4X43A

Structure of proline-free e. coli thioredoxin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGACKMIAAILDEIADEYQGKLTVAKLNIDQNAGTAAKYGIRGIATLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin-1
publication title Acceleration of protein folding by four orders of magnitude through a single amino acid substitution.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 30
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4x43A00
3U5RE 1XW6A 3PR8A 4JBBA 2CX3A 5ELGA 4GTUA 2YP6A 4PQHA 3TJFA 2YN1A 4YQMA 3BJ5A 1OC9B 4TXVA 1OKTA 3G7JA 3WGDA 3GH6A 4MABA 4XTSA 2DJ3A 1FO5A 2MMNA 4PQ1A 3LYKA 3U6VA 2DLXA 1EV4A 2HRNA 5CRHA 1TU8A 1XCCA 2VL2C 1RQMA 2DJ0A 3GFKA 4ZB8A 2L4CA 4K7OA 2FY6A 4I2TA 1HQOA 2GS3A 2HLSA 3E0UA 2WB9A 3KTBA 3BOAA 4TN8A 1THXA 2BMXA 3HD5A 3FZ4A 1XWKA 5A5KA 5B8BA 1KNGA 3CTGA 4HUAA 2X8HA 1M9BA 3WD6A 1AQVA 2WS2A 1LJRA 2FUG2 4WR4A 2CAQA 3ZFBA 4KCAA 3TKSE 3TDGA 4GCIA 2RLIA 1CQGA 2V41A 2C0GA 1YKCA 3VLNA 2H1GA 1JZDA 3D22A 5DCHA 1J08A 1GLPA 2C1YA 2EIOA 5EPFA 3UAPA 3PH9A 3FR6A 1TTZA 4BWSA 1OC9A 3ZLPA 4G9HA 5GAND 1WE0A 3PINA 1X0RA 4ECIA 4ZXGA 5CREA 2FA4A 4HU9A 5G31A 2L6DA 3FYGA 1E6BA 4ULXA 5J4UA 2R4VA 3ZZXA 2RUEA 1GTAA 1FAAA 4L5OA 1HNBA 4AJ6A 4ZB6A 3RAZA 3IA1A 5DJLA 1K3LA 1YEPA 2F3MA 4G2EA 3NOFA 3N9JA 1ERVA 2HZFA 2FLSA 4K1FA 5IMCA 1FW1A 3FRCA 3G7YA 2EIQA 4YAPA 1AQXA 2LNTA 1AAZA 2YWNA 2HRFA 3HCZA 1BYEA 2REMA 2P5QA 2WULA 2VD1A 4HEA2 4K9ZA 4E8HA 2IJYA 4Q5FA 4G10A 4MJEA 13GSA 1XIYA 1GSDA 4N11A 4V1Ag 2LRCA 5HFKA 3DGQA 4HJ2A 1SK0A 2C3QA 3EURA 1MD4A 1XFLA 2IL3A 1I9DA 2NVLA 4EDYA 1Z9HA 2PERA 2PGTA 1NHYA 5IMVA 1O85A 4TOPA 1B48A 1SYXA 3UL3A 2JSZA 3QFBC 1EOGA 5EY6A 2K8SA 2ZUPA 4ZL8A 1XWAA 2RM6A 5FT3A 5H5QA 1TRSA 2XC2A 4PUAA 2PVOC 3TGZA 2NPBA 5GZZB 4OD7A 2I1UA 3C71A 4RUVA 1R5PA 3TCOA 5HR3A 1WJKA 1WRYA 3RHCA 1X9WB 2IMEA 3EMPA 2WJUA 1YY7A 12GSA 2YWIA 5KN3A 4JR4A 1S3AA 2GSQA 1BG5A 1C72A 3Q6OA 3SWLA 2X99A 2H6YA 2YV7A 1MDKA 3LJRA 1YDKA 1YQ1A 4PNFA 1MD3A 2OACA 1PRXA 2L59A 6GSTA 4OFTA 3CRTA 1XBSA 2HT9A 4PURA 3KP8A 3H4KA 4IKHA 2GQLA 5ECLB 4K7NA 5ECSA 2C0DA 4ZBBA 2DIZA 5DALB 1U87A 4O92A 4PUFC 3A2VA 4HI7A 5F0GA 2F51A 4POBA 1EEJA 4MCUA 4N0VA 3UJ1A 3UVTA 2VM2A 4HQZA 1R7HA 3E3EA 1BEDA 5A4UA 5E59A 3ZITA 1GSYA 2ON7A 5A4VA 2CQ9A 2B7JA 3KGKA 1SL0B 2H1AA 5H5SA 5ABRA 4V2LA 3FK8A 3W8SA 4CW9A 3FZAA 2M80A 1VGLA 1TRWA 2H6ZA 4MZBA 1SKWB 3GIXA 1SKSB 1QQ2A 3W8JA 2B1KA 1XVWA 4IP1A 1OE8A 4TR3A 2IFQB 2N5BA 1AQWA 3IXRA 3BCIA 4MJAA 4XRDA 17GSA 2H76A 1K3OA 3F9UA 2YWMA 5COHA 4V2NA 5ECPB 2CZ3A 2PBJA 6GSWA 1XXUA 3GNJA 4GQFA 1F3BA 3TJKA 1FOVA 3GTUB 4KDXA 1M99A 1N8JA 3ERWA 1NHOA 1SJZA 1ABAA 2YZHA 1VF3A 5JCUA 3GX8A 4IQ1A 2CA8A 4O32A 5DALA 5DJMA 4G19A 1AUCA 4H86A 1Z3EA 3CBUA 1SK1A 3APSA 3UARA 2HE3A 5DAKB 4ECJA 4JR6A 1B4PA 5D9XA 3FW2A 2FD3A 4MK3A 3VFIA 3S9FA 2CVBA 2JZRA 2L5LA 1O7UA 2ZCTA 1QGVA 4IS0A 4Q5QA 4AF2A 5HFGA 1XW5A 2LRTA 4OO4A 4TR4A 1V2AA 1T4YA 2B7KA 2DJ1A 3EU4A 4QL9A 1A2MA 4NHWA 2LQOA 1TXXA 1PMTA 2QGVA 1AXDA 1SL2B 3US3A 3TUEA 1B9YC 5E4WA 1G0TA 1T00A 2VCWA 5CRDA 5EVOA 1O8XA 2HI7A 4TR0A 1R5AA 2EC4A 2M72A 4K0GA 1ERTA 1A2JA 1T8EB 3KZQA 4F0CA 3QMXA 3NIVA 2P31A 1GSUA 4YH2A 5JWRB 1ACVA 3F4SA 4DEJA 3GTUA 1XPVA 5KN2A 5G2ZA 3FY7A 1TK0B 5KEJA 3APOA 1V9WA 4POKA 1WPIA 3CSIA 2DMMA 3O6TA 4D73B 3QCPA 2NDOA 3LEFA 1ZYQB 2H8LA 1GP1A 2CV4A 2AV4A 3WGEA 2H70A 1BJXA 3G9BA 3KTLA 1NSWA 1PKWA 5AIXA 5ECQB 2CT6A 5IM9A 4BA7A 1SK2A 2IWTA 4HQSA 4NPBA 2YV9A 2GTUA 4L5LA 5KN0A 2MYGA 3HYPA 1X5DA 2R3XA 3GKMA 4IHUA 4TR1B 3L9VA 5ECNB 5ID2A 2Z9SA 3IBHA 4WETA 5C04A 3GA4A 4MLYA 1VF1A 4I2UA 5INYA 3RPNA 3KEBA 3TJJA 1JZOA 4XS4A 4F82A 2R6KA 4E8EA 2GT5A 2GZZA 4HU7A 5G1LA 1KTEA 2XPEA 1EEMA 3HZ4A 3M0FA 5JCGA 1GWCA 1LBKA 2F9SA 2L57A 16GSA 2KUCA 4GWRA 4J56E 1GNWA 5EL8A 2V1MA 2J23A 1Z5YE 2YWOA 2G0FA 2LQQA 3GKKA 5ELAA 2O8VB 4IGJA 1GH2A 1O6JA 4HJMA 1M2AA 2GQMA 4HOJA 3GURA 4D73A 2P0GA 4ZB9A 1Y6EA 2JACA 2P5RA 3ZFLA 3ZL5A 1Y25A 2I4AA 4P3YB 3F3QA 3A3TA 4MF6A 4NHZA 2B5YA 2LSTA 4MZCA 4XIHA 4MJBA 5CO3A 4Q5RA 1AW9A 4JRRA 3BBYA 1JZRA 2N5FA 3GN3A 5ENUA 5A4WA 2F8AA 4KNDA 5D9TA 4Q5NA 1G6YA 1WWJA 4XHMA 5C00A 2YCDA 4Z7XA 1ILOA 3HA9A 1U6TA 2FWFA 3PGTA 3D6IA 1DE1A 3RDWA 1N2AA 3TOUA 1UN2A 1HNAA 1XWBA 5CRGA 1QK8A 1UC7A 4V2MA 4J2FA 2MMOA 4GXZA 1PGTA 4KDUA 1FG4A 3VPTA 2K18A 1SENA 1PN9A 3EU3A 1PL1A 3WT2A 4PGTA 2RM5A 4I6XA 4POLA 2KP1A 2LJAA 2PMTA 5CP1A 2XPDA 3IK7A 1TI3A 1AIUA 2LKUA 2H66A 2FHEA 2L4QA 1S3CA 1DUGA 4RQXA 3UEMA 5DDLA 2V6KA 3ISOA 3TB2A 1TKDB 1Z7PA 1ERWA 3C8EA 3F0IA 1XW9A 3I9V2 4PNGA 2TIRA 1BQ7A 1ZOFA 1B9XC 3FEUA 2V2GA 2R37A 3ERFA 5HFIA 3MNGA 1TRVA 2DIYA 2EIRA 1BAYA 3ZIVA 2VO4A 2VL9A 1M0UA 4KA0A 4XRAA 4GSNA 2JSYA 4MH3A 2H0GA 1GTIA 1EGRA 2GZYA 2GGTA 1WOUA 1GSEA 2HNLA 1YEXA 5F8BA 4YQVA 3DWVA 4ILFA 1GULA 4MMMA 5HR2A 3H79A 3IOSA 1SKRB 2FWEA 3ME8A 2JZSA 4DSSB 1O73A 1G7EA 2H1DA 1K0OA 2YJHA 3HXSA 2AB6A 4WKWA 3UVHA 3DEXA 2XBQA 1A23A 4XCSA 2IIYA 3GMFA 2XHFA 5JCWA 4DSQA 3J7Yk 1XZOA 4MP4A 3L78A 5B8AA 2L5OA 1ZL9A 1ZZYA 3CRUA 1U3IA 3WYWA 2WDUA 5G30A 4EF0A 4MDCA 2HZEB 4L8EA 1MDIA 3C73A 4N30A 2VOCA 5IOXA 5AN1A 4ML6A 3TJGA 5D8IA 4QL7A 3QAWA 3C1RA 3HVSA 3HVXA 5IO2A 4KGIA 5LNKe 4FIWA 4KX4A 1TI1A 2PWJA 1JLVA 2O7KA 3TKRA 3IDVA 4O7HA 3ZMKA 2VIMA 1Z6MA 1PX7A 5IMDA 2IMDA 2MMAA 3KM6A 2LJKA 4EDZA 2LTKA 4CDOA 1T4ZA 2DC5A 1B8XA 3HHVA 6GSYA 5ECKB 2X8CA 4ZL9A 5IPHA 3LSZA 5D9VA 3M1GA 3AY8A 4ZIJA 1Z7RA 10GSA 3KH7A 1MDJA 1OAZA 4WEYA 2VCXA 2LEGA 2ZNMA 4PQIA 2H0HA 1YF0A 1SJIA 4ACSA 1A0RP 1IYIA 1GRXA 2FA8A 1F6MC 4NV2A 1FB0A 1Q4JA 3TJBA 5IPGA 1DSBA 5FHIA 2O87A 2PVQA 3CSHA 5G5EA 1V98A 2A2SA 1YJ6A 3WGXA 3KP9A 1U88A 2K6VA 3A5WA 3ME7A 3P8WA 2FWHA 2JU5A 1T1VA 2H1BA 4LL1B 3L0HA 2KP2A 4EUYA 1GUKA 2GSTA 3IHQA 1ZMAA 1OE7A 1V40A 2WZ9A 5IMFA 3F63A 1K3YA 1H75A 5ECOB 3DVWA 3HJOA 3KD0A 3VK9A 14GSA 3VPQA 3JCML 2OADA 2VLUA 1F9MA 1FHEA 1ST9A 2OKAA 3GV1A 2OJLA 4N10A 3QOUA 5ECMB 1Z6NA 3VI7A 2GZPA 4J57E 2OBKA 1USBA 5F07A 3HKRA 3LXZA 2VCZA 1GLQA 3F8UA 3I69A 3LQ7A 3IAM2 4BVYA 2O85A 5G5FA 3HZ8A 5ECIB 5KN1A 2PPTA 3KJYA 1PKZA 3VURA 2C0FA 4HS1A 4MF7A 4NV5A 2VL3A 3Q74A 1X9MB 1K0DA 3TKQA 2YJ7A 5D9WA 5GAPD 4LL4B 3EC3A 4IN0A 4EO3A 4F0BA 3VWUA 1EP7A 2E7PA 4EVMA 2E2MA 4OMVA 2E0QA 5J9BA 1K0CA 2R2JA 2IFQA 4ISDA 1A24A 1GUMA 3KXOA 1TK5B 1TJDA 1A8YA 2A4VA 3DVXA 4TXOB 3ZMLA 1SJ6A 3E9JB 1JHBA 1OVNA 4ZILA 2QSIA 3TKSA 1T7PB 1GL8A 1F3AA 2YANA 4NAXA 2DJKA 3Q19A 5B6NA 2MMZA 4F9ZA 1EWXA 3GL5A 1QFNA 1B4QA 4PXOA 2V32A 2KLXA 3IC4A 2B1LA 4GSTA 4IVFA 1FVKA 2H75A 4JEDA 3DIEA 19GSA 1TOFA 5DAKA 4HZ4A 1IYHA 1ZGNA 1NM3A 3APQA 5AGYA 1K0NA 3BCKA 2CZ2A 4K7IA 2LNSA 2WRTA 1SD8A 1M9AA 4RI7A 6GSXA 1V58A 2B3SA 2VAFA 3MDKA 2B5EA 3DXBA 4TKYA 1H4OA 1RK4A 3R2QA 4DVCA 1FVJA 4PX1A 2H6XA 1KBNA 4MA9A 1TDIA 2H19A 3QAGA 1HYUA 1GTUA 2VD0A 3GKXA 2RIIA 2KOKA 4YAVA 4CHSA 3UBKA 1K0AA 1OYJA 3VWWA 2O89A 4N0ZA 2I9HA 4KB3A 1ZYEA 2OE3A 5IOWA 1M2BA 3OR5A 1UVZA 3LXTA 3DD3A 4HZ2A 1X9SB 3A2XA 3I6AA 1W4VA 2C3TA 2VCTA 2D2ZA 1XOBA 2DSAA 3LG6A 4IELA 5J3RA 1PL2A 2K9FA 3HVVA 2CAIA 5F06A 3M3MA 3TRXA 11GSA 4IJ3A 5ECHB 3RBTA 2LUSA 3MAKA 5DCGA 1S3DA 3P90A 4KUNA 4IW9A 2PUKC 3IRAA 3L9UA 4K8MA 4L0UA 2VCVA 2H01A 4TR1A 4KH7A 4FYCA 6GSUA 2IN3A 3ZVJA 1E2YA 2B6MA 4WXTA 5ECRB 2IMIA 22GSA 2C4JA 4BWQA 3IAS2 3F3RA 3TRQA 3ZVJD 2BTOT 1V57A 4BL7A 4WBJA 1MTCA 2X8GA 3F6DA 2HSHA 2X64A 2GDRA 2TRCP 2CVKA 3C1SA 4YQUA 2H71A 4EC0A 3ED3A 2VUPA 4IJIA 1PX6A 1T3BA 3DKSA 5JWOB 1EV9A 3FKFA 1X5EA 1J9BA 2IPAA 2GVPA 3KMNA 1PQNA 2HFDA 3F4RA 1ERUA 2WCIA 1QMVA 5D73A 4FO5A 3D4MA 4ZBAA 4JE1A 4AGSA 1W89A 4RQRA 3I43A 2JADA 3MSZA 3RHBA 1M2DA 5H5RA 5GSSA 4GSSA 5G1KA 2IMKA 2GSRA 3P7XA 2AUVA 1GSFA 1WP0A 5F05A 1SYRA 2LRNA 3VWVA 1ML6A 3N5OA 3ZIJA 5B7CA 5CNWA 2C0EA 2IMFA 3UOMA 4X43A 4ECBA 5IO0A 2R5GA 5LCZA 2FWGA 1HNCA 2QC7A 3UMAA 4OFMA 3CSJA 1A0FA 4KAEA 1J0FA 1EGOA 2XBIA 1GSQA 3TRPA 4LA1A 4MH2A 3WT1A 1K0MA 3TOTA 4NMUA 1CQHA 5B6MA 1X5CA 5HR0A 4I5QA 3KH9A 3O76A 4GLTA 5AISA 3GHAA 5HQPA 1FB6A 3D4TA 2JL4A 1OKDA 2GQKA 2PU9C 3O3TA 1JFUA 3VI5A 4X0XA 3LWAA 2H74A 1SL1B 1TW9A 6GSSA 4OFNA 1U3AA 4KW6A 1OC8A 2E2GA 3RPPA 2VL2A 3F6FA 1SU9A 2L6CA 3P2AA 4AJ7A 3GSSA 3ERGA 1NW2A 4WF4A 3FR3A 3QD9A 4IQAA 1R4WA 2OE1A 2WFCA 1XOAA 3IR4A 2CVDA 2GT6A 5AIVA 4KCEA 2K8VA 4KSOA 8GSSA 3D21A 9GSSA 3D0ZA 3EVIA 3EE2A 4L0WA 1BX9A 3GRXA 1XVQA 4V1Ap 2OA7A 3IE3A 4TW5A 3D5JA 4F03A 1WIKA 2QKEA 3LGCA 4MZWA 3LFLA 2LV3A 2B5XA 4DSSA 1PSQA 4EE0A 1A2LA 3J7Yb 1EZKA 4OWYA 3NZNA 5IMZA 2H73A 1WMJA 2A2RA 5CRWA 4IP6A 2VM1A 4LLRA 1THOA 3M9JA 5GSTA 4WR5A 1LU4A 2I81A 4ECCA 2I3YA 4K6XA 1EOHA 1XWGA 2H0IA 1G6WA 1XWCA 2VLVA 1OC3A 3VWXA 2PN8A 4ZBDA 4AJ8A 2HZEA 2KHPA 2TRXA 2N5AA 3IK9A 1GUHA 2VLTA 3BD2A 2GLRA 5IIZA 2DMLA 1SD9A 3EWLA 3M8NA 4XS6A 5DBQA 3QR6A 5CAXA 3TKSC 2HXKA 2H72A 2ES7A 3HJPA 3K8NA 20GSA 2LJRA 3DMLA 2ALBA 3HJMA 3QFAC 5IMAA 1PD21 1G7OA 2YOIA 3ZREA 3QDNA 2ON5A 2FNOA 4MPGA 3GH9A 4FYUA 5CYYA 4KSMA 2RUFA 2JZTA 4RI6A 4GQCA 1TP9A 5LD0A 1DBYA 2OBIA 2YZUA 4LMWA 2VCQA 4I8BA 4GRFA 4EL1A 1R26A 18GSA 5J9CA 3F4TA 4OO5A 3M9KA 2AJQB 5FWGA 4NWYA 1VF2A 5DQYA 3FZ5A 4JZQA 4KE3A 2YNXA 2OE0A 1K0BA 1YF1A 3FR9A 3IV4A 1HD2A 1GTBA 1PA3A 4MPFA 5DQSA 4LMVA 4GF0A 2M46A 5D93A 3ZYWA 4I97A 3UIWA 5D96A 2MZCA 1TRUA 4ZL7A 2GSSA 1UA5A 1TK8B 2WGRA 2LS5A 1O81A 4ML1A 3IPZA 3GX0A 1MEKA 4K2DA 3CTFA 1VF4A 1F37A 7GSSA 3C7MA 3L4NA 1URMA 1Q98A 3KIJA 5J5NA 3H1NA 3HY2A 3ZTLA 5ID2B 2J9HA 3EINA 1EP8A 5J41A 3CYNA 2HSYA 4MF5A 2C80A 3LYPA 4POMA 1JZWA 3W6GA 2NBSA 4BVXA 3MWHA 4XS4B 2HYXA 3KMOA 2AAWA 3QAVA 4IBPA 3CMIA 1GSSA 1RW1A 3LORA 2DJJA 2AYTA 1AC1A 4FH8A 4KDYA 3CXGA 3H8QA 5JWQB 2BJXA 2C8UA 4WBRD 3GUSA 4ID0A 3L9SA 3GL3A 3V1WA 2C3NA 4BPYA 1QUWA 3DYRA 2AHEA 3G7IA 4OCFA 1A8LA 1F2EA 4EXJA 1KEBA 3KCMA 1VRSD 3A2WA 3DRNA 4NXIA 4TVEA 3FHKA 3ZRDA 2G2QA 4FYBA 1DE2A 3HDCA 2DJ2A 1JLWA 2FCHA 1TU7A 3EYTA 2MBSA 3TKPA 1QXHA 3FZ9A 3H93A 4JU5A 4O5RA 1ZCPA 6GSVA 5IQYA 1ON4A 3SBCA 3UBLA 1YZXA 2YPMA 2F8FA 4TRXA 1M7TA 2DBCA 1YKAA 5HR1A 5DVBA 4HDEA 4QQ7A 1O8WA 3Q18A 4XS1A 2H30A 3EMXA 4WF5A 4MJCA 3GYKA 4K0NA 1GNEA 4TXOA 3GSTA 2MBTA 4DSRA 1I5GA 2CX4A 2NTOA 4OCEA 2FGXA 5L71A 2V6OA 3GKNA 4EKZA 4X1UA 3QPMA 4F2IA
chains in the Genus database with same CATH superfamily
3U5RE 1XW6A 3PR8A 4JBBA 2CX3A 5ELGA 4GTUA 2YP6A 4PQHA 3TJFA 2YN1A 3MIXA 4YQMA 3BJ5A 1OC9B 4TXVA 1OKTA 3G7JA 3WGDA 3GH6A 4MABA 4XTSA 2DJ3A 1FO5A 2MMNA 4PQ1A 3LYKA 3U6VA 2DLXA 1EV4A 2HRNA 5CRHA 1TU8A 1XCCA 2VL2C 1RQMA 2DJ0A 3GFKA 4ZB8A 2L4CA 4K7OA 2FY6A 4I2TA 1HQOA 2GS3A 2HLSA 3E0UA 2WB9A 3KTBA 3BOAA 4TN8A 1THXA 2BMXA 3HD5A 3FZ4A 1XWKA 5A5KA 5B8BA 1KNGA 3CTGA 4HUAA 2X8HA 1M9BA 3WD6A 1AQVA 2WS2A 1LJRA 2FUG2 4WR4A 2CAQA 3ZFBA 4KCAA 3TKSE 3TDGA 4GCIA 2RLIA 1CQGA 2V41A 2C0GA 1YKCA 3VLNA 2H1GA 1JZDA 3D22A 5DCHA 1J08A 1GLPA 2C1YA 2EIOA 5EPFA 3UAPA 3PH9A 3FR6A 1TTZA 4BWSA 4K5SA 1OC9A 3ZLPA 2HRAA 4G9HA 5GAND 1WE0A 3PINA 1X0RA 4ECIA 4ZXGA 5CREA 3EPTA 2FA4A 4HU9A 5G31A 2L6DA 3FYGA 1E6BA 4ULXA 5J4UA 2R4VA 1M3JA 3ZZXA 2A4HA 2RUEA 1GTAA 1FAAA 5KOWA 4L5OA 1HNBA 4AJ6A 4ZB6A 3RAZA 3IA1A 5DJLA 1K3LA 1YEPA 2F3MA 4G2EA 3NOFA 3N9JA 1ERVA 2HZFA 2FLSA 4K1FA 5IMCA 1FW1A 3MYDA 3FRCA 3G7YA 2EIQA 4YAPA 1AQXA 2LNTA 1AAZA 4FQUA 2A2PA 2YWNA 2HRFA 3HCZA 1BYEA 2REMA 2P5QA 2WULA 2VD1A 4HEA2 4K9ZA 4E8HA 2IJYA 4Q5FA 4G10A 4MJEA 13GSA 1XIYA 1GSDA 4N11A 4V1Ag 2LRCA 5HFKA 3DGQA 4HJ2A 1SK0A 2C3QA 3EURA 1MD4A 1XFLA 2IL3A 1I9DA 2NVLA 4EDYA 1Z9HA 2PERA 2PGTA 4O5QA 1NHYA 5IMVA 1O85A 4TOPA 1B48A 1SYXA 3UL3A 2JSZA 3QFBC 1EOGA 5EY6A 2K8SA 2ZUPA 4ZL8A 1XWAA 2RM6A 5FT3A 5H5QA 1TRSA 2XC2A 4PUAA 2PVOC 3TGZA 2NPBA 5GZZB 1ZYNA 4OD7A 2I1UA 3C71A 4RUVA 2X4AA 1R5PA 3TCOA 5HR3A 1WJKA 1WRYA 3RHCA 1X9WB 2IMEA 3EMPA 2WJUA 1YY7A 12GSA 2YWIA 5KN3A 4JR4A 1S3AA 2GSQA 1BG5A 1C72A 3Q6OA 3SWLA 1PFOA 2H6YA 2X99A 2YV7A 1MDKA 3LJRA 1YDKA 1YQ1A 4PNFA 1MD3A 2OACA 1PRXA 2L59A 6GSTA 4OFTA 3CRTA 1XBSA 2HT9A 4PURA 3KP8A 3H4KA 4IKHA 2GQLA 5ECLB 4K7NA 5ECSA 2C0DA 4ZBBA 2DIZA 5DALB 1U87A 4O92A 4PUFC 3A2VA 4HI7A 5F0GA 2F51A 4POBA 1EEJA 4MCUA 4N0VA 3UJ1A 3UVTA 2VM2A 4HQZA 1R7HA 3E3EA 1BEDA 5A4UA 5E59A 3ZITA 1GSYA 2ON7A 5A4VA 2CQ9A 2B7JA 3IHGA 3KGKA 1SL0B 2H1AA 5H5SA 5ABRA 4V2LA 3FK8A 3W8SA 4CW9A 3FZAA 4Z2UA 2M80A 1VGLA 1TRWA 2H6ZA 4MZBA 1SKWB 3GIXA 1SKSB 1QQ2A 3W8JA 2B1KA 1XVWA 4IP1A 1OE8A 4TR3A 2IFQB 2N5BA 1AQWA 3IXRA 3BCIA 4MJAA 4XRDA 17GSA 2H76A 1K3OA 3F9UA 2YWMA 5COHA 4V2NA 5ECPB 2CZ3A 2PBJA 6GSWA 1XXUA 3GNJA 4GQFA 1F3BA 3TJKA 1FOVA 3GTUB 4KDXA 1M99A 1N8JA 3ERWA 1NHOA 1SJZA 1ABAA 2YZHA 1VF3A 5JCUA 3GX8A 4IQ1A 2CA8A 4O32A 5DALA 5DJMA 4G19A 1AUCA 4H86A 1Z3EA 3CBUA 1SK1A 3APSA 3UARA 2HE3A 5DAKB 4ECJA 4JR6A 1B4PA 5D9XA 3FW2A 2FD3A 4MK3A 3VFIA 3S9FA 2CVBA 2JZRA 2L5LA 1O7UA 2ZCTA 1QGVA 4IS0A 4Q5QA 4AF2A 1ZYPA 5HFGA 1XW5A 2LRTA 4OO4A 4TR4A 1V2AA 1T4YA 2B7KA 2DJ1A 3EU4A 4QL9A 1A2MA 4NHWA 2LQOA 1TXXA 1PMTA 2QGVA 1AXDA 1SL2B 3US3A 3TUEA 1B9YC 5E4WA 1G0TA 1T00A 2VCWA 5CRDA 5EVOA 1O8XA 2HI7A 4TR0A 1R5AA 2EC4A 2M72A 4K0GA 1ERTA 1A2JA 1T8EB 3KZQA 4F0CA 3QMXA 3NIVA 2P31A 1GSUA 2R0PA 4YH2A 5JWRB 1ACVA 3F4SA 4DEJA 3GTUA 1XPVA 5KN2A 5G2ZA 3HVNA 3FY7A 4ICYA 1TK0B 5KEJA 3APOA 1V9WA 4POKA 1WPIA 3CSIA 2DMMA 3O6TA 4D73B 3QCPA 2NDOA 3LEFA 1ZYQB 2H8LA 1GP1A 2CV4A 2AV4A 3WGEA 2H70A 1BJXA 3G9BA 3KTLA 1NSWA 1PKWA 5AIXA 5ECQB 2CT6A 5IM9A 4BA7A 1SK2A 4BIKA 2IWTA 4HQSA 4NPBA 2YV9A 2GTUA 4L5LA 5KN0A 2MYGA 3HYPA 2HSMA 1X5DA 2R3XA 3GKMA 4IHUA 4TR1B 3L9VA 5ECNB 5ID2A 2Z9SA 3IBHA 4WETA 5C04A 3GA4A 4MLYA 1VF1A 4I2UA 5INYA 3RPNA 3KEBA 3TJJA 1JZOA 4XS4A 4F82A 2R6KA 4E8EA 2GT5A 2GZZA 4HU7A 5G1LA 1KTEA 2XPEA 1EEMA 3HZ4A 3M0FA 4BL7B 5JCGA 1GWCA 1LBKA 2F9SA 2L57A 16GSA 2KUCA 4GWRA 4J56E 1GNWA 5EL8A 2V1MA 2J23A 1Z5YE 2YWOA 2G0FA 2LQQA 3GKKA 5ELAA 2O8VB 4IGJA 1GH2A 1O6JA 4HJMA 1M2AA 2GQMA 4HOJA 3GURA 4D73A 2P0GA 4ZB9A 1Y6EA 2JACA 4KF9A 2P5RA 3ZFLA 3ZL5A 1Y25A 2I4AA 4P3YB 3F3QA 3A3TA 4MF6A 4NHZA 2B5YA 2LSTA 4MZCA 4XIHA 4MJBA 5CO3A 4Q5RA 1AW9A 4JRRA 3BBYA 1JZRA 2N5FA 3GN3A 5ENUA 5A4WA 2F8AA 4KNDA 5D9TA 4Q5NA 1G6YA 1WWJA 4XHMA 5C00A 2YCDA 4Z7XA 1ILOA 3HA9A 1U6TA 2FWFA 3PGTA 3D6IA 1DE1A 3RDWA 1N2AA 3TOUA 1UN2A 1HNAA 1XWBA 5CRGA 1QK8A 1UC7A 4V2MA 4J2FA 2MMOA 4GXZA 4Z2TA 1PGTA 4KDUA 1FG4A 3VPTA 2K18A 1SENA 1PN9A 3EU3A 1PL1A 3WT2A 4PGTA 2RM5A 4I6XA 4POLA 2KP1A 2LJAA 2PMTA 5CP1A 2XPDA 4G0KA 3IK7A 1TI3A 1AIUA 2LKUA 2H66A 2FHEA 2L4QA 1S3CA 1DUGA 4RQXA 3UEMA 5DDLA 2V6KA 3ISOA 3TB2A 1TKDB 1Z7PA 1ERWA 3C8EA 3F0IA 1XW9A 3I9V2 4PNGA 2TIRA 1BQ7A 1ZOFA 1B9XC 3FEUA 2V2GA 2R37A 3ERFA 5HFIA 3MNGA 4USSA 1TRVA 2DIYA 2EIRA 1BAYA 3ZIVA 2VO4A 2VL9A 3R3EA 1M0UA 4KA0A 4XRAA 4GSNA 2JSYA 1XG8A 4MH3A 2H0GA 1GTIA 1EGRA 2GZYA 2GGTA 1WOUA 2X49A 4A5PA 1GSEA 2HNLA 1YEXA 5F8BA 4YQVA 3DWVA 4ILFA 1GULA 4MMMA 5HR2A 3IC8A 3H79A 3IOSA 1SKRB 2FWEA 3ME8A 2JZSA 4HSCX 4DSSB 1O73A 1G7EA 2H1DA 1K0OA 2YJHA 3HXSA 2AB6A 4WKWA 3UVHA 3DEXA 2XBQA 1A23A 4XCSA 2IIYA 3GMFA 2XHFA 5JCWA 4DSQA 3J7Yk 1XZOA 4MP4A 3L78A 5B8AA 2L5OA 1ZL9A 1ZZYA 3CRUA 1U3IA 3WYWA 2WDUA 5G30A 4EF0A 4MDCA 2HZEB 4L8EA 1MDIA 3C73A 4N30A 2VOCA 5IOXA 1PN0A 5AN1A 4ML6A 3TJGA 5D8IA 4QL7A 1FOHA 3QAWA 3C1RA 3HVSA 3HVXA 5IO2A 4KGIA 5LNKe 4FIWA 4KX4A 1TI1A 2PWJA 1JLVA 2O7KA 3TKRA 3IDVA 4O7HA 3ZMKA 2VIMA 2HRKA 1Z6MA 1PX7A 5IMDA 2IMDA 2MMAA 3KM6A 2LJKA 4EDZA 2LTKA 4CDOA 1T4ZA 2DC5A 1B8XA 3HHVA 4YKGA 6GSYA 5ECKB 2X8CA 4ZL9A 5IPHA 3LSZA 5D9VA 3M1GA 3AY8A 4ZIJA 1Z7RA 10GSA 3KH7A 1MDJA 1OAZA 4WEYA 2VCXA 2LEGA 4BVYB 2ZNMA 4PQIA 2H0HA 1YF0A 1SJIA 3LW9A 4ACSA 1A0RP 1IYIA 1GRXA 2FA8A 1F6MC 4NV2A 1FB0A 1Q4JA 3TJBA 2R0CA 5IPGA 1DSBA 5FHIA 2O87A 2PVQA 3CSHA 5G5EA 1V98A 2A2SA 1YJ6A 3WGXA 3KP9A 1U88A 2K6VA 2UZ8A 3A5WA 3ME7A 3P8WA 2FWHA 2JU5A 1T1VA 2H1BA 4LL1B 3L0HA 2KP2A 3PPUA 4EUYA 1GUKA 2GSTA 3IHQA 1ZMAA 1OE7A 1S3RA 1V40A 2WZ9A 5KOXA 5IMFA 3F63A 1K3YA 1H75A 5ECOB 3DVWA 3HJOA 3KD0A 3VK9A 14GSA 3VPQA 3JCML 2OADA 2VLUA 1F9MA 1FHEA 4O5UA 1ST9A 2OKAA 3GV1A 2OJLA 2DKIA 4N10A 3QOUA 5ECMB 1Z6NA 3VI7A 2GZPA 4J57E 2OBKA 1USBA 5F07A 3HKRA 3LXZA 3A5IA 2VCZA 1GLQA 3F8UA 3I69A 3LQ7A 3IAM2 4BVYA 2O85A 5G5FA 3HZ8A 5ECIB 5KN1A 2PPTA 3KJYA 1PKZA 3VURA 2C0FA 4HS1A 4MF7A 4NV5A 2VL3A 3Q74A 1X9MB 1K0DA 3TKQA 2YJ7A 5D9WA 5GAPD 4LL4B 3EC3A 4IN0A 4EO3A 4F0BA 3VWUA 1EP7A 2E7PA 4EVMA 2E2MA 4OMVA 2E0QA 5J9BA 1K0CA 2R2JA 2IFQA 4ISDA 1A24A 1GUMA 3FMWA 3KXOA 1TK5B 1TJDA 1A8YA 2A4VA 3DVXA 4TXOB 3ZMLA 1SJ6A 3E9JB 1JHBA 1OVNA 4ZILA 2QSIA 3TKSA 1T7PB 1GL8A 1F3AA 2YANA 4NAXA 2DJKA 3Q19A 5B6NA 2MMZA 4F9ZA 1EWXA 3GL5A 1QFNA 1B4QA 4PXOA 2V32A 2KLXA 3IC4A 2B1LA 4GSTA 4IVFA 1FVKA 2H75A 4JEDA 3DIEA 19GSA 1TOFA 5DAKA 4HZ4A 1IYHA 1ZGNA 1NM3A 3APQA 5AGYA 1K0NA 3BCKA 2CZ2A 4K7IA 2LNSA 2WRTA 1SD8A 1M9AA 4RI7A 6GSXA 1V58A 2B3SA 2VAFA 3MDKA 2B5EA 3DXBA 4TKYA 1H4OA 1RK4A 3R2QA 4DVCA 1FVJA 4PX1A 2H6XA 1KBNA 4MA9A 1TDIA 2H19A 3QAGA 1HYUA 1GTUA 2VD0A 4X4JA 3GKXA 2RIIA 2KOKA 4YAVA 4CHSA 3UBKA 1K0AA 1OYJA 4K2XA 3VWWA 2O89A 4N0ZA 2I9HA 4KB3A 1ZYEA 2OE3A 5IOWA 1M2BA 3OR5A 4MNNA 1UVZA 3LXTA 3DD3A 4HZ2A 1X9SB 3A2XA 3I6AA 1W4VA 2C3TA 2VCTA 2D2ZA 1XOBA 2DSAA 3LG6A 2R0GA 4IELA 5J3RA 1PL2A 2K9FA 3HVVA 2CAIA 5F06A 3M3MA 3TRXA 11GSA 4IJ3A 5ECHB 3RBTA 2LUSA 3MAKA 5DCGA 1S3DA 3P90A 4KUNA 4IW9A 2PUKC 3IRAA 3L9UA 4K8MA 4L0UA 2VCVA 2H01A 4TR1A 4KH7A 4FYCA 6GSUA 2IN3A 3ZVJA 1E2YA 2B6MA 4WXTA 5ECRB 2IMIA 22GSA 2C4JA 4BWQA 3IAS2 3F3RA 3TRQA 3ZVJD 2BTOT 1V57A 4BL7A 4WBJA 1MTCA 2X8GA 3F6DA 2HSHA 2X64A 2GDRA 2TRCP 2CVKA 3C1SA 4YQUA 2H71A 4EC0A 3ED3A 2VUPA 4IJIA 1PX6A 1T3BA 3DKSA 5JWOB 1EV9A 3FKFA 1X5EA 1J9BA 2IPAA 2GVPA 3KMNA 1PQNA 2HFDA 3F4RA 1ERUA 2WCIA 1QMVA 5D73A 4FO5A 3D4MA 4ZBAA 4JE1A 4AGSA 1W89A 4RQRA 3I43A 2JADA 3MSZA 3RHBA 1M2DA 5H5RA 5GSSA 4GSSA 5G1KA 2IMKA 2GSRA 3P7XA 2AUVA 1GSFA 1WP0A 5F05A 1SYRA 2LRNA 3VWVA 1ML6A 3N5OA 3ZIJA 3CQFA 5CNWA 5B7CA 2C0EA 2IMFA 3UOMA 4X43A 4ECBA 5IO0A 2R5GA 5LCZA 2FWGA 1HNCA 2QC7A 3UMAA 4OFMA 3CSJA 1A0FA 4KAEA 1J0FA 1EGOA 2XBIA 1GSQA 3TRPA 4LA1A 4MH2A 3WT1A 1K0MA 3TOTA 4NMUA 1CQHA 5B6MA 1X5CA 5HR0A 4I5QA 3KH9A 3O76A 4GLTA 5AISA 3GHAA 5HQPA 1FB6A 3D4TA 2JL4A 1OKDA 2GQKA 2PU9C 3O3TA 1JFUA 3VI5A 4X0XA 3LWAA 2H74A 1SL1B 1TW9A 6GSSA 4OFNA 1U3AA 4KW6A 1OC8A 2E2GA 3RPPA 2VL2A 3F6FA 1SU9A 2L6CA 3P2AA 4AJ7A 3GSSA 3ERGA 1NW2A 4WF4A 3FR3A 3QD9A 4IQAA 1R4WA 2OE1A 2WFCA 1XOAA 3IR4A 2CVDA 2GT6A 5AIVA 4KCEA 2K8VA 4KSOA 8GSSA 3D21A 9GSSA 3D0ZA 3EVIA 3EE2A 4L0WA 1BX9A 3GRXA 1XVQA 4V1Ap 2OA7A 3IE3A 4TW5A 3D5JA 4F03A 1WIKA 2QKEA 3LGCA 4MZWA 3LFLA 2LV3A 2B5XA 4DSSA 1PSQA 4EE0A 1A2LA 3J7Yb 1EZKA 4OWYA 3NZNA 5IMZA 2H73A 1WMJA 2A2RA 5CRWA 4IP6A 2VM1A 4LLRA 1THOA 3M9JA 5GSTA 4WR5A 1LU4A 2I81A 4ECCA 2I3YA 4K6XA 1EOHA 1XWGA 2H0IA 1G6WA 1XWCA 2VLVA 1OC3A 3VWXA 2PN8A 4ZBDA 4AJ8A 2HZEA 2KHPA 2TRXA 2N5AA 3IK9A 1GUHA 2VLTA 3BD2A 2GLRA 5IIZA 2DMLA 1SD9A 3EWLA 3M8NA 4K5RA 4XS6A 5DBQA 2QA2A 3QR6A 4Z2RA 5CAXA 3TKSC 2HXKA 2H72A 2ES7A 3HJPA 3K8NA 20GSA 2LJRA 3DMLA 2ALBA 3HJMA 3QFAC 5IMAA 1PD21 1G7OA 2YOIA 3ZREA 3QDNA 2ON5A 4CY8A 2FNOA 4MPGA 3GH9A 4FYUA 5CYYA 4KSMA 2RUFA 2JZTA 4RI6A 4BVXB 4GQCA 1TP9A 5LD0A 1DBYA 2OBIA 2YZUA 4LMWA 2VCQA 4I8BA 4CY6A 4GRFA 4EL1A 1R26A 18GSA 5J9CA 3F4TA 4EIPA 4OO5A 3M9KA 2AJQB 5FWGA 4NWYA 1VF2A 5DQYA 3FZ5A 4JZQA 4PTSA 4KE3A 2YNXA 2OE0A 1K0BA 1YF1A 3FR9A 3IV4A 1HD2A 1GTBA 1PA3A 4MPFA 5DQSA 4LMVA 4GF0A 2M46A 5D93A 3ZYWA 4I97A 3UIWA 5D96A 2MZCA 1TRUA 4ZL7A 2GSSA 1UA5A 1TK8B 2WGRA 2LS5A 1O81A 2QA1A 4ML1A 3IPZA 3GX0A 1MEKA 4K2DA 3CTFA 1VF4A 1F37A 7GSSA 3C7MA 3L4NA 1URMA 1Q98A 3KIJA 4G0IA 5J5NA 3H1NA 3HY2A 3ZTLA 5ID2B 2J9HA 3EINA 2DKHA 1EP8A 5J41A 3CYNA 2HSYA 4MF5A 2C80A 3LYPA 4POMA 1JZWA 3W6GA 2NBSA 4BVXA 3MWHA 4XS4B 2HYXA 3KMOA 2AAWA 3QAVA 4IBPA 3CMIA 1GSSA 1RW1A 3LORA 2DJJA 2AYTA 1AC1A 4G0LA 4FH8A 4KDYA 3CXGA 3H8QA 5JWQB 5BMUA 2BJXA 5BRTA 2C8UA 4WBRD 3GUSA 4ID0A 3L9SA 3GL3A 3V1WA 2C3NA 4BPYA 1QUWA 3DYRA 2AHEA 3G7IA 4OCFA 1A8LA 1F2EA 4EXJA 1KEBA 3KCMA 1VRSD 3A2WA 3DRNA 4NXIA 4TVEA 3FHKA 3ZRDA 2G2QA 1M3IA 4FYBA 4EIQA 1DE2A 3HDCA 2DJ2A 1JLWA 2FCHA 1TU7A 3EYTA 2MBSA 3TKPA 1QXHA 3FZ9A 3H93A 4JU5A 4O5RA 1ZCPA 6GSVA 5IQYA 1ON4A 3SBCA 3UBLA 1YZXA 2YPMA 4YKFA 2F8FA 4TRXA 1M7TA 2DBCA 1YKAA 5HR1A 5DVBA 4HDEA 4QQ7A 1O8WA 3Q18A 4XS1A 2H30A 3EMXA 4WF5A 4MJCA 3GYKA 4K0NA 1GNEA 4TXOA 3GSTA 2MBTA 4DSRA 1I5GA 2CX4A 2NTOA 4OCEA 2FGXA 5L71A 2V6OA 3GKNA 4EKZA 4X1UA 3QPMA 4F2IA
chains in the Genus database with same CATH topology
3U5RE 1XW6A 3PR8A 4JBBA 2CX3A 5ELGA 4GTUA 2YP6A 4PQHA 3TJFA 2YN1A 3MIXA 4YQMA 3BJ5A 1OC9B 4TXVA 1OKTA 3G7JA 3WGDA 3GH6A 4MABA 4XTSA 2DJ3A 1FO5A 2MMNA 4PQ1A 3LYKA 3U6VA 2DLXA 1EV4A 2HRNA 5CRHA 1TU8A 1XCCA 2VL2C 1RQMA 2DJ0A 3GFKA 4ZB8A 2L4CA 4K7OA 2FY6A 4I2TA 1HQOA 2GS3A 2HLSA 3E0UA 2WB9A 3KTBA 3BOAA 4TN8A 1THXA 2BMXA 3HD5A 3FZ4A 1XWKA 5A5KA 5B8BA 1KNGA 3CTGA 4HUAA 2X8HA 1M9BA 3WD6A 1AQVA 2WS2A 1LJRA 2FUG2 4WR4A 2CAQA 3ZFBA 4KCAA 3TKSE 3TDGA 4GCIA 2RLIA 1CQGA 2V41A 2C0GA 1YKCA 3VLNA 2H1GA 1JZDA 3D22A 5DCHA 1J08A 1GLPA 2C1YA 2EIOA 5EPFA 3UAPA 3PH9A 3FR6A 1TTZA 4BWSA 4K5SA 1OC9A 3ZLPA 2HRAA 4G9HA 5GAND 1WE0A 3PINA 1X0RA 4ECIA 4ZXGA 5CREA 3EPTA 2FA4A 4HU9A 5G31A 2L6DA 3FYGA 1E6BA 4ULXA 5J4UA 2R4VA 3ZZXA 2A4HA 2RUEA 1GTAA 1FAAA 5KOWA 4L5OA 1HNBA 4AJ6A 4ZB6A 3RAZA 3IA1A 5DJLA 1K3LA 1YEPA 2F3MA 4G2EA 3NOFA 3N9JA 1ERVA 2HZFA 2FLSA 4K1FA 5IMCA 1FW1A 3MYDA 3FRCA 3G7YA 2EIQA 4YAPA 1AQXA 2LNTA 1AAZA 4FQUA 2A2PA 2YWNA 2HRFA 3HCZA 1BYEA 2REMA 2P5QA 2WULA 2VD1A 4HEA2 4K9ZA 4E8HA 2IJYA 4Q5FA 4G10A 4MJEA 13GSA 1XIYA 1GSDA 4N11A 4V1Ag 2LRCA 5HFKA 3DGQA 4HJ2A 1SK0A 2C3QA 3EURA 1MD4A 1XFLA 2IL3A 1I9DA 2NVLA 4EDYA 1Z9HA 2PERA 2PGTA 4O5QA 1NHYA 5IMVA 1O85A 4TOPA 1B48A 1SYXA 3UL3A 2JSZA 3QFBC 1EOGA 5EY6A 2K8SA 2ZUPA 4ZL8A 1XWAA 2RM6A 5FT3A 5H5QA 1TRSA 2XC2A 4PUAA 2PVOC 3TGZA 2NPBA 5GZZB 1ZYNA 4OD7A 2I1UA 3C71A 4RUVA 2X4AA 1R5PA 3TCOA 5HR3A 1WJKA 1WRYA 3RHCA 1X9WB 2IMEA 3EMPA 2WJUA 1YY7A 12GSA 2YWIA 5KN3A 4JR4A 1S3AA 2GSQA 1BG5A 1C72A 3Q6OA 3SWLA 2X99A 2H6YA 2YV7A 1MDKA 3LJRA 1YDKA 1YQ1A 4PNFA 1MD3A 2OACA 1PRXA 2L59A 6GSTA 4OFTA 3CRTA 1XBSA 2HT9A 4PURA 3KP8A 3H4KA 4IKHA 2GQLA 5ECLB 4K7NA 5ECSA 2C0DA 4ZBBA 2DIZA 5DALB 1U87A 4O92A 4PUFC 3A2VA 4HI7A 5F0GA 2F51A 4POBA 1EEJA 4MCUA 4N0VA 3UJ1A 3UVTA 2VM2A 4HQZA 1R7HA 3E3EA 1BEDA 5A4UA 5E59A 3ZITA 1GSYA 2ON7A 5A4VA 2CQ9A 2B7JA 3IHGA 3KGKA 1SL0B 2H1AA 5H5SA 5ABRA 4V2LA 3FK8A 3W8SA 4CW9A 3FZAA 4Z2UA 2M80A 1VGLA 1TRWA 2H6ZA 4MZBA 1SKWB 3GIXA 1SKSB 1QQ2A 3W8JA 2B1KA 1XVWA 4IP1A 1OE8A 4TR3A 2IFQB 2N5BA 1AQWA 3IXRA 3BCIA 4MJAA 4XRDA 17GSA 2H76A 1K3OA 3F9UA 2YWMA 5COHA 4V2NA 5ECPB 2CZ3A 2PBJA 6GSWA 1XXUA 3GNJA 4GQFA 1F3BA 3TJKA 1FOVA 3GTUB 4KDXA 1M99A 1N8JA 3ERWA 1NHOA 1SJZA 1ABAA 2YZHA 1VF3A 5JCUA 3GX8A 4IQ1A 2CA8A 4O32A 5DALA 5DJMA 4G19A 1AUCA 4H86A 1Z3EA 3CBUA 1SK1A 3APSA 3UARA 2HE3A 5DAKB 4ECJA 4JR6A 1B4PA 5D9XA 3FW2A 2FD3A 4MK3A 3VFIA 3S9FA 2CVBA 2JZRA 2L5LA 1O7UA 2ZCTA 1QGVA 4IS0A 4Q5QA 4AF2A 1ZYPA 5HFGA 1XW5A 2LRTA 4OO4A 4TR4A 1V2AA 1T4YA 2B7KA 2DJ1A 3EU4A 4QL9A 1A2MA 4NHWA 2LQOA 1TXXA 1PMTA 2QGVA 1AXDA 1SL2B 3US3A 3TUEA 1B9YC 5E4WA 1G0TA 1T00A 2VCWA 5CRDA 5EVOA 1O8XA 2HI7A 4TR0A 1R5AA 2EC4A 2M72A 4K0GA 1ERTA 1A2JA 1T8EB 3KZQA 4F0CA 3QMXA 3NIVA 2P31A 1GSUA 2R0PA 4YH2A 5JWRB 1ACVA 3F4SA 4DEJA 3GTUA 1XPVA 5KN2A 5G2ZA 3FY7A 4ICYA 1TK0B 5KEJA 3APOA 1V9WA 4POKA 1WPIA 3CSIA 2DMMA 3O6TA 4D73B 3QCPA 2NDOA 3LEFA 1ZYQB 2H8LA 1GP1A 2CV4A 2AV4A 3WGEA 2H70A 1BJXA 3G9BA 3KTLA 1NSWA 1PKWA 5AIXA 5ECQB 2CT6A 5IM9A 4BA7A 1SK2A 2IWTA 4HQSA 4NPBA 2YV9A 2GTUA 4L5LA 5KN0A 2MYGA 3HYPA 2HSMA 1X5DA 2R3XA 3GKMA 4IHUA 4TR1B 3L9VA 5ECNB 5ID2A 2Z9SA 3IBHA 4WETA 5C04A 3GA4A 4MLYA 1VF1A 4I2UA 5INYA 3RPNA 3KEBA 3TJJA 1JZOA 4XS4A 4F82A 2R6KA 4E8EA 2GT5A 2GZZA 4HU7A 5G1LA 1KTEA 2XPEA 1EEMA 3HZ4A 3M0FA 4BL7B 5JCGA 1GWCA 1LBKA 2F9SA 2L57A 16GSA 2KUCA 4GWRA 4J56E 1GNWA 5EL8A 2V1MA 2J23A 1Z5YE 2YWOA 2G0FA 2LQQA 3GKKA 5ELAA 2O8VB 4IGJA 1GH2A 1O6JA 4HJMA 1M2AA 2GQMA 4HOJA 3GURA 4D73A 2P0GA 4ZB9A 1Y6EA 2JACA 4KF9A 2P5RA 3ZFLA 3ZL5A 1Y25A 2I4AA 4P3YB 3F3QA 3A3TA 4MF6A 4NHZA 2B5YA 2LSTA 4MZCA 4XIHA 4MJBA 5CO3A 4Q5RA 1AW9A 4JRRA 3BBYA 1JZRA 2N5FA 3GN3A 5ENUA 5A4WA 2F8AA 4KNDA 5D9TA 4Q5NA 1G6YA 1WWJA 4XHMA 5C00A 2YCDA 4Z7XA 1ILOA 3HA9A 1U6TA 2FWFA 3PGTA 3D6IA 1DE1A 3RDWA 1N2AA 3TOUA 1UN2A 1HNAA 1XWBA 5CRGA 1QK8A 1UC7A 4V2MA 4J2FA 2MMOA 4GXZA 4Z2TA 1PGTA 4KDUA 1FG4A 3VPTA 2K18A 1SENA 1PN9A 3EU3A 1PL1A 3WT2A 4PGTA 2RM5A 4I6XA 4POLA 2KP1A 2LJAA 2PMTA 5CP1A 2XPDA 4G0KA 3IK7A 1TI3A 1AIUA 2LKUA 2H66A 2FHEA 2L4QA 1S3CA 1DUGA 4RQXA 3UEMA 5DDLA 2V6KA 3ISOA 3TB2A 1TKDB 1Z7PA 1ERWA 3C8EA 3F0IA 1XW9A 3I9V2 4PNGA 2TIRA 1BQ7A 1ZOFA 1B9XC 3FEUA 2V2GA 2R37A 3ERFA 5HFIA 3MNGA 4USSA 1TRVA 2DIYA 2EIRA 1BAYA 3ZIVA 2VO4A 2VL9A 3R3EA 1M0UA 4KA0A 4XRAA 4GSNA 2JSYA 4MH3A 2H0GA 1GTIA 1EGRA 2GZYA 2GGTA 1WOUA 2X49A 4A5PA 1GSEA 2HNLA 1YEXA 5F8BA 4YQVA 3DWVA 4ILFA 1GULA 4MMMA 5HR2A 3IC8A 3H79A 3IOSA 1SKRB 2FWEA 3ME8A 2JZSA 4DSSB 1O73A 1G7EA 2H1DA 1K0OA 2YJHA 3HXSA 2AB6A 4WKWA 3UVHA 3DEXA 2XBQA 1A23A 4XCSA 2IIYA 3GMFA 2XHFA 5JCWA 4DSQA 3J7Yk 1XZOA 4MP4A 3L78A 5B8AA 2L5OA 1ZL9A 1ZZYA 3CRUA 1U3IA 3WYWA 2WDUA 5G30A 4EF0A 4MDCA 2HZEB 4L8EA 1MDIA 3C73A 4N30A 2VOCA 5IOXA 1PN0A 5AN1A 4ML6A 3TJGA 5D8IA 4QL7A 1FOHA 3QAWA 3C1RA 3HVSA 3HVXA 5IO2A 4KGIA 5LNKe 4FIWA 4KX4A 1TI1A 2PWJA 1JLVA 2O7KA 3TKRA 3IDVA 4O7HA 3ZMKA 2VIMA 2HRKA 1Z6MA 1PX7A 5IMDA 2IMDA 2MMAA 3KM6A 2LJKA 4EDZA 2LTKA 4CDOA 1T4ZA 2DC5A 1B8XA 3HHVA 4YKGA 6GSYA 5ECKB 2X8CA 4ZL9A 5IPHA 3LSZA 5D9VA 3M1GA 3AY8A 4ZIJA 1Z7RA 10GSA 3KH7A 1MDJA 1OAZA 4WEYA 2VCXA 2LEGA 4BVYB 2ZNMA 4PQIA 2H0HA 1YF0A 1SJIA 3LW9A 4ACSA 1A0RP 1IYIA 1GRXA 2FA8A 1F6MC 4NV2A 1FB0A 1Q4JA 3TJBA 2R0CA 5IPGA 1DSBA 5FHIA 2O87A 2PVQA 3CSHA 5G5EA 1V98A 2A2SA 1YJ6A 3WGXA 3KP9A 1U88A 2K6VA 2UZ8A 3A5WA 3ME7A 3P8WA 2FWHA 2JU5A 1T1VA 2H1BA 4LL1B 3L0HA 2KP2A 3PPUA 4EUYA 1GUKA 2GSTA 3IHQA 1ZMAA 1OE7A 1V40A 2WZ9A 5KOXA 5IMFA 3F63A 1K3YA 1H75A 5ECOB 3DVWA 3HJOA 3KD0A 3VK9A 14GSA 3VPQA 3JCML 2OADA 2VLUA 1F9MA 1FHEA 4O5UA 1ST9A 2OKAA 3GV1A 2OJLA 2DKIA 4N10A 3QOUA 5ECMB 1Z6NA 3VI7A 2GZPA 4J57E 2OBKA 1USBA 5F07A 3HKRA 3LXZA 3A5IA 2VCZA 1GLQA 3F8UA 3I69A 3LQ7A 3IAM2 4BVYA 2O85A 5G5FA 3HZ8A 5ECIB 5KN1A 2PPTA 3KJYA 1PKZA 3VURA 2C0FA 4HS1A 4MF7A 4NV5A 2VL3A 3Q74A 1X9MB 1K0DA 3TKQA 2YJ7A 5D9WA 5GAPD 4LL4B 3EC3A 4IN0A 4EO3A 4F0BA 3VWUA 1EP7A 2E7PA 4EVMA 2E2MA 4OMVA 2E0QA 5J9BA 1K0CA 2R2JA 2IFQA 4ISDA 1A24A 1GUMA 3FMWA 3KXOA 1TK5B 1TJDA 1A8YA 2A4VA 3DVXA 4TXOB 3ZMLA 1SJ6A 3E9JB 1JHBA 1OVNA 4ZILA 2QSIA 3TKSA 1T7PB 1GL8A 1F3AA 2YANA 4NAXA 2DJKA 3Q19A 5B6NA 2MMZA 4F9ZA 1EWXA 3GL5A 1QFNA 1B4QA 4PXOA 2V32A 2KLXA 3IC4A 2B1LA 4GSTA 4IVFA 1FVKA 2H75A 4JEDA 3DIEA 19GSA 1TOFA 5DAKA 4HZ4A 1IYHA 1ZGNA 1NM3A 3APQA 5AGYA 1K0NA 3BCKA 2CZ2A 4K7IA 2LNSA 2WRTA 1SD8A 1M9AA 4RI7A 6GSXA 1V58A 2B3SA 2VAFA 3MDKA 2B5EA 3DXBA 4TKYA 1H4OA 1RK4A 3R2QA 4DVCA 1FVJA 4PX1A 2H6XA 1KBNA 4MA9A 1TDIA 2H19A 3QAGA 1HYUA 1GTUA 2VD0A 4X4JA 3GKXA 2RIIA 2KOKA 4YAVA 4CHSA 3UBKA 1K0AA 1OYJA 4K2XA 3VWWA 2O89A 4N0ZA 2I9HA 4KB3A 1ZYEA 2OE3A 5IOWA 1M2BA 3OR5A 4MNNA 1UVZA 3LXTA 3DD3A 4HZ2A 1X9SB 3A2XA 3I6AA 1W4VA 2C3TA 2VCTA 2D2ZA 1XOBA 2DSAA 3LG6A 2R0GA 4IELA 5J3RA 1PL2A 2K9FA 3HVVA 2CAIA 5F06A 3M3MA 3TRXA 11GSA 4IJ3A 5ECHB 3RBTA 2LUSA 3MAKA 5DCGA 1S3DA 3P90A 4KUNA 4IW9A 2PUKC 3IRAA 3L9UA 4K8MA 4L0UA 2VCVA 2H01A 4TR1A 4KH7A 4FYCA 6GSUA 2IN3A 3ZVJA 1E2YA 2B6MA 4WXTA 5ECRB 2IMIA 22GSA 2C4JA 4BWQA 3IAS2 3F3RA 3TRQA 3ZVJD 2BTOT 1V57A 4BL7A 4WBJA 1MTCA 2X8GA 3F6DA 2HSHA 2X64A 2GDRA 2TRCP 2CVKA 3C1SA 4YQUA 2H71A 4EC0A 3ED3A 2VUPA 4IJIA 1PX6A 1T3BA 3DKSA 5JWOB 1EV9A 3FKFA 1X5EA 1J9BA 2IPAA 2GVPA 3KMNA 1PQNA 2HFDA 3F4RA 1ERUA 2WCIA 1QMVA 5D73A 4FO5A 3D4MA 4ZBAA 4JE1A 4AGSA 1W89A 4RQRA 3I43A 2JADA 3MSZA 3RHBA 1M2DA 5H5RA 5GSSA 4GSSA 5G1KA 2IMKA 2GSRA 3P7XA 2AUVA 1GSFA 1WP0A 5F05A 1SYRA 2LRNA 3VWVA 1ML6A 3N5OA 3ZIJA 5B7CA 5CNWA 2C0EA 2IMFA 3UOMA 4X43A 4ECBA 5IO0A 2R5GA 5LCZA 2FWGA 1HNCA 2QC7A 3UMAA 4OFMA 3CSJA 1A0FA 4KAEA 1J0FA 1EGOA 2XBIA 1GSQA 3TRPA 4LA1A 4MH2A 3WT1A 1K0MA 3TOTA 4NMUA 1CQHA 5B6MA 1X5CA 5HR0A 4I5QA 3KH9A 3O76A 4GLTA 5AISA 3GHAA 5HQPA 1FB6A 3D4TA 2JL4A 1OKDA 2GQKA 2PU9C 3O3TA 1JFUA 3VI5A 4X0XA 3LWAA 2H74A 1SL1B 1TW9A 6GSSA 4OFNA 1U3AA 4KW6A 1OC8A 2E2GA 3RPPA 2VL2A 3F6FA 1SU9A 2L6CA 3P2AA 4AJ7A 3GSSA 3ERGA 1NW2A 4WF4A 3FR3A 3QD9A 4IQAA 1R4WA 2OE1A 2WFCA 1XOAA 3IR4A 2CVDA 2GT6A 5AIVA 4KCEA 2K8VA 4KSOA 8GSSA 3D21A 9GSSA 3D0ZA 3EVIA 3EE2A 4L0WA 1BX9A 3GRXA 1XVQA 4V1Ap 2OA7A 3IE3A 4TW5A 3D5JA 4F03A 1WIKA 2QKEA 3LGCA 4MZWA 3LFLA 2LV3A 2B5XA 4DSSA 1PSQA 4EE0A 1A2LA 3J7Yb 1EZKA 4OWYA 3NZNA 5IMZA 2H73A 1WMJA 2A2RA 5CRWA 4IP6A 2VM1A 4LLRA 1THOA 3M9JA 5GSTA 4WR5A 1LU4A 2I81A 4ECCA 2I3YA 4K6XA 1EOHA 1XWGA 2H0IA 1G6WA 1XWCA 2VLVA 1OC3A 3VWXA 2PN8A 4ZBDA 4AJ8A 2HZEA 2KHPA 2TRXA 2N5AA 3IK9A 1GUHA 2VLTA 3BD2A 2GLRA 5IIZA 2DMLA 1SD9A 3EWLA 3M8NA 4K5RA 4XS6A 5DBQA 2QA2A 3QR6A 4Z2RA 5CAXA 3TKSC 2HXKA 2H72A 2ES7A 3HJPA 3K8NA 20GSA 2LJRA 3DMLA 2ALBA 3HJMA 3QFAC 5IMAA 1PD21 1G7OA 2YOIA 3ZREA 3QDNA 2ON5A 4CY8A 2FNOA 4MPGA 3GH9A 4FYUA 5CYYA 4KSMA 2RUFA 2JZTA 4RI6A 4BVXB 4GQCA 1TP9A 5LD0A 1DBYA 2OBIA 2YZUA 4LMWA 2VCQA 4I8BA 4CY6A 4GRFA 4EL1A 1R26A 18GSA 5J9CA 3F4TA 4EIPA 4OO5A 3M9KA 2AJQB 5FWGA 4NWYA 1VF2A 5DQYA 3FZ5A 4JZQA 4PTSA 4KE3A 2YNXA 2OE0A 1K0BA 1YF1A 3FR9A 3IV4A 1HD2A 1GTBA 1PA3A 4MPFA 5DQSA 4LMVA 4GF0A 2M46A 5D93A 3ZYWA 4I97A 3UIWA 5D96A 2MZCA 1TRUA 4ZL7A 2GSSA 1UA5A 1TK8B 2WGRA 2LS5A 1O81A 2QA1A 4ML1A 3IPZA 3GX0A 1MEKA 4K2DA 3CTFA 1VF4A 1F37A 7GSSA 3C7MA 3L4NA 1URMA 1Q98A 3KIJA 4G0IA 5J5NA 3H1NA 3HY2A 3ZTLA 5ID2B 2J9HA 3EINA 2DKHA 1EP8A 5J41A 3CYNA 2HSYA 4MF5A 2C80A 3LYPA 4POMA 1JZWA 3W6GA 2NBSA 4BVXA 3MWHA 4XS4B 2HYXA 3KMOA 2AAWA 3QAVA 4IBPA 3CMIA 1GSSA 1RW1A 3LORA 2DJJA 2AYTA 1AC1A 4G0LA 4FH8A 4KDYA 3CXGA 3H8QA 5JWQB 5BMUA 2BJXA 5BRTA 2C8UA 4WBRD 3GUSA 4ID0A 3L9SA 3GL3A 3V1WA 2C3NA 4BPYA 1QUWA 3DYRA 2AHEA 3G7IA 4OCFA 1A8LA 1F2EA 4EXJA 1KEBA 3KCMA 1VRSD 3A2WA 3DRNA 4NXIA 4TVEA 3FHKA 3ZRDA 2G2QA 4FYBA 4EIQA 1DE2A 3HDCA 2DJ2A 1JLWA 2FCHA 1TU7A 3EYTA 2MBSA 3TKPA 1QXHA 3FZ9A 3H93A 4JU5A 4O5RA 1ZCPA 6GSVA 5IQYA 1ON4A 3SBCA 3UBLA 1YZXA 2YPMA 4YKFA 2F8FA 4TRXA 1M7TA 2DBCA 1YKAA 5HR1A 5DVBA 4HDEA 4QQ7A 1O8WA 3Q18A 4XS1A 2H30A 3EMXA 4WF5A 4MJCA 3GYKA 4K0NA 1GNEA 4TXOA 3GSTA 2MBTA 4DSRA 1I5GA 2CX4A 2NTOA 4OCEA 2FGXA 5L71A 2V6OA 3GKNA 4EKZA 4X1UA 3QPMA 4F2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5R E;  1XW6 A;  3PR8 A;  4JBB A;  2CX3 A;  5ELG A;  4GTU A;  2YP6 A;  4PQH A;  3TJF A;  2YN1 A;  4YQM A;  3BJ5 A;  1OC9 B;  4TXV A;  1OKT A;  3G7J A;  3WGD A;  3GH6 A;  4MAB A;  4XTS A;  2DJ3 A;  1FO5 A;  2MMN A;  4PQ1 A;  3LYK A;  3U6V A;  2DLX A;  1EV4 A;  2HRN A;  5CRH A;  1TU8 A;  1XCC A;  2VL2 C;  1RQM A;  2DJ0 A;  3GFK A;  4ZB8 A;  2L4C A;  4K7O A;  2FY6 A;  4I2T A;  1HQO A;  2GS3 A;  2HLS A;  3E0U A;  2WB9 A;  3KTB A;  3BOA A;  4TN8 A;  1THX A;  2BMX A;  3HD5 A;  3FZ4 A;  1XWK A;  5A5K A;  5B8B A;  1KNG A;  3CTG A;  4HUA A;  2X8H A;  1M9B A;  3WD6 A;  1AQV A;  2WS2 A;  1LJR A;  2FUG 2;  4WR4 A;  2CAQ A;  3ZFB A;  4KCA A;  3TKS E;  3TDG A;  4GCI A;  2RLI A;  1CQG A;  2V41 A;  2C0G A;  1YKC A;  3VLN A;  2H1G A;  1JZD A;  3D22 A;  5DCH A;  1J08 A;  1GLP A;  2C1Y A;  2EIO A;  5EPF A;  3UAP A;  3PH9 A;  3FR6 A;  1TTZ A;  4BWS A;  1OC9 A;  3ZLP A;  4G9H A;  5GAN D;  1WE0 A;  3PIN A;  1X0R A;  4ECI A;  4ZXG A;  5CRE A;  2FA4 A;  4HU9 A;  5G31 A;  2L6D A;  3FYG A;  1E6B A;  4ULX A;  5J4U A;  2R4V A;  3ZZX A;  2RUE A;  1GTA A;  1FAA A;  4L5O A;  1HNB A;  4AJ6 A;  4ZB6 A;  3RAZ A;  3IA1 A;  5DJL A;  1K3L A;  1YEP A;  2F3M A;  4G2E A;  3NOF A;  3N9J A;  1ERV A;  2HZF A;  2FLS A;  4K1F A;  5IMC A;  1FW1 A;  3FRC A;  3G7Y A;  2EIQ A;  4YAP A;  1AQX A;  2LNT A;  1AAZ A;  2YWN A;  2HRF A;  3HCZ A;  1BYE A;  2REM A;  2P5Q A;  2WUL A;  2VD1 A;  4HEA 2;  4K9Z A;  4E8H A;  2IJY A;  4Q5F A;  4G10 A;  4MJE A;  13GS A;  1XIY A;  1GSD A;  4N11 A;  4V1A g;  2LRC A;  5HFK A;  3DGQ A;  4HJ2 A;  1SK0 A;  2C3Q A;  3EUR A;  1MD4 A;  1XFL A;  2IL3 A;  1I9D A;  2NVL A;  4EDY A;  1Z9H A;  2PER A;  2PGT A;  1NHY A;  5IMV A;  1O85 A;  4TOP A;  1B48 A;  1SYX A;  3UL3 A;  2JSZ A;  3QFB C;  1EOG A;  5EY6 A;  2K8S A;  2ZUP A;  4ZL8 A;  1XWA A;  2RM6 A;  5FT3 A;  5H5Q A;  1TRS A;  2XC2 A;  4PUA A;  2PVO C;  3TGZ A;  2NPB A;  5GZZ B;  4OD7 A;  2I1U A;  3C71 A;  4RUV A;  1R5P A;  3TCO A;  5HR3 A;  1WJK A;  1WRY A;  3RHC A;  1X9W B;  2IME A;  3EMP A;  2WJU A;  1YY7 A;  12GS A;  2YWI A;  5KN3 A;  4JR4 A;  1S3A A;  2GSQ A;  1BG5 A;  1C72 A;  3Q6O A;  3SWL A;  2X99 A;  2H6Y A;  2YV7 A;  1MDK A;  3LJR A;  1YDK A;  1YQ1 A;  4PNF A;  1MD3 A;  2OAC A;  1PRX A;  2L59 A;  6GST A;  4OFT A;  3CRT A;  1XBS A;  2HT9 A;  4PUR A;  3KP8 A;  3H4K A;  4IKH A;  2GQL A;  5ECL B;  4K7N A;  5ECS A;  2C0D A;  4ZBB A;  2DIZ A;  5DAL B;  1U87 A;  4O92 A;  4PUF C;  3A2V A;  4HI7 A;  5F0G A;  2F51 A;  4POB A;  1EEJ A;  4MCU A;  4N0V A;  3UJ1 A;  3UVT A;  2VM2 A;  4HQZ A;  1R7H A;  3E3E A;  1BED A;  5A4U A;  5E59 A;  3ZIT A;  1GSY A;  2ON7 A;  5A4V A;  2CQ9 A;  2B7J A;  3KGK A;  1SL0 B;  2H1A A;  5H5S A;  5ABR A;  4V2L A;  3FK8 A;  3W8S A;  4CW9 A;  3FZA A;  2M80 A;  1VGL A;  1TRW A;  2H6Z A;  4MZB A;  1SKW B;  3GIX A;  1SKS B;  1QQ2 A;  3W8J A;  2B1K A;  1XVW A;  4IP1 A;  1OE8 A;  4TR3 A;  2IFQ B;  2N5B A;  1AQW A;  3IXR A;  3BCI A;  4MJA A;  4XRD A;  17GS A;  2H76 A;  1K3O A;  3F9U A;  2YWM A;  5COH A;  4V2N A;  5ECP B;  2CZ3 A;  2PBJ A;  6GSW A;  1XXU A;  3GNJ A;  4GQF A;  1F3B A;  3TJK A;  1FOV A;  3GTU B;  4KDX A;  1M99 A;  1N8J A;  3ERW A;  1NHO A;  1SJZ A;  1ABA A;  2YZH A;  1VF3 A;  5JCU A;  3GX8 A;  4IQ1 A;  2CA8 A;  4O32 A;  5DAL A;  5DJM A;  4G19 A;  1AUC A;  4H86 A;  1Z3E A;  3CBU A;  1SK1 A;  3APS A;  3UAR A;  2HE3 A;  5DAK B;  4ECJ A;  4JR6 A;  1B4P A;  5D9X A;  3FW2 A;  2FD3 A;  4MK3 A;  3VFI A;  3S9F A;  2CVB A;  2JZR A;  2L5L A;  1O7U A;  2ZCT A;  1QGV A;  4IS0 A;  4Q5Q A;  4AF2 A;  5HFG A;  1XW5 A;  2LRT A;  4OO4 A;  4TR4 A;  1V2A A;  1T4Y A;  2B7K A;  2DJ1 A;  3EU4 A;  4QL9 A;  1A2M A;  4NHW A;  2LQO A;  1TXX A;  1PMT A;  2QGV A;  1AXD A;  1SL2 B;  3US3 A;  3TUE A;  1B9Y C;  5E4W A;  1G0T A;  1T00 A;  2VCW A;  5CRD A;  5EVO A;  1O8X A;  2HI7 A;  4TR0 A;  1R5A A;  2EC4 A;  2M72 A;  4K0G A;  1ERT A;  1A2J A;  1T8E B;  3KZQ A;  4F0C A;  3QMX A;  3NIV A;  2P31 A;  1GSU A;  4YH2 A;  5JWR B;  1ACV A;  3F4S A;  4DEJ A;  3GTU A;  1XPV A;  5KN2 A;  5G2Z A;  3FY7 A;  1TK0 B;  5KEJ A;  3APO A;  1V9W A;  4POK A;  1WPI A;  3CSI A;  2DMM A;  3O6T A;  4D73 B;  3QCP A;  2NDO A;  3LEF A;  1ZYQ B;  2H8L A;  1GP1 A;  2CV4 A;  2AV4 A;  3WGE A;  2H70 A;  1BJX A;  3G9B A;  3KTL A;  1NSW A;  1PKW A;  5AIX A;  5ECQ B;  2CT6 A;  5IM9 A;  4BA7 A;  1SK2 A;  2IWT A;  4HQS A;  4NPB A;  2YV9 A;  2GTU A;  4L5L A;  5KN0 A;  2MYG A;  3HYP A;  1X5D A;  2R3X A;  3GKM A;  4IHU A;  4TR1 B;  3L9V A;  5ECN B;  5ID2 A;  2Z9S A;  3IBH A;  4WET A;  5C04 A;  3GA4 A;  4MLY A;  1VF1 A;  4I2U A;  5INY A;  3RPN A;  3KEB A;  3TJJ A;  1JZO A;  4XS4 A;  4F82 A;  2R6K A;  4E8E A;  2GT5 A;  2GZZ A;  4HU7 A;  5G1L A;  1KTE A;  2XPE A;  1EEM A;  3HZ4 A;  3M0F A;  5JCG A;  1GWC A;  1LBK A;  2F9S A;  2L57 A;  16GS A;  2KUC A;  4GWR A;  4J56 E;  1GNW A;  5EL8 A;  2V1M A;  2J23 A;  1Z5Y E;  2YWO A;  2G0F A;  2LQQ A;  3GKK A;  5ELA A;  2O8V B;  4IGJ A;  1GH2 A;  1O6J A;  4HJM A;  1M2A A;  2GQM A;  4HOJ A;  3GUR A;  4D73 A;  2P0G A;  4ZB9 A;  1Y6E A;  2JAC A;  2P5R A;  3ZFL A;  3ZL5 A;  1Y25 A;  2I4A A;  4P3Y B;  3F3Q A;  3A3T A;  4MF6 A;  4NHZ A;  2B5Y A;  2LST A;  4MZC A;  4XIH A;  4MJB A;  5CO3 A;  4Q5R A;  1AW9 A;  4JRR A;  3BBY A;  1JZR A;  2N5F A;  3GN3 A;  5ENU A;  5A4W A;  2F8A A;  4KND A;  5D9T A;  4Q5N A;  1G6Y A;  1WWJ A;  4XHM A;  5C00 A;  2YCD A;  4Z7X A;  1ILO A;  3HA9 A;  1U6T A;  2FWF A;  3PGT A;  3D6I A;  1DE1 A;  3RDW A;  1N2A A;  3TOU A;  1UN2 A;  1HNA A;  1XWB A;  5CRG A;  1QK8 A;  1UC7 A;  4V2M A;  4J2F A;  2MMO A;  4GXZ A;  1PGT A;  4KDU A;  1FG4 A;  3VPT A;  2K18 A;  1SEN A;  1PN9 A;  3EU3 A;  1PL1 A;  3WT2 A;  4PGT A;  2RM5 A;  4I6X A;  4POL A;  2KP1 A;  2LJA A;  2PMT A;  5CP1 A;  2XPD A;  3IK7 A;  1TI3 A;  1AIU A;  2LKU A;  2H66 A;  2FHE A;  2L4Q A;  1S3C A;  1DUG A;  4RQX A;  3UEM A;  5DDL A;  2V6K A;  3ISO A;  3TB2 A;  1TKD B;  1Z7P A;  1ERW A;  3C8E A;  3F0I A;  1XW9 A;  3I9V 2;  4PNG A;  2TIR A;  1BQ7 A;  1ZOF A;  1B9X C;  3FEU A;  2V2G A;  2R37 A;  3ERF A;  5HFI A;  3MNG A;  1TRV A;  2DIY A;  2EIR A;  1BAY A;  3ZIV A;  2VO4 A;  2VL9 A;  1M0U A;  4KA0 A;  4XRA A;  4GSN A;  2JSY A;  4MH3 A;  2H0G A;  1GTI A;  1EGR A;  2GZY A;  2GGT A;  1WOU A;  1GSE A;  2HNL A;  1YEX A;  5F8B A;  4YQV A;  3DWV A;  4ILF A;  1GUL A;  4MMM A;  5HR2 A;  3H79 A;  3IOS A;  1SKR B;  2FWE A;  3ME8 A;  2JZS A;  4DSS B;  1O73 A;  1G7E A;  2H1D A;  1K0O A;  2YJH A;  3HXS A;  2AB6 A;  4WKW A;  3UVH A;  3DEX A;  2XBQ A;  1A23 A;  4XCS A;  2IIY A;  3GMF A;  2XHF A;  5JCW A;  4DSQ A;  3J7Y k;  1XZO A;  4MP4 A;  3L78 A;  5B8A A;  2L5O A;  1ZL9 A;  1ZZY A;  3CRU A;  1U3I A;  3WYW A;  2WDU A;  5G30 A;  4EF0 A;  4MDC A;  2HZE B;  4L8E A;  1MDI A;  3C73 A;  4N30 A;  2VOC A;  5IOX A;  5AN1 A;  4ML6 A;  3TJG A;  5D8I A;  4QL7 A;  3QAW A;  3C1R A;  3HVS A;  3HVX A;  5IO2 A;  4KGI A;  5LNK e;  4FIW A;  4KX4 A;  1TI1 A;  2PWJ A;  1JLV A;  2O7K A;  3TKR A;  3IDV A;  4O7H A;  3ZMK A;  2VIM A;  1Z6M A;  1PX7 A;  5IMD A;  2IMD A;  2MMA A;  3KM6 A;  2LJK A;  4EDZ A;  2LTK A;  4CDO A;  1T4Z A;  2DC5 A;  1B8X A;  3HHV A;  6GSY A;  5ECK B;  2X8C A;  4ZL9 A;  5IPH A;  3LSZ A;  5D9V A;  3M1G A;  3AY8 A;  4ZIJ A;  1Z7R A;  10GS A;  3KH7 A;  1MDJ A;  1OAZ A;  4WEY A;  2VCX A;  2LEG A;  2ZNM A;  4PQI A;  2H0H A;  1YF0 A;  1SJI A;  4ACS A;  1A0R P;  1IYI A;  1GRX A;  2FA8 A;  1F6M C;  4NV2 A;  1FB0 A;  1Q4J A;  3TJB A;  5IPG A;  1DSB A;  5FHI A;  2O87 A;  2PVQ A;  3CSH A;  5G5E A;  1V98 A;  2A2S A;  1YJ6 A;  3WGX A;  3KP9 A;  1U88 A;  2K6V A;  3A5W A;  3ME7 A;  3P8W A;  2FWH A;  2JU5 A;  1T1V A;  2H1B A;  4LL1 B;  3L0H A;  2KP2 A;  4EUY A;  1GUK A;  2GST A;  3IHQ A;  1ZMA A;  1OE7 A;  1V40 A;  2WZ9 A;  5IMF A;  3F63 A;  1K3Y A;  1H75 A;  5ECO B;  3DVW A;  3HJO A;  3KD0 A;  3VK9 A;  14GS A;  3VPQ A;  3JCM L;  2OAD A;  2VLU A;  1F9M A;  1FHE A;  1ST9 A;  2OKA A;  3GV1 A;  2OJL A;  4N10 A;  3QOU A;  5ECM B;  1Z6N A;  3VI7 A;  2GZP A;  4J57 E;  2OBK A;  1USB A;  5F07 A;  3HKR A;  3LXZ A;  2VCZ A;  1GLQ A;  3F8U A;  3I69 A;  3LQ7 A;  3IAM 2;  4BVY A;  2O85 A;  5G5F A;  3HZ8 A;  5ECI B;  5KN1 A;  2PPT A;  3KJY A;  1PKZ A;  3VUR A;  2C0F A;  4HS1 A;  4MF7 A;  4NV5 A;  2VL3 A;  3Q74 A;  1X9M B;  1K0D A;  3TKQ A;  2YJ7 A;  5D9W A;  5GAP D;  4LL4 B;  3EC3 A;  4IN0 A;  4EO3 A;  4F0B A;  3VWU A;  1EP7 A;  2E7P A;  4EVM A;  2E2M A;  4OMV A;  2E0Q A;  5J9B A;  1K0C A;  2R2J A;  2IFQ A;  4ISD A;  1A24 A;  1GUM A;  3KXO A;  1TK5 B;  1TJD A;  1A8Y A;  2A4V A;  3DVX A;  4TXO B;  3ZML A;  1SJ6 A;  3E9J B;  1JHB A;  1OVN A;  4ZIL A;  2QSI A;  3TKS A;  1T7P B;  1GL8 A;  1F3A A;  2YAN A;  4NAX A;  2DJK A;  3Q19 A;  5B6N A;  2MMZ A;  4F9Z A;  1EWX A;  3GL5 A;  1QFN A;  1B4Q A;  4PXO A;  2V32 A;  2KLX A;  3IC4 A;  2B1L A;  4GST A;  4IVF A;  1FVK A;  2H75 A;  4JED A;  3DIE A;  19GS A;  1TOF A;  5DAK A;  4HZ4 A;  1IYH A;  1ZGN A;  1NM3 A;  3APQ A;  5AGY A;  1K0N A;  3BCK A;  2CZ2 A;  4K7I A;  2LNS A;  2WRT A;  1SD8 A;  1M9A A;  4RI7 A;  6GSX A;  1V58 A;  2B3S A;  2VAF A;  3MDK A;  2B5E A;  3DXB A;  4TKY A;  1H4O A;  1RK4 A;  3R2Q A;  4DVC A;  1FVJ A;  4PX1 A;  2H6X A;  1KBN A;  4MA9 A;  1TDI A;  2H19 A;  3QAG A;  1HYU A;  1GTU A;  2VD0 A;  3GKX A;  2RII A;  2KOK A;  4YAV A;  4CHS A;  3UBK A;  1K0A A;  1OYJ A;  3VWW A;  2O89 A;  4N0Z A;  2I9H A;  4KB3 A;  1ZYE A;  2OE3 A;  5IOW A;  1M2B A;  3OR5 A;  1UVZ A;  3LXT A;  3DD3 A;  4HZ2 A;  1X9S B;  3A2X A;  3I6A A;  1W4V A;  2C3T A;  2VCT A;  2D2Z A;  1XOB A;  2DSA A;  3LG6 A;  4IEL A;  5J3R A;  1PL2 A;  2K9F A;  3HVV A;  2CAI A;  5F06 A;  3M3M A;  3TRX A;  11GS A;  4IJ3 A;  5ECH B;  3RBT A;  2LUS A;  3MAK A;  5DCG A;  1S3D A;  3P90 A;  4KUN A;  4IW9 A;  2PUK C;  3IRA A;  3L9U A;  4K8M A;  4L0U A;  2VCV A;  2H01 A;  4TR1 A;  4KH7 A;  4FYC A;  6GSU A;  2IN3 A;  3ZVJ A;  1E2Y A;  2B6M A;  4WXT A;  5ECR B;  2IMI A;  22GS A;  2C4J A;  4BWQ A;  3IAS 2;  3F3R A;  3TRQ A;  3ZVJ D;  2BTO T;  1V57 A;  4BL7 A;  4WBJ A;  1MTC A;  2X8G A;  3F6D A;  2HSH A;  2X64 A;  2GDR A;  2TRC P;  2CVK A;  3C1S A;  4YQU A;  2H71 A;  4EC0 A;  3ED3 A;  2VUP A;  4IJI A;  1PX6 A;  1T3B A;  3DKS A;  5JWO B;  1EV9 A;  3FKF A;  1X5E A;  1J9B A;  2IPA A;  2GVP A;  3KMN A;  1PQN A;  2HFD A;  3F4R A;  1ERU A;  2WCI A;  1QMV A;  5D73 A;  4FO5 A;  3D4M A;  4ZBA A;  4JE1 A;  4AGS A;  1W89 A;  4RQR A;  3I43 A;  2JAD A;  3MSZ A;  3RHB A;  1M2D A;  5H5R A;  5GSS A;  4GSS A;  5G1K A;  2IMK A;  2GSR A;  3P7X A;  2AUV A;  1GSF A;  1WP0 A;  5F05 A;  1SYR A;  2LRN A;  3VWV A;  1ML6 A;  3N5O A;  3ZIJ A;  5B7C A;  5CNW A;  2C0E A;  2IMF A;  3UOM A;  4X43 A;  4ECB A;  5IO0 A;  2R5G A;  5LCZ A;  2FWG A;  1HNC A;  2QC7 A;  3UMA A;  4OFM A;  3CSJ A;  1A0F A;  4KAE A;  1J0F A;  1EGO A;  2XBI A;  1GSQ A;  3TRP A;  4LA1 A;  4MH2 A;  3WT1 A;  1K0M A;  3TOT A;  4NMU A;  1CQH A;  5B6M A;  1X5C A;  5HR0 A;  4I5Q A;  3KH9 A;  3O76 A;  4GLT A;  5AIS A;  3GHA A;  5HQP A;  1FB6 A;  3D4T A;  2JL4 A;  1OKD A;  2GQK A;  2PU9 C;  3O3T A;  1JFU A;  3VI5 A;  4X0X A;  3LWA A;  2H74 A;  1SL1 B;  1TW9 A;  6GSS A;  4OFN A;  1U3A A;  4KW6 A;  1OC8 A;  2E2G A;  3RPP A;  2VL2 A;  3F6F A;  1SU9 A;  2L6C A;  3P2A A;  4AJ7 A;  3GSS A;  3ERG A;  1NW2 A;  4WF4 A;  3FR3 A;  3QD9 A;  4IQA A;  1R4W A;  2OE1 A;  2WFC A;  1XOA A;  3IR4 A;  2CVD A;  2GT6 A;  5AIV A;  4KCE A;  2K8V A;  4KSO A;  8GSS A;  3D21 A;  9GSS A;  3D0Z A;  3EVI A;  3EE2 A;  4L0W A;  1BX9 A;  3GRX A;  1XVQ A;  4V1A p;  2OA7 A;  3IE3 A;  4TW5 A;  3D5J A;  4F03 A;  1WIK A;  2QKE A;  3LGC A;  4MZW A;  3LFL A;  2LV3 A;  2B5X A;  4DSS A;  1PSQ A;  4EE0 A;  1A2L A;  3J7Y b;  1EZK A;  4OWY A;  3NZN A;  5IMZ A;  2H73 A;  1WMJ A;  2A2R A;  5CRW A;  4IP6 A;  2VM1 A;  4LLR A;  1THO A;  3M9J A;  5GST A;  4WR5 A;  1LU4 A;  2I81 A;  4ECC A;  2I3Y A;  4K6X A;  1EOH A;  1XWG A;  2H0I A;  1G6W A;  1XWC A;  2VLV A;  1OC3 A;  3VWX A;  2PN8 A;  4ZBD A;  4AJ8 A;  2HZE A;  2KHP A;  2TRX A;  2N5A A;  3IK9 A;  1GUH A;  2VLT A;  3BD2 A;  2GLR A;  5IIZ A;  2DML A;  1SD9 A;  3EWL A;  3M8N A;  4XS6 A;  5DBQ A;  3QR6 A;  5CAX A;  3TKS C;  2HXK A;  2H72 A;  2ES7 A;  3HJP A;  3K8N A;  20GS A;  2LJR A;  3DML A;  2ALB A;  3HJM A;  3QFA C;  5IMA A;  1PD2 1;  1G7O A;  2YOI A;  3ZRE A;  3QDN A;  2ON5 A;  2FNO A;  4MPG A;  3GH9 A;  4FYU A;  5CYY A;  4KSM A;  2RUF A;  2JZT A;  4RI6 A;  4GQC A;  1TP9 A;  5LD0 A;  1DBY A;  2OBI A;  2YZU A;  4LMW A;  2VCQ A;  4I8B A;  4GRF A;  4EL1 A;  1R26 A;  18GS A;  5J9C A;  3F4T A;  4OO5 A;  3M9K A;  2AJQ B;  5FWG A;  4NWY A;  1VF2 A;  5DQY A;  3FZ5 A;  4JZQ A;  4KE3 A;  2YNX A;  2OE0 A;  1K0B A;  1YF1 A;  3FR9 A;  3IV4 A;  1HD2 A;  1GTB A;  1PA3 A;  4MPF A;  5DQS A;  4LMV A;  4GF0 A;  2M46 A;  5D93 A;  3ZYW A;  4I97 A;  3UIW A;  5D96 A;  2MZC A;  1TRU A;  4ZL7 A;  2GSS A;  1UA5 A;  1TK8 B;  2WGR A;  2LS5 A;  1O81 A;  4ML1 A;  3IPZ A;  3GX0 A;  1MEK A;  4K2D A;  3CTF A;  1VF4 A;  1F37 A;  7GSS A;  3C7M A;  3L4N A;  1URM A;  1Q98 A;  3KIJ A;  5J5N A;  3H1N A;  3HY2 A;  3ZTL A;  5ID2 B;  2J9H A;  3EIN A;  1EP8 A;  5J41 A;  3CYN A;  2HSY A;  4MF5 A;  2C80 A;  3LYP A;  4POM A;  1JZW A;  3W6G A;  2NBS A;  4BVX A;  3MWH A;  4XS4 B;  2HYX A;  3KMO A;  2AAW A;  3QAV A;  4IBP A;  3CMI A;  1GSS A;  1RW1 A;  3LOR A;  2DJJ A;  2AYT A;  1AC1 A;  4FH8 A;  4KDY A;  3CXG A;  3H8Q A;  5JWQ B;  2BJX A;  2C8U A;  4WBR D;  3GUS A;  4ID0 A;  3L9S A;  3GL3 A;  3V1W A;  2C3N A;  4BPY A;  1QUW A;  3DYR A;  2AHE A;  3G7I A;  4OCF A;  1A8L A;  1F2E A;  4EXJ A;  1KEB A;  3KCM A;  1VRS D;  3A2W A;  3DRN A;  4NXI A;  4TVE A;  3FHK A;  3ZRD A;  2G2Q A;  4FYB A;  1DE2 A;  3HDC A;  2DJ2 A;  1JLW A;  2FCH A;  1TU7 A;  3EYT A;  2MBS A;  3TKP A;  1QXH A;  3FZ9 A;  3H93 A;  4JU5 A;  4O5R A;  1ZCP A;  6GSV A;  5IQY A;  1ON4 A;  3SBC A;  3UBL A;  1YZX A;  2YPM A;  2F8F A;  4TRX A;  1M7T A;  2DBC A;  1YKA A;  5HR1 A;  5DVB A;  4HDE A;  4QQ7 A;  1O8W A;  3Q18 A;  4XS1 A;  2H30 A;  3EMX A;  4WF5 A;  4MJC A;  3GYK A;  4K0N A;  1GNE A;  4TXO A;  3GST A;  2MBT A;  4DSR A;  1I5G A;  2CX4 A;  2NTO A;  4OCE A;  2FGX A;  5L71 A;  2V6O A;  3GKN A;  4EKZ A;  4X1U A;  3QPM A;  4F2I A; 
#chains in the Genus database with same CATH topology
 3U5R E;  1XW6 A;  3PR8 A;  4JBB A;  2CX3 A;  5ELG A;  4GTU A;  2YP6 A;  4PQH A;  3TJF A;  2YN1 A;  3MIX A;  4YQM A;  3BJ5 A;  1OC9 B;  4TXV A;  1OKT A;  3G7J A;  3WGD A;  3GH6 A;  4MAB A;  4XTS A;  2DJ3 A;  1FO5 A;  2MMN A;  4PQ1 A;  3LYK A;  3U6V A;  2DLX A;  1EV4 A;  2HRN A;  5CRH A;  1TU8 A;  1XCC A;  2VL2 C;  1RQM A;  2DJ0 A;  3GFK A;  4ZB8 A;  2L4C A;  4K7O A;  2FY6 A;  4I2T A;  1HQO A;  2GS3 A;  2HLS A;  3E0U A;  2WB9 A;  3KTB A;  3BOA A;  4TN8 A;  1THX A;  2BMX A;  3HD5 A;  3FZ4 A;  1XWK A;  5A5K A;  5B8B A;  1KNG A;  3CTG A;  4HUA A;  2X8H A;  1M9B A;  3WD6 A;  1AQV A;  2WS2 A;  1LJR A;  2FUG 2;  4WR4 A;  2CAQ A;  3ZFB A;  4KCA A;  3TKS E;  3TDG A;  4GCI A;  2RLI A;  1CQG A;  2V41 A;  2C0G A;  1YKC A;  3VLN A;  2H1G A;  1JZD A;  3D22 A;  5DCH A;  1J08 A;  1GLP A;  2C1Y A;  2EIO A;  5EPF A;  3UAP A;  3PH9 A;  3FR6 A;  1TTZ A;  4BWS A;  4K5S A;  1OC9 A;  3ZLP A;  2HRA A;  4G9H A;  5GAN D;  1WE0 A;  3PIN A;  1X0R A;  4ECI A;  4ZXG A;  5CRE A;  3EPT A;  2FA4 A;  4HU9 A;  5G31 A;  2L6D A;  3FYG A;  1E6B A;  4ULX A;  5J4U A;  2R4V A;  1M3J A;  3ZZX A;  2A4H A;  2RUE A;  1GTA A;  1FAA A;  5KOW A;  4L5O A;  1HNB A;  4AJ6 A;  4ZB6 A;  3RAZ A;  3IA1 A;  5DJL A;  1K3L A;  1YEP A;  2F3M A;  4G2E A;  3NOF A;  3N9J A;  1ERV A;  2HZF A;  2FLS A;  4K1F A;  5IMC A;  1FW1 A;  3MYD A;  3FRC A;  3G7Y A;  2EIQ A;  4YAP A;  1AQX A;  2LNT A;  1AAZ A;  4FQU A;  2A2P A;  2YWN A;  2HRF A;  3HCZ A;  1BYE A;  2REM A;  2P5Q A;  2WUL A;  2VD1 A;  4HEA 2;  4K9Z A;  4E8H A;  2IJY A;  4Q5F A;  4G10 A;  4MJE A;  13GS A;  1XIY A;  1GSD A;  4N11 A;  4V1A g;  2LRC A;  5HFK A;  3DGQ A;  4HJ2 A;  1SK0 A;  2C3Q A;  3EUR A;  1MD4 A;  1XFL A;  2IL3 A;  1I9D A;  2NVL A;  4EDY A;  1Z9H A;  2PER A;  2PGT A;  4O5Q A;  1NHY A;  5IMV A;  1O85 A;  4TOP A;  1B48 A;  1SYX A;  3UL3 A;  2JSZ A;  3QFB C;  1EOG A;  5EY6 A;  2K8S A;  2ZUP A;  4ZL8 A;  1XWA A;  2RM6 A;  5FT3 A;  5H5Q A;  1TRS A;  2XC2 A;  4PUA A;  2PVO C;  3TGZ A;  2NPB A;  5GZZ B;  1ZYN A;  4OD7 A;  2I1U A;  3C71 A;  4RUV A;  2X4A A;  1R5P A;  3TCO A;  5HR3 A;  1WJK A;  1WRY A;  3RHC A;  1X9W B;  2IME A;  3EMP A;  2WJU A;  1YY7 A;  12GS A;  2YWI A;  5KN3 A;  4JR4 A;  1S3A A;  2GSQ A;  1BG5 A;  1C72 A;  3Q6O A;  3SWL A;  1PFO A;  2H6Y A;  2X99 A;  2YV7 A;  1MDK A;  3LJR A;  1YDK A;  1YQ1 A;  4PNF A;  1MD3 A;  2OAC A;  1PRX A;  2L59 A;  6GST A;  4OFT A;  3CRT A;  1XBS A;  2HT9 A;  4PUR A;  3KP8 A;  3H4K A;  4IKH A;  2GQL A;  5ECL B;  4K7N A;  5ECS A;  2C0D A;  4ZBB A;  2DIZ A;  5DAL B;  1U87 A;  4O92 A;  4PUF C;  3A2V A;  4HI7 A;  5F0G A;  2F51 A;  4POB A;  1EEJ A;  4MCU A;  4N0V A;  3UJ1 A;  3UVT A;  2VM2 A;  4HQZ A;  1R7H A;  3E3E A;  1BED A;  5A4U A;  5E59 A;  3ZIT A;  1GSY A;  2ON7 A;  5A4V A;  2CQ9 A;  2B7J A;  3IHG A;  3KGK A;  1SL0 B;  2H1A A;  5H5S A;  5ABR A;  4V2L A;  3FK8 A;  3W8S A;  4CW9 A;  3FZA A;  4Z2U A;  2M80 A;  1VGL A;  1TRW A;  2H6Z A;  4MZB A;  1SKW B;  3GIX A;  1SKS B;  1QQ2 A;  3W8J A;  2B1K A;  1XVW A;  4IP1 A;  1OE8 A;  4TR3 A;  2IFQ B;  2N5B A;  1AQW A;  3IXR A;  3BCI A;  4MJA A;  4XRD A;  17GS A;  2H76 A;  1K3O A;  3F9U A;  2YWM A;  5COH A;  4V2N A;  5ECP B;  2CZ3 A;  2PBJ A;  6GSW A;  1XXU A;  3GNJ A;  4GQF A;  1F3B A;  3TJK A;  1FOV A;  3GTU B;  4KDX A;  1M99 A;  1N8J A;  3ERW A;  1NHO A;  1SJZ A;  1ABA A;  2YZH A;  1VF3 A;  5JCU A;  3GX8 A;  4IQ1 A;  2CA8 A;  4O32 A;  5DAL A;  5DJM A;  4G19 A;  1AUC A;  4H86 A;  1Z3E A;  3CBU A;  1SK1 A;  3APS A;  3UAR A;  2HE3 A;  5DAK B;  4ECJ A;  4JR6 A;  1B4P A;  5D9X A;  3FW2 A;  2FD3 A;  4MK3 A;  3VFI A;  3S9F A;  2CVB A;  2JZR A;  2L5L A;  1O7U A;  2ZCT A;  1QGV A;  4IS0 A;  4Q5Q A;  4AF2 A;  1ZYP A;  5HFG A;  1XW5 A;  2LRT A;  4OO4 A;  4TR4 A;  1V2A A;  1T4Y A;  2B7K A;  2DJ1 A;  3EU4 A;  4QL9 A;  1A2M A;  4NHW A;  2LQO A;  1TXX A;  1PMT A;  2QGV A;  1AXD A;  1SL2 B;  3US3 A;  3TUE A;  1B9Y C;  5E4W A;  1G0T A;  1T00 A;  2VCW A;  5CRD A;  5EVO A;  1O8X A;  2HI7 A;  4TR0 A;  1R5A A;  2EC4 A;  2M72 A;  4K0G A;  1ERT A;  1A2J A;  1T8E B;  3KZQ A;  4F0C A;  3QMX A;  3NIV A;  2P31 A;  1GSU A;  2R0P A;  4YH2 A;  5JWR B;  1ACV A;  3F4S A;  4DEJ A;  3GTU A;  1XPV A;  5KN2 A;  5G2Z A;  3HVN A;  3FY7 A;  4ICY A;  1TK0 B;  5KEJ A;  3APO A;  1V9W A;  4POK A;  1WPI A;  3CSI A;  2DMM A;  3O6T A;  4D73 B;  3QCP A;  2NDO A;  3LEF A;  1ZYQ B;  2H8L A;  1GP1 A;  2CV4 A;  2AV4 A;  3WGE A;  2H70 A;  1BJX A;  3G9B A;  3KTL A;  1NSW A;  1PKW A;  5AIX A;  5ECQ B;  2CT6 A;  5IM9 A;  4BA7 A;  1SK2 A;  4BIK A;  2IWT A;  4HQS A;  4NPB A;  2YV9 A;  2GTU A;  4L5L A;  5KN0 A;  2MYG A;  3HYP A;  2HSM A;  1X5D A;  2R3X A;  3GKM A;  4IHU A;  4TR1 B;  3L9V A;  5ECN B;  5ID2 A;  2Z9S A;  3IBH A;  4WET A;  5C04 A;  3GA4 A;  4MLY A;  1VF1 A;  4I2U A;  5INY A;  3RPN A;  3KEB A;  3TJJ A;  1JZO A;  4XS4 A;  4F82 A;  2R6K A;  4E8E A;  2GT5 A;  2GZZ A;  4HU7 A;  5G1L A;  1KTE A;  2XPE A;  1EEM A;  3HZ4 A;  3M0F A;  4BL7 B;  5JCG A;  1GWC A;  1LBK A;  2F9S A;  2L57 A;  16GS A;  2KUC A;  4GWR A;  4J56 E;  1GNW A;  5EL8 A;  2V1M A;  2J23 A;  1Z5Y E;  2YWO A;  2G0F A;  2LQQ A;  3GKK A;  5ELA A;  2O8V B;  4IGJ A;  1GH2 A;  1O6J A;  4HJM A;  1M2A A;  2GQM A;  4HOJ A;  3GUR A;  4D73 A;  2P0G A;  4ZB9 A;  1Y6E A;  2JAC A;  4KF9 A;  2P5R A;  3ZFL A;  3ZL5 A;  1Y25 A;  2I4A A;  4P3Y B;  3F3Q A;  3A3T A;  4MF6 A;  4NHZ A;  2B5Y A;  2LST A;  4MZC A;  4XIH A;  4MJB A;  5CO3 A;  4Q5R A;  1AW9 A;  4JRR A;  3BBY A;  1JZR A;  2N5F A;  3GN3 A;  5ENU A;  5A4W A;  2F8A A;  4KND A;  5D9T A;  4Q5N A;  1G6Y A;  1WWJ A;  4XHM A;  5C00 A;  2YCD A;  4Z7X A;  1ILO A;  3HA9 A;  1U6T A;  2FWF A;  3PGT A;  3D6I A;  1DE1 A;  3RDW A;  1N2A A;  3TOU A;  1UN2 A;  1HNA A;  1XWB A;  5CRG A;  1QK8 A;  1UC7 A;  4V2M A;  4J2F A;  2MMO A;  4GXZ A;  4Z2T A;  1PGT A;  4KDU A;  1FG4 A;  3VPT A;  2K18 A;  1SEN A;  1PN9 A;  3EU3 A;  1PL1 A;  3WT2 A;  4PGT A;  2RM5 A;  4I6X A;  4POL A;  2KP1 A;  2LJA A;  2PMT A;  5CP1 A;  2XPD A;  4G0K A;  3IK7 A;  1TI3 A;  1AIU A;  2LKU A;  2H66 A;  2FHE A;  2L4Q A;  1S3C A;  1DUG A;  4RQX A;  3UEM A;  5DDL A;  2V6K A;  3ISO A;  3TB2 A;  1TKD B;  1Z7P A;  1ERW A;  3C8E A;  3F0I A;  1XW9 A;  3I9V 2;  4PNG A;  2TIR A;  1BQ7 A;  1ZOF A;  1B9X C;  3FEU A;  2V2G A;  2R37 A;  3ERF A;  5HFI A;  3MNG A;  4USS A;  1TRV A;  2DIY A;  2EIR A;  1BAY A;  3ZIV A;  2VO4 A;  2VL9 A;  3R3E A;  1M0U A;  4KA0 A;  4XRA A;  4GSN A;  2JSY A;  1XG8 A;  4MH3 A;  2H0G A;  1GTI A;  1EGR A;  2GZY A;  2GGT A;  1WOU A;  2X49 A;  4A5P A;  1GSE A;  2HNL A;  1YEX A;  5F8B A;  4YQV A;  3DWV A;  4ILF A;  1GUL A;  4MMM A;  5HR2 A;  3IC8 A;  3H79 A;  3IOS A;  1SKR B;  2FWE A;  3ME8 A;  2JZS A;  4HSC X;  4DSS B;  1O73 A;  1G7E A;  2H1D A;  1K0O A;  2YJH A;  3HXS A;  2AB6 A;  4WKW A;  3UVH A;  3DEX A;  2XBQ A;  1A23 A;  4XCS A;  2IIY A;  3GMF A;  2XHF A;  5JCW A;  4DSQ A;  3J7Y k;  1XZO A;  4MP4 A;  3L78 A;  5B8A A;  2L5O A;  1ZL9 A;  1ZZY A;  3CRU A;  1U3I A;  3WYW A;  2WDU A;  5G30 A;  4EF0 A;  4MDC A;  2HZE B;  4L8E A;  1MDI A;  3C73 A;  4N30 A;  2VOC A;  5IOX A;  1PN0 A;  5AN1 A;  4ML6 A;  3TJG A;  5D8I A;  4QL7 A;  1FOH A;  3QAW A;  3C1R A;  3HVS A;  3HVX A;  5IO2 A;  4KGI A;  5LNK e;  4FIW A;  4KX4 A;  1TI1 A;  2PWJ A;  1JLV A;  2O7K A;  3TKR A;  3IDV A;  4O7H A;  3ZMK A;  2VIM A;  2HRK A;  1Z6M A;  1PX7 A;  5IMD A;  2IMD A;  2MMA A;  3KM6 A;  2LJK A;  4EDZ A;  2LTK A;  4CDO A;  1T4Z A;  2DC5 A;  1B8X A;  3HHV A;  4YKG A;  6GSY A;  5ECK B;  2X8C A;  4ZL9 A;  5IPH A;  3LSZ A;  5D9V A;  3M1G A;  3AY8 A;  4ZIJ A;  1Z7R A;  10GS A;  3KH7 A;  1MDJ A;  1OAZ A;  4WEY A;  2VCX A;  2LEG A;  4BVY B;  2ZNM A;  4PQI A;  2H0H A;  1YF0 A;  1SJI A;  3LW9 A;  4ACS A;  1A0R P;  1IYI A;  1GRX A;  2FA8 A;  1F6M C;  4NV2 A;  1FB0 A;  1Q4J A;  3TJB A;  2R0C A;  5IPG A;  1DSB A;  5FHI A;  2O87 A;  2PVQ A;  3CSH A;  5G5E A;  1V98 A;  2A2S A;  1YJ6 A;  3WGX A;  3KP9 A;  1U88 A;  2K6V A;  2UZ8 A;  3A5W A;  3ME7 A;  3P8W A;  2FWH A;  2JU5 A;  1T1V A;  2H1B A;  4LL1 B;  3L0H A;  2KP2 A;  3PPU A;  4EUY A;  1GUK A;  2GST A;  3IHQ A;  1ZMA A;  1OE7 A;  1S3R A;  1V40 A;  2WZ9 A;  5KOX A;  5IMF A;  3F63 A;  1K3Y A;  1H75 A;  5ECO B;  3DVW A;  3HJO A;  3KD0 A;  3VK9 A;  14GS A;  3VPQ A;  3JCM L;  2OAD A;  2VLU A;  1F9M A;  1FHE A;  4O5U A;  1ST9 A;  2OKA A;  3GV1 A;  2OJL A;  2DKI A;  4N10 A;  3QOU A;  5ECM B;  1Z6N A;  3VI7 A;  2GZP A;  4J57 E;  2OBK A;  1USB A;  5F07 A;  3HKR A;  3LXZ A;  3A5I A;  2VCZ A;  1GLQ A;  3F8U A;  3I69 A;  3LQ7 A;  3IAM 2;  4BVY A;  2O85 A;  5G5F A;  3HZ8 A;  5ECI B;  5KN1 A;  2PPT A;  3KJY A;  1PKZ A;  3VUR A;  2C0F A;  4HS1 A;  4MF7 A;  4NV5 A;  2VL3 A;  3Q74 A;  1X9M B;  1K0D A;  3TKQ A;  2YJ7 A;  5D9W A;  5GAP D;  4LL4 B;  3EC3 A;  4IN0 A;  4EO3 A;  4F0B A;  3VWU A;  1EP7 A;  2E7P A;  4EVM A;  2E2M A;  4OMV A;  2E0Q A;  5J9B A;  1K0C A;  2R2J A;  2IFQ A;  4ISD A;  1A24 A;  1GUM A;  3FMW A;  3KXO A;  1TK5 B;  1TJD A;  1A8Y A;  2A4V A;  3DVX A;  4TXO B;  3ZML A;  1SJ6 A;  3E9J B;  1JHB A;  1OVN A;  4ZIL A;  2QSI A;  3TKS A;  1T7P B;  1GL8 A;  1F3A A;  2YAN A;  4NAX A;  2DJK A;  3Q19 A;  5B6N A;  2MMZ A;  4F9Z A;  1EWX A;  3GL5 A;  1QFN A;  1B4Q A;  4PXO A;  2V32 A;  2KLX A;  3IC4 A;  2B1L A;  4GST A;  4IVF A;  1FVK A;  2H75 A;  4JED A;  3DIE A;  19GS A;  1TOF A;  5DAK A;  4HZ4 A;  1IYH A;  1ZGN A;  1NM3 A;  3APQ A;  5AGY A;  1K0N A;  3BCK A;  2CZ2 A;  4K7I A;  2LNS A;  2WRT A;  1SD8 A;  1M9A A;  4RI7 A;  6GSX A;  1V58 A;  2B3S A;  2VAF A;  3MDK A;  2B5E A;  3DXB A;  4TKY A;  1H4O A;  1RK4 A;  3R2Q A;  4DVC A;  1FVJ A;  4PX1 A;  2H6X A;  1KBN A;  4MA9 A;  1TDI A;  2H19 A;  3QAG A;  1HYU A;  1GTU A;  2VD0 A;  4X4J A;  3GKX A;  2RII A;  2KOK A;  4YAV A;  4CHS A;  3UBK A;  1K0A A;  1OYJ A;  4K2X A;  3VWW A;  2O89 A;  4N0Z A;  2I9H A;  4KB3 A;  1ZYE A;  2OE3 A;  5IOW A;  1M2B A;  3OR5 A;  4MNN A;  1UVZ A;  3LXT A;  3DD3 A;  4HZ2 A;  1X9S B;  3A2X A;  3I6A A;  1W4V A;  2C3T A;  2VCT A;  2D2Z A;  1XOB A;  2DSA A;  3LG6 A;  2R0G A;  4IEL A;  5J3R A;  1PL2 A;  2K9F A;  3HVV A;  2CAI A;  5F06 A;  3M3M A;  3TRX A;  11GS A;  4IJ3 A;  5ECH B;  3RBT A;  2LUS A;  3MAK A;  5DCG A;  1S3D A;  3P90 A;  4KUN A;  4IW9 A;  2PUK C;  3IRA A;  3L9U A;  4K8M A;  4L0U A;  2VCV A;  2H01 A;  4TR1 A;  4KH7 A;  4FYC A;  6GSU A;  2IN3 A;  3ZVJ A;  1E2Y A;  2B6M A;  4WXT A;  5ECR B;  2IMI A;  22GS A;  2C4J A;  4BWQ A;  3IAS 2;  3F3R A;  3TRQ A;  3ZVJ D;  2BTO T;  1V57 A;  4BL7 A;  4WBJ A;  1MTC A;  2X8G A;  3F6D A;  2HSH A;  2X64 A;  2GDR A;  2TRC P;  2CVK A;  3C1S A;  4YQU A;  2H71 A;  4EC0 A;  3ED3 A;  2VUP A;  4IJI A;  1PX6 A;  1T3B A;  3DKS A;  5JWO B;  1EV9 A;  3FKF A;  1X5E A;  1J9B A;  2IPA A;  2GVP A;  3KMN A;  1PQN A;  2HFD A;  3F4R A;  1ERU A;  2WCI A;  1QMV A;  5D73 A;  4FO5 A;  3D4M A;  4ZBA A;  4JE1 A;  4AGS A;  1W89 A;  4RQR A;  3I43 A;  2JAD A;  3MSZ A;  3RHB A;  1M2D A;  5H5R A;  5GSS A;  4GSS A;  5G1K A;  2IMK A;  2GSR A;  3P7X A;  2AUV A;  1GSF A;  1WP0 A;  5F05 A;  1SYR A;  2LRN A;  3VWV A;  1ML6 A;  3N5O A;  3ZIJ A;  3CQF A;  5CNW A;  5B7C A;  2C0E A;  2IMF A;  3UOM A;  4X43 A;  4ECB A;  5IO0 A;  2R5G A;  5LCZ A;  2FWG A;  1HNC A;  2QC7 A;  3UMA A;  4OFM A;  3CSJ A;  1A0F A;  4KAE A;  1J0F A;  1EGO A;  2XBI A;  1GSQ A;  3TRP A;  4LA1 A;  4MH2 A;  3WT1 A;  1K0M A;  3TOT A;  4NMU A;  1CQH A;  5B6M A;  1X5C A;  5HR0 A;  4I5Q A;  3KH9 A;  3O76 A;  4GLT A;  5AIS A;  3GHA A;  5HQP A;  1FB6 A;  3D4T A;  2JL4 A;  1OKD A;  2GQK A;  2PU9 C;  3O3T A;  1JFU A;  3VI5 A;  4X0X A;  3LWA A;  2H74 A;  1SL1 B;  1TW9 A;  6GSS A;  4OFN A;  1U3A A;  4KW6 A;  1OC8 A;  2E2G A;  3RPP A;  2VL2 A;  3F6F A;  1SU9 A;  2L6C A;  3P2A A;  4AJ7 A;  3GSS A;  3ERG A;  1NW2 A;  4WF4 A;  3FR3 A;  3QD9 A;  4IQA A;  1R4W A;  2OE1 A;  2WFC A;  1XOA A;  3IR4 A;  2CVD A;  2GT6 A;  5AIV A;  4KCE A;  2K8V A;  4KSO A;  8GSS A;  3D21 A;  9GSS A;  3D0Z A;  3EVI A;  3EE2 A;  4L0W A;  1BX9 A;  3GRX A;  1XVQ A;  4V1A p;  2OA7 A;  3IE3 A;  4TW5 A;  3D5J A;  4F03 A;  1WIK A;  2QKE A;  3LGC A;  4MZW A;  3LFL A;  2LV3 A;  2B5X A;  4DSS A;  1PSQ A;  4EE0 A;  1A2L A;  3J7Y b;  1EZK A;  4OWY A;  3NZN A;  5IMZ A;  2H73 A;  1WMJ A;  2A2R A;  5CRW A;  4IP6 A;  2VM1 A;  4LLR A;  1THO A;  3M9J A;  5GST A;  4WR5 A;  1LU4 A;  2I81 A;  4ECC A;  2I3Y A;  4K6X A;  1EOH A;  1XWG A;  2H0I A;  1G6W A;  1XWC A;  2VLV A;  1OC3 A;  3VWX A;  2PN8 A;  4ZBD A;  4AJ8 A;  2HZE A;  2KHP A;  2TRX A;  2N5A A;  3IK9 A;  1GUH A;  2VLT A;  3BD2 A;  2GLR A;  5IIZ A;  2DML A;  1SD9 A;  3EWL A;  3M8N A;  4K5R A;  4XS6 A;  5DBQ A;  2QA2 A;  3QR6 A;  4Z2R A;  5CAX A;  3TKS C;  2HXK A;  2H72 A;  2ES7 A;  3HJP A;  3K8N A;  20GS A;  2LJR A;  3DML A;  2ALB A;  3HJM A;  3QFA C;  5IMA A;  1PD2 1;  1G7O A;  2YOI A;  3ZRE A;  3QDN A;  2ON5 A;  4CY8 A;  2FNO A;  4MPG A;  3GH9 A;  4FYU A;  5CYY A;  4KSM A;  2RUF A;  2JZT A;  4RI6 A;  4BVX B;  4GQC A;  1TP9 A;  5LD0 A;  1DBY A;  2OBI A;  2YZU A;  4LMW A;  2VCQ A;  4I8B A;  4CY6 A;  4GRF A;  4EL1 A;  1R26 A;  18GS A;  5J9C A;  3F4T A;  4EIP A;  4OO5 A;  3M9K A;  2AJQ B;  5FWG A;  4NWY A;  1VF2 A;  5DQY A;  3FZ5 A;  4JZQ A;  4PTS A;  4KE3 A;  2YNX A;  2OE0 A;  1K0B A;  1YF1 A;  3FR9 A;  3IV4 A;  1HD2 A;  1GTB A;  1PA3 A;  4MPF A;  5DQS A;  4LMV A;  4GF0 A;  2M46 A;  5D93 A;  3ZYW A;  4I97 A;  3UIW A;  5D96 A;  2MZC A;  1TRU A;  4ZL7 A;  2GSS A;  1UA5 A;  1TK8 B;  2WGR A;  2LS5 A;  1O81 A;  2QA1 A;  4ML1 A;  3IPZ A;  3GX0 A;  1MEK A;  4K2D A;  3CTF A;  1VF4 A;  1F37 A;  7GSS A;  3C7M A;  3L4N A;  1URM A;  1Q98 A;  3KIJ A;  4G0I A;  5J5N A;  3H1N A;  3HY2 A;  3ZTL A;  5ID2 B;  2J9H A;  3EIN A;  2DKH A;  1EP8 A;  5J41 A;  3CYN A;  2HSY A;  4MF5 A;  2C80 A;  3LYP A;  4POM A;  1JZW A;  3W6G A;  2NBS A;  4BVX A;  3MWH A;  4XS4 B;  2HYX A;  3KMO A;  2AAW A;  3QAV A;  4IBP A;  3CMI A;  1GSS A;  1RW1 A;  3LOR A;  2DJJ A;  2AYT A;  1AC1 A;  4G0L A;  4FH8 A;  4KDY A;  3CXG A;  3H8Q A;  5JWQ B;  5BMU A;  2BJX A;  5BRT A;  2C8U A;  4WBR D;  3GUS A;  4ID0 A;  3L9S A;  3GL3 A;  3V1W A;  2C3N A;  4BPY A;  1QUW A;  3DYR A;  2AHE A;  3G7I A;  4OCF A;  1A8L A;  1F2E A;  4EXJ A;  1KEB A;  3KCM A;  1VRS D;  3A2W A;  3DRN A;  4NXI A;  4TVE A;  3FHK A;  3ZRD A;  2G2Q A;  1M3I A;  4FYB A;  4EIQ A;  1DE2 A;  3HDC A;  2DJ2 A;  1JLW A;  2FCH A;  1TU7 A;  3EYT A;  2MBS A;  3TKP A;  1QXH A;  3FZ9 A;  3H93 A;  4JU5 A;  4O5R A;  1ZCP A;  6GSV A;  5IQY A;  1ON4 A;  3SBC A;  3UBL A;  1YZX A;  2YPM A;  4YKF A;  2F8F A;  4TRX A;  1M7T A;  2DBC A;  1YKA A;  5HR1 A;  5DVB A;  4HDE A;  4QQ7 A;  1O8W A;  3Q18 A;  4XS1 A;  2H30 A;  3EMX A;  4WF5 A;  4MJC A;  3GYK A;  4K0N A;  1GNE A;  4TXO A;  3GST A;  2MBT A;  4DSR A;  1I5G A;  2CX4 A;  2NTO A;  4OCE A;  2FGX A;  5L71 A;  2V6O A;  3GKN A;  4EKZ A;  4X1U A;  3QPM A;  4F2I A; 
#chains in the Genus database with same CATH homology
 3U5R E;  1XW6 A;  3PR8 A;  4JBB A;  2CX3 A;  5ELG A;  4GTU A;  2YP6 A;  4PQH A;  3TJF A;  2YN1 A;  3MIX A;  4YQM A;  3BJ5 A;  1OC9 B;  4TXV A;  1OKT A;  3G7J A;  3WGD A;  3GH6 A;  4MAB A;  4XTS A;  2DJ3 A;  1FO5 A;  2MMN A;  4PQ1 A;  3LYK A;  3U6V A;  2DLX A;  1EV4 A;  2HRN A;  5CRH A;  1TU8 A;  1XCC A;  2VL2 C;  1RQM A;  2DJ0 A;  3GFK A;  4ZB8 A;  2L4C A;  4K7O A;  2FY6 A;  4I2T A;  1HQO A;  2GS3 A;  2HLS A;  3E0U A;  2WB9 A;  3KTB A;  3BOA A;  4TN8 A;  1THX A;  2BMX A;  3HD5 A;  3FZ4 A;  1XWK A;  5A5K A;  5B8B A;  1KNG A;  3CTG A;  4HUA A;  2X8H A;  1M9B A;  3WD6 A;  1AQV A;  2WS2 A;  1LJR A;  2FUG 2;  4WR4 A;  2CAQ A;  3ZFB A;  4KCA A;  3TKS E;  3TDG A;  4GCI A;  2RLI A;  1CQG A;  2V41 A;  2C0G A;  1YKC A;  3VLN A;  2H1G A;  1JZD A;  3D22 A;  5DCH A;  1J08 A;  1GLP A;  2C1Y A;  2EIO A;  5EPF A;  3UAP A;  3PH9 A;  3FR6 A;  1TTZ A;  4BWS A;  4K5S A;  1OC9 A;  3ZLP A;  2HRA A;  4G9H A;  5GAN D;  1WE0 A;  3PIN A;  1X0R A;  4ECI A;  4ZXG A;  5CRE A;  3EPT A;  2FA4 A;  4HU9 A;  5G31 A;  2L6D A;  3FYG A;  1E6B A;  4ULX A;  5J4U A;  2R4V A;  3ZZX A;  2A4H A;  2RUE A;  1GTA A;  1FAA A;  5KOW A;  4L5O A;  1HNB A;  4AJ6 A;  4ZB6 A;  3RAZ A;  3IA1 A;  5DJL A;  1K3L A;  1YEP A;  2F3M A;  4G2E A;  3NOF A;  3N9J A;  1ERV A;  2HZF A;  2FLS A;  4K1F A;  5IMC A;  1FW1 A;  3MYD A;  3FRC A;  3G7Y A;  2EIQ A;  4YAP A;  1AQX A;  2LNT A;  1AAZ A;  4FQU A;  2A2P A;  2YWN A;  2HRF A;  3HCZ A;  1BYE A;  2REM A;  2P5Q A;  2WUL A;  2VD1 A;  4HEA 2;  4K9Z A;  4E8H A;  2IJY A;  4Q5F A;  4G10 A;  4MJE A;  13GS A;  1XIY A;  1GSD A;  4N11 A;  4V1A g;  2LRC A;  5HFK A;  3DGQ A;  4HJ2 A;  1SK0 A;  2C3Q A;  3EUR A;  1MD4 A;  1XFL A;  2IL3 A;  1I9D A;  2NVL A;  4EDY A;  1Z9H A;  2PER A;  2PGT A;  4O5Q A;  1NHY A;  5IMV A;  1O85 A;  4TOP A;  1B48 A;  1SYX A;  3UL3 A;  2JSZ A;  3QFB C;  1EOG A;  5EY6 A;  2K8S A;  2ZUP A;  4ZL8 A;  1XWA A;  2RM6 A;  5FT3 A;  5H5Q A;  1TRS A;  2XC2 A;  4PUA A;  2PVO C;  3TGZ A;  2NPB A;  5GZZ B;  1ZYN A;  4OD7 A;  2I1U A;  3C71 A;  4RUV A;  2X4A A;  1R5P A;  3TCO A;  5HR3 A;  1WJK A;  1WRY A;  3RHC A;  1X9W B;  2IME A;  3EMP A;  2WJU A;  1YY7 A;  12GS A;  2YWI A;  5KN3 A;  4JR4 A;  1S3A A;  2GSQ A;  1BG5 A;  1C72 A;  3Q6O A;  3SWL A;  2X99 A;  2H6Y A;  2YV7 A;  1MDK A;  3LJR A;  1YDK A;  1YQ1 A;  4PNF A;  1MD3 A;  2OAC A;  1PRX A;  2L59 A;  6GST A;  4OFT A;  3CRT A;  1XBS A;  2HT9 A;  4PUR A;  3KP8 A;  3H4K A;  4IKH A;  2GQL A;  5ECL B;  4K7N A;  5ECS A;  2C0D A;  4ZBB A;  2DIZ A;  5DAL B;  1U87 A;  4O92 A;  4PUF C;  3A2V A;  4HI7 A;  5F0G A;  2F51 A;  4POB A;  1EEJ A;  4MCU A;  4N0V A;  3UJ1 A;  3UVT A;  2VM2 A;  4HQZ A;  1R7H A;  3E3E A;  1BED A;  5A4U A;  5E59 A;  3ZIT A;  1GSY A;  2ON7 A;  5A4V A;  2CQ9 A;  2B7J A;  3IHG A;  3KGK A;  1SL0 B;  2H1A A;  5H5S A;  5ABR A;  4V2L A;  3FK8 A;  3W8S A;  4CW9 A;  3FZA A;  4Z2U A;  2M80 A;  1VGL A;  1TRW A;  2H6Z A;  4MZB A;  1SKW B;  3GIX A;  1SKS B;  1QQ2 A;  3W8J A;  2B1K A;  1XVW A;  4IP1 A;  1OE8 A;  4TR3 A;  2IFQ B;  2N5B A;  1AQW A;  3IXR A;  3BCI A;  4MJA A;  4XRD A;  17GS A;  2H76 A;  1K3O A;  3F9U A;  2YWM A;  5COH A;  4V2N A;  5ECP B;  2CZ3 A;  2PBJ A;  6GSW A;  1XXU A;  3GNJ A;  4GQF A;  1F3B A;  3TJK A;  1FOV A;  3GTU B;  4KDX A;  1M99 A;  1N8J A;  3ERW A;  1NHO A;  1SJZ A;  1ABA A;  2YZH A;  1VF3 A;  5JCU A;  3GX8 A;  4IQ1 A;  2CA8 A;  4O32 A;  5DAL A;  5DJM A;  4G19 A;  1AUC A;  4H86 A;  1Z3E A;  3CBU A;  1SK1 A;  3APS A;  3UAR A;  2HE3 A;  5DAK B;  4ECJ A;  4JR6 A;  1B4P A;  5D9X A;  3FW2 A;  2FD3 A;  4MK3 A;  3VFI A;  3S9F A;  2CVB A;  2JZR A;  2L5L A;  1O7U A;  2ZCT A;  1QGV A;  4IS0 A;  4Q5Q A;  4AF2 A;  1ZYP A;  5HFG A;  1XW5 A;  2LRT A;  4OO4 A;  4TR4 A;  1V2A A;  1T4Y A;  2B7K A;  2DJ1 A;  3EU4 A;  4QL9 A;  1A2M A;  4NHW A;  2LQO A;  1TXX A;  1PMT A;  2QGV A;  1AXD A;  1SL2 B;  3US3 A;  3TUE A;  1B9Y C;  5E4W A;  1G0T A;  1T00 A;  2VCW A;  5CRD A;  5EVO A;  1O8X A;  2HI7 A;  4TR0 A;  1R5A A;  2EC4 A;  2M72 A;  4K0G A;  1ERT A;  1A2J A;  1T8E B;  3KZQ A;  4F0C A;  3QMX A;  3NIV A;  2P31 A;  1GSU A;  2R0P A;  4YH2 A;  5JWR B;  1ACV A;  3F4S A;  4DEJ A;  3GTU A;  1XPV A;  5KN2 A;  5G2Z A;  3FY7 A;  4ICY A;  1TK0 B;  5KEJ A;  3APO A;  1V9W A;  4POK A;  1WPI A;  3CSI A;  2DMM A;  3O6T A;  4D73 B;  3QCP A;  2NDO A;  3LEF A;  1ZYQ B;  2H8L A;  1GP1 A;  2CV4 A;  2AV4 A;  3WGE A;  2H70 A;  1BJX A;  3G9B A;  3KTL A;  1NSW A;  1PKW A;  5AIX A;  5ECQ B;  2CT6 A;  5IM9 A;  4BA7 A;  1SK2 A;  2IWT A;  4HQS A;  4NPB A;  2YV9 A;  2GTU A;  4L5L A;  5KN0 A;  2MYG A;  3HYP A;  2HSM A;  1X5D A;  2R3X A;  3GKM A;  4IHU A;  4TR1 B;  3L9V A;  5ECN B;  5ID2 A;  2Z9S A;  3IBH A;  4WET A;  5C04 A;  3GA4 A;  4MLY A;  1VF1 A;  4I2U A;  5INY A;  3RPN A;  3KEB A;  3TJJ A;  1JZO A;  4XS4 A;  4F82 A;  2R6K A;  4E8E A;  2GT5 A;  2GZZ A;  4HU7 A;  5G1L A;  1KTE A;  2XPE A;  1EEM A;  3HZ4 A;  3M0F A;  4BL7 B;  5JCG A;  1GWC A;  1LBK A;  2F9S A;  2L57 A;  16GS A;  2KUC A;  4GWR A;  4J56 E;  1GNW A;  5EL8 A;  2V1M A;  2J23 A;  1Z5Y E;  2YWO A;  2G0F A;  2LQQ A;  3GKK A;  5ELA A;  2O8V B;  4IGJ A;  1GH2 A;  1O6J A;  4HJM A;  1M2A A;  2GQM A;  4HOJ A;  3GUR A;  4D73 A;  2P0G A;  4ZB9 A;  1Y6E A;  2JAC A;  4KF9 A;  2P5R A;  3ZFL A;  3ZL5 A;  1Y25 A;  2I4A A;  4P3Y B;  3F3Q A;  3A3T A;  4MF6 A;  4NHZ A;  2B5Y A;  2LST A;  4MZC A;  4XIH A;  4MJB A;  5CO3 A;  4Q5R A;  1AW9 A;  4JRR A;  3BBY A;  1JZR A;  2N5F A;  3GN3 A;  5ENU A;  5A4W A;  2F8A A;  4KND A;  5D9T A;  4Q5N A;  1G6Y A;  1WWJ A;  4XHM A;  5C00 A;  2YCD A;  4Z7X A;  1ILO A;  3HA9 A;  1U6T A;  2FWF A;  3PGT A;  3D6I A;  1DE1 A;  3RDW A;  1N2A A;  3TOU A;  1UN2 A;  1HNA A;  1XWB A;  5CRG A;  1QK8 A;  1UC7 A;  4V2M A;  4J2F A;  2MMO A;  4GXZ A;  4Z2T A;  1PGT A;  4KDU A;  1FG4 A;  3VPT A;  2K18 A;  1SEN A;  1PN9 A;  3EU3 A;  1PL1 A;  3WT2 A;  4PGT A;  2RM5 A;  4I6X A;  4POL A;  2KP1 A;  2LJA A;  2PMT A;  5CP1 A;  2XPD A;  4G0K A;  3IK7 A;  1TI3 A;  1AIU A;  2LKU A;  2H66 A;  2FHE A;  2L4Q A;  1S3C A;  1DUG A;  4RQX A;  3UEM A;  5DDL A;  2V6K A;  3ISO A;  3TB2 A;  1TKD B;  1Z7P A;  1ERW A;  3C8E A;  3F0I A;  1XW9 A;  3I9V 2;  4PNG A;  2TIR A;  1BQ7 A;  1ZOF A;  1B9X C;  3FEU A;  2V2G A;  2R37 A;  3ERF A;  5HFI A;  3MNG A;  4USS A;  1TRV A;  2DIY A;  2EIR A;  1BAY A;  3ZIV A;  2VO4 A;  2VL9 A;  3R3E A;  1M0U A;  4KA0 A;  4XRA A;  4GSN A;  2JSY A;  4MH3 A;  2H0G A;  1GTI A;  1EGR A;  2GZY A;  2GGT A;  1WOU A;  2X49 A;  4A5P A;  1GSE A;  2HNL A;  1YEX A;  5F8B A;  4YQV A;  3DWV A;  4ILF A;  1GUL A;  4MMM A;  5HR2 A;  3IC8 A;  3H79 A;  3IOS A;  1SKR B;  2FWE A;  3ME8 A;  2JZS A;  4DSS B;  1O73 A;  1G7E A;  2H1D A;  1K0O A;  2YJH A;  3HXS A;  2AB6 A;  4WKW A;  3UVH A;  3DEX A;  2XBQ A;  1A23 A;  4XCS A;  2IIY A;  3GMF A;  2XHF A;  5JCW A;  4DSQ A;  3J7Y k;  1XZO A;  4MP4 A;  3L78 A;  5B8A A;  2L5O A;  1ZL9 A;  1ZZY A;  3CRU A;  1U3I A;  3WYW A;  2WDU A;  5G30 A;  4EF0 A;  4MDC A;  2HZE B;  4L8E A;  1MDI A;  3C73 A;  4N30 A;  2VOC A;  5IOX A;  1PN0 A;  5AN1 A;  4ML6 A;  3TJG A;  5D8I A;  4QL7 A;  1FOH A;  3QAW A;  3C1R A;  3HVS A;  3HVX A;  5IO2 A;  4KGI A;  5LNK e;  4FIW A;  4KX4 A;  1TI1 A;  2PWJ A;  1JLV A;  2O7K A;  3TKR A;  3IDV A;  4O7H A;  3ZMK A;  2VIM A;  2HRK A;  1Z6M A;  1PX7 A;  5IMD A;  2IMD A;  2MMA A;  3KM6 A;  2LJK A;  4EDZ A;  2LTK A;  4CDO A;  1T4Z A;  2DC5 A;  1B8X A;  3HHV A;  4YKG A;  6GSY A;  5ECK B;  2X8C A;  4ZL9 A;  5IPH A;  3LSZ A;  5D9V A;  3M1G A;  3AY8 A;  4ZIJ A;  1Z7R A;  10GS A;  3KH7 A;  1MDJ A;  1OAZ A;  4WEY A;  2VCX A;  2LEG A;  4BVY B;  2ZNM A;  4PQI A;  2H0H A;  1YF0 A;  1SJI A;  3LW9 A;  4ACS A;  1A0R P;  1IYI A;  1GRX A;  2FA8 A;  1F6M C;  4NV2 A;  1FB0 A;  1Q4J A;  3TJB A;  2R0C A;  5IPG A;  1DSB A;  5FHI A;  2O87 A;  2PVQ A;  3CSH A;  5G5E A;  1V98 A;  2A2S A;  1YJ6 A;  3WGX A;  3KP9 A;  1U88 A;  2K6V A;  2UZ8 A;  3A5W A;  3ME7 A;  3P8W A;  2FWH A;  2JU5 A;  1T1V A;  2H1B A;  4LL1 B;  3L0H A;  2KP2 A;  3PPU A;  4EUY A;  1GUK A;  2GST A;  3IHQ A;  1ZMA A;  1OE7 A;  1V40 A;  2WZ9 A;  5KOX A;  5IMF A;  3F63 A;  1K3Y A;  1H75 A;  5ECO B;  3DVW A;  3HJO A;  3KD0 A;  3VK9 A;  14GS A;  3VPQ A;  3JCM L;  2OAD A;  2VLU A;  1F9M A;  1FHE A;  4O5U A;  1ST9 A;  2OKA A;  3GV1 A;  2OJL A;  2DKI A;  4N10 A;  3QOU A;  5ECM B;  1Z6N A;  3VI7 A;  2GZP A;  4J57 E;  2OBK A;  1USB A;  5F07 A;  3HKR A;  3LXZ A;  3A5I A;  2VCZ A;  1GLQ A;  3F8U A;  3I69 A;  3LQ7 A;  3IAM 2;  4BVY A;  2O85 A;  5G5F A;  3HZ8 A;  5ECI B;  5KN1 A;  2PPT A;  3KJY A;  1PKZ A;  3VUR A;  2C0F A;  4HS1 A;  4MF7 A;  4NV5 A;  2VL3 A;  3Q74 A;  1X9M B;  1K0D A;  3TKQ A;  2YJ7 A;  5D9W A;  5GAP D;  4LL4 B;  3EC3 A;  4IN0 A;  4EO3 A;  4F0B A;  3VWU A;  1EP7 A;  2E7P A;  4EVM A;  2E2M A;  4OMV A;  2E0Q A;  5J9B A;  1K0C A;  2R2J A;  2IFQ A;  4ISD A;  1A24 A;  1GUM A;  3FMW A;  3KXO A;  1TK5 B;  1TJD A;  1A8Y A;  2A4V A;  3DVX A;  4TXO B;  3ZML A;  1SJ6 A;  3E9J B;  1JHB A;  1OVN A;  4ZIL A;  2QSI A;  3TKS A;  1T7P B;  1GL8 A;  1F3A A;  2YAN A;  4NAX A;  2DJK A;  3Q19 A;  5B6N A;  2MMZ A;  4F9Z A;  1EWX A;  3GL5 A;  1QFN A;  1B4Q A;  4PXO A;  2V32 A;  2KLX A;  3IC4 A;  2B1L A;  4GST A;  4IVF A;  1FVK A;  2H75 A;  4JED A;  3DIE A;  19GS A;  1TOF A;  5DAK A;  4HZ4 A;  1IYH A;  1ZGN A;  1NM3 A;  3APQ A;  5AGY A;  1K0N A;  3BCK A;  2CZ2 A;  4K7I A;  2LNS A;  2WRT A;  1SD8 A;  1M9A A;  4RI7 A;  6GSX A;  1V58 A;  2B3S A;  2VAF A;  3MDK A;  2B5E A;  3DXB A;  4TKY A;  1H4O A;  1RK4 A;  3R2Q A;  4DVC A;  1FVJ A;  4PX1 A;  2H6X A;  1KBN A;  4MA9 A;  1TDI A;  2H19 A;  3QAG A;  1HYU A;  1GTU A;  2VD0 A;  4X4J A;  3GKX A;  2RII A;  2KOK A;  4YAV A;  4CHS A;  3UBK A;  1K0A A;  1OYJ A;  4K2X A;  3VWW A;  2O89 A;  4N0Z A;  2I9H A;  4KB3 A;  1ZYE A;  2OE3 A;  5IOW A;  1M2B A;  3OR5 A;  4MNN A;  1UVZ A;  3LXT A;  3DD3 A;  4HZ2 A;  1X9S B;  3A2X A;  3I6A A;  1W4V A;  2C3T A;  2VCT A;  2D2Z A;  1XOB A;  2DSA A;  3LG6 A;  2R0G A;  4IEL A;  5J3R A;  1PL2 A;  2K9F A;  3HVV A;  2CAI A;  5F06 A;  3M3M A;  3TRX A;  11GS A;  4IJ3 A;  5ECH B;  3RBT A;  2LUS A;  3MAK A;  5DCG A;  1S3D A;  3P90 A;  4KUN A;  4IW9 A;  2PUK C;  3IRA A;  3L9U A;  4K8M A;  4L0U A;  2VCV A;  2H01 A;  4TR1 A;  4KH7 A;  4FYC A;  6GSU A;  2IN3 A;  3ZVJ A;  1E2Y A;  2B6M A;  4WXT A;  5ECR B;  2IMI A;  22GS A;  2C4J A;  4BWQ A;  3IAS 2;  3F3R A;  3TRQ A;  3ZVJ D;  2BTO T;  1V57 A;  4BL7 A;  4WBJ A;  1MTC A;  2X8G A;  3F6D A;  2HSH A;  2X64 A;  2GDR A;  2TRC P;  2CVK A;  3C1S A;  4YQU A;  2H71 A;  4EC0 A;  3ED3 A;  2VUP A;  4IJI A;  1PX6 A;  1T3B A;  3DKS A;  5JWO B;  1EV9 A;  3FKF A;  1X5E A;  1J9B A;  2IPA A;  2GVP A;  3KMN A;  1PQN A;  2HFD A;  3F4R A;  1ERU A;  2WCI A;  1QMV A;  5D73 A;  4FO5 A;  3D4M A;  4ZBA A;  4JE1 A;  4AGS A;  1W89 A;  4RQR A;  3I43 A;  2JAD A;  3MSZ A;  3RHB A;  1M2D A;  5H5R A;  5GSS A;  4GSS A;  5G1K A;  2IMK A;  2GSR A;  3P7X A;  2AUV A;  1GSF A;  1WP0 A;  5F05 A;  1SYR A;  2LRN A;  3VWV A;  1ML6 A;  3N5O A;  3ZIJ A;  5B7C A;  5CNW A;  2C0E A;  2IMF A;  3UOM A;  4X43 A;  4ECB A;  5IO0 A;  2R5G A;  5LCZ A;  2FWG A;  1HNC A;  2QC7 A;  3UMA A;  4OFM A;  3CSJ A;  1A0F A;  4KAE A;  1J0F A;  1EGO A;  2XBI A;  1GSQ A;  3TRP A;  4LA1 A;  4MH2 A;  3WT1 A;  1K0M A;  3TOT A;  4NMU A;  1CQH A;  5B6M A;  1X5C A;  5HR0 A;  4I5Q A;  3KH9 A;  3O76 A;  4GLT A;  5AIS A;  3GHA A;  5HQP A;  1FB6 A;  3D4T A;  2JL4 A;  1OKD A;  2GQK A;  2PU9 C;  3O3T A;  1JFU A;  3VI5 A;  4X0X A;  3LWA A;  2H74 A;  1SL1 B;  1TW9 A;  6GSS A;  4OFN A;  1U3A A;  4KW6 A;  1OC8 A;  2E2G A;  3RPP A;  2VL2 A;  3F6F A;  1SU9 A;  2L6C A;  3P2A A;  4AJ7 A;  3GSS A;  3ERG A;  1NW2 A;  4WF4 A;  3FR3 A;  3QD9 A;  4IQA A;  1R4W A;  2OE1 A;  2WFC A;  1XOA A;  3IR4 A;  2CVD A;  2GT6 A;  5AIV A;  4KCE A;  2K8V A;  4KSO A;  8GSS A;  3D21 A;  9GSS A;  3D0Z A;  3EVI A;  3EE2 A;  4L0W A;  1BX9 A;  3GRX A;  1XVQ A;  4V1A p;  2OA7 A;  3IE3 A;  4TW5 A;  3D5J A;  4F03 A;  1WIK A;  2QKE A;  3LGC A;  4MZW A;  3LFL A;  2LV3 A;  2B5X A;  4DSS A;  1PSQ A;  4EE0 A;  1A2L A;  3J7Y b;  1EZK A;  4OWY A;  3NZN A;  5IMZ A;  2H73 A;  1WMJ A;  2A2R A;  5CRW A;  4IP6 A;  2VM1 A;  4LLR A;  1THO A;  3M9J A;  5GST A;  4WR5 A;  1LU4 A;  2I81 A;  4ECC A;  2I3Y A;  4K6X A;  1EOH A;  1XWG A;  2H0I A;  1G6W A;  1XWC A;  2VLV A;  1OC3 A;  3VWX A;  2PN8 A;  4ZBD A;  4AJ8 A;  2HZE A;  2KHP A;  2TRX A;  2N5A A;  3IK9 A;  1GUH A;  2VLT A;  3BD2 A;  2GLR A;  5IIZ A;  2DML A;  1SD9 A;  3EWL A;  3M8N A;  4K5R A;  4XS6 A;  5DBQ A;  2QA2 A;  3QR6 A;  4Z2R A;  5CAX A;  3TKS C;  2HXK A;  2H72 A;  2ES7 A;  3HJP A;  3K8N A;  20GS A;  2LJR A;  3DML A;  2ALB A;  3HJM A;  3QFA C;  5IMA A;  1PD2 1;  1G7O A;  2YOI A;  3ZRE A;  3QDN A;  2ON5 A;  4CY8 A;  2FNO A;  4MPG A;  3GH9 A;  4FYU A;  5CYY A;  4KSM A;  2RUF A;  2JZT A;  4RI6 A;  4BVX B;  4GQC A;  1TP9 A;  5LD0 A;  1DBY A;  2OBI A;  2YZU A;  4LMW A;  2VCQ A;  4I8B A;  4CY6 A;  4GRF A;  4EL1 A;  1R26 A;  18GS A;  5J9C A;  3F4T A;  4EIP A;  4OO5 A;  3M9K A;  2AJQ B;  5FWG A;  4NWY A;  1VF2 A;  5DQY A;  3FZ5 A;  4JZQ A;  4PTS A;  4KE3 A;  2YNX A;  2OE0 A;  1K0B A;  1YF1 A;  3FR9 A;  3IV4 A;  1HD2 A;  1GTB A;  1PA3 A;  4MPF A;  5DQS A;  4LMV A;  4GF0 A;  2M46 A;  5D93 A;  3ZYW A;  4I97 A;  3UIW A;  5D96 A;  2MZC A;  1TRU A;  4ZL7 A;  2GSS A;  1UA5 A;  1TK8 B;  2WGR A;  2LS5 A;  1O81 A;  2QA1 A;  4ML1 A;  3IPZ A;  3GX0 A;  1MEK A;  4K2D A;  3CTF A;  1VF4 A;  1F37 A;  7GSS A;  3C7M A;  3L4N A;  1URM A;  1Q98 A;  3KIJ A;  4G0I A;  5J5N A;  3H1N A;  3HY2 A;  3ZTL A;  5ID2 B;  2J9H A;  3EIN A;  2DKH A;  1EP8 A;  5J41 A;  3CYN A;  2HSY A;  4MF5 A;  2C80 A;  3LYP A;  4POM A;  1JZW A;  3W6G A;  2NBS A;  4BVX A;  3MWH A;  4XS4 B;  2HYX A;  3KMO A;  2AAW A;  3QAV A;  4IBP A;  3CMI A;  1GSS A;  1RW1 A;  3LOR A;  2DJJ A;  2AYT A;  1AC1 A;  4G0L A;  4FH8 A;  4KDY A;  3CXG A;  3H8Q A;  5JWQ B;  5BMU A;  2BJX A;  5BRT A;  2C8U A;  4WBR D;  3GUS A;  4ID0 A;  3L9S A;  3GL3 A;  3V1W A;  2C3N A;  4BPY A;  1QUW A;  3DYR A;  2AHE A;  3G7I A;  4OCF A;  1A8L A;  1F2E A;  4EXJ A;  1KEB A;  3KCM A;  1VRS D;  3A2W A;  3DRN A;  4NXI A;  4TVE A;  3FHK A;  3ZRD A;  2G2Q A;  4FYB A;  4EIQ A;  1DE2 A;  3HDC A;  2DJ2 A;  1JLW A;  2FCH A;  1TU7 A;  3EYT A;  2MBS A;  3TKP A;  1QXH A;  3FZ9 A;  3H93 A;  4JU5 A;  4O5R A;  1ZCP A;  6GSV A;  5IQY A;  1ON4 A;  3SBC A;  3UBL A;  1YZX A;  2YPM A;  4YKF A;  2F8F A;  4TRX A;  1M7T A;  2DBC A;  1YKA A;  5HR1 A;  5DVB A;  4HDE A;  4QQ7 A;  1O8W A;  3Q18 A;  4XS1 A;  2H30 A;  3EMX A;  4WF5 A;  4MJC A;  3GYK A;  4K0N A;  1GNE A;  4TXO A;  3GST A;  2MBT A;  4DSR A;  1I5G A;  2CX4 A;  2NTO A;  4OCE A;  2FGX A;  5L71 A;  2V6O A;  3GKN A;  4EKZ A;  4X1U A;  3QPM A;  4F2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...