H4KA 2DMLA 3LJRA 4HJMA 4MA9A 2YN1A 1B48A 2V32A 4GTUA 2H1BA 2H71A 3UARA 3QFBC 3NOFA 1TTZA 4N30A 5KOXA 4OO4A 5DAKA 3CRTA 4MNNA 2HZEA 1UVZA 1USBA 3APOA 3FZAA 3LXTA 1PSQA 2CVDA 4GCIA 4QQ7A 1O81A 4EVMA 2YWMA 3WYWA 5ECNB 5JCUA 1TK5B 3HJMA 2ON5A 1J9BA 1F6MC 3FR6A 2JACA 3HYPA 2VLTA 1FVJA 3DVXA 1FHEA 4KNDA 2G0FA 4XS4A 5G1LA 1S3CA 4F0BA 3HJPA 2XBIA 2K8SA 1XWKA 3V1WA 4MZBA 4POLA 2FNOA 3D4MA 2VLVA 5CRDA 4PX1A 4O32A 3VWUA 3RAZA 1IYIA 2FWFA 3IDVA 4MMMA 3MAKA 4ZL8A 4EXJA 1T00A 1UA5A 4XS1A 5D9WA 3IPZA 2C8UA 2HNLA 2N5BA 3BCKA 2VM1A 2V2GA 1ZYEA 1LBKA 3C1RA 4K2XA 16GSA 3GURA 4J2FA 3ZL5A 1JLVA 2H1GA 3IAM2 3EYTA 3DRNA 3H1NA 1K0BA 14GSA 3I69A 2F51A 1XZOA 2YANA 1PN9A 2XPEA 1T4YA 4V1Ap 3QAGA 4OD7A 3UVTA 3Q19A 2R0CA 5L71A 4ZBAA 2WCIA 1HQOA 1A2MA 2RUFA 5EPFA 3PINA 3ME8A 4ECIA 2I3YA 3VK9A 5ECQB 2C3NA 2I9HA 2K9FA 5LD0A 2NVLA 4Q5FA 2A2PA 2LNTA 4EF0A 3IXRA 2PVQA 2GLRA 2VCWA 1XW9A 2L6DA 1GTUA 1HNCA 4MZWA 4TR3A 3TJGA 4X1UA 2N5AA 3A5IA 1ERWA 3CSJA 3L9UA 4WBJA 4ZB8A 2NTOA 4ZIJA 1SJIA 4WXTA 2N5FA 1QFNA 3QPMA 1M0UA 3MYDA 3I43A 1TXXA 1V9WA 1X5EA 22GSA 2DJJA 1JFUA 2GQLA 3A5WA 3ZFLA 1KEBA 1OE8A 2IMEA 2QA2A 3EC3A 1OC3A 3P90A 3ZIVA 1ZYQB 1UC7A 4QL9A 5HR2A 1T4ZA 3GSSA 4IS0A 2GT5A 5LNKe 4G10A 5DAKB 3EU4A 1OKTA 3KH7A 2HZEB 3ISOA 3KXOA 2CAIA 2YZUA 4HZ2A 5F07A 4O5RA 2IJYA 4RI7A 4HJ2A 1EGRA 3KP9A 2VD1A 5H5RA 1G7OA 4IW9A 2V41A 2JZTA 3HY2A 2AJQB 3F4RA 4J57E 1FOVA 4TOPA 4AF2A 1TP9A 1X9MB 1VF1A 2H66A 6GSVA 3TKSA 2G2QA 4G9HA 4NHWA 3U5RE 8GSSA 2IMKA 2L5OA 2YJ7A 3Q18A 2FGXA 2LRCA 4MDCA 4XS4B 3LSZA 2LQQA 4OFNA 3A2WA 4ACSA 2HRKA 1XW5A 4J56E 4IBPA 2A4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KP2 A;  3O76 A;  5DAL B;  4NWY A;  5JWR B;  1EWX A;  4XRD A;  2YWN A;  4V1A g;  4DSS B;  2F8A A;  3G9B A;  1ABA A;  4OCE A;  5H5S A;  2OAC A;  4V2M A;  4GST A;  1GUM A;  4F03 A;  5GAN D;  4OWY A;  1A24 A;  1R7H A;  2L57 A;  3HZ4 A;  5DVB A;  3WGX A;  2B6M A;  4PGT A;  1DE2 A;  2HSH A;  3BCI A;  2FUG 2;  3EWL A;  2GST A;  1SJ6 A;  4FYC A;  2YWI A;  5LCZ A;  2O85 A;  2XPD A;  4BVY A;  5ECM B;  4CDO A;  2H70 A;  2QSI A;  2JSZ A;  3IRA A;  5FHI A;  2MMZ A;  2OKA A;  1XWB A;  3H93 A;  4IP1 A;  4HQS A;  3UOM A;  4FH8 A;  1A2J A;  1PA3 A;  1I5G A;  2VIM A;  5DCH A;  3RDW A;  4ZL7 A;  3VPT A;  3GFK A;  2PMT A;  3Q74 A;  2OJL A;  2ON7 A;  2HZF A;  1H75 A;  3HHV A;  4K0G A;  5IMC A;  1BQ7 A;  1EOH A;  2DLX A;  3HKR A;  1HNA A;  2XC2 A;  4IGJ A;  1V40 A;  2CZ3 A;  2AYT A;  2O87 A;  4KAE A;  1Z6N A;  3TCO A;  1GLP A;  5KN1 A;  5CNW A;  3UBL A;  4EL1 A;  1G6Y A;  3F4T A;  2LST A;  1SKW B;  1HD2 A;  4Q5Q A;  1A2L A;  1OC8 A;  3ZFB A;  4TR1 A;  3US3 A;  5JCW A;  3ZIJ A;  4RQX A;  2EIO A;  3GKK A;  5CAX A;  4I2U A;  1K0A A;  1M9A A;  1O8X A;  3WD6 A;  1YKA A;  3EMP A;  1F37 A;  1K3O A;  4ID0 A;  3BJ5 A;  1B9Y C;  1BG5 A;  4X0X A;  2B1K A;  3RBT A;  2H0I A;  3O6T A;  5D96 A;  2CQ9 A;  4LL1 B;  2H6Y A;  4I5Q A;  1GTI A;  3APQ A;  4BL7 A;  2CZ2 A;  5DCG A;  3F63 A;  3CYN A;  3D22 A;  5IMV A;  1XVQ A;  1OAZ A;  3MWH A;  1YJ6 A;  3FK8 A;  1VRS D;  1EGO A;  1O8W A;  4EKZ A;  1Z9H A;  4TRX A;  1XXU A;  2HT9 A;  1SD9 A;  2GDR A;  2H73 A;  5INY A;  3LYK A;  1PL2 A;  3KGK A;  1B4Q A;  4FIW A;  3ERW A;  1XOA A;  3GNJ A;  3G7Y A;  1A0F A;  2WB9 A;  1THX A;  1OE7 A;  4IN0 A;  1EEJ A;  4KCE A;  2DIZ A;  4MJA A;  4G2E A;  3GKN A;  2TRX A;  5JWQ B;  3TKS C;  1B8X A;  1V2A A;  4JZQ A;  2VCX A;  3F0I A;  4XCS A;  3TGZ A;  4MLY A;  5A4U A;  2IIY A;  3TKR A;  3ZVJ A;  1GSU A;  2WS2 A;  1X9S B;  1WP0 A;  5IPG A;  4V2L A;  2H74 A;  2VAF A;  4AGS A;  2VM2 A;  2AUV A;  2P31 A;  4AJ7 A;  2FHE A;  3P2A A;  2AAW A;  3HJO A;  2DJ2 A;  3EVI A;  5IQY A;  1K3L A;  2VCT A;  4HUA A;  1DSB A;  6GSX A;  4PUA A;  3E3E A;  3ZLP A;  1AQV A;  5IMF A;  4HS1 A;  3CRU A;  2WDU A;  1K3Y A;  3AY8 A;  2OBK A;  2M80 A;  1TDI A;  3O3T A;  4IHU A;  1KBN A;  3GH6 A;  1EEM A;  1AW9 A;  1K0O A;  3EMX A;  4GQC A;  2A2R A;  5B6M A;  3QMX A;  3LEF A;  3F6D A;  2F8F A;  1TK8 B;  2MYG A;  2C0D A;  2I1U A;  3KP8 A;  2M72 A;  3QCP A;  2DSA A;  4ZB6 A;  4PNF A;  5JCG A;  2O8V B;  2XHF A;  5HR1 A;  2LV3 A;  1R4W A;  2CT6 A;  3WGD A;  1QQ2 A;  2EC4 A;  5A4W A;  3JCM L;  4IEL A;  1ILO A;  1W4V A;  2X64 A;  5IOW A;  4MCU A;  1PX6 A;  4TR1 B;  4NMU A;  4DSQ A;  3VLN A;  5ENU A;  1J0F A;  4EDZ A;  3DIE A;  4K7O A;  1X0R A;  5G5F A;  2P0G A;  4GLT A;  13GS A;  3LQ7 A;  4YQM A;  1SKS B;  1K0M A;  2AV4 A;  2VCQ A;  4MF6 A;  7GSS A;  3J7Y k;  4FYU A;  1G6W A;  2GSS A;  2IFQ A;  3IR4 A;  2GGT A;  3E9J B;  3M8N A;  3QD9 A;  1U3I A;  1THO A;  1I9D A;  2YOI A;  3W8S A;  3VWW A;  2RM6 A;  4Q5N A;  1SEN A;  4XTS A;  1XCC A;  5GZZ B;  3G7J A;  4E8E A;  2JL4 A;  18GS A;  5DAL A;  1SK2 A;  5HR0 A;  2L4Q A;  2LTK A;  5CRW A;  2Z9S A;  4ZBB A;  2K8V A;  5ECH B;  4DSS A;  4V2N A;  1BED A;  2XBQ A;  1Q98 A;  3M0F A;  4HDE A;  1FW1 A;  1MD4 A;  2PER A;  5AN1 A;  3ZIT A;  5CP1 A;  4BPY A;  1WJK A;  2YZH A;  1MTC A;  1NHO A;  2FLS A;  1URM A;  2LJA A;  1Z5Y E;  1F2E A;  1RQM A;  4ECC A;  2HRN A;  4HEA 2;  1Q4J A;  1CQG A;  2MBT A;  4KCA A;  2KHP A;  2FWG A;  2WJU A;  4D73 A;  3DXB A;  1OKD A;  2F9S A;  1ON4 A;  2R4V A;  4LMW A;  4TXO B;  1NM3 A;  2DMM A;  4YQV A;  1ZOF A;  1F9M A;  5DQY A;  2P5R A;  1LU4 A;  5J9C A;  3HCZ A;  3FZ4 A;  3C1S A;  2A2S A;  3ZRD A;  3GA4 A;  4LMV A;  1U87 A;  3DYR A;  4WEY A;  5ABR A;  4PQ1 A;  4L5L A;  3ERG A;  1QMV A;  3UL3 A;  2V1M A;  3BOA A;  5AIS A;  1ERT A;  1B9X C;  3K8N A;  3HVS A;  2B5X A;  2R5G A;  1GH2 A;  2LRT A;  4KSM A;  4RUV A;  4TR0 A;  2VCV A;  1YEX A;  5ELG A;  2TRC P;  4BA7 A;  3W8J A;  4KDU A;  3BBY A;  1AQW A;  2JU5 A;  1BJX A;  4MF5 A;  1PX7 A;  2H19 A;  2PGT A;  3KMN A;  1U6T A;  3QAW A;  2FA4 A;  3TOU A;  5J4U A;  1VGL A;  4Z7X A;  3BD2 A;  4O7H A;  3TUE A;  2KP1 A;  3IBH A;  4N11 A;  1GTB A;  2LUS A;  1RW1 A;  4TXV A;  4FO5 A;  2VUP A;  3LYP A;  2CX4 A;  1GSQ A;  2H76 A;  1SYR A;  1GSY A;  3RHB A;  1DE1 A;  1KNG A;  2B7K A;  1AUC A;  2RUE A;  3ERF A;  4ZBD A;  1XFL A;  4WBR D;  5IMD A;  2HE3 A;  2X8H A;  5CRG A;  4K6X A;  3UEM A;  3HZ8 A;  3DWV A;  1G7E A;  4L0W A;  2HSY A;  4LLR A;  3MDK A;  1TRU A;  5F8B A;  2EIR A;  1N8J A;  3VFI A;  2PPT A;  2DBC A;  4NHZ A;  5DJM A;  4HI7 A;  4GRF A;  4WF4 A;  5EL8 A;  1PRX A;  4F9Z A;  3RPN A;  4YAV A;  1TI3 A;  1WIK A;  1YZX A;  1GSE A;  1ERV A;  5D8I A;  2H6Z A;  4ISD A;  1GSS A;  1R5A A;  5D9V A;  3L4N A;  2GZY A;  2JSY A;  5COH A;  1TKD B;  3F6F A;  2IFQ B;  1TI1 A;  4TR4 A;  3GYK A;  1XVW A;  2F3M A;  2OAD A;  1CQH A;  20GS A;  3IK9 A;  5ECR B;  1SL0 B;  2V6O A;  3M9J A;  5IMA A;  4JED A;  3GN3 A;  2BTO T;  2ES7 A;  5B8B A;  1MD3 A;  4K2D A;  4I6X A;  3UVH A;  1O73 A;  1GSD A;  3G7I A;  3GIX A;  4CHS A;  1G0T A;  2WUL A;  2B1L A;  2FA8 A;  3GHA A;  3P8W A;  4KUN A;  1AC1 A;  3DVW A;  3R2Q A;  3GST A;  4H86 A;  2HI7 A;  1SD8 A;  1VF4 A;  5KN0 A;  5IO0 A;  1YEP A;  3PR8 A;  4I2T A;  3UIW A;  3IV4 A;  5G5E A;  4D73 B;  2CA8 A;  1O7U A;  3M3M A;  4I97 A;  2HRF A;  5KN2 A;  1EP8 A;  3CMI A;  3KIJ A;  3KEB A;  4FYB A;  2YV9 A;  2K6V A;  2PWJ A;  1WWJ A;  1M2B A;  3GTU B;  3J7Y b;  2YNX A;  1YY7 A;  1V98 A;  1V58 A;  3IOS A;  2E2M A;  2BJX A;  2YJH A;  1YF0 A;  3WT2 A;  4N0V A;  4F0C A;  2RM5 A;  1A23 A;  1T7P B;  4OO5 A;  2IWT A;  2GS3 A;  3DKS A;  1A0R P;  2VLU A;  1BX9 A;  4PQI A;  5DJL A;  4TVE A;  1WRY A;  2AB6 A;  4L0U A;  2H01 A;  5CYY A;  4ZIL A;  4ILF A;  4L5O A;  1Z7R A;  2E0Q A;  4RQR A;  2FCH A;  1XBS A;  17GS A;  2IMI A;  2JZR A;  1U3A A;  3A3T A;  3A2V A;  1WOU A;  4MJB A;  2ZCT A;  2MMO A;  2O7K A;  1BAY A;  4POK A;  1SYX A;  2YP6 A;  5H5Q A;  1JZR A;  5DQS A;  1H4O A;  2IPA A;  2MMA A;  1S3D A;  3DD3 A;  4ECB A;  1HYU A;  4BVX A;  1WMJ A;  3H8Q A;  1QXH A;  1EZK A;  4MF7 A;  1WPI A;  1TU8 A;  4IP6 A;  10GS A;  3HVX A;  1AIU A;  4F2I A;  9GSS A;  3TRX A;  4ZXG A;  2LEG A;  5AIV A;  1MDK A;  3C8E A;  3EUR A;  3FR3 A;  4NPB A;  5E4W A;  2WGR A;  2DJK A;  3D5J A;  1V57 A;  2BMX A;  4DVC A;  4WR5 A;  3KTL A;  1T1V A;  1C72 A;  1FB6 A;  1ACV A;  1ML6 A;  4IJI A;  4KX4 A;  4G19 A;  4YH2 A;  2PU9 C;  3FYG A;  3C73 A;  4L8E A;  4KE3 A;  3C7M A;  1TJD A;  3FZ5 A;  1MEK A;  2H72 A;  1SJZ A;  4AJ6 A;  1GP1 A;  1PMT A;  4MAB A;  4TXO A;  5F05 A;  2D2Z A;  4HU9 A;  2B5Y A;  3LG6 A;  2VCZ A;  1GSF A;  1FG4 A;  6GSY A;  1Z6M A;  1XWG A;  4YQU A;  1X9W B;  4PQH A;  4KDX A;  5ECK B;  3M1G A;  3QFA C;  3GKX A;  5AIX A;  4MH2 A;  1XW6 A;  3TKS E;  6GST A;  2H1A A;  2A4V A;  3TKP A;  5ECL B;  1AQX A;  1GUH A;  1FB0 A;  3UJ1 A;  3ZMK A;  1R26 A;  1SU9 A;  3RHC A;  6GSS A;  2YCD A;  1VF2 A;  3HDC A;  1GWC A;  1K0C A;  2L6C A;  1QGV A;  2KLX A;  2L4C A;  3L9S A;  3H79 A;  1K0N A;  5AGY A;  3HVV A;  3GX8 A;  4MPG A;  2NBS A;  2AHE A;  3N9J A;  4XRA A;  4HU7 A;  3TOT A;  3U6V A;  3FZ9 A;  1RK4 A;  2QC7 A;  2I81 A;  2GT6 A;  1E6B A;  4KDY A;  3RPP A;  3FEU A;  3TJK A;  4KSO A;  3KD0 A;  5FWG A;  1JZW A;  1S3A A;  1XPV A;  1A8L A;  3ME7 A;  1M2A A;  2IN3 A;  1GUK A;  1WE0 A;  1TW9 A;  1TOF A;  2LJR A;  5DDL A;  4YAP A;  4EE0 A;  5ECI B;  3TDG A;  2GVP A;  1UN2 A;  4N0Z A;  2GSQ A;  2OE1 A;  3IE3 A;  3Q6O A;  1NW2 A;  3UBK A;  4ZL9 A;  3FHK A;  3ZYW A;  4MJE A;  2H30 A;  1E2Y A;  5GAP D;  4JE1 A;  5B8A A;  3GV1 A;  3VI7 A;  1W89 A;  6GSU A;  2V6K A;  4POB A;  4ML6 A;  1KTE A;  5ECS A;  11GS A;  2LKU A;  5CO3 A;  3VUR A;  4HZ4 A;  3UAP A;  5J41 A;  3I6A A;  3TJB A;  5B6N A;  1JHB A;  2PVO C;  2YV7 A;  5GST A;  3KTB A;  2B5E A;  4K7I A;  3VWV A;  4OFT A;  4K8M A;  2X8G A;  1YDK A;  2CX3 A;  12GS A;  2CV4 A;  4I8B A;  2X99 A;  3DML A;  3ZML A;  3CSH A;  1ST9 A;  1IYH A;  5IIZ A;  3IC4 A;  3QR6 A;  1ZMA A;  3VI5 A;  3PGT A;  2FWE A;  3DGQ A;  3TJJ A;  1ZCP A;  1ERU A;  2HYX A;  3KJY A;  1MDI A;  1SL1 B;  1Z7P A;  2FY6 A;  4N10 A;  1Z3E A;  4EUY A;  3GTU A;  5E59 A;  5A4V A;  1XIY A;  3F4S A;  5D9T A;  4P3Y B;  4GSN A;  4IKH A;  1JLW A;  3ED3 A;  2VL2 C;  2R3X A;  1GNW A;  1GLQ A;  4KGI A;  2ALB A;  2LQO A;  2WFC A;  4ECJ A;  3HD5 A;  1DUG A;  2C1Y A;  4ZB9 A;  4POM A;  3GX0 A;  2ZNM A;  4PUF C;  1FO5 A;  2VD0 A;  1PGT A;  2OE3 A;  4NV5 A;  5ID2 B;  4IVF A;  4E8H A;  1MDJ A;  3S9F A;  3P7X A;  1SK0 A;  4JU5 A;  4F82 A;  3F3Q A;  1GUL A;  3KZQ A;  3WGE A;  1Y25 A;  1O85 A;  4RI6 A;  3CBU A;  1YQ1 A;  1X5D A;  4NV2 A;  2VO4 A;  2DJ3 A;  3GMF A;  4JR6 A;  2GQK A;  5DBQ A;  4EDY A;  2J23 A;  2GTU A;  2H75 A;  5A5K A;  19GS A;  4MZC A;  2OA7 A;  5F0G A;  3GH9 A;  1O6J A;  1GL8 A;  3C71 A;  2NPB A;  4HOJ A;  3FW2 A;  2RLI A;  4LA1 A;  3ZTL A;  2GSR A;  4K0N A;  4OCF A;  2FWH A;  4PXO A;  1XOB A;  1ZL9 A;  1BYE A;  2H6X A;  3CTG A;  3NIV A;  5G2Z A;  4PNG A;  3WT1 A;  1M7T A;  4MPF A;  4XHM A;  3KMO A;  2PBJ A;  1QUW A;  4HQZ A;  1EV4 A;  2C4J A;  1PKZ A;  4ULX A;  1YF1 A;  3N5O A;  2QKE A;  5EY6 A;  5IMZ A;  1LJR A;  5J9B A;  3D6I A;  4WKW A;  4O92 A;  4IQA A;  4WR4 A;  2HFD A;  1EV9 A;  2K18 A;  3SBC A;  2QGV A;  3F9U A;  5B7C A;  3L78 A;  4BWQ A;  3GKM A;  2OBI A;  3E0U A;  5ELA A;  1JZD A;  1TK0 B;  5G30 A;  2OE0 A;  2LS5 A;  4IJ3 A;  1GTA A;  1OC9 A;  1YKC A;  3L9V A;  4K9Z A;  2MZC A;  2LNS A;  3IK7 A;  4GXZ A;  4XIH A;  2C0F A;  4ML1 A;  2P5Q A;  3EE2 A;  1FAA A;  3LFL A;  4Q5R A;  5D73 A;  1J08 A;  1JZO A;  3GL3 A;  1AXD A;  2VL3 A;  3FY7 A;  2HXK A;  1T8E B;  2REM A;  4IQ1 A;  1F3A A;  3KM6 A;  4EC0 A;  1M2D A;  1U88 A;  3HXS A;  4JBB A;  4KB3 A;  4MH3 A;  2R6K A;  5C00 A;  3A2X A;  4NXI A;  5ECP B;  2WRT A;  3TB2 A;  3D0Z A;  3TJF A;  5G1K A;  1K0D A;  4DSR A;  5D93 A;  2IL3 A;  1SK1 A;  2E7P A;  1XWC A;  4JRR A;  3ZVJ D;  3DEX A;  3UMA A;  3TRP A;  3FKF A;  3I9V 2;  2CVK A;  2JAD A;  2C80 A;  4KA0 A;  2E2G A;  3LWA A;  1TRW A;  1TRV A;  5EVO A;  1EP7 A;  3VPQ A;  1PQN A;  1NSW A;  1FVK A;  1N2A A;  2H1D A;  2GZZ A;  5HR3 A;  2C3Q A;  2L59 A;  3D4T A;  4NAX A;  2EIQ A;  3F8U A;  2H0H A;  3LGC A;  2B3S A;  3OR5 A;  5HFK A;  3TRQ A;  3LXZ A;  2DIY A;  4GQF A;  2PUK C;  3QDN A;  1QK8 A;  1R5P A;  3HA9 A;  1DBY A;  4DEJ A;  4X43 A;  3F3R A;  2VL9 A;  1M9B A;  3PH9 A;  5IPH A;  1GRX A;  2IMD A;  1ZGN A;  2C0G A;  4K1F A;  1A8Y A;  5HQP A;  2WZ9 A;  3TKQ A;  3FR9 A;  3MNG A;  3FRC A;  4XS6 A;  5J5N A;  1OYJ A;  3M9K A;  4OMV A;  2H0G A;  1HNB A;  5C04 A;  5KEJ A;  2I4A A;  3LOR A;  2DJ0 A;  4EO3 A;  5CRE A;  4MK3 A;  4PUR A;  3IHQ A;  2MBS A;  4OFM A;  3ZRE A;  2O89 A;  4TW5 A;  4WET A;  1AAZ A;  2DC5 A;  5D9X A;  5IOX A;  5IM9 A;  1SL2 B;  5J3R A;  3CSI A;  1X5C A;  2X8C A;  3CTF A;  5F06 A;  2L5L A;  4TKY A;  5HFG A;  2NDO A;  4CW9 A;  4GF0 A;  2R37 A;  3GUS A;  1PD2 1;  4KH7 A;  2VOC A;  3CXG A;  1T3B A;  4AJ8 A;  2JZS A;  2B7J A;  2YPM A;  5ECO B;  1F3B A;  1M99 A;  1OC9 B;  2GZP A;  1SKR B;  2MMN A;  1GNE A;  5GSS A;  1Y6E A;  4QL7 A;  1PKW A;  4LL4 B;  4KW6 A;  1PL1 A;  2KOK A;  2VL2 A;  3VWX A;  4TN8 A;  5KN3 A;  4K7N A;  3QOU A;  3EIN A;  2LJK A;  2ZUP A;  4GWR A;  3L0H A;  3QAV A;  5JWO B;  3ZZX A;  3D21 A;  4MJC A;  1OVN A;  2M46 A;  1XWA A;  3KCM A;  2C3T A;  3W6G A;  1EOG A;  2LRN A;  5CRH A;  1B4P A;  4BWS A;  3MSZ A;  2R2J A;  3EU3 A;  3APS A;  5IO2 A;  4JR4 A;  2TIR A;  2CVB A;  3GRX A;  2GQM A;  2CAQ A;  1TRS A;  3NZN A;  5ID2 A;  2C0E A;  2KUC A;  2PN8 A;  5FT3 A;  2YWO A;  2RII A;  1NHY A;  3GL5 A;  3IAS 2;  5HFI A;  3SWL A;  2J9H A;  4MP4 A;  2FD3 A;  5G31 A;  6GSW A;  2DJ1 A;  2H8L A;  1ZZY A;  3KH9 A;  2IMF A;  3IA1 A;  2HLS A;  4WF5 A;  1VF3 A;  1TU7 A;  4GSS A;  3H4K A;  2DML A;  3LJR A;  4HJM A;  4MA9 A;  2YN1 A;  1B48 A;  2V32 A;  4GTU A;  2H1B A;  2H71 A;  3UAR A;  3QFB C;  3NOF A;  1TTZ A;  4N30 A;  4OO4 A;  5DAK A;  3CRT A;  2HZE A;  1UVZ A;  1USB A;  3APO A;  3FZA A;  3LXT A;  1PSQ A;  2CVD A;  4GCI A;  4QQ7 A;  1O81 A;  4EVM A;  2YWM A;  3WYW A;  5ECN B;  5JCU A;  1TK5 B;  3HJM A;  2ON5 A;  1J9B A;  1F6M C;  3FR6 A;  2JAC A;  3HYP A;  2VLT A;  1FVJ A;  3DVX A;  1FHE A;  4KND A;  2G0F A;  4XS4 A;  5G1L A;  1S3C A;  4F0B A;  3HJP A;  2XBI A;  2K8S A;  1XWK A;  3V1W A;  4MZB A;  4POL A;  2FNO A;  3D4M A;  2VLV A;  5CRD A;  4PX1 A;  4O32 A;  3VWU A;  3RAZ A;  1IYI A;  2FWF A;  3IDV A;  4MMM A;  3MAK A;  4ZL8 A;  4EXJ A;  1T00 A;  1UA5 A;  4XS1 A;  5D9W A;  3IPZ A;  2C8U A;  2HNL A;  2N5B A;  3BCK A;  2VM1 A;  2V2G A;  1ZYE A;  1LBK A;  3C1R A;  16GS A;  3GUR A;  4J2F A;  3ZL5 A;  1JLV A;  2H1G A;  3IAM 2;  3EYT A;  3DRN A;  3H1N A;  1K0B A;  14GS A;  3I69 A;  2F51 A;  1XZO A;  2YAN A;  1PN9 A;  2XPE A;  1T4Y A;  4V1A p;  3QAG A;  4OD7 A;  3UVT A;  3Q19 A;  5L71 A;  4ZBA A;  2WCI A;  1HQO A;  1A2M A;  2RUF A;  5EPF A;  3PIN A;  3ME8 A;  4ECI A;  2I3Y A;  3VK9 A;  5ECQ B;  2C3N A;  2I9H A;  2K9F A;  5LD0 A;  2NVL A;  4Q5F A;  2LNT A;  4EF0 A;  3IXR A;  2PVQ A;  2GLR A;  2VCW A;  1XW9 A;  2L6D A;  1GTU A;  1HNC A;  4MZW A;  4TR3 A;  3TJG A;  4X1U A;  2N5A A;  3CSJ A;  1ERW A;  3L9U A;  4WBJ A;  4ZB8 A;  2NTO A;  4ZIJ A;  1SJI A;  4WXT A;  2N5F A;  1QFN A;  3QPM A;  1M0U A;  3I43 A;  1TXX A;  1V9W A;  1X5E A;  22GS A;  2DJJ A;  1JFU A;  2GQL A;  3A5W A;  3ZFL A;  1KEB A;  1OE8 A;  2IME A;  3EC3 A;  1OC3 A;  3P90 A;  3ZIV A;  1ZYQ B;  1UC7 A;  4QL9 A;  5HR2 A;  1T4Z A;  3GSS A;  4IS0 A;  2GT5 A;  5LNK e;  4G10 A;  5DAK B;  3EU4 A;  1OKT A;  3KH7 A;  2HZE B;  3ISO A;  3KXO A;  2CAI A;  2YZU A;  4HZ2 A;  5F07 A;  4O5R A;  2IJY A;  4RI7 A;  4HJ2 A;  1EGR A;  3KP9 A;  2VD1 A;  5H5R A;  1G7O A;  4IW9 A;  2V41 A;  2JZT A;  3HY2 A;  2AJQ B;  3F4R A;  4J57 E;  1FOV A;  4TOP A;  4AF2 A;  1TP9 A;  1X9M B;  1VF1 A;  2H66 A;  6GSV A;  3TKS A;  2G2Q A;  4G9H A;  4NHW A;  3U5R E;  8GSS A;  2IMK A;  2L5O A;  2YJ7 A;  3Q18 A;  2FGX A;  2LRC A;  4MDC A;  4XS4 B;  3LSZ A;  2LQQ A;  4OFN A;  3A2W A;  4ACS A;  1XW5 A;  4J56 E;  4IBP A; 
#chains in the Genus database with same CATH topology
 2KP2 A;  3O76 A;  5DAL B;  4NWY A;  5JWR B;  1EWX A;  4XRD A;  2YWN A;  4V1A g;  4DSS B;  3MIX A;  2F8A A;  2DKI A;  3G9B A;  1ABA A;  4OCE A;  5H5S A;  2OAC A;  4V2M A;  4GST A;  1GUM A;  4F03 A;  5GAN D;  4OWY A;  1A24 A;  1R7H A;  2L57 A;  3HZ4 A;  5DVB A;  3WGX A;  2B6M A;  4PGT A;  1DE2 A;  2HSH A;  3BCI A;  2FUG 2;  3EWL A;  2GST A;  1SJ6 A;  4FYC A;  2YWI A;  5LCZ A;  2O85 A;  2XPD A;  4BVY A;  5ECM B;  4CDO A;  2H70 A;  2QSI A;  2JSZ A;  3IRA A;  5FHI A;  2MMZ A;  2OKA A;  4USS A;  1XWB A;  3H93 A;  4IP1 A;  4HQS A;  3UOM A;  4FH8 A;  1A2J A;  1PA3 A;  1I5G A;  2VIM A;  5DCH A;  3RDW A;  4ZL7 A;  3VPT A;  3GFK A;  2PMT A;  3Q74 A;  2OJL A;  2ON7 A;  2HZF A;  4G0K A;  1H75 A;  4K0G A;  3HHV A;  1ZYN A;  5IMC A;  1BQ7 A;  1EOH A;  2DLX A;  3HKR A;  1HNA A;  2XC2 A;  4IGJ A;  1V40 A;  2CZ3 A;  2AYT A;  2O87 A;  3LW9 A;  4Z2U A;  4KAE A;  1Z6N A;  3TCO A;  1GLP A;  5KN1 A;  5CNW A;  3UBL A;  4EL1 A;  1G6Y A;  4EIP A;  3F4T A;  2LST A;  4O5Q A;  1SKW B;  1HD2 A;  4Q5Q A;  1A2L A;  1OC8 A;  3ZFB A;  4TR1 A;  3US3 A;  5JCW A;  3ZIJ A;  4RQX A;  2EIO A;  3GKK A;  4K5S A;  5CAX A;  4I2U A;  1K0A A;  1M9A A;  1O8X A;  3WD6 A;  1YKA A;  3EMP A;  1F37 A;  1K3O A;  4ID0 A;  3BJ5 A;  1B9Y C;  1BG5 A;  4X0X A;  2B1K A;  3RBT A;  2H0I A;  3O6T A;  5D96 A;  2CQ9 A;  4LL1 B;  2H6Y A;  4I5Q A;  1GTI A;  3APQ A;  4BL7 A;  2CZ2 A;  5DCG A;  3F63 A;  3CYN A;  3D22 A;  5IMV A;  1XVQ A;  1OAZ A;  3EPT A;  3MWH A;  1YJ6 A;  3FK8 A;  1VRS D;  1EGO A;  1O8W A;  4EKZ A;  1Z9H A;  4TRX A;  1XXU A;  2HT9 A;  1SD9 A;  2GDR A;  2H73 A;  5INY A;  3LYK A;  1PL2 A;  3KGK A;  1B4Q A;  4FIW A;  3ERW A;  1XOA A;  3GNJ A;  1XG8 A;  3G7Y A;  1A0F A;  2WB9 A;  1THX A;  1OE7 A;  4IN0 A;  1EEJ A;  4KCE A;  2DIZ A;  4MJA A;  4G2E A;  3GKN A;  2TRX A;  2HRA A;  5JWQ B;  3TKS C;  1B8X A;  4G0L A;  1V2A A;  4JZQ A;  2VCX A;  3F0I A;  4XCS A;  3TGZ A;  4MLY A;  5A4U A;  2IIY A;  3TKR A;  3ZVJ A;  1GSU A;  2WS2 A;  4CY6 A;  1X9S B;  1WP0 A;  5IPG A;  2X49 A;  4V2L A;  2H74 A;  2VAF A;  4AGS A;  2VM2 A;  2AUV A;  2P31 A;  4AJ7 A;  2FHE A;  3P2A A;  2AAW A;  3HJO A;  2DJ2 A;  3EVI A;  5IQY A;  1K3L A;  2VCT A;  4HUA A;  1DSB A;  6GSX A;  4PUA A;  3E3E A;  3ZLP A;  1AQV A;  5IMF A;  4HS1 A;  1M3J A;  3CRU A;  2WDU A;  1K3Y A;  3AY8 A;  2OBK A;  2M80 A;  1TDI A;  3O3T A;  4IHU A;  1KBN A;  3GH6 A;  1EEM A;  1AW9 A;  1K0O A;  3EMX A;  4GQC A;  2A2R A;  5B6M A;  3QMX A;  3LEF A;  3F6D A;  2F8F A;  1TK8 B;  2MYG A;  2C0D A;  2I1U A;  3KP8 A;  2M72 A;  3QCP A;  2UZ8 A;  2DSA A;  4ZB6 A;  4PNF A;  5JCG A;  2O8V B;  2XHF A;  5HR1 A;  2LV3 A;  4YKF A;  1R4W A;  2CT6 A;  3WGD A;  1QQ2 A;  2EC4 A;  5A4W A;  3JCM L;  4IEL A;  1ILO A;  4YKG A;  1W4V A;  2X64 A;  5IOW A;  4MCU A;  1PX6 A;  4TR1 B;  4NMU A;  4DSQ A;  3VLN A;  5ENU A;  1J0F A;  4EDZ A;  3DIE A;  4K7O A;  1X0R A;  5G5F A;  2P0G A;  4GLT A;  13GS A;  3LQ7 A;  4YQM A;  1SKS B;  1K0M A;  2AV4 A;  2VCQ A;  4MF6 A;  7GSS A;  3J7Y k;  4BL7 B;  4FYU A;  1G6W A;  2GSS A;  2IFQ A;  3IHG A;  3IR4 A;  2GGT A;  3E9J B;  3M8N A;  3QD9 A;  1U3I A;  1THO A;  1I9D A;  2YOI A;  3W8S A;  3VWW A;  2RM6 A;  4Q5N A;  1SEN A;  4XTS A;  1XCC A;  5GZZ B;  3G7J A;  4E8E A;  2JL4 A;  18GS A;  5DAL A;  1SK2 A;  5HR0 A;  2L4Q A;  2LTK A;  5CRW A;  2Z9S A;  4ZBB A;  2K8V A;  5ECH B;  4DSS A;  4V2N A;  1BED A;  2XBQ A;  1Q98 A;  3M0F A;  4HDE A;  1FW1 A;  1MD4 A;  2PER A;  5AN1 A;  3ZIT A;  5CP1 A;  4BPY A;  1WJK A;  2YZH A;  1MTC A;  1NHO A;  2FLS A;  1URM A;  2LJA A;  1Z5Y E;  1F2E A;  1RQM A;  4ECC A;  2HRN A;  4HEA 2;  1Q4J A;  1CQG A;  2MBT A;  4KCA A;  2KHP A;  2FWG A;  2WJU A;  4D73 A;  1ZYP A;  3DXB A;  1OKD A;  2F9S A;  1ON4 A;  2R4V A;  4LMW A;  4TXO B;  1NM3 A;  2DMM A;  4YQV A;  1ZOF A;  1F9M A;  5DQY A;  2P5R A;  1LU4 A;  5J9C A;  3HCZ A;  3FZ4 A;  3C1S A;  2A2S A;  3ZRD A;  3GA4 A;  4LMV A;  1U87 A;  3DYR A;  4WEY A;  5ABR A;  4PQ1 A;  4L5L A;  3ERG A;  1QMV A;  3UL3 A;  2V1M A;  3BOA A;  5AIS A;  1ERT A;  1B9X C;  3K8N A;  3HVS A;  2B5X A;  2R5G A;  1GH2 A;  2LRT A;  4KSM A;  4RUV A;  4TR0 A;  2VCV A;  1YEX A;  5ELG A;  2TRC P;  4BA7 A;  3W8J A;  4KDU A;  3BBY A;  1AQW A;  2JU5 A;  1BJX A;  4MF5 A;  1PX7 A;  2H19 A;  2PGT A;  3KMN A;  1U6T A;  3QAW A;  2FA4 A;  3TOU A;  5J4U A;  1VGL A;  4Z7X A;  3BD2 A;  4O7H A;  3TUE A;  2KP1 A;  3IBH A;  4N11 A;  1GTB A;  2LUS A;  1RW1 A;  4TXV A;  4FO5 A;  2VUP A;  3LYP A;  2CX4 A;  1GSQ A;  2H76 A;  1SYR A;  1GSY A;  1FOH A;  3RHB A;  1DE1 A;  1KNG A;  2B7K A;  1AUC A;  2RUE A;  3ERF A;  4ZBD A;  1XFL A;  4WBR D;  5IMD A;  2HE3 A;  2X8H A;  5CRG A;  4K6X A;  3UEM A;  3HZ8 A;  3DWV A;  1G7E A;  4L0W A;  2HSY A;  4LLR A;  3MDK A;  1TRU A;  5F8B A;  2EIR A;  1N8J A;  3VFI A;  2PPT A;  2DBC A;  4NHZ A;  5DJM A;  4HI7 A;  4GRF A;  4WF4 A;  5EL8 A;  1PRX A;  4F9Z A;  3RPN A;  4YAV A;  1TI3 A;  1WIK A;  1YZX A;  1GSE A;  1ERV A;  5D8I A;  2H6Z A;  4ISD A;  1GSS A;  1R5A A;  5D9V A;  3L4N A;  2GZY A;  2JSY A;  5COH A;  3FMW A;  1TKD B;  3F6F A;  2IFQ B;  1TI1 A;  4TR4 A;  3GYK A;  1XVW A;  2F3M A;  2OAD A;  1CQH A;  20GS A;  3IK9 A;  5ECR B;  1SL0 B;  2V6O A;  3M9J A;  5IMA A;  4JED A;  3GN3 A;  2BTO T;  2ES7 A;  5B8B A;  1MD3 A;  4K2D A;  4I6X A;  3UVH A;  1O73 A;  1GSD A;  3G7I A;  3GIX A;  4CHS A;  1G0T A;  2WUL A;  2B1L A;  2FA8 A;  3GHA A;  3P8W A;  4KUN A;  1AC1 A;  3DVW A;  3R2Q A;  3GST A;  4H86 A;  2HI7 A;  1SD8 A;  1VF4 A;  5KN0 A;  5IO0 A;  1YEP A;  3PR8 A;  4I2T A;  3UIW A;  3IV4 A;  5G5E A;  4D73 B;  2CA8 A;  1O7U A;  3M3M A;  4I97 A;  2HRF A;  5KN2 A;  1EP8 A;  3CMI A;  3KIJ A;  3KEB A;  4FYB A;  2YV9 A;  2K6V A;  2PWJ A;  1WWJ A;  1M2B A;  3GTU B;  3J7Y b;  2YNX A;  1YY7 A;  1V98 A;  1V58 A;  3IOS A;  2E2M A;  2BJX A;  2YJH A;  1YF0 A;  3WT2 A;  4N0V A;  4F0C A;  2RM5 A;  1A23 A;  1T7P B;  4OO5 A;  5BRT A;  2IWT A;  2GS3 A;  3DKS A;  1A0R P;  2VLU A;  1BX9 A;  4PQI A;  5DJL A;  4TVE A;  1WRY A;  2AB6 A;  4L0U A;  2H01 A;  5CYY A;  1PFO A;  4ZIL A;  4ILF A;  4L5O A;  1Z7R A;  2E0Q A;  4RQR A;  2FCH A;  1XBS A;  17GS A;  2IMI A;  2JZR A;  1U3A A;  3A3T A;  3A2V A;  1WOU A;  4MJB A;  2ZCT A;  2MMO A;  2O7K A;  1BAY A;  4POK A;  1SYX A;  2YP6 A;  5H5Q A;  1JZR A;  5DQS A;  3PPU A;  1H4O A;  2IPA A;  2MMA A;  1S3D A;  3DD3 A;  4ECB A;  1HYU A;  4BVX A;  1WMJ A;  3H8Q A;  1QXH A;  1EZK A;  4MF7 A;  1WPI A;  1TU8 A;  4IP6 A;  10GS A;  3HVX A;  1AIU A;  4F2I A;  9GSS A;  1M3I A;  3TRX A;  4ZXG A;  2LEG A;  5AIV A;  1MDK A;  3C8E A;  3EUR A;  3FR3 A;  4NPB A;  5E4W A;  2WGR A;  2DJK A;  3D5J A;  1V57 A;  2BMX A;  4DVC A;  4WR5 A;  3KTL A;  1T1V A;  1C72 A;  1FB6 A;  1ACV A;  1ML6 A;  4IJI A;  4KX4 A;  4G19 A;  4YH2 A;  2PU9 C;  3FYG A;  3C73 A;  4L8E A;  4KE3 A;  3C7M A;  1TJD A;  3FZ5 A;  1MEK A;  2H72 A;  1SJZ A;  4AJ6 A;  1GP1 A;  1PMT A;  4MAB A;  4TXO A;  5F05 A;  2D2Z A;  4HU9 A;  4ICY A;  2B5Y A;  3LG6 A;  2VCZ A;  1GSF A;  1FG4 A;  6GSY A;  1Z6M A;  1XWG A;  4YQU A;  1X9W B;  4PQH A;  4KDX A;  5ECK B;  3M1G A;  3QFA C;  3GKX A;  5AIX A;  4MH2 A;  1XW6 A;  3TKS E;  6GST A;  2H1A A;  2A4V A;  3TKP A;  5ECL B;  3IC8 A;  1AQX A;  4Z2T A;  1GUH A;  1FB0 A;  3UJ1 A;  3ZMK A;  1R26 A;  1SU9 A;  3RHC A;  6GSS A;  2YCD A;  4O5U A;  1VF2 A;  3HDC A;  1GWC A;  1K0C A;  2L6C A;  1QGV A;  2KLX A;  2L4C A;  3L9S A;  3H79 A;  1K0N A;  5AGY A;  3HVV A;  3GX8 A;  4MPG A;  2NBS A;  2AHE A;  3N9J A;  4XRA A;  4HU7 A;  3TOT A;  3U6V A;  3FZ9 A;  4HSC X;  4CY8 A;  1RK4 A;  2QC7 A;  2I81 A;  2GT6 A;  1E6B A;  4KDY A;  3RPP A;  3FEU A;  3TJK A;  4X4J A;  4KSO A;  3KD0 A;  5FWG A;  1JZW A;  1S3A A;  3CQF A;  1XPV A;  1A8L A;  3ME7 A;  1M2A A;  2IN3 A;  1GUK A;  1WE0 A;  1TW9 A;  1TOF A;  2LJR A;  5DDL A;  4YAP A;  4EE0 A;  5ECI B;  3TDG A;  2GVP A;  1UN2 A;  4N0Z A;  2GSQ A;  2OE1 A;  3IE3 A;  3Q6O A;  1NW2 A;  3UBK A;  4ZL9 A;  3FHK A;  3ZYW A;  4BVX B;  4MJE A;  2H30 A;  1E2Y A;  5GAP D;  4JE1 A;  5B8A A;  3GV1 A;  3VI7 A;  1W89 A;  6GSU A;  2V6K A;  4POB A;  4ML6 A;  1KTE A;  5ECS A;  11GS A;  2LKU A;  5CO3 A;  3VUR A;  4HZ4 A;  3UAP A;  5J41 A;  3I6A A;  3TJB A;  5B6N A;  1JHB A;  2PVO C;  2YV7 A;  5GST A;  3KTB A;  2B5E A;  4K7I A;  3VWV A;  4OFT A;  4K8M A;  2X8G A;  1YDK A;  2CX3 A;  12GS A;  2CV4 A;  4I8B A;  2X99 A;  3DML A;  3ZML A;  3CSH A;  1ST9 A;  1IYH A;  5IIZ A;  3IC4 A;  3QR6 A;  1ZMA A;  3VI5 A;  3PGT A;  2FWE A;  3DGQ A;  3TJJ A;  1ZCP A;  1ERU A;  2HYX A;  3KJY A;  4K5R A;  1MDI A;  1SL1 B;  1Z7P A;  2FY6 A;  4N10 A;  1Z3E A;  2R0P A;  4EUY A;  3GTU A;  5E59 A;  5A4V A;  1XIY A;  3F4S A;  5D9T A;  4P3Y B;  4GSN A;  4IKH A;  1JLW A;  3ED3 A;  5KOW A;  2VL2 C;  2R3X A;  1GNW A;  1GLQ A;  4KGI A;  2ALB A;  2LQO A;  2WFC A;  4FQU A;  4ECJ A;  3HD5 A;  1DUG A;  4EIQ A;  2C1Y A;  4ZB9 A;  4POM A;  3GX0 A;  2ZNM A;  4PUF C;  1FO5 A;  2VD0 A;  1PGT A;  2OE3 A;  4NV5 A;  5ID2 B;  4IVF A;  4E8H A;  1MDJ A;  3S9F A;  3P7X A;  1SK0 A;  4JU5 A;  4F82 A;  3F3Q A;  1GUL A;  3KZQ A;  3WGE A;  1Y25 A;  1O85 A;  4RI6 A;  3CBU A;  1YQ1 A;  1X5D A;  4NV2 A;  2VO4 A;  2DJ3 A;  3GMF A;  4JR6 A;  2GQK A;  5DBQ A;  4EDY A;  2J23 A;  2GTU A;  2H75 A;  5A5K A;  19GS A;  4MZC A;  2OA7 A;  5F0G A;  3GH9 A;  1O6J A;  1GL8 A;  3C71 A;  2NPB A;  4HOJ A;  3FW2 A;  2RLI A;  4LA1 A;  3ZTL A;  2QA1 A;  2GSR A;  4K0N A;  4OCF A;  2FWH A;  4PXO A;  1XOB A;  1ZL9 A;  1BYE A;  2H6X A;  3CTG A;  3NIV A;  5G2Z A;  4PNG A;  3WT1 A;  1M7T A;  4MPF A;  4XHM A;  3KMO A;  2PBJ A;  1QUW A;  4HQZ A;  1EV4 A;  2C4J A;  1PKZ A;  4ULX A;  1YF1 A;  3N5O A;  2QKE A;  5EY6 A;  5IMZ A;  1LJR A;  5J9B A;  3D6I A;  4WKW A;  4O92 A;  4IQA A;  4WR4 A;  2HFD A;  1EV9 A;  2K18 A;  3SBC A;  2QGV A;  3F9U A;  5B7C A;  3L78 A;  4BWQ A;  3GKM A;  2OBI A;  3E0U A;  5ELA A;  1JZD A;  1TK0 B;  5G30 A;  2OE0 A;  2LS5 A;  4IJ3 A;  1GTA A;  1OC9 A;  1YKC A;  3L9V A;  4K9Z A;  2MZC A;  2LNS A;  3IK7 A;  4GXZ A;  4XIH A;  2C0F A;  5BMU A;  4ML1 A;  2P5Q A;  3EE2 A;  1FAA A;  2DKH A;  3LFL A;  4Q5R A;  5D73 A;  1J08 A;  2R0G A;  1JZO A;  3GL3 A;  1AXD A;  2VL3 A;  3FY7 A;  2HXK A;  2X4A A;  1T8E B;  2REM A;  4IQ1 A;  1F3A A;  3KM6 A;  4EC0 A;  1M2D A;  1U88 A;  3HXS A;  4JBB A;  4KB3 A;  4MH3 A;  2R6K A;  5C00 A;  3A2X A;  4NXI A;  5ECP B;  2WRT A;  3TB2 A;  3D0Z A;  3TJF A;  4Z2R A;  5G1K A;  1K0D A;  4DSR A;  5D93 A;  2IL3 A;  1SK1 A;  2E7P A;  1XWC A;  4JRR A;  3ZVJ D;  3DEX A;  3UMA A;  3TRP A;  3FKF A;  3I9V 2;  2CVK A;  2JAD A;  2C80 A;  4KA0 A;  2E2G A;  3LWA A;  1TRW A;  1TRV A;  5EVO A;  1EP7 A;  3VPQ A;  1PQN A;  1NSW A;  1FVK A;  1N2A A;  2H1D A;  2GZZ A;  5HR3 A;  2C3Q A;  2L59 A;  3D4T A;  4NAX A;  2EIQ A;  3F8U A;  2H0H A;  3LGC A;  2B3S A;  3OR5 A;  5HFK A;  4G0I A;  3TRQ A;  3LXZ A;  2DIY A;  4GQF A;  2PUK C;  3QDN A;  1QK8 A;  1R5P A;  3HA9 A;  1DBY A;  4DEJ A;  4X43 A;  3F3R A;  2VL9 A;  1M9B A;  3PH9 A;  2HSM A;  5IPH A;  1GRX A;  2IMD A;  1ZGN A;  2C0G A;  4K1F A;  1A8Y A;  5HQP A;  2WZ9 A;  3TKQ A;  3FR9 A;  3MNG A;  3FRC A;  4XS6 A;  5J5N A;  1OYJ A;  3M9K A;  4OMV A;  2H0G A;  1HNB A;  5C04 A;  5KEJ A;  2I4A A;  3LOR A;  2DJ0 A;  4EO3 A;  5CRE A;  4MK3 A;  4PUR A;  3IHQ A;  2MBS A;  4OFM A;  3ZRE A;  2O89 A;  4TW5 A;  4WET A;  1AAZ A;  2DC5 A;  5D9X A;  5IOX A;  4A5P A;  5IM9 A;  1SL2 B;  5J3R A;  3CSI A;  1X5C A;  2X8C A;  3CTF A;  5F06 A;  2L5L A;  4TKY A;  5HFG A;  2NDO A;  4CW9 A;  4GF0 A;  2R37 A;  3GUS A;  1PD2 1;  4KH7 A;  2VOC A;  3CXG A;  1T3B A;  4AJ8 A;  2JZS A;  2B7J A;  2YPM A;  1S3R A;  5ECO B;  1F3B A;  1M99 A;  1OC9 B;  2GZP A;  1SKR B;  4KF9 A;  2MMN A;  1GNE A;  5GSS A;  1Y6E A;  4QL7 A;  1PKW A;  4LL4 B;  4KW6 A;  1PL1 A;  2KOK A;  2VL2 A;  3VWX A;  4TN8 A;  5KN3 A;  4K7N A;  3QOU A;  3EIN A;  2LJK A;  2ZUP A;  4GWR A;  3L0H A;  3QAV A;  5JWO B;  3ZZX A;  3D21 A;  4MJC A;  1OVN A;  2M46 A;  1XWA A;  3HVN A;  3KCM A;  2C3T A;  3W6G A;  1EOG A;  2LRN A;  5CRH A;  1B4P A;  3R3E A;  4BWS A;  3MSZ A;  2R2J A;  3EU3 A;  3APS A;  5IO2 A;  4JR4 A;  2TIR A;  2CVB A;  3GRX A;  2GQM A;  2CAQ A;  4BVY B;  1TRS A;  3NZN A;  5ID2 A;  2C0E A;  2KUC A;  2PN8 A;  5FT3 A;  2YWO A;  4PTS A;  2RII A;  1NHY A;  3GL5 A;  3IAS 2;  5HFI A;  3SWL A;  1PN0 A;  2J9H A;  4MP4 A;  2FD3 A;  5G31 A;  6GSW A;  2DJ1 A;  2H8L A;  1ZZY A;  3KH9 A;  2IMF A;  3IA1 A;  2HLS A;  4WF5 A;  1VF3 A;  1TU7 A;  4GSS A;  3H4K A;  2DML A;  3LJR A;  4HJM A;  4MA9 A;  2YN1 A;  1B48 A;  2V32 A;  4GTU A;  2H1B A;  2H71 A;  3UAR A;  3QFB C;  3NOF A;  1TTZ A;  4N30 A;  5KOX A;  4OO4 A;  5DAK A;  3CRT A;  4MNN A;  2HZE A;  1UVZ A;  1USB A;  3APO A;  3FZA A;  3LXT A;  1PSQ A;  2CVD A;  4GCI A;  4QQ7 A;  1O81 A;  4EVM A;  2YWM A;  3WYW A;  5ECN B;  5JCU A;  1TK5 B;  3HJM A;  2ON5 A;  1J9B A;  1F6M C;  3FR6 A;  2JAC A;  3HYP A;  2VLT A;  1FVJ A;  3DVX A;  1FHE A;  4KND A;  2G0F A;  4XS4 A;  5G1L A;  1S3C A;  4F0B A;  3HJP A;  2XBI A;  2K8S A;  1XWK A;  3V1W A;  4MZB A;  4POL A;  2FNO A;  3D4M A;  2VLV A;  4BIK A;  5CRD A;  4PX1 A;  4O32 A;  3VWU A;  3RAZ A;  1IYI A;  2FWF A;  3IDV A;  4MMM A;  3MAK A;  4ZL8 A;  4EXJ A;  1T00 A;  1UA5 A;  4XS1 A;  5D9W A;  3IPZ A;  2C8U A;  2HNL A;  2N5B A;  3BCK A;  2VM1 A;  2V2G A;  1ZYE A;  1LBK A;  3C1R A;  4K2X A;  16GS A;  3GUR A;  4J2F A;  3ZL5 A;  1JLV A;  2H1G A;  3IAM 2;  3EYT A;  3DRN A;  3H1N A;  1K0B A;  14GS A;  3I69 A;  2F51 A;  1XZO A;  2YAN A;  1PN9 A;  2XPE A;  1T4Y A;  4V1A p;  3QAG A;  4OD7 A;  3UVT A;  3Q19 A;  2R0C A;  5L71 A;  4ZBA A;  2WCI A;  1HQO A;  1A2M A;  2RUF A;  5EPF A;  3PIN A;  3ME8 A;  4ECI A;  2I3Y A;  3VK9 A;  5ECQ B;  2C3N A;  2I9H A;  2K9F A;  5LD0 A;  2NVL A;  4Q5F A;  2A2P A;  2LNT A;  4EF0 A;  3IXR A;  2PVQ A;  2GLR A;  2VCW A;  1XW9 A;  2L6D A;  1GTU A;  1HNC A;  4MZW A;  4TR3 A;  3TJG A;  4X1U A;  2N5A A;  3A5I A;  1ERW A;  3CSJ A;  3L9U A;  4WBJ A;  4ZB8 A;  2NTO A;  4ZIJ A;  1SJI A;  4WXT A;  2N5F A;  1QFN A;  3QPM A;  1M0U A;  3MYD A;  3I43 A;  1TXX A;  1V9W A;  1X5E A;  22GS A;  2DJJ A;  1JFU A;  2GQL A;  3A5W A;  3ZFL A;  1KEB A;  1OE8 A;  2IME A;  2QA2 A;  3EC3 A;  1OC3 A;  3P90 A;  3ZIV A;  1ZYQ B;  1UC7 A;  4QL9 A;  5HR2 A;  1T4Z A;  3GSS A;  4IS0 A;  2GT5 A;  5LNK e;  4G10 A;  5DAK B;  3EU4 A;  1OKT A;  3KH7 A;  2HZE B;  3ISO A;  3KXO A;  2CAI A;  2YZU A;  4HZ2 A;  5F07 A;  4O5R A;  2IJY A;  4RI7 A;  4HJ2 A;  1EGR A;  3KP9 A;  2VD1 A;  5H5R A;  1G7O A;  4IW9 A;  2V41 A;  2JZT A;  3HY2 A;  2AJQ B;  3F4R A;  4J57 E;  1FOV A;  4TOP A;  4AF2 A;  1TP9 A;  1X9M B;  1VF1 A;  2H66 A;  6GSV A;  3TKS A;  2G2Q A;  4G9H A;  4NHW A;  3U5R E;  8GSS A;  2IMK A;  2L5O A;  2YJ7 A;  3Q18 A;  2FGX A;  2LRC A;  4MDC A;  4XS4 B;  3LSZ A;  2LQQ A;  4OFN A;  3A2W A;  4ACS A;  2HRK A;  1XW5 A;  4J56 E;  4IBP A;  2A4H A; 
#chains in the Genus database with same CATH homology
 2KP2 A;  3O76 A;  5DAL B;  4NWY A;  5JWR B;  1EWX A;  4XRD A;  2YWN A;  4V1A g;  4DSS B;  3MIX A;  2F8A A;  2DKI A;  3G9B A;  1ABA A;  4OCE A;  5H5S A;  2OAC A;  4V2M A;  4GST A;  1GUM A;  4F03 A;  5GAN D;  4OWY A;  1A24 A;  1R7H A;  2L57 A;  3HZ4 A;  5DVB A;  3WGX A;  2B6M A;  4PGT A;  1DE2 A;  2HSH A;  3BCI A;  2FUG 2;  3EWL A;  2GST A;  1SJ6 A;  4FYC A;  2YWI A;  5LCZ A;  2O85 A;  2XPD A;  4BVY A;  5ECM B;  4CDO A;  2H70 A;  2QSI A;  2JSZ A;  3IRA A;  5FHI A;  2MMZ A;  2OKA A;  4USS A;  1XWB A;  3H93 A;  4IP1 A;  4HQS A;  3UOM A;  4FH8 A;  1A2J A;  1PA3 A;  1I5G A;  2VIM A;  5DCH A;  3RDW A;  4ZL7 A;  3VPT A;  3GFK A;  2PMT A;  3Q74 A;  2OJL A;  2ON7 A;  2HZF A;  4G0K A;  1H75 A;  4K0G A;  3HHV A;  1ZYN A;  5IMC A;  1BQ7 A;  1EOH A;  2DLX A;  3HKR A;  1HNA A;  2XC2 A;  4IGJ A;  1V40 A;  2CZ3 A;  2AYT A;  2O87 A;  3LW9 A;  4Z2U A;  4KAE A;  1Z6N A;  3TCO A;  1GLP A;  5KN1 A;  5CNW A;  3UBL A;  4EL1 A;  1G6Y A;  4EIP A;  3F4T A;  2LST A;  4O5Q A;  1SKW B;  1HD2 A;  4Q5Q A;  1A2L A;  1OC8 A;  3ZFB A;  4TR1 A;  3US3 A;  5JCW A;  3ZIJ A;  4RQX A;  2EIO A;  3GKK A;  4K5S A;  5CAX A;  4I2U A;  1K0A A;  1M9A A;  1O8X A;  3WD6 A;  1YKA A;  3EMP A;  1F37 A;  1K3O A;  4ID0 A;  3BJ5 A;  1B9Y C;  1BG5 A;  4X0X A;  2B1K A;  3RBT A;  2H0I A;  3O6T A;  5D96 A;  2CQ9 A;  4LL1 B;  2H6Y A;  4I5Q A;  1GTI A;  3APQ A;  4BL7 A;  2CZ2 A;  5DCG A;  3F63 A;  3CYN A;  3D22 A;  5IMV A;  1XVQ A;  1OAZ A;  3EPT A;  3MWH A;  1YJ6 A;  3FK8 A;  1VRS D;  1EGO A;  1O8W A;  4EKZ A;  1Z9H A;  4TRX A;  1XXU A;  2HT9 A;  1SD9 A;  2GDR A;  2H73 A;  5INY A;  3LYK A;  1PL2 A;  3KGK A;  1B4Q A;  4FIW A;  3ERW A;  1XOA A;  3GNJ A;  3G7Y A;  1A0F A;  2WB9 A;  1THX A;  1OE7 A;  4IN0 A;  1EEJ A;  4KCE A;  2DIZ A;  4MJA A;  4G2E A;  3GKN A;  2TRX A;  2HRA A;  5JWQ B;  3TKS C;  1B8X A;  4G0L A;  1V2A A;  4JZQ A;  2VCX A;  3F0I A;  4XCS A;  3TGZ A;  4MLY A;  5A4U A;  2IIY A;  3TKR A;  3ZVJ A;  1GSU A;  2WS2 A;  4CY6 A;  1X9S B;  1WP0 A;  5IPG A;  2X49 A;  4V2L A;  2H74 A;  2VAF A;  4AGS A;  2VM2 A;  2AUV A;  2P31 A;  4AJ7 A;  2FHE A;  3P2A A;  2AAW A;  3HJO A;  2DJ2 A;  3EVI A;  5IQY A;  1K3L A;  2VCT A;  4HUA A;  1DSB A;  6GSX A;  4PUA A;  3E3E A;  3ZLP A;  1AQV A;  5IMF A;  4HS1 A;  3CRU A;  2WDU A;  1K3Y A;  3AY8 A;  2OBK A;  2M80 A;  1TDI A;  3O3T A;  4IHU A;  1KBN A;  3GH6 A;  1EEM A;  1AW9 A;  1K0O A;  3EMX A;  4GQC A;  2A2R A;  5B6M A;  3QMX A;  3LEF A;  3F6D A;  2F8F A;  1TK8 B;  2MYG A;  2C0D A;  2I1U A;  3KP8 A;  2M72 A;  3QCP A;  2UZ8 A;  2DSA A;  4ZB6 A;  4PNF A;  5JCG A;  2O8V B;  2XHF A;  5HR1 A;  2LV3 A;  4YKF A;  1R4W A;  2CT6 A;  3WGD A;  1QQ2 A;  2EC4 A;  5A4W A;  3JCM L;  4IEL A;  1ILO A;  4YKG A;  1W4V A;  2X64 A;  5IOW A;  4MCU A;  1PX6 A;  4TR1 B;  4NMU A;  4DSQ A;  3VLN A;  5ENU A;  1J0F A;  4EDZ A;  3DIE A;  4K7O A;  1X0R A;  5G5F A;  2P0G A;  4GLT A;  13GS A;  3LQ7 A;  4YQM A;  1SKS B;  1K0M A;  2AV4 A;  2VCQ A;  4MF6 A;  7GSS A;  3J7Y k;  4BL7 B;  4FYU A;  1G6W A;  2GSS A;  2IFQ A;  3IHG A;  3IR4 A;  2GGT A;  3E9J B;  3M8N A;  3QD9 A;  1U3I A;  1THO A;  1I9D A;  2YOI A;  3W8S A;  3VWW A;  2RM6 A;  4Q5N A;  1SEN A;  4XTS A;  1XCC A;  5GZZ B;  3G7J A;  4E8E A;  2JL4 A;  18GS A;  5DAL A;  1SK2 A;  5HR0 A;  2L4Q A;  2LTK A;  5CRW A;  2Z9S A;  4ZBB A;  2K8V A;  5ECH B;  4DSS A;  4V2N A;  1BED A;  2XBQ A;  1Q98 A;  3M0F A;  4HDE A;  1FW1 A;  1MD4 A;  2PER A;  5AN1 A;  3ZIT A;  5CP1 A;  4BPY A;  1WJK A;  2YZH A;  1MTC A;  1NHO A;  2FLS A;  1URM A;  2LJA A;  1Z5Y E;  1F2E A;  1RQM A;  4ECC A;  2HRN A;  4HEA 2;  1Q4J A;  1CQG A;  2MBT A;  4KCA A;  2KHP A;  2FWG A;  2WJU A;  4D73 A;  1ZYP A;  3DXB A;  1OKD A;  2F9S A;  1ON4 A;  2R4V A;  4LMW A;  4TXO B;  1NM3 A;  2DMM A;  4YQV A;  1ZOF A;  1F9M A;  5DQY A;  2P5R A;  1LU4 A;  5J9C A;  3HCZ A;  3FZ4 A;  3C1S A;  2A2S A;  3ZRD A;  3GA4 A;  4LMV A;  1U87 A;  3DYR A;  4WEY A;  5ABR A;  4PQ1 A;  4L5L A;  3ERG A;  1QMV A;  3UL3 A;  2V1M A;  3BOA A;  5AIS A;  1ERT A;  1B9X C;  3K8N A;  3HVS A;  2B5X A;  2R5G A;  1GH2 A;  2LRT A;  4KSM A;  4RUV A;  4TR0 A;  2VCV A;  1YEX A;  5ELG A;  2TRC P;  4BA7 A;  3W8J A;  4KDU A;  3BBY A;  1AQW A;  2JU5 A;  1BJX A;  4MF5 A;  1PX7 A;  2H19 A;  2PGT A;  3KMN A;  1U6T A;  3QAW A;  2FA4 A;  3TOU A;  5J4U A;  1VGL A;  4Z7X A;  3BD2 A;  4O7H A;  3TUE A;  2KP1 A;  3IBH A;  4N11 A;  1GTB A;  2LUS A;  1RW1 A;  4TXV A;  4FO5 A;  2VUP A;  3LYP A;  2CX4 A;  1GSQ A;  2H76 A;  1SYR A;  1GSY A;  1FOH A;  3RHB A;  1DE1 A;  1KNG A;  2B7K A;  1AUC A;  2RUE A;  3ERF A;  4ZBD A;  1XFL A;  4WBR D;  5IMD A;  2HE3 A;  2X8H A;  5CRG A;  4K6X A;  3UEM A;  3HZ8 A;  3DWV A;  1G7E A;  4L0W A;  2HSY A;  4LLR A;  3MDK A;  1TRU A;  5F8B A;  2EIR A;  1N8J A;  3VFI A;  2PPT A;  2DBC A;  4NHZ A;  5DJM A;  4HI7 A;  4GRF A;  4WF4 A;  5EL8 A;  1PRX A;  4F9Z A;  3RPN A;  4YAV A;  1TI3 A;  1WIK A;  1YZX A;  1GSE A;  1ERV A;  5D8I A;  2H6Z A;  4ISD A;  1GSS A;  1R5A A;  5D9V A;  3L4N A;  2GZY A;  2JSY A;  5COH A;  3FMW A;  1TKD B;  3F6F A;  2IFQ B;  1TI1 A;  4TR4 A;  3GYK A;  1XVW A;  2F3M A;  2OAD A;  1CQH A;  20GS A;  3IK9 A;  5ECR B;  1SL0 B;  2V6O A;  3M9J A;  5IMA A;  4JED A;  3GN3 A;  2BTO T;  2ES7 A;  5B8B A;  1MD3 A;  4K2D A;  4I6X A;  3UVH A;  1O73 A;  1GSD A;  3G7I A;  3GIX A;  4CHS A;  1G0T A;  2WUL A;  2B1L A;  2FA8 A;  3GHA A;  3P8W A;  4KUN A;  1AC1 A;  3DVW A;  3R2Q A;  3GST A;  4H86 A;  2HI7 A;  1SD8 A;  1VF4 A;  5KN0 A;  5IO0 A;  1YEP A;  3PR8 A;  4I2T A;  3UIW A;  3IV4 A;  5G5E A;  4D73 B;  2CA8 A;  1O7U A;  3M3M A;  4I97 A;  2HRF A;  5KN2 A;  1EP8 A;  3CMI A;  3KIJ A;  3KEB A;  4FYB A;  2YV9 A;  2K6V A;  2PWJ A;  1WWJ A;  1M2B A;  3GTU B;  3J7Y b;  2YNX A;  1YY7 A;  1V98 A;  1V58 A;  3IOS A;  2E2M A;  2BJX A;  2YJH A;  1YF0 A;  3WT2 A;  4N0V A;  4F0C A;  2RM5 A;  1A23 A;  1T7P B;  4OO5 A;  5BRT A;  2IWT A;  2GS3 A;  3DKS A;  1A0R P;  2VLU A;  1BX9 A;  4PQI A;  5DJL A;  4TVE A;  1WRY A;  2AB6 A;  4L0U A;  2H01 A;  5CYY A;  4ZIL A;  4ILF A;  4L5O A;  1Z7R A;  2E0Q A;  4RQR A;  2FCH A;  1XBS A;  17GS A;  2IMI A;  2JZR A;  1U3A A;  3A3T A;  3A2V A;  1WOU A;  4MJB A;  2ZCT A;  2MMO A;  2O7K A;  1BAY A;  4POK A;  1SYX A;  2YP6 A;  5H5Q A;  1JZR A;  5DQS A;  3PPU A;  1H4O A;  2IPA A;  2MMA A;  1S3D A;  3DD3 A;  4ECB A;  1HYU A;  4BVX A;  1WMJ A;  3H8Q A;  1QXH A;  1EZK A;  4MF7 A;  1WPI A;  1TU8 A;  4IP6 A;  10GS A;  3HVX A;  1AIU A;  4F2I A;  9GSS A;  3TRX A;  4ZXG A;  2LEG A;  5AIV A;  1MDK A;  3C8E A;  3EUR A;  3FR3 A;  4NPB A;  5E4W A;  2WGR A;  2DJK A;  3D5J A;  1V57 A;  2BMX A;  4DVC A;  4WR5 A;  3KTL A;  1T1V A;  1C72 A;  1FB6 A;  1ACV A;  1ML6 A;  4IJI A;  4KX4 A;  4G19 A;  4YH2 A;  2PU9 C;  3FYG A;  3C73 A;  4L8E A;  4KE3 A;  3C7M A;  1TJD A;  3FZ5 A;  1MEK A;  2H72 A;  1SJZ A;  4AJ6 A;  1GP1 A;  1PMT A;  4MAB A;  4TXO A;  5F05 A;  2D2Z A;  4HU9 A;  4ICY A;  2B5Y A;  3LG6 A;  2VCZ A;  1GSF A;  1FG4 A;  6GSY A;  1Z6M A;  1XWG A;  4YQU A;  1X9W B;  4PQH A;  4KDX A;  5ECK B;  3M1G A;  3QFA C;  3GKX A;  5AIX A;  4MH2 A;  1XW6 A;  3TKS E;  6GST A;  2H1A A;  2A4V A;  3TKP A;  5ECL B;  3IC8 A;  1AQX A;  4Z2T A;  1GUH A;  1FB0 A;  3UJ1 A;  3ZMK A;  1R26 A;  1SU9 A;  3RHC A;  6GSS A;  2YCD A;  4O5U A;  1VF2 A;  3HDC A;  1GWC A;  1K0C A;  2L6C A;  1QGV A;  2KLX A;  2L4C A;  3L9S A;  3H79 A;  1K0N A;  5AGY A;  3HVV A;  3GX8 A;  4MPG A;  2NBS A;  2AHE A;  3N9J A;  4XRA A;  4HU7 A;  3TOT A;  3U6V A;  3FZ9 A;  4CY8 A;  1RK4 A;  2QC7 A;  2I81 A;  2GT6 A;  1E6B A;  4KDY A;  3RPP A;  3FEU A;  3TJK A;  4X4J A;  4KSO A;  3KD0 A;  5FWG A;  1JZW A;  1S3A A;  1XPV A;  1A8L A;  3ME7 A;  1M2A A;  2IN3 A;  1GUK A;  1WE0 A;  1TW9 A;  1TOF A;  2LJR A;  5DDL A;  4YAP A;  4EE0 A;  5ECI B;  3TDG A;  2GVP A;  1UN2 A;  4N0Z A;  2GSQ A;  2OE1 A;  3IE3 A;  3Q6O A;  1NW2 A;  3UBK A;  4ZL9 A;  3FHK A;  3ZYW A;  4BVX B;  4MJE A;  2H30 A;  1E2Y A;  5GAP D;  4JE1 A;  5B8A A;  3GV1 A;  3VI7 A;  1W89 A;  6GSU A;  2V6K A;  4POB A;  4ML6 A;  1KTE A;  5ECS A;  11GS A;  2LKU A;  5CO3 A;  3VUR A;  4HZ4 A;  3UAP A;  5J41 A;  3I6A A;  3TJB A;  5B6N A;  1JHB A;  2PVO C;  2YV7 A;  5GST A;  3KTB A;  2B5E A;  4K7I A;  3VWV A;  4OFT A;  4K8M A;  2X8G A;  1YDK A;  2CX3 A;  12GS A;  2CV4 A;  4I8B A;  2X99 A;  3DML A;  3ZML A;  3CSH A;  1ST9 A;  1IYH A;  5IIZ A;  3IC4 A;  3QR6 A;  1ZMA A;  3VI5 A;  3PGT A;  2FWE A;  3DGQ A;  3TJJ A;  1ZCP A;  1ERU A;  2HYX A;  3KJY A;  4K5R A;  1MDI A;  1SL1 B;  1Z7P A;  2FY6 A;  4N10 A;  1Z3E A;  2R0P A;  4EUY A;  3GTU A;  5E59 A;  5A4V A;  1XIY A;  3F4S A;  5D9T A;  4P3Y B;  4GSN A;  4IKH A;  1JLW A;  3ED3 A;  5KOW A;  2VL2 C;  2R3X A;  1GNW A;  1GLQ A;  4KGI A;  2ALB A;  2LQO A;  2WFC A;  4FQU A;  4ECJ A;  3HD5 A;  1DUG A;  4EIQ A;  2C1Y A;  4ZB9 A;  4POM A;  3GX0 A;  2ZNM A;  4PUF C;  1FO5 A;  2VD0 A;  1PGT A;  2OE3 A;  4NV5 A;  5ID2 B;  4IVF A;  4E8H A;  1MDJ A;  3S9F A;  3P7X A;  1SK0 A;  4JU5 A;  4F82 A;  3F3Q A;  1GUL A;  3KZQ A;  3WGE A;  1Y25 A;  1O85 A;  4RI6 A;  3CBU A;  1YQ1 A;  1X5D A;  4NV2 A;  2VO4 A;  2DJ3 A;  3GMF A;  4JR6 A;  2GQK A;  5DBQ A;  4EDY A;  2J23 A;  2GTU A;  2H75 A;  5A5K A;  19GS A;  4MZC A;  2OA7 A;  5F0G A;  3GH9 A;  1O6J A;  1GL8 A;  3C71 A;  2NPB A;  4HOJ A;  3FW2 A;  2RLI A;  4LA1 A;  3ZTL A;  2QA1 A;  2GSR A;  4K0N A;  4OCF A;  2FWH A;  4PXO A;  1XOB A;  1ZL9 A;  1BYE A;  2H6X A;  3CTG A;  3NIV A;  5G2Z A;  4PNG A;  3WT1 A;  1M7T A;  4MPF A;  4XHM A;  3KMO A;  2PBJ A;  1QUW A;  4HQZ A;  1EV4 A;  2C4J A;  1PKZ A;  4ULX A;  1YF1 A;  3N5O A;  2QKE A;  5EY6 A;  5IMZ A;  1LJR A;  5J9B A;  3D6I A;  4WKW A;  4O92 A;  4IQA A;  4WR4 A;  2HFD A;  1EV9 A;  2K18 A;  3SBC A;  2QGV A;  3F9U A;  5B7C A;  3L78 A;  4BWQ A;  3GKM A;  2OBI A;  3E0U A;  5ELA A;  1JZD A;  1TK0 B;  5G30 A;  2OE0 A;  2LS5 A;  4IJ3 A;  1GTA A;  1OC9 A;  1YKC A;  3L9V A;  4K9Z A;  2MZC A;  2LNS A;  3IK7 A;  4GXZ A;  4XIH A;  2C0F A;  5BMU A;  4ML1 A;  2P5Q A;  3EE2 A;  1FAA A;  2DKH A;  3LFL A;  4Q5R A;  5D73 A;  1J08 A;  2R0G A;  1JZO A;  3GL3 A;  1AXD A;  2VL3 A;  3FY7 A;  2HXK A;  2X4A A;  1T8E B;  2REM A;  4IQ1 A;  1F3A A;  3KM6 A;  4EC0 A;  1M2D A;  1U88 A;  3HXS A;  4JBB A;  4KB3 A;  4MH3 A;  2R6K A;  5C00 A;  3A2X A;  4NXI A;  5ECP B;  2WRT A;  3TB2 A;  3D0Z A;  3TJF A;  4Z2R A;  5G1K A;  1K0D A;  4DSR A;  5D93 A;  2IL3 A;  1SK1 A;  2E7P A;  1XWC A;  4JRR A;  3ZVJ D;  3DEX A;  3UMA A;  3TRP A;  3FKF A;  3I9V 2;  2CVK A;  2JAD A;  2C80 A;  4KA0 A;  2E2G A;  3LWA A;  1TRW A;  1TRV A;  5EVO A;  1EP7 A;  3VPQ A;  1PQN A;  1NSW A;  1FVK A;  1N2A A;  2H1D A;  2GZZ A;  5HR3 A;  2C3Q A;  2L59 A;  3D4T A;  4NAX A;  2EIQ A;  3F8U A;  2H0H A;  3LGC A;  2B3S A;  3OR5 A;  5HFK A;  4G0I A;  3TRQ A;  3LXZ A;  2DIY A;  4GQF A;  2PUK C;  3QDN A;  1QK8 A;  1R5P A;  3HA9 A;  1DBY A;  4DEJ A;  4X43 A;  3F3R A;  2VL9 A;  1M9B A;  3PH9 A;  2HSM A;  5IPH A;  1GRX A;  2IMD A;  1ZGN A;  2C0G A;  4K1F A;  1A8Y A;  5HQP A;  2WZ9 A;  3TKQ A;  3FR9 A;  3MNG A;  3FRC A;  4XS6 A;  5J5N A;  1OYJ A;  3M9K A;  4OMV A;  2H0G A;  1HNB A;  5C04 A;  5KEJ A;  2I4A A;  3LOR A;  2DJ0 A;  4EO3 A;  5CRE A;  4MK3 A;  4PUR A;  3IHQ A;  2MBS A;  4OFM A;  3ZRE A;  2O89 A;  4TW5 A;  4WET A;  1AAZ A;  2DC5 A;  5D9X A;  5IOX A;  4A5P A;  5IM9 A;  1SL2 B;  5J3R A;  3CSI A;  1X5C A;  2X8C A;  3CTF A;  5F06 A;  2L5L A;  4TKY A;  5HFG A;  2NDO A;  4CW9 A;  4GF0 A;  2R37 A;  3GUS A;  1PD2 1;  4KH7 A;  2VOC A;  3CXG A;  1T3B A;  4AJ8 A;  2JZS A;  2B7J A;  2YPM A;  5ECO B;  1F3B A;  1M99 A;  1OC9 B;  2GZP A;  1SKR B;  4KF9 A;  2MMN A;  1GNE A;  5GSS A;  1Y6E A;  4QL7 A;  1PKW A;  4LL4 B;  4KW6 A;  1PL1 A;  2KOK A;  2VL2 A;  3VWX A;  4TN8 A;  5KN3 A;  4K7N A;  3QOU A;  3EIN A;  2LJK A;  2ZUP A;  4GWR A;  3L0H A;  3QAV A;  5JWO B;  3ZZX A;  3D21 A;  4MJC A;  1OVN A;  2M46 A;  1XWA A;  3KCM A;  2C3T A;  3W6G A;  1EOG A;  2LRN A;  5CRH A;  1B4P A;  3R3E A;  4BWS A;  3MSZ A;  2R2J A;  3EU3 A;  3APS A;  5IO2 A;  4JR4 A;  2TIR A;  2CVB A;  3GRX A;  2GQM A;  2CAQ A;  4BVY B;  1TRS A;  3NZN A;  5ID2 A;  2C0E A;  2KUC A;  2PN8 A;  5FT3 A;  2YWO A;  4PTS A;  2RII A;  1NHY A;  3GL5 A;  3IAS 2;  5HFI A;  3SWL A;  1PN0 A;  2J9H A;  4MP4 A;  2FD3 A;  5G31 A;  6GSW A;  2DJ1 A;  2H8L A;  1ZZY A;  3KH9 A;  2IMF A;  3IA1 A;  2HLS A;  4WF5 A;  1VF3 A;  1TU7 A;  4GSS A;  3H4K A;  2DML A;  3LJR A;  4HJM A;  4MA9 A;  2YN1 A;  1B48 A;  2V32 A;  4GTU A;  2H1B A;  2H71 A;  3UAR A;  3QFB C;  3NOF A;  1TTZ A;  4N30 A;  5KOX A;  4OO4 A;  5DAK A;  3CRT A;  4MNN A;  2HZE A;  1UVZ A;  1USB A;  3APO A;  3FZA A;  3LXT A;  1PSQ A;  2CVD A;  4GCI A;  4QQ7 A;  1O81 A;  4EVM A;  2YWM A;  3WYW A;  5ECN B;  5JCU A;  1TK5 B;  3HJM A;  2ON5 A;  1J9B A;  1F6M C;  3FR6 A;  2JAC A;  3HYP A;  2VLT A;  1FVJ A;  3DVX A;  1FHE A;  4KND A;  2G0F A;  4XS4 A;  5G1L A;  1S3C A;  4F0B A;  3HJP A;  2XBI A;  2K8S A;  1XWK A;  3V1W A;  4MZB A;  4POL A;  2FNO A;  3D4M A;  2VLV A;  5CRD A;  4PX1 A;  4O32 A;  3VWU A;  3RAZ A;  1IYI A;  2FWF A;  3IDV A;  4MMM A;  3MAK A;  4ZL8 A;  4EXJ A;  1T00 A;  1UA5 A;  4XS1 A;  5D9W A;  3IPZ A;  2C8U A;  2HNL A;  2N5B A;  3BCK A;  2VM1 A;  2V2G A;  1ZYE A;  1LBK A;  3C1R A;  4K2X A;  16GS A;  3GUR A;  4J2F A;  3ZL5 A;  1JLV A;  2H1G A;  3IAM 2;  3EYT A;  3DRN A;  3H1N A;  1K0B A;  14GS A;  3I69 A;  2F51 A;  1XZO A;  2YAN A;  1PN9 A;  2XPE A;  1T4Y A;  4V1A p;  3QAG A;  4OD7 A;  3UVT A;  3Q19 A;  2R0C A;  5L71 A;  4ZBA A;  2WCI A;  1HQO A;  1A2M A;  2RUF A;  5EPF A;  3PIN A;  3ME8 A;  4ECI A;  2I3Y A;  3VK9 A;  5ECQ B;  2C3N A;  2I9H A;  2K9F A;  5LD0 A;  2NVL A;  4Q5F A;  2A2P A;  2LNT A;  4EF0 A;  3IXR A;  2PVQ A;  2GLR A;  2VCW A;  1XW9 A;  2L6D A;  1GTU A;  1HNC A;  4MZW A;  4TR3 A;  3TJG A;  4X1U A;  2N5A A;  3A5I A;  1ERW A;  3CSJ A;  3L9U A;  4WBJ A;  4ZB8 A;  2NTO A;  4ZIJ A;  1SJI A;  4WXT A;  2N5F A;  1QFN A;  3QPM A;  1M0U A;  3MYD A;  3I43 A;  1TXX A;  1V9W A;  1X5E A;  22GS A;  2DJJ A;  1JFU A;  2GQL A;  3A5W A;  3ZFL A;  1KEB A;  1OE8 A;  2IME A;  2QA2 A;  3EC3 A;  1OC3 A;  3P90 A;  3ZIV A;  1ZYQ B;  1UC7 A;  4QL9 A;  5HR2 A;  1T4Z A;  3GSS A;  4IS0 A;  2GT5 A;  5LNK e;  4G10 A;  5DAK B;  3EU4 A;  1OKT A;  3KH7 A;  2HZE B;  3ISO A;  3KXO A;  2CAI A;  2YZU A;  4HZ2 A;  5F07 A;  4O5R A;  2IJY A;  4RI7 A;  4HJ2 A;  1EGR A;  3KP9 A;  2VD1 A;  5H5R A;  1G7O A;  4IW9 A;  2V41 A;  2JZT A;  3HY2 A;  2AJQ B;  3F4R A;  4J57 E;  1FOV A;  4TOP A;  4AF2 A;  1TP9 A;  1X9M B;  1VF1 A;  2H66 A;  6GSV A;  3TKS A;  2G2Q A;  4G9H A;  4NHW A;  3U5R E;  8GSS A;  2IMK A;  2L5O A;  2YJ7 A;  3Q18 A;  2FGX A;  2LRC A;  4MDC A;  4XS4 B;  3LSZ A;  2LQQ A;  4OFN A;  3A2W A;  4ACS A;  2HRK A;  1XW5 A;  4J56 E;  4IBP A;  2A4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...