3TJGA

Crystal structure of human peroxiredoxin iv c51a mutant in oxidized form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
SKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-4
publication title Crystal Structure of Reduced and of Oxidized Peroxiredoxin IV Enzyme Reveals a Stable Oxidized Decamer and a Non-disulfide-bonded Intermediate in the Catalytic Cycle.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 167
sequence length 167
chains with identical sequence B, C, D, E
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tjgA00
2AHEA 3VWXA 2CX4A 3GX0A 2B3SA 1DE1A 3GH6A 1MTCA 4Q5FA 1EWXA 5ID2A 3L9UA 3Q18A 1ACVA 1T4YA 1NM3A 4K0NA 2LUSA 7GSSA 2IMIA 1GUKA 2X64A 4V2LA 3WGXA 1XBSA 4MH3A 1U3AA 4ECCA 1LBKA 2GGTA 3D4MA 2JSYA 1V40A 5J41A 2HRFA 3PH9A 2A4VA 2NBSA 3ZL5A 1PN9A 3C71A 5IOWA 4BL7A 2H6YA 1X5CA 1FO5A 3VURA 3TKSA 3KM6A 3APSA 2CVBA 3DIEA 1SKRB 1XFLA 3HHVA 5IMDA 2GT5A 1AIUA 1MD3A 1O8XA 1OC3A 5LD0A 2GVPA 4POBA 1R7HA 2WS2A 1N2AA 5CRHA 3PGTA 4GQCA 1NSWA 2HZEB 2O7KA 6GSVA 1SL1B 5DAKA 4KW6A 3APQA 1OKDA 4FYUA 3LXTA 2FA8A 2X8GA 1ZL9A 4K7OA 3BCIA 2RM6A 1X5EA 4AJ8A 5DBQA 3FHKA 2GSTA 4ML6A 1BJXA 1G6WA 1SU9A 2L57A 3GSTA 3TKSC 1TTZA 1SYXA 1GH2A 1M2AA 5KN2A 4PNGA 1F3BA 1JLWA 2BTOT 2OADA 1QGVA 4EKZA 3NOFA 2RUFA 5C00A 4FYBA 3M3MA 4ML1A 1ERUA 2OE1A 3AY8A 3D21A 4MPFA 4MJCA 4NV2A 2M72A 2VUPA 2VM1A 2H30A 4IKHA 4V2NA 2QSIA 3IV4A 2AV4A 1QQ2A 2FCHA 3KD0A 4I2UA 2MBSA 5CRWA 2R4VA 3F4RA 2DJJA 2V6OA 1XPVA 5A5KA 3M1GA 1XWCA 3ZYWA 3UMAA 3HZ8A 1UC7A 4F82A 2LSTA 1OYJA 4TRXA 6GSWA 3TCOA 3UBLA 3HJPA 1GSFA 2LNTA 3E9JB 3N9JA 2IMFA 2VLVA 4IP1A 5HFKA 1N8JA 5HR1A 4IQ1A 2FWEA 2K9FA 1F37A 1PMTA 5DCGA 4WKWA 4Q5NA 3H93A 4JEDA 3VI7A 2WB9A 4F0BA 4N30A 1C72A 2HYXA 3M9KA 2IFQA 4ZB8A 4OCFA 2FUG2 4MP4A 2LJAA 4K8MA 2F9SA 1MD4A 3UVTA 3FR3A 2H76A 2OKAA 1UVZA 2LEGA 2YOIA 3TJGA 2YJHA 3IXRA 4OMVA 5HR2A 4HQSA 2DBCA 5G2ZA 2DJ0A 5G1KA 2H73A 3TKQA 3H1NA 2HFDA 1F2EA 1EEJA 2KUCA 2LKUA 3V1WA 3KCMA 5D9TA 19GSA 4V2MA 2E2MA 2C0FA 2Z9SA 2AJQB 1XVQA 5IQYA 2XBIA 5HR3A 4TR3A 2E2GA 2PU9C 5JWOB 3C1RA 3TRXA 4AJ6A 12GSA 2CZ2A 4XS1A 5B8BA 3RHBA 5DVBA 5G31A 4JBBA 5A4WA 3D6IA 2EIRA 2FWGA 4TR4A 3ZREA 3EMXA 4PUFC 2K18A 2MMAA 5KN0A 1K3YA 1H75A 5ECNB 3GURA 2PGTA 3SWLA 2LV3A 1SK1A 1GTAA 3L0HA 3TJKA 1SD8A 2WGRA 2O85A 3D5JA 1YF1A 2F3MA 2DJ2A 2FGXA 5KN1A 3PR8A 3GL3A 3GL5A 2K6VA 3D22A 1W4VA 2WULA 3DKSA 1TI3A 3DGQA 4IQAA 2V2GA 4WETA 3P8WA 1G7EA 4D73B 2F8AA 4NV5A 4KB3A 3LYPA 4N11A 10GSA 4TW5A 4G9HA 3UVHA 5B6NA 4ACSA 1W89A 3NIVA 1ZZYA 2H74A 2QKEA 4JU5A 3W6GA 2PWJA 5E59A 4ZIJA 4KA0A 5ECLB 3TUEA 3GFKA 3GV1A 4WF5A 2IWTA 4NWYA 3EYTA 4N10A 1K3LA 2OJLA 1B9YC 2H71A 3EC3A 4KSMA 2DC5A 3TOUA 3TJBA 1B48A 1SYRA 3A2VA 1T7PB 2B1LA 1A8YA 2E0QA 3BJ5A 4PUAA 5CRGA 1GLPA 4LL1B 3TJFA 3ZFBA 1GSQA 3FZ4A 3HY2A 2YNXA 22GSA 4IN0A 2VLUA 3ERFA 4DSRA 4EXJA 4JR4A 3FZ5A 1Z9HA 2IL3A 3DWVA 1USBA 1DUGA 2VCWA 3WGEA 2OE3A 4Q5QA 1KNGA 2LS5A 3ERWA 1GUHA 4YQMA 4HU7A 4ZBAA 3QAVA 5D96A 2H66A 1TI1A 1DSBA 1Z6NA 2DMMA 1PL2A 4RI6A 2LRNA 3LXZA 4IJIA 1TDIA 4HJMA 4HZ2A 3P7XA 5INYA 2B5YA 1G0TA 2MYGA 1M2BA 2DLXA 5IOXA 2YZUA 1WWJA 8GSSA 1TP9A 2GDRA 4YAPA 2L6DA 5F06A 3CYNA 4GWRA 2LJKA 4KCEA 3ZVJD 4KE3A 5EPFA 3LFLA 1BX9A 1PSQA 3M8NA 3UEMA 2YP6A 4CDOA 4K7NA 2G0FA 3PINA 3IAS2 1YQ1A 5DCHA 1GLQA 3ZITA 3EU3A 2VLTA 1WJKA 2X99A 1K0DA 4AJ7A 4GCIA 2R3XA 2H0GA 2N5FA 1B4PA 1DBYA 5ELGA 1OE8A 1OC9B 1AUCA 1WOUA 2NPBA 4YQUA 3GKMA 1O8WA 5CRDA 1A2MA 4LMVA 4EO3A 4YQVA 1GSEA 2OBIA 4TXOB 4X1UA 3BBYA 4HS1A 1R5PA 4YAVA 4F0CA 1BQ7A 2DJ1A 4IBPA 1O85A 1ON4A 1EV9A 1AW9A 1YJ6A 2I3YA 4MCUA 3HJMA 5F0GA 1EP8A 1TK0B 2OACA 2FNOA 5CREA 5ECIB 5JCWA 1AQXA 1H4OA 3O6TA 4BVYA 1QK8A 4MABA 3QFAC 3GHAA 4XTSA 2DIYA 3C7MA 1TKDB 3F3QA 2MMZA 1WMJA 3FYGA 3GTUB 1QMVA 1YKCA 2C0EA 1BAYA 3QDNA 3D0ZA 4RUVA 3RPPA 3TKRA 1Z3EA 2VCZA 3F0IA 1Z7RA 4JRRA 3IC4A 3GNJA 2JZSA 3CRUA 2OE0A 3UAPA 2O8VB 2GT6A 3FY7A 4TVEA 5GAPD 5JWRB 6GSUA 4DEJA 3R2QA 4I8BA 3ZFLA 4H86A 1XW6A 3KP9A 3QD9A 4PGTA 2F8FA 5FWGA 2PMTA 1UN2A 5J9CA 3DRNA 2LRCA 4OFTA 3UL3A 1ILOA 5DJLA 3KP8A 2H1DA 5B6MA 4K7IA 4O7HA 3TDGA 1VGLA 2O87A 1RW1A 3E3EA 4XCSA 1IYHA 1VF3A 2EC4A 4NMUA 3M9JA 3ME8A 2PVOC 3LQ7A 4O92A 1FVKA 5GSSA 1TK8B 3UJ1A 2I9HA 5DALB 3FZ9A 1PX7A 2YN1A 4BWQA 3RPNA 1VRSD 1OC8A 5ECQB 4MPGA 1K0AA 5IIZA 1XZOA 4ZB9A 1ZYQB 5CO3A 2VL2C 1XWBA 3NZNA 3ZIJA 1TRWA 3FEUA 3CSIA 5IMCA 3VPTA 3W8SA 4D73A 2B5XA 2H6ZA 5DQYA 3EURA 4K1FA 2L5OA 1Q98A 2J9HA 3IR4A 4O32A 3KH9A 3MWHA 3KJYA 3UIWA 1WE0A 4L0WA 5L71A 1ZOFA 4ECIA 2R6KA 1G7OA 4HOJA 5D9WA 1FOVA 3F63A 3EWLA 1SKSB 4KNDA 5H5SA 3P2AA 1SJ6A 4X0XA 4PX1A 2GQMA 3L4NA 16GSA 2WFCA 3I43A 2D2ZA 2VD1A 3C1SA 1XW5A 2I1UA 5JCGA 2B7KA 5F8BA 1NW2A 3GRXA 1X9MB 3FR9A 2CZ3A 4TKYA 4KDUA 2CAIA 2AAWA 1BG5A 4MMMA 5ECMB 2L4QA 2TRCP 2I81A 2H6XA 3J7Yk 4TXVA 4ZILA 3CTGA 5ECOB 1F3AA 3KXOA 2YV7A 3ZMKA 5J4UA 2GLRA 2PVQA 2X8CA 3RBTA 2GQLA 2O89A 2B6MA 4MLYA 5H5QA 1JZOA 4ZBBA 1TW9A 3CSHA 1O81A 4XHMA 4V1Ag 4EVMA 1TRVA 2HLSA 1VF1A 1HNCA 4LL4B 2FLSA 2HXKA 3VWUA 1FAAA 1YEPA 3GKNA 1GULA 2P31A 4ECBA 2HI7A 1XIYA 2I4AA 1GWCA 4MF6A 2HE3A 2A2SA 5HR0A 2CV4A 2YJ7A 4HU9A 3GMFA 1XXUA 4GRFA 4MA9A 1KBNA 1S3AA 4ZBDA 1TJDA 5DQSA 4GF0A 4XS4B 1MDIA 2V6KA 2VCVA 2VD0A 2N5AA 4MJEA 3F3RA 2VL3A 4IVFA 3HXSA 5G30A 2L59A 2VIMA 4E8HA 1OAZA 2QGVA 1TU7A 3MNGA 1OC9A 1WRYA 2CT6A 3IE3A 1OKTA 2XPEA 1SENA 2FA4A 5ECKB 3UBKA 1A8LA 2JACA 1LJRA 1GL8A 1UA5A 1K0OA 4HDEA 1Q4JA 2WCIA 1XVWA 5D8IA 4POKA 4YH2A 4EF0A 2RM5A 3IK7A 2RUEA 1XOBA 3EE2A 1AQWA 5ID2B 3TRPA 4WR5A 1X5DA 3GH9A 3KH7A 4HEA2 3L9SA 3RHCA 4G2EA 3GKXA 1SJIA 2VM2A 3GTUA 2DIZA 5AISA 3KGKA 3F9UA 4X43A 3BCKA 2C3QA 1JHBA 3QR6A 2WDUA 3F6FA 5A4VA 1NHOA 2CA8A 4QL7A 1V9WA 3RAZA 1M7TA 6GSYA 1WPIA 3HVSA 2CVKA 2NTOA 2R2JA 5DDLA 2GTUA 1R4WA 1ZCPA 3DMLA 3ZVJA 3CSJA 4QL9A 2G2QA 1HNBA 4PQIA 3IPZA 5DAKB 4QQ7A 2VL9A 1GSSA 3G7IA 1FVJA 3HZ4A 3OR5A 3P90A 2LNSA 2IMEA 1GTBA 2ZNMA 2HSYA 1E2YA 1VF2A 4BVXA 1QXHA 2P0GA 1O7UA 2LRTA 1YZXA 5A4UA 1Z7PA 3SBCA 1TU8A 3MAKA 2JZRA 5FT3A 2LQQA 5E4WA 3KZQA 4TN8A 1XOAA 3ZTLA 2AB6A 3QCPA 3LYKA 2F51A 1O6JA 2C0DA 4G19A 2YANA 1AC1A 2L6CA 2QC7A 3G7YA 4OWYA 2GQKA 1URMA 2IIYA 1V2AA 4EDZA 2FY6A 4KDXA 2XHFA 4HUAA 1TK5B 1M99A 4K0GA 1WP0A 3VPQA 5H5RA 3LEFA 4PQ1A 2ES7A 1B9XC 4XS6A 2HZEA 3HJOA 5AN1A 4Q5RA 3MDKA 4OO4A 3DEXA 1J0FA 2H01A 1THOA 5CP1A 2B7JA 3GIXA 3F8UA 1FHEA 5CYYA 2V32A 5IPHA 1FW1A 1XCCA 2VOCA 3CMIA 1EZKA 4MJAA 2YPMA 2A2RA 3TJJA 2TRXA 1B8XA 2CVDA 1M2DA 2DSAA 3US3A 3I69A 3VWWA 1SK0A 1B4QA 1K0MA 4WBRD 1KTEA 2VO4A 4IW9A 4F03A 4HI7A 1QFNA 1PGTA 3O76A 2B5EA 4DVCA 2GSRA 2N5BA 2PN8A 4E8EA 2EIOA 2HZFA 1VF4A 1GNWA 2R5GA 1FB6A 3HDCA 2BMXA 2L5LA 2WRTA 3GA4A 2P5RA 3LORA 4KX4A 5D93A 4RQRA 2H8LA 4IJ3A 4GSNA 2GZYA 4OFNA 2C3TA 3F4TA 1CQHA 3KTLA 3ZZXA 2K8VA 5AIXA 1JLVA 2MZCA 1BEDA 4TOPA 2XBQA 1IYIA 1V57A 4MZCA 3CXGA 2YWNA 4ID0A 1K0CA 2JL4A 2H72A 2HRNA 3IOSA 3HKRA 4IHUA 3GKKA 1XW9A 1HQOA 3DD3A 2FD3A 1K0NA 3IBHA 2C4JA 5LCZA 3GSSA 3H4KA 5CAXA 2DJ3A 1EEMA 3IDVA 3IHQA 2C8UA 9GSSA 4IP6A 2IMDA 1RQMA 3QPMA 4L0UA 4I97A 17GSA 2MMOA 4JZQA 4XS4A 1QUWA 2TIRA 4NHZA 5AGYA 2JSZA 3H79A 1S3DA 5EY6A 4OD7A 3WT2A 1EOGA 4ZL7A 4F9ZA 5HFIA 5HQPA 3VWVA 1PD21 1A2LA 1AQVA 3KIJA 2ZCTA 2GSSA 4KSOA 3N5OA 3LWAA 1Z6MA 5F05A 5IMAA 1JZDA 2DMLA 4HZ4A 5IMFA 2CX3A 1JZWA 4POMA 2H70A 4RI7A 1PQNA 2K8SA 3U6VA 3L9VA 1LU4A 3ZIVA 1PKWA 5IM9A 2NDOA 3G7JA 2YWOA 1GSDA 5ABRA 3HA9A 3HYPA 2BJXA 4DSQA 1ZMAA 1J9BA 2XC2A 2YCDA 1HYUA 4OO5A 2VL2A 2J23A 5ECSA 4MZWA 1MEKA 1ERVA 3A2WA 2AUVA 4JR6A 2IPAA 3FRCA 2L4CA 3FZAA 5IMVA 5ECHB 5IO0A 3JCML 3O3TA 3K8NA 2M80A 1U88A 2VCXA 4IELA 4O5RA 3VLNA 3A3TA 4BWSA 2M46A 4HQZA 2H0IA 4DSSB 1TRSA 2MMNA 1OVNA 2NVLA 4KH7A 2EIQA 1SL2B 1SL0B 1XWAA 3KMNA 3CBUA 5KEJA 4KGIA 1BYEA 2H19A 4IS0A 1EV4A 2DJKA 4L8EA 1MDJA 4WR4A 2KOKA 1A24A 5HFGA 4LMWA 2V1MA 1TRUA 1YDKA 4V1Ap 5COHA 3BOAA 3VFIA 4KUNA 4XIHA 2ALBA 1M9BA 4K6XA 4WEYA 4ZL8A 4L5OA 4NXIA 1XWGA 4WF4A 1SD9A 2FHEA 4GQFA 1T1VA 3LSZA 4IGJA 1U3IA 1F6MC 5ECPB 2JU5A 2JZTA 1PKZA 2OA7A 2WJUA 1A0FA 3F6DA 5ECRB 5J5NA 2C80A 6GSSA 4MF5A 2JADA 5D73A 1EOHA 2OBKA 2C3NA 5GAND 3FR6A 4J2FA 4GSTA 5ELAA 1GSUA 6GSXA 3DVWA 1JFUA 2YV9A 3LG6A 1YKAA 4FO5A 4J57E 4XRDA 5LNKe 1T00A 4TR1B 2CAQA 5G1LA 1FG4A 4I6XA 5AIVA 4MDCA 5KN3A 1GNEA 4PURA 2HT9A 4MK3A 1K3OA 18GSA 1F9MA 2PPTA 1SKWB 5G5FA 4K9ZA 1OE7A 2X8HA 1KEBA 1I9DA 2P5QA 1CQGA 4ZL9A 1GRXA 4GXZA 3WD6A 4AF2A 4EUYA 5J3RA 4PXOA 1PL1A 5CNWA 2R37A 2C1YA 3M0FA 4CHSA 4WXTA 3DYRA 4TR0A 1THXA 4WBJA 2VCQA 3DVXA 1SK2A 5JCUA 3QMXA 2CQ9A 2YWIA 3APOA 3IRAA 1V58A 1ZGNA 4MH2A 4EC0A 2IN3A 3GUSA 3ME7A 4OFMA 4TXOA 3U5RE 2ON7A 2PUKC 4NPBA 1EGRA 1GTUA 20GSA 6GSTA 1WIKA 1G6YA 3KMOA 1MDKA 11GSA 1GSYA 1M0UA 5ENUA 3H8QA 3LGCA 3QAWA 2GS3A 3UOMA 1I5GA 2PBJA 4K2DA 2IMKA 5J9BA 4N0ZA 4L5LA 4J56E 3I9V2 3G9BA 1Y6EA 3D4TA 1PRXA 1X9WB 2ZUPA 2YWMA 3WGDA 1SJZA 1HNAA 3LJRA 3I6AA 2H0HA 3GYKA 2PERA 1AAZA 3TKSE 2B1KA 4ULXA 3BD2A 3EINA 3CRTA 4KCAA 4LLRA 5C04A 4LA1A 4JE1A 5G5EA 2FWHA 2KHPA 2WZ9A 3WYWA 5IO2A 3MSZA 4CW9A 3EMPA 1Z5YE 3CTFA 13GSA 4MF7A 1NHYA 1TOFA 1GTIA 4ISDA 3IAM2 4G10A 3TOTA 3Q6OA 2E7PA 2HSHA 2LJRA 3C73A 3TGZA 3J7Yb 3ERGA 1AXDA 4KAEA 2MBTA 3IK9A 5IMZA 4ZB6A 4NHWA 3Q74A 4AGSA 3IA1A 5DALA 3EVIA 3FK8A 1T3BA 4ZXGA 14GSA 4P3YB 3RDWA 3S9FA 3UARA 4PNFA 5FHIA 3HCZA 4BPYA 1YEXA 5B8AA 4DSSA 4OCEA 3ED3A 1O73A 1TXXA 2GZPA 3FKFA 4GTUA 4MZBA 2XPDA 4HJ2A 4I5QA 4KDYA 1ERTA 3TRQA 2C0GA 3ZRDA 4XRAA 4Z7XA 4POLA 1U87A 2GSQA 2H1GA 1ZYEA 2KP1A 1ERWA 3QOUA 4ECJA 2ON5A 2FWFA 3C8EA 5DJMA 4GLTA 4FYCA 2LTKA 1R5AA 1GUMA 2V41A 2VCTA 2IFQB 4PQHA 3TKPA 4N0VA 1XWKA 3ZMLA 4MJBA 1YF0A 2REMA 1YY7A 2RIIA 2LQOA 2H1BA 3HVVA 3A2XA 5JWQB 3HVXA 4EL1A 3A5WA 5B7CA 1ST9A 1R26A 3VI5A 4FIWA 5F07A 1Y25A 1T4ZA 1JZRA 3ISOA 1PA3A 4GSSA 3W8JA 5EVOA 3FW2A 2GZZA 2VAFA 3GX8A 4EDYA 4TR1A 5D9VA 3HD5A 3GN3A 4FH8A 4RQXA 2H1AA 4F2IA 2HNLA 5GZZB 1ABAA 3EU4A 3Q19A 1FB0A 1ML6A 2KLXA 1M9AA 2YZHA 1HD2A 1U6TA 1A2JA 1T8EB 2AYTA 5IPGA 1X0RA 3QFBC 1E6BA 4ILFA 3DXBA 2H75A 2IJYA 1J08A 1X9SB 1RK4A 3KTBA 4BA7A 1A0RP 3WT1A 1K0BA 1EP7A 1A23A 3F4SA 4I2TA 5EL8A 5GSTA 1S3CA 1V98A 3L78A 1GP1A 3ZLPA 1PX6A 3TB2A 4NAXA 4EE0A 5D9XA 3VK9A 3KEBA 3QAGA 1EGOA 2KP2A 3E0UA 1DE2A 2RLIA
chains in the Genus database with same CATH superfamily
2AHEA 3VWXA 2CX4A 3GX0A 2B3SA 1DE1A 3GH6A 1MTCA 4Q5FA 1EWXA 5ID2A 3L9UA 3Q18A 1ACVA 1T4YA 1NM3A 4K0NA 2LUSA 7GSSA 2IMIA 1GUKA 2X64A 4V2LA 4BVXB 3WGXA 1XBSA 4MH3A 1U3AA 4ECCA 1LBKA 2GGTA 3D4MA 2JSYA 1V40A 4USSA 5J41A 2HRFA 3PH9A 2A4VA 2NBSA 3ZL5A 1PN9A 3C71A 5IOWA 4BL7A 2H6YA 1X5CA 1FO5A 3VURA 3TKSA 3KM6A 3APSA 2CVBA 3DIEA 1SKRB 1XFLA 3HHVA 5IMDA 2GT5A 1AIUA 1MD3A 1O8XA 1OC3A 5LD0A 4KF9A 2GVPA 4POBA 1R7HA 2WS2A 1N2AA 5CRHA 3PGTA 4GQCA 1NSWA 2HZEB 2O7KA 6GSVA 1SL1B 5DAKA 4KW6A 3APQA 1M3IA 1OKDA 4FYUA 3LXTA 2FA8A 2X8GA 1ZL9A 4K7OA 3BCIA 2RM6A 1X5EA 4AJ8A 5DBQA 3FHKA 2GSTA 4ML6A 1BJXA 1G6WA 1SU9A 2L57A 3GSTA 3TKSC 1TTZA 1SYXA 1GH2A 1M2AA 5KN2A 4PNGA 1F3BA 1JLWA 2BTOT 2OADA 1QGVA 4EKZA 3NOFA 2RUFA 5C00A 4FYBA 3M3MA 4ML1A 1ERUA 3PPUA 2OE1A 3AY8A 3D21A 4MPFA 4MJCA 4NV2A 2M72A 2VUPA 2R0CA 2VM1A 2H30A 4IKHA 4V2NA 2QSIA 3IV4A 2AV4A 1QQ2A 2FCHA 3KD0A 4I2UA 4X4JA 2MBSA 5CRWA 2R4VA 3F4RA 2DJJA 2V6OA 1XPVA 5A5KA 3M1GA 4Z2RA 1XWCA 3ZYWA 3UMAA 3HZ8A 1UC7A 4F82A 2LSTA 1OYJA 4TRXA 6GSWA 3TCOA 3UBLA 3HJPA 1GSFA 2LNTA 3E9JB 3N9JA 2IMFA 2VLVA 4IP1A 5HFKA 1N8JA 5HR1A 4IQ1A 2FWEA 2K9FA 1F37A 1PMTA 5DCGA 4WKWA 4Q5NA 3H93A 4JEDA 3VI7A 2WB9A 4F0BA 4N30A 1C72A 2HYXA 4BVYB 3M9KA 2IFQA 4ZB8A 4OCFA 2FUG2 4MP4A 2LJAA 4K8MA 2F9SA 1MD4A 3UVTA 3FR3A 4O5QA 2H76A 2OKAA 1UVZA 2LEGA 2YOIA 3TJGA 2YJHA 3IXRA 4OMVA 5HR2A 4HQSA 2DBCA 5G2ZA 2DJ0A 5G1KA 2H73A 3TKQA 3H1NA 2HFDA 1F2EA 4O5UA 1EEJA 2KUCA 2LKUA 3V1WA 3KCMA 5D9TA 19GSA 4V2MA 2E2MA 2C0FA 2Z9SA 2AJQB 1XVQA 5IQYA 2XBIA 5HR3A 4TR3A 2E2GA 2PU9C 5JWOB 3C1RA 3TRXA 4AJ6A 12GSA 2CZ2A 4XS1A 5B8BA 4G0LA 3RHBA 5DVBA 5G31A 4JBBA 5A4WA 3D6IA 2EIRA 2FWGA 4TR4A 3ZREA 3EMXA 4PUFC 2K18A 2MMAA 5KN0A 1K3YA 1H75A 5ECNB 3GURA 2PGTA 3SWLA 2LV3A 1SK1A 1GTAA 3L0HA 3TJKA 1SD8A 2WGRA 2O85A 3D5JA 1YF1A 2F3MA 2DJ2A 2FGXA 5KN1A 3PR8A 3GL3A 3GL5A 2K6VA 3D22A 1W4VA 2WULA 3DKSA 1TI3A 3DGQA 4IQAA 2V2GA 4WETA 3P8WA 1G7EA 4D73B 2F8AA 4NV5A 4KB3A 3LYPA 4N11A 4MNNA 10GSA 4TW5A 4G9HA 3UVHA 5B6NA 4ACSA 1W89A 3NIVA 1ZZYA 2H74A 2QKEA 4JU5A 3W6GA 2PWJA 5E59A 4ZIJA 4KA0A 5ECLB 3TUEA 3GFKA 3GV1A 4WF5A 2IWTA 4NWYA 3EYTA 4N10A 1K3LA 2OJLA 1B9YC 2H71A 3EC3A 4KSMA 2DC5A 3TOUA 3TJBA 1B48A 1SYRA 3A2VA 1T7PB 2B1LA 1A8YA 2E0QA 3BJ5A 4PUAA 5CRGA 1GLPA 4LL1B 3TJFA 3ZFBA 1GSQA 3FZ4A 3HY2A 2YNXA 22GSA 4IN0A 2VLUA 3ERFA 4DSRA 4EXJA 4JR4A 3FZ5A 1Z9HA 2IL3A 3DWVA 1USBA 1DUGA 2VCWA 3WGEA 2OE3A 1PFOA 4Q5QA 1KNGA 2LS5A 3ERWA 1GUHA 4YQMA 4HU7A 4FQUA 4ZBAA 3QAVA 5D96A 2H66A 1TI1A 1DSBA 1Z6NA 2DMMA 1PL2A 4RI6A 2LRNA 3LXZA 4IJIA 1TDIA 4HJMA 4HZ2A 3P7XA 5INYA 2B5YA 5KOWA 1G0TA 2MYGA 1M2BA 2DLXA 5IOXA 2YZUA 1WWJA 8GSSA 1TP9A 2GDRA 4YAPA 2L6DA 2UZ8A 5F06A 3CYNA 4GWRA 2LJKA 4KCEA 3ZVJD 4KE3A 5EPFA 3LFLA 1BX9A 1PSQA 3M8NA 3UEMA 2YP6A 4CDOA 4K7NA 2G0FA 3PINA 3IAS2 1YQ1A 5DCHA 1GLQA 3ZITA 3EU3A 2VLTA 1WJKA 2X99A 1K0DA 4AJ7A 4GCIA 2R3XA 2H0GA 2N5FA 1B4PA 1DBYA 5ELGA 1OE8A 1OC9B 1AUCA 1WOUA 2NPBA 4YQUA 3GKMA 1O8WA 5CRDA 1A2MA 4LMVA 4EO3A 4YQVA 1GSEA 2OBIA 4TXOB 4X1UA 2X49A 3BBYA 4HS1A 1R5PA 4YAVA 4F0CA 1BQ7A 2DJ1A 4IBPA 1O85A 1ON4A 1EV9A 1AW9A 1YJ6A 2I3YA 4MCUA 3HJMA 1M3JA 5F0GA 1EP8A 1TK0B 2OACA 2FNOA 1XG8A 5CREA 5ECIB 5JCWA 1AQXA 1H4OA 3O6TA 4BVYA 1QK8A 4MABA 3QFAC 3GHAA 4XTSA 2DIYA 3C7MA 1TKDB 3F3QA 2MMZA 1WMJA 3FYGA 3GTUB 1QMVA 1YKCA 2C0EA 1BAYA 3QDNA 3D0ZA 2A2PA 4RUVA 3RPPA 3TKRA 1Z3EA 2VCZA 3F0IA 1Z7RA 4JRRA 3IC4A 3GNJA 2JZSA 3CRUA 2OE0A 3UAPA 2O8VB 2GT6A 3FY7A 4TVEA 5GAPD 5JWRB 6GSUA 4DEJA 3R2QA 4I8BA 3ZFLA 4H86A 1XW6A 3KP9A 3QD9A 4PGTA 2F8FA 5FWGA 2PMTA 1UN2A 5J9CA 3DRNA 2LRCA 4OFTA 3UL3A 1ILOA 5DJLA 3KP8A 2H1DA 5B6MA 4K7IA 4O7HA 3TDGA 1VGLA 2O87A 1RW1A 3E3EA 4XCSA 1IYHA 1VF3A 3MIXA 2EC4A 4NMUA 3M9JA 3ME8A 2PVOC 3LQ7A 4O92A 1FVKA 5GSSA 1TK8B 3UJ1A 2I9HA 5DALB 3FZ9A 1PX7A 2YN1A 4YKFA 4BWQA 3RPNA 1VRSD 1OC8A 5ECQB 4MPGA 1K0AA 5IIZA 1XZOA 4ZB9A 1ZYQB 5CO3A 2VL2C 1XWBA 3NZNA 3ZIJA 1TRWA 3FEUA 3CSIA 5IMCA 3VPTA 3W8SA 4D73A 2B5XA 2H6ZA 5DQYA 3EURA 4K1FA 2L5OA 1Q98A 2J9HA 3IR4A 4O32A 3KH9A 3MWHA 3KJYA 3UIWA 1WE0A 4L0WA 5L71A 1ZOFA 4ECIA 2R6KA 1G7OA 4HOJA 3LW9A 5D9WA 1FOVA 3F63A 3EWLA 1SKSB 4KNDA 5H5SA 3P2AA 1SJ6A 4X0XA 4PX1A 2GQMA 3L4NA 16GSA 2WFCA 3I43A 2D2ZA 2VD1A 3C1SA 1XW5A 2I1UA 5JCGA 2B7KA 5F8BA 1NW2A 3GRXA 1X9MB 3FR9A 2CZ3A 4TKYA 4KDUA 2CAIA 2AAWA 1BG5A 4MMMA 5ECMB 2L4QA 2TRCP 2I81A 2H6XA 3J7Yk 4TXVA 4ZILA 3CTGA 5ECOB 1F3AA 3KXOA 2YV7A 3ZMKA 5J4UA 2GLRA 2PVQA 2X8CA 3RBTA 2GQLA 2O89A 2B6MA 4MLYA 5H5QA 1JZOA 4ZBBA 1TW9A 3CSHA 1O81A 4XHMA 4V1Ag 4EVMA 1TRVA 3MYDA 2QA2A 2HLSA 1VF1A 1HNCA 4LL4B 2FLSA 2HXKA 3VWUA 1FAAA 1YEPA 3GKNA 1GULA 2P31A 4ECBA 2HI7A 1XIYA 2I4AA 1GWCA 4MF6A 2HE3A 2A2SA 5HR0A 2CV4A 2YJ7A 3FMWA 4HU9A 3GMFA 1XXUA 4GRFA 4MA9A 1KBNA 1S3AA 4ZBDA 1TJDA 5DQSA 4GF0A 4XS4B 1MDIA 2V6KA 2VCVA 2VD0A 2N5AA 4EIPA 4MJEA 3F3RA 2VL3A 4IVFA 3HXSA 5G30A 2L59A 2VIMA 4E8HA 1OAZA 2QGVA 1TU7A 3MNGA 1OC9A 1WRYA 2CT6A 3IE3A 1OKTA 2XPEA 1SENA 2FA4A 5ECKB 3UBKA 1A8LA 2JACA 1LJRA 2X4AA 1GL8A 1UA5A 2QA1A 1K0OA 4HDEA 1Q4JA 2WCIA 1XVWA 5D8IA 4POKA 4Z2TA 4YH2A 4EF0A 2RM5A 3IK7A 2RUEA 4ICYA 1XOBA 3EE2A 1AQWA 5ID2B 3TRPA 4WR5A 1X5DA 3GH9A 3KH7A 4HEA2 3L9SA 3RHCA 4G2EA 3GKXA 1SJIA 2VM2A 3GTUA 3CQFA 2DIZA 5AISA 3KGKA 3F9UA 4X43A 3BCKA 2C3QA 1JHBA 3QR6A 2WDUA 3F6FA 5A4VA 1NHOA 2CA8A 4QL7A 1V9WA 3RAZA 3IC8A 1M7TA 2DKHA 6GSYA 1WPIA 3HVSA 2CVKA 2NTOA 2R2JA 5DDLA 2GTUA 1R4WA 1ZCPA 3DMLA 3ZVJA 3CSJA 4QL9A 2G2QA 1HNBA 4PQIA 3IPZA 5DAKB 4QQ7A 2VL9A 1GSSA 3G7IA 1FVJA 3HZ4A 3OR5A 3P90A 2LNSA 2IMEA 1GTBA 2ZNMA 2HSYA 1E2YA 1VF2A 4BVXA 1QXHA 2P0GA 1O7UA 2LRTA 1YZXA 5A4UA 1Z7PA 3SBCA 1TU8A 3MAKA 2JZRA 5FT3A 2LQQA 5E4WA 3KZQA 4TN8A 1XOAA 3ZTLA 2AB6A 3QCPA 3LYKA 2F51A 1O6JA 2C0DA 4G19A 2YANA 1AC1A 2L6CA 2QC7A 3G7YA 4OWYA 2GQKA 1URMA 2IIYA 1V2AA 4EDZA 2FY6A 4KDXA 2XHFA 4HUAA 2DKIA 1TK5B 4PTSA 1M99A 4K0GA 1WP0A 3VPQA 5H5RA 3LEFA 4PQ1A 2ES7A 1B9XC 4XS6A 2HZEA 3HJOA 5AN1A 4Q5RA 3MDKA 4OO4A 3DEXA 1J0FA 2H01A 1THOA 5CP1A 2R0GA 2B7JA 3GIXA 3F8UA 1FHEA 5CYYA 2V32A 5IPHA 1FW1A 1XCCA 2VOCA 3CMIA 1EZKA 4YKGA 4MJAA 2YPMA 2A2RA 3TJJA 2TRXA 1B8XA 2CVDA 1M2DA 2DSAA 3US3A 3I69A 3VWWA 1SK0A 1B4QA 1K0MA 4WBRD 1KTEA 2VO4A 4IW9A 4F03A 4HI7A 1QFNA 1PGTA 3O76A 2B5EA 4DVCA 2GSRA 2N5BA 2PN8A 4E8EA 2EIOA 2HZFA 1VF4A 1GNWA 2R5GA 1FB6A 3HDCA 2BMXA 2L5LA 2WRTA 3GA4A 2P5RA 3LORA 4KX4A 5D93A 4RQRA 2H8LA 4IJ3A 4GSNA 2GZYA 4OFNA 2C3TA 3F4TA 1CQHA 3KTLA 3ZZXA 2K8VA 5AIXA 1JLVA 2MZCA 1BEDA 4TOPA 2XBQA 1IYIA 1V57A 4MZCA 3CXGA 2YWNA 4ID0A 1K0CA 2JL4A 2H72A 2HRNA 3IOSA 3HKRA 4IHUA 3GKKA 1XW9A 1HQOA 3DD3A 2FD3A 4G0IA 1K0NA 3IBHA 2C4JA 5LCZA 3GSSA 3H4KA 5CAXA 2DJ3A 1EEMA 3IDVA 3IHQA 2C8UA 9GSSA 4IP6A 2IMDA 1RQMA 3QPMA 4L0UA 4I97A 17GSA 2MMOA 4JZQA 4XS4A 1QUWA 2TIRA 4NHZA 5AGYA 2JSZA 3H79A 1S3DA 5EY6A 4OD7A 3WT2A 1EOGA 4ZL7A 4F9ZA 5HFIA 5HQPA 3VWVA 1PD21 1A2LA 1AQVA 3KIJA 2ZCTA 2GSSA 4KSOA 3EPTA 3N5OA 1S3RA 3LWAA 1Z6MA 5F05A 5IMAA 1JZDA 2DMLA 4HZ4A 5IMFA 2CX3A 1JZWA 4POMA 2H70A 4RI7A 1PQNA 2K8SA 3U6VA 4Z2UA 3L9VA 2HRKA 1LU4A 1ZYNA 3ZIVA 1PKWA 5IM9A 2NDOA 2HRAA 3G7JA 2YWOA 1GSDA 5ABRA 3HA9A 3HYPA 2BJXA 4DSQA 1ZMAA 1J9BA 2XC2A 2YCDA 1HYUA 4OO5A 2VL2A 2J23A 5ECSA 4MZWA 1MEKA 1ERVA 3A2WA 3A5IA 2AUVA 4JR6A 4G0KA 2IPAA 3FRCA 2L4CA 3FZAA 5IMVA 5KOXA 5ECHB 5IO0A 3JCML 3O3TA 3K8NA 2M80A 1U88A 2VCXA 4IELA 4O5RA 3VLNA 3A3TA 4BWSA 2M46A 4HQZA 2H0IA 4DSSB 1TRSA 4CY6A 2MMNA 1OVNA 2NVLA 4KH7A 2EIQA 1SL2B 1SL0B 1XWAA 3KMNA 3CBUA 5KEJA 4KGIA 5BMUA 1BYEA 2H19A 4IS0A 1EV4A 2DJKA 4L8EA 1MDJA 4WR4A 2KOKA 1A24A 5HFGA 4LMWA 2V1MA 1ZYPA 1TRUA 1YDKA 4V1Ap 5COHA 3BOAA 3VFIA 4KUNA 4XIHA 2ALBA 1M9BA 4K6XA 4WEYA 4ZL8A 4L5OA 4NXIA 1XWGA 4WF4A 1SD9A 2FHEA 4GQFA 1T1VA 3LSZA 4IGJA 1U3IA 1F6MC 5ECPB 2JU5A 2JZTA 1PKZA 2OA7A 2WJUA 1A0FA 3F6DA 5ECRB 5J5NA 2C80A 6GSSA 4MF5A 2JADA 5D73A 1EOHA 2OBKA 2C3NA 5GAND 3FR6A 4J2FA 4GSTA 5ELAA 1GSUA 6GSXA 3DVWA 1JFUA 2YV9A 3LG6A 1YKAA 4FO5A 4J57E 4XRDA 5LNKe 1T00A 4TR1B 2CAQA 5G1LA 1FG4A 4I6XA 5AIVA 2A4HA 4MDCA 5KN3A 1GNEA 4PURA 2HT9A 4MK3A 1K3OA 18GSA 1F9MA 2PPTA 1SKWB 5G5FA 4K9ZA 1OE7A 2X8HA 1KEBA 1I9DA 2P5QA 1CQGA 4ZL9A 1GRXA 4GXZA 3WD6A 4AF2A 4EUYA 5J3RA 2HSMA 4PXOA 1PL1A 5CNWA 2R37A 2C1YA 3M0FA 4CHSA 4WXTA 3DYRA 4TR0A 1THXA 4WBJA 4K2XA 2VCQA 3DVXA 1SK2A 5JCUA 3QMXA 2CQ9A 2YWIA 3APOA 3IRAA 1V58A 1ZGNA 4MH2A 4EC0A 2IN3A 3GUSA 3ME7A 4OFMA 4TXOA 3U5RE 2ON7A 2PUKC 4NPBA 1EGRA 1GTUA 20GSA 1PN0A 6GSTA 1WIKA 1G6YA 3KMOA 1MDKA 11GSA 1GSYA 1M0UA 5ENUA 3H8QA 3LGCA 3QAWA 2GS3A 3UOMA 1I5GA 2PBJA 4K2DA 2IMKA 5J9BA 4N0ZA 4L5LA 4J56E 3I9V2 3G9BA 1Y6EA 3D4TA 1PRXA 1X9WB 2ZUPA 2YWMA 3WGDA 4EIQA 1SJZA 1HNAA 3LJRA 3I6AA 2H0HA 4K5SA 3GYKA 2PERA 4BL7B 1AAZA 3TKSE 2B1KA 4ULXA 3BD2A 3EINA 3CRTA 4KCAA 4LLRA 5C04A 4LA1A 4JE1A 5G5EA 2FWHA 2KHPA 2WZ9A 3WYWA 5IO2A 3IHGA 3MSZA 4CW9A 3EMPA 1Z5YE 3CTFA 13GSA 4MF7A 1NHYA 1TOFA 1GTIA 4ISDA 3IAM2 4G10A 3TOTA 3Q6OA 2R0PA 2E7PA 2HSHA 2LJRA 3C73A 3TGZA 3J7Yb 3ERGA 1AXDA 4KAEA 1FOHA 2MBTA 3IK9A 5IMZA 4ZB6A 4NHWA 3Q74A 4AGSA 3IA1A 5DALA 3EVIA 3FK8A 1T3BA 4ZXGA 14GSA 4P3YB 3RDWA 3HVNA 3S9FA 3UARA 4A5PA 4PNFA 5FHIA 3HCZA 4BPYA 1YEXA 5B8AA 4DSSA 4OCEA 3ED3A 1O73A 1TXXA 2GZPA 3FKFA 4GTUA 4MZBA 2XPDA 4HJ2A 4I5QA 4KDYA 1ERTA 3TRQA 2C0GA 3ZRDA 4XRAA 4Z7XA 4POLA 1U87A 2GSQA 2H1GA 1ZYEA 2KP1A 1ERWA 3QOUA 4ECJA 2ON5A 2FWFA 3C8EA 5DJMA 4GLTA 4K5RA 4FYCA 2LTKA 1R5AA 3R3EA 1GUMA 2V41A 2VCTA 2IFQB 4PQHA 3TKPA 4N0VA 1XWKA 3ZMLA 4MJBA 1YF0A 2REMA 1YY7A 2RIIA 2LQOA 2H1BA 5BRTA 3HVVA 3A2XA 5JWQB 3HVXA 4EL1A 3A5WA 5B7CA 1ST9A 1R26A 3VI5A 4FIWA 5F07A 1Y25A 1T4ZA 1JZRA 3ISOA 1PA3A 4GSSA 3W8JA 5EVOA 4HSCX 3FW2A 2GZZA 2VAFA 3GX8A 4EDYA 4TR1A 5D9VA 3HD5A 3GN3A 4FH8A 4RQXA 2H1AA 4F2IA 2HNLA 5GZZB 1ABAA 3EU4A 3Q19A 1FB0A 1ML6A 2KLXA 1M9AA 2YZHA 1HD2A 1U6TA 1A2JA 1T8EB 2AYTA 5IPGA 1X0RA 3QFBC 1E6BA 4ILFA 3DXBA 2H75A 2IJYA 1J08A 4CY8A 1X9SB 1RK4A 3KTBA 4BA7A 1A0RP 3WT1A 1K0BA 1EP7A 1A23A 3F4SA 4I2TA 5EL8A 5GSTA 1S3CA 1V98A 3L78A 1GP1A 3ZLPA 1PX6A 3TB2A 4NAXA 4EE0A 5D9XA 3VK9A 3KEBA 3QAGA 1EGOA 2KP2A 3E0UA 1DE2A 2RLIA 4BIKA
chains in the Genus database with same CATH topology
2AHEA 3VWXA 2CX4A 3GX0A 2B3SA 1DE1A 3GH6A 1MTCA 4Q5FA 1EWXA 5ID2A 3L9UA 3Q18A 1ACVA 1T4YA 1NM3A 4K0NA 2LUSA 7GSSA 2IMIA 1GUKA 2X64A 4V2LA 4BVXB 3WGXA 1XBSA 4MH3A 1U3AA 4ECCA 1LBKA 2GGTA 3D4MA 2JSYA 1V40A 4USSA 5J41A 2HRFA 3PH9A 2A4VA 2NBSA 3ZL5A 1PN9A 3C71A 5IOWA 4BL7A 2H6YA 1X5CA 1FO5A 3VURA 3TKSA 3KM6A 3APSA 2CVBA 3DIEA 1SKRB 1XFLA 3HHVA 5IMDA 2GT5A 1AIUA 1MD3A 1O8XA 1OC3A 5LD0A 4KF9A 2GVPA 4POBA 1R7HA 2WS2A 1N2AA 5CRHA 3PGTA 4GQCA 1NSWA 2HZEB 2O7KA 6GSVA 1SL1B 5DAKA 4KW6A 3APQA 1OKDA 4FYUA 3LXTA 2FA8A 2X8GA 1ZL9A 4K7OA 3BCIA 2RM6A 1X5EA 4AJ8A 5DBQA 3FHKA 2GSTA 4ML6A 1BJXA 1G6WA 1SU9A 2L57A 3GSTA 3TKSC 1TTZA 1SYXA 1GH2A 1M2AA 5KN2A 4PNGA 1F3BA 1JLWA 2BTOT 2OADA 1QGVA 4EKZA 3NOFA 2RUFA 5C00A 4FYBA 3M3MA 4ML1A 1ERUA 3PPUA 2OE1A 3AY8A 3D21A 4MPFA 4MJCA 4NV2A 2M72A 2VUPA 2R0CA 2VM1A 2H30A 4IKHA 4V2NA 2QSIA 3IV4A 2AV4A 1QQ2A 2FCHA 3KD0A 4I2UA 4X4JA 2MBSA 5CRWA 2R4VA 3F4RA 2DJJA 2V6OA 1XPVA 5A5KA 3M1GA 4Z2RA 1XWCA 3ZYWA 3UMAA 3HZ8A 1UC7A 4F82A 2LSTA 1OYJA 4TRXA 6GSWA 3TCOA 3UBLA 3HJPA 1GSFA 2LNTA 3E9JB 3N9JA 2IMFA 2VLVA 4IP1A 5HFKA 1N8JA 5HR1A 4IQ1A 2FWEA 2K9FA 1F37A 1PMTA 5DCGA 4WKWA 4Q5NA 3H93A 4JEDA 3VI7A 2WB9A 4F0BA 4N30A 1C72A 2HYXA 4BVYB 3M9KA 2IFQA 4ZB8A 4OCFA 2FUG2 4MP4A 2LJAA 4K8MA 2F9SA 1MD4A 3UVTA 3FR3A 4O5QA 2H76A 2OKAA 1UVZA 2LEGA 2YOIA 3TJGA 2YJHA 3IXRA 4OMVA 5HR2A 4HQSA 2DBCA 5G2ZA 2DJ0A 5G1KA 2H73A 3TKQA 3H1NA 2HFDA 1F2EA 4O5UA 1EEJA 2KUCA 2LKUA 3V1WA 3KCMA 5D9TA 19GSA 4V2MA 2E2MA 2C0FA 2Z9SA 2AJQB 1XVQA 5IQYA 2XBIA 5HR3A 4TR3A 2E2GA 2PU9C 5JWOB 3C1RA 3TRXA 4AJ6A 12GSA 2CZ2A 4XS1A 5B8BA 4G0LA 3RHBA 5DVBA 5G31A 4JBBA 5A4WA 3D6IA 2EIRA 2FWGA 4TR4A 3ZREA 3EMXA 4PUFC 2K18A 2MMAA 5KN0A 1K3YA 1H75A 5ECNB 3GURA 2PGTA 3SWLA 2LV3A 1SK1A 1GTAA 3L0HA 3TJKA 1SD8A 2WGRA 2O85A 3D5JA 1YF1A 2F3MA 2DJ2A 2FGXA 5KN1A 3PR8A 3GL3A 3GL5A 2K6VA 3D22A 1W4VA 2WULA 3DKSA 1TI3A 3DGQA 4IQAA 2V2GA 4WETA 3P8WA 1G7EA 4D73B 2F8AA 4NV5A 4KB3A 3LYPA 4N11A 4MNNA 10GSA 4TW5A 4G9HA 3UVHA 5B6NA 4ACSA 1W89A 3NIVA 1ZZYA 2H74A 2QKEA 4JU5A 3W6GA 2PWJA 5E59A 4ZIJA 4KA0A 5ECLB 3TUEA 3GFKA 3GV1A 4WF5A 2IWTA 4NWYA 3EYTA 4N10A 1K3LA 2OJLA 1B9YC 2H71A 3EC3A 4KSMA 2DC5A 3TOUA 3TJBA 1B48A 1SYRA 3A2VA 1T7PB 2B1LA 1A8YA 2E0QA 3BJ5A 4PUAA 5CRGA 1GLPA 4LL1B 3TJFA 3ZFBA 1GSQA 3FZ4A 3HY2A 2YNXA 22GSA 4IN0A 2VLUA 3ERFA 4DSRA 4EXJA 4JR4A 3FZ5A 1Z9HA 2IL3A 3DWVA 1USBA 1DUGA 2VCWA 3WGEA 2OE3A 4Q5QA 1KNGA 2LS5A 3ERWA 1GUHA 4YQMA 4HU7A 4FQUA 4ZBAA 3QAVA 5D96A 2H66A 1TI1A 1DSBA 1Z6NA 2DMMA 1PL2A 4RI6A 2LRNA 3LXZA 4IJIA 1TDIA 4HJMA 4HZ2A 3P7XA 5INYA 2B5YA 5KOWA 1G0TA 2MYGA 1M2BA 2DLXA 5IOXA 2YZUA 1WWJA 8GSSA 1TP9A 2GDRA 4YAPA 2L6DA 2UZ8A 5F06A 3CYNA 4GWRA 2LJKA 4KCEA 3ZVJD 4KE3A 5EPFA 3LFLA 1BX9A 1PSQA 3M8NA 3UEMA 2YP6A 4CDOA 4K7NA 2G0FA 3PINA 3IAS2 1YQ1A 5DCHA 1GLQA 3ZITA 3EU3A 2VLTA 1WJKA 2X99A 1K0DA 4AJ7A 4GCIA 2R3XA 2H0GA 2N5FA 1B4PA 1DBYA 5ELGA 1OE8A 1OC9B 1AUCA 1WOUA 2NPBA 4YQUA 3GKMA 1O8WA 5CRDA 1A2MA 4LMVA 4EO3A 4YQVA 1GSEA 2OBIA 4TXOB 4X1UA 2X49A 3BBYA 4HS1A 1R5PA 4YAVA 4F0CA 1BQ7A 2DJ1A 4IBPA 1O85A 1ON4A 1EV9A 1AW9A 1YJ6A 2I3YA 4MCUA 3HJMA 5F0GA 1EP8A 1TK0B 2OACA 2FNOA 5CREA 5ECIB 5JCWA 1AQXA 1H4OA 3O6TA 4BVYA 1QK8A 4MABA 3QFAC 3GHAA 4XTSA 2DIYA 3C7MA 1TKDB 3F3QA 2MMZA 1WMJA 3FYGA 3GTUB 1QMVA 1YKCA 2C0EA 1BAYA 3QDNA 3D0ZA 2A2PA 4RUVA 3RPPA 3TKRA 1Z3EA 2VCZA 3F0IA 1Z7RA 4JRRA 3IC4A 3GNJA 2JZSA 3CRUA 2OE0A 3UAPA 2O8VB 2GT6A 3FY7A 4TVEA 5GAPD 5JWRB 6GSUA 4DEJA 3R2QA 4I8BA 3ZFLA 4H86A 1XW6A 3KP9A 3QD9A 4PGTA 2F8FA 5FWGA 2PMTA 1UN2A 5J9CA 3DRNA 2LRCA 4OFTA 3UL3A 1ILOA 5DJLA 3KP8A 2H1DA 5B6MA 4K7IA 4O7HA 3TDGA 1VGLA 2O87A 1RW1A 3E3EA 4XCSA 1IYHA 1VF3A 3MIXA 2EC4A 4NMUA 3M9JA 3ME8A 2PVOC 3LQ7A 4O92A 1FVKA 5GSSA 1TK8B 3UJ1A 2I9HA 5DALB 3FZ9A 1PX7A 2YN1A 4YKFA 4BWQA 3RPNA 1VRSD 1OC8A 5ECQB 4MPGA 1K0AA 5IIZA 1XZOA 4ZB9A 1ZYQB 5CO3A 2VL2C 1XWBA 3NZNA 3ZIJA 1TRWA 3FEUA 3CSIA 5IMCA 3VPTA 3W8SA 4D73A 2B5XA 2H6ZA 5DQYA 3EURA 4K1FA 2L5OA 1Q98A 2J9HA 3IR4A 4O32A 3KH9A 3MWHA 3KJYA 3UIWA 1WE0A 4L0WA 5L71A 1ZOFA 4ECIA 2R6KA 1G7OA 4HOJA 3LW9A 5D9WA 1FOVA 3F63A 3EWLA 1SKSB 4KNDA 5H5SA 3P2AA 1SJ6A 4X0XA 4PX1A 2GQMA 3L4NA 16GSA 2WFCA 3I43A 2D2ZA 2VD1A 3C1SA 1XW5A 2I1UA 5JCGA 2B7KA 5F8BA 1NW2A 3GRXA 1X9MB 3FR9A 2CZ3A 4TKYA 4KDUA 2CAIA 2AAWA 1BG5A 4MMMA 5ECMB 2L4QA 2TRCP 2I81A 2H6XA 3J7Yk 4TXVA 4ZILA 3CTGA 5ECOB 1F3AA 3KXOA 2YV7A 3ZMKA 5J4UA 2GLRA 2PVQA 2X8CA 3RBTA 2GQLA 2O89A 2B6MA 4MLYA 5H5QA 1JZOA 4ZBBA 1TW9A 3CSHA 1O81A 4XHMA 4V1Ag 4EVMA 1TRVA 3MYDA 2QA2A 2HLSA 1VF1A 1HNCA 4LL4B 2FLSA 2HXKA 3VWUA 1FAAA 1YEPA 3GKNA 1GULA 2P31A 4ECBA 2HI7A 1XIYA 2I4AA 1GWCA 4MF6A 2HE3A 2A2SA 5HR0A 2CV4A 2YJ7A 3FMWA 4HU9A 3GMFA 1XXUA 4GRFA 4MA9A 1KBNA 1S3AA 4ZBDA 1TJDA 5DQSA 4GF0A 4XS4B 1MDIA 2V6KA 2VCVA 2VD0A 2N5AA 4EIPA 4MJEA 3F3RA 2VL3A 4IVFA 3HXSA 5G30A 2L59A 2VIMA 4E8HA 1OAZA 2QGVA 1TU7A 3MNGA 1OC9A 1WRYA 2CT6A 3IE3A 1OKTA 2XPEA 1SENA 2FA4A 5ECKB 3UBKA 1A8LA 2JACA 1LJRA 2X4AA 1GL8A 1UA5A 2QA1A 1K0OA 4HDEA 1Q4JA 2WCIA 1XVWA 5D8IA 4POKA 4Z2TA 4YH2A 4EF0A 2RM5A 3IK7A 2RUEA 4ICYA 1XOBA 3EE2A 1AQWA 5ID2B 3TRPA 4WR5A 1X5DA 3GH9A 3KH7A 4HEA2 3L9SA 3RHCA 4G2EA 3GKXA 1SJIA 2VM2A 3GTUA 2DIZA 5AISA 3KGKA 3F9UA 4X43A 3BCKA 2C3QA 1JHBA 3QR6A 2WDUA 3F6FA 5A4VA 1NHOA 2CA8A 4QL7A 1V9WA 3RAZA 3IC8A 1M7TA 2DKHA 6GSYA 1WPIA 3HVSA 2CVKA 2NTOA 2R2JA 5DDLA 2GTUA 1R4WA 1ZCPA 3DMLA 3ZVJA 3CSJA 4QL9A 2G2QA 1HNBA 4PQIA 3IPZA 5DAKB 4QQ7A 2VL9A 1GSSA 3G7IA 1FVJA 3HZ4A 3OR5A 3P90A 2LNSA 2IMEA 1GTBA 2ZNMA 2HSYA 1E2YA 1VF2A 4BVXA 1QXHA 2P0GA 1O7UA 2LRTA 1YZXA 5A4UA 1Z7PA 3SBCA 1TU8A 3MAKA 2JZRA 5FT3A 2LQQA 5E4WA 3KZQA 4TN8A 1XOAA 3ZTLA 2AB6A 3QCPA 3LYKA 2F51A 1O6JA 2C0DA 4G19A 2YANA 1AC1A 2L6CA 2QC7A 3G7YA 4OWYA 2GQKA 1URMA 2IIYA 1V2AA 4EDZA 2FY6A 4KDXA 2XHFA 4HUAA 2DKIA 1TK5B 4PTSA 1M99A 4K0GA 1WP0A 3VPQA 5H5RA 3LEFA 4PQ1A 2ES7A 1B9XC 4XS6A 2HZEA 3HJOA 5AN1A 4Q5RA 3MDKA 4OO4A 3DEXA 1J0FA 2H01A 1THOA 5CP1A 2R0GA 2B7JA 3GIXA 3F8UA 1FHEA 5CYYA 2V32A 5IPHA 1FW1A 1XCCA 2VOCA 3CMIA 1EZKA 4YKGA 4MJAA 2YPMA 2A2RA 3TJJA 2TRXA 1B8XA 2CVDA 1M2DA 2DSAA 3US3A 3I69A 3VWWA 1SK0A 1B4QA 1K0MA 4WBRD 1KTEA 2VO4A 4IW9A 4F03A 4HI7A 1QFNA 1PGTA 3O76A 2B5EA 4DVCA 2GSRA 2N5BA 2PN8A 4E8EA 2EIOA 2HZFA 1VF4A 1GNWA 2R5GA 1FB6A 3HDCA 2BMXA 2L5LA 2WRTA 3GA4A 2P5RA 3LORA 4KX4A 5D93A 4RQRA 2H8LA 4IJ3A 4GSNA 2GZYA 4OFNA 2C3TA 3F4TA 1CQHA 3KTLA 3ZZXA 2K8VA 5AIXA 1JLVA 2MZCA 1BEDA 4TOPA 2XBQA 1IYIA 1V57A 4MZCA 3CXGA 2YWNA 4ID0A 1K0CA 2JL4A 2H72A 2HRNA 3IOSA 3HKRA 4IHUA 3GKKA 1XW9A 1HQOA 3DD3A 2FD3A 4G0IA 1K0NA 3IBHA 2C4JA 5LCZA 3GSSA 3H4KA 5CAXA 2DJ3A 1EEMA 3IDVA 3IHQA 2C8UA 9GSSA 4IP6A 2IMDA 1RQMA 3QPMA 4L0UA 4I97A 17GSA 2MMOA 4JZQA 4XS4A 1QUWA 2TIRA 4NHZA 5AGYA 2JSZA 3H79A 1S3DA 5EY6A 4OD7A 3WT2A 1EOGA 4ZL7A 4F9ZA 5HFIA 5HQPA 3VWVA 1PD21 1A2LA 1AQVA 3KIJA 2ZCTA 2GSSA 4KSOA 3EPTA 3N5OA 3LWAA 1Z6MA 5F05A 5IMAA 1JZDA 2DMLA 4HZ4A 5IMFA 2CX3A 1JZWA 4POMA 2H70A 4RI7A 1PQNA 2K8SA 3U6VA 4Z2UA 3L9VA 2HRKA 1LU4A 1ZYNA 3ZIVA 1PKWA 5IM9A 2NDOA 2HRAA 3G7JA 2YWOA 1GSDA 5ABRA 3HA9A 3HYPA 2BJXA 4DSQA 1ZMAA 1J9BA 2XC2A 2YCDA 1HYUA 4OO5A 2VL2A 2J23A 5ECSA 4MZWA 1MEKA 1ERVA 3A2WA 3A5IA 2AUVA 4JR6A 4G0KA 2IPAA 3FRCA 2L4CA 3FZAA 5IMVA 5KOXA 5ECHB 5IO0A 3JCML 3O3TA 3K8NA 2M80A 1U88A 2VCXA 4IELA 4O5RA 3VLNA 3A3TA 4BWSA 2M46A 4HQZA 2H0IA 4DSSB 1TRSA 4CY6A 2MMNA 1OVNA 2NVLA 4KH7A 2EIQA 1SL2B 1SL0B 1XWAA 3KMNA 3CBUA 5KEJA 4KGIA 5BMUA 1BYEA 2H19A 4IS0A 1EV4A 2DJKA 4L8EA 1MDJA 4WR4A 2KOKA 1A24A 5HFGA 4LMWA 2V1MA 1ZYPA 1TRUA 1YDKA 4V1Ap 5COHA 3BOAA 3VFIA 4KUNA 4XIHA 2ALBA 1M9BA 4K6XA 4WEYA 4ZL8A 4L5OA 4NXIA 1XWGA 4WF4A 1SD9A 2FHEA 4GQFA 1T1VA 3LSZA 4IGJA 1U3IA 1F6MC 5ECPB 2JU5A 2JZTA 1PKZA 2OA7A 2WJUA 1A0FA 3F6DA 5ECRB 5J5NA 2C80A 6GSSA 4MF5A 2JADA 5D73A 1EOHA 2OBKA 2C3NA 5GAND 3FR6A 4J2FA 4GSTA 5ELAA 1GSUA 6GSXA 3DVWA 1JFUA 2YV9A 3LG6A 1YKAA 4FO5A 4J57E 4XRDA 5LNKe 1T00A 4TR1B 2CAQA 5G1LA 1FG4A 4I6XA 5AIVA 2A4HA 4MDCA 5KN3A 1GNEA 4PURA 2HT9A 4MK3A 1K3OA 18GSA 1F9MA 2PPTA 1SKWB 5G5FA 4K9ZA 1OE7A 2X8HA 1KEBA 1I9DA 2P5QA 1CQGA 4ZL9A 1GRXA 4GXZA 3WD6A 4AF2A 4EUYA 5J3RA 2HSMA 4PXOA 1PL1A 5CNWA 2R37A 2C1YA 3M0FA 4CHSA 4WXTA 3DYRA 4TR0A 1THXA 4WBJA 4K2XA 2VCQA 3DVXA 1SK2A 5JCUA 3QMXA 2CQ9A 2YWIA 3APOA 3IRAA 1V58A 1ZGNA 4MH2A 4EC0A 2IN3A 3GUSA 3ME7A 4OFMA 4TXOA 3U5RE 2ON7A 2PUKC 4NPBA 1EGRA 1GTUA 20GSA 1PN0A 6GSTA 1WIKA 1G6YA 3KMOA 1MDKA 11GSA 1GSYA 1M0UA 5ENUA 3H8QA 3LGCA 3QAWA 2GS3A 3UOMA 1I5GA 2PBJA 4K2DA 2IMKA 5J9BA 4N0ZA 4L5LA 4J56E 3I9V2 3G9BA 1Y6EA 3D4TA 1PRXA 1X9WB 2ZUPA 2YWMA 3WGDA 4EIQA 1SJZA 1HNAA 3LJRA 3I6AA 2H0HA 4K5SA 3GYKA 2PERA 4BL7B 1AAZA 3TKSE 2B1KA 4ULXA 3BD2A 3EINA 3CRTA 4KCAA 4LLRA 5C04A 4LA1A 4JE1A 5G5EA 2FWHA 2KHPA 2WZ9A 3WYWA 5IO2A 3IHGA 3MSZA 4CW9A 3EMPA 1Z5YE 3CTFA 13GSA 4MF7A 1NHYA 1TOFA 1GTIA 4ISDA 3IAM2 4G10A 3TOTA 3Q6OA 2R0PA 2E7PA 2HSHA 2LJRA 3C73A 3TGZA 3J7Yb 3ERGA 1AXDA 4KAEA 1FOHA 2MBTA 3IK9A 5IMZA 4ZB6A 4NHWA 3Q74A 4AGSA 3IA1A 5DALA 3EVIA 3FK8A 1T3BA 4ZXGA 14GSA 4P3YB 3RDWA 3S9FA 3UARA 4A5PA 4PNFA 5FHIA 3HCZA 4BPYA 1YEXA 5B8AA 4DSSA 4OCEA 3ED3A 1O73A 1TXXA 2GZPA 3FKFA 4GTUA 4MZBA 2XPDA 4HJ2A 4I5QA 4KDYA 1ERTA 3TRQA 2C0GA 3ZRDA 4XRAA 4Z7XA 4POLA 1U87A 2GSQA 2H1GA 1ZYEA 2KP1A 1ERWA 3QOUA 4ECJA 2ON5A 2FWFA 3C8EA 5DJMA 4GLTA 4K5RA 4FYCA 2LTKA 1R5AA 3R3EA 1GUMA 2V41A 2VCTA 2IFQB 4PQHA 3TKPA 4N0VA 1XWKA 3ZMLA 4MJBA 1YF0A 2REMA 1YY7A 2RIIA 2LQOA 2H1BA 5BRTA 3HVVA 3A2XA 5JWQB 3HVXA 4EL1A 3A5WA 5B7CA 1ST9A 1R26A 3VI5A 4FIWA 5F07A 1Y25A 1T4ZA 1JZRA 3ISOA 1PA3A 4GSSA 3W8JA 5EVOA 3FW2A 2GZZA 2VAFA 3GX8A 4EDYA 4TR1A 5D9VA 3HD5A 3GN3A 4FH8A 4RQXA 2H1AA 4F2IA 2HNLA 5GZZB 1ABAA 3EU4A 3Q19A 1FB0A 1ML6A 2KLXA 1M9AA 2YZHA 1HD2A 1U6TA 1A2JA 1T8EB 2AYTA 5IPGA 1X0RA 3QFBC 1E6BA 4ILFA 3DXBA 2H75A 2IJYA 1J08A 4CY8A 1X9SB 1RK4A 3KTBA 4BA7A 1A0RP 3WT1A 1K0BA 1EP7A 1A23A 3F4SA 4I2TA 5EL8A 5GSTA 1S3CA 1V98A 3L78A 1GP1A 3ZLPA 1PX6A 3TB2A 4NAXA 4EE0A 5D9XA 3VK9A 3KEBA 3QAGA 1EGOA 2KP2A 3E0UA 1DE2A 2RLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHE A;  3VWX A;  2CX4 A;  3GX0 A;  2B3S A;  1DE1 A;  3GH6 A;  1MTC A;  4Q5F A;  1EWX A;  5ID2 A;  3L9U A;  3Q18 A;  1ACV A;  1T4Y A;  1NM3 A;  4K0N A;  2LUS A;  7GSS A;  2IMI A;  1GUK A;  2X64 A;  4V2L A;  3WGX A;  1XBS A;  4MH3 A;  1U3A A;  4ECC A;  1LBK A;  2GGT A;  3D4M A;  2JSY A;  1V40 A;  5J41 A;  2HRF A;  3PH9 A;  2A4V A;  2NBS A;  3ZL5 A;  1PN9 A;  3C71 A;  5IOW A;  4BL7 A;  2H6Y A;  1X5C A;  1FO5 A;  3VUR A;  3TKS A;  3KM6 A;  3APS A;  2CVB A;  3DIE A;  1SKR B;  1XFL A;  3HHV A;  5IMD A;  2GT5 A;  1AIU A;  1MD3 A;  1O8X A;  1OC3 A;  5LD0 A;  2GVP A;  4POB A;  1R7H A;  2WS2 A;  1N2A A;  5CRH A;  3PGT A;  4GQC A;  1NSW A;  2HZE B;  2O7K A;  6GSV A;  1SL1 B;  5DAK A;  4KW6 A;  3APQ A;  1OKD A;  4FYU A;  3LXT A;  2FA8 A;  2X8G A;  1ZL9 A;  4K7O A;  3BCI A;  2RM6 A;  1X5E A;  4AJ8 A;  5DBQ A;  3FHK A;  2GST A;  4ML6 A;  1BJX A;  1G6W A;  1SU9 A;  2L57 A;  3GST A;  3TKS C;  1TTZ A;  1SYX A;  1GH2 A;  1M2A A;  5KN2 A;  4PNG A;  1F3B A;  1JLW A;  2BTO T;  2OAD A;  1QGV A;  4EKZ A;  3NOF A;  2RUF A;  5C00 A;  4FYB A;  3M3M A;  4ML1 A;  1ERU A;  2OE1 A;  3AY8 A;  3D21 A;  4MPF A;  4MJC A;  4NV2 A;  2M72 A;  2VUP A;  2VM1 A;  2H30 A;  4IKH A;  4V2N A;  2QSI A;  3IV4 A;  2AV4 A;  1QQ2 A;  2FCH A;  3KD0 A;  4I2U A;  2MBS A;  5CRW A;  2R4V A;  3F4R A;  2DJJ A;  2V6O A;  1XPV A;  5A5K A;  3M1G A;  1XWC A;  3ZYW A;  3UMA A;  3HZ8 A;  1UC7 A;  4F82 A;  2LST A;  1OYJ A;  4TRX A;  6GSW A;  3TCO A;  3UBL A;  3HJP A;  1GSF A;  2LNT A;  3E9J B;  3N9J A;  2IMF A;  2VLV A;  4IP1 A;  5HFK A;  1N8J A;  5HR1 A;  4IQ1 A;  2FWE A;  2K9F A;  1F37 A;  1PMT A;  5DCG A;  4WKW A;  4Q5N A;  3H93 A;  4JED A;  3VI7 A;  2WB9 A;  4F0B A;  4N30 A;  1C72 A;  2HYX A;  3M9K A;  2IFQ A;  4ZB8 A;  4OCF A;  2FUG 2;  4MP4 A;  2LJA A;  4K8M A;  2F9S A;  1MD4 A;  3UVT A;  3FR3 A;  2H76 A;  2OKA A;  1UVZ A;  2LEG A;  2YOI A;  3TJG A;  2YJH A;  3IXR A;  4OMV A;  5HR2 A;  4HQS A;  2DBC A;  5G2Z A;  2DJ0 A;  5G1K A;  2H73 A;  3TKQ A;  3H1N A;  2HFD A;  1F2E A;  1EEJ A;  2KUC A;  2LKU A;  3V1W A;  3KCM A;  5D9T A;  19GS A;  4V2M A;  2E2M A;  2C0F A;  2Z9S A;  2AJQ B;  1XVQ A;  5IQY A;  2XBI A;  5HR3 A;  4TR3 A;  2E2G A;  2PU9 C;  5JWO B;  3C1R A;  3TRX A;  4AJ6 A;  12GS A;  2CZ2 A;  4XS1 A;  5B8B A;  3RHB A;  5DVB A;  5G31 A;  4JBB A;  5A4W A;  3D6I A;  2EIR A;  2FWG A;  4TR4 A;  3ZRE A;  3EMX A;  4PUF C;  2K18 A;  2MMA A;  5KN0 A;  1K3Y A;  1H75 A;  5ECN B;  3GUR A;  2PGT A;  3SWL A;  2LV3 A;  1SK1 A;  1GTA A;  3L0H A;  3TJK A;  1SD8 A;  2WGR A;  2O85 A;  3D5J A;  1YF1 A;  2F3M A;  2DJ2 A;  2FGX A;  5KN1 A;  3PR8 A;  3GL3 A;  3GL5 A;  2K6V A;  3D22 A;  1W4V A;  2WUL A;  3DKS A;  1TI3 A;  3DGQ A;  4IQA A;  2V2G A;  4WET A;  3P8W A;  1G7E A;  4D73 B;  2F8A A;  4NV5 A;  4KB3 A;  3LYP A;  4N11 A;  10GS A;  4TW5 A;  4G9H A;  3UVH A;  5B6N A;  4ACS A;  1W89 A;  3NIV A;  1ZZY A;  2H74 A;  2QKE A;  4JU5 A;  3W6G A;  2PWJ A;  5E59 A;  4ZIJ A;  4KA0 A;  5ECL B;  3TUE A;  3GFK A;  3GV1 A;  4WF5 A;  2IWT A;  4NWY A;  3EYT A;  4N10 A;  1K3L A;  2OJL A;  1B9Y C;  2H71 A;  3EC3 A;  4KSM A;  2DC5 A;  3TOU A;  3TJB A;  1B48 A;  1SYR A;  3A2V A;  1T7P B;  2B1L A;  1A8Y A;  2E0Q A;  3BJ5 A;  4PUA A;  5CRG A;  1GLP A;  4LL1 B;  3TJF A;  3ZFB A;  1GSQ A;  3FZ4 A;  3HY2 A;  2YNX A;  22GS A;  4IN0 A;  2VLU A;  3ERF A;  4DSR A;  4EXJ A;  4JR4 A;  3FZ5 A;  1Z9H A;  2IL3 A;  3DWV A;  1USB A;  1DUG A;  2VCW A;  3WGE A;  2OE3 A;  4Q5Q A;  1KNG A;  2LS5 A;  3ERW A;  1GUH A;  4YQM A;  4HU7 A;  4ZBA A;  3QAV A;  5D96 A;  2H66 A;  1TI1 A;  1DSB A;  1Z6N A;  2DMM A;  1PL2 A;  4RI6 A;  2LRN A;  3LXZ A;  4IJI A;  1TDI A;  4HJM A;  4HZ2 A;  3P7X A;  5INY A;  2B5Y A;  1G0T A;  2MYG A;  1M2B A;  2DLX A;  5IOX A;  2YZU A;  1WWJ A;  8GSS A;  1TP9 A;  2GDR A;  4YAP A;  2L6D A;  5F06 A;  3CYN A;  4GWR A;  2LJK A;  4KCE A;  3ZVJ D;  4KE3 A;  5EPF A;  3LFL A;  1BX9 A;  1PSQ A;  3M8N A;  3UEM A;  2YP6 A;  4CDO A;  4K7N A;  2G0F A;  3PIN A;  3IAS 2;  1YQ1 A;  5DCH A;  1GLQ A;  3ZIT A;  3EU3 A;  2VLT A;  1WJK A;  2X99 A;  1K0D A;  4AJ7 A;  4GCI A;  2R3X A;  2H0G A;  2N5F A;  1B4P A;  1DBY A;  5ELG A;  1OE8 A;  1OC9 B;  1AUC A;  1WOU A;  2NPB A;  4YQU A;  3GKM A;  1O8W A;  5CRD A;  1A2M A;  4LMV A;  4EO3 A;  4YQV A;  1GSE A;  2OBI A;  4TXO B;  4X1U A;  3BBY A;  4HS1 A;  1R5P A;  4YAV A;  4F0C A;  1BQ7 A;  2DJ1 A;  4IBP A;  1O85 A;  1ON4 A;  1EV9 A;  1AW9 A;  1YJ6 A;  2I3Y A;  4MCU A;  3HJM A;  5F0G A;  1EP8 A;  1TK0 B;  2OAC A;  2FNO A;  5CRE A;  5ECI B;  5JCW A;  1AQX A;  1H4O A;  3O6T A;  4BVY A;  1QK8 A;  4MAB A;  3QFA C;  3GHA A;  4XTS A;  2DIY A;  3C7M A;  1TKD B;  3F3Q A;  2MMZ A;  1WMJ A;  3FYG A;  3GTU B;  1QMV A;  1YKC A;  2C0E A;  1BAY A;  3QDN A;  3D0Z A;  4RUV A;  3RPP A;  3TKR A;  1Z3E A;  2VCZ A;  3F0I A;  1Z7R A;  4JRR A;  3IC4 A;  3GNJ A;  2JZS A;  3CRU A;  2OE0 A;  3UAP A;  2O8V B;  2GT6 A;  3FY7 A;  4TVE A;  5GAP D;  5JWR B;  6GSU A;  4DEJ A;  3R2Q A;  4I8B A;  3ZFL A;  4H86 A;  1XW6 A;  3KP9 A;  3QD9 A;  4PGT A;  2F8F A;  5FWG A;  2PMT A;  1UN2 A;  5J9C A;  3DRN A;  2LRC A;  4OFT A;  3UL3 A;  1ILO A;  5DJL A;  3KP8 A;  2H1D A;  5B6M A;  4K7I A;  4O7H A;  3TDG A;  1VGL A;  2O87 A;  1RW1 A;  3E3E A;  4XCS A;  1IYH A;  1VF3 A;  2EC4 A;  4NMU A;  3M9J A;  3ME8 A;  2PVO C;  3LQ7 A;  4O92 A;  1FVK A;  5GSS A;  1TK8 B;  3UJ1 A;  2I9H A;  5DAL B;  3FZ9 A;  1PX7 A;  2YN1 A;  4BWQ A;  3RPN A;  1VRS D;  1OC8 A;  5ECQ B;  4MPG A;  1K0A A;  5IIZ A;  1XZO A;  4ZB9 A;  1ZYQ B;  5CO3 A;  2VL2 C;  1XWB A;  3NZN A;  3ZIJ A;  1TRW A;  3FEU A;  3CSI A;  5IMC A;  3VPT A;  3W8S A;  4D73 A;  2B5X A;  2H6Z A;  5DQY A;  3EUR A;  4K1F A;  2L5O A;  1Q98 A;  2J9H A;  3IR4 A;  4O32 A;  3KH9 A;  3MWH A;  3KJY A;  3UIW A;  1WE0 A;  4L0W A;  5L71 A;  1ZOF A;  4ECI A;  2R6K A;  1G7O A;  4HOJ A;  5D9W A;  1FOV A;  3F63 A;  3EWL A;  1SKS B;  4KND A;  5H5S A;  3P2A A;  1SJ6 A;  4X0X A;  4PX1 A;  2GQM A;  3L4N A;  16GS A;  2WFC A;  3I43 A;  2D2Z A;  2VD1 A;  3C1S A;  1XW5 A;  2I1U A;  5JCG A;  2B7K A;  5F8B A;  1NW2 A;  3GRX A;  1X9M B;  3FR9 A;  2CZ3 A;  4TKY A;  4KDU A;  2CAI A;  2AAW A;  1BG5 A;  4MMM A;  5ECM B;  2L4Q A;  2TRC P;  2I81 A;  2H6X A;  3J7Y k;  4TXV A;  4ZIL A;  3CTG A;  5ECO B;  1F3A A;  3KXO A;  2YV7 A;  3ZMK A;  5J4U A;  2GLR A;  2PVQ A;  2X8C A;  3RBT A;  2GQL A;  2O89 A;  2B6M A;  4MLY A;  5H5Q A;  1JZO A;  4ZBB A;  1TW9 A;  3CSH A;  1O81 A;  4XHM A;  4V1A g;  4EVM A;  1TRV A;  2HLS A;  1VF1 A;  1HNC A;  4LL4 B;  2FLS A;  2HXK A;  3VWU A;  1FAA A;  1YEP A;  3GKN A;  1GUL A;  2P31 A;  4ECB A;  2HI7 A;  1XIY A;  2I4A A;  1GWC A;  4MF6 A;  2HE3 A;  2A2S A;  5HR0 A;  2CV4 A;  2YJ7 A;  4HU9 A;  3GMF A;  1XXU A;  4GRF A;  4MA9 A;  1KBN A;  1S3A A;  4ZBD A;  1TJD A;  5DQS A;  4GF0 A;  4XS4 B;  1MDI A;  2V6K A;  2VCV A;  2VD0 A;  2N5A A;  4MJE A;  3F3R A;  2VL3 A;  4IVF A;  3HXS A;  5G30 A;  2L59 A;  2VIM A;  4E8H A;  1OAZ A;  2QGV A;  1TU7 A;  3MNG A;  1OC9 A;  1WRY A;  2CT6 A;  3IE3 A;  1OKT A;  2XPE A;  1SEN A;  2FA4 A;  5ECK B;  3UBK A;  1A8L A;  2JAC A;  1LJR A;  1GL8 A;  1UA5 A;  1K0O A;  4HDE A;  1Q4J A;  2WCI A;  1XVW A;  5D8I A;  4POK A;  4YH2 A;  4EF0 A;  2RM5 A;  3IK7 A;  2RUE A;  1XOB A;  3EE2 A;  1AQW A;  5ID2 B;  3TRP A;  4WR5 A;  1X5D A;  3GH9 A;  3KH7 A;  4HEA 2;  3L9S A;  3RHC A;  4G2E A;  3GKX A;  1SJI A;  2VM2 A;  3GTU A;  2DIZ A;  5AIS A;  3KGK A;  3F9U A;  4X43 A;  3BCK A;  2C3Q A;  1JHB A;  3QR6 A;  2WDU A;  3F6F A;  5A4V A;  1NHO A;  2CA8 A;  4QL7 A;  1V9W A;  3RAZ A;  1M7T A;  6GSY A;  1WPI A;  3HVS A;  2CVK A;  2NTO A;  2R2J A;  5DDL A;  2GTU A;  1R4W A;  1ZCP A;  3DML A;  3ZVJ A;  3CSJ A;  4QL9 A;  2G2Q A;  1HNB A;  4PQI A;  3IPZ A;  5DAK B;  4QQ7 A;  2VL9 A;  1GSS A;  3G7I A;  1FVJ A;  3HZ4 A;  3OR5 A;  3P90 A;  2LNS A;  2IME A;  1GTB A;  2ZNM A;  2HSY A;  1E2Y A;  1VF2 A;  4BVX A;  1QXH A;  2P0G A;  1O7U A;  2LRT A;  1YZX A;  5A4U A;  1Z7P A;  3SBC A;  1TU8 A;  3MAK A;  2JZR A;  5FT3 A;  2LQQ A;  5E4W A;  3KZQ A;  4TN8 A;  1XOA A;  3ZTL A;  2AB6 A;  3QCP A;  3LYK A;  2F51 A;  1O6J A;  2C0D A;  4G19 A;  2YAN A;  1AC1 A;  2L6C A;  2QC7 A;  3G7Y A;  4OWY A;  2GQK A;  1URM A;  2IIY A;  1V2A A;  4EDZ A;  2FY6 A;  4KDX A;  2XHF A;  4HUA A;  1TK5 B;  1M99 A;  4K0G A;  1WP0 A;  3VPQ A;  5H5R A;  3LEF A;  4PQ1 A;  2ES7 A;  1B9X C;  4XS6 A;  2HZE A;  3HJO A;  5AN1 A;  4Q5R A;  3MDK A;  4OO4 A;  3DEX A;  1J0F A;  2H01 A;  1THO A;  5CP1 A;  2B7J A;  3GIX A;  3F8U A;  1FHE A;  5CYY A;  2V32 A;  5IPH A;  1FW1 A;  1XCC A;  2VOC A;  3CMI A;  1EZK A;  4MJA A;  2YPM A;  2A2R A;  3TJJ A;  2TRX A;  1B8X A;  2CVD A;  1M2D A;  2DSA A;  3US3 A;  3I69 A;  3VWW A;  1SK0 A;  1B4Q A;  1K0M A;  4WBR D;  1KTE A;  2VO4 A;  4IW9 A;  4F03 A;  4HI7 A;  1QFN A;  1PGT A;  3O76 A;  2B5E A;  4DVC A;  2GSR A;  2N5B A;  2PN8 A;  4E8E A;  2EIO A;  2HZF A;  1VF4 A;  1GNW A;  2R5G A;  1FB6 A;  3HDC A;  2BMX A;  2L5L A;  2WRT A;  3GA4 A;  2P5R A;  3LOR A;  4KX4 A;  5D93 A;  4RQR A;  2H8L A;  4IJ3 A;  4GSN A;  2GZY A;  4OFN A;  2C3T A;  3F4T A;  1CQH A;  3KTL A;  3ZZX A;  2K8V A;  5AIX A;  1JLV A;  2MZC A;  1BED A;  4TOP A;  2XBQ A;  1IYI A;  1V57 A;  4MZC A;  3CXG A;  2YWN A;  4ID0 A;  1K0C A;  2JL4 A;  2H72 A;  2HRN A;  3IOS A;  3HKR A;  4IHU A;  3GKK A;  1XW9 A;  1HQO A;  3DD3 A;  2FD3 A;  1K0N A;  3IBH A;  2C4J A;  5LCZ A;  3GSS A;  3H4K A;  5CAX A;  2DJ3 A;  1EEM A;  3IDV A;  3IHQ A;  2C8U A;  9GSS A;  4IP6 A;  2IMD A;  1RQM A;  3QPM A;  4L0U A;  4I97 A;  17GS A;  2MMO A;  4JZQ A;  4XS4 A;  1QUW A;  2TIR A;  4NHZ A;  5AGY A;  2JSZ A;  3H79 A;  1S3D A;  5EY6 A;  4OD7 A;  3WT2 A;  1EOG A;  4ZL7 A;  4F9Z A;  5HFI A;  5HQP A;  3VWV A;  1PD2 1;  1A2L A;  1AQV A;  3KIJ A;  2ZCT A;  2GSS A;  4KSO A;  3N5O A;  3LWA A;  1Z6M A;  5F05 A;  5IMA A;  1JZD A;  2DML A;  4HZ4 A;  5IMF A;  2CX3 A;  1JZW A;  4POM A;  2H70 A;  4RI7 A;  1PQN A;  2K8S A;  3U6V A;  3L9V A;  1LU4 A;  3ZIV A;  1PKW A;  5IM9 A;  2NDO A;  3G7J A;  2YWO A;  1GSD A;  5ABR A;  3HA9 A;  3HYP A;  2BJX A;  4DSQ A;  1ZMA A;  1J9B A;  2XC2 A;  2YCD A;  1HYU A;  4OO5 A;  2VL2 A;  2J23 A;  5ECS A;  4MZW A;  1MEK A;  1ERV A;  3A2W A;  2AUV A;  4JR6 A;  2IPA A;  3FRC A;  2L4C A;  3FZA A;  5IMV A;  5ECH B;  5IO0 A;  3JCM L;  3O3T A;  3K8N A;  2M80 A;  1U88 A;  2VCX A;  4IEL A;  4O5R A;  3VLN A;  3A3T A;  4BWS A;  2M46 A;  4HQZ A;  2H0I A;  4DSS B;  1TRS A;  2MMN A;  1OVN A;  2NVL A;  4KH7 A;  2EIQ A;  1SL2 B;  1SL0 B;  1XWA A;  3KMN A;  3CBU A;  5KEJ A;  4KGI A;  1BYE A;  2H19 A;  4IS0 A;  1EV4 A;  2DJK A;  4L8E A;  1MDJ A;  4WR4 A;  2KOK A;  1A24 A;  5HFG A;  4LMW A;  2V1M A;  1TRU A;  1YDK A;  4V1A p;  5COH A;  3BOA A;  3VFI A;  4KUN A;  4XIH A;  2ALB A;  1M9B A;  4K6X A;  4WEY A;  4ZL8 A;  4L5O A;  4NXI A;  1XWG A;  4WF4 A;  1SD9 A;  2FHE A;  4GQF A;  1T1V A;  3LSZ A;  4IGJ A;  1U3I A;  1F6M C;  5ECP B;  2JU5 A;  2JZT A;  1PKZ A;  2OA7 A;  2WJU A;  1A0F A;  3F6D A;  5ECR B;  5J5N A;  2C80 A;  6GSS A;  4MF5 A;  2JAD A;  5D73 A;  1EOH A;  2OBK A;  2C3N A;  5GAN D;  3FR6 A;  4J2F A;  4GST A;  5ELA A;  1GSU A;  6GSX A;  3DVW A;  1JFU A;  2YV9 A;  3LG6 A;  1YKA A;  4FO5 A;  4J57 E;  4XRD A;  5LNK e;  1T00 A;  4TR1 B;  2CAQ A;  5G1L A;  1FG4 A;  4I6X A;  5AIV A;  4MDC A;  5KN3 A;  1GNE A;  4PUR A;  2HT9 A;  4MK3 A;  1K3O A;  18GS A;  1F9M A;  2PPT A;  1SKW B;  5G5F A;  4K9Z A;  1OE7 A;  2X8H A;  1KEB A;  1I9D A;  2P5Q A;  1CQG A;  4ZL9 A;  1GRX A;  4GXZ A;  3WD6 A;  4AF2 A;  4EUY A;  5J3R A;  4PXO A;  1PL1 A;  5CNW A;  2R37 A;  2C1Y A;  3M0F A;  4CHS A;  4WXT A;  3DYR A;  4TR0 A;  1THX A;  4WBJ A;  2VCQ A;  3DVX A;  1SK2 A;  5JCU A;  3QMX A;  2CQ9 A;  2YWI A;  3APO A;  3IRA A;  1V58 A;  1ZGN A;  4MH2 A;  4EC0 A;  2IN3 A;  3GUS A;  3ME7 A;  4OFM A;  4TXO A;  3U5R E;  2ON7 A;  2PUK C;  4NPB A;  1EGR A;  1GTU A;  20GS A;  6GST A;  1WIK A;  1G6Y A;  3KMO A;  1MDK A;  11GS A;  1GSY A;  1M0U A;  5ENU A;  3H8Q A;  3LGC A;  3QAW A;  2GS3 A;  3UOM A;  1I5G A;  2PBJ A;  4K2D A;  2IMK A;  5J9B A;  4N0Z A;  4L5L A;  4J56 E;  3I9V 2;  3G9B A;  1Y6E A;  3D4T A;  1PRX A;  1X9W B;  2ZUP A;  2YWM A;  3WGD A;  1SJZ A;  1HNA A;  3LJR A;  3I6A A;  2H0H A;  3GYK A;  2PER A;  1AAZ A;  3TKS E;  2B1K A;  4ULX A;  3BD2 A;  3EIN A;  3CRT A;  4KCA A;  4LLR A;  5C04 A;  4LA1 A;  4JE1 A;  5G5E A;  2FWH A;  2KHP A;  2WZ9 A;  3WYW A;  5IO2 A;  3MSZ A;  4CW9 A;  3EMP A;  1Z5Y E;  3CTF A;  13GS A;  4MF7 A;  1NHY A;  1TOF A;  1GTI A;  4ISD A;  3IAM 2;  4G10 A;  3TOT A;  3Q6O A;  2E7P A;  2HSH A;  2LJR A;  3C73 A;  3TGZ A;  3J7Y b;  3ERG A;  1AXD A;  4KAE A;  2MBT A;  3IK9 A;  5IMZ A;  4ZB6 A;  4NHW A;  3Q74 A;  4AGS A;  3IA1 A;  5DAL A;  3EVI A;  3FK8 A;  1T3B A;  4ZXG A;  14GS A;  4P3Y B;  3RDW A;  3S9F A;  3UAR A;  4PNF A;  5FHI A;  3HCZ A;  4BPY A;  1YEX A;  5B8A A;  4DSS A;  4OCE A;  3ED3 A;  1O73 A;  1TXX A;  2GZP A;  3FKF A;  4GTU A;  4MZB A;  2XPD A;  4HJ2 A;  4I5Q A;  4KDY A;  1ERT A;  3TRQ A;  2C0G A;  3ZRD A;  4XRA A;  4Z7X A;  4POL A;  1U87 A;  2GSQ A;  2H1G A;  1ZYE A;  2KP1 A;  1ERW A;  3QOU A;  4ECJ A;  2ON5 A;  2FWF A;  3C8E A;  5DJM A;  4GLT A;  4FYC A;  2LTK A;  1R5A A;  1GUM A;  2V41 A;  2VCT A;  2IFQ B;  4PQH A;  3TKP A;  4N0V A;  1XWK A;  3ZML A;  4MJB A;  1YF0 A;  2REM A;  1YY7 A;  2RII A;  2LQO A;  2H1B A;  3HVV A;  3A2X A;  5JWQ B;  3HVX A;  4EL1 A;  3A5W A;  5B7C A;  1ST9 A;  1R26 A;  3VI5 A;  4FIW A;  5F07 A;  1Y25 A;  1T4Z A;  1JZR A;  3ISO A;  1PA3 A;  4GSS A;  3W8J A;  5EVO A;  3FW2 A;  2GZZ A;  2VAF A;  3GX8 A;  4EDY A;  4TR1 A;  5D9V A;  3HD5 A;  3GN3 A;  4FH8 A;  4RQX A;  2H1A A;  4F2I A;  2HNL A;  5GZZ B;  1ABA A;  3EU4 A;  3Q19 A;  1FB0 A;  1ML6 A;  2KLX A;  1M9A A;  2YZH A;  1HD2 A;  1U6T A;  1A2J A;  1T8E B;  2AYT A;  5IPG A;  1X0R A;  3QFB C;  1E6B A;  4ILF A;  3DXB A;  2H75 A;  2IJY A;  1J08 A;  1X9S B;  1RK4 A;  3KTB A;  4BA7 A;  1A0R P;  3WT1 A;  1K0B A;  1EP7 A;  1A23 A;  3F4S A;  4I2T A;  5EL8 A;  5GST A;  1S3C A;  1V98 A;  3L78 A;  1GP1 A;  3ZLP A;  1PX6 A;  3TB2 A;  4NAX A;  4EE0 A;  5D9X A;  3VK9 A;  3KEB A;  3QAG A;  1EGO A;  2KP2 A;  3E0U A;  1DE2 A;  2RLI A; 
#chains in the Genus database with same CATH topology
 2AHE A;  3VWX A;  2CX4 A;  3GX0 A;  2B3S A;  1DE1 A;  3GH6 A;  1MTC A;  4Q5F A;  1EWX A;  5ID2 A;  3L9U A;  3Q18 A;  1ACV A;  1T4Y A;  1NM3 A;  4K0N A;  2LUS A;  7GSS A;  2IMI A;  1GUK A;  2X64 A;  4V2L A;  4BVX B;  3WGX A;  1XBS A;  4MH3 A;  1U3A A;  4ECC A;  1LBK A;  2GGT A;  3D4M A;  2JSY A;  1V40 A;  4USS A;  5J41 A;  2HRF A;  3PH9 A;  2A4V A;  2NBS A;  3ZL5 A;  1PN9 A;  3C71 A;  5IOW A;  4BL7 A;  2H6Y A;  1X5C A;  1FO5 A;  3VUR A;  3TKS A;  3KM6 A;  3APS A;  2CVB A;  3DIE A;  1SKR B;  1XFL A;  3HHV A;  5IMD A;  2GT5 A;  1AIU A;  1MD3 A;  1O8X A;  1OC3 A;  5LD0 A;  4KF9 A;  2GVP A;  4POB A;  1R7H A;  2WS2 A;  1N2A A;  5CRH A;  3PGT A;  4GQC A;  1NSW A;  2HZE B;  2O7K A;  6GSV A;  1SL1 B;  5DAK A;  4KW6 A;  3APQ A;  1M3I A;  1OKD A;  4FYU A;  3LXT A;  2FA8 A;  2X8G A;  1ZL9 A;  4K7O A;  3BCI A;  2RM6 A;  1X5E A;  4AJ8 A;  5DBQ A;  3FHK A;  2GST A;  4ML6 A;  1BJX A;  1G6W A;  1SU9 A;  2L57 A;  3GST A;  3TKS C;  1TTZ A;  1SYX A;  1GH2 A;  1M2A A;  5KN2 A;  4PNG A;  1F3B A;  1JLW A;  2BTO T;  2OAD A;  1QGV A;  4EKZ A;  3NOF A;  2RUF A;  5C00 A;  4FYB A;  3M3M A;  4ML1 A;  1ERU A;  3PPU A;  2OE1 A;  3AY8 A;  3D21 A;  4MPF A;  4MJC A;  4NV2 A;  2M72 A;  2VUP A;  2R0C A;  2VM1 A;  2H30 A;  4IKH A;  4V2N A;  2QSI A;  3IV4 A;  2AV4 A;  1QQ2 A;  2FCH A;  3KD0 A;  4I2U A;  4X4J A;  2MBS A;  5CRW A;  2R4V A;  3F4R A;  2DJJ A;  2V6O A;  1XPV A;  5A5K A;  3M1G A;  4Z2R A;  1XWC A;  3ZYW A;  3UMA A;  3HZ8 A;  1UC7 A;  4F82 A;  2LST A;  1OYJ A;  4TRX A;  6GSW A;  3TCO A;  3UBL A;  3HJP A;  1GSF A;  2LNT A;  3E9J B;  3N9J A;  2IMF A;  2VLV A;  4IP1 A;  5HFK A;  1N8J A;  5HR1 A;  4IQ1 A;  2FWE A;  2K9F A;  1F37 A;  1PMT A;  5DCG A;  4WKW A;  4Q5N A;  3H93 A;  4JED A;  3VI7 A;  2WB9 A;  4F0B A;  4N30 A;  1C72 A;  2HYX A;  4BVY B;  3M9K A;  2IFQ A;  4ZB8 A;  4OCF A;  2FUG 2;  4MP4 A;  2LJA A;  4K8M A;  2F9S A;  1MD4 A;  3UVT A;  3FR3 A;  4O5Q A;  2H76 A;  2OKA A;  1UVZ A;  2LEG A;  2YOI A;  3TJG A;  2YJH A;  3IXR A;  4OMV A;  5HR2 A;  4HQS A;  2DBC A;  5G2Z A;  2DJ0 A;  5G1K A;  2H73 A;  3TKQ A;  3H1N A;  2HFD A;  1F2E A;  4O5U A;  1EEJ A;  2KUC A;  2LKU A;  3V1W A;  3KCM A;  5D9T A;  19GS A;  4V2M A;  2E2M A;  2C0F A;  2Z9S A;  2AJQ B;  1XVQ A;  5IQY A;  2XBI A;  5HR3 A;  4TR3 A;  2E2G A;  2PU9 C;  5JWO B;  3C1R A;  3TRX A;  4AJ6 A;  12GS A;  2CZ2 A;  4XS1 A;  5B8B A;  4G0L A;  3RHB A;  5DVB A;  5G31 A;  4JBB A;  5A4W A;  3D6I A;  2EIR A;  2FWG A;  4TR4 A;  3ZRE A;  3EMX A;  4PUF C;  2K18 A;  2MMA A;  5KN0 A;  1K3Y A;  1H75 A;  5ECN B;  3GUR A;  2PGT A;  3SWL A;  2LV3 A;  1SK1 A;  1GTA A;  3L0H A;  3TJK A;  1SD8 A;  2WGR A;  2O85 A;  3D5J A;  1YF1 A;  2F3M A;  2DJ2 A;  2FGX A;  5KN1 A;  3PR8 A;  3GL3 A;  3GL5 A;  2K6V A;  3D22 A;  1W4V A;  2WUL A;  3DKS A;  1TI3 A;  3DGQ A;  4IQA A;  2V2G A;  4WET A;  3P8W A;  1G7E A;  4D73 B;  2F8A A;  4NV5 A;  4KB3 A;  3LYP A;  4N11 A;  4MNN A;  10GS A;  4TW5 A;  4G9H A;  3UVH A;  5B6N A;  4ACS A;  1W89 A;  3NIV A;  1ZZY A;  2H74 A;  2QKE A;  4JU5 A;  3W6G A;  2PWJ A;  5E59 A;  4ZIJ A;  4KA0 A;  5ECL B;  3TUE A;  3GFK A;  3GV1 A;  4WF5 A;  2IWT A;  4NWY A;  3EYT A;  4N10 A;  1K3L A;  2OJL A;  1B9Y C;  2H71 A;  3EC3 A;  4KSM A;  2DC5 A;  3TOU A;  3TJB A;  1B48 A;  1SYR A;  3A2V A;  1T7P B;  2B1L A;  1A8Y A;  2E0Q A;  3BJ5 A;  4PUA A;  5CRG A;  1GLP A;  4LL1 B;  3TJF A;  3ZFB A;  1GSQ A;  3FZ4 A;  3HY2 A;  2YNX A;  22GS A;  4IN0 A;  2VLU A;  3ERF A;  4DSR A;  4EXJ A;  4JR4 A;  3FZ5 A;  1Z9H A;  2IL3 A;  3DWV A;  1USB A;  1DUG A;  2VCW A;  3WGE A;  2OE3 A;  1PFO A;  4Q5Q A;  1KNG A;  2LS5 A;  3ERW A;  1GUH A;  4YQM A;  4HU7 A;  4FQU A;  4ZBA A;  3QAV A;  5D96 A;  2H66 A;  1TI1 A;  1DSB A;  1Z6N A;  2DMM A;  1PL2 A;  4RI6 A;  2LRN A;  3LXZ A;  4IJI A;  1TDI A;  4HJM A;  4HZ2 A;  3P7X A;  5INY A;  2B5Y A;  5KOW A;  1G0T A;  2MYG A;  1M2B A;  2DLX A;  5IOX A;  2YZU A;  1WWJ A;  8GSS A;  1TP9 A;  2GDR A;  4YAP A;  2L6D A;  2UZ8 A;  5F06 A;  3CYN A;  4GWR A;  2LJK A;  4KCE A;  3ZVJ D;  4KE3 A;  5EPF A;  3LFL A;  1BX9 A;  1PSQ A;  3M8N A;  3UEM A;  2YP6 A;  4CDO A;  4K7N A;  2G0F A;  3PIN A;  3IAS 2;  1YQ1 A;  5DCH A;  1GLQ A;  3ZIT A;  3EU3 A;  2VLT A;  1WJK A;  2X99 A;  1K0D A;  4AJ7 A;  4GCI A;  2R3X A;  2H0G A;  2N5F A;  1B4P A;  1DBY A;  5ELG A;  1OE8 A;  1OC9 B;  1AUC A;  1WOU A;  2NPB A;  4YQU A;  3GKM A;  1O8W A;  5CRD A;  1A2M A;  4LMV A;  4EO3 A;  4YQV A;  1GSE A;  2OBI A;  4TXO B;  4X1U A;  2X49 A;  3BBY A;  4HS1 A;  1R5P A;  4YAV A;  4F0C A;  1BQ7 A;  2DJ1 A;  4IBP A;  1O85 A;  1ON4 A;  1EV9 A;  1AW9 A;  1YJ6 A;  2I3Y A;  4MCU A;  3HJM A;  1M3J A;  5F0G A;  1EP8 A;  1TK0 B;  2OAC A;  2FNO A;  1XG8 A;  5CRE A;  5ECI B;  5JCW A;  1AQX A;  1H4O A;  3O6T A;  4BVY A;  1QK8 A;  4MAB A;  3QFA C;  3GHA A;  4XTS A;  2DIY A;  3C7M A;  1TKD B;  3F3Q A;  2MMZ A;  1WMJ A;  3FYG A;  3GTU B;  1QMV A;  1YKC A;  2C0E A;  1BAY A;  3QDN A;  3D0Z A;  2A2P A;  4RUV A;  3RPP A;  3TKR A;  1Z3E A;  2VCZ A;  3F0I A;  1Z7R A;  4JRR A;  3IC4 A;  3GNJ A;  2JZS A;  3CRU A;  2OE0 A;  3UAP A;  2O8V B;  2GT6 A;  3FY7 A;  4TVE A;  5GAP D;  5JWR B;  6GSU A;  4DEJ A;  3R2Q A;  4I8B A;  3ZFL A;  4H86 A;  1XW6 A;  3KP9 A;  3QD9 A;  4PGT A;  2F8F A;  5FWG A;  2PMT A;  1UN2 A;  5J9C A;  3DRN A;  2LRC A;  4OFT A;  3UL3 A;  1ILO A;  5DJL A;  3KP8 A;  2H1D A;  5B6M A;  4K7I A;  4O7H A;  3TDG A;  1VGL A;  2O87 A;  1RW1 A;  3E3E A;  4XCS A;  1IYH A;  1VF3 A;  3MIX A;  2EC4 A;  4NMU A;  3M9J A;  3ME8 A;  2PVO C;  3LQ7 A;  4O92 A;  1FVK A;  5GSS A;  1TK8 B;  3UJ1 A;  2I9H A;  5DAL B;  3FZ9 A;  1PX7 A;  2YN1 A;  4YKF A;  4BWQ A;  3RPN A;  1VRS D;  1OC8 A;  5ECQ B;  4MPG A;  1K0A A;  5IIZ A;  1XZO A;  4ZB9 A;  1ZYQ B;  5CO3 A;  2VL2 C;  1XWB A;  3NZN A;  3ZIJ A;  1TRW A;  3FEU A;  3CSI A;  5IMC A;  3VPT A;  3W8S A;  4D73 A;  2B5X A;  2H6Z A;  5DQY A;  3EUR A;  4K1F A;  2L5O A;  1Q98 A;  2J9H A;  3IR4 A;  4O32 A;  3KH9 A;  3MWH A;  3KJY A;  3UIW A;  1WE0 A;  4L0W A;  5L71 A;  1ZOF A;  4ECI A;  2R6K A;  1G7O A;  4HOJ A;  3LW9 A;  5D9W A;  1FOV A;  3F63 A;  3EWL A;  1SKS B;  4KND A;  5H5S A;  3P2A A;  1SJ6 A;  4X0X A;  4PX1 A;  2GQM A;  3L4N A;  16GS A;  2WFC A;  3I43 A;  2D2Z A;  2VD1 A;  3C1S A;  1XW5 A;  2I1U A;  5JCG A;  2B7K A;  5F8B A;  1NW2 A;  3GRX A;  1X9M B;  3FR9 A;  2CZ3 A;  4TKY A;  4KDU A;  2CAI A;  2AAW A;  1BG5 A;  4MMM A;  5ECM B;  2L4Q A;  2TRC P;  2I81 A;  2H6X A;  3J7Y k;  4TXV A;  4ZIL A;  3CTG A;  5ECO B;  1F3A A;  3KXO A;  2YV7 A;  3ZMK A;  5J4U A;  2GLR A;  2PVQ A;  2X8C A;  3RBT A;  2GQL A;  2O89 A;  2B6M A;  4MLY A;  5H5Q A;  1JZO A;  4ZBB A;  1TW9 A;  3CSH A;  1O81 A;  4XHM A;  4V1A g;  4EVM A;  1TRV A;  3MYD A;  2QA2 A;  2HLS A;  1VF1 A;  1HNC A;  4LL4 B;  2FLS A;  2HXK A;  3VWU A;  1FAA A;  1YEP A;  3GKN A;  1GUL A;  2P31 A;  4ECB A;  2HI7 A;  1XIY A;  2I4A A;  1GWC A;  4MF6 A;  2HE3 A;  2A2S A;  5HR0 A;  2CV4 A;  2YJ7 A;  3FMW A;  4HU9 A;  3GMF A;  1XXU A;  4GRF A;  4MA9 A;  1KBN A;  1S3A A;  4ZBD A;  1TJD A;  5DQS A;  4GF0 A;  4XS4 B;  1MDI A;  2V6K A;  2VCV A;  2VD0 A;  2N5A A;  4EIP A;  4MJE A;  3F3R A;  2VL3 A;  4IVF A;  3HXS A;  5G30 A;  2L59 A;  2VIM A;  4E8H A;  1OAZ A;  2QGV A;  1TU7 A;  3MNG A;  1OC9 A;  1WRY A;  2CT6 A;  3IE3 A;  1OKT A;  2XPE A;  1SEN A;  2FA4 A;  5ECK B;  3UBK A;  1A8L A;  2JAC A;  1LJR A;  2X4A A;  1GL8 A;  1UA5 A;  2QA1 A;  1K0O A;  4HDE A;  1Q4J A;  2WCI A;  1XVW A;  5D8I A;  4POK A;  4Z2T A;  4YH2 A;  4EF0 A;  2RM5 A;  3IK7 A;  2RUE A;  4ICY A;  1XOB A;  3EE2 A;  1AQW A;  5ID2 B;  3TRP A;  4WR5 A;  1X5D A;  3GH9 A;  3KH7 A;  4HEA 2;  3L9S A;  3RHC A;  4G2E A;  3GKX A;  1SJI A;  2VM2 A;  3GTU A;  3CQF A;  2DIZ A;  5AIS A;  3KGK A;  3F9U A;  4X43 A;  3BCK A;  2C3Q A;  1JHB A;  3QR6 A;  2WDU A;  3F6F A;  5A4V A;  1NHO A;  2CA8 A;  4QL7 A;  1V9W A;  3RAZ A;  3IC8 A;  1M7T A;  2DKH A;  6GSY A;  1WPI A;  3HVS A;  2CVK A;  2NTO A;  2R2J A;  5DDL A;  2GTU A;  1R4W A;  1ZCP A;  3DML A;  3ZVJ A;  3CSJ A;  4QL9 A;  2G2Q A;  1HNB A;  4PQI A;  3IPZ A;  5DAK B;  4QQ7 A;  2VL9 A;  1GSS A;  3G7I A;  1FVJ A;  3HZ4 A;  3OR5 A;  3P90 A;  2LNS A;  2IME A;  1GTB A;  2ZNM A;  2HSY A;  1E2Y A;  1VF2 A;  4BVX A;  1QXH A;  2P0G A;  1O7U A;  2LRT A;  1YZX A;  5A4U A;  1Z7P A;  3SBC A;  1TU8 A;  3MAK A;  2JZR A;  5FT3 A;  2LQQ A;  5E4W A;  3KZQ A;  4TN8 A;  1XOA A;  3ZTL A;  2AB6 A;  3QCP A;  3LYK A;  2F51 A;  1O6J A;  2C0D A;  4G19 A;  2YAN A;  1AC1 A;  2L6C A;  2QC7 A;  3G7Y A;  4OWY A;  2GQK A;  1URM A;  2IIY A;  1V2A A;  4EDZ A;  2FY6 A;  4KDX A;  2XHF A;  4HUA A;  2DKI A;  1TK5 B;  4PTS A;  1M99 A;  4K0G A;  1WP0 A;  3VPQ A;  5H5R A;  3LEF A;  4PQ1 A;  2ES7 A;  1B9X C;  4XS6 A;  2HZE A;  3HJO A;  5AN1 A;  4Q5R A;  3MDK A;  4OO4 A;  3DEX A;  1J0F A;  2H01 A;  1THO A;  5CP1 A;  2R0G A;  2B7J A;  3GIX A;  3F8U A;  1FHE A;  5CYY A;  2V32 A;  5IPH A;  1FW1 A;  1XCC A;  2VOC A;  3CMI A;  1EZK A;  4YKG A;  4MJA A;  2YPM A;  2A2R A;  3TJJ A;  2TRX A;  1B8X A;  2CVD A;  1M2D A;  2DSA A;  3US3 A;  3I69 A;  3VWW A;  1SK0 A;  1B4Q A;  1K0M A;  4WBR D;  1KTE A;  2VO4 A;  4IW9 A;  4F03 A;  4HI7 A;  1QFN A;  1PGT A;  3O76 A;  2B5E A;  4DVC A;  2GSR A;  2N5B A;  2PN8 A;  4E8E A;  2EIO A;  2HZF A;  1VF4 A;  1GNW A;  2R5G A;  1FB6 A;  3HDC A;  2BMX A;  2L5L A;  2WRT A;  3GA4 A;  2P5R A;  3LOR A;  4KX4 A;  5D93 A;  4RQR A;  2H8L A;  4IJ3 A;  4GSN A;  2GZY A;  4OFN A;  2C3T A;  3F4T A;  1CQH A;  3KTL A;  3ZZX A;  2K8V A;  5AIX A;  1JLV A;  2MZC A;  1BED A;  4TOP A;  2XBQ A;  1IYI A;  1V57 A;  4MZC A;  3CXG A;  2YWN A;  4ID0 A;  1K0C A;  2JL4 A;  2H72 A;  2HRN A;  3IOS A;  3HKR A;  4IHU A;  3GKK A;  1XW9 A;  1HQO A;  3DD3 A;  2FD3 A;  4G0I A;  1K0N A;  3IBH A;  2C4J A;  5LCZ A;  3GSS A;  3H4K A;  5CAX A;  2DJ3 A;  1EEM A;  3IDV A;  3IHQ A;  2C8U A;  9GSS A;  4IP6 A;  2IMD A;  1RQM A;  3QPM A;  4L0U A;  4I97 A;  17GS A;  2MMO A;  4JZQ A;  4XS4 A;  1QUW A;  2TIR A;  4NHZ A;  5AGY A;  2JSZ A;  3H79 A;  1S3D A;  5EY6 A;  4OD7 A;  3WT2 A;  1EOG A;  4ZL7 A;  4F9Z A;  5HFI A;  5HQP A;  3VWV A;  1PD2 1;  1A2L A;  1AQV A;  3KIJ A;  2ZCT A;  2GSS A;  4KSO A;  3EPT A;  3N5O A;  1S3R A;  3LWA A;  1Z6M A;  5F05 A;  5IMA A;  1JZD A;  2DML A;  4HZ4 A;  5IMF A;  2CX3 A;  1JZW A;  4POM A;  2H70 A;  4RI7 A;  1PQN A;  2K8S A;  3U6V A;  4Z2U A;  3L9V A;  2HRK A;  1LU4 A;  1ZYN A;  3ZIV A;  1PKW A;  5IM9 A;  2NDO A;  2HRA A;  3G7J A;  2YWO A;  1GSD A;  5ABR A;  3HA9 A;  3HYP A;  2BJX A;  4DSQ A;  1ZMA A;  1J9B A;  2XC2 A;  2YCD A;  1HYU A;  4OO5 A;  2VL2 A;  2J23 A;  5ECS A;  4MZW A;  1MEK A;  1ERV A;  3A2W A;  3A5I A;  2AUV A;  4JR6 A;  4G0K A;  2IPA A;  3FRC A;  2L4C A;  3FZA A;  5IMV A;  5KOX A;  5ECH B;  5IO0 A;  3JCM L;  3O3T A;  3K8N A;  2M80 A;  1U88 A;  2VCX A;  4IEL A;  4O5R A;  3VLN A;  3A3T A;  4BWS A;  2M46 A;  4HQZ A;  2H0I A;  4DSS B;  1TRS A;  4CY6 A;  2MMN A;  1OVN A;  2NVL A;  4KH7 A;  2EIQ A;  1SL2 B;  1SL0 B;  1XWA A;  3KMN A;  3CBU A;  5KEJ A;  4KGI A;  5BMU A;  1BYE A;  2H19 A;  4IS0 A;  1EV4 A;  2DJK A;  4L8E A;  1MDJ A;  4WR4 A;  2KOK A;  1A24 A;  5HFG A;  4LMW A;  2V1M A;  1ZYP A;  1TRU A;  1YDK A;  4V1A p;  5COH A;  3BOA A;  3VFI A;  4KUN A;  4XIH A;  2ALB A;  1M9B A;  4K6X A;  4WEY A;  4ZL8 A;  4L5O A;  4NXI A;  1XWG A;  4WF4 A;  1SD9 A;  2FHE A;  4GQF A;  1T1V A;  3LSZ A;  4IGJ A;  1U3I A;  1F6M C;  5ECP B;  2JU5 A;  2JZT A;  1PKZ A;  2OA7 A;  2WJU A;  1A0F A;  3F6D A;  5ECR B;  5J5N A;  2C80 A;  6GSS A;  4MF5 A;  2JAD A;  5D73 A;  1EOH A;  2OBK A;  2C3N A;  5GAN D;  3FR6 A;  4J2F A;  4GST A;  5ELA A;  1GSU A;  6GSX A;  3DVW A;  1JFU A;  2YV9 A;  3LG6 A;  1YKA A;  4FO5 A;  4J57 E;  4XRD A;  5LNK e;  1T00 A;  4TR1 B;  2CAQ A;  5G1L A;  1FG4 A;  4I6X A;  5AIV A;  2A4H A;  4MDC A;  5KN3 A;  1GNE A;  4PUR A;  2HT9 A;  4MK3 A;  1K3O A;  18GS A;  1F9M A;  2PPT A;  1SKW B;  5G5F A;  4K9Z A;  1OE7 A;  2X8H A;  1KEB A;  1I9D A;  2P5Q A;  1CQG A;  4ZL9 A;  1GRX A;  4GXZ A;  3WD6 A;  4AF2 A;  4EUY A;  5J3R A;  2HSM A;  4PXO A;  1PL1 A;  5CNW A;  2R37 A;  2C1Y A;  3M0F A;  4CHS A;  4WXT A;  3DYR A;  4TR0 A;  1THX A;  4WBJ A;  4K2X A;  2VCQ A;  3DVX A;  1SK2 A;  5JCU A;  3QMX A;  2CQ9 A;  2YWI A;  3APO A;  3IRA A;  1V58 A;  1ZGN A;  4MH2 A;  4EC0 A;  2IN3 A;  3GUS A;  3ME7 A;  4OFM A;  4TXO A;  3U5R E;  2ON7 A;  2PUK C;  4NPB A;  1EGR A;  1GTU A;  20GS A;  1PN0 A;  6GST A;  1WIK A;  1G6Y A;  3KMO A;  1MDK A;  11GS A;  1GSY A;  1M0U A;  5ENU A;  3H8Q A;  3LGC A;  3QAW A;  2GS3 A;  3UOM A;  1I5G A;  2PBJ A;  4K2D A;  2IMK A;  5J9B A;  4N0Z A;  4L5L A;  4J56 E;  3I9V 2;  3G9B A;  1Y6E A;  3D4T A;  1PRX A;  1X9W B;  2ZUP A;  2YWM A;  3WGD A;  4EIQ A;  1SJZ A;  1HNA A;  3LJR A;  3I6A A;  2H0H A;  4K5S A;  3GYK A;  2PER A;  4BL7 B;  1AAZ A;  3TKS E;  2B1K A;  4ULX A;  3BD2 A;  3EIN A;  3CRT A;  4KCA A;  4LLR A;  5C04 A;  4LA1 A;  4JE1 A;  5G5E A;  2FWH A;  2KHP A;  2WZ9 A;  3WYW A;  5IO2 A;  3IHG A;  3MSZ A;  4CW9 A;  3EMP A;  1Z5Y E;  3CTF A;  13GS A;  4MF7 A;  1NHY A;  1TOF A;  1GTI A;  4ISD A;  3IAM 2;  4G10 A;  3TOT A;  3Q6O A;  2R0P A;  2E7P A;  2HSH A;  2LJR A;  3C73 A;  3TGZ A;  3J7Y b;  3ERG A;  1AXD A;  4KAE A;  1FOH A;  2MBT A;  3IK9 A;  5IMZ A;  4ZB6 A;  4NHW A;  3Q74 A;  4AGS A;  3IA1 A;  5DAL A;  3EVI A;  3FK8 A;  1T3B A;  4ZXG A;  14GS A;  4P3Y B;  3RDW A;  3HVN A;  3S9F A;  3UAR A;  4A5P A;  4PNF A;  5FHI A;  3HCZ A;  4BPY A;  1YEX A;  5B8A A;  4DSS A;  4OCE A;  3ED3 A;  1O73 A;  1TXX A;  2GZP A;  3FKF A;  4GTU A;  4MZB A;  2XPD A;  4HJ2 A;  4I5Q A;  4KDY A;  1ERT A;  3TRQ A;  2C0G A;  3ZRD A;  4XRA A;  4Z7X A;  4POL A;  1U87 A;  2GSQ A;  2H1G A;  1ZYE A;  2KP1 A;  1ERW A;  3QOU A;  4ECJ A;  2ON5 A;  2FWF A;  3C8E A;  5DJM A;  4GLT A;  4K5R A;  4FYC A;  2LTK A;  1R5A A;  3R3E A;  1GUM A;  2V41 A;  2VCT A;  2IFQ B;  4PQH A;  3TKP A;  4N0V A;  1XWK A;  3ZML A;  4MJB A;  1YF0 A;  2REM A;  1YY7 A;  2RII A;  2LQO A;  2H1B A;  5BRT A;  3HVV A;  3A2X A;  5JWQ B;  3HVX A;  4EL1 A;  3A5W A;  5B7C A;  1ST9 A;  1R26 A;  3VI5 A;  4FIW A;  5F07 A;  1Y25 A;  1T4Z A;  1JZR A;  3ISO A;  1PA3 A;  4GSS A;  3W8J A;  5EVO A;  4HSC X;  3FW2 A;  2GZZ A;  2VAF A;  3GX8 A;  4EDY A;  4TR1 A;  5D9V A;  3HD5 A;  3GN3 A;  4FH8 A;  4RQX A;  2H1A A;  4F2I A;  2HNL A;  5GZZ B;  1ABA A;  3EU4 A;  3Q19 A;  1FB0 A;  1ML6 A;  2KLX A;  1M9A A;  2YZH A;  1HD2 A;  1U6T A;  1A2J A;  1T8E B;  2AYT A;  5IPG A;  1X0R A;  3QFB C;  1E6B A;  4ILF A;  3DXB A;  2H75 A;  2IJY A;  1J08 A;  4CY8 A;  1X9S B;  1RK4 A;  3KTB A;  4BA7 A;  1A0R P;  3WT1 A;  1K0B A;  1EP7 A;  1A23 A;  3F4S A;  4I2T A;  5EL8 A;  5GST A;  1S3C A;  1V98 A;  3L78 A;  1GP1 A;  3ZLP A;  1PX6 A;  3TB2 A;  4NAX A;  4EE0 A;  5D9X A;  3VK9 A;  3KEB A;  3QAG A;  1EGO A;  2KP2 A;  3E0U A;  1DE2 A;  2RLI A;  4BIK A; 
#chains in the Genus database with same CATH homology
 2AHE A;  3VWX A;  2CX4 A;  3GX0 A;  2B3S A;  1DE1 A;  3GH6 A;  1MTC A;  4Q5F A;  1EWX A;  5ID2 A;  3L9U A;  3Q18 A;  1ACV A;  1T4Y A;  1NM3 A;  4K0N A;  2LUS A;  7GSS A;  2IMI A;  1GUK A;  2X64 A;  4V2L A;  4BVX B;  3WGX A;  1XBS A;  4MH3 A;  1U3A A;  4ECC A;  1LBK A;  2GGT A;  3D4M A;  2JSY A;  1V40 A;  4USS A;  5J41 A;  2HRF A;  3PH9 A;  2A4V A;  2NBS A;  3ZL5 A;  1PN9 A;  3C71 A;  5IOW A;  4BL7 A;  2H6Y A;  1X5C A;  1FO5 A;  3VUR A;  3TKS A;  3KM6 A;  3APS A;  2CVB A;  3DIE A;  1SKR B;  1XFL A;  3HHV A;  5IMD A;  2GT5 A;  1AIU A;  1MD3 A;  1O8X A;  1OC3 A;  5LD0 A;  4KF9 A;  2GVP A;  4POB A;  1R7H A;  2WS2 A;  1N2A A;  5CRH A;  3PGT A;  4GQC A;  1NSW A;  2HZE B;  2O7K A;  6GSV A;  1SL1 B;  5DAK A;  4KW6 A;  3APQ A;  1OKD A;  4FYU A;  3LXT A;  2FA8 A;  2X8G A;  1ZL9 A;  4K7O A;  3BCI A;  2RM6 A;  1X5E A;  4AJ8 A;  5DBQ A;  3FHK A;  2GST A;  4ML6 A;  1BJX A;  1G6W A;  1SU9 A;  2L57 A;  3GST A;  3TKS C;  1TTZ A;  1SYX A;  1GH2 A;  1M2A A;  5KN2 A;  4PNG A;  1F3B A;  1JLW A;  2BTO T;  2OAD A;  1QGV A;  4EKZ A;  3NOF A;  2RUF A;  5C00 A;  4FYB A;  3M3M A;  4ML1 A;  1ERU A;  3PPU A;  2OE1 A;  3AY8 A;  3D21 A;  4MPF A;  4MJC A;  4NV2 A;  2M72 A;  2VUP A;  2R0C A;  2VM1 A;  2H30 A;  4IKH A;  4V2N A;  2QSI A;  3IV4 A;  2AV4 A;  1QQ2 A;  2FCH A;  3KD0 A;  4I2U A;  4X4J A;  2MBS A;  5CRW A;  2R4V A;  3F4R A;  2DJJ A;  2V6O A;  1XPV A;  5A5K A;  3M1G A;  4Z2R A;  1XWC A;  3ZYW A;  3UMA A;  3HZ8 A;  1UC7 A;  4F82 A;  2LST A;  1OYJ A;  4TRX A;  6GSW A;  3TCO A;  3UBL A;  3HJP A;  1GSF A;  2LNT A;  3E9J B;  3N9J A;  2IMF A;  2VLV A;  4IP1 A;  5HFK A;  1N8J A;  5HR1 A;  4IQ1 A;  2FWE A;  2K9F A;  1F37 A;  1PMT A;  5DCG A;  4WKW A;  4Q5N A;  3H93 A;  4JED A;  3VI7 A;  2WB9 A;  4F0B A;  4N30 A;  1C72 A;  2HYX A;  4BVY B;  3M9K A;  2IFQ A;  4ZB8 A;  4OCF A;  2FUG 2;  4MP4 A;  2LJA A;  4K8M A;  2F9S A;  1MD4 A;  3UVT A;  3FR3 A;  4O5Q A;  2H76 A;  2OKA A;  1UVZ A;  2LEG A;  2YOI A;  3TJG A;  2YJH A;  3IXR A;  4OMV A;  5HR2 A;  4HQS A;  2DBC A;  5G2Z A;  2DJ0 A;  5G1K A;  2H73 A;  3TKQ A;  3H1N A;  2HFD A;  1F2E A;  4O5U A;  1EEJ A;  2KUC A;  2LKU A;  3V1W A;  3KCM A;  5D9T A;  19GS A;  4V2M A;  2E2M A;  2C0F A;  2Z9S A;  2AJQ B;  1XVQ A;  5IQY A;  2XBI A;  5HR3 A;  4TR3 A;  2E2G A;  2PU9 C;  5JWO B;  3C1R A;  3TRX A;  4AJ6 A;  12GS A;  2CZ2 A;  4XS1 A;  5B8B A;  4G0L A;  3RHB A;  5DVB A;  5G31 A;  4JBB A;  5A4W A;  3D6I A;  2EIR A;  2FWG A;  4TR4 A;  3ZRE A;  3EMX A;  4PUF C;  2K18 A;  2MMA A;  5KN0 A;  1K3Y A;  1H75 A;  5ECN B;  3GUR A;  2PGT A;  3SWL A;  2LV3 A;  1SK1 A;  1GTA A;  3L0H A;  3TJK A;  1SD8 A;  2WGR A;  2O85 A;  3D5J A;  1YF1 A;  2F3M A;  2DJ2 A;  2FGX A;  5KN1 A;  3PR8 A;  3GL3 A;  3GL5 A;  2K6V A;  3D22 A;  1W4V A;  2WUL A;  3DKS A;  1TI3 A;  3DGQ A;  4IQA A;  2V2G A;  4WET A;  3P8W A;  1G7E A;  4D73 B;  2F8A A;  4NV5 A;  4KB3 A;  3LYP A;  4N11 A;  4MNN A;  10GS A;  4TW5 A;  4G9H A;  3UVH A;  5B6N A;  4ACS A;  1W89 A;  3NIV A;  1ZZY A;  2H74 A;  2QKE A;  4JU5 A;  3W6G A;  2PWJ A;  5E59 A;  4ZIJ A;  4KA0 A;  5ECL B;  3TUE A;  3GFK A;  3GV1 A;  4WF5 A;  2IWT A;  4NWY A;  3EYT A;  4N10 A;  1K3L A;  2OJL A;  1B9Y C;  2H71 A;  3EC3 A;  4KSM A;  2DC5 A;  3TOU A;  3TJB A;  1B48 A;  1SYR A;  3A2V A;  1T7P B;  2B1L A;  1A8Y A;  2E0Q A;  3BJ5 A;  4PUA A;  5CRG A;  1GLP A;  4LL1 B;  3TJF A;  3ZFB A;  1GSQ A;  3FZ4 A;  3HY2 A;  2YNX A;  22GS A;  4IN0 A;  2VLU A;  3ERF A;  4DSR A;  4EXJ A;  4JR4 A;  3FZ5 A;  1Z9H A;  2IL3 A;  3DWV A;  1USB A;  1DUG A;  2VCW A;  3WGE A;  2OE3 A;  4Q5Q A;  1KNG A;  2LS5 A;  3ERW A;  1GUH A;  4YQM A;  4HU7 A;  4FQU A;  4ZBA A;  3QAV A;  5D96 A;  2H66 A;  1TI1 A;  1DSB A;  1Z6N A;  2DMM A;  1PL2 A;  4RI6 A;  2LRN A;  3LXZ A;  4IJI A;  1TDI A;  4HJM A;  4HZ2 A;  3P7X A;  5INY A;  2B5Y A;  5KOW A;  1G0T A;  2MYG A;  1M2B A;  2DLX A;  5IOX A;  2YZU A;  1WWJ A;  8GSS A;  1TP9 A;  2GDR A;  4YAP A;  2L6D A;  2UZ8 A;  5F06 A;  3CYN A;  4GWR A;  2LJK A;  4KCE A;  3ZVJ D;  4KE3 A;  5EPF A;  3LFL A;  1BX9 A;  1PSQ A;  3M8N A;  3UEM A;  2YP6 A;  4CDO A;  4K7N A;  2G0F A;  3PIN A;  3IAS 2;  1YQ1 A;  5DCH A;  1GLQ A;  3ZIT A;  3EU3 A;  2VLT A;  1WJK A;  2X99 A;  1K0D A;  4AJ7 A;  4GCI A;  2R3X A;  2H0G A;  2N5F A;  1B4P A;  1DBY A;  5ELG A;  1OE8 A;  1OC9 B;  1AUC A;  1WOU A;  2NPB A;  4YQU A;  3GKM A;  1O8W A;  5CRD A;  1A2M A;  4LMV A;  4EO3 A;  4YQV A;  1GSE A;  2OBI A;  4TXO B;  4X1U A;  2X49 A;  3BBY A;  4HS1 A;  1R5P A;  4YAV A;  4F0C A;  1BQ7 A;  2DJ1 A;  4IBP A;  1O85 A;  1ON4 A;  1EV9 A;  1AW9 A;  1YJ6 A;  2I3Y A;  4MCU A;  3HJM A;  5F0G A;  1EP8 A;  1TK0 B;  2OAC A;  2FNO A;  5CRE A;  5ECI B;  5JCW A;  1AQX A;  1H4O A;  3O6T A;  4BVY A;  1QK8 A;  4MAB A;  3QFA C;  3GHA A;  4XTS A;  2DIY A;  3C7M A;  1TKD B;  3F3Q A;  2MMZ A;  1WMJ A;  3FYG A;  3GTU B;  1QMV A;  1YKC A;  2C0E A;  1BAY A;  3QDN A;  3D0Z A;  2A2P A;  4RUV A;  3RPP A;  3TKR A;  1Z3E A;  2VCZ A;  3F0I A;  1Z7R A;  4JRR A;  3IC4 A;  3GNJ A;  2JZS A;  3CRU A;  2OE0 A;  3UAP A;  2O8V B;  2GT6 A;  3FY7 A;  4TVE A;  5GAP D;  5JWR B;  6GSU A;  4DEJ A;  3R2Q A;  4I8B A;  3ZFL A;  4H86 A;  1XW6 A;  3KP9 A;  3QD9 A;  4PGT A;  2F8F A;  5FWG A;  2PMT A;  1UN2 A;  5J9C A;  3DRN A;  2LRC A;  4OFT A;  3UL3 A;  1ILO A;  5DJL A;  3KP8 A;  2H1D A;  5B6M A;  4K7I A;  4O7H A;  3TDG A;  1VGL A;  2O87 A;  1RW1 A;  3E3E A;  4XCS A;  1IYH A;  1VF3 A;  3MIX A;  2EC4 A;  4NMU A;  3M9J A;  3ME8 A;  2PVO C;  3LQ7 A;  4O92 A;  1FVK A;  5GSS A;  1TK8 B;  3UJ1 A;  2I9H A;  5DAL B;  3FZ9 A;  1PX7 A;  2YN1 A;  4YKF A;  4BWQ A;  3RPN A;  1VRS D;  1OC8 A;  5ECQ B;  4MPG A;  1K0A A;  5IIZ A;  1XZO A;  4ZB9 A;  1ZYQ B;  5CO3 A;  2VL2 C;  1XWB A;  3NZN A;  3ZIJ A;  1TRW A;  3FEU A;  3CSI A;  5IMC A;  3VPT A;  3W8S A;  4D73 A;  2B5X A;  2H6Z A;  5DQY A;  3EUR A;  4K1F A;  2L5O A;  1Q98 A;  2J9H A;  3IR4 A;  4O32 A;  3KH9 A;  3MWH A;  3KJY A;  3UIW A;  1WE0 A;  4L0W A;  5L71 A;  1ZOF A;  4ECI A;  2R6K A;  1G7O A;  4HOJ A;  3LW9 A;  5D9W A;  1FOV A;  3F63 A;  3EWL A;  1SKS B;  4KND A;  5H5S A;  3P2A A;  1SJ6 A;  4X0X A;  4PX1 A;  2GQM A;  3L4N A;  16GS A;  2WFC A;  3I43 A;  2D2Z A;  2VD1 A;  3C1S A;  1XW5 A;  2I1U A;  5JCG A;  2B7K A;  5F8B A;  1NW2 A;  3GRX A;  1X9M B;  3FR9 A;  2CZ3 A;  4TKY A;  4KDU A;  2CAI A;  2AAW A;  1BG5 A;  4MMM A;  5ECM B;  2L4Q A;  2TRC P;  2I81 A;  2H6X A;  3J7Y k;  4TXV A;  4ZIL A;  3CTG A;  5ECO B;  1F3A A;  3KXO A;  2YV7 A;  3ZMK A;  5J4U A;  2GLR A;  2PVQ A;  2X8C A;  3RBT A;  2GQL A;  2O89 A;  2B6M A;  4MLY A;  5H5Q A;  1JZO A;  4ZBB A;  1TW9 A;  3CSH A;  1O81 A;  4XHM A;  4V1A g;  4EVM A;  1TRV A;  3MYD A;  2QA2 A;  2HLS A;  1VF1 A;  1HNC A;  4LL4 B;  2FLS A;  2HXK A;  3VWU A;  1FAA A;  1YEP A;  3GKN A;  1GUL A;  2P31 A;  4ECB A;  2HI7 A;  1XIY A;  2I4A A;  1GWC A;  4MF6 A;  2HE3 A;  2A2S A;  5HR0 A;  2CV4 A;  2YJ7 A;  3FMW A;  4HU9 A;  3GMF A;  1XXU A;  4GRF A;  4MA9 A;  1KBN A;  1S3A A;  4ZBD A;  1TJD A;  5DQS A;  4GF0 A;  4XS4 B;  1MDI A;  2V6K A;  2VCV A;  2VD0 A;  2N5A A;  4EIP A;  4MJE A;  3F3R A;  2VL3 A;  4IVF A;  3HXS A;  5G30 A;  2L59 A;  2VIM A;  4E8H A;  1OAZ A;  2QGV A;  1TU7 A;  3MNG A;  1OC9 A;  1WRY A;  2CT6 A;  3IE3 A;  1OKT A;  2XPE A;  1SEN A;  2FA4 A;  5ECK B;  3UBK A;  1A8L A;  2JAC A;  1LJR A;  2X4A A;  1GL8 A;  1UA5 A;  2QA1 A;  1K0O A;  4HDE A;  1Q4J A;  2WCI A;  1XVW A;  5D8I A;  4POK A;  4Z2T A;  4YH2 A;  4EF0 A;  2RM5 A;  3IK7 A;  2RUE A;  4ICY A;  1XOB A;  3EE2 A;  1AQW A;  5ID2 B;  3TRP A;  4WR5 A;  1X5D A;  3GH9 A;  3KH7 A;  4HEA 2;  3L9S A;  3RHC A;  4G2E A;  3GKX A;  1SJI A;  2VM2 A;  3GTU A;  2DIZ A;  5AIS A;  3KGK A;  3F9U A;  4X43 A;  3BCK A;  2C3Q A;  1JHB A;  3QR6 A;  2WDU A;  3F6F A;  5A4V A;  1NHO A;  2CA8 A;  4QL7 A;  1V9W A;  3RAZ A;  3IC8 A;  1M7T A;  2DKH A;  6GSY A;  1WPI A;  3HVS A;  2CVK A;  2NTO A;  2R2J A;  5DDL A;  2GTU A;  1R4W A;  1ZCP A;  3DML A;  3ZVJ A;  3CSJ A;  4QL9 A;  2G2Q A;  1HNB A;  4PQI A;  3IPZ A;  5DAK B;  4QQ7 A;  2VL9 A;  1GSS A;  3G7I A;  1FVJ A;  3HZ4 A;  3OR5 A;  3P90 A;  2LNS A;  2IME A;  1GTB A;  2ZNM A;  2HSY A;  1E2Y A;  1VF2 A;  4BVX A;  1QXH A;  2P0G A;  1O7U A;  2LRT A;  1YZX A;  5A4U A;  1Z7P A;  3SBC A;  1TU8 A;  3MAK A;  2JZR A;  5FT3 A;  2LQQ A;  5E4W A;  3KZQ A;  4TN8 A;  1XOA A;  3ZTL A;  2AB6 A;  3QCP A;  3LYK A;  2F51 A;  1O6J A;  2C0D A;  4G19 A;  2YAN A;  1AC1 A;  2L6C A;  2QC7 A;  3G7Y A;  4OWY A;  2GQK A;  1URM A;  2IIY A;  1V2A A;  4EDZ A;  2FY6 A;  4KDX A;  2XHF A;  4HUA A;  2DKI A;  1TK5 B;  4PTS A;  1M99 A;  4K0G A;  1WP0 A;  3VPQ A;  5H5R A;  3LEF A;  4PQ1 A;  2ES7 A;  1B9X C;  4XS6 A;  2HZE A;  3HJO A;  5AN1 A;  4Q5R A;  3MDK A;  4OO4 A;  3DEX A;  1J0F A;  2H01 A;  1THO A;  5CP1 A;  2R0G A;  2B7J A;  3GIX A;  3F8U A;  1FHE A;  5CYY A;  2V32 A;  5IPH A;  1FW1 A;  1XCC A;  2VOC A;  3CMI A;  1EZK A;  4YKG A;  4MJA A;  2YPM A;  2A2R A;  3TJJ A;  2TRX A;  1B8X A;  2CVD A;  1M2D A;  2DSA A;  3US3 A;  3I69 A;  3VWW A;  1SK0 A;  1B4Q A;  1K0M A;  4WBR D;  1KTE A;  2VO4 A;  4IW9 A;  4F03 A;  4HI7 A;  1QFN A;  1PGT A;  3O76 A;  2B5E A;  4DVC A;  2GSR A;  2N5B A;  2PN8 A;  4E8E A;  2EIO A;  2HZF A;  1VF4 A;  1GNW A;  2R5G A;  1FB6 A;  3HDC A;  2BMX A;  2L5L A;  2WRT A;  3GA4 A;  2P5R A;  3LOR A;  4KX4 A;  5D93 A;  4RQR A;  2H8L A;  4IJ3 A;  4GSN A;  2GZY A;  4OFN A;  2C3T A;  3F4T A;  1CQH A;  3KTL A;  3ZZX A;  2K8V A;  5AIX A;  1JLV A;  2MZC A;  1BED A;  4TOP A;  2XBQ A;  1IYI A;  1V57 A;  4MZC A;  3CXG A;  2YWN A;  4ID0 A;  1K0C A;  2JL4 A;  2H72 A;  2HRN A;  3IOS A;  3HKR A;  4IHU A;  3GKK A;  1XW9 A;  1HQO A;  3DD3 A;  2FD3 A;  4G0I A;  1K0N A;  3IBH A;  2C4J A;  5LCZ A;  3GSS A;  3H4K A;  5CAX A;  2DJ3 A;  1EEM A;  3IDV A;  3IHQ A;  2C8U A;  9GSS A;  4IP6 A;  2IMD A;  1RQM A;  3QPM A;  4L0U A;  4I97 A;  17GS A;  2MMO A;  4JZQ A;  4XS4 A;  1QUW A;  2TIR A;  4NHZ A;  5AGY A;  2JSZ A;  3H79 A;  1S3D A;  5EY6 A;  4OD7 A;  3WT2 A;  1EOG A;  4ZL7 A;  4F9Z A;  5HFI A;  5HQP A;  3VWV A;  1PD2 1;  1A2L A;  1AQV A;  3KIJ A;  2ZCT A;  2GSS A;  4KSO A;  3EPT A;  3N5O A;  3LWA A;  1Z6M A;  5F05 A;  5IMA A;  1JZD A;  2DML A;  4HZ4 A;  5IMF A;  2CX3 A;  1JZW A;  4POM A;  2H70 A;  4RI7 A;  1PQN A;  2K8S A;  3U6V A;  4Z2U A;  3L9V A;  2HRK A;  1LU4 A;  1ZYN A;  3ZIV A;  1PKW A;  5IM9 A;  2NDO A;  2HRA A;  3G7J A;  2YWO A;  1GSD A;  5ABR A;  3HA9 A;  3HYP A;  2BJX A;  4DSQ A;  1ZMA A;  1J9B A;  2XC2 A;  2YCD A;  1HYU A;  4OO5 A;  2VL2 A;  2J23 A;  5ECS A;  4MZW A;  1MEK A;  1ERV A;  3A2W A;  3A5I A;  2AUV A;  4JR6 A;  4G0K A;  2IPA A;  3FRC A;  2L4C A;  3FZA A;  5IMV A;  5KOX A;  5ECH B;  5IO0 A;  3JCM L;  3O3T A;  3K8N A;  2M80 A;  1U88 A;  2VCX A;  4IEL A;  4O5R A;  3VLN A;  3A3T A;  4BWS A;  2M46 A;  4HQZ A;  2H0I A;  4DSS B;  1TRS A;  4CY6 A;  2MMN A;  1OVN A;  2NVL A;  4KH7 A;  2EIQ A;  1SL2 B;  1SL0 B;  1XWA A;  3KMN A;  3CBU A;  5KEJ A;  4KGI A;  5BMU A;  1BYE A;  2H19 A;  4IS0 A;  1EV4 A;  2DJK A;  4L8E A;  1MDJ A;  4WR4 A;  2KOK A;  1A24 A;  5HFG A;  4LMW A;  2V1M A;  1ZYP A;  1TRU A;  1YDK A;  4V1A p;  5COH A;  3BOA A;  3VFI A;  4KUN A;  4XIH A;  2ALB A;  1M9B A;  4K6X A;  4WEY A;  4ZL8 A;  4L5O A;  4NXI A;  1XWG A;  4WF4 A;  1SD9 A;  2FHE A;  4GQF A;  1T1V A;  3LSZ A;  4IGJ A;  1U3I A;  1F6M C;  5ECP B;  2JU5 A;  2JZT A;  1PKZ A;  2OA7 A;  2WJU A;  1A0F A;  3F6D A;  5ECR B;  5J5N A;  2C80 A;  6GSS A;  4MF5 A;  2JAD A;  5D73 A;  1EOH A;  2OBK A;  2C3N A;  5GAN D;  3FR6 A;  4J2F A;  4GST A;  5ELA A;  1GSU A;  6GSX A;  3DVW A;  1JFU A;  2YV9 A;  3LG6 A;  1YKA A;  4FO5 A;  4J57 E;  4XRD A;  5LNK e;  1T00 A;  4TR1 B;  2CAQ A;  5G1L A;  1FG4 A;  4I6X A;  5AIV A;  2A4H A;  4MDC A;  5KN3 A;  1GNE A;  4PUR A;  2HT9 A;  4MK3 A;  1K3O A;  18GS A;  1F9M A;  2PPT A;  1SKW B;  5G5F A;  4K9Z A;  1OE7 A;  2X8H A;  1KEB A;  1I9D A;  2P5Q A;  1CQG A;  4ZL9 A;  1GRX A;  4GXZ A;  3WD6 A;  4AF2 A;  4EUY A;  5J3R A;  2HSM A;  4PXO A;  1PL1 A;  5CNW A;  2R37 A;  2C1Y A;  3M0F A;  4CHS A;  4WXT A;  3DYR A;  4TR0 A;  1THX A;  4WBJ A;  4K2X A;  2VCQ A;  3DVX A;  1SK2 A;  5JCU A;  3QMX A;  2CQ9 A;  2YWI A;  3APO A;  3IRA A;  1V58 A;  1ZGN A;  4MH2 A;  4EC0 A;  2IN3 A;  3GUS A;  3ME7 A;  4OFM A;  4TXO A;  3U5R E;  2ON7 A;  2PUK C;  4NPB A;  1EGR A;  1GTU A;  20GS A;  1PN0 A;  6GST A;  1WIK A;  1G6Y A;  3KMO A;  1MDK A;  11GS A;  1GSY A;  1M0U A;  5ENU A;  3H8Q A;  3LGC A;  3QAW A;  2GS3 A;  3UOM A;  1I5G A;  2PBJ A;  4K2D A;  2IMK A;  5J9B A;  4N0Z A;  4L5L A;  4J56 E;  3I9V 2;  3G9B A;  1Y6E A;  3D4T A;  1PRX A;  1X9W B;  2ZUP A;  2YWM A;  3WGD A;  4EIQ A;  1SJZ A;  1HNA A;  3LJR A;  3I6A A;  2H0H A;  4K5S A;  3GYK A;  2PER A;  4BL7 B;  1AAZ A;  3TKS E;  2B1K A;  4ULX A;  3BD2 A;  3EIN A;  3CRT A;  4KCA A;  4LLR A;  5C04 A;  4LA1 A;  4JE1 A;  5G5E A;  2FWH A;  2KHP A;  2WZ9 A;  3WYW A;  5IO2 A;  3IHG A;  3MSZ A;  4CW9 A;  3EMP A;  1Z5Y E;  3CTF A;  13GS A;  4MF7 A;  1NHY A;  1TOF A;  1GTI A;  4ISD A;  3IAM 2;  4G10 A;  3TOT A;  3Q6O A;  2R0P A;  2E7P A;  2HSH A;  2LJR A;  3C73 A;  3TGZ A;  3J7Y b;  3ERG A;  1AXD A;  4KAE A;  1FOH A;  2MBT A;  3IK9 A;  5IMZ A;  4ZB6 A;  4NHW A;  3Q74 A;  4AGS A;  3IA1 A;  5DAL A;  3EVI A;  3FK8 A;  1T3B A;  4ZXG A;  14GS A;  4P3Y B;  3RDW A;  3S9F A;  3UAR A;  4A5P A;  4PNF A;  5FHI A;  3HCZ A;  4BPY A;  1YEX A;  5B8A A;  4DSS A;  4OCE A;  3ED3 A;  1O73 A;  1TXX A;  2GZP A;  3FKF A;  4GTU A;  4MZB A;  2XPD A;  4HJ2 A;  4I5Q A;  4KDY A;  1ERT A;  3TRQ A;  2C0G A;  3ZRD A;  4XRA A;  4Z7X A;  4POL A;  1U87 A;  2GSQ A;  2H1G A;  1ZYE A;  2KP1 A;  1ERW A;  3QOU A;  4ECJ A;  2ON5 A;  2FWF A;  3C8E A;  5DJM A;  4GLT A;  4K5R A;  4FYC A;  2LTK A;  1R5A A;  3R3E A;  1GUM A;  2V41 A;  2VCT A;  2IFQ B;  4PQH A;  3TKP A;  4N0V A;  1XWK A;  3ZML A;  4MJB A;  1YF0 A;  2REM A;  1YY7 A;  2RII A;  2LQO A;  2H1B A;  5BRT A;  3HVV A;  3A2X A;  5JWQ B;  3HVX A;  4EL1 A;  3A5W A;  5B7C A;  1ST9 A;  1R26 A;  3VI5 A;  4FIW A;  5F07 A;  1Y25 A;  1T4Z A;  1JZR A;  3ISO A;  1PA3 A;  4GSS A;  3W8J A;  5EVO A;  3FW2 A;  2GZZ A;  2VAF A;  3GX8 A;  4EDY A;  4TR1 A;  5D9V A;  3HD5 A;  3GN3 A;  4FH8 A;  4RQX A;  2H1A A;  4F2I A;  2HNL A;  5GZZ B;  1ABA A;  3EU4 A;  3Q19 A;  1FB0 A;  1ML6 A;  2KLX A;  1M9A A;  2YZH A;  1HD2 A;  1U6T A;  1A2J A;  1T8E B;  2AYT A;  5IPG A;  1X0R A;  3QFB C;  1E6B A;  4ILF A;  3DXB A;  2H75 A;  2IJY A;  1J08 A;  4CY8 A;  1X9S B;  1RK4 A;  3KTB A;  4BA7 A;  1A0R P;  3WT1 A;  1K0B A;  1EP7 A;  1A23 A;  3F4S A;  4I2T A;  5EL8 A;  5GST A;  1S3C A;  1V98 A;  3L78 A;  1GP1 A;  3ZLP A;  1PX6 A;  3TB2 A;  4NAX A;  4EE0 A;  5D9X A;  3VK9 A;  3KEB A;  3QAG A;  1EGO A;  2KP2 A;  3E0U A;  1DE2 A;  2RLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...