1EWXA

Crystal structure of native tryparedoxin i from crithidia fasciculata
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
144
structure length
144
Chain Sequence
SGLDKYLPGIEKLRRGDGEVEVKSLAGKLVFFYFSASWCPPCRGFTPQLIEFYDKFHESKNFEVVFCTWDEEEDGFAGYFAKMPWLAVPFAQSEAVQKLSKHFNVESIPTLIGVDADSGDVVTTRARATLVKDPEGEQFPWKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords TRYPAREDOXIN I
publication title Structures of tryparedoxins revealing interaction with trypanothione.
pubmed doi rcsb
total genus 43
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2000-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ewxA00
2VIMA 2EIQA 3ME7A 5EPFA 1TKDB 3DYRA 4L8EA 2OE1A 3IBHA 4KNDA 1SK2A 3UBKA 1HNCA 3I6AA 2ALBA 2KUCA 1J0FA 2TRCP 2FGXA 2YWNA 5IMDA 1TK0B 1Q98A 1YJ6A 1BEDA 1O7UA 1GWCA 1THXA 2BMXA 8GSSA 4OWYA 2NBSA 4YAVA 2LRCA 1GSQA 2WGRA 3F0IA 2AV4A 3IA1A 6GSWA 2LV3A 12GSA 3MAKA 5H5QA 2IJYA 3DRNA 2CX4A 2ON7A 1HQOA 2H76A 3CBUA 4L5LA 2QSIA 1V98A 4MPFA 4NWYA 5G31A 4ZBAA 1GRXA 5B6NA 3EC3A 4HUAA 1SU9A 1R7HA 4ZB6A 3C1SA 2ZUPA 3HVXA 1A24A 1HNBA 1GTBA 2DJJA 1G6YA 3FR6A 2X64A 5E59A 2AHEA 2I1UA 1G7EA 1TP9A 2MMZA 2L57A 4Q5NA 1PL2A 2PWJA 1XIYA 4WBJA 4MLYA 5FWGA 3A5WA 4RQXA 3IE3A 3NIVA 2R4VA 5CYYA 1PA3A 2HXKA 3TJBA 2MBSA 2WCIA 5B8BA 1M0UA 1TTZA 2FLSA 3RPPA 1B8XA 4KSOA 3KIJA 1I9DA 4MP4A 3IDVA 5A4UA 5D8IA 3APSA 1QFNA 4K6XA 3VPTA 3EYTA 3WYWA 2JACA 2VLTA 3ZMLA 3L78A 4BVXA 3IXRA 2J23A 5J3RA 3TCOA 2GTUA 4F82A 1XWKA 1TJDA 2B1KA 3UAPA 4I8BA 5IOWA 3BCIA 5ECPB 2OE0A 3ZVJD 4DEJA 2JU5A 1ERVA 2H0IA 4F2IA 3KH7A 3VWWA 2YWIA 2GSSA 4CW9A 3TJFA 13GSA 3F9UA 3KMOA 5HR2A 1X9MB 1OKDA 4X43A 1EGOA 3MWHA 4ECIA 1ZYEA 3L9UA 4HU7A 1XVWA 2H70A 5JWRB 2GGTA 4I6XA 2E0QA 2L6DA 3Q74A 1PGTA 3O6TA 4PQ1A 1A0RP 3KJYA 1B9YC 3TKPA 4KDYA 4OCFA 2YP6A 2VCTA 5ENUA 3HVSA 4IJIA 3GUSA 4PNGA 3IOSA 1H4OA 2F8FA 2MMOA 17GSA 3HKRA 1EEJA 4MZBA 5ELGA 5ECKB 2XBQA 4LL4B 3M9JA 3K8NA 3L9SA 2EC4A 1QK8A 5DALB 2V32A 4ZXGA 4Q5FA 5DQYA 4AJ7A 3W6GA 3GKNA 1NSWA 3LJRA 4K8MA 1FVKA 2C3NA 4RI7A 3W8SA 1GNWA 4D73B 18GSA 2CZ2A 3P2AA 4MF7A 2ZCTA 5A4VA 1G7OA 4WF4A 2A2SA 4AGSA 5DBQA 1GNEA 1GL8A 2NPBA 4P3YB 3D5JA 4HJ2A 3IK7A 4GTUA 2VD0A 3IK9A 1ERWA 4XRDA 5B7CA 4HS1A 2P5QA 1MD3A 4V1Ag 2GT5A 1UVZA 4MF6A 3CMIA 4EDZA 3Q18A 1EGRA 3UARA 2B7JA 4X0XA 2PPTA 1SL2B 1SKWB 4QL9A 6GSVA 1MDIA 3QOUA 1RQMA 2DMMA 4TW5A 5A4WA 2GDRA 3LG6A 1PQNA 5A5KA 1TRSA 5HQPA 1QXHA 2DJKA 3DVWA 2R37A 2C8UA 3H4KA 5CNWA 5LD0A 4GSSA 2CVDA 1WP0A 3P8WA 5B8AA 2H74A 3TKQA 3H1NA 5CO3A 3WGXA 1XW5A 4NMUA 2WRTA 2IWTA 5D93A 2FNOA 2GZZA 1O8WA 1OC3A 1SD8A 2MMNA 4WR4A 4DSSB 2H72A 5G5EA 5J9BA 2AUVA 2NDOA 1YKCA 2PBJA 4HDEA 1K3LA 3QCPA 4K0NA 4QQ7A 3F4RA 3VI5A 4GQCA 1YKAA 2YZUA 2CV4A 1JZOA 2JZRA 1F3BA 5D9VA 5DQSA 4HQZA 3HJOA 3ZZXA 5ECRB 2L5OA 2CVKA 2B5YA 1EOHA 1WWJA 3ZMKA 1S3DA 2YWMA 1W4VA 3GH6A 4YQMA 3RAZA 2DIYA 4K7NA 4PQHA 2H71A 4FIWA 5G5FA 1KNGA 3ISOA 3G7YA 3MSZA 4EO3A 3VK9A 1IYIA 2AB6A 4JR6A 4LMWA 22GSA 3WT1A 3V1WA 3RHCA 4XS6A 4OO5A 1EV9A 2FA8A 1U3IA 1GSYA 2YN1A 2H66A 3ZIJA 3C8EA 3GURA 4NAXA 3ME8A 10GSA 2HSYA 4MA9A 2IMFA 3DXBA 1FW1A 4MCUA 4G19A 1Q4JA 1YDKA 5H5RA 2B1LA 3BCKA 1CQHA 3PINA 5IO2A 1TU8A 3F6DA 2C1YA 1T00A 3G9BA 2EIRA 1A0FA 2V1MA 2LNSA 1QUWA 3HDCA 2H0HA 3KGKA 4NV5A 2LUSA 1XW9A 4PX1A 5DCHA 4FH8A 5J9CA 1CQGA 2LEGA 4WBRD 3CSIA 4EL1A 4ULXA 2K6VA 2WDUA 3O76A 2OBKA 1ABAA 2LRNA 2PVOC 1K0AA 5DJMA 1WOUA 1E2YA 1AAZA 5GAPD 1GP1A 2HZEB 3VURA 1VF2A 3CTFA 1TOFA 2EIOA 4NHWA 1T3BA 3E9JB 3N9JA 2L6CA 2HZFA 3GX8A 3TRPA 2YZHA 5J5NA 4IHUA 2K18A 4I5QA 4LA1A 5IMAA 4PUFC 2IIYA 2CAQA 1OC9B 5COHA 1V57A 2M72A 2LJRA 3W8JA 4V2MA 3FZ9A 3APOA 1YZXA 4QL7A 1PX6A 2FA4A 4KH7A 2GLRA 1ACVA 3UVHA 1XOAA 4IP6A 5JCUA 4GXZA 2R6KA 4XS4B 1EWXA 5KN3A 5CAXA 1MEKA 1M2DA 5LNKe 1SKSB 2C3QA 1G6WA 3DEXA 3IRAA 2KOKA 1ZOFA 1LBKA 5DDLA 1Z7RA 1A8LA 3LFLA 3UVTA 4FYUA 2FWHA 3KH9A 1GTUA 3FK8A 5IM9A 1QGVA 3KP8A 2VL3A 3DKSA 5IMFA 2F3MA 1WE0A 3FY7A 1XCCA 3FZ5A 3IAS2 1AQVA 3LWAA 2FUG2 2B5XA 1X5CA 3TGZA 1QMVA 4GCIA 1THOA 2JL4A 1ILOA 3IR4A 1OE7A 2PUKC 5DAKB 1JZWA 4FO5A 1ZZYA 2YANA 2CQ9A 1SL0B 1R5PA 2A2RA 4IS0A 1MDKA 1MD4A 1NW2A 2GZYA 2VL2A 4EUYA 3DWVA 6GSTA 5AIXA 4GLTA 2JSZA 3GKXA 2HRFA 3EVIA 5ECIB 1GSSA 4HEA2 3GH9A 3U6VA 2X8GA 2HT9A 4ECBA 1FOVA 2CVBA 3QDNA 1SYRA 4MJBA 1NHYA 2HFDA 2PGTA 4HZ2A 3ZLPA 4BA7A 4ML6A 4F0CA 1YEPA 2RM6A 2C80A 3VWXA 5GZZB 1FAAA 5H5SA 3QFAC 3KZQA 2PERA 3HJMA 4BWSA 3TJGA 2RM5A 1H75A 1U6TA 4J56E 1DBYA 3LXZA 1BX9A 5GAND 1Z3EA 2GT6A 1XWBA 1PKZA 3L9VA 1OKTA 5ELAA 1USBA 2I81A 4BVYA 2PU9C 3SWLA 1Z7PA 2VAFA 2L4QA 1OAZA 5D96A 4GSNA 3C73A 1TK8B 4IQAA 2VM2A 4ZB9A 7GSSA 2IPAA 4L5OA 4HI7A 2OE3A 1GSUA 1FO5A 2DJ0A 1V9WA 4PXOA 2MYGA 3I9V2 2YJHA 2YPMA 1R5AA 2VLUA 5DALA 2AAWA 1BAYA 2CX3A 3KP9A 1JFUA 3LEFA 2FHEA 1DE2A 1M7TA 2O8VB 1DUGA 2PMTA 5F07A 4D73A 2P0GA 4HQSA 4OO4A 3PH9A 4XCSA 3GA4A 3D0ZA 5B6MA 4KUNA 2YOIA 4OCEA 2IL3A 1Y25A 3BJ5A 2HE3A 1TW9A 4L0WA 1O6JA 3EMXA 2YWOA 4IELA 4J2FA 1TRUA 4IBPA 3TDGA 3QPMA 4LLRA 2E7PA 2BJXA 2H30A 2FWFA 1XXUA 2XBIA 1XWCA 3HZ4A 3F3QA 5ECLB 1SJIA 20GSA 2WFCA 3VLNA 4RUVA 3FYGA 5ECOB 1UC7A 4L0UA 1U87A 3DMLA 4K7IA 4TR3A 1BYEA 2F51A 4Q5QA 1EP8A 5F06A 4N0VA 3EE2A 3TJJA 4EKZA 5AIVA 3O3TA 9GSSA 3IV4A 4PGTA 3BD2A 3A2WA 4XIHA 3FZAA 2VL9A 1PL1A 3G7JA 2H6XA 4KCAA 4PUAA 4DSSA 3US3A 2H6ZA 2VOCA 5G1KA 1SJZA 2IMDA 1PKWA 2O85A 4WXTA 3ERGA 1B4QA 3L4NA 3TKRA 4YH2A 3U5RE 4KE3A 2LQOA 3UJ1A 4HJMA 1BG5A 2ON5A 1TI1A 3TUEA 3C7MA 1WMJA 3ED3A 5AGYA 5E4WA 1GSFA 3HCZA 3GSSA 2NTOA 1PD21 2JADA 4YAPA 1DSBA 3GV1A 4JZQA 2LRTA 3OR5A 1S3CA 4F9ZA 2M80A 3ZYWA 1A23A 3TOUA 1KBNA 5IOXA 3WT2A 5J4UA 3CYNA 1T8EB 2WULA 1GLPA 5C04A 3KCMA 4XS1A 1X5EA 3QR6A 2QKEA 5ECQB 4GF0A 2VD1A 2I4AA 2HI7A 2GQLA 3BOAA 3KTLA 3ZFBA 3LGCA 3DVXA 2IFQB 1KEBA 2YNXA 3ZVJA 1YY7A 1A8YA 1JZDA 2FD3A 5AN1A 4N10A 1VF3A 19GSA 4RI6A 3GHAA 4IVFA 2FWEA 1ZL9A 2ES7A 1QQ2A 2LJAA 1N2AA 5CRDA 3GMFA 3NOFA 1B4PA 2H0GA 4IGJA 3IHQA 4ML1A 1X9SB 3HY2A 2L5LA 4NPBA 3JCML 4MZWA 3CSJA 3EU3A 2H73A 3HZ8A 4DSRA 1O73A 1PX7A 2V6OA 3ZL5A 1ON4A 4V2NA 4HZ4A 1AQXA 3G7IA 1O81A 4IW9A 4MABA 3GRXA 3F8UA 1W89A 1O8XA 2M46A 2LS5A 2GSQA 5CRHA 1TRWA 2CT6A 3CTGA 5INYA 2HZEA 3ZFLA 4O92A 4TR1B 3UEMA 3UL3A 3FW2A 2FCHA 2WJUA 2OA7A 2DSAA 2VM1A 5G2ZA 1WPIA 4PQIA 1OC9A 5IQYA 4MDCA 2L59A 4ZBBA 1JHBA 2LNTA 5ID2B 2P5RA 1VF1A 3CXGA 1XWGA 2K9FA 3CSHA 5KN1A 1Z6MA 3GN3A 5F05A 3GNJA 2AJQB 4XS4A 1T4ZA 4JBBA 2GZPA 2B5EA 4WEYA 4N0ZA 2VO4A 4BL7A 2B7KA 1WJKA 1UN2A 1TU7A 3QMXA 1OC8A 1SJ6A 5KN2A 5IIZA 5IMCA 2C0EA 4KDUA 4TXOB 2VCWA 4WKWA 4YQVA 1U88A 5ECMB 1WRYA 3QAWA 1F9MA 1M9BA 4FYBA 3KD0A 3RHBA 2B3SA 1AC1A 5FT3A 5DAKA 1NM3A 2IMIA 4CDOA 3VFIA 2WB9A 3PGTA 2RLIA 2GVPA 3LSZA 3LXTA 5KEJA 4ECJA 3ERWA 3SBCA 4ILFA 1A2MA 3VI7A 4AJ8A 1ERUA 3QFBC 2CZ3A 2GS3A 4EE0A 2H75A 1FB0A 3ZREA 1U3AA 1PMTA 2VCXA 2J9HA 4TXVA 5D73A 2H01A 2X8HA 2RUFA 4CHSA 2N5AA 2RUEA 2HYXA 1YEXA 1O85A 4AJ6A 4MH3A 2WZ9A 3ZIVA 1SL1B 1K0CA 2H1DA 2YJ7A 3M1GA 3RPNA 1K0NA 4MZCA 1J9BA 2PN8A 3MNGA 5D9WA 4TOPA 1K0DA 2LQQA 1GTIA 1OYJA 5JCGA 4Q5RA 1SK1A 2P31A 3AY8A 3D21A 2H19A 3D6IA 4MJEA 3E0UA 4JE1A 1SENA 4MJAA 1AUCA 1SYXA 4OFNA 4GWRA 1SKRB 4WF5A 4IJ3A 3GL3A 2NVLA 2E2MA 5F8BA 2MBTA 3LYPA 1SK0A 3P90A 5GSTA 1T1VA 3EINA 3GTUB 5L71A 1AIUA 2KHPA 2FY6A 5HR0A 2V41A 4O32A 3FZ4A 3VWUA 1GULA 2DIZA 4JEDA 1C72A 3LYKA 4HU9A 1EP7A 1MDJA 2QGVA 1ZGNA 2MMAA 3GKMA 1YF0A 4TR0A 2G0FA 2TRXA 3EURA 3M9KA 1EV4A 5JWOB 2GSRA 4K7OA 2H1AA 5ECNB 3VWVA 3GFKA 4TR4A 1M99A 4ZB8A 4ISDA 3WGEA 4ACSA 4NV2A 1E6BA 2VCQA 4G2EA 2WS2A 2VCVA 5G1LA 2I3YA 1VGLA 2C3TA 3H8QA 5HFKA 5HR1A 3GYKA 3ZTLA 1OE8A 3M0FA 2DJ3A 2F9SA 3D4TA 3DIEA 2X99A 3P7XA 2HSHA 2AYTA 1K0BA 2C0FA 3CRUA 5HFIA 3F3RA 3N5OA 3F4TA 4TRXA 4YQUA 4EF0A 4KSMA 6GSSA 1Z5YE 2OBIA 1FG4A 3KM6A 5GSSA 4N30A 2DLXA 3H93A 4POBA 1EOGA 4F0BA 3VPQA 4XHMA 1GLQA 1R26A 2DMLA 2JZTA 1X5DA 1HYUA 5J41A 2GQKA 5JCWA 1NHOA 11GSA 4G9HA 1LU4A 3FRCA 3A3TA 2TIRA 1JLVA 3A2XA 1HNAA 2LJKA 3M8NA 1TI3A 3TKSC 3F4SA 1TRVA 2R2JA 4EDYA 4DSQA 3TJKA 4ZILA 4ID0A 2GSTA 4V1Ap 3DGQA 5KN0A 2C4JA 3FKFA 1XZOA 1ZYQB 1XPVA 5D9TA 1JZRA 2HNLA 4POMA 1JLWA 3EU4A 1RW1A 1F37A 1K0MA 2O89A 4LMVA 2H8LA 2XPDA 3HJPA 3H79A 3F63A 4O7HA 2F8AA 4LL1B 1IYHA 2IFQA 2H6YA 2JZSA 1TXXA 1EEMA 3I43A 3EWLA 3IPZA 3KTBA 2ZNMA 3FR3A 4DVCA 3TOTA 3S9FA 1XBSA 2H1GA 1TDIA 2X8CA 3KEBA 4O5RA 1XW6A 4ZL8A 2R3XA 3LQ7A 3DD3A 1GTAA 2H1BA 4TN8A 5EL8A 3HVVA 4PURA 5AISA 4I97A 2DJ2A 2O7KA 1ERTA 4KB3A 3QAGA 3TKSE 2IMKA 5CP1A 4ZBDA 4E8HA 4I2UA 1F2EA 2CA8A 4MMMA 4MF5A 5F0GA 1S3AA 4ECCA 5EY6A 1XFLA 3Q19A 5D9XA 1N8JA 1AW9A 3RDWA 1UA5A 3I69A 6GSUA 1T4YA 4TR1A 2L4CA 3EMPA 1ML6A 3QD9A 3A2VA 1SD9A 4HOJA 4KAEA 3FR9A 5DJLA 1B9XC 4KDXA 3MDKA 4K9ZA 2D2ZA 2O87A 2R5GA 3TKSA 4WETA 4KCEA 5ECHB 3LORA 2JSYA 2CAIA 4OFMA 2Z9SA 2V2GA 4Z7XA 1I5GA 5ID2A 4JRRA 5IPGA 2IMEA 3C1RA 3E3EA 4ZL7A 1PRXA 4JR4A 2LKUA 1GSEA 3Q6OA 4V2LA 1AXDA 3UMAA 5IMVA 1GUMA 4MK3A 3WGDA 4K2DA 5IMZA 2B6MA 3APQA 4E8EA 2KP2A 2A4VA 4KA0A 4F03A 1AQWA 1YF1A 4TKYA 4MPGA 3BBYA 4G10A 3IC4A 3IAM2 4POKA 4IP1A 1R4WA 1X9WB 1VRSD 4EVMA 2YV9A 1YQ1A 5C00A 4KW6A 3UBLA 4TXOA 2VUPA 3UIWA 2XHFA 1V58A 2OKAA 1F3AA 1VF4A 1K0OA 2OADA 3GKKA 3HHVA 5FHIA 1EZKA 2C0GA 2KLXA 4J57E 4OFTA 1DE1A 4OD7A 6GSXA 1GUHA 1ZMAA 5IO0A 3ZITA 1M2AA 1XWAA 2BTOT 1K3YA 5ECSA 3L0HA 2YV7A 1FB6A 5G30A 2IN3A 2FWGA 1Z6NA 3HXSA 2XPEA 4TVEA 2REMA 3D22A 1RK4A 4GSTA 3TRXA 4FYCA 4MH2A 4XTSA 4JU5A 3M3MA 3J7Yk 1T7PB 2K8SA 5CREA 4BWQA 2LSTA 3KMNA 2GQMA 4NHZA 1MTCA 1BJXA 16GSA 3WD6A 4EXJA 3J7Yb 4ZIJA 2DJ1A 5DVBA 5DCGA 1F6MC 4WR5A 5CRWA 5HR3A 4KGIA 3CRTA 2DC5A 3NZNA 4IKHA 4K0GA 1Z9HA 4H86A 2OACA 1K3OA 1KTEA 2QC7A 3PR8A 2XC2A 1GH2A 1V2AA 2VL2C 1XVQA 1ZCPA 3HA9A 4I2TA 2VCZA 3HYPA 2LTKA 1B48A 2N5FA 1M9AA 5CRGA 3GTUA 3ERFA 1XOBA 4POLA 2G2QA 1GUKA 1G0TA 4GRFA 1URMA 2HLSA 3UOMA 3FEUA 2RIIA 5ABRA 2C0DA 4X1UA 1V40A 3KXOA 2N5BA 3HD5A 4PNFA 4IQ1A 4BPYA 2KP1A 5JWQB 3F6FA 4EC0A 3GSTA 1A2LA 1LJRA 2YCDA 3D4MA 4NXIA 5LCZA 1FHEA 4OMVA 2OJLA 1OVNA 1X0RA 1ST9A 5IPHA 3QAVA 4N11A 1FVJA 4MJCA 3RBTA 2K8VA 2V6KA 4ZL9A 1TK5B 1BQ7A 3TB2A 4AF2A 2DBCA 6GSYA 4K1FA 2E2GA 1A2JA 4RQRA 1M2BA 2I9HA 3FHKA 1HD2A 1J08A 4KX4A 3ZRDA 2HRNA 1PSQA 2VLVA 1WIKA 3C71A 5EVOA 3GL5A 2PVQA 1GSDA 4XRAA 3GIXA 5HFGA 1Y6EA 14GSA 4IN0A 3TRQA 3R2QA 3GX0A 2MZCA 1PN9A 4GQFA
chains in the Genus database with same CATH superfamily
2VIMA 2EIQA 3ME7A 5EPFA 1TKDB 3DYRA 4L8EA 2OE1A 3IBHA 4KNDA 1SK2A 3UBKA 2DKIA 1HNCA 3I6AA 2ALBA 2KUCA 1J0FA 2TRCP 2FGXA 2YWNA 5IMDA 1TK0B 1Q98A 1YJ6A 1BEDA 1O7UA 1GWCA 1THXA 2BMXA 8GSSA 4OWYA 2NBSA 4YAVA 2LRCA 1GSQA 2WGRA 3F0IA 2AV4A 3IA1A 6GSWA 2LV3A 12GSA 3MAKA 5H5QA 2IJYA 3DRNA 2CX4A 2ON7A 1HQOA 2H76A 3CBUA 4L5LA 2QSIA 1V98A 3A5IA 4MPFA 4NWYA 5G31A 4ZBAA 1GRXA 5B6NA 3EC3A 4HUAA 1SU9A 1R7HA 4ZB6A 3C1SA 4Z2TA 2ZUPA 3HVXA 1A24A 1HNBA 1GTBA 2DJJA 1G6YA 3FR6A 2X64A 5E59A 2AHEA 2I1UA 1G7EA 1TP9A 2MMZA 2L57A 4Q5NA 1PL2A 2PWJA 1XIYA 4WBJA 4MLYA 5FWGA 3A5WA 4RQXA 3IE3A 3NIVA 2R4VA 5CYYA 1PA3A 2HXKA 3TJBA 2MBSA 2WCIA 5B8BA 1M0UA 1TTZA 2FLSA 3RPPA 1B8XA 4KSOA 3KIJA 1I9DA 4MP4A 3IDVA 5A4UA 5D8IA 3APSA 1QFNA 4K6XA 3VPTA 3EYTA 3WYWA 2JACA 2VLTA 3ZMLA 3L78A 4BVXA 3IXRA 2J23A 5J3RA 3TCOA 2GTUA 4F82A 1XWKA 1TJDA 2B1KA 3UAPA 4I8BA 5IOWA 3BCIA 5ECPB 2OE0A 3ZVJD 4DEJA 2JU5A 1ERVA 2H0IA 4F2IA 3KH7A 3VWWA 4YKFA 2YWIA 2GSSA 4CW9A 3TJFA 13GSA 3F9UA 3KMOA 5HR2A 1X9MB 1OKDA 4X43A 1EGOA 3MWHA 4ECIA 1ZYEA 3L9UA 4HU7A 1XVWA 2H70A 5JWRB 2GGTA 4I6XA 2E0QA 2L6DA 3Q74A 1PGTA 3O6TA 4PQ1A 1A0RP 3KJYA 1B9YC 4BVYB 3TKPA 4KDYA 4OCFA 2YP6A 2VCTA 3HVNA 3HVSA 5ENUA 4IJIA 4BIKA 3GUSA 4PNGA 3IOSA 1H4OA 2F8FA 2MMOA 17GSA 3HKRA 1EEJA 4MZBA 5ELGA 5ECKB 2XBQA 2R0PA 4LL4B 3M9JA 3K8NA 3L9SA 2EC4A 1QK8A 5DALB 2V32A 4ZXGA 4Q5FA 5DQYA 4AJ7A 3W6GA 3GKNA 1NSWA 3LJRA 4K8MA 1FVKA 2C3NA 4RI7A 3W8SA 1GNWA 4D73B 18GSA 3R3EA 2CZ2A 3P2AA 4MF7A 2ZCTA 5A4VA 1G7OA 4WF4A 2A2SA 4AGSA 5DBQA 1GNEA 1GL8A 2NPBA 4P3YB 3D5JA 4HJ2A 3IK7A 4GTUA 2VD0A 1XG8A 3IK9A 1ERWA 4XRDA 5B7CA 4HS1A 2P5QA 1MD3A 4V1Ag 2GT5A 1UVZA 4MF6A 3CMIA 4EDZA 3Q18A 1EGRA 3UARA 4USSA 2B7JA 4X0XA 2PPTA 1SL2B 4HSCX 1SKWB 4QL9A 6GSVA 1MDIA 3QOUA 1RQMA 2DMMA 4TW5A 5A4WA 2GDRA 3LG6A 1PQNA 1M3JA 5A5KA 1TRSA 5HQPA 1QXHA 2DJKA 3DVWA 2R37A 2C8UA 3H4KA 5CNWA 5LD0A 4GSSA 2CVDA 1WP0A 3P8WA 5B8AA 2H74A 3TKQA 3H1NA 5CO3A 3WGXA 1XW5A 4NMUA 2WRTA 2IWTA 5D93A 2FNOA 1M3IA 4EIQA 2GZZA 1O8WA 1OC3A 1SD8A 2X49A 2MMNA 4WR4A 4DSSB 2H72A 5G5EA 5J9BA 2AUVA 2NDOA 1YKCA 2PBJA 4HDEA 1K3LA 3QCPA 4K0NA 4QQ7A 3F4RA 3VI5A 4GQCA 1YKAA 2YZUA 2CV4A 1JZOA 2JZRA 1F3BA 5D9VA 5DQSA 4HQZA 3HJOA 3ZZXA 5ECRB 2L5OA 2CVKA 2B5YA 1EOHA 1WWJA 3ZMKA 1S3DA 2YWMA 1W4VA 3GH6A 4CY8A 4YQMA 3RAZA 2DIYA 4K7NA 4PQHA 2H71A 4FIWA 5G5FA 1KNGA 3ISOA 3G7YA 3MSZA 4EO3A 3VK9A 1IYIA 2AB6A 4JR6A 4LMWA 22GSA 3WT1A 3V1WA 3RHCA 4XS6A 4OO5A 1EV9A 2FA8A 1U3IA 1GSYA 2YN1A 2H66A 3ZIJA 3C8EA 3GURA 4NAXA 3ME8A 10GSA 2HSYA 4MA9A 2IMFA 3DXBA 1FW1A 4MCUA 4G19A 1Q4JA 1YDKA 5H5RA 2B1LA 3BCKA 1CQHA 3PINA 5IO2A 1TU8A 3F6DA 2C1YA 1T00A 3G9BA 2EIRA 1A0FA 2V1MA 2LNSA 1QUWA 3HDCA 2H0HA 3KGKA 4NV5A 2LUSA 1XW9A 4PX1A 5DCHA 4FH8A 5J9CA 1CQGA 4X4JA 2LEGA 4WBRD 3CSIA 4EL1A 4ULXA 2K6VA 2WDUA 3O76A 2OBKA 1ABAA 2LRNA 2PVOC 1K0AA 5DJMA 1WOUA 1E2YA 1AAZA 5GAPD 1GP1A 2HZEB 3VURA 1VF2A 3CTFA 1TOFA 2EIOA 4NHWA 1T3BA 3E9JB 3N9JA 2L6CA 2HZFA 3GX8A 3TRPA 2YZHA 5J5NA 4IHUA 2K18A 4I5QA 4LA1A 5IMAA 4PUFC 2IIYA 2CAQA 1OC9B 5COHA 1V57A 2M72A 2LJRA 3W8JA 4V2MA 3FZ9A 3APOA 1YZXA 4QL7A 1PX6A 2FA4A 4G0KA 4KH7A 2GLRA 1ACVA 3UVHA 1XOAA 4IP6A 5JCUA 4EIPA 4GXZA 2R6KA 4XS4B 1EWXA 5KN3A 5CAXA 1MEKA 1M2DA 5LNKe 1SKSB 2C3QA 1G6WA 3DEXA 3IRAA 2KOKA 1ZOFA 1LBKA 5DDLA 1Z7RA 1A8LA 3LFLA 3UVTA 4BL7B 4FYUA 2FWHA 3KH9A 1GTUA 3FK8A 4FQUA 5IM9A 1QGVA 3KP8A 2VL3A 3DKSA 5IMFA 2F3MA 1WE0A 3FY7A 1XCCA 3FZ5A 3IAS2 1AQVA 3LWAA 2FUG2 2B5XA 1X5CA 3TGZA 1QMVA 4GCIA 1THOA 2JL4A 1ILOA 4G0IA 3IR4A 1OE7A 2PUKC 5DAKB 1JZWA 4FO5A 1ZZYA 2YANA 2CQ9A 1SL0B 1R5PA 2A2RA 4IS0A 1MDKA 1MD4A 1NW2A 2GZYA 2VL2A 4EUYA 3DWVA 6GSTA 5AIXA 4GLTA 2JSZA 1S3RA 2HRFA 3EVIA 3GKXA 5ECIB 1GSSA 4HEA2 3GH9A 3U6VA 2X8GA 2HT9A 4ECBA 1FOVA 2CVBA 3QDNA 1SYRA 4MJBA 1NHYA 2HFDA 2PGTA 4HZ2A 3ZLPA 4BA7A 4ML6A 4F0CA 1YEPA 2RM6A 2C80A 3VWXA 5GZZB 1FAAA 5H5SA 3QFAC 3KZQA 2PERA 3HJMA 4BWSA 3TJGA 2RM5A 1H75A 1U6TA 4J56E 1DBYA 3LXZA 1BX9A 5GAND 1Z3EA 2GT6A 1XWBA 1PKZA 3L9VA 1OKTA 5ELAA 1USBA 2I81A 4BVYA 2PU9C 3SWLA 1Z7PA 2VAFA 2L4QA 1OAZA 5D96A 4GSNA 3C73A 1TK8B 4IQAA 2VM2A 4ZB9A 7GSSA 2IPAA 4L5OA 4HI7A 2OE3A 1GSUA 1FO5A 2DJ0A 1V9WA 4PXOA 2MYGA 3I9V2 2YJHA 2YPMA 1R5AA 2VLUA 5DALA 2AAWA 1BAYA 2CX3A 3KP9A 1JFUA 3LEFA 2FHEA 1DE2A 1M7TA 2O8VB 1DUGA 2PMTA 5F07A 4D73A 2P0GA 4HQSA 4OO4A 3PH9A 4XCSA 3GA4A 4Z2UA 3D0ZA 5BRTA 5B6MA 4KUNA 2YOIA 4OCEA 2IL3A 1Y25A 3BJ5A 2HE3A 1TW9A 4K5SA 4L0WA 1O6JA 3EMXA 2YWOA 4IELA 4J2FA 1TRUA 4IBPA 3TDGA 3QPMA 4LLRA 2E7PA 2BJXA 2H30A 2FWFA 1XXUA 2XBIA 1XWCA 3HZ4A 3F3QA 5ECLB 1SJIA 20GSA 2WFCA 3VLNA 4RUVA 3FYGA 5ECOB 1UC7A 2QA1A 4L0UA 1U87A 3DMLA 4K7IA 4TR3A 1BYEA 2F51A 4Q5QA 1EP8A 5F06A 4N0VA 3EE2A 3TJJA 4EKZA 2R0CA 5AIVA 3O3TA 9GSSA 3IV4A 4PGTA 3BD2A 3A2WA 4XIHA 3FZAA 2VL9A 1PL1A 3G7JA 2H6XA 4KCAA 4PUAA 4DSSA 3US3A 2H6ZA 2VOCA 5G1KA 1SJZA 2IMDA 1PKWA 2O85A 4WXTA 3ERGA 1B4QA 3L4NA 3TKRA 4YH2A 3U5RE 4KE3A 2LQOA 3UJ1A 4HJMA 1BG5A 2ON5A 1TI1A 3TUEA 3C7MA 1WMJA 3ED3A 5AGYA 5E4WA 1GSFA 3HCZA 3GSSA 2NTOA 1PD21 2JADA 4YAPA 1DSBA 3GV1A 4MNNA 4JZQA 2LRTA 3OR5A 1S3CA 4F9ZA 2M80A 3ZYWA 4PTSA 1A23A 3TOUA 1KBNA 5IOXA 3WT2A 5J4UA 3CYNA 1T8EB 2WULA 1GLPA 5C04A 3KCMA 4XS1A 1X5EA 3QR6A 2QKEA 5ECQB 4GF0A 2VD1A 2I4AA 2HI7A 2GQLA 2A4HA 3BOAA 3KTLA 3ZFBA 3LGCA 3DVXA 2IFQB 1KEBA 2YNXA 3ZVJA 1YY7A 1A8YA 1JZDA 2FD3A 4G0LA 5AN1A 4N10A 1VF3A 19GSA 4RI6A 3GHAA 4IVFA 2FWEA 1ZL9A 2ES7A 1QQ2A 2LJAA 1N2AA 5CRDA 3GMFA 3NOFA 1B4PA 2H0GA 4IGJA 3IHQA 4ML1A 1X9SB 3HY2A 2L5LA 4NPBA 3JCML 4MZWA 3CSJA 3EU3A 2H73A 3HZ8A 4DSRA 1O73A 1PX7A 2V6OA 2HSMA 3ZL5A 1ON4A 4V2NA 4HZ4A 1AQXA 3G7IA 1O81A 4IW9A 4MABA 3GRXA 3F8UA 4A5PA 1W89A 1O8XA 2X4AA 2M46A 2LS5A 2GSQA 5CRHA 1TRWA 2CT6A 3CTGA 5INYA 2HZEA 3ZFLA 4O92A 4TR1B 3UEMA 3UL3A 3FW2A 2FCHA 2WJUA 2OA7A 2DSAA 2VM1A 5G2ZA 1WPIA 4PQIA 1OC9A 5IQYA 4MDCA 2L59A 4ZBBA 1JHBA 2LNTA 5ID2B 2P5RA 1VF1A 3MYDA 3CXGA 1XWGA 4YKGA 2K9FA 3CSHA 5KN1A 1Z6MA 3GN3A 5F05A 3GNJA 2AJQB 4XS4A 1T4ZA 4JBBA 2GZPA 2B5EA 4WEYA 4N0ZA 2VO4A 4BL7A 2B7KA 1WJKA 1UN2A 1TU7A 3QMXA 1OC8A 1SJ6A 5KN2A 5IIZA 5IMCA 2C0EA 4KDUA 4TXOB 2VCWA 4WKWA 4YQVA 1U88A 4K2XA 5ECMB 1WRYA 3QAWA 1F9MA 1M9BA 4FYBA 3KD0A 3RHBA 2B3SA 1AC1A 5FT3A 5DAKA 1NM3A 2IMIA 4CDOA 3VFIA 2WB9A 3PGTA 2RLIA 2GVPA 3LSZA 3LXTA 5KEJA 4ECJA 3ERWA 3SBCA 4ILFA 1A2MA 3VI7A 4AJ8A 1ERUA 3QFBC 2CZ3A 2GS3A 4EE0A 2H75A 1FB0A 3ZREA 1U3AA 1PMTA 2VCXA 2J9HA 4TXVA 5D73A 2H01A 2X8HA 2RUFA 4CHSA 2N5AA 2RUEA 2HYXA 1YEXA 1O85A 4AJ6A 2DKHA 2WZ9A 4MH3A 3ZIVA 1SL1B 1K0CA 2H1DA 2YJ7A 3M1GA 3RPNA 1K0NA 4MZCA 1J9BA 3MIXA 2PN8A 3MNGA 2A2PA 5D9WA 4TOPA 1K0DA 2LQQA 1GTIA 1OYJA 5JCGA 4Q5RA 1SK1A 2P31A 3AY8A 3D21A 2H19A 3D6IA 4MJEA 3E0UA 4JE1A 1SENA 4MJAA 1AUCA 1SYXA 4OFNA 4GWRA 1SKRB 4WF5A 3EPTA 4IJ3A 3GL3A 2NVLA 2E2MA 5F8BA 2MBTA 3LYPA 1SK0A 3P90A 5GSTA 2QA2A 1T1VA 3EINA 3GTUB 5L71A 1AIUA 2KHPA 2FY6A 5HR0A 2V41A 4O32A 3FZ4A 3VWUA 1GULA 2DIZA 4JEDA 1C72A 3LYKA 2UZ8A 4HU9A 1EP7A 1MDJA 2QGVA 1ZGNA 2MMAA 3GKMA 1YF0A 4TR0A 2G0FA 2TRXA 3EURA 3M9KA 1EV4A 5JWOB 2HRAA 2GSRA 4K7OA 2H1AA 5ECNB 3VWVA 3GFKA 4TR4A 1M99A 4ZB8A 4ISDA 3WGEA 4ACSA 4NV2A 1E6BA 2VCQA 4G2EA 2WS2A 2VCVA 5G1LA 2I3YA 1VGLA 2C3TA 3H8QA 5HFKA 5HR1A 3GYKA 3ZTLA 1OE8A 3M0FA 2DJ3A 2F9SA 3D4TA 3DIEA 2X99A 3P7XA 2HSHA 2AYTA 1K0BA 2C0FA 3CRUA 5HFIA 5KOXA 3F3RA 3N5OA 3F4TA 4TRXA 4YQUA 4EF0A 4KSMA 6GSSA 1Z5YE 2OBIA 1FG4A 3KM6A 5GSSA 4N30A 2DLXA 3H93A 4POBA 1EOGA 4F0BA 3VPQA 4XHMA 4CY6A 4O5UA 3IC8A 1GLQA 1R26A 2DMLA 2JZTA 1X5DA 1HYUA 5J41A 2GQKA 5JCWA 1NHOA 11GSA 4G9HA 1LU4A 3FRCA 3A3TA 2TIRA 1JLVA 3A2XA 1HNAA 1ZYPA 2LJKA 3M8NA 1TI3A 3TKSC 3F4SA 1TRVA 2R2JA 4EDYA 4DSQA 3TJKA 4ZILA 4ID0A 2GSTA 4V1Ap 3DGQA 5KN0A 2C4JA 3FKFA 1XZOA 1ZYQB 1XPVA 5D9TA 1JZRA 2HNLA 4POMA 1JLWA 3EU4A 1RW1A 1F37A 2R0GA 1K0MA 2O89A 4LMVA 2H8LA 4Z2RA 2XPDA 3HJPA 3H79A 3F63A 4O7HA 5KOWA 2F8AA 4LL1B 1IYHA 2IFQA 2H6YA 2JZSA 1TXXA 4KF9A 1EEMA 3I43A 3EWLA 3IPZA 3KTBA 2ZNMA 3FR3A 4DVCA 3TOTA 3S9FA 1XBSA 4ICYA 2H1GA 1TDIA 2X8CA 3KEBA 4O5RA 1XW6A 4ZL8A 2R3XA 1PFOA 2HRKA 3LQ7A 3DD3A 1GTAA 2H1BA 4TN8A 5EL8A 3HVVA 4PURA 5AISA 4I97A 2DJ2A 2O7KA 1ERTA 4KB3A 3QAGA 3TKSE 2IMKA 5CP1A 4ZBDA 4BVXB 4E8HA 4I2UA 1F2EA 2CA8A 4MMMA 4MF5A 5F0GA 1S3AA 4ECCA 5EY6A 1XFLA 3Q19A 5D9XA 1N8JA 1AW9A 3RDWA 1UA5A 3I69A 6GSUA 1T4YA 4TR1A 2L4CA 3EMPA 1ML6A 3QD9A 3A2VA 1SD9A 4HOJA 4KAEA 3FR9A 5BMUA 5DJLA 1B9XC 4KDXA 3MDKA 4K9ZA 2D2ZA 2O87A 2R5GA 3TKSA 3FMWA 4KCEA 4WETA 5ECHB 3LORA 2JSYA 2CAIA 4OFMA 2Z9SA 2V2GA 4Z7XA 1I5GA 5ID2A 4JRRA 5IPGA 2IMEA 3C1RA 3E3EA 4ZL7A 1PRXA 4JR4A 2LKUA 1GSEA 3Q6OA 4V2LA 1AXDA 3UMAA 5IMVA 1GUMA 4MK3A 3WGDA 4K2DA 5IMZA 2B6MA 3APQA 4E8EA 4O5QA 2KP2A 2A4VA 4KA0A 4F03A 1AQWA 1YF1A 4TKYA 4MPGA 3BBYA 4G10A 3IC4A 3IAM2 4POKA 4IP1A 1R4WA 3CQFA 1X9WB 1VRSD 4EVMA 2YV9A 1YQ1A 5C00A 4KW6A 3UBLA 4TXOA 3IHGA 2VUPA 3UIWA 3LW9A 2XHFA 1V58A 2OKAA 1F3AA 1VF4A 1K0OA 2OADA 3GKKA 3HHVA 5FHIA 1EZKA 2C0GA 2KLXA 4J57E 4OFTA 1DE1A 4OD7A 6GSXA 1GUHA 1ZMAA 1ZYNA 5IO0A 3ZITA 1M2AA 1XWAA 2BTOT 1K3YA 5ECSA 3L0HA 2YV7A 1FB6A 5G30A 2IN3A 2FWGA 1Z6NA 3HXSA 2XPEA 4TVEA 2REMA 3D22A 1RK4A 4GSTA 3TRXA 4FYCA 4MH2A 4XTSA 4JU5A 3M3MA 3J7Yk 1T7PB 2K8SA 5CREA 4BWQA 2LSTA 3KMNA 2GQMA 4NHZA 1MTCA 1BJXA 16GSA 3WD6A 4EXJA 3J7Yb 4ZIJA 2DJ1A 5DVBA 5DCGA 1F6MC 4WR5A 1PN0A 5CRWA 5HR3A 4KGIA 3CRTA 2DC5A 3NZNA 4IKHA 4K0GA 3PPUA 1Z9HA 4H86A 2OACA 1K3OA 1KTEA 4K5RA 2QC7A 3PR8A 2XC2A 1GH2A 1V2AA 2VL2C 1XVQA 1ZCPA 3HA9A 4I2TA 2VCZA 3HYPA 2LTKA 1B48A 2N5FA 1M9AA 5CRGA 3GTUA 3ERFA 1XOBA 4POLA 2G2QA 1GUKA 1G0TA 4GRFA 1URMA 2HLSA 3UOMA 3FEUA 2RIIA 5ABRA 2C0DA 4X1UA 1V40A 3KXOA 2N5BA 3HD5A 4PNFA 4IQ1A 4BPYA 2KP1A 5JWQB 3F6FA 4EC0A 3GSTA 1A2LA 1LJRA 2YCDA 3D4MA 4NXIA 5LCZA 1FHEA 4OMVA 2OJLA 1OVNA 1X0RA 1ST9A 5IPHA 3QAVA 4N11A 1FVJA 4MJCA 3RBTA 2K8VA 2V6KA 4ZL9A 1TK5B 1BQ7A 3TB2A 4AF2A 2DBCA 6GSYA 4K1FA 2E2GA 1A2JA 4RQRA 1M2BA 2I9HA 3FHKA 1HD2A 1J08A 4KX4A 3ZRDA 1FOHA 2HRNA 1PSQA 2VLVA 1WIKA 3C71A 5EVOA 3GL5A 2PVQA 1GSDA 4XRAA 3GIXA 5HFGA 1Y6EA 14GSA 4IN0A 3TRQA 3R2QA 3GX0A 2MZCA 1PN9A 4GQFA
chains in the Genus database with same CATH topology
2VIMA 2EIQA 3ME7A 5EPFA 1TKDB 3DYRA 4L8EA 2OE1A 3IBHA 4KNDA 1SK2A 3UBKA 2DKIA 1HNCA 3I6AA 2ALBA 2KUCA 1J0FA 2TRCP 2FGXA 2YWNA 5IMDA 1TK0B 1Q98A 1YJ6A 1BEDA 1O7UA 1GWCA 1THXA 2BMXA 8GSSA 4OWYA 2NBSA 4YAVA 2LRCA 1GSQA 2WGRA 3F0IA 2AV4A 3IA1A 6GSWA 2LV3A 12GSA 3MAKA 5H5QA 2IJYA 3DRNA 2CX4A 2ON7A 1HQOA 2H76A 3CBUA 4L5LA 2QSIA 1V98A 3A5IA 4MPFA 4NWYA 5G31A 4ZBAA 1GRXA 5B6NA 3EC3A 4HUAA 1SU9A 1R7HA 4ZB6A 3C1SA 4Z2TA 2ZUPA 3HVXA 1A24A 1HNBA 1GTBA 2DJJA 1G6YA 3FR6A 2X64A 5E59A 2AHEA 2I1UA 1G7EA 1TP9A 2MMZA 2L57A 4Q5NA 1PL2A 2PWJA 1XIYA 4WBJA 4MLYA 5FWGA 3A5WA 4RQXA 3IE3A 3NIVA 2R4VA 5CYYA 1PA3A 2HXKA 3TJBA 2MBSA 2WCIA 5B8BA 1M0UA 1TTZA 2FLSA 3RPPA 1B8XA 4KSOA 3KIJA 1I9DA 4MP4A 3IDVA 5A4UA 5D8IA 3APSA 1QFNA 4K6XA 3VPTA 3EYTA 3WYWA 2JACA 2VLTA 3ZMLA 3L78A 4BVXA 3IXRA 2J23A 5J3RA 3TCOA 2GTUA 4F82A 1XWKA 1TJDA 2B1KA 3UAPA 4I8BA 5IOWA 3BCIA 5ECPB 2OE0A 3ZVJD 4DEJA 2JU5A 1ERVA 2H0IA 4F2IA 3KH7A 3VWWA 4YKFA 2YWIA 2GSSA 4CW9A 3TJFA 13GSA 3F9UA 3KMOA 5HR2A 1X9MB 1OKDA 4X43A 1EGOA 3MWHA 4ECIA 1ZYEA 3L9UA 4HU7A 1XVWA 2H70A 5JWRB 2GGTA 4I6XA 2E0QA 2L6DA 3Q74A 1PGTA 3O6TA 4PQ1A 1A0RP 3KJYA 1B9YC 4BVYB 3TKPA 4KDYA 4OCFA 2YP6A 2VCTA 5ENUA 3HVSA 4IJIA 3GUSA 4PNGA 3IOSA 1H4OA 2F8FA 2MMOA 17GSA 3HKRA 1EEJA 4MZBA 5ELGA 5ECKB 2XBQA 2R0PA 4LL4B 3M9JA 3K8NA 3L9SA 2EC4A 1QK8A 5DALB 2V32A 4ZXGA 4Q5FA 5DQYA 4AJ7A 3W6GA 3GKNA 1NSWA 3LJRA 4K8MA 1FVKA 2C3NA 4RI7A 3W8SA 1GNWA 4D73B 18GSA 3R3EA 2CZ2A 3P2AA 4MF7A 2ZCTA 5A4VA 1G7OA 4WF4A 2A2SA 4AGSA 5DBQA 1GNEA 1GL8A 2NPBA 4P3YB 3D5JA 4HJ2A 3IK7A 4GTUA 2VD0A 3IK9A 1ERWA 4XRDA 5B7CA 4HS1A 2P5QA 1MD3A 4V1Ag 2GT5A 1UVZA 4MF6A 3CMIA 4EDZA 3Q18A 1EGRA 3UARA 4USSA 2B7JA 4X0XA 2PPTA 1SL2B 1SKWB 4QL9A 6GSVA 1MDIA 3QOUA 1RQMA 2DMMA 4TW5A 5A4WA 2GDRA 3LG6A 1PQNA 5A5KA 1TRSA 5HQPA 1QXHA 2DJKA 3DVWA 2R37A 2C8UA 3H4KA 5CNWA 5LD0A 4GSSA 2CVDA 1WP0A 3P8WA 5B8AA 2H74A 3TKQA 3H1NA 5CO3A 3WGXA 1XW5A 4NMUA 2WRTA 2IWTA 5D93A 2FNOA 4EIQA 2GZZA 1O8WA 1OC3A 1SD8A 2X49A 2MMNA 4WR4A 4DSSB 2H72A 5G5EA 5J9BA 2AUVA 2NDOA 1YKCA 2PBJA 4HDEA 1K3LA 3QCPA 4K0NA 4QQ7A 3F4RA 3VI5A 4GQCA 1YKAA 2YZUA 2CV4A 1JZOA 2JZRA 1F3BA 5D9VA 5DQSA 4HQZA 3HJOA 3ZZXA 5ECRB 2L5OA 2CVKA 2B5YA 1EOHA 1WWJA 3ZMKA 1S3DA 2YWMA 1W4VA 3GH6A 4CY8A 4YQMA 3RAZA 2DIYA 4K7NA 4PQHA 2H71A 4FIWA 5G5FA 1KNGA 3ISOA 3G7YA 3MSZA 4EO3A 3VK9A 1IYIA 2AB6A 4JR6A 4LMWA 22GSA 3WT1A 3V1WA 3RHCA 4XS6A 4OO5A 1EV9A 2FA8A 1U3IA 1GSYA 2YN1A 2H66A 3ZIJA 3C8EA 3GURA 4NAXA 3ME8A 10GSA 2HSYA 4MA9A 2IMFA 3DXBA 1FW1A 4MCUA 4G19A 1Q4JA 1YDKA 5H5RA 2B1LA 3BCKA 1CQHA 3PINA 5IO2A 1TU8A 3F6DA 2C1YA 1T00A 3G9BA 2EIRA 1A0FA 2V1MA 2LNSA 1QUWA 3HDCA 2H0HA 3KGKA 4NV5A 2LUSA 1XW9A 4PX1A 5DCHA 4FH8A 5J9CA 1CQGA 4X4JA 2LEGA 4WBRD 3CSIA 4EL1A 4ULXA 2K6VA 2WDUA 3O76A 2OBKA 1ABAA 2LRNA 2PVOC 1K0AA 5DJMA 1WOUA 1E2YA 1AAZA 5GAPD 1GP1A 2HZEB 3VURA 1VF2A 3CTFA 1TOFA 2EIOA 4NHWA 1T3BA 3E9JB 3N9JA 2L6CA 2HZFA 3GX8A 3TRPA 2YZHA 5J5NA 4IHUA 2K18A 4I5QA 4LA1A 5IMAA 4PUFC 2IIYA 2CAQA 1OC9B 5COHA 1V57A 2M72A 2LJRA 3W8JA 4V2MA 3FZ9A 3APOA 1YZXA 4QL7A 1PX6A 2FA4A 4G0KA 4KH7A 2GLRA 1ACVA 3UVHA 1XOAA 4IP6A 5JCUA 4EIPA 4GXZA 2R6KA 4XS4B 1EWXA 5KN3A 5CAXA 1MEKA 1M2DA 5LNKe 1SKSB 2C3QA 1G6WA 3DEXA 3IRAA 2KOKA 1ZOFA 1LBKA 5DDLA 1Z7RA 1A8LA 3LFLA 3UVTA 4BL7B 4FYUA 2FWHA 3KH9A 1GTUA 3FK8A 4FQUA 5IM9A 1QGVA 3KP8A 2VL3A 3DKSA 5IMFA 2F3MA 1WE0A 3FY7A 1XCCA 3FZ5A 3IAS2 1AQVA 3LWAA 2FUG2 2B5XA 1X5CA 3TGZA 1QMVA 4GCIA 1THOA 2JL4A 1ILOA 4G0IA 3IR4A 1OE7A 2PUKC 5DAKB 1JZWA 4FO5A 1ZZYA 2YANA 2CQ9A 1SL0B 1R5PA 2A2RA 4IS0A 1MDKA 1MD4A 1NW2A 2GZYA 2VL2A 4EUYA 3DWVA 6GSTA 5AIXA 4GLTA 2JSZA 3GKXA 2HRFA 3EVIA 5ECIB 1GSSA 4HEA2 3GH9A 3U6VA 2X8GA 2HT9A 4ECBA 1FOVA 2CVBA 3QDNA 1SYRA 4MJBA 1NHYA 2HFDA 2PGTA 4HZ2A 3ZLPA 4BA7A 4ML6A 4F0CA 1YEPA 2RM6A 2C80A 3VWXA 5GZZB 1FAAA 5H5SA 3QFAC 3KZQA 2PERA 3HJMA 4BWSA 3TJGA 2RM5A 1H75A 1U6TA 4J56E 1DBYA 3LXZA 1BX9A 5GAND 1Z3EA 2GT6A 1XWBA 1PKZA 3L9VA 1OKTA 5ELAA 1USBA 2I81A 4BVYA 2PU9C 3SWLA 1Z7PA 2VAFA 2L4QA 1OAZA 5D96A 4GSNA 3C73A 1TK8B 4IQAA 2VM2A 4ZB9A 7GSSA 2IPAA 4L5OA 4HI7A 2OE3A 1GSUA 1FO5A 2DJ0A 1V9WA 4PXOA 2MYGA 3I9V2 2YJHA 2YPMA 1R5AA 2VLUA 5DALA 2AAWA 1BAYA 2CX3A 3KP9A 1JFUA 3LEFA 2FHEA 1DE2A 1M7TA 2O8VB 1DUGA 2PMTA 5F07A 4D73A 2P0GA 4HQSA 4OO4A 3PH9A 4XCSA 3GA4A 4Z2UA 3D0ZA 5BRTA 5B6MA 4KUNA 2YOIA 4OCEA 2IL3A 1Y25A 3BJ5A 2HE3A 1TW9A 4K5SA 4L0WA 1O6JA 3EMXA 2YWOA 4IELA 4J2FA 1TRUA 4IBPA 3TDGA 3QPMA 4LLRA 2E7PA 2BJXA 2H30A 2FWFA 1XXUA 2XBIA 1XWCA 3HZ4A 3F3QA 5ECLB 1SJIA 20GSA 2WFCA 3VLNA 4RUVA 3FYGA 5ECOB 1UC7A 2QA1A 4L0UA 1U87A 3DMLA 4K7IA 4TR3A 1BYEA 2F51A 4Q5QA 1EP8A 5F06A 4N0VA 3EE2A 3TJJA 4EKZA 2R0CA 5AIVA 3O3TA 9GSSA 3IV4A 4PGTA 3BD2A 3A2WA 4XIHA 3FZAA 2VL9A 1PL1A 3G7JA 2H6XA 4KCAA 4PUAA 4DSSA 3US3A 2H6ZA 2VOCA 5G1KA 1SJZA 2IMDA 1PKWA 2O85A 4WXTA 3ERGA 1B4QA 3L4NA 3TKRA 4YH2A 3U5RE 4KE3A 2LQOA 3UJ1A 4HJMA 1BG5A 2ON5A 1TI1A 3TUEA 3C7MA 1WMJA 3ED3A 5AGYA 5E4WA 1GSFA 3HCZA 3GSSA 2NTOA 1PD21 2JADA 4YAPA 1DSBA 3GV1A 4MNNA 4JZQA 2LRTA 3OR5A 1S3CA 4F9ZA 2M80A 3ZYWA 4PTSA 1A23A 3TOUA 1KBNA 5IOXA 3WT2A 5J4UA 3CYNA 1T8EB 2WULA 1GLPA 5C04A 3KCMA 4XS1A 1X5EA 3QR6A 2QKEA 5ECQB 4GF0A 2VD1A 2I4AA 2HI7A 2GQLA 2A4HA 3BOAA 3KTLA 3ZFBA 3LGCA 3DVXA 2IFQB 1KEBA 2YNXA 3ZVJA 1YY7A 1A8YA 1JZDA 2FD3A 4G0LA 5AN1A 4N10A 1VF3A 19GSA 4RI6A 3GHAA 4IVFA 2FWEA 1ZL9A 2ES7A 1QQ2A 2LJAA 1N2AA 5CRDA 3GMFA 3NOFA 1B4PA 2H0GA 4IGJA 3IHQA 4ML1A 1X9SB 3HY2A 2L5LA 4NPBA 3JCML 4MZWA 3CSJA 3EU3A 2H73A 3HZ8A 4DSRA 1O73A 1PX7A 2V6OA 2HSMA 3ZL5A 1ON4A 4V2NA 4HZ4A 1AQXA 3G7IA 1O81A 4IW9A 4MABA 3GRXA 3F8UA 4A5PA 1W89A 1O8XA 2X4AA 2M46A 2LS5A 2GSQA 5CRHA 1TRWA 2CT6A 3CTGA 5INYA 2HZEA 3ZFLA 4O92A 4TR1B 3UEMA 3UL3A 3FW2A 2FCHA 2WJUA 2OA7A 2DSAA 2VM1A 5G2ZA 1WPIA 4PQIA 1OC9A 5IQYA 4MDCA 2L59A 4ZBBA 1JHBA 2LNTA 5ID2B 2P5RA 1VF1A 3MYDA 3CXGA 1XWGA 4YKGA 2K9FA 3CSHA 5KN1A 1Z6MA 3GN3A 5F05A 3GNJA 2AJQB 4XS4A 1T4ZA 4JBBA 2GZPA 2B5EA 4WEYA 4N0ZA 2VO4A 4BL7A 2B7KA 1WJKA 1UN2A 1TU7A 3QMXA 1OC8A 1SJ6A 5KN2A 5IIZA 5IMCA 2C0EA 4KDUA 4TXOB 2VCWA 4WKWA 4YQVA 1U88A 4K2XA 5ECMB 1WRYA 3QAWA 1F9MA 1M9BA 4FYBA 3KD0A 3RHBA 2B3SA 1AC1A 5FT3A 5DAKA 1NM3A 2IMIA 4CDOA 3VFIA 2WB9A 3PGTA 2RLIA 2GVPA 3LSZA 3LXTA 5KEJA 4ECJA 3ERWA 3SBCA 4ILFA 1A2MA 3VI7A 4AJ8A 1ERUA 3QFBC 2CZ3A 2GS3A 4EE0A 2H75A 1FB0A 3ZREA 1U3AA 1PMTA 2VCXA 2J9HA 4TXVA 5D73A 2H01A 2X8HA 2RUFA 4CHSA 2N5AA 2RUEA 2HYXA 1YEXA 1O85A 4AJ6A 2DKHA 2WZ9A 4MH3A 3ZIVA 1SL1B 1K0CA 2H1DA 2YJ7A 3M1GA 3RPNA 1K0NA 4MZCA 1J9BA 3MIXA 2PN8A 3MNGA 2A2PA 5D9WA 4TOPA 1K0DA 2LQQA 1GTIA 1OYJA 5JCGA 4Q5RA 1SK1A 2P31A 3AY8A 3D21A 2H19A 3D6IA 4MJEA 3E0UA 4JE1A 1SENA 4MJAA 1AUCA 1SYXA 4OFNA 4GWRA 1SKRB 4WF5A 3EPTA 4IJ3A 3GL3A 2NVLA 2E2MA 5F8BA 2MBTA 3LYPA 1SK0A 3P90A 5GSTA 2QA2A 1T1VA 3EINA 3GTUB 5L71A 1AIUA 2KHPA 2FY6A 5HR0A 2V41A 4O32A 3FZ4A 3VWUA 1GULA 2DIZA 4JEDA 1C72A 3LYKA 2UZ8A 4HU9A 1EP7A 1MDJA 2QGVA 1ZGNA 2MMAA 3GKMA 1YF0A 4TR0A 2G0FA 2TRXA 3EURA 3M9KA 1EV4A 5JWOB 2HRAA 2GSRA 4K7OA 2H1AA 5ECNB 3VWVA 3GFKA 4TR4A 1M99A 4ZB8A 4ISDA 3WGEA 4ACSA 4NV2A 1E6BA 2VCQA 4G2EA 2WS2A 2VCVA 5G1LA 2I3YA 1VGLA 2C3TA 3H8QA 5HFKA 5HR1A 3GYKA 3ZTLA 1OE8A 3M0FA 2DJ3A 2F9SA 3D4TA 3DIEA 2X99A 3P7XA 2HSHA 2AYTA 1K0BA 2C0FA 3CRUA 5HFIA 5KOXA 3F3RA 3N5OA 3F4TA 4TRXA 4YQUA 4EF0A 4KSMA 6GSSA 1Z5YE 2OBIA 1FG4A 3KM6A 5GSSA 4N30A 2DLXA 3H93A 4POBA 1EOGA 4F0BA 3VPQA 4XHMA 4CY6A 4O5UA 3IC8A 1GLQA 1R26A 2DMLA 2JZTA 1X5DA 1HYUA 5J41A 2GQKA 5JCWA 1NHOA 11GSA 4G9HA 1LU4A 3FRCA 3A3TA 2TIRA 1JLVA 3A2XA 1HNAA 1ZYPA 2LJKA 3M8NA 1TI3A 3TKSC 3F4SA 1TRVA 2R2JA 4EDYA 4DSQA 3TJKA 4ZILA 4ID0A 2GSTA 4V1Ap 3DGQA 5KN0A 2C4JA 3FKFA 1XZOA 1ZYQB 1XPVA 5D9TA 1JZRA 2HNLA 4POMA 1JLWA 3EU4A 1RW1A 1F37A 2R0GA 1K0MA 2O89A 4LMVA 2H8LA 4Z2RA 2XPDA 3HJPA 3H79A 3F63A 4O7HA 5KOWA 2F8AA 4LL1B 1IYHA 2IFQA 2H6YA 2JZSA 1TXXA 4KF9A 1EEMA 3I43A 3EWLA 3IPZA 3KTBA 2ZNMA 3FR3A 4DVCA 3TOTA 3S9FA 1XBSA 4ICYA 2H1GA 1TDIA 2X8CA 3KEBA 4O5RA 1XW6A 4ZL8A 2R3XA 2HRKA 3LQ7A 3DD3A 1GTAA 2H1BA 4TN8A 5EL8A 3HVVA 4PURA 5AISA 4I97A 2DJ2A 2O7KA 1ERTA 4KB3A 3QAGA 3TKSE 2IMKA 5CP1A 4ZBDA 4BVXB 4E8HA 4I2UA 1F2EA 2CA8A 4MMMA 4MF5A 5F0GA 1S3AA 4ECCA 5EY6A 1XFLA 3Q19A 5D9XA 1N8JA 1AW9A 3RDWA 1UA5A 3I69A 6GSUA 1T4YA 4TR1A 2L4CA 3EMPA 1ML6A 3QD9A 3A2VA 1SD9A 4HOJA 4KAEA 3FR9A 5BMUA 5DJLA 1B9XC 4KDXA 3MDKA 4K9ZA 2D2ZA 2O87A 2R5GA 3TKSA 3FMWA 4KCEA 4WETA 5ECHB 3LORA 2JSYA 2CAIA 4OFMA 2Z9SA 2V2GA 4Z7XA 1I5GA 5ID2A 4JRRA 5IPGA 2IMEA 3C1RA 3E3EA 4ZL7A 1PRXA 4JR4A 2LKUA 1GSEA 3Q6OA 4V2LA 1AXDA 3UMAA 5IMVA 1GUMA 4MK3A 3WGDA 4K2DA 5IMZA 2B6MA 3APQA 4E8EA 4O5QA 2KP2A 2A4VA 4KA0A 4F03A 1AQWA 1YF1A 4TKYA 4MPGA 3BBYA 4G10A 3IC4A 3IAM2 4POKA 4IP1A 1R4WA 1X9WB 1VRSD 4EVMA 2YV9A 1YQ1A 5C00A 4KW6A 3UBLA 4TXOA 3IHGA 2VUPA 3UIWA 3LW9A 2XHFA 1V58A 2OKAA 1F3AA 1VF4A 1K0OA 2OADA 3GKKA 3HHVA 5FHIA 1EZKA 2C0GA 2KLXA 4J57E 4OFTA 1DE1A 4OD7A 6GSXA 1GUHA 1ZMAA 1ZYNA 5IO0A 3ZITA 1M2AA 1XWAA 2BTOT 1K3YA 5ECSA 3L0HA 2YV7A 1FB6A 5G30A 2IN3A 2FWGA 1Z6NA 3HXSA 2XPEA 4TVEA 2REMA 3D22A 1RK4A 4GSTA 3TRXA 4FYCA 4MH2A 4XTSA 4JU5A 3M3MA 3J7Yk 1T7PB 2K8SA 5CREA 4BWQA 2LSTA 3KMNA 2GQMA 4NHZA 1MTCA 1BJXA 16GSA 3WD6A 4EXJA 3J7Yb 4ZIJA 2DJ1A 5DVBA 5DCGA 1F6MC 4WR5A 1PN0A 5CRWA 5HR3A 4KGIA 3CRTA 2DC5A 3NZNA 4IKHA 4K0GA 3PPUA 1Z9HA 4H86A 2OACA 1K3OA 1KTEA 4K5RA 2QC7A 3PR8A 2XC2A 1GH2A 1V2AA 2VL2C 1XVQA 1ZCPA 3HA9A 4I2TA 2VCZA 3HYPA 2LTKA 1B48A 2N5FA 1M9AA 5CRGA 3GTUA 3ERFA 1XOBA 4POLA 2G2QA 1GUKA 1G0TA 4GRFA 1URMA 2HLSA 3UOMA 3FEUA 2RIIA 5ABRA 2C0DA 4X1UA 1V40A 3KXOA 2N5BA 3HD5A 4PNFA 4IQ1A 4BPYA 2KP1A 5JWQB 3F6FA 4EC0A 3GSTA 1A2LA 1LJRA 2YCDA 3D4MA 4NXIA 5LCZA 1FHEA 4OMVA 2OJLA 1OVNA 1X0RA 1ST9A 5IPHA 3QAVA 4N11A 1FVJA 4MJCA 3RBTA 2K8VA 2V6KA 4ZL9A 1TK5B 1BQ7A 3TB2A 4AF2A 2DBCA 6GSYA 4K1FA 2E2GA 1A2JA 4RQRA 1M2BA 2I9HA 3FHKA 1HD2A 1J08A 4KX4A 3ZRDA 1FOHA 2HRNA 1PSQA 2VLVA 1WIKA 3C71A 5EVOA 3GL5A 2PVQA 1GSDA 4XRAA 3GIXA 5HFGA 1Y6EA 14GSA 4IN0A 3TRQA 3R2QA 3GX0A 2MZCA 1PN9A 4GQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VIM A;  2EIQ A;  3ME7 A;  5EPF A;  1TKD B;  3DYR A;  4L8E A;  2OE1 A;  3IBH A;  4KND A;  1SK2 A;  3UBK A;  1HNC A;  3I6A A;  2ALB A;  2KUC A;  1J0F A;  2TRC P;  2FGX A;  2YWN A;  5IMD A;  1TK0 B;  1Q98 A;  1YJ6 A;  1BED A;  1O7U A;  1GWC A;  1THX A;  2BMX A;  8GSS A;  4OWY A;  2NBS A;  4YAV A;  2LRC A;  1GSQ A;  2WGR A;  3F0I A;  2AV4 A;  3IA1 A;  6GSW A;  2LV3 A;  12GS A;  3MAK A;  5H5Q A;  2IJY A;  3DRN A;  2CX4 A;  2ON7 A;  1HQO A;  2H76 A;  3CBU A;  4L5L A;  2QSI A;  1V98 A;  4MPF A;  4NWY A;  5G31 A;  4ZBA A;  1GRX A;  5B6N A;  3EC3 A;  4HUA A;  1SU9 A;  1R7H A;  4ZB6 A;  3C1S A;  2ZUP A;  3HVX A;  1A24 A;  1HNB A;  1GTB A;  2DJJ A;  1G6Y A;  3FR6 A;  2X64 A;  5E59 A;  2AHE A;  2I1U A;  1G7E A;  1TP9 A;  2MMZ A;  2L57 A;  4Q5N A;  1PL2 A;  2PWJ A;  1XIY A;  4WBJ A;  4MLY A;  5FWG A;  3A5W A;  4RQX A;  3IE3 A;  3NIV A;  2R4V A;  5CYY A;  1PA3 A;  2HXK A;  3TJB A;  2MBS A;  2WCI A;  5B8B A;  1M0U A;  1TTZ A;  2FLS A;  3RPP A;  1B8X A;  4KSO A;  3KIJ A;  1I9D A;  4MP4 A;  3IDV A;  5A4U A;  5D8I A;  3APS A;  1QFN A;  4K6X A;  3VPT A;  3EYT A;  3WYW A;  2JAC A;  2VLT A;  3ZML A;  3L78 A;  4BVX A;  3IXR A;  2J23 A;  5J3R A;  3TCO A;  2GTU A;  4F82 A;  1XWK A;  1TJD A;  2B1K A;  3UAP A;  4I8B A;  5IOW A;  3BCI A;  5ECP B;  2OE0 A;  3ZVJ D;  4DEJ A;  2JU5 A;  1ERV A;  2H0I A;  4F2I A;  3KH7 A;  3VWW A;  2YWI A;  2GSS A;  4CW9 A;  3TJF A;  13GS A;  3F9U A;  3KMO A;  5HR2 A;  1X9M B;  1OKD A;  4X43 A;  1EGO A;  3MWH A;  4ECI A;  1ZYE A;  3L9U A;  4HU7 A;  1XVW A;  2H70 A;  5JWR B;  2GGT A;  4I6X A;  2E0Q A;  2L6D A;  3Q74 A;  1PGT A;  3O6T A;  4PQ1 A;  1A0R P;  3KJY A;  1B9Y C;  3TKP A;  4KDY A;  4OCF A;  2YP6 A;  2VCT A;  5ENU A;  3HVS A;  4IJI A;  3GUS A;  4PNG A;  3IOS A;  1H4O A;  2F8F A;  2MMO A;  17GS A;  3HKR A;  1EEJ A;  4MZB A;  5ELG A;  5ECK B;  2XBQ A;  4LL4 B;  3M9J A;  3K8N A;  3L9S A;  2EC4 A;  1QK8 A;  5DAL B;  2V32 A;  4ZXG A;  4Q5F A;  5DQY A;  4AJ7 A;  3W6G A;  3GKN A;  1NSW A;  3LJR A;  4K8M A;  1FVK A;  2C3N A;  4RI7 A;  3W8S A;  1GNW A;  4D73 B;  18GS A;  2CZ2 A;  3P2A A;  4MF7 A;  2ZCT A;  5A4V A;  1G7O A;  4WF4 A;  2A2S A;  4AGS A;  5DBQ A;  1GNE A;  1GL8 A;  2NPB A;  4P3Y B;  3D5J A;  4HJ2 A;  3IK7 A;  4GTU A;  2VD0 A;  3IK9 A;  1ERW A;  4XRD A;  5B7C A;  4HS1 A;  2P5Q A;  1MD3 A;  4V1A g;  2GT5 A;  1UVZ A;  4MF6 A;  3CMI A;  4EDZ A;  3Q18 A;  1EGR A;  3UAR A;  2B7J A;  4X0X A;  2PPT A;  1SL2 B;  1SKW B;  4QL9 A;  6GSV A;  1MDI A;  3QOU A;  1RQM A;  2DMM A;  4TW5 A;  5A4W A;  2GDR A;  3LG6 A;  1PQN A;  5A5K A;  1TRS A;  5HQP A;  1QXH A;  2DJK A;  3DVW A;  2R37 A;  2C8U A;  3H4K A;  5CNW A;  5LD0 A;  4GSS A;  2CVD A;  1WP0 A;  3P8W A;  5B8A A;  2H74 A;  3TKQ A;  3H1N A;  5CO3 A;  3WGX A;  1XW5 A;  4NMU A;  2WRT A;  2IWT A;  5D93 A;  2FNO A;  2GZZ A;  1O8W A;  1OC3 A;  1SD8 A;  2MMN A;  4WR4 A;  4DSS B;  2H72 A;  5G5E A;  5J9B A;  2AUV A;  2NDO A;  1YKC A;  2PBJ A;  4HDE A;  1K3L A;  3QCP A;  4K0N A;  4QQ7 A;  3F4R A;  3VI5 A;  4GQC A;  1YKA A;  2YZU A;  2CV4 A;  1JZO A;  2JZR A;  1F3B A;  5D9V A;  5DQS A;  4HQZ A;  3HJO A;  3ZZX A;  5ECR B;  2L5O A;  2CVK A;  2B5Y A;  1EOH A;  1WWJ A;  3ZMK A;  1S3D A;  2YWM A;  1W4V A;  3GH6 A;  4YQM A;  3RAZ A;  2DIY A;  4K7N A;  4PQH A;  2H71 A;  4FIW A;  5G5F A;  1KNG A;  3ISO A;  3G7Y A;  3MSZ A;  4EO3 A;  3VK9 A;  1IYI A;  2AB6 A;  4JR6 A;  4LMW A;  22GS A;  3WT1 A;  3V1W A;  3RHC A;  4XS6 A;  4OO5 A;  1EV9 A;  2FA8 A;  1U3I A;  1GSY A;  2YN1 A;  2H66 A;  3ZIJ A;  3C8E A;  3GUR A;  4NAX A;  3ME8 A;  10GS A;  2HSY A;  4MA9 A;  2IMF A;  3DXB A;  1FW1 A;  4MCU A;  4G19 A;  1Q4J A;  1YDK A;  5H5R A;  2B1L A;  3BCK A;  1CQH A;  3PIN A;  5IO2 A;  1TU8 A;  3F6D A;  2C1Y A;  1T00 A;  3G9B A;  2EIR A;  1A0F A;  2V1M A;  2LNS A;  1QUW A;  3HDC A;  2H0H A;  3KGK A;  4NV5 A;  2LUS A;  1XW9 A;  4PX1 A;  5DCH A;  4FH8 A;  5J9C A;  1CQG A;  2LEG A;  4WBR D;  3CSI A;  4EL1 A;  4ULX A;  2K6V A;  2WDU A;  3O76 A;  2OBK A;  1ABA A;  2LRN A;  2PVO C;  1K0A A;  5DJM A;  1WOU A;  1E2Y A;  1AAZ A;  5GAP D;  1GP1 A;  2HZE B;  3VUR A;  1VF2 A;  3CTF A;  1TOF A;  2EIO A;  4NHW A;  1T3B A;  3E9J B;  3N9J A;  2L6C A;  2HZF A;  3GX8 A;  3TRP A;  2YZH A;  5J5N A;  4IHU A;  2K18 A;  4I5Q A;  4LA1 A;  5IMA A;  4PUF C;  2IIY A;  2CAQ A;  1OC9 B;  5COH A;  1V57 A;  2M72 A;  2LJR A;  3W8J A;  4V2M A;  3FZ9 A;  3APO A;  1YZX A;  4QL7 A;  1PX6 A;  2FA4 A;  4KH7 A;  2GLR A;  1ACV A;  3UVH A;  1XOA A;  4IP6 A;  5JCU A;  4GXZ A;  2R6K A;  4XS4 B;  1EWX A;  5KN3 A;  5CAX A;  1MEK A;  1M2D A;  5LNK e;  1SKS B;  2C3Q A;  1G6W A;  3DEX A;  3IRA A;  2KOK A;  1ZOF A;  1LBK A;  5DDL A;  1Z7R A;  1A8L A;  3LFL A;  3UVT A;  4FYU A;  2FWH A;  3KH9 A;  1GTU A;  3FK8 A;  5IM9 A;  1QGV A;  3KP8 A;  2VL3 A;  3DKS A;  5IMF A;  2F3M A;  1WE0 A;  3FY7 A;  1XCC A;  3FZ5 A;  3IAS 2;  1AQV A;  3LWA A;  2FUG 2;  2B5X A;  1X5C A;  3TGZ A;  1QMV A;  4GCI A;  1THO A;  2JL4 A;  1ILO A;  3IR4 A;  1OE7 A;  2PUK C;  5DAK B;  1JZW A;  4FO5 A;  1ZZY A;  2YAN A;  2CQ9 A;  1SL0 B;  1R5P A;  2A2R A;  4IS0 A;  1MDK A;  1MD4 A;  1NW2 A;  2GZY A;  2VL2 A;  4EUY A;  3DWV A;  6GST A;  5AIX A;  4GLT A;  2JSZ A;  3GKX A;  2HRF A;  3EVI A;  5ECI B;  1GSS A;  4HEA 2;  3GH9 A;  3U6V A;  2X8G A;  2HT9 A;  4ECB A;  1FOV A;  2CVB A;  3QDN A;  1SYR A;  4MJB A;  1NHY A;  2HFD A;  2PGT A;  4HZ2 A;  3ZLP A;  4BA7 A;  4ML6 A;  4F0C A;  1YEP A;  2RM6 A;  2C80 A;  3VWX A;  5GZZ B;  1FAA A;  5H5S A;  3QFA C;  3KZQ A;  2PER A;  3HJM A;  4BWS A;  3TJG A;  2RM5 A;  1H75 A;  1U6T A;  4J56 E;  1DBY A;  3LXZ A;  1BX9 A;  5GAN D;  1Z3E A;  2GT6 A;  1XWB A;  1PKZ A;  3L9V A;  1OKT A;  5ELA A;  1USB A;  2I81 A;  4BVY A;  2PU9 C;  3SWL A;  1Z7P A;  2VAF A;  2L4Q A;  1OAZ A;  5D96 A;  4GSN A;  3C73 A;  1TK8 B;  4IQA A;  2VM2 A;  4ZB9 A;  7GSS A;  2IPA A;  4L5O A;  4HI7 A;  2OE3 A;  1GSU A;  1FO5 A;  2DJ0 A;  1V9W A;  4PXO A;  2MYG A;  3I9V 2;  2YJH A;  2YPM A;  1R5A A;  2VLU A;  5DAL A;  2AAW A;  1BAY A;  2CX3 A;  3KP9 A;  1JFU A;  3LEF A;  2FHE A;  1DE2 A;  1M7T A;  2O8V B;  1DUG A;  2PMT A;  5F07 A;  4D73 A;  2P0G A;  4HQS A;  4OO4 A;  3PH9 A;  4XCS A;  3GA4 A;  3D0Z A;  5B6M A;  4KUN A;  2YOI A;  4OCE A;  2IL3 A;  1Y25 A;  3BJ5 A;  2HE3 A;  1TW9 A;  4L0W A;  1O6J A;  3EMX A;  2YWO A;  4IEL A;  4J2F A;  1TRU A;  4IBP A;  3TDG A;  3QPM A;  4LLR A;  2E7P A;  2BJX A;  2H30 A;  2FWF A;  1XXU A;  2XBI A;  1XWC A;  3HZ4 A;  3F3Q A;  5ECL B;  1SJI A;  20GS A;  2WFC A;  3VLN A;  4RUV A;  3FYG A;  5ECO B;  1UC7 A;  4L0U A;  1U87 A;  3DML A;  4K7I A;  4TR3 A;  1BYE A;  2F51 A;  4Q5Q A;  1EP8 A;  5F06 A;  4N0V A;  3EE2 A;  3TJJ A;  4EKZ A;  5AIV A;  3O3T A;  9GSS A;  3IV4 A;  4PGT A;  3BD2 A;  3A2W A;  4XIH A;  3FZA A;  2VL9 A;  1PL1 A;  3G7J A;  2H6X A;  4KCA A;  4PUA A;  4DSS A;  3US3 A;  2H6Z A;  2VOC A;  5G1K A;  1SJZ A;  2IMD A;  1PKW A;  2O85 A;  4WXT A;  3ERG A;  1B4Q A;  3L4N A;  3TKR A;  4YH2 A;  3U5R E;  4KE3 A;  2LQO A;  3UJ1 A;  4HJM A;  1BG5 A;  2ON5 A;  1TI1 A;  3TUE A;  3C7M A;  1WMJ A;  3ED3 A;  5AGY A;  5E4W A;  1GSF A;  3HCZ A;  3GSS A;  2NTO A;  1PD2 1;  2JAD A;  4YAP A;  1DSB A;  3GV1 A;  4JZQ A;  2LRT A;  3OR5 A;  1S3C A;  4F9Z A;  2M80 A;  3ZYW A;  1A23 A;  3TOU A;  1KBN A;  5IOX A;  3WT2 A;  5J4U A;  3CYN A;  1T8E B;  2WUL A;  1GLP A;  5C04 A;  3KCM A;  4XS1 A;  1X5E A;  3QR6 A;  2QKE A;  5ECQ B;  4GF0 A;  2VD1 A;  2I4A A;  2HI7 A;  2GQL A;  3BOA A;  3KTL A;  3ZFB A;  3LGC A;  3DVX A;  2IFQ B;  1KEB A;  2YNX A;  3ZVJ A;  1YY7 A;  1A8Y A;  1JZD A;  2FD3 A;  5AN1 A;  4N10 A;  1VF3 A;  19GS A;  4RI6 A;  3GHA A;  4IVF A;  2FWE A;  1ZL9 A;  2ES7 A;  1QQ2 A;  2LJA A;  1N2A A;  5CRD A;  3GMF A;  3NOF A;  1B4P A;  2H0G A;  4IGJ A;  3IHQ A;  4ML1 A;  1X9S B;  3HY2 A;  2L5L A;  4NPB A;  3JCM L;  4MZW A;  3CSJ A;  3EU3 A;  2H73 A;  3HZ8 A;  4DSR A;  1O73 A;  1PX7 A;  2V6O A;  3ZL5 A;  1ON4 A;  4V2N A;  4HZ4 A;  1AQX A;  3G7I A;  1O81 A;  4IW9 A;  4MAB A;  3GRX A;  3F8U A;  1W89 A;  1O8X A;  2M46 A;  2LS5 A;  2GSQ A;  5CRH A;  1TRW A;  2CT6 A;  3CTG A;  5INY A;  2HZE A;  3ZFL A;  4O92 A;  4TR1 B;  3UEM A;  3UL3 A;  3FW2 A;  2FCH A;  2WJU A;  2OA7 A;  2DSA A;  2VM1 A;  5G2Z A;  1WPI A;  4PQI A;  1OC9 A;  5IQY A;  4MDC A;  2L59 A;  4ZBB A;  1JHB A;  2LNT A;  5ID2 B;  2P5R A;  1VF1 A;  3CXG A;  1XWG A;  2K9F A;  3CSH A;  5KN1 A;  1Z6M A;  3GN3 A;  5F05 A;  3GNJ A;  2AJQ B;  4XS4 A;  1T4Z A;  4JBB A;  2GZP A;  2B5E A;  4WEY A;  4N0Z A;  2VO4 A;  4BL7 A;  2B7K A;  1WJK A;  1UN2 A;  1TU7 A;  3QMX A;  1OC8 A;  1SJ6 A;  5KN2 A;  5IIZ A;  5IMC A;  2C0E A;  4KDU A;  4TXO B;  2VCW A;  4WKW A;  4YQV A;  1U88 A;  5ECM B;  1WRY A;  3QAW A;  1F9M A;  1M9B A;  4FYB A;  3KD0 A;  3RHB A;  2B3S A;  1AC1 A;  5FT3 A;  5DAK A;  1NM3 A;  2IMI A;  4CDO A;  3VFI A;  2WB9 A;  3PGT A;  2RLI A;  2GVP A;  3LSZ A;  3LXT A;  5KEJ A;  4ECJ A;  3ERW A;  3SBC A;  4ILF A;  1A2M A;  3VI7 A;  4AJ8 A;  1ERU A;  3QFB C;  2CZ3 A;  2GS3 A;  4EE0 A;  2H75 A;  1FB0 A;  3ZRE A;  1U3A A;  1PMT A;  2VCX A;  2J9H A;  4TXV A;  5D73 A;  2H01 A;  2X8H A;  2RUF A;  4CHS A;  2N5A A;  2RUE A;  2HYX A;  1YEX A;  1O85 A;  4AJ6 A;  4MH3 A;  2WZ9 A;  3ZIV A;  1SL1 B;  1K0C A;  2H1D A;  2YJ7 A;  3M1G A;  3RPN A;  1K0N A;  4MZC A;  1J9B A;  2PN8 A;  3MNG A;  5D9W A;  4TOP A;  1K0D A;  2LQQ A;  1GTI A;  1OYJ A;  5JCG A;  4Q5R A;  1SK1 A;  2P31 A;  3AY8 A;  3D21 A;  2H19 A;  3D6I A;  4MJE A;  3E0U A;  4JE1 A;  1SEN A;  4MJA A;  1AUC A;  1SYX A;  4OFN A;  4GWR A;  1SKR B;  4WF5 A;  4IJ3 A;  3GL3 A;  2NVL A;  2E2M A;  5F8B A;  2MBT A;  3LYP A;  1SK0 A;  3P90 A;  5GST A;  1T1V A;  3EIN A;  3GTU B;  5L71 A;  1AIU A;  2KHP A;  2FY6 A;  5HR0 A;  2V41 A;  4O32 A;  3FZ4 A;  3VWU A;  1GUL A;  2DIZ A;  4JED A;  1C72 A;  3LYK A;  4HU9 A;  1EP7 A;  1MDJ A;  2QGV A;  1ZGN A;  2MMA A;  3GKM A;  1YF0 A;  4TR0 A;  2G0F A;  2TRX A;  3EUR A;  3M9K A;  1EV4 A;  5JWO B;  2GSR A;  4K7O A;  2H1A A;  5ECN B;  3VWV A;  3GFK A;  4TR4 A;  1M99 A;  4ZB8 A;  4ISD A;  3WGE A;  4ACS A;  4NV2 A;  1E6B A;  2VCQ A;  4G2E A;  2WS2 A;  2VCV A;  5G1L A;  2I3Y A;  1VGL A;  2C3T A;  3H8Q A;  5HFK A;  5HR1 A;  3GYK A;  3ZTL A;  1OE8 A;  3M0F A;  2DJ3 A;  2F9S A;  3D4T A;  3DIE A;  2X99 A;  3P7X A;  2HSH A;  2AYT A;  1K0B A;  2C0F A;  3CRU A;  5HFI A;  3F3R A;  3N5O A;  3F4T A;  4TRX A;  4YQU A;  4EF0 A;  4KSM A;  6GSS A;  1Z5Y E;  2OBI A;  1FG4 A;  3KM6 A;  5GSS A;  4N30 A;  2DLX A;  3H93 A;  4POB A;  1EOG A;  4F0B A;  3VPQ A;  4XHM A;  1GLQ A;  1R26 A;  2DML A;  2JZT A;  1X5D A;  1HYU A;  5J41 A;  2GQK A;  5JCW A;  1NHO A;  11GS A;  4G9H A;  1LU4 A;  3FRC A;  3A3T A;  2TIR A;  1JLV A;  3A2X A;  1HNA A;  2LJK A;  3M8N A;  1TI3 A;  3TKS C;  3F4S A;  1TRV A;  2R2J A;  4EDY A;  4DSQ A;  3TJK A;  4ZIL A;  4ID0 A;  2GST A;  4V1A p;  3DGQ A;  5KN0 A;  2C4J A;  3FKF A;  1XZO A;  1ZYQ B;  1XPV A;  5D9T A;  1JZR A;  2HNL A;  4POM A;  1JLW A;  3EU4 A;  1RW1 A;  1F37 A;  1K0M A;  2O89 A;  4LMV A;  2H8L A;  2XPD A;  3HJP A;  3H79 A;  3F63 A;  4O7H A;  2F8A A;  4LL1 B;  1IYH A;  2IFQ A;  2H6Y A;  2JZS A;  1TXX A;  1EEM A;  3I43 A;  3EWL A;  3IPZ A;  3KTB A;  2ZNM A;  3FR3 A;  4DVC A;  3TOT A;  3S9F A;  1XBS A;  2H1G A;  1TDI A;  2X8C A;  3KEB A;  4O5R A;  1XW6 A;  4ZL8 A;  2R3X A;  3LQ7 A;  3DD3 A;  1GTA A;  2H1B A;  4TN8 A;  5EL8 A;  3HVV A;  4PUR A;  5AIS A;  4I97 A;  2DJ2 A;  2O7K A;  1ERT A;  4KB3 A;  3QAG A;  3TKS E;  2IMK A;  5CP1 A;  4ZBD A;  4E8H A;  4I2U A;  1F2E A;  2CA8 A;  4MMM A;  4MF5 A;  5F0G A;  1S3A A;  4ECC A;  5EY6 A;  1XFL A;  3Q19 A;  5D9X A;  1N8J A;  1AW9 A;  3RDW A;  1UA5 A;  3I69 A;  6GSU A;  1T4Y A;  4TR1 A;  2L4C A;  3EMP A;  1ML6 A;  3QD9 A;  3A2V A;  1SD9 A;  4HOJ A;  4KAE A;  3FR9 A;  5DJL A;  1B9X C;  4KDX A;  3MDK A;  4K9Z A;  2D2Z A;  2O87 A;  2R5G A;  3TKS A;  4WET A;  4KCE A;  5ECH B;  3LOR A;  2JSY A;  2CAI A;  4OFM A;  2Z9S A;  2V2G A;  4Z7X A;  1I5G A;  5ID2 A;  4JRR A;  5IPG A;  2IME A;  3C1R A;  3E3E A;  4ZL7 A;  1PRX A;  4JR4 A;  2LKU A;  1GSE A;  3Q6O A;  4V2L A;  1AXD A;  3UMA A;  5IMV A;  1GUM A;  4MK3 A;  3WGD A;  4K2D A;  5IMZ A;  2B6M A;  3APQ A;  4E8E A;  2KP2 A;  2A4V A;  4KA0 A;  4F03 A;  1AQW A;  1YF1 A;  4TKY A;  4MPG A;  3BBY A;  4G10 A;  3IC4 A;  3IAM 2;  4POK A;  4IP1 A;  1R4W A;  1X9W B;  1VRS D;  4EVM A;  2YV9 A;  1YQ1 A;  5C00 A;  4KW6 A;  3UBL A;  4TXO A;  2VUP A;  3UIW A;  2XHF A;  1V58 A;  2OKA A;  1F3A A;  1VF4 A;  1K0O A;  2OAD A;  3GKK A;  3HHV A;  5FHI A;  1EZK A;  2C0G A;  2KLX A;  4J57 E;  4OFT A;  1DE1 A;  4OD7 A;  6GSX A;  1GUH A;  1ZMA A;  5IO0 A;  3ZIT A;  1M2A A;  1XWA A;  2BTO T;  1K3Y A;  5ECS A;  3L0H A;  2YV7 A;  1FB6 A;  5G30 A;  2IN3 A;  2FWG A;  1Z6N A;  3HXS A;  2XPE A;  4TVE A;  2REM A;  3D22 A;  1RK4 A;  4GST A;  3TRX A;  4FYC A;  4MH2 A;  4XTS A;  4JU5 A;  3M3M A;  3J7Y k;  1T7P B;  2K8S A;  5CRE A;  4BWQ A;  2LST A;  3KMN A;  2GQM A;  4NHZ A;  1MTC A;  1BJX A;  16GS A;  3WD6 A;  4EXJ A;  3J7Y b;  4ZIJ A;  2DJ1 A;  5DVB A;  5DCG A;  1F6M C;  4WR5 A;  5CRW A;  5HR3 A;  4KGI A;  3CRT A;  2DC5 A;  3NZN A;  4IKH A;  4K0G A;  1Z9H A;  4H86 A;  2OAC A;  1K3O A;  1KTE A;  2QC7 A;  3PR8 A;  2XC2 A;  1GH2 A;  1V2A A;  2VL2 C;  1XVQ A;  1ZCP A;  3HA9 A;  4I2T A;  2VCZ A;  3HYP A;  2LTK A;  1B48 A;  2N5F A;  1M9A A;  5CRG A;  3GTU A;  3ERF A;  1XOB A;  4POL A;  2G2Q A;  1GUK A;  1G0T A;  4GRF A;  1URM A;  2HLS A;  3UOM A;  3FEU A;  2RII A;  5ABR A;  2C0D A;  4X1U A;  1V40 A;  3KXO A;  2N5B A;  3HD5 A;  4PNF A;  4IQ1 A;  4BPY A;  2KP1 A;  5JWQ B;  3F6F A;  4EC0 A;  3GST A;  1A2L A;  1LJR A;  2YCD A;  3D4M A;  4NXI A;  5LCZ A;  1FHE A;  4OMV A;  2OJL A;  1OVN A;  1X0R A;  1ST9 A;  5IPH A;  3QAV A;  4N11 A;  1FVJ A;  4MJC A;  3RBT A;  2K8V A;  2V6K A;  4ZL9 A;  1TK5 B;  1BQ7 A;  3TB2 A;  4AF2 A;  2DBC A;  6GSY A;  4K1F A;  2E2G A;  1A2J A;  4RQR A;  1M2B A;  2I9H A;  3FHK A;  1HD2 A;  1J08 A;  4KX4 A;  3ZRD A;  2HRN A;  1PSQ A;  2VLV A;  1WIK A;  3C71 A;  5EVO A;  3GL5 A;  2PVQ A;  1GSD A;  4XRA A;  3GIX A;  5HFG A;  1Y6E A;  14GS A;  4IN0 A;  3TRQ A;  3R2Q A;  3GX0 A;  2MZC A;  1PN9 A;  4GQF A; 
#chains in the Genus database with same CATH topology
 2VIM A;  2EIQ A;  3ME7 A;  5EPF A;  1TKD B;  3DYR A;  4L8E A;  2OE1 A;  3IBH A;  4KND A;  1SK2 A;  3UBK A;  2DKI A;  1HNC A;  3I6A A;  2ALB A;  2KUC A;  1J0F A;  2TRC P;  2FGX A;  2YWN A;  5IMD A;  1TK0 B;  1Q98 A;  1YJ6 A;  1BED A;  1O7U A;  1GWC A;  1THX A;  2BMX A;  8GSS A;  4OWY A;  2NBS A;  4YAV A;  2LRC A;  1GSQ A;  2WGR A;  3F0I A;  2AV4 A;  3IA1 A;  6GSW A;  2LV3 A;  12GS A;  3MAK A;  5H5Q A;  2IJY A;  3DRN A;  2CX4 A;  2ON7 A;  1HQO A;  2H76 A;  3CBU A;  4L5L A;  2QSI A;  1V98 A;  3A5I A;  4MPF A;  4NWY A;  5G31 A;  4ZBA A;  1GRX A;  5B6N A;  3EC3 A;  4HUA A;  1SU9 A;  1R7H A;  4ZB6 A;  3C1S A;  4Z2T A;  2ZUP A;  3HVX A;  1A24 A;  1HNB A;  1GTB A;  2DJJ A;  1G6Y A;  3FR6 A;  2X64 A;  5E59 A;  2AHE A;  2I1U A;  1G7E A;  1TP9 A;  2MMZ A;  2L57 A;  4Q5N A;  1PL2 A;  2PWJ A;  1XIY A;  4WBJ A;  4MLY A;  5FWG A;  3A5W A;  4RQX A;  3IE3 A;  3NIV A;  2R4V A;  5CYY A;  1PA3 A;  2HXK A;  3TJB A;  2MBS A;  2WCI A;  5B8B A;  1M0U A;  1TTZ A;  2FLS A;  3RPP A;  1B8X A;  4KSO A;  3KIJ A;  1I9D A;  4MP4 A;  3IDV A;  5A4U A;  5D8I A;  3APS A;  1QFN A;  4K6X A;  3VPT A;  3EYT A;  3WYW A;  2JAC A;  2VLT A;  3ZML A;  3L78 A;  4BVX A;  3IXR A;  2J23 A;  5J3R A;  3TCO A;  2GTU A;  4F82 A;  1XWK A;  1TJD A;  2B1K A;  3UAP A;  4I8B A;  5IOW A;  3BCI A;  5ECP B;  2OE0 A;  3ZVJ D;  4DEJ A;  2JU5 A;  1ERV A;  2H0I A;  4F2I A;  3KH7 A;  3VWW A;  4YKF A;  2YWI A;  2GSS A;  4CW9 A;  3TJF A;  13GS A;  3F9U A;  3KMO A;  5HR2 A;  1X9M B;  1OKD A;  4X43 A;  1EGO A;  3MWH A;  4ECI A;  1ZYE A;  3L9U A;  4HU7 A;  1XVW A;  2H70 A;  5JWR B;  2GGT A;  4I6X A;  2E0Q A;  2L6D A;  3Q74 A;  1PGT A;  3O6T A;  4PQ1 A;  1A0R P;  3KJY A;  1B9Y C;  4BVY B;  3TKP A;  4KDY A;  4OCF A;  2YP6 A;  2VCT A;  3HVN A;  3HVS A;  5ENU A;  4IJI A;  4BIK A;  3GUS A;  4PNG A;  3IOS A;  1H4O A;  2F8F A;  2MMO A;  17GS A;  3HKR A;  1EEJ A;  4MZB A;  5ELG A;  5ECK B;  2XBQ A;  2R0P A;  4LL4 B;  3M9J A;  3K8N A;  3L9S A;  2EC4 A;  1QK8 A;  5DAL B;  2V32 A;  4ZXG A;  4Q5F A;  5DQY A;  4AJ7 A;  3W6G A;  3GKN A;  1NSW A;  3LJR A;  4K8M A;  1FVK A;  2C3N A;  4RI7 A;  3W8S A;  1GNW A;  4D73 B;  18GS A;  3R3E A;  2CZ2 A;  3P2A A;  4MF7 A;  2ZCT A;  5A4V A;  1G7O A;  4WF4 A;  2A2S A;  4AGS A;  5DBQ A;  1GNE A;  1GL8 A;  2NPB A;  4P3Y B;  3D5J A;  4HJ2 A;  3IK7 A;  4GTU A;  2VD0 A;  1XG8 A;  3IK9 A;  1ERW A;  4XRD A;  5B7C A;  4HS1 A;  2P5Q A;  1MD3 A;  4V1A g;  2GT5 A;  1UVZ A;  4MF6 A;  3CMI A;  4EDZ A;  3Q18 A;  1EGR A;  3UAR A;  4USS A;  2B7J A;  4X0X A;  2PPT A;  1SL2 B;  4HSC X;  1SKW B;  4QL9 A;  6GSV A;  1MDI A;  3QOU A;  1RQM A;  2DMM A;  4TW5 A;  5A4W A;  2GDR A;  3LG6 A;  1PQN A;  1M3J A;  5A5K A;  1TRS A;  5HQP A;  1QXH A;  2DJK A;  3DVW A;  2R37 A;  2C8U A;  3H4K A;  5CNW A;  5LD0 A;  4GSS A;  2CVD A;  1WP0 A;  3P8W A;  5B8A A;  2H74 A;  3TKQ A;  3H1N A;  5CO3 A;  3WGX A;  1XW5 A;  4NMU A;  2WRT A;  2IWT A;  5D93 A;  2FNO A;  1M3I A;  4EIQ A;  2GZZ A;  1O8W A;  1OC3 A;  1SD8 A;  2X49 A;  2MMN A;  4WR4 A;  4DSS B;  2H72 A;  5G5E A;  5J9B A;  2AUV A;  2NDO A;  1YKC A;  2PBJ A;  4HDE A;  1K3L A;  3QCP A;  4K0N A;  4QQ7 A;  3F4R A;  3VI5 A;  4GQC A;  1YKA A;  2YZU A;  2CV4 A;  1JZO A;  2JZR A;  1F3B A;  5D9V A;  5DQS A;  4HQZ A;  3HJO A;  3ZZX A;  5ECR B;  2L5O A;  2CVK A;  2B5Y A;  1EOH A;  1WWJ A;  3ZMK A;  1S3D A;  2YWM A;  1W4V A;  3GH6 A;  4CY8 A;  4YQM A;  3RAZ A;  2DIY A;  4K7N A;  4PQH A;  2H71 A;  4FIW A;  5G5F A;  1KNG A;  3ISO A;  3G7Y A;  3MSZ A;  4EO3 A;  3VK9 A;  1IYI A;  2AB6 A;  4JR6 A;  4LMW A;  22GS A;  3WT1 A;  3V1W A;  3RHC A;  4XS6 A;  4OO5 A;  1EV9 A;  2FA8 A;  1U3I A;  1GSY A;  2YN1 A;  2H66 A;  3ZIJ A;  3C8E A;  3GUR A;  4NAX A;  3ME8 A;  10GS A;  2HSY A;  4MA9 A;  2IMF A;  3DXB A;  1FW1 A;  4MCU A;  4G19 A;  1Q4J A;  1YDK A;  5H5R A;  2B1L A;  3BCK A;  1CQH A;  3PIN A;  5IO2 A;  1TU8 A;  3F6D A;  2C1Y A;  1T00 A;  3G9B A;  2EIR A;  1A0F A;  2V1M A;  2LNS A;  1QUW A;  3HDC A;  2H0H A;  3KGK A;  4NV5 A;  2LUS A;  1XW9 A;  4PX1 A;  5DCH A;  4FH8 A;  5J9C A;  1CQG A;  4X4J A;  2LEG A;  4WBR D;  3CSI A;  4EL1 A;  4ULX A;  2K6V A;  2WDU A;  3O76 A;  2OBK A;  1ABA A;  2LRN A;  2PVO C;  1K0A A;  5DJM A;  1WOU A;  1E2Y A;  1AAZ A;  5GAP D;  1GP1 A;  2HZE B;  3VUR A;  1VF2 A;  3CTF A;  1TOF A;  2EIO A;  4NHW A;  1T3B A;  3E9J B;  3N9J A;  2L6C A;  2HZF A;  3GX8 A;  3TRP A;  2YZH A;  5J5N A;  4IHU A;  2K18 A;  4I5Q A;  4LA1 A;  5IMA A;  4PUF C;  2IIY A;  2CAQ A;  1OC9 B;  5COH A;  1V57 A;  2M72 A;  2LJR A;  3W8J A;  4V2M A;  3FZ9 A;  3APO A;  1YZX A;  4QL7 A;  1PX6 A;  2FA4 A;  4G0K A;  4KH7 A;  2GLR A;  1ACV A;  3UVH A;  1XOA A;  4IP6 A;  5JCU A;  4EIP A;  4GXZ A;  2R6K A;  4XS4 B;  1EWX A;  5KN3 A;  5CAX A;  1MEK A;  1M2D A;  5LNK e;  1SKS B;  2C3Q A;  1G6W A;  3DEX A;  3IRA A;  2KOK A;  1ZOF A;  1LBK A;  5DDL A;  1Z7R A;  1A8L A;  3LFL A;  3UVT A;  4BL7 B;  4FYU A;  2FWH A;  3KH9 A;  1GTU A;  3FK8 A;  4FQU A;  5IM9 A;  1QGV A;  3KP8 A;  2VL3 A;  3DKS A;  5IMF A;  2F3M A;  1WE0 A;  3FY7 A;  1XCC A;  3FZ5 A;  3IAS 2;  1AQV A;  3LWA A;  2FUG 2;  2B5X A;  1X5C A;  3TGZ A;  1QMV A;  4GCI A;  1THO A;  2JL4 A;  1ILO A;  4G0I A;  3IR4 A;  1OE7 A;  2PUK C;  5DAK B;  1JZW A;  4FO5 A;  1ZZY A;  2YAN A;  2CQ9 A;  1SL0 B;  1R5P A;  2A2R A;  4IS0 A;  1MDK A;  1MD4 A;  1NW2 A;  2GZY A;  2VL2 A;  4EUY A;  3DWV A;  6GST A;  5AIX A;  4GLT A;  2JSZ A;  1S3R A;  2HRF A;  3EVI A;  3GKX A;  5ECI B;  1GSS A;  4HEA 2;  3GH9 A;  3U6V A;  2X8G A;  2HT9 A;  4ECB A;  1FOV A;  2CVB A;  3QDN A;  1SYR A;  4MJB A;  1NHY A;  2HFD A;  2PGT A;  4HZ2 A;  3ZLP A;  4BA7 A;  4ML6 A;  4F0C A;  1YEP A;  2RM6 A;  2C80 A;  3VWX A;  5GZZ B;  1FAA A;  5H5S A;  3QFA C;  3KZQ A;  2PER A;  3HJM A;  4BWS A;  3TJG A;  2RM5 A;  1H75 A;  1U6T A;  4J56 E;  1DBY A;  3LXZ A;  1BX9 A;  5GAN D;  1Z3E A;  2GT6 A;  1XWB A;  1PKZ A;  3L9V A;  1OKT A;  5ELA A;  1USB A;  2I81 A;  4BVY A;  2PU9 C;  3SWL A;  1Z7P A;  2VAF A;  2L4Q A;  1OAZ A;  5D96 A;  4GSN A;  3C73 A;  1TK8 B;  4IQA A;  2VM2 A;  4ZB9 A;  7GSS A;  2IPA A;  4L5O A;  4HI7 A;  2OE3 A;  1GSU A;  1FO5 A;  2DJ0 A;  1V9W A;  4PXO A;  2MYG A;  3I9V 2;  2YJH A;  2YPM A;  1R5A A;  2VLU A;  5DAL A;  2AAW A;  1BAY A;  2CX3 A;  3KP9 A;  1JFU A;  3LEF A;  2FHE A;  1DE2 A;  1M7T A;  2O8V B;  1DUG A;  2PMT A;  5F07 A;  4D73 A;  2P0G A;  4HQS A;  4OO4 A;  3PH9 A;  4XCS A;  3GA4 A;  4Z2U A;  3D0Z A;  5BRT A;  5B6M A;  4KUN A;  2YOI A;  4OCE A;  2IL3 A;  1Y25 A;  3BJ5 A;  2HE3 A;  1TW9 A;  4K5S A;  4L0W A;  1O6J A;  3EMX A;  2YWO A;  4IEL A;  4J2F A;  1TRU A;  4IBP A;  3TDG A;  3QPM A;  4LLR A;  2E7P A;  2BJX A;  2H30 A;  2FWF A;  1XXU A;  2XBI A;  1XWC A;  3HZ4 A;  3F3Q A;  5ECL B;  1SJI A;  20GS A;  2WFC A;  3VLN A;  4RUV A;  3FYG A;  5ECO B;  1UC7 A;  2QA1 A;  4L0U A;  1U87 A;  3DML A;  4K7I A;  4TR3 A;  1BYE A;  2F51 A;  4Q5Q A;  1EP8 A;  5F06 A;  4N0V A;  3EE2 A;  3TJJ A;  4EKZ A;  2R0C A;  5AIV A;  3O3T A;  9GSS A;  3IV4 A;  4PGT A;  3BD2 A;  3A2W A;  4XIH A;  3FZA A;  2VL9 A;  1PL1 A;  3G7J A;  2H6X A;  4KCA A;  4PUA A;  4DSS A;  3US3 A;  2H6Z A;  2VOC A;  5G1K A;  1SJZ A;  2IMD A;  1PKW A;  2O85 A;  4WXT A;  3ERG A;  1B4Q A;  3L4N A;  3TKR A;  4YH2 A;  3U5R E;  4KE3 A;  2LQO A;  3UJ1 A;  4HJM A;  1BG5 A;  2ON5 A;  1TI1 A;  3TUE A;  3C7M A;  1WMJ A;  3ED3 A;  5AGY A;  5E4W A;  1GSF A;  3HCZ A;  3GSS A;  2NTO A;  1PD2 1;  2JAD A;  4YAP A;  1DSB A;  3GV1 A;  4MNN A;  4JZQ A;  2LRT A;  3OR5 A;  1S3C A;  4F9Z A;  2M80 A;  3ZYW A;  4PTS A;  1A23 A;  3TOU A;  1KBN A;  5IOX A;  3WT2 A;  5J4U A;  3CYN A;  1T8E B;  2WUL A;  1GLP A;  5C04 A;  3KCM A;  4XS1 A;  1X5E A;  3QR6 A;  2QKE A;  5ECQ B;  4GF0 A;  2VD1 A;  2I4A A;  2HI7 A;  2GQL A;  2A4H A;  3BOA A;  3KTL A;  3ZFB A;  3LGC A;  3DVX A;  2IFQ B;  1KEB A;  2YNX A;  3ZVJ A;  1YY7 A;  1A8Y A;  1JZD A;  2FD3 A;  4G0L A;  5AN1 A;  4N10 A;  1VF3 A;  19GS A;  4RI6 A;  3GHA A;  4IVF A;  2FWE A;  1ZL9 A;  2ES7 A;  1QQ2 A;  2LJA A;  1N2A A;  5CRD A;  3GMF A;  3NOF A;  1B4P A;  2H0G A;  4IGJ A;  3IHQ A;  4ML1 A;  1X9S B;  3HY2 A;  2L5L A;  4NPB A;  3JCM L;  4MZW A;  3CSJ A;  3EU3 A;  2H73 A;  3HZ8 A;  4DSR A;  1O73 A;  1PX7 A;  2V6O A;  2HSM A;  3ZL5 A;  1ON4 A;  4V2N A;  4HZ4 A;  1AQX A;  3G7I A;  1O81 A;  4IW9 A;  4MAB A;  3GRX A;  3F8U A;  4A5P A;  1W89 A;  1O8X A;  2X4A A;  2M46 A;  2LS5 A;  2GSQ A;  5CRH A;  1TRW A;  2CT6 A;  3CTG A;  5INY A;  2HZE A;  3ZFL A;  4O92 A;  4TR1 B;  3UEM A;  3UL3 A;  3FW2 A;  2FCH A;  2WJU A;  2OA7 A;  2DSA A;  2VM1 A;  5G2Z A;  1WPI A;  4PQI A;  1OC9 A;  5IQY A;  4MDC A;  2L59 A;  4ZBB A;  1JHB A;  2LNT A;  5ID2 B;  2P5R A;  1VF1 A;  3MYD A;  3CXG A;  1XWG A;  4YKG A;  2K9F A;  3CSH A;  5KN1 A;  1Z6M A;  3GN3 A;  5F05 A;  3GNJ A;  2AJQ B;  4XS4 A;  1T4Z A;  4JBB A;  2GZP A;  2B5E A;  4WEY A;  4N0Z A;  2VO4 A;  4BL7 A;  2B7K A;  1WJK A;  1UN2 A;  1TU7 A;  3QMX A;  1OC8 A;  1SJ6 A;  5KN2 A;  5IIZ A;  5IMC A;  2C0E A;  4KDU A;  4TXO B;  2VCW A;  4WKW A;  4YQV A;  1U88 A;  4K2X A;  5ECM B;  1WRY A;  3QAW A;  1F9M A;  1M9B A;  4FYB A;  3KD0 A;  3RHB A;  2B3S A;  1AC1 A;  5FT3 A;  5DAK A;  1NM3 A;  2IMI A;  4CDO A;  3VFI A;  2WB9 A;  3PGT A;  2RLI A;  2GVP A;  3LSZ A;  3LXT A;  5KEJ A;  4ECJ A;  3ERW A;  3SBC A;  4ILF A;  1A2M A;  3VI7 A;  4AJ8 A;  1ERU A;  3QFB C;  2CZ3 A;  2GS3 A;  4EE0 A;  2H75 A;  1FB0 A;  3ZRE A;  1U3A A;  1PMT A;  2VCX A;  2J9H A;  4TXV A;  5D73 A;  2H01 A;  2X8H A;  2RUF A;  4CHS A;  2N5A A;  2RUE A;  2HYX A;  1YEX A;  1O85 A;  4AJ6 A;  2DKH A;  2WZ9 A;  4MH3 A;  3ZIV A;  1SL1 B;  1K0C A;  2H1D A;  2YJ7 A;  3M1G A;  3RPN A;  1K0N A;  4MZC A;  1J9B A;  3MIX A;  2PN8 A;  3MNG A;  2A2P A;  5D9W A;  4TOP A;  1K0D A;  2LQQ A;  1GTI A;  1OYJ A;  5JCG A;  4Q5R A;  1SK1 A;  2P31 A;  3AY8 A;  3D21 A;  2H19 A;  3D6I A;  4MJE A;  3E0U A;  4JE1 A;  1SEN A;  4MJA A;  1AUC A;  1SYX A;  4OFN A;  4GWR A;  1SKR B;  4WF5 A;  3EPT A;  4IJ3 A;  3GL3 A;  2NVL A;  2E2M A;  5F8B A;  2MBT A;  3LYP A;  1SK0 A;  3P90 A;  5GST A;  2QA2 A;  1T1V A;  3EIN A;  3GTU B;  5L71 A;  1AIU A;  2KHP A;  2FY6 A;  5HR0 A;  2V41 A;  4O32 A;  3FZ4 A;  3VWU A;  1GUL A;  2DIZ A;  4JED A;  1C72 A;  3LYK A;  2UZ8 A;  4HU9 A;  1EP7 A;  1MDJ A;  2QGV A;  1ZGN A;  2MMA A;  3GKM A;  1YF0 A;  4TR0 A;  2G0F A;  2TRX A;  3EUR A;  3M9K A;  1EV4 A;  5JWO B;  2HRA A;  2GSR A;  4K7O A;  2H1A A;  5ECN B;  3VWV A;  3GFK A;  4TR4 A;  1M99 A;  4ZB8 A;  4ISD A;  3WGE A;  4ACS A;  4NV2 A;  1E6B A;  2VCQ A;  4G2E A;  2WS2 A;  2VCV A;  5G1L A;  2I3Y A;  1VGL A;  2C3T A;  3H8Q A;  5HFK A;  5HR1 A;  3GYK A;  3ZTL A;  1OE8 A;  3M0F A;  2DJ3 A;  2F9S A;  3D4T A;  3DIE A;  2X99 A;  3P7X A;  2HSH A;  2AYT A;  1K0B A;  2C0F A;  3CRU A;  5HFI A;  5KOX A;  3F3R A;  3N5O A;  3F4T A;  4TRX A;  4YQU A;  4EF0 A;  4KSM A;  6GSS A;  1Z5Y E;  2OBI A;  1FG4 A;  3KM6 A;  5GSS A;  4N30 A;  2DLX A;  3H93 A;  4POB A;  1EOG A;  4F0B A;  3VPQ A;  4XHM A;  4CY6 A;  4O5U A;  3IC8 A;  1GLQ A;  1R26 A;  2DML A;  2JZT A;  1X5D A;  1HYU A;  5J41 A;  2GQK A;  5JCW A;  1NHO A;  11GS A;  4G9H A;  1LU4 A;  3FRC A;  3A3T A;  2TIR A;  1JLV A;  3A2X A;  1HNA A;  1ZYP A;  2LJK A;  3M8N A;  1TI3 A;  3TKS C;  3F4S A;  1TRV A;  2R2J A;  4EDY A;  4DSQ A;  3TJK A;  4ZIL A;  4ID0 A;  2GST A;  4V1A p;  3DGQ A;  5KN0 A;  2C4J A;  3FKF A;  1XZO A;  1ZYQ B;  1XPV A;  5D9T A;  1JZR A;  2HNL A;  4POM A;  1JLW A;  3EU4 A;  1RW1 A;  1F37 A;  2R0G A;  1K0M A;  2O89 A;  4LMV A;  2H8L A;  4Z2R A;  2XPD A;  3HJP A;  3H79 A;  3F63 A;  4O7H A;  5KOW A;  2F8A A;  4LL1 B;  1IYH A;  2IFQ A;  2H6Y A;  2JZS A;  1TXX A;  4KF9 A;  1EEM A;  3I43 A;  3EWL A;  3IPZ A;  3KTB A;  2ZNM A;  3FR3 A;  4DVC A;  3TOT A;  3S9F A;  1XBS A;  4ICY A;  2H1G A;  1TDI A;  2X8C A;  3KEB A;  4O5R A;  1XW6 A;  4ZL8 A;  2R3X A;  1PFO A;  2HRK A;  3LQ7 A;  3DD3 A;  1GTA A;  2H1B A;  4TN8 A;  5EL8 A;  3HVV A;  4PUR A;  5AIS A;  4I97 A;  2DJ2 A;  2O7K A;  1ERT A;  4KB3 A;  3QAG A;  3TKS E;  2IMK A;  5CP1 A;  4ZBD A;  4BVX B;  4E8H A;  4I2U A;  1F2E A;  2CA8 A;  4MMM A;  4MF5 A;  5F0G A;  1S3A A;  4ECC A;  5EY6 A;  1XFL A;  3Q19 A;  5D9X A;  1N8J A;  1AW9 A;  3RDW A;  1UA5 A;  3I69 A;  6GSU A;  1T4Y A;  4TR1 A;  2L4C A;  3EMP A;  1ML6 A;  3QD9 A;  3A2V A;  1SD9 A;  4HOJ A;  4KAE A;  3FR9 A;  5BMU A;  5DJL A;  1B9X C;  4KDX A;  3MDK A;  4K9Z A;  2D2Z A;  2O87 A;  2R5G A;  3TKS A;  3FMW A;  4KCE A;  4WET A;  5ECH B;  3LOR A;  2JSY A;  2CAI A;  4OFM A;  2Z9S A;  2V2G A;  4Z7X A;  1I5G A;  5ID2 A;  4JRR A;  5IPG A;  2IME A;  3C1R A;  3E3E A;  4ZL7 A;  1PRX A;  4JR4 A;  2LKU A;  1GSE A;  3Q6O A;  4V2L A;  1AXD A;  3UMA A;  5IMV A;  1GUM A;  4MK3 A;  3WGD A;  4K2D A;  5IMZ A;  2B6M A;  3APQ A;  4E8E A;  4O5Q A;  2KP2 A;  2A4V A;  4KA0 A;  4F03 A;  1AQW A;  1YF1 A;  4TKY A;  4MPG A;  3BBY A;  4G10 A;  3IC4 A;  3IAM 2;  4POK A;  4IP1 A;  1R4W A;  3CQF A;  1X9W B;  1VRS D;  4EVM A;  2YV9 A;  1YQ1 A;  5C00 A;  4KW6 A;  3UBL A;  4TXO A;  3IHG A;  2VUP A;  3UIW A;  3LW9 A;  2XHF A;  1V58 A;  2OKA A;  1F3A A;  1VF4 A;  1K0O A;  2OAD A;  3GKK A;  3HHV A;  5FHI A;  1EZK A;  2C0G A;  2KLX A;  4J57 E;  4OFT A;  1DE1 A;  4OD7 A;  6GSX A;  1GUH A;  1ZMA A;  1ZYN A;  5IO0 A;  3ZIT A;  1M2A A;  1XWA A;  2BTO T;  1K3Y A;  5ECS A;  3L0H A;  2YV7 A;  1FB6 A;  5G30 A;  2IN3 A;  2FWG A;  1Z6N A;  3HXS A;  2XPE A;  4TVE A;  2REM A;  3D22 A;  1RK4 A;  4GST A;  3TRX A;  4FYC A;  4MH2 A;  4XTS A;  4JU5 A;  3M3M A;  3J7Y k;  1T7P B;  2K8S A;  5CRE A;  4BWQ A;  2LST A;  3KMN A;  2GQM A;  4NHZ A;  1MTC A;  1BJX A;  16GS A;  3WD6 A;  4EXJ A;  3J7Y b;  4ZIJ A;  2DJ1 A;  5DVB A;  5DCG A;  1F6M C;  4WR5 A;  1PN0 A;  5CRW A;  5HR3 A;  4KGI A;  3CRT A;  2DC5 A;  3NZN A;  4IKH A;  4K0G A;  3PPU A;  1Z9H A;  4H86 A;  2OAC A;  1K3O A;  1KTE A;  4K5R A;  2QC7 A;  3PR8 A;  2XC2 A;  1GH2 A;  1V2A A;  2VL2 C;  1XVQ A;  1ZCP A;  3HA9 A;  4I2T A;  2VCZ A;  3HYP A;  2LTK A;  1B48 A;  2N5F A;  1M9A A;  5CRG A;  3GTU A;  3ERF A;  1XOB A;  4POL A;  2G2Q A;  1GUK A;  1G0T A;  4GRF A;  1URM A;  2HLS A;  3UOM A;  3FEU A;  2RII A;  5ABR A;  2C0D A;  4X1U A;  1V40 A;  3KXO A;  2N5B A;  3HD5 A;  4PNF A;  4IQ1 A;  4BPY A;  2KP1 A;  5JWQ B;  3F6F A;  4EC0 A;  3GST A;  1A2L A;  1LJR A;  2YCD A;  3D4M A;  4NXI A;  5LCZ A;  1FHE A;  4OMV A;  2OJL A;  1OVN A;  1X0R A;  1ST9 A;  5IPH A;  3QAV A;  4N11 A;  1FVJ A;  4MJC A;  3RBT A;  2K8V A;  2V6K A;  4ZL9 A;  1TK5 B;  1BQ7 A;  3TB2 A;  4AF2 A;  2DBC A;  6GSY A;  4K1F A;  2E2G A;  1A2J A;  4RQR A;  1M2B A;  2I9H A;  3FHK A;  1HD2 A;  1J08 A;  4KX4 A;  3ZRD A;  1FOH A;  2HRN A;  1PSQ A;  2VLV A;  1WIK A;  3C71 A;  5EVO A;  3GL5 A;  2PVQ A;  1GSD A;  4XRA A;  3GIX A;  5HFG A;  1Y6E A;  14GS A;  4IN0 A;  3TRQ A;  3R2Q A;  3GX0 A;  2MZC A;  1PN9 A;  4GQF A; 
#chains in the Genus database with same CATH homology
 2VIM A;  2EIQ A;  3ME7 A;  5EPF A;  1TKD B;  3DYR A;  4L8E A;  2OE1 A;  3IBH A;  4KND A;  1SK2 A;  3UBK A;  2DKI A;  1HNC A;  3I6A A;  2ALB A;  2KUC A;  1J0F A;  2TRC P;  2FGX A;  2YWN A;  5IMD A;  1TK0 B;  1Q98 A;  1YJ6 A;  1BED A;  1O7U A;  1GWC A;  1THX A;  2BMX A;  8GSS A;  4OWY A;  2NBS A;  4YAV A;  2LRC A;  1GSQ A;  2WGR A;  3F0I A;  2AV4 A;  3IA1 A;  6GSW A;  2LV3 A;  12GS A;  3MAK A;  5H5Q A;  2IJY A;  3DRN A;  2CX4 A;  2ON7 A;  1HQO A;  2H76 A;  3CBU A;  4L5L A;  2QSI A;  1V98 A;  3A5I A;  4MPF A;  4NWY A;  5G31 A;  4ZBA A;  1GRX A;  5B6N A;  3EC3 A;  4HUA A;  1SU9 A;  1R7H A;  4ZB6 A;  3C1S A;  4Z2T A;  2ZUP A;  3HVX A;  1A24 A;  1HNB A;  1GTB A;  2DJJ A;  1G6Y A;  3FR6 A;  2X64 A;  5E59 A;  2AHE A;  2I1U A;  1G7E A;  1TP9 A;  2MMZ A;  2L57 A;  4Q5N A;  1PL2 A;  2PWJ A;  1XIY A;  4WBJ A;  4MLY A;  5FWG A;  3A5W A;  4RQX A;  3IE3 A;  3NIV A;  2R4V A;  5CYY A;  1PA3 A;  2HXK A;  3TJB A;  2MBS A;  2WCI A;  5B8B A;  1M0U A;  1TTZ A;  2FLS A;  3RPP A;  1B8X A;  4KSO A;  3KIJ A;  1I9D A;  4MP4 A;  3IDV A;  5A4U A;  5D8I A;  3APS A;  1QFN A;  4K6X A;  3VPT A;  3EYT A;  3WYW A;  2JAC A;  2VLT A;  3ZML A;  3L78 A;  4BVX A;  3IXR A;  2J23 A;  5J3R A;  3TCO A;  2GTU A;  4F82 A;  1XWK A;  1TJD A;  2B1K A;  3UAP A;  4I8B A;  5IOW A;  3BCI A;  5ECP B;  2OE0 A;  3ZVJ D;  4DEJ A;  2JU5 A;  1ERV A;  2H0I A;  4F2I A;  3KH7 A;  3VWW A;  4YKF A;  2YWI A;  2GSS A;  4CW9 A;  3TJF A;  13GS A;  3F9U A;  3KMO A;  5HR2 A;  1X9M B;  1OKD A;  4X43 A;  1EGO A;  3MWH A;  4ECI A;  1ZYE A;  3L9U A;  4HU7 A;  1XVW A;  2H70 A;  5JWR B;  2GGT A;  4I6X A;  2E0Q A;  2L6D A;  3Q74 A;  1PGT A;  3O6T A;  4PQ1 A;  1A0R P;  3KJY A;  1B9Y C;  4BVY B;  3TKP A;  4KDY A;  4OCF A;  2YP6 A;  2VCT A;  5ENU A;  3HVS A;  4IJI A;  3GUS A;  4PNG A;  3IOS A;  1H4O A;  2F8F A;  2MMO A;  17GS A;  3HKR A;  1EEJ A;  4MZB A;  5ELG A;  5ECK B;  2XBQ A;  2R0P A;  4LL4 B;  3M9J A;  3K8N A;  3L9S A;  2EC4 A;  1QK8 A;  5DAL B;  2V32 A;  4ZXG A;  4Q5F A;  5DQY A;  4AJ7 A;  3W6G A;  3GKN A;  1NSW A;  3LJR A;  4K8M A;  1FVK A;  2C3N A;  4RI7 A;  3W8S A;  1GNW A;  4D73 B;  18GS A;  3R3E A;  2CZ2 A;  3P2A A;  4MF7 A;  2ZCT A;  5A4V A;  1G7O A;  4WF4 A;  2A2S A;  4AGS A;  5DBQ A;  1GNE A;  1GL8 A;  2NPB A;  4P3Y B;  3D5J A;  4HJ2 A;  3IK7 A;  4GTU A;  2VD0 A;  3IK9 A;  1ERW A;  4XRD A;  5B7C A;  4HS1 A;  2P5Q A;  1MD3 A;  4V1A g;  2GT5 A;  1UVZ A;  4MF6 A;  3CMI A;  4EDZ A;  3Q18 A;  1EGR A;  3UAR A;  4USS A;  2B7J A;  4X0X A;  2PPT A;  1SL2 B;  1SKW B;  4QL9 A;  6GSV A;  1MDI A;  3QOU A;  1RQM A;  2DMM A;  4TW5 A;  5A4W A;  2GDR A;  3LG6 A;  1PQN A;  5A5K A;  1TRS A;  5HQP A;  1QXH A;  2DJK A;  3DVW A;  2R37 A;  2C8U A;  3H4K A;  5CNW A;  5LD0 A;  4GSS A;  2CVD A;  1WP0 A;  3P8W A;  5B8A A;  2H74 A;  3TKQ A;  3H1N A;  5CO3 A;  3WGX A;  1XW5 A;  4NMU A;  2WRT A;  2IWT A;  5D93 A;  2FNO A;  4EIQ A;  2GZZ A;  1O8W A;  1OC3 A;  1SD8 A;  2X49 A;  2MMN A;  4WR4 A;  4DSS B;  2H72 A;  5G5E A;  5J9B A;  2AUV A;  2NDO A;  1YKC A;  2PBJ A;  4HDE A;  1K3L A;  3QCP A;  4K0N A;  4QQ7 A;  3F4R A;  3VI5 A;  4GQC A;  1YKA A;  2YZU A;  2CV4 A;  1JZO A;  2JZR A;  1F3B A;  5D9V A;  5DQS A;  4HQZ A;  3HJO A;  3ZZX A;  5ECR B;  2L5O A;  2CVK A;  2B5Y A;  1EOH A;  1WWJ A;  3ZMK A;  1S3D A;  2YWM A;  1W4V A;  3GH6 A;  4CY8 A;  4YQM A;  3RAZ A;  2DIY A;  4K7N A;  4PQH A;  2H71 A;  4FIW A;  5G5F A;  1KNG A;  3ISO A;  3G7Y A;  3MSZ A;  4EO3 A;  3VK9 A;  1IYI A;  2AB6 A;  4JR6 A;  4LMW A;  22GS A;  3WT1 A;  3V1W A;  3RHC A;  4XS6 A;  4OO5 A;  1EV9 A;  2FA8 A;  1U3I A;  1GSY A;  2YN1 A;  2H66 A;  3ZIJ A;  3C8E A;  3GUR A;  4NAX A;  3ME8 A;  10GS A;  2HSY A;  4MA9 A;  2IMF A;  3DXB A;  1FW1 A;  4MCU A;  4G19 A;  1Q4J A;  1YDK A;  5H5R A;  2B1L A;  3BCK A;  1CQH A;  3PIN A;  5IO2 A;  1TU8 A;  3F6D A;  2C1Y A;  1T00 A;  3G9B A;  2EIR A;  1A0F A;  2V1M A;  2LNS A;  1QUW A;  3HDC A;  2H0H A;  3KGK A;  4NV5 A;  2LUS A;  1XW9 A;  4PX1 A;  5DCH A;  4FH8 A;  5J9C A;  1CQG A;  4X4J A;  2LEG A;  4WBR D;  3CSI A;  4EL1 A;  4ULX A;  2K6V A;  2WDU A;  3O76 A;  2OBK A;  1ABA A;  2LRN A;  2PVO C;  1K0A A;  5DJM A;  1WOU A;  1E2Y A;  1AAZ A;  5GAP D;  1GP1 A;  2HZE B;  3VUR A;  1VF2 A;  3CTF A;  1TOF A;  2EIO A;  4NHW A;  1T3B A;  3E9J B;  3N9J A;  2L6C A;  2HZF A;  3GX8 A;  3TRP A;  2YZH A;  5J5N A;  4IHU A;  2K18 A;  4I5Q A;  4LA1 A;  5IMA A;  4PUF C;  2IIY A;  2CAQ A;  1OC9 B;  5COH A;  1V57 A;  2M72 A;  2LJR A;  3W8J A;  4V2M A;  3FZ9 A;  3APO A;  1YZX A;  4QL7 A;  1PX6 A;  2FA4 A;  4G0K A;  4KH7 A;  2GLR A;  1ACV A;  3UVH A;  1XOA A;  4IP6 A;  5JCU A;  4EIP A;  4GXZ A;  2R6K A;  4XS4 B;  1EWX A;  5KN3 A;  5CAX A;  1MEK A;  1M2D A;  5LNK e;  1SKS B;  2C3Q A;  1G6W A;  3DEX A;  3IRA A;  2KOK A;  1ZOF A;  1LBK A;  5DDL A;  1Z7R A;  1A8L A;  3LFL A;  3UVT A;  4BL7 B;  4FYU A;  2FWH A;  3KH9 A;  1GTU A;  3FK8 A;  4FQU A;  5IM9 A;  1QGV A;  3KP8 A;  2VL3 A;  3DKS A;  5IMF A;  2F3M A;  1WE0 A;  3FY7 A;  1XCC A;  3FZ5 A;  3IAS 2;  1AQV A;  3LWA A;  2FUG 2;  2B5X A;  1X5C A;  3TGZ A;  1QMV A;  4GCI A;  1THO A;  2JL4 A;  1ILO A;  4G0I A;  3IR4 A;  1OE7 A;  2PUK C;  5DAK B;  1JZW A;  4FO5 A;  1ZZY A;  2YAN A;  2CQ9 A;  1SL0 B;  1R5P A;  2A2R A;  4IS0 A;  1MDK A;  1MD4 A;  1NW2 A;  2GZY A;  2VL2 A;  4EUY A;  3DWV A;  6GST A;  5AIX A;  4GLT A;  2JSZ A;  3GKX A;  2HRF A;  3EVI A;  5ECI B;  1GSS A;  4HEA 2;  3GH9 A;  3U6V A;  2X8G A;  2HT9 A;  4ECB A;  1FOV A;  2CVB A;  3QDN A;  1SYR A;  4MJB A;  1NHY A;  2HFD A;  2PGT A;  4HZ2 A;  3ZLP A;  4BA7 A;  4ML6 A;  4F0C A;  1YEP A;  2RM6 A;  2C80 A;  3VWX A;  5GZZ B;  1FAA A;  5H5S A;  3QFA C;  3KZQ A;  2PER A;  3HJM A;  4BWS A;  3TJG A;  2RM5 A;  1H75 A;  1U6T A;  4J56 E;  1DBY A;  3LXZ A;  1BX9 A;  5GAN D;  1Z3E A;  2GT6 A;  1XWB A;  1PKZ A;  3L9V A;  1OKT A;  5ELA A;  1USB A;  2I81 A;  4BVY A;  2PU9 C;  3SWL A;  1Z7P A;  2VAF A;  2L4Q A;  1OAZ A;  5D96 A;  4GSN A;  3C73 A;  1TK8 B;  4IQA A;  2VM2 A;  4ZB9 A;  7GSS A;  2IPA A;  4L5O A;  4HI7 A;  2OE3 A;  1GSU A;  1FO5 A;  2DJ0 A;  1V9W A;  4PXO A;  2MYG A;  3I9V 2;  2YJH A;  2YPM A;  1R5A A;  2VLU A;  5DAL A;  2AAW A;  1BAY A;  2CX3 A;  3KP9 A;  1JFU A;  3LEF A;  2FHE A;  1DE2 A;  1M7T A;  2O8V B;  1DUG A;  2PMT A;  5F07 A;  4D73 A;  2P0G A;  4HQS A;  4OO4 A;  3PH9 A;  4XCS A;  3GA4 A;  4Z2U A;  3D0Z A;  5BRT A;  5B6M A;  4KUN A;  2YOI A;  4OCE A;  2IL3 A;  1Y25 A;  3BJ5 A;  2HE3 A;  1TW9 A;  4K5S A;  4L0W A;  1O6J A;  3EMX A;  2YWO A;  4IEL A;  4J2F A;  1TRU A;  4IBP A;  3TDG A;  3QPM A;  4LLR A;  2E7P A;  2BJX A;  2H30 A;  2FWF A;  1XXU A;  2XBI A;  1XWC A;  3HZ4 A;  3F3Q A;  5ECL B;  1SJI A;  20GS A;  2WFC A;  3VLN A;  4RUV A;  3FYG A;  5ECO B;  1UC7 A;  2QA1 A;  4L0U A;  1U87 A;  3DML A;  4K7I A;  4TR3 A;  1BYE A;  2F51 A;  4Q5Q A;  1EP8 A;  5F06 A;  4N0V A;  3EE2 A;  3TJJ A;  4EKZ A;  2R0C A;  5AIV A;  3O3T A;  9GSS A;  3IV4 A;  4PGT A;  3BD2 A;  3A2W A;  4XIH A;  3FZA A;  2VL9 A;  1PL1 A;  3G7J A;  2H6X A;  4KCA A;  4PUA A;  4DSS A;  3US3 A;  2H6Z A;  2VOC A;  5G1K A;  1SJZ A;  2IMD A;  1PKW A;  2O85 A;  4WXT A;  3ERG A;  1B4Q A;  3L4N A;  3TKR A;  4YH2 A;  3U5R E;  4KE3 A;  2LQO A;  3UJ1 A;  4HJM A;  1BG5 A;  2ON5 A;  1TI1 A;  3TUE A;  3C7M A;  1WMJ A;  3ED3 A;  5AGY A;  5E4W A;  1GSF A;  3HCZ A;  3GSS A;  2NTO A;  1PD2 1;  2JAD A;  4YAP A;  1DSB A;  3GV1 A;  4MNN A;  4JZQ A;  2LRT A;  3OR5 A;  1S3C A;  4F9Z A;  2M80 A;  3ZYW A;  4PTS A;  1A23 A;  3TOU A;  1KBN A;  5IOX A;  3WT2 A;  5J4U A;  3CYN A;  1T8E B;  2WUL A;  1GLP A;  5C04 A;  3KCM A;  4XS1 A;  1X5E A;  3QR6 A;  2QKE A;  5ECQ B;  4GF0 A;  2VD1 A;  2I4A A;  2HI7 A;  2GQL A;  2A4H A;  3BOA A;  3KTL A;  3ZFB A;  3LGC A;  3DVX A;  2IFQ B;  1KEB A;  2YNX A;  3ZVJ A;  1YY7 A;  1A8Y A;  1JZD A;  2FD3 A;  4G0L A;  5AN1 A;  4N10 A;  1VF3 A;  19GS A;  4RI6 A;  3GHA A;  4IVF A;  2FWE A;  1ZL9 A;  2ES7 A;  1QQ2 A;  2LJA A;  1N2A A;  5CRD A;  3GMF A;  3NOF A;  1B4P A;  2H0G A;  4IGJ A;  3IHQ A;  4ML1 A;  1X9S B;  3HY2 A;  2L5L A;  4NPB A;  3JCM L;  4MZW A;  3CSJ A;  3EU3 A;  2H73 A;  3HZ8 A;  4DSR A;  1O73 A;  1PX7 A;  2V6O A;  2HSM A;  3ZL5 A;  1ON4 A;  4V2N A;  4HZ4 A;  1AQX A;  3G7I A;  1O81 A;  4IW9 A;  4MAB A;  3GRX A;  3F8U A;  4A5P A;  1W89 A;  1O8X A;  2X4A A;  2M46 A;  2LS5 A;  2GSQ A;  5CRH A;  1TRW A;  2CT6 A;  3CTG A;  5INY A;  2HZE A;  3ZFL A;  4O92 A;  4TR1 B;  3UEM A;  3UL3 A;  3FW2 A;  2FCH A;  2WJU A;  2OA7 A;  2DSA A;  2VM1 A;  5G2Z A;  1WPI A;  4PQI A;  1OC9 A;  5IQY A;  4MDC A;  2L59 A;  4ZBB A;  1JHB A;  2LNT A;  5ID2 B;  2P5R A;  1VF1 A;  3MYD A;  3CXG A;  1XWG A;  4YKG A;  2K9F A;  3CSH A;  5KN1 A;  1Z6M A;  3GN3 A;  5F05 A;  3GNJ A;  2AJQ B;  4XS4 A;  1T4Z A;  4JBB A;  2GZP A;  2B5E A;  4WEY A;  4N0Z A;  2VO4 A;  4BL7 A;  2B7K A;  1WJK A;  1UN2 A;  1TU7 A;  3QMX A;  1OC8 A;  1SJ6 A;  5KN2 A;  5IIZ A;  5IMC A;  2C0E A;  4KDU A;  4TXO B;  2VCW A;  4WKW A;  4YQV A;  1U88 A;  4K2X A;  5ECM B;  1WRY A;  3QAW A;  1F9M A;  1M9B A;  4FYB A;  3KD0 A;  3RHB A;  2B3S A;  1AC1 A;  5FT3 A;  5DAK A;  1NM3 A;  2IMI A;  4CDO A;  3VFI A;  2WB9 A;  3PGT A;  2RLI A;  2GVP A;  3LSZ A;  3LXT A;  5KEJ A;  4ECJ A;  3ERW A;  3SBC A;  4ILF A;  1A2M A;  3VI7 A;  4AJ8 A;  1ERU A;  3QFB C;  2CZ3 A;  2GS3 A;  4EE0 A;  2H75 A;  1FB0 A;  3ZRE A;  1U3A A;  1PMT A;  2VCX A;  2J9H A;  4TXV A;  5D73 A;  2H01 A;  2X8H A;  2RUF A;  4CHS A;  2N5A A;  2RUE A;  2HYX A;  1YEX A;  1O85 A;  4AJ6 A;  2DKH A;  2WZ9 A;  4MH3 A;  3ZIV A;  1SL1 B;  1K0C A;  2H1D A;  2YJ7 A;  3M1G A;  3RPN A;  1K0N A;  4MZC A;  1J9B A;  3MIX A;  2PN8 A;  3MNG A;  2A2P A;  5D9W A;  4TOP A;  1K0D A;  2LQQ A;  1GTI A;  1OYJ A;  5JCG A;  4Q5R A;  1SK1 A;  2P31 A;  3AY8 A;  3D21 A;  2H19 A;  3D6I A;  4MJE A;  3E0U A;  4JE1 A;  1SEN A;  4MJA A;  1AUC A;  1SYX A;  4OFN A;  4GWR A;  1SKR B;  4WF5 A;  3EPT A;  4IJ3 A;  3GL3 A;  2NVL A;  2E2M A;  5F8B A;  2MBT A;  3LYP A;  1SK0 A;  3P90 A;  5GST A;  2QA2 A;  1T1V A;  3EIN A;  3GTU B;  5L71 A;  1AIU A;  2KHP A;  2FY6 A;  5HR0 A;  2V41 A;  4O32 A;  3FZ4 A;  3VWU A;  1GUL A;  2DIZ A;  4JED A;  1C72 A;  3LYK A;  2UZ8 A;  4HU9 A;  1EP7 A;  1MDJ A;  2QGV A;  1ZGN A;  2MMA A;  3GKM A;  1YF0 A;  4TR0 A;  2G0F A;  2TRX A;  3EUR A;  3M9K A;  1EV4 A;  5JWO B;  2HRA A;  2GSR A;  4K7O A;  2H1A A;  5ECN B;  3VWV A;  3GFK A;  4TR4 A;  1M99 A;  4ZB8 A;  4ISD A;  3WGE A;  4ACS A;  4NV2 A;  1E6B A;  2VCQ A;  4G2E A;  2WS2 A;  2VCV A;  5G1L A;  2I3Y A;  1VGL A;  2C3T A;  3H8Q A;  5HFK A;  5HR1 A;  3GYK A;  3ZTL A;  1OE8 A;  3M0F A;  2DJ3 A;  2F9S A;  3D4T A;  3DIE A;  2X99 A;  3P7X A;  2HSH A;  2AYT A;  1K0B A;  2C0F A;  3CRU A;  5HFI A;  5KOX A;  3F3R A;  3N5O A;  3F4T A;  4TRX A;  4YQU A;  4EF0 A;  4KSM A;  6GSS A;  1Z5Y E;  2OBI A;  1FG4 A;  3KM6 A;  5GSS A;  4N30 A;  2DLX A;  3H93 A;  4POB A;  1EOG A;  4F0B A;  3VPQ A;  4XHM A;  4CY6 A;  4O5U A;  3IC8 A;  1GLQ A;  1R26 A;  2DML A;  2JZT A;  1X5D A;  1HYU A;  5J41 A;  2GQK A;  5JCW A;  1NHO A;  11GS A;  4G9H A;  1LU4 A;  3FRC A;  3A3T A;  2TIR A;  1JLV A;  3A2X A;  1HNA A;  1ZYP A;  2LJK A;  3M8N A;  1TI3 A;  3TKS C;  3F4S A;  1TRV A;  2R2J A;  4EDY A;  4DSQ A;  3TJK A;  4ZIL A;  4ID0 A;  2GST A;  4V1A p;  3DGQ A;  5KN0 A;  2C4J A;  3FKF A;  1XZO A;  1ZYQ B;  1XPV A;  5D9T A;  1JZR A;  2HNL A;  4POM A;  1JLW A;  3EU4 A;  1RW1 A;  1F37 A;  2R0G A;  1K0M A;  2O89 A;  4LMV A;  2H8L A;  4Z2R A;  2XPD A;  3HJP A;  3H79 A;  3F63 A;  4O7H A;  5KOW A;  2F8A A;  4LL1 B;  1IYH A;  2IFQ A;  2H6Y A;  2JZS A;  1TXX A;  4KF9 A;  1EEM A;  3I43 A;  3EWL A;  3IPZ A;  3KTB A;  2ZNM A;  3FR3 A;  4DVC A;  3TOT A;  3S9F A;  1XBS A;  4ICY A;  2H1G A;  1TDI A;  2X8C A;  3KEB A;  4O5R A;  1XW6 A;  4ZL8 A;  2R3X A;  2HRK A;  3LQ7 A;  3DD3 A;  1GTA A;  2H1B A;  4TN8 A;  5EL8 A;  3HVV A;  4PUR A;  5AIS A;  4I97 A;  2DJ2 A;  2O7K A;  1ERT A;  4KB3 A;  3QAG A;  3TKS E;  2IMK A;  5CP1 A;  4ZBD A;  4BVX B;  4E8H A;  4I2U A;  1F2E A;  2CA8 A;  4MMM A;  4MF5 A;  5F0G A;  1S3A A;  4ECC A;  5EY6 A;  1XFL A;  3Q19 A;  5D9X A;  1N8J A;  1AW9 A;  3RDW A;  1UA5 A;  3I69 A;  6GSU A;  1T4Y A;  4TR1 A;  2L4C A;  3EMP A;  1ML6 A;  3QD9 A;  3A2V A;  1SD9 A;  4HOJ A;  4KAE A;  3FR9 A;  5BMU A;  5DJL A;  1B9X C;  4KDX A;  3MDK A;  4K9Z A;  2D2Z A;  2O87 A;  2R5G A;  3TKS A;  3FMW A;  4KCE A;  4WET A;  5ECH B;  3LOR A;  2JSY A;  2CAI A;  4OFM A;  2Z9S A;  2V2G A;  4Z7X A;  1I5G A;  5ID2 A;  4JRR A;  5IPG A;  2IME A;  3C1R A;  3E3E A;  4ZL7 A;  1PRX A;  4JR4 A;  2LKU A;  1GSE A;  3Q6O A;  4V2L A;  1AXD A;  3UMA A;  5IMV A;  1GUM A;  4MK3 A;  3WGD A;  4K2D A;  5IMZ A;  2B6M A;  3APQ A;  4E8E A;  4O5Q A;  2KP2 A;  2A4V A;  4KA0 A;  4F03 A;  1AQW A;  1YF1 A;  4TKY A;  4MPG A;  3BBY A;  4G10 A;  3IC4 A;  3IAM 2;  4POK A;  4IP1 A;  1R4W A;  1X9W B;  1VRS D;  4EVM A;  2YV9 A;  1YQ1 A;  5C00 A;  4KW6 A;  3UBL A;  4TXO A;  3IHG A;  2VUP A;  3UIW A;  3LW9 A;  2XHF A;  1V58 A;  2OKA A;  1F3A A;  1VF4 A;  1K0O A;  2OAD A;  3GKK A;  3HHV A;  5FHI A;  1EZK A;  2C0G A;  2KLX A;  4J57 E;  4OFT A;  1DE1 A;  4OD7 A;  6GSX A;  1GUH A;  1ZMA A;  1ZYN A;  5IO0 A;  3ZIT A;  1M2A A;  1XWA A;  2BTO T;  1K3Y A;  5ECS A;  3L0H A;  2YV7 A;  1FB6 A;  5G30 A;  2IN3 A;  2FWG A;  1Z6N A;  3HXS A;  2XPE A;  4TVE A;  2REM A;  3D22 A;  1RK4 A;  4GST A;  3TRX A;  4FYC A;  4MH2 A;  4XTS A;  4JU5 A;  3M3M A;  3J7Y k;  1T7P B;  2K8S A;  5CRE A;  4BWQ A;  2LST A;  3KMN A;  2GQM A;  4NHZ A;  1MTC A;  1BJX A;  16GS A;  3WD6 A;  4EXJ A;  3J7Y b;  4ZIJ A;  2DJ1 A;  5DVB A;  5DCG A;  1F6M C;  4WR5 A;  1PN0 A;  5CRW A;  5HR3 A;  4KGI A;  3CRT A;  2DC5 A;  3NZN A;  4IKH A;  4K0G A;  3PPU A;  1Z9H A;  4H86 A;  2OAC A;  1K3O A;  1KTE A;  4K5R A;  2QC7 A;  3PR8 A;  2XC2 A;  1GH2 A;  1V2A A;  2VL2 C;  1XVQ A;  1ZCP A;  3HA9 A;  4I2T A;  2VCZ A;  3HYP A;  2LTK A;  1B48 A;  2N5F A;  1M9A A;  5CRG A;  3GTU A;  3ERF A;  1XOB A;  4POL A;  2G2Q A;  1GUK A;  1G0T A;  4GRF A;  1URM A;  2HLS A;  3UOM A;  3FEU A;  2RII A;  5ABR A;  2C0D A;  4X1U A;  1V40 A;  3KXO A;  2N5B A;  3HD5 A;  4PNF A;  4IQ1 A;  4BPY A;  2KP1 A;  5JWQ B;  3F6F A;  4EC0 A;  3GST A;  1A2L A;  1LJR A;  2YCD A;  3D4M A;  4NXI A;  5LCZ A;  1FHE A;  4OMV A;  2OJL A;  1OVN A;  1X0R A;  1ST9 A;  5IPH A;  3QAV A;  4N11 A;  1FVJ A;  4MJC A;  3RBT A;  2K8V A;  2V6K A;  4ZL9 A;  1TK5 B;  1BQ7 A;  3TB2 A;  4AF2 A;  2DBC A;  6GSY A;  4K1F A;  2E2G A;  1A2J A;  4RQR A;  1M2B A;  2I9H A;  3FHK A;  1HD2 A;  1J08 A;  4KX4 A;  3ZRD A;  1FOH A;  2HRN A;  1PSQ A;  2VLV A;  1WIK A;  3C71 A;  5EVO A;  3GL5 A;  2PVQ A;  1GSD A;  4XRA A;  3GIX A;  5HFG A;  1Y6E A;  14GS A;  4IN0 A;  3TRQ A;  3R2Q A;  3GX0 A;  2MZC A;  1PN9 A;  4GQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...