2CQ9A

Solution structure of rsgi ruh-044, an n-terminal domain of glutaredoxin 2 from human cdna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
130
structure length
130
Chain Sequence
GSSGSSGSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords GLRX2 protein
publication title Solution structure of RSGI RUH-044, an N-terminal domain of Glutaredoxin 2 from human cDNA
rcsb
source organism Homo sapiens
total genus 26
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2cq9A01
1R5AA 1A2JA 3ZYWA 1ZGNA 3IC4A 1F3BA 2C0DA 4EC0A 3L78A 4JU5A 1CQGA 4IP6A 4XS6A 1XXUA 2GSRA 2OE0A 4XRDA 3TKSC 3VWVA 1SL1B 4GWRA 3ZLPA 1A2MA 5HR1A 5D96A 5DVBA 1GLPA 3EMXA 1XBSA 1Y6EA 1PA3A 4FIWA 4NXIA 4MPFA 4KH7A 4BPYA 5B6NA 3VI5A 4ZB9A 1YJ6A 2R5GA 3QOUA 5D9WA 22GSA 1GUKA 5F8BA 4V1Ag 8GSSA 4X43A 2H19A 3U5RE 2VLVA 1B48A 2FLSA 2EIRA 4PUAA 1FB0A 1C72A 1JLVA 2KOKA 3EINA 4ZL9A 2VLTA 3FZ9A 2CT6A 3GV1A 1K0AA 6GSWA 2C0GA 1EEMA 4IQ1A 4F2IA 3QMXA 2IMKA 2V6KA 2OE1A 1EGOA 3ZMLA 2PVOC 1F37A 2IFQA 3ED3A 5KEJA 1JZOA 5J4UA 4MZBA 5IM9A 2BMXA 1TXXA 2VCXA 1YEXA 4MLYA 1SJIA 2IL3A 2GSSA 4BA7A 1WMJA 2F9SA 5G1LA 2R3XA 1DE2A 3QFBC 5KN0A 1V57A 4GQFA 2JZSA 3OR5A 3FKFA 5FWGA 1ILOA 2HNLA 3DKSA 2FA8A 2IJYA 4WBJA 5IO2A 1AW9A 2GSTA 3RHCA 2WJUA 2IMEA 3FZAA 4G2EA 2R2JA 1TRSA 4EKZA 2H6ZA 1AXDA 3CRUA 3EYTA 3US3A 3ERWA 2GGTA 2YWNA 5JCUA 3BJ5A 4YQVA 4HS1A 4F9ZA 5D73A 3DYRA 3H1NA 3M3MA 1GSDA 4GRFA 2XPEA 3VFIA 5B6MA 4NHWA 2H6YA 2V41A 4V2LA 3RPPA 5GSSA 4ACSA 1PL2A 1SK1A 2H30A 4POLA 1K0OA 2DJ1A 3IV4A 2C0FA 1ERVA 4MK3A 2XHFA 5EY6A 2IN3A 4HU7A 4HUAA 4CHSA 2C3NA 2RM6A 3BCKA 3VPQA 2CAQA 2XBQA 2FWGA 1A24A 3DMLA 4TR3A 5DQYA 3TB2A 1MD3A 1EEJA 3CSJA 4ISDA 4JR4A 4DSRA 4KW6A 4I97A 4LL4B 2OKAA 1TI3A 3CSHA 2DJ0A 3CRTA 2VD1A 1SKSB 3L0HA 2LQOA 3ERFA 4KB3A 2YNXA 4EF0A 4KX4A 4WR4A 3RAZA 2NPBA 3DD3A 4ECIA 3PINA 3KZQA 4I2TA 3M1GA 5IPGA 3GSTA 1GSQA 4LA1A 4MJEA 2MBTA 1ZZYA 2ON5A 4QL7A 3G7IA 4TR0A 5JWQB 5HFGA 4L8EA 4D73A 2VIMA 1PX7A 5DJLA 1LBKA 3VURA 2AHEA 7GSSA 5G5EA 4TVEA 5IPHA 4EUYA 4EL1A 4AJ7A 1OE7A 1VF2A 3FRCA 2FHEA 4IJ3A 3F3RA 2DJJA 4L5OA 2OA7A 3KJYA 2OBKA 3DRNA 5KN1A 4MJCA 3IA1A 4N0ZA 2L6CA 2H72A 2JU5A 2N5AA 1GNWA 4DVCA 5A4WA 1T4ZA 2C3TA 4IELA 4K7NA 3ZL5A 3I43A 4WETA 4E8HA 3KH7A 4ZBBA 2PUKC 3CYNA 5ECKB 14GSA 2WFCA 3GH6A 1MD4A 2P31A 1J08A 3KGKA 5IOWA 3TKRA 3FR6A 3GRXA 5IIZA 1XZOA 4ECCA 1M99A 4ULXA 1TK0B 1TK5B 4KDYA 4K0GA 1GSSA 1HQOA 3IK7A 2VL3A 1O81A 3HDCA 1SL0B 2HSHA 4XCSA 3S9FA 1URMA 2QGVA 2L4CA 4PQ1A 2QSIA 3GUSA 1PL1A 3UVHA 1A8YA 4WF5A 1RK4A 1OVNA 2RM5A 3LWAA 1X9WB 3G9BA 2YP6A 5EL8A 1V9WA 3GKNA 4WXTA 5DCHA 3IRAA 4PX1A 3HZ8A 1J0FA 2GSQA 1RW1A 5ELAA 2ZNMA 3QAWA 2FWFA 4K9ZA 2FGXA 1WJKA 5CP1A 3I6AA 20GSA 1S3DA 5LNKe 1VF3A 2O7KA 3TDGA 4YAVA 5J5NA 13GSA 3FEUA 1EOGA 3KMNA 4ZXGA 2ES7A 5ECOB 3DVXA 3IAM2 1GTBA 1TI1A 2XC2A 2X99A 3TGZA 2DJ2A 2F51A 4RI7A 5HQPA 1AC1A 1SKWB 5D9VA 3QD9A 2F8AA 4KCAA 1A0FA 2C3QA 2H1AA 3EWLA 1O85A 3GTUB 2GZPA 1BQ7A 1N8JA 4ML1A 3ZFLA 5JCGA 5E59A 2WB9A 4ZIJA 2E0QA 4FH8A 3WD6A 5IMAA 3D4MA 1TJDA 2H70A 5A4VA 5B8BA 2WCIA 4Z7XA 4NV2A 2O89A 3H8QA 1YEPA 1TDIA 3TJFA 5COHA 1FAAA 4IBPA 4TXOA 5JCWA 3DIEA 1WE0A 4IW9A 2EIOA 4L0UA 2I3YA 2EIQA 10GSA 3IE3A 1KBNA 1Z9HA 2MZCA 4AGSA 1ERTA 1G6YA 2P5QA 1W4VA 2R6KA 3I9V2 2B1KA 3WGEA 1XFLA 4K7IA 1TU7A 1WWJA 4OWYA 4GSSA 4HU9A 3APOA 5KN2A 4DSSB 2MYGA 3AY8A 3P2AA 2O8VB 2LRNA 2VCVA 3FHKA 3VWUA 3CTFA 1YQ1A 4ZBDA 1G7OA 4ZL8A 2I1UA 3EVIA 1GP1A 4EXJA 4XIHA 4KUNA 1TTZA 2L4QA 2QKEA 3G7YA 2N5BA 1SL2B 3ME7A 3QAGA 2DMMA 3KXOA 4RI6A 3M9KA 1EV4A 3M8NA 4IS0A 4N11A 1R5PA 4MF5A 3D22A 3DXBA 3O76A 2M80A 4J56E 2YANA 2YCDA 4OCFA 1G7EA 3I69A 5DJMA 4WR5A 1SENA 5G2ZA 4JR6A 1PQNA 2HLSA 1ABAA 4K6XA 2YV7A 1M2AA 5KN3A 3PR8A 1BG5A 3CXGA 1ST9A 3WYWA 2L5OA 1JZWA 4GCIA 4TN8A 4KAEA 1DUGA 1GL8A 4MF7A 3UARA 3BD2A 2V1MA 3L9SA 4MJBA 4RQXA 3W8JA 4TOPA 2FCHA 5F05A 5C00A 2FWEA 4FYUA 2HSYA 1U6TA 2GLRA 1TP9A 5HR0A 3ZREA 3NOFA 5ABRA 2TRCP 1JHBA 11GSA 5F0GA 5HFKA 1ML6A 3Q74A 1TKDB 1XVWA 3VK9A 2HT9A 3A5WA 1DSBA 3TJKA 1GRXA 1V58A 3MDKA 5G1KA 2WULA 4ZB8A 3IHQA 2LSTA 2YZHA 5G31A 2GQMA 4MH2A 2VAFA 4H86A 3D5JA 1AAZA 4POKA 4NMUA 2KP2A 2JL4A 4V2MA 5DCGA 4PGTA 3MAKA 1ZL9A 1ZYEA 4IGJA 1E6BA 1GTIA 1JZDA 1K0DA 3L9UA 3HZ4A 5ECRB 2WGRA 3GH9A 2BJXA 1YKCA 3GX8A 2HZEA 1TK8B 1N2AA 2CX4A 1HNBA 2OBIA 5B7CA 1EV9A 4TRXA 1AIUA 2B3SA 2IIYA 2MMZA 4XS4A 1XCCA 2CVDA 3GNJA 4G10A 2K6VA 2A2RA 4PNFA 5CYYA 1OC8A 5DAKB 3SWLA 3WT1A 3TRQA 2L57A 1MDIA 4ZB6A 1S3CA 3GKMA 2O87A 3VWWA 5F06A 3G7JA 1K0BA 4MPGA 1FVJA 2BTOT 1NSWA 4MABA 2H6XA 4JEDA 3QPMA 1NW2A 2DLXA 1SYXA 4HQZA 5IOXA 1S3AA 2CV4A 4ILFA 1FHEA 5ECNB 5CNWA 4TR1A 4KDUA 3J7Yb 3A2XA 3LSZA 4MCUA 4WBRD 2D2ZA 4PXOA 3F0IA 3C7MA 4KA0A 2GVPA 1EZKA 1PGTA 3GA4A 1M9AA 4HI7A 5C04A 3QR6A 1FW1A 1OC9B 3F63A 4OFTA 2H1DA 4O92A 2WRTA 3ZFBA 3U6VA 5LD0A 2RLIA 3F8UA 2LJKA 5AISA 1FB6A 2E2GA 1JZRA 5ECQB 4OMVA 4OD7A 5IMZA 3ZTLA 1Z6NA 3QFAC 2H71A 1AQVA 5L71A 1GH2A 3GHAA 1AQXA 2B5YA 3C71A 1TW9A 2VL9A 4KGIA 1XWAA 1GSUA 3C1SA 2YJHA 1U3IA 3J7Yk 1KTEA 2IWTA 1F9MA 2FUG2 5DALA 3TJJA 2CX3A 1YY7A 1MEKA 2FD3A 3KP9A 3LGCA 4O32A 2NTOA 4WEYA 3A2VA 1LJRA 3VI7A 1T4YA 1SJ6A 2DIZA 1YF0A 2TIRA 1A0RP 2R4VA 2X8GA 3D21A 1QGVA 4E8EA 3K8NA 2P5RA 1MDJA 4JZQA 5ID2A 5HR2A 4L0WA 2EC4A 1NHYA 18GSA 3EC3A 3LYKA 1T3BA 4NPBA 2VM2A 4OO4A 4ECBA 3CBUA 4LL1B 3QAVA 2H73A 1X5DA 3W6GA 2XPDA 4TXVA 2DJ3A 2WZ9A 3M9JA 5J41A 1X5CA 5CRGA 4BL7A 5H5SA 3L9VA 2YV9A 2ZUPA 4HOJA 2CQ9A 1M7TA 2VO4A 2JZTA 5AIXA 1PD21 3C8EA 2LJAA 2L6DA 2LV3A 4NWYA 2IFQB 1K0MA 3NIVA 4MF6A 1Z7PA 3UMAA 2JSZA 2DMLA 1BYEA 1M9BA 2H76A 2HRNA 3UAPA 5ENUA 5CRHA 3P7XA 5J3RA 1ZCPA 4PQIA 2JZRA 2CVBA 3HHVA 3HJMA 3VWXA 1VGLA 3FYGA 4MP4A 2LJRA 1PKZA 5G30A 1H4OA 2WS2A 4MH3A 3UEMA 1PKWA 1YDKA 3ZIJA 3E3EA 3CMIA 1Q4JA 1EGRA 5ECIB 2LKUA 2PN8A 4IQAA 4OO5A 1A8LA 3GYKA 2HE3A 2LTKA 3MWHA 2VCTA 4GQCA 4KCEA 1OAZA 4LMVA 4KDXA 2E7PA 3KEBA 3H79A 2LQQA 1T00A 1OKTA 2CA8A 2GZYA 3BOAA 1EP7A 5D9TA 1O8XA 3TRXA 3DEXA 5IQYA 1H75A 3UL3A 2LNTA 1GTAA 4GSTA 3LORA 4MJAA 3ZRDA 2B7KA 1ZOFA 4GXZA 1GULA 2HZFA 3M0FA 1XW6A 2HXKA 4V1Ap 1SU9A 2PVQA 2B5EA 2GS3A 3EU4A 4QL9A 4DEJA 5J9CA 3APSA 2VD0A 1KNGA 3UOMA 2B5XA 4KSMA 3HVSA 2AUVA 4XTSA 2HRFA 3FR9A 2LUSA 3C73A 1THOA 4G19A 5ECMB 1UA5A 1GUMA 2H0IA 2KUCA 5GAPD 1QQ2A 4Q5QA 5DDLA 3TCOA 4IKHA 4ECJA 3F4SA 3TOUA 4F82A 3HJPA 1HNAA 3RHBA 4NV5A 1DBYA 5JWRB 2F3MA 4HEA2 3DVWA 1Y25A 2DBCA 5GZZB 2A4VA 3ZITA 5GSTA 1PRXA 2O85A 3A3TA 1SD9A 1B9YC 2YWIA 1BAYA 1VF4A 1QUWA 2MMNA 3IAS2 2YN1A 2E2MA 1GNEA 3FR3A 3L4NA 3LJRA 1PSQA 2AAWA 5JWOB 3LG6A 3HCZA 1O73A 4BVXA 4D73B 4N30A 3NZNA 1TU8A 4KE3A 1FG4A 1CQHA 2YPMA 3ME8A 1T8EB 2C80A 3ISOA 4GF0A 4MMMA 3GX0A 3LFLA 1OYJA 2REMA 2LRTA 3FZ5A 1QFNA 1M0UA 1KEBA 2IPAA 4HZ4A 1U3AA 1WIKA 1PX6A 4XS1A 3UIWA 4X0XA 1UVZA 1GLQA 3TKPA 2OADA 2H66A 1XWBA 5AN1A 2K8SA 2RIIA 2V2GA 3CSIA 2DC5A 2MMOA 4PQHA 3VLNA 2I9HA 1X5EA 4NHZA 4PURA 5CRDA 4IHUA 3KMOA 4KNDA 2YWOA 1M2BA 3EURA 2VCQA 4MA9A 3QCPA 1M2DA 2VLUA 4WKWA 3LXTA 2PBJA 1TRUA 5H5QA 1F2EA 3KIJA 3LEFA 4XRAA 1TRWA 4FYBA 4I5QA 4N0VA 1IYIA 2HFDA 4J57E 3QDNA 1R4WA 4WF4A 1YKAA 3HVVA 3TRPA 1GWCA 1I9DA 2DSAA 3TOTA 3KTLA 1PN9A 2H0GA 1G0TA 4MZWA 1XOAA 2L59A 2CZ3A 3EMPA 2ALBA 4F0CA 1B4QA 4POBA 5CAXA 3KM6A 3GL5A 1V2AA 6GSXA 2M46A 1V98A 4K7OA 1FO5A 5CREA 1T1VA 3ZMKA 3UJ1A 2I4AA 2C8UA 5AIVA 5ECSA 1WRYA 3O3TA 1Z5YE 3TJGA 2R37A 1USBA 5FHIA 3GL3A 3F4TA 3TUEA 1T7PB 1WOUA 4J2FA 3PH9A 2PPTA 4BWQA 1ERWA 4ML6A 3GKXA 4RUVA 1K3OA 2Z9SA 5A5KA 3BBYA 3VPTA 1R7HA 5A4UA 3IBHA 1AUCA 5AGYA 1Q98A 2LNSA 1RQMA 2H8LA 2B7JA 1EOHA 4V2NA 1SD8A 3RBTA 2OJLA 4I6XA 2PU9C 3ZVJA 4IJIA 2GT5A 3MNGA 1VRSD 2IMDA 2MBSA 3HXSA 4GLTA 4IN0A 2GZZA 3GURA 3UBLA 4GSNA 2I81A 2VM1A 4QQ7A 3IXRA 2X8CA 3F9UA 2L5LA 3DWVA 4TXOB 1AQWA 1ERUA 1F6MC 2FNOA 1B8XA 3H93A 4CDOA 2YJ7A 2J23A 3F4RA 2AB6A 1BX9A 4TKYA 4F03A 1JFUA 4POMA 2VL2A 4AJ6A 2A2SA 4OCEA 2IMIA 1EWXA 2GDRA 3EU3A 3Q19A 3RPNA 3F6FA 1FVKA 3TKQA 1THXA 4EDZA 1UC7A 2C4JA 3GTUA 3FZ4A 3EE2A 5INYA 2JSYA 3KP8A 2H1GA 1TRVA 4K2DA 5CRWA 4JBBA 3DGQA 3N5OA 2X8HA 3MSZA 2ZCTA 3GMFA 1U88A 1MDKA 5F07A 3ERGA 5D9XA 2B6MA 1K3LA 4PNGA 2GT6A 4KSOA 1XPVA 4GTUA 1WPIA 4K1FA 2DJKA 2VUPA 2V6OA 3P8WA 1Z6MA 5DQSA 1GUHA 1OC3A 3HD5A 4HJ2A 4ZILA 2C1YA 3F6DA 3LYPA 3TKSE 3HY2A 4P3YB 1O8WA 3CTGA 5IMDA 4RQRA 5J9BA 3IR4A 2X64A 4I8BA 1BJXA 5FT3A 1Z3EA 3WT2A 3FY7A 3ZVJD 1JLWA 1TOFA 1SKRB 3TKSA 2DIYA 3KTBA 4DSSA 3HJOA 3P90A 1QMVA 2KHPA 1QK8A 4PUFC 1K0NA 3D0ZA 1B9XC 1QXHA 12GSA 3KD0A 5HFIA 1NHOA 2YOIA 2FA4A 3A2WA 2GTUA 1K0CA 3FW2A 4BVYA 1V40A 1HYUA 2KP1A 3APQA 2JACA 3KH9A 3RDWA 4EE0A 1B4PA 2OACA 2GQKA 5IMVA 3SBCA 5EVOA 4EDYA 3ZIVA 3IDVA 5IMCA 4MZCA 5G5FA 2H74A 3BCIA 3Q6OA 1K3YA 4IP1A 2F8FA 3F3QA 19GSA 1O6JA 1J9BA 3PGTA 5ELGA 2FWHA 4ZL7A 2NDOA 2AV4A 1XWCA 1IYHA 3R2QA 2K8VA 3LQ7A 3GFKA 5H5RA 3WGDA 3E0UA 5DBQA 2GQLA 3HYPA 3KCMA 3D4TA 5EPFA 3JCML 4JRRA 2JADA 1BEDA 2WDUA 1ACVA 4N10A 2K18A 1GTUA 6GSUA 1WP0A 2H0HA 1SJZA 1PMTA 6GSYA 3UBKA 5GAND 2LS5A 2YZUA 2CAIA 2LRCA 4LLRA 4I2UA 4EO3A 3W8SA 1ON4A 3GKKA 4K0NA 4OFMA 4MDCA 2HZEB 4K8MA 4Q5NA 2KLXA 2AJQB 3Q18A 5CO3A 1XOBA 4HZ2A 4YH2A 2G0FA 4FYCA 1YF1A 4F0BA 4IVFA 4XS4B 2V32A 3H4KA 3UVTA 3V1WA 1GSYA 3O6TA 1R26A 2VCZA 3GN3A 3E9JB 1E2YA 1F3AA 3HVXA 4Q5FA 2RUFA 2MMAA 2P0GA 2VOCA 3D6IA 4HQSA 1X0RA 1XW5A 3IOSA 2NBSA 4X1UA 4FO5A 2M72A 5E4WA 4O7HA 3ZZXA 6GSSA 4ID0A 1A2LA 1ZYQB 2IMFA 2ON7A 4LMWA 5D8IA 4ZBAA 4EVMA 4TR4A 2K9FA 2N5FA 2FY6A 3HKRA 4TR1B 2B1LA 3N9JA 1GSEA 1LU4A 4YQMA 1XWGA 2XBIA 6GSTA 2PERA 1A23A 3GSSA 2YWMA 2HI7A 3LXZA 5IMFA 5DAKA 5IO0A 3GIXA 1SK0A 1VF1A 2PWJA 1SYRA 1OE8A 2LEGA 4YAPA 1I5GA 1OKDA 3HA9A 5B8AA 4BWSA 2H75A 5LCZA 6GSVA 1SK2A 1DE1A 2H1BA 1W89A 4Q5RA 4AF2A 1ZMAA 2PMTA 4CW9A 9GSSA 3WGXA 5ECLB 3TJBA 4YQUA 1HNCA 1XW9A 2G2QA 3C1RA 2VL2C 5HR3A 4HJMA 17GSA 2CVKA 4O5RA 5DALB 2CZ2A 1HD2A 3FK8A 2PGTA 1U87A 1NM3A 5ECHB 2H01A 1XIYA 4DSQA 2TRXA 2HYXA 2OE3A 4XHMA 1EP8A 5D93A 4JE1A 1FOVA 4NAXA 1OC9A 1XVQA 1XWKA 4AJ8A 2AYTA 2J9HA 1G6WA 5ID2B 2RUEA 1X9MB 1YZXA 2VCWA 4HDEA 4L5LA 16GSA 4TW5A 1UN2A 2QC7A 1X9SB 4G9HA 1GSFA 1MTCA 2C0EA 5ECPB 1O7UA 1Z7RA 2NVLA 4OFNA 3IK9A 3IPZA
chains in the Genus database with same CATH superfamily
1R5AA 1A2JA 3ZYWA 1ZGNA 3IC4A 1F3BA 4BL7B 2C0DA 4EC0A 3L78A 4JU5A 1CQGA 4KF9A 4IP6A 4XS6A 1XXUA 2GSRA 2OE0A 4XRDA 3TKSC 3VWVA 1SL1B 4GWRA 3ZLPA 1A2MA 5HR1A 5D96A 5DVBA 1GLPA 3EMXA 1XBSA 1Y6EA 1PA3A 4FIWA 4NXIA 4MPFA 4KH7A 4BPYA 5B6NA 3VI5A 4ZB9A 1YJ6A 2R5GA 3QOUA 5D9WA 22GSA 1GUKA 5F8BA 4V1Ag 8GSSA 4X43A 2H19A 3U5RE 2VLVA 1B48A 2FLSA 2EIRA 4X4JA 4PUAA 1FB0A 1C72A 1JLVA 2KOKA 3EINA 4ZL9A 2VLTA 3FZ9A 2CT6A 3GV1A 1K0AA 6GSWA 2C0GA 1EEMA 4IQ1A 4F2IA 3QMXA 2IMKA 2V6KA 2OE1A 1EGOA 3ZMLA 2PVOC 1F37A 2IFQA 3ED3A 5KEJA 1JZOA 5J4UA 4MZBA 5IM9A 2BMXA 1TXXA 2VCXA 1YEXA 4MLYA 1SJIA 2IL3A 2GSSA 4BA7A 1WMJA 2F9SA 5G1LA 2R3XA 1DE2A 3QFBC 5KN0A 1XG8A 1V57A 4GQFA 2JZSA 3OR5A 3FKFA 5FWGA 1ILOA 2HNLA 3DKSA 2FA8A 2IJYA 4WBJA 5IO2A 1AW9A 2GSTA 3RHCA 2WJUA 2IMEA 3FZAA 4G2EA 2R2JA 1TRSA 4EKZA 2H6ZA 1AXDA 3CRUA 3EYTA 3US3A 3ERWA 2GGTA 2YWNA 5JCUA 4A5PA 3BJ5A 4YQVA 4HS1A 4F9ZA 5D73A 2X49A 3DYRA 3H1NA 3M3MA 1GSDA 4GRFA 2XPEA 3VFIA 5B6MA 4NHWA 2H6YA 2V41A 4V2LA 3RPPA 5GSSA 4ACSA 1PL2A 1SK1A 2H30A 4POLA 1K0OA 2DJ1A 3IV4A 2C0FA 1ERVA 4MK3A 2XHFA 5EY6A 2IN3A 4HU7A 4HUAA 4CHSA 4BVXB 2C3NA 2RM6A 3BCKA 3VPQA 2CAQA 2XBQA 2FWGA 1A24A 3DMLA 4TR3A 5DQYA 3TB2A 1MD3A 1EEJA 3CSJA 4ISDA 4JR4A 4DSRA 3LW9A 4KW6A 4I97A 4LL4B 2OKAA 1TI3A 3CSHA 2DJ0A 3CRTA 2VD1A 1SKSB 3L0HA 2LQOA 3ERFA 4KB3A 2YNXA 4EF0A 4KX4A 4WR4A 3RAZA 2NPBA 3DD3A 4ECIA 3PINA 3KZQA 4I2TA 3M1GA 5IPGA 3GSTA 1GSQA 4LA1A 4MJEA 2MBTA 1ZZYA 2ON5A 4QL7A 3G7IA 4TR0A 5JWQB 5HFGA 4L8EA 4D73A 2VIMA 1PX7A 5DJLA 1LBKA 3VURA 2AHEA 7GSSA 5G5EA 4TVEA 5IPHA 4EUYA 4EL1A 1ZYNA 1OE7A 1VF2A 4AJ7A 3FRCA 2FHEA 4IJ3A 3F3RA 2DJJA 4L5OA 2OA7A 3KJYA 2OBKA 3DRNA 5KN1A 4MJCA 3IA1A 4N0ZA 2L6CA 2H72A 2JU5A 2N5AA 1GNWA 4DVCA 5A4WA 2R0PA 1T4ZA 2R0GA 2C3TA 4IELA 4K7NA 3ZL5A 3I43A 4WETA 4E8HA 3KH7A 4ZBBA 2PUKC 3CYNA 5ECKB 14GSA 2WFCA 3GH6A 1MD4A 2P31A 1J08A 3KGKA 5IOWA 3TKRA 3FR6A 3GRXA 5IIZA 1XZOA 4ECCA 1M99A 4ULXA 1TK0B 1TK5B 4KDYA 4K0GA 1GSSA 1HQOA 3IK7A 2VL3A 1O81A 3HDCA 1SL0B 2HSHA 4XCSA 3S9FA 1URMA 2QGVA 2L4CA 4PQ1A 2QSIA 3GUSA 1PL1A 3UVHA 1A8YA 4WF5A 1RK4A 1OVNA 2RM5A 3LWAA 1X9WB 3G9BA 2YP6A 5EL8A 1V9WA 3GKNA 4WXTA 3IC8A 1ZYPA 3IRAA 5DCHA 4PX1A 3HZ8A 1J0FA 2GSQA 1RW1A 5ELAA 2ZNMA 4YKGA 3QAWA 2FWFA 4K9ZA 2FGXA 1WJKA 3PPUA 5CP1A 3I6AA 20GSA 1S3DA 5LNKe 1VF3A 2O7KA 3TDGA 4YAVA 5J5NA 13GSA 3FEUA 1EOGA 3KMNA 4ZXGA 2ES7A 5ECOB 3DVXA 3IAM2 1GTBA 1TI1A 2XC2A 2X99A 3TGZA 2DJ2A 2F51A 1PN0A 4RI7A 5HQPA 1AC1A 1SKWB 5D9VA 3QD9A 2F8AA 4KCAA 4K5RA 4Z2TA 1A0FA 2C3QA 2H1AA 3EWLA 1O85A 3GTUB 2GZPA 1BQ7A 1N8JA 4ML1A 3ZFLA 5JCGA 5E59A 2WB9A 4ZIJA 2E0QA 2QA1A 4FH8A 3WD6A 5IMAA 3D4MA 1TJDA 2H70A 5A4VA 5B8BA 2WCIA 4Z7XA 4NV2A 2O89A 3H8QA 1YEPA 1TDIA 3TJFA 5COHA 3HVNA 1FAAA 4IBPA 4TXOA 5JCWA 3DIEA 1WE0A 4IW9A 5BMUA 2EIOA 4L0UA 2I3YA 2EIQA 1M3IA 10GSA 3IE3A 1KBNA 1Z9HA 3MYDA 2MZCA 4AGSA 1ERTA 1G6YA 2P5QA 1W4VA 2R6KA 3I9V2 2B1KA 3WGEA 4K5SA 1XFLA 4K7IA 1TU7A 1WWJA 4OWYA 4GSSA 3A5IA 4HU9A 3APOA 5KN2A 4DSSB 2MYGA 3AY8A 3P2AA 2O8VB 2LRNA 2VCVA 3FHKA 3VWUA 3CTFA 1YQ1A 4BVYB 4ZBDA 1G7OA 4ZL8A 2I1UA 3EVIA 1GP1A 4EXJA 4XIHA 4KUNA 1TTZA 2L4QA 2QKEA 3G7YA 2N5BA 1SL2B 4USSA 3ME7A 3QAGA 2DMMA 3KXOA 4RI6A 3M9KA 1EV4A 3M8NA 4IS0A 4N11A 1R5PA 4MF5A 3D22A 3DXBA 3O76A 2M80A 4J56E 2YANA 2YCDA 4OCFA 1G7EA 3I69A 5DJMA 4WR5A 2DKIA 1SENA 5G2ZA 4JR6A 1PQNA 2HLSA 1ABAA 4K6XA 2YV7A 1M2AA 5KN3A 3PR8A 1BG5A 3CXGA 1ST9A 3WYWA 2L5OA 1JZWA 4GCIA 4TN8A 4KAEA 1DUGA 1GL8A 4MF7A 3UARA 3BD2A 2V1MA 3L9SA 4MJBA 4RQXA 3W8JA 4TOPA 2FCHA 5F05A 5C00A 2FWEA 4FYUA 2HSYA 1U6TA 2GLRA 1TP9A 5HR0A 3ZREA 3NOFA 5ABRA 2TRCP 1JHBA 11GSA 5F0GA 5HFKA 1ML6A 3Q74A 1TKDB 1XVWA 3VK9A 2HT9A 3A5WA 1DSBA 3TJKA 1GRXA 1V58A 3MDKA 5G1KA 2WULA 4ZB8A 3IHQA 2LSTA 2YZHA 5G31A 2GQMA 4MH2A 2VAFA 4H86A 3D5JA 1AAZA 4POKA 4NMUA 2KP2A 2JL4A 4V2MA 5DCGA 4PGTA 3MAKA 1ZL9A 1ZYEA 4IGJA 1E6BA 1GTIA 1JZDA 1K0DA 3L9UA 3HZ4A 5ECRB 2WGRA 3GH9A 2BJXA 4CY6A 1YKCA 3GX8A 2HZEA 4O5UA 1TK8B 1N2AA 2CX4A 1HNBA 2OBIA 5B7CA 1EV9A 4TRXA 1AIUA 2B3SA 2IIYA 2MMZA 4XS4A 1XCCA 2CVDA 3GNJA 4G10A 2K6VA 2A2RA 4PNFA 5CYYA 1OC8A 5DAKB 3SWLA 3WT1A 3TRQA 2L57A 1MDIA 4ZB6A 1S3CA 3GKMA 2O87A 3VWWA 5F06A 3G7JA 1K0BA 4MPGA 1FVJA 2BTOT 1NSWA 4MABA 2H6XA 4JEDA 3QPMA 1NW2A 2DLXA 1SYXA 4HQZA 5IOXA 1S3AA 2CV4A 4ILFA 1FHEA 5ECNB 5CNWA 3MIXA 4TR1A 4KDUA 3J7Yb 3A2XA 3LSZA 4MCUA 4WBRD 2D2ZA 4PXOA 3F0IA 3C7MA 4Z2RA 4KA0A 2GVPA 1EZKA 1PGTA 3GA4A 1M9AA 4HI7A 5C04A 3QR6A 1FW1A 1OC9B 3F63A 4OFTA 2H1DA 4O92A 2WRTA 3ZFBA 4MNNA 5LD0A 3U6VA 2RLIA 3F8UA 2LJKA 5AISA 1FB6A 2E2GA 1JZRA 5ECQB 4OMVA 4OD7A 5IMZA 3ZTLA 1Z6NA 3QFAC 2H71A 1AQVA 5L71A 1GH2A 3GHAA 1AQXA 2B5YA 3C71A 1TW9A 2VL9A 4KGIA 1XWAA 1GSUA 3C1SA 2YJHA 1U3IA 3J7Yk 1KTEA 2IWTA 1F9MA 2FUG2 5DALA 3TJJA 2CX3A 1YY7A 1MEKA 2FD3A 3KP9A 3LGCA 4O32A 2NTOA 4WEYA 3A2VA 1LJRA 3VI7A 1T4YA 1SJ6A 2DIZA 1YF0A 2TIRA 1A0RP 2R4VA 2X8GA 3D21A 1QGVA 4E8EA 3K8NA 2P5RA 1MDJA 4JZQA 5ID2A 5HR2A 2HRKA 4L0WA 2EC4A 1NHYA 18GSA 3EC3A 3LYKA 1T3BA 4NPBA 2VM2A 4OO4A 4ECBA 3CBUA 4LL1B 3QAVA 2H73A 1X5DA 3W6GA 2XPDA 4TXVA 2DJ3A 2WZ9A 3M9JA 5J41A 1X5CA 5CRGA 4BL7A 5H5SA 3L9VA 2YV9A 2ZUPA 4HOJA 2CQ9A 1M7TA 2VO4A 2JZTA 5AIXA 1PD21 3C8EA 2LJAA 2L6DA 2LV3A 4NWYA 4YKFA 2IFQB 1K0MA 3NIVA 4MF6A 1Z7PA 4EIQA 3UMAA 2JSZA 2DMLA 1BYEA 1M9BA 2H76A 2HRNA 4EIPA 3UAPA 5ENUA 5CRHA 3P7XA 5J3RA 1ZCPA 4PQIA 2JZRA 2CVBA 3HHVA 3HJMA 3VWXA 1VGLA 3FYGA 4MP4A 2LJRA 1PKZA 5G30A 1H4OA 2WS2A 4MH3A 3UEMA 1PKWA 1YDKA 3ZIJA 3E3EA 3CMIA 1Q4JA 1EGRA 5ECIB 2LKUA 2PN8A 4IQAA 4OO5A 1A8LA 3GYKA 2HE3A 2LTKA 3MWHA 2VCTA 4GQCA 4KCEA 1OAZA 4LMVA 4KDXA 2E7PA 3KEBA 2HRAA 3H79A 2LQQA 1T00A 1OKTA 2CA8A 2GZYA 3BOAA 1EP7A 4G0KA 5D9TA 1O8XA 3TRXA 3DEXA 5IQYA 1H75A 3UL3A 2LNTA 1GTAA 4GSTA 3LORA 4MJAA 3ZRDA 2B7KA 1ZOFA 4GXZA 1GULA 2HZFA 3M0FA 1XW6A 2HXKA 4V1Ap 1SU9A 2PVQA 2B5EA 4G0LA 2GS3A 3EU4A 4QL9A 4DEJA 5J9CA 3APSA 2VD0A 1KNGA 4K2XA 3UOMA 2B5XA 4KSMA 3HVSA 2AUVA 4XTSA 2HRFA 3FR9A 2LUSA 3C73A 1PFOA 5BRTA 1THOA 4G19A 5ECMB 1UA5A 1GUMA 2H0IA 2KUCA 5GAPD 1QQ2A 4Q5QA 5DDLA 3TCOA 4IKHA 4ECJA 3F4SA 3TOUA 4F82A 3HJPA 1HNAA 3RHBA 4NV5A 1DBYA 5JWRB 2F3MA 4HEA2 3DVWA 1Y25A 2DBCA 5GZZB 2A4VA 3ZITA 5GSTA 1PRXA 2O85A 3A3TA 1SD9A 1B9YC 2YWIA 1BAYA 1VF4A 1QUWA 2MMNA 3IAS2 2DKHA 2YN1A 2E2MA 1GNEA 3FR3A 3L4NA 3LJRA 1PSQA 2AAWA 5JWOB 1S3RA 3LG6A 3HCZA 1O73A 4BVXA 4D73B 4N30A 5KOXA 3NZNA 1TU8A 3CQFA 4KE3A 1FG4A 1CQHA 2YPMA 3ME8A 1T8EB 2C80A 3ISOA 4GF0A 4MMMA 3GX0A 3LFLA 1OYJA 2REMA 2LRTA 3FZ5A 3IHGA 1QFNA 2A2PA 1M0UA 1KEBA 2UZ8A 2IPAA 4HZ4A 1U3AA 1WIKA 1PX6A 4XS1A 3UIWA 4X0XA 1UVZA 1GLQA 3TKPA 2OADA 2H66A 1XWBA 5AN1A 2K8SA 2RIIA 2V2GA 3CSIA 2DC5A 2MMOA 4PQHA 3VLNA 2I9HA 1X5EA 4NHZA 4PURA 5CRDA 4IHUA 3KMOA 4KNDA 2YWOA 4CY8A 1M2BA 3EURA 2VCQA 4MA9A 3QCPA 1M2DA 2VLUA 4WKWA 3LXTA 2PBJA 1TRUA 5H5QA 1F2EA 3KIJA 3LEFA 4XRAA 1TRWA 4FYBA 4I5QA 4N0VA 4PTSA 1IYIA 2HFDA 4J57E 3QDNA 1R4WA 4WF4A 1YKAA 3HVVA 3TRPA 4G0IA 1GWCA 1I9DA 2DSAA 3TOTA 4HSCX 3KTLA 1PN9A 2H0GA 1G0TA 4MZWA 1XOAA 2L59A 2CZ3A 3EMPA 2ALBA 4F0CA 1B4QA 4POBA 5CAXA 3KM6A 3GL5A 1V2AA 6GSXA 2M46A 1V98A 4K7OA 1FO5A 5CREA 1T1VA 3ZMKA 3UJ1A 2I4AA 2C8UA 5AIVA 5ECSA 1WRYA 3O3TA 4FQUA 1Z5YE 3TJGA 2R37A 1USBA 5FHIA 3GL3A 3F4TA 3TUEA 1T7PB 1WOUA 4J2FA 3PH9A 2PPTA 4BWQA 1ERWA 4ML6A 3GKXA 4RUVA 1K3OA 2Z9SA 5A5KA 3BBYA 3VPTA 1R7HA 2QA2A 5A4UA 3IBHA 1AUCA 5AGYA 1Q98A 2LNSA 1RQMA 2H8LA 2B7JA 1EOHA 4V2NA 1SD8A 3RBTA 2OJLA 4I6XA 2PU9C 3ZVJA 4IJIA 2GT5A 3MNGA 1VRSD 2IMDA 2MBSA 3HXSA 4GLTA 4IN0A 2GZZA 3GURA 3UBLA 4GSNA 2I81A 2VM1A 4QQ7A 3IXRA 2X8CA 3F9UA 2L5LA 3DWVA 4TXOB 1AQWA 1ERUA 1F6MC 2FNOA 1B8XA 3H93A 4CDOA 2YJ7A 2J23A 3F4RA 2AB6A 1BX9A 4TKYA 4F03A 1JFUA 4POMA 2VL2A 4AJ6A 2A2SA 4OCEA 2IMIA 1EWXA 2GDRA 3EU3A 3Q19A 3RPNA 3F6FA 1FVKA 3TKQA 3FMWA 1THXA 4EDZA 1UC7A 2C4JA 3GTUA 3FZ4A 3EE2A 5INYA 2JSYA 3KP8A 2H1GA 1TRVA 4K2DA 5CRWA 4JBBA 3DGQA 3N5OA 2X8HA 3MSZA 2ZCTA 3GMFA 1U88A 1MDKA 5F07A 3ERGA 5D9XA 4O5QA 2B6MA 1K3LA 4PNGA 2GT6A 4KSOA 1XPVA 3R3EA 4GTUA 1WPIA 4K1FA 2DJKA 2VUPA 3EPTA 2V6OA 3P8WA 1Z6MA 5DQSA 1GUHA 1OC3A 3HD5A 4HJ2A 4ZILA 2C1YA 3F6DA 3LYPA 3TKSE 3HY2A 4P3YB 1M3JA 1O8WA 3CTGA 5IMDA 4RQRA 5J9BA 3IR4A 2X64A 4I8BA 1BJXA 5FT3A 1Z3EA 3WT2A 3FY7A 3ZVJD 1JLWA 1TOFA 1SKRB 3TKSA 2DIYA 3KTBA 4DSSA 3HJOA 3P90A 5KOWA 1QMVA 2KHPA 1QK8A 4PUFC 1K0NA 3D0ZA 1B9XC 1QXHA 12GSA 3KD0A 5HFIA 1NHOA 2YOIA 2FA4A 3A2WA 2GTUA 1K0CA 3FW2A 4BVYA 1V40A 1HYUA 2KP1A 3APQA 2JACA 3KH9A 3RDWA 4EE0A 1B4PA 2OACA 2GQKA 5IMVA 3SBCA 5EVOA 4EDYA 3ZIVA 3IDVA 5IMCA 4MZCA 5G5FA 2H74A 3BCIA 3Q6OA 1K3YA 4IP1A 2F8FA 3F3QA 19GSA 1O6JA 1J9BA 3PGTA 5ELGA 2FWHA 4ZL7A 2NDOA 2AV4A 1XWCA 4BIKA 2X4AA 1IYHA 3R2QA 2K8VA 3LQ7A 3GFKA 5H5RA 3WGDA 3E0UA 5DBQA 2GQLA 3HYPA 3KCMA 3D4TA 5EPFA 3JCML 4JRRA 2JADA 1BEDA 2WDUA 1ACVA 4N10A 2K18A 1GTUA 6GSUA 1WP0A 2H0HA 1SJZA 1PMTA 6GSYA 3UBKA 5GAND 2LS5A 2YZUA 2CAIA 2LRCA 4LLRA 4I2UA 4EO3A 3W8SA 1ON4A 3GKKA 4K0NA 4OFMA 4MDCA 2HZEB 4K8MA 4Q5NA 2KLXA 4ICYA 2AJQB 3Q18A 5CO3A 1XOBA 4HZ2A 4YH2A 2G0FA 4FYCA 1YF1A 4F0BA 4IVFA 4XS4B 2V32A 3H4KA 3UVTA 3V1WA 1GSYA 3O6TA 1R26A 2VCZA 3GN3A 3E9JB 1E2YA 1F3AA 3HVXA 4Q5FA 2RUFA 2HSMA 2R0CA 2MMAA 2P0GA 2VOCA 3D6IA 4HQSA 1X0RA 1XW5A 3IOSA 2NBSA 4X1UA 4FO5A 2M72A 5E4WA 4O7HA 3ZZXA 6GSSA 4ID0A 1A2LA 1ZYQB 2IMFA 2ON7A 4LMWA 5D8IA 4ZBAA 4EVMA 4TR4A 2K9FA 2N5FA 2FY6A 3HKRA 4TR1B 2B1LA 3N9JA 1GSEA 1LU4A 4YQMA 1XWGA 2XBIA 6GSTA 2PERA 1A23A 3GSSA 2YWMA 2HI7A 3LXZA 5IMFA 5DAKA 5IO0A 3GIXA 1SK0A 1VF1A 2PWJA 1SYRA 1OE8A 2LEGA 4YAPA 1I5GA 1OKDA 3HA9A 5B8AA 4BWSA 2H75A 4Z2UA 5LCZA 6GSVA 1SK2A 1DE1A 2H1BA 1W89A 4Q5RA 4AF2A 1ZMAA 2PMTA 4CW9A 9GSSA 3WGXA 5ECLB 3TJBA 1FOHA 4YQUA 1HNCA 1XW9A 2G2QA 3C1RA 2VL2C 5HR3A 4HJMA 17GSA 2CVKA 4O5RA 5DALB 2CZ2A 1HD2A 3FK8A 2PGTA 1U87A 1NM3A 5ECHB 2H01A 1XIYA 4DSQA 2TRXA 2HYXA 2OE3A 4XHMA 1EP8A 5D93A 4JE1A 1FOVA 4NAXA 2A4HA 1OC9A 1XVQA 1XWKA 4AJ8A 2AYTA 2J9HA 1G6WA 5ID2B 2RUEA 1X9MB 1YZXA 2VCWA 4HDEA 4L5LA 16GSA 4TW5A 1UN2A 2QC7A 1X9SB 4G9HA 1GSFA 1MTCA 2C0EA 5ECPB 1O7UA 1Z7RA 2NVLA 4OFNA 3IK9A 3IPZA
chains in the Genus database with same CATH topology
1R5AA 1A2JA 3ZYWA 1ZGNA 3IC4A 1F3BA 4BL7B 2C0DA 4EC0A 3L78A 4JU5A 1CQGA 4KF9A 4IP6A 4XS6A 1XXUA 2GSRA 2OE0A 4XRDA 3TKSC 3VWVA 1SL1B 4GWRA 3ZLPA 1A2MA 5HR1A 5D96A 5DVBA 1GLPA 3EMXA 1XBSA 1Y6EA 1PA3A 4FIWA 4NXIA 4MPFA 4KH7A 4BPYA 5B6NA 3VI5A 4ZB9A 1YJ6A 2R5GA 3QOUA 5D9WA 22GSA 1GUKA 5F8BA 4V1Ag 8GSSA 4X43A 2H19A 3U5RE 2VLVA 1B48A 2FLSA 2EIRA 4X4JA 4PUAA 1FB0A 1C72A 1JLVA 2KOKA 3EINA 4ZL9A 2VLTA 3FZ9A 2CT6A 3GV1A 1K0AA 6GSWA 2C0GA 1EEMA 4IQ1A 4F2IA 3QMXA 2IMKA 2V6KA 2OE1A 1EGOA 3ZMLA 2PVOC 1F37A 2IFQA 3ED3A 5KEJA 1JZOA 5J4UA 4MZBA 5IM9A 2BMXA 1TXXA 2VCXA 1YEXA 4MLYA 1SJIA 2IL3A 2GSSA 4BA7A 1WMJA 2F9SA 5G1LA 2R3XA 1DE2A 3QFBC 5KN0A 1V57A 4GQFA 2JZSA 3OR5A 3FKFA 5FWGA 1ILOA 2HNLA 3DKSA 2FA8A 2IJYA 4WBJA 5IO2A 1AW9A 2GSTA 3RHCA 2WJUA 2IMEA 3FZAA 4G2EA 2R2JA 1TRSA 4EKZA 2H6ZA 1AXDA 3CRUA 3EYTA 3US3A 3ERWA 2GGTA 2YWNA 5JCUA 4A5PA 3BJ5A 4YQVA 4HS1A 4F9ZA 5D73A 2X49A 3DYRA 3H1NA 3M3MA 1GSDA 4GRFA 2XPEA 3VFIA 5B6MA 4NHWA 2H6YA 2V41A 4V2LA 3RPPA 5GSSA 4ACSA 1PL2A 1SK1A 2H30A 4POLA 1K0OA 2DJ1A 3IV4A 2C0FA 1ERVA 4MK3A 2XHFA 5EY6A 2IN3A 4HU7A 4HUAA 4CHSA 4BVXB 2C3NA 2RM6A 3BCKA 3VPQA 2CAQA 2XBQA 2FWGA 1A24A 3DMLA 4TR3A 5DQYA 3TB2A 1MD3A 1EEJA 3CSJA 4ISDA 4JR4A 4DSRA 3LW9A 4KW6A 4I97A 4LL4B 2OKAA 1TI3A 3CSHA 2DJ0A 3CRTA 2VD1A 1SKSB 3L0HA 2LQOA 3ERFA 4KB3A 2YNXA 4EF0A 4KX4A 4WR4A 3RAZA 2NPBA 3DD3A 4ECIA 3PINA 3KZQA 4I2TA 3M1GA 5IPGA 3GSTA 1GSQA 4LA1A 4MJEA 2MBTA 1ZZYA 2ON5A 4QL7A 3G7IA 4TR0A 5JWQB 5HFGA 4L8EA 4D73A 2VIMA 1PX7A 5DJLA 1LBKA 3VURA 2AHEA 7GSSA 5G5EA 4TVEA 5IPHA 4EUYA 4EL1A 1ZYNA 1OE7A 1VF2A 4AJ7A 3FRCA 2FHEA 4IJ3A 3F3RA 2DJJA 4L5OA 2OA7A 3KJYA 2OBKA 3DRNA 5KN1A 4MJCA 3IA1A 4N0ZA 2L6CA 2H72A 2JU5A 2N5AA 1GNWA 4DVCA 5A4WA 2R0PA 1T4ZA 2R0GA 2C3TA 4IELA 4K7NA 3ZL5A 3I43A 4WETA 4E8HA 3KH7A 4ZBBA 2PUKC 3CYNA 5ECKB 14GSA 2WFCA 3GH6A 1MD4A 2P31A 1J08A 3KGKA 5IOWA 3TKRA 3FR6A 3GRXA 5IIZA 1XZOA 4ECCA 1M99A 4ULXA 1TK0B 1TK5B 4KDYA 4K0GA 1GSSA 1HQOA 3IK7A 2VL3A 1O81A 3HDCA 1SL0B 2HSHA 4XCSA 3S9FA 1URMA 2QGVA 2L4CA 4PQ1A 2QSIA 3GUSA 1PL1A 3UVHA 1A8YA 4WF5A 1RK4A 1OVNA 2RM5A 3LWAA 1X9WB 3G9BA 2YP6A 5EL8A 1V9WA 3GKNA 4WXTA 3IC8A 1ZYPA 3IRAA 5DCHA 4PX1A 3HZ8A 1J0FA 2GSQA 1RW1A 5ELAA 2ZNMA 4YKGA 3QAWA 2FWFA 4K9ZA 2FGXA 1WJKA 3PPUA 5CP1A 3I6AA 20GSA 1S3DA 5LNKe 1VF3A 2O7KA 3TDGA 4YAVA 5J5NA 13GSA 3FEUA 1EOGA 3KMNA 4ZXGA 2ES7A 5ECOB 3DVXA 3IAM2 1GTBA 1TI1A 2XC2A 2X99A 3TGZA 2DJ2A 2F51A 1PN0A 4RI7A 5HQPA 1AC1A 1SKWB 5D9VA 3QD9A 2F8AA 4KCAA 4K5RA 4Z2TA 1A0FA 2C3QA 2H1AA 3EWLA 1O85A 3GTUB 2GZPA 1BQ7A 1N8JA 4ML1A 3ZFLA 5JCGA 5E59A 2WB9A 4ZIJA 2E0QA 2QA1A 4FH8A 3WD6A 5IMAA 3D4MA 1TJDA 2H70A 5A4VA 5B8BA 2WCIA 4Z7XA 4NV2A 2O89A 3H8QA 1YEPA 1TDIA 3TJFA 5COHA 1FAAA 4IBPA 4TXOA 5JCWA 3DIEA 1WE0A 4IW9A 5BMUA 2EIOA 4L0UA 2I3YA 2EIQA 10GSA 3IE3A 1KBNA 1Z9HA 3MYDA 2MZCA 4AGSA 1ERTA 1G6YA 2P5QA 1W4VA 2R6KA 3I9V2 2B1KA 3WGEA 4K5SA 1XFLA 4K7IA 1TU7A 1WWJA 4OWYA 4GSSA 3A5IA 4HU9A 3APOA 5KN2A 4DSSB 2MYGA 3AY8A 3P2AA 2O8VB 2LRNA 2VCVA 3FHKA 3VWUA 3CTFA 1YQ1A 4BVYB 4ZBDA 1G7OA 4ZL8A 2I1UA 3EVIA 1GP1A 4EXJA 4XIHA 4KUNA 1TTZA 2L4QA 2QKEA 3G7YA 2N5BA 1SL2B 4USSA 3ME7A 3QAGA 2DMMA 3KXOA 4RI6A 3M9KA 1EV4A 3M8NA 4IS0A 4N11A 1R5PA 4MF5A 3D22A 3DXBA 3O76A 2M80A 4J56E 2YANA 2YCDA 4OCFA 1G7EA 3I69A 5DJMA 4WR5A 2DKIA 1SENA 5G2ZA 4JR6A 1PQNA 2HLSA 1ABAA 4K6XA 2YV7A 1M2AA 5KN3A 3PR8A 1BG5A 3CXGA 1ST9A 3WYWA 2L5OA 1JZWA 4GCIA 4TN8A 4KAEA 1DUGA 1GL8A 4MF7A 3UARA 3BD2A 2V1MA 3L9SA 4MJBA 4RQXA 3W8JA 4TOPA 2FCHA 5F05A 5C00A 2FWEA 4FYUA 2HSYA 1U6TA 2GLRA 1TP9A 5HR0A 3ZREA 3NOFA 5ABRA 2TRCP 1JHBA 11GSA 5F0GA 5HFKA 1ML6A 3Q74A 1TKDB 1XVWA 3VK9A 2HT9A 3A5WA 1DSBA 3TJKA 1GRXA 1V58A 3MDKA 5G1KA 2WULA 4ZB8A 3IHQA 2LSTA 2YZHA 5G31A 2GQMA 4MH2A 2VAFA 4H86A 3D5JA 1AAZA 4POKA 4NMUA 2KP2A 2JL4A 4V2MA 5DCGA 4PGTA 3MAKA 1ZL9A 1ZYEA 4IGJA 1E6BA 1GTIA 1JZDA 1K0DA 3L9UA 3HZ4A 5ECRB 2WGRA 3GH9A 2BJXA 4CY6A 1YKCA 3GX8A 2HZEA 4O5UA 1TK8B 1N2AA 2CX4A 1HNBA 2OBIA 5B7CA 1EV9A 4TRXA 1AIUA 2B3SA 2IIYA 2MMZA 4XS4A 1XCCA 2CVDA 3GNJA 4G10A 2K6VA 2A2RA 4PNFA 5CYYA 1OC8A 5DAKB 3SWLA 3WT1A 3TRQA 2L57A 1MDIA 4ZB6A 1S3CA 3GKMA 2O87A 3VWWA 5F06A 3G7JA 1K0BA 4MPGA 1FVJA 2BTOT 1NSWA 4MABA 2H6XA 4JEDA 3QPMA 1NW2A 2DLXA 1SYXA 4HQZA 5IOXA 1S3AA 2CV4A 4ILFA 1FHEA 5ECNB 5CNWA 3MIXA 4TR1A 4KDUA 3J7Yb 3A2XA 3LSZA 4MCUA 4WBRD 2D2ZA 4PXOA 3F0IA 3C7MA 4Z2RA 4KA0A 2GVPA 1EZKA 1PGTA 3GA4A 1M9AA 4HI7A 5C04A 3QR6A 1FW1A 1OC9B 3F63A 4OFTA 2H1DA 4O92A 2WRTA 3ZFBA 4MNNA 5LD0A 3U6VA 2RLIA 3F8UA 2LJKA 5AISA 1FB6A 2E2GA 1JZRA 5ECQB 4OMVA 4OD7A 5IMZA 3ZTLA 1Z6NA 3QFAC 2H71A 1AQVA 5L71A 1GH2A 3GHAA 1AQXA 2B5YA 3C71A 1TW9A 2VL9A 4KGIA 1XWAA 1GSUA 3C1SA 2YJHA 1U3IA 3J7Yk 1KTEA 2IWTA 1F9MA 2FUG2 5DALA 3TJJA 2CX3A 1YY7A 1MEKA 2FD3A 3KP9A 3LGCA 4O32A 2NTOA 4WEYA 3A2VA 1LJRA 3VI7A 1T4YA 1SJ6A 2DIZA 1YF0A 2TIRA 1A0RP 2R4VA 2X8GA 3D21A 1QGVA 4E8EA 3K8NA 2P5RA 1MDJA 4JZQA 5ID2A 5HR2A 2HRKA 4L0WA 2EC4A 1NHYA 18GSA 3EC3A 3LYKA 1T3BA 4NPBA 2VM2A 4OO4A 4ECBA 3CBUA 4LL1B 3QAVA 2H73A 1X5DA 3W6GA 2XPDA 4TXVA 2DJ3A 2WZ9A 3M9JA 5J41A 1X5CA 5CRGA 4BL7A 5H5SA 3L9VA 2YV9A 2ZUPA 4HOJA 2CQ9A 1M7TA 2VO4A 2JZTA 5AIXA 1PD21 3C8EA 2LJAA 2L6DA 2LV3A 4NWYA 4YKFA 2IFQB 1K0MA 3NIVA 4MF6A 1Z7PA 4EIQA 3UMAA 2JSZA 2DMLA 1BYEA 1M9BA 2H76A 2HRNA 4EIPA 3UAPA 5ENUA 5CRHA 3P7XA 5J3RA 1ZCPA 4PQIA 2JZRA 2CVBA 3HHVA 3HJMA 3VWXA 1VGLA 3FYGA 4MP4A 2LJRA 1PKZA 5G30A 1H4OA 2WS2A 4MH3A 3UEMA 1PKWA 1YDKA 3ZIJA 3E3EA 3CMIA 1Q4JA 1EGRA 5ECIB 2LKUA 2PN8A 4IQAA 4OO5A 1A8LA 3GYKA 2HE3A 2LTKA 3MWHA 2VCTA 4GQCA 4KCEA 1OAZA 4LMVA 4KDXA 2E7PA 3KEBA 2HRAA 3H79A 2LQQA 1T00A 1OKTA 2CA8A 2GZYA 3BOAA 1EP7A 4G0KA 5D9TA 1O8XA 3TRXA 3DEXA 5IQYA 1H75A 3UL3A 2LNTA 1GTAA 4GSTA 3LORA 4MJAA 3ZRDA 2B7KA 1ZOFA 4GXZA 1GULA 2HZFA 3M0FA 1XW6A 2HXKA 4V1Ap 1SU9A 2PVQA 2B5EA 4G0LA 2GS3A 3EU4A 4QL9A 4DEJA 5J9CA 3APSA 2VD0A 1KNGA 4K2XA 3UOMA 2B5XA 4KSMA 3HVSA 2AUVA 4XTSA 2HRFA 3FR9A 2LUSA 3C73A 5BRTA 1THOA 4G19A 5ECMB 1UA5A 1GUMA 2H0IA 2KUCA 5GAPD 1QQ2A 4Q5QA 5DDLA 3TCOA 4IKHA 4ECJA 3F4SA 3TOUA 4F82A 3HJPA 1HNAA 3RHBA 4NV5A 1DBYA 5JWRB 2F3MA 4HEA2 3DVWA 1Y25A 2DBCA 5GZZB 2A4VA 3ZITA 5GSTA 1PRXA 2O85A 3A3TA 1SD9A 1B9YC 2YWIA 1BAYA 1VF4A 1QUWA 2MMNA 3IAS2 2DKHA 2YN1A 2E2MA 1GNEA 3FR3A 3L4NA 3LJRA 1PSQA 2AAWA 5JWOB 3LG6A 3HCZA 1O73A 4BVXA 4D73B 4N30A 5KOXA 3NZNA 1TU8A 4KE3A 1FG4A 1CQHA 2YPMA 3ME8A 1T8EB 2C80A 3ISOA 4GF0A 4MMMA 3GX0A 3LFLA 1OYJA 2REMA 2LRTA 3FZ5A 3IHGA 1QFNA 2A2PA 1M0UA 1KEBA 2UZ8A 2IPAA 4HZ4A 1U3AA 1WIKA 1PX6A 4XS1A 3UIWA 4X0XA 1UVZA 1GLQA 3TKPA 2OADA 2H66A 1XWBA 5AN1A 2K8SA 2RIIA 2V2GA 3CSIA 2DC5A 2MMOA 4PQHA 3VLNA 2I9HA 1X5EA 4NHZA 4PURA 5CRDA 4IHUA 3KMOA 4KNDA 2YWOA 4CY8A 1M2BA 3EURA 2VCQA 4MA9A 3QCPA 1M2DA 2VLUA 4WKWA 3LXTA 2PBJA 1TRUA 5H5QA 1F2EA 3KIJA 3LEFA 4XRAA 1TRWA 4FYBA 4I5QA 4N0VA 4PTSA 1IYIA 2HFDA 4J57E 3QDNA 1R4WA 4WF4A 1YKAA 3HVVA 3TRPA 4G0IA 1GWCA 1I9DA 2DSAA 3TOTA 3KTLA 1PN9A 2H0GA 1G0TA 4MZWA 1XOAA 2L59A 2CZ3A 3EMPA 2ALBA 4F0CA 1B4QA 4POBA 5CAXA 3KM6A 3GL5A 1V2AA 6GSXA 2M46A 1V98A 4K7OA 1FO5A 5CREA 1T1VA 3ZMKA 3UJ1A 2I4AA 2C8UA 5AIVA 5ECSA 1WRYA 3O3TA 4FQUA 1Z5YE 3TJGA 2R37A 1USBA 5FHIA 3GL3A 3F4TA 3TUEA 1T7PB 1WOUA 4J2FA 3PH9A 2PPTA 4BWQA 1ERWA 4ML6A 3GKXA 4RUVA 1K3OA 2Z9SA 5A5KA 3BBYA 3VPTA 1R7HA 2QA2A 5A4UA 3IBHA 1AUCA 5AGYA 1Q98A 2LNSA 1RQMA 2H8LA 2B7JA 1EOHA 4V2NA 1SD8A 3RBTA 2OJLA 4I6XA 2PU9C 3ZVJA 4IJIA 2GT5A 3MNGA 1VRSD 2IMDA 2MBSA 3HXSA 4GLTA 4IN0A 2GZZA 3GURA 3UBLA 4GSNA 2I81A 2VM1A 4QQ7A 3IXRA 2X8CA 3F9UA 2L5LA 3DWVA 4TXOB 1AQWA 1ERUA 1F6MC 2FNOA 1B8XA 3H93A 4CDOA 2YJ7A 2J23A 3F4RA 2AB6A 1BX9A 4TKYA 4F03A 1JFUA 4POMA 2VL2A 4AJ6A 2A2SA 4OCEA 2IMIA 1EWXA 2GDRA 3EU3A 3Q19A 3RPNA 3F6FA 1FVKA 3TKQA 3FMWA 1THXA 4EDZA 1UC7A 2C4JA 3GTUA 3FZ4A 3EE2A 5INYA 2JSYA 3KP8A 2H1GA 1TRVA 4K2DA 5CRWA 4JBBA 3DGQA 3N5OA 2X8HA 3MSZA 2ZCTA 3GMFA 1U88A 1MDKA 5F07A 3ERGA 5D9XA 4O5QA 2B6MA 1K3LA 4PNGA 2GT6A 4KSOA 1XPVA 3R3EA 4GTUA 1WPIA 4K1FA 2DJKA 2VUPA 3EPTA 2V6OA 3P8WA 1Z6MA 5DQSA 1GUHA 1OC3A 3HD5A 4HJ2A 4ZILA 2C1YA 3F6DA 3LYPA 3TKSE 3HY2A 4P3YB 1O8WA 3CTGA 5IMDA 4RQRA 5J9BA 3IR4A 2X64A 4I8BA 1BJXA 5FT3A 1Z3EA 3WT2A 3FY7A 3ZVJD 1JLWA 1TOFA 1SKRB 3TKSA 2DIYA 3KTBA 4DSSA 3HJOA 3P90A 5KOWA 1QMVA 2KHPA 1QK8A 4PUFC 1K0NA 3D0ZA 1B9XC 1QXHA 12GSA 3KD0A 5HFIA 1NHOA 2YOIA 2FA4A 3A2WA 2GTUA 1K0CA 3FW2A 4BVYA 1V40A 1HYUA 2KP1A 3APQA 2JACA 3KH9A 3RDWA 4EE0A 1B4PA 2OACA 2GQKA 5IMVA 3SBCA 5EVOA 4EDYA 3ZIVA 3IDVA 5IMCA 4MZCA 5G5FA 2H74A 3BCIA 3Q6OA 1K3YA 4IP1A 2F8FA 3F3QA 19GSA 1O6JA 1J9BA 3PGTA 5ELGA 2FWHA 4ZL7A 2NDOA 2AV4A 1XWCA 2X4AA 1IYHA 3R2QA 2K8VA 3LQ7A 3GFKA 5H5RA 3WGDA 3E0UA 5DBQA 2GQLA 3HYPA 3KCMA 3D4TA 5EPFA 3JCML 4JRRA 2JADA 1BEDA 2WDUA 1ACVA 4N10A 2K18A 1GTUA 6GSUA 1WP0A 2H0HA 1SJZA 1PMTA 6GSYA 3UBKA 5GAND 2LS5A 2YZUA 2CAIA 2LRCA 4LLRA 4I2UA 4EO3A 3W8SA 1ON4A 3GKKA 4K0NA 4OFMA 4MDCA 2HZEB 4K8MA 4Q5NA 2KLXA 4ICYA 2AJQB 3Q18A 5CO3A 1XOBA 4HZ2A 4YH2A 2G0FA 4FYCA 1YF1A 4F0BA 4IVFA 4XS4B 2V32A 3H4KA 3UVTA 3V1WA 1GSYA 3O6TA 1R26A 2VCZA 3GN3A 3E9JB 1E2YA 1F3AA 3HVXA 4Q5FA 2RUFA 2HSMA 2R0CA 2MMAA 2P0GA 2VOCA 3D6IA 4HQSA 1X0RA 1XW5A 3IOSA 2NBSA 4X1UA 4FO5A 2M72A 5E4WA 4O7HA 3ZZXA 6GSSA 4ID0A 1A2LA 1ZYQB 2IMFA 2ON7A 4LMWA 5D8IA 4ZBAA 4EVMA 4TR4A 2K9FA 2N5FA 2FY6A 3HKRA 4TR1B 2B1LA 3N9JA 1GSEA 1LU4A 4YQMA 1XWGA 2XBIA 6GSTA 2PERA 1A23A 3GSSA 2YWMA 2HI7A 3LXZA 5IMFA 5DAKA 5IO0A 3GIXA 1SK0A 1VF1A 2PWJA 1SYRA 1OE8A 2LEGA 4YAPA 1I5GA 1OKDA 3HA9A 5B8AA 4BWSA 2H75A 4Z2UA 5LCZA 6GSVA 1SK2A 1DE1A 2H1BA 1W89A 4Q5RA 4AF2A 1ZMAA 2PMTA 4CW9A 9GSSA 3WGXA 5ECLB 3TJBA 1FOHA 4YQUA 1HNCA 1XW9A 2G2QA 3C1RA 2VL2C 5HR3A 4HJMA 17GSA 2CVKA 4O5RA 5DALB 2CZ2A 1HD2A 3FK8A 2PGTA 1U87A 1NM3A 5ECHB 2H01A 1XIYA 4DSQA 2TRXA 2HYXA 2OE3A 4XHMA 1EP8A 5D93A 4JE1A 1FOVA 4NAXA 2A4HA 1OC9A 1XVQA 1XWKA 4AJ8A 2AYTA 2J9HA 1G6WA 5ID2B 2RUEA 1X9MB 1YZXA 2VCWA 4HDEA 4L5LA 16GSA 4TW5A 1UN2A 2QC7A 1X9SB 4G9HA 1GSFA 1MTCA 2C0EA 5ECPB 1O7UA 1Z7RA 2NVLA 4OFNA 3IK9A 3IPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5A A;  1A2J A;  3ZYW A;  1ZGN A;  3IC4 A;  1F3B A;  2C0D A;  4EC0 A;  3L78 A;  4JU5 A;  1CQG A;  4IP6 A;  4XS6 A;  1XXU A;  2GSR A;  2OE0 A;  4XRD A;  3TKS C;  3VWV A;  1SL1 B;  4GWR A;  3ZLP A;  1A2M A;  5HR1 A;  5D96 A;  5DVB A;  1GLP A;  3EMX A;  1XBS A;  1Y6E A;  1PA3 A;  4FIW A;  4NXI A;  4MPF A;  4KH7 A;  4BPY A;  5B6N A;  3VI5 A;  4ZB9 A;  1YJ6 A;  2R5G A;  3QOU A;  5D9W A;  22GS A;  1GUK A;  5F8B A;  4V1A g;  8GSS A;  4X43 A;  2H19 A;  3U5R E;  2VLV A;  1B48 A;  2FLS A;  2EIR A;  4PUA A;  1FB0 A;  1C72 A;  1JLV A;  2KOK A;  3EIN A;  4ZL9 A;  2VLT A;  3FZ9 A;  2CT6 A;  3GV1 A;  1K0A A;  6GSW A;  2C0G A;  1EEM A;  4IQ1 A;  4F2I A;  3QMX A;  2IMK A;  2V6K A;  2OE1 A;  1EGO A;  3ZML A;  2PVO C;  1F37 A;  2IFQ A;  3ED3 A;  5KEJ A;  1JZO A;  5J4U A;  4MZB A;  5IM9 A;  2BMX A;  1TXX A;  2VCX A;  1YEX A;  4MLY A;  1SJI A;  2IL3 A;  2GSS A;  4BA7 A;  1WMJ A;  2F9S A;  5G1L A;  2R3X A;  1DE2 A;  3QFB C;  5KN0 A;  1V57 A;  4GQF A;  2JZS A;  3OR5 A;  3FKF A;  5FWG A;  1ILO A;  2HNL A;  3DKS A;  2FA8 A;  2IJY A;  4WBJ A;  5IO2 A;  1AW9 A;  2GST A;  3RHC A;  2WJU A;  2IME A;  3FZA A;  4G2E A;  2R2J A;  1TRS A;  4EKZ A;  2H6Z A;  1AXD A;  3CRU A;  3EYT A;  3US3 A;  3ERW A;  2GGT A;  2YWN A;  5JCU A;  3BJ5 A;  4YQV A;  4HS1 A;  4F9Z A;  5D73 A;  3DYR A;  3H1N A;  3M3M A;  1GSD A;  4GRF A;  2XPE A;  3VFI A;  5B6M A;  4NHW A;  2H6Y A;  2V41 A;  4V2L A;  3RPP A;  5GSS A;  4ACS A;  1PL2 A;  1SK1 A;  2H30 A;  4POL A;  1K0O A;  2DJ1 A;  3IV4 A;  2C0F A;  1ERV A;  4MK3 A;  2XHF A;  5EY6 A;  2IN3 A;  4HU7 A;  4HUA A;  4CHS A;  2C3N A;  2RM6 A;  3BCK A;  3VPQ A;  2CAQ A;  2XBQ A;  2FWG A;  1A24 A;  3DML A;  4TR3 A;  5DQY A;  3TB2 A;  1MD3 A;  1EEJ A;  3CSJ A;  4ISD A;  4JR4 A;  4DSR A;  4KW6 A;  4I97 A;  4LL4 B;  2OKA A;  1TI3 A;  3CSH A;  2DJ0 A;  3CRT A;  2VD1 A;  1SKS B;  3L0H A;  2LQO A;  3ERF A;  4KB3 A;  2YNX A;  4EF0 A;  4KX4 A;  4WR4 A;  3RAZ A;  2NPB A;  3DD3 A;  4ECI A;  3PIN A;  3KZQ A;  4I2T A;  3M1G A;  5IPG A;  3GST A;  1GSQ A;  4LA1 A;  4MJE A;  2MBT A;  1ZZY A;  2ON5 A;  4QL7 A;  3G7I A;  4TR0 A;  5JWQ B;  5HFG A;  4L8E A;  4D73 A;  2VIM A;  1PX7 A;  5DJL A;  1LBK A;  3VUR A;  2AHE A;  7GSS A;  5G5E A;  4TVE A;  5IPH A;  4EUY A;  4EL1 A;  4AJ7 A;  1OE7 A;  1VF2 A;  3FRC A;  2FHE A;  4IJ3 A;  3F3R A;  2DJJ A;  4L5O A;  2OA7 A;  3KJY A;  2OBK A;  3DRN A;  5KN1 A;  4MJC A;  3IA1 A;  4N0Z A;  2L6C A;  2H72 A;  2JU5 A;  2N5A A;  1GNW A;  4DVC A;  5A4W A;  1T4Z A;  2C3T A;  4IEL A;  4K7N A;  3ZL5 A;  3I43 A;  4WET A;  4E8H A;  3KH7 A;  4ZBB A;  2PUK C;  3CYN A;  5ECK B;  14GS A;  2WFC A;  3GH6 A;  1MD4 A;  2P31 A;  1J08 A;  3KGK A;  5IOW A;  3TKR A;  3FR6 A;  3GRX A;  5IIZ A;  1XZO A;  4ECC A;  1M99 A;  4ULX A;  1TK0 B;  1TK5 B;  4KDY A;  4K0G A;  1GSS A;  1HQO A;  3IK7 A;  2VL3 A;  1O81 A;  3HDC A;  1SL0 B;  2HSH A;  4XCS A;  3S9F A;  1URM A;  2QGV A;  2L4C A;  4PQ1 A;  2QSI A;  3GUS A;  1PL1 A;  3UVH A;  1A8Y A;  4WF5 A;  1RK4 A;  1OVN A;  2RM5 A;  3LWA A;  1X9W B;  3G9B A;  2YP6 A;  5EL8 A;  1V9W A;  3GKN A;  4WXT A;  5DCH A;  3IRA A;  4PX1 A;  3HZ8 A;  1J0F A;  2GSQ A;  1RW1 A;  5ELA A;  2ZNM A;  3QAW A;  2FWF A;  4K9Z A;  2FGX A;  1WJK A;  5CP1 A;  3I6A A;  20GS A;  1S3D A;  5LNK e;  1VF3 A;  2O7K A;  3TDG A;  4YAV A;  5J5N A;  13GS A;  3FEU A;  1EOG A;  3KMN A;  4ZXG A;  2ES7 A;  5ECO B;  3DVX A;  3IAM 2;  1GTB A;  1TI1 A;  2XC2 A;  2X99 A;  3TGZ A;  2DJ2 A;  2F51 A;  4RI7 A;  5HQP A;  1AC1 A;  1SKW B;  5D9V A;  3QD9 A;  2F8A A;  4KCA A;  1A0F A;  2C3Q A;  2H1A A;  3EWL A;  1O85 A;  3GTU B;  2GZP A;  1BQ7 A;  1N8J A;  4ML1 A;  3ZFL A;  5JCG A;  5E59 A;  2WB9 A;  4ZIJ A;  2E0Q A;  4FH8 A;  3WD6 A;  5IMA A;  3D4M A;  1TJD A;  2H70 A;  5A4V A;  5B8B A;  2WCI A;  4Z7X A;  4NV2 A;  2O89 A;  3H8Q A;  1YEP A;  1TDI A;  3TJF A;  5COH A;  1FAA A;  4IBP A;  4TXO A;  5JCW A;  3DIE A;  1WE0 A;  4IW9 A;  2EIO A;  4L0U A;  2I3Y A;  2EIQ A;  10GS A;  3IE3 A;  1KBN A;  1Z9H A;  2MZC A;  4AGS A;  1ERT A;  1G6Y A;  2P5Q A;  1W4V A;  2R6K A;  3I9V 2;  2B1K A;  3WGE A;  1XFL A;  4K7I A;  1TU7 A;  1WWJ A;  4OWY A;  4GSS A;  4HU9 A;  3APO A;  5KN2 A;  4DSS B;  2MYG A;  3AY8 A;  3P2A A;  2O8V B;  2LRN A;  2VCV A;  3FHK A;  3VWU A;  3CTF A;  1YQ1 A;  4ZBD A;  1G7O A;  4ZL8 A;  2I1U A;  3EVI A;  1GP1 A;  4EXJ A;  4XIH A;  4KUN A;  1TTZ A;  2L4Q A;  2QKE A;  3G7Y A;  2N5B A;  1SL2 B;  3ME7 A;  3QAG A;  2DMM A;  3KXO A;  4RI6 A;  3M9K A;  1EV4 A;  3M8N A;  4IS0 A;  4N11 A;  1R5P A;  4MF5 A;  3D22 A;  3DXB A;  3O76 A;  2M80 A;  4J56 E;  2YAN A;  2YCD A;  4OCF A;  1G7E A;  3I69 A;  5DJM A;  4WR5 A;  1SEN A;  5G2Z A;  4JR6 A;  1PQN A;  2HLS A;  1ABA A;  4K6X A;  2YV7 A;  1M2A A;  5KN3 A;  3PR8 A;  1BG5 A;  3CXG A;  1ST9 A;  3WYW A;  2L5O A;  1JZW A;  4GCI A;  4TN8 A;  4KAE A;  1DUG A;  1GL8 A;  4MF7 A;  3UAR A;  3BD2 A;  2V1M A;  3L9S A;  4MJB A;  4RQX A;  3W8J A;  4TOP A;  2FCH A;  5F05 A;  5C00 A;  2FWE A;  4FYU A;  2HSY A;  1U6T A;  2GLR A;  1TP9 A;  5HR0 A;  3ZRE A;  3NOF A;  5ABR A;  2TRC P;  1JHB A;  11GS A;  5F0G A;  5HFK A;  1ML6 A;  3Q74 A;  1TKD B;  1XVW A;  3VK9 A;  2HT9 A;  3A5W A;  1DSB A;  3TJK A;  1GRX A;  1V58 A;  3MDK A;  5G1K A;  2WUL A;  4ZB8 A;  3IHQ A;  2LST A;  2YZH A;  5G31 A;  2GQM A;  4MH2 A;  2VAF A;  4H86 A;  3D5J A;  1AAZ A;  4POK A;  4NMU A;  2KP2 A;  2JL4 A;  4V2M A;  5DCG A;  4PGT A;  3MAK A;  1ZL9 A;  1ZYE A;  4IGJ A;  1E6B A;  1GTI A;  1JZD A;  1K0D A;  3L9U A;  3HZ4 A;  5ECR B;  2WGR A;  3GH9 A;  2BJX A;  1YKC A;  3GX8 A;  2HZE A;  1TK8 B;  1N2A A;  2CX4 A;  1HNB A;  2OBI A;  5B7C A;  1EV9 A;  4TRX A;  1AIU A;  2B3S A;  2IIY A;  2MMZ A;  4XS4 A;  1XCC A;  2CVD A;  3GNJ A;  4G10 A;  2K6V A;  2A2R A;  4PNF A;  5CYY A;  1OC8 A;  5DAK B;  3SWL A;  3WT1 A;  3TRQ A;  2L57 A;  1MDI A;  4ZB6 A;  1S3C A;  3GKM A;  2O87 A;  3VWW A;  5F06 A;  3G7J A;  1K0B A;  4MPG A;  1FVJ A;  2BTO T;  1NSW A;  4MAB A;  2H6X A;  4JED A;  3QPM A;  1NW2 A;  2DLX A;  1SYX A;  4HQZ A;  5IOX A;  1S3A A;  2CV4 A;  4ILF A;  1FHE A;  5ECN B;  5CNW A;  4TR1 A;  4KDU A;  3J7Y b;  3A2X A;  3LSZ A;  4MCU A;  4WBR D;  2D2Z A;  4PXO A;  3F0I A;  3C7M A;  4KA0 A;  2GVP A;  1EZK A;  1PGT A;  3GA4 A;  1M9A A;  4HI7 A;  5C04 A;  3QR6 A;  1FW1 A;  1OC9 B;  3F63 A;  4OFT A;  2H1D A;  4O92 A;  2WRT A;  3ZFB A;  3U6V A;  5LD0 A;  2RLI A;  3F8U A;  2LJK A;  5AIS A;  1FB6 A;  2E2G A;  1JZR A;  5ECQ B;  4OMV A;  4OD7 A;  5IMZ A;  3ZTL A;  1Z6N A;  3QFA C;  2H71 A;  1AQV A;  5L71 A;  1GH2 A;  3GHA A;  1AQX A;  2B5Y A;  3C71 A;  1TW9 A;  2VL9 A;  4KGI A;  1XWA A;  1GSU A;  3C1S A;  2YJH A;  1U3I A;  3J7Y k;  1KTE A;  2IWT A;  1F9M A;  2FUG 2;  5DAL A;  3TJJ A;  2CX3 A;  1YY7 A;  1MEK A;  2FD3 A;  3KP9 A;  3LGC A;  4O32 A;  2NTO A;  4WEY A;  3A2V A;  1LJR A;  3VI7 A;  1T4Y A;  1SJ6 A;  2DIZ A;  1YF0 A;  2TIR A;  1A0R P;  2R4V A;  2X8G A;  3D21 A;  1QGV A;  4E8E A;  3K8N A;  2P5R A;  1MDJ A;  4JZQ A;  5ID2 A;  5HR2 A;  4L0W A;  2EC4 A;  1NHY A;  18GS A;  3EC3 A;  3LYK A;  1T3B A;  4NPB A;  2VM2 A;  4OO4 A;  4ECB A;  3CBU A;  4LL1 B;  3QAV A;  2H73 A;  1X5D A;  3W6G A;  2XPD A;  4TXV A;  2DJ3 A;  2WZ9 A;  3M9J A;  5J41 A;  1X5C A;  5CRG A;  4BL7 A;  5H5S A;  3L9V A;  2YV9 A;  2ZUP A;  4HOJ A;  2CQ9 A;  1M7T A;  2VO4 A;  2JZT A;  5AIX A;  1PD2 1;  3C8E A;  2LJA A;  2L6D A;  2LV3 A;  4NWY A;  2IFQ B;  1K0M A;  3NIV A;  4MF6 A;  1Z7P A;  3UMA A;  2JSZ A;  2DML A;  1BYE A;  1M9B A;  2H76 A;  2HRN A;  3UAP A;  5ENU A;  5CRH A;  3P7X A;  5J3R A;  1ZCP A;  4PQI A;  2JZR A;  2CVB A;  3HHV A;  3HJM A;  3VWX A;  1VGL A;  3FYG A;  4MP4 A;  2LJR A;  1PKZ A;  5G30 A;  1H4O A;  2WS2 A;  4MH3 A;  3UEM A;  1PKW A;  1YDK A;  3ZIJ A;  3E3E A;  3CMI A;  1Q4J A;  1EGR A;  5ECI B;  2LKU A;  2PN8 A;  4IQA A;  4OO5 A;  1A8L A;  3GYK A;  2HE3 A;  2LTK A;  3MWH A;  2VCT A;  4GQC A;  4KCE A;  1OAZ A;  4LMV A;  4KDX A;  2E7P A;  3KEB A;  3H79 A;  2LQQ A;  1T00 A;  1OKT A;  2CA8 A;  2GZY A;  3BOA A;  1EP7 A;  5D9T A;  1O8X A;  3TRX A;  3DEX A;  5IQY A;  1H75 A;  3UL3 A;  2LNT A;  1GTA A;  4GST A;  3LOR A;  4MJA A;  3ZRD A;  2B7K A;  1ZOF A;  4GXZ A;  1GUL A;  2HZF A;  3M0F A;  1XW6 A;  2HXK A;  4V1A p;  1SU9 A;  2PVQ A;  2B5E A;  2GS3 A;  3EU4 A;  4QL9 A;  4DEJ A;  5J9C A;  3APS A;  2VD0 A;  1KNG A;  3UOM A;  2B5X A;  4KSM A;  3HVS A;  2AUV A;  4XTS A;  2HRF A;  3FR9 A;  2LUS A;  3C73 A;  1THO A;  4G19 A;  5ECM B;  1UA5 A;  1GUM A;  2H0I A;  2KUC A;  5GAP D;  1QQ2 A;  4Q5Q A;  5DDL A;  3TCO A;  4IKH A;  4ECJ A;  3F4S A;  3TOU A;  4F82 A;  3HJP A;  1HNA A;  3RHB A;  4NV5 A;  1DBY A;  5JWR B;  2F3M A;  4HEA 2;  3DVW A;  1Y25 A;  2DBC A;  5GZZ B;  2A4V A;  3ZIT A;  5GST A;  1PRX A;  2O85 A;  3A3T A;  1SD9 A;  1B9Y C;  2YWI A;  1BAY A;  1VF4 A;  1QUW A;  2MMN A;  3IAS 2;  2YN1 A;  2E2M A;  1GNE A;  3FR3 A;  3L4N A;  3LJR A;  1PSQ A;  2AAW A;  5JWO B;  3LG6 A;  3HCZ A;  1O73 A;  4BVX A;  4D73 B;  4N30 A;  3NZN A;  1TU8 A;  4KE3 A;  1FG4 A;  1CQH A;  2YPM A;  3ME8 A;  1T8E B;  2C80 A;  3ISO A;  4GF0 A;  4MMM A;  3GX0 A;  3LFL A;  1OYJ A;  2REM A;  2LRT A;  3FZ5 A;  1QFN A;  1M0U A;  1KEB A;  2IPA A;  4HZ4 A;  1U3A A;  1WIK A;  1PX6 A;  4XS1 A;  3UIW A;  4X0X A;  1UVZ A;  1GLQ A;  3TKP A;  2OAD A;  2H66 A;  1XWB A;  5AN1 A;  2K8S A;  2RII A;  2V2G A;  3CSI A;  2DC5 A;  2MMO A;  4PQH A;  3VLN A;  2I9H A;  1X5E A;  4NHZ A;  4PUR A;  5CRD A;  4IHU A;  3KMO A;  4KND A;  2YWO A;  1M2B A;  3EUR A;  2VCQ A;  4MA9 A;  3QCP A;  1M2D A;  2VLU A;  4WKW A;  3LXT A;  2PBJ A;  1TRU A;  5H5Q A;  1F2E A;  3KIJ A;  3LEF A;  4XRA A;  1TRW A;  4FYB A;  4I5Q A;  4N0V A;  1IYI A;  2HFD A;  4J57 E;  3QDN A;  1R4W A;  4WF4 A;  1YKA A;  3HVV A;  3TRP A;  1GWC A;  1I9D A;  2DSA A;  3TOT A;  3KTL A;  1PN9 A;  2H0G A;  1G0T A;  4MZW A;  1XOA A;  2L59 A;  2CZ3 A;  3EMP A;  2ALB A;  4F0C A;  1B4Q A;  4POB A;  5CAX A;  3KM6 A;  3GL5 A;  1V2A A;  6GSX A;  2M46 A;  1V98 A;  4K7O A;  1FO5 A;  5CRE A;  1T1V A;  3ZMK A;  3UJ1 A;  2I4A A;  2C8U A;  5AIV A;  5ECS A;  1WRY A;  3O3T A;  1Z5Y E;  3TJG A;  2R37 A;  1USB A;  5FHI A;  3GL3 A;  3F4T A;  3TUE A;  1T7P B;  1WOU A;  4J2F A;  3PH9 A;  2PPT A;  4BWQ A;  1ERW A;  4ML6 A;  3GKX A;  4RUV A;  1K3O A;  2Z9S A;  5A5K A;  3BBY A;  3VPT A;  1R7H A;  5A4U A;  3IBH A;  1AUC A;  5AGY A;  1Q98 A;  2LNS A;  1RQM A;  2H8L A;  2B7J A;  1EOH A;  4V2N A;  1SD8 A;  3RBT A;  2OJL A;  4I6X A;  2PU9 C;  3ZVJ A;  4IJI A;  2GT5 A;  3MNG A;  1VRS D;  2IMD A;  2MBS A;  3HXS A;  4GLT A;  4IN0 A;  2GZZ A;  3GUR A;  3UBL A;  4GSN A;  2I81 A;  2VM1 A;  4QQ7 A;  3IXR A;  2X8C A;  3F9U A;  2L5L A;  3DWV A;  4TXO B;  1AQW A;  1ERU A;  1F6M C;  2FNO A;  1B8X A;  3H93 A;  4CDO A;  2YJ7 A;  2J23 A;  3F4R A;  2AB6 A;  1BX9 A;  4TKY A;  4F03 A;  1JFU A;  4POM A;  2VL2 A;  4AJ6 A;  2A2S A;  4OCE A;  2IMI A;  1EWX A;  2GDR A;  3EU3 A;  3Q19 A;  3RPN A;  3F6F A;  1FVK A;  3TKQ A;  1THX A;  4EDZ A;  1UC7 A;  2C4J A;  3GTU A;  3FZ4 A;  3EE2 A;  5INY A;  2JSY A;  3KP8 A;  2H1G A;  1TRV A;  4K2D A;  5CRW A;  4JBB A;  3DGQ A;  3N5O A;  2X8H A;  3MSZ A;  2ZCT A;  3GMF A;  1U88 A;  1MDK A;  5F07 A;  3ERG A;  5D9X A;  2B6M A;  1K3L A;  4PNG A;  2GT6 A;  4KSO A;  1XPV A;  4GTU A;  1WPI A;  4K1F A;  2DJK A;  2VUP A;  2V6O A;  3P8W A;  1Z6M A;  5DQS A;  1GUH A;  1OC3 A;  3HD5 A;  4HJ2 A;  4ZIL A;  2C1Y A;  3F6D A;  3LYP A;  3TKS E;  3HY2 A;  4P3Y B;  1O8W A;  3CTG A;  5IMD A;  4RQR A;  5J9B A;  3IR4 A;  2X64 A;  4I8B A;  1BJX A;  5FT3 A;  1Z3E A;  3WT2 A;  3FY7 A;  3ZVJ D;  1JLW A;  1TOF A;  1SKR B;  3TKS A;  2DIY A;  3KTB A;  4DSS A;  3HJO A;  3P90 A;  1QMV A;  2KHP A;  1QK8 A;  4PUF C;  1K0N A;  3D0Z A;  1B9X C;  1QXH A;  12GS A;  3KD0 A;  5HFI A;  1NHO A;  2YOI A;  2FA4 A;  3A2W A;  2GTU A;  1K0C A;  3FW2 A;  4BVY A;  1V40 A;  1HYU A;  2KP1 A;  3APQ A;  2JAC A;  3KH9 A;  3RDW A;  4EE0 A;  1B4P A;  2OAC A;  2GQK A;  5IMV A;  3SBC A;  5EVO A;  4EDY A;  3ZIV A;  3IDV A;  5IMC A;  4MZC A;  5G5F A;  2H74 A;  3BCI A;  3Q6O A;  1K3Y A;  4IP1 A;  2F8F A;  3F3Q A;  19GS A;  1O6J A;  1J9B A;  3PGT A;  5ELG A;  2FWH A;  4ZL7 A;  2NDO A;  2AV4 A;  1XWC A;  1IYH A;  3R2Q A;  2K8V A;  3LQ7 A;  3GFK A;  5H5R A;  3WGD A;  3E0U A;  5DBQ A;  2GQL A;  3HYP A;  3KCM A;  3D4T A;  5EPF A;  3JCM L;  4JRR A;  2JAD A;  1BED A;  2WDU A;  1ACV A;  4N10 A;  2K18 A;  1GTU A;  6GSU A;  1WP0 A;  2H0H A;  1SJZ A;  1PMT A;  6GSY A;  3UBK A;  5GAN D;  2LS5 A;  2YZU A;  2CAI A;  2LRC A;  4LLR A;  4I2U A;  4EO3 A;  3W8S A;  1ON4 A;  3GKK A;  4K0N A;  4OFM A;  4MDC A;  2HZE B;  4K8M A;  4Q5N A;  2KLX A;  2AJQ B;  3Q18 A;  5CO3 A;  1XOB A;  4HZ2 A;  4YH2 A;  2G0F A;  4FYC A;  1YF1 A;  4F0B A;  4IVF A;  4XS4 B;  2V32 A;  3H4K A;  3UVT A;  3V1W A;  1GSY A;  3O6T A;  1R26 A;  2VCZ A;  3GN3 A;  3E9J B;  1E2Y A;  1F3A A;  3HVX A;  4Q5F A;  2RUF A;  2MMA A;  2P0G A;  2VOC A;  3D6I A;  4HQS A;  1X0R A;  1XW5 A;  3IOS A;  2NBS A;  4X1U A;  4FO5 A;  2M72 A;  5E4W A;  4O7H A;  3ZZX A;  6GSS A;  4ID0 A;  1A2L A;  1ZYQ B;  2IMF A;  2ON7 A;  4LMW A;  5D8I A;  4ZBA A;  4EVM A;  4TR4 A;  2K9F A;  2N5F A;  2FY6 A;  3HKR A;  4TR1 B;  2B1L A;  3N9J A;  1GSE A;  1LU4 A;  4YQM A;  1XWG A;  2XBI A;  6GST A;  2PER A;  1A23 A;  3GSS A;  2YWM A;  2HI7 A;  3LXZ A;  5IMF A;  5DAK A;  5IO0 A;  3GIX A;  1SK0 A;  1VF1 A;  2PWJ A;  1SYR A;  1OE8 A;  2LEG A;  4YAP A;  1I5G A;  1OKD A;  3HA9 A;  5B8A A;  4BWS A;  2H75 A;  5LCZ A;  6GSV A;  1SK2 A;  1DE1 A;  2H1B A;  1W89 A;  4Q5R A;  4AF2 A;  1ZMA A;  2PMT A;  4CW9 A;  9GSS A;  3WGX A;  5ECL B;  3TJB A;  4YQU A;  1HNC A;  1XW9 A;  2G2Q A;  3C1R A;  2VL2 C;  5HR3 A;  4HJM A;  17GS A;  2CVK A;  4O5R A;  5DAL B;  2CZ2 A;  1HD2 A;  3FK8 A;  2PGT A;  1U87 A;  1NM3 A;  5ECH B;  2H01 A;  1XIY A;  4DSQ A;  2TRX A;  2HYX A;  2OE3 A;  4XHM A;  1EP8 A;  5D93 A;  4JE1 A;  1FOV A;  4NAX A;  1OC9 A;  1XVQ A;  1XWK A;  4AJ8 A;  2AYT A;  2J9H A;  1G6W A;  5ID2 B;  2RUE A;  1X9M B;  1YZX A;  2VCW A;  4HDE A;  4L5L A;  16GS A;  4TW5 A;  1UN2 A;  2QC7 A;  1X9S B;  4G9H A;  1GSF A;  1MTC A;  2C0E A;  5ECP B;  1O7U A;  1Z7R A;  2NVL A;  4OFN A;  3IK9 A;  3IPZ A; 
#chains in the Genus database with same CATH topology
 1R5A A;  1A2J A;  3ZYW A;  1ZGN A;  3IC4 A;  1F3B A;  4BL7 B;  2C0D A;  4EC0 A;  3L78 A;  4JU5 A;  1CQG A;  4KF9 A;  4IP6 A;  4XS6 A;  1XXU A;  2GSR A;  2OE0 A;  4XRD A;  3TKS C;  3VWV A;  1SL1 B;  4GWR A;  3ZLP A;  1A2M A;  5HR1 A;  5D96 A;  5DVB A;  1GLP A;  3EMX A;  1XBS A;  1Y6E A;  1PA3 A;  4FIW A;  4NXI A;  4MPF A;  4KH7 A;  4BPY A;  5B6N A;  3VI5 A;  4ZB9 A;  1YJ6 A;  2R5G A;  3QOU A;  5D9W A;  22GS A;  1GUK A;  5F8B A;  4V1A g;  8GSS A;  4X43 A;  2H19 A;  3U5R E;  2VLV A;  1B48 A;  2FLS A;  2EIR A;  4X4J A;  4PUA A;  1FB0 A;  1C72 A;  1JLV A;  2KOK A;  3EIN A;  4ZL9 A;  2VLT A;  3FZ9 A;  2CT6 A;  3GV1 A;  1K0A A;  6GSW A;  2C0G A;  1EEM A;  4IQ1 A;  4F2I A;  3QMX A;  2IMK A;  2V6K A;  2OE1 A;  1EGO A;  3ZML A;  2PVO C;  1F37 A;  2IFQ A;  3ED3 A;  5KEJ A;  1JZO A;  5J4U A;  4MZB A;  5IM9 A;  2BMX A;  1TXX A;  2VCX A;  1YEX A;  4MLY A;  1SJI A;  2IL3 A;  2GSS A;  4BA7 A;  1WMJ A;  2F9S A;  5G1L A;  2R3X A;  1DE2 A;  3QFB C;  5KN0 A;  1XG8 A;  1V57 A;  4GQF A;  2JZS A;  3OR5 A;  3FKF A;  5FWG A;  1ILO A;  2HNL A;  3DKS A;  2FA8 A;  2IJY A;  4WBJ A;  5IO2 A;  1AW9 A;  2GST A;  3RHC A;  2WJU A;  2IME A;  3FZA A;  4G2E A;  2R2J A;  1TRS A;  4EKZ A;  2H6Z A;  1AXD A;  3CRU A;  3EYT A;  3US3 A;  3ERW A;  2GGT A;  2YWN A;  5JCU A;  4A5P A;  3BJ5 A;  4YQV A;  4HS1 A;  4F9Z A;  5D73 A;  2X49 A;  3DYR A;  3H1N A;  3M3M A;  1GSD A;  4GRF A;  2XPE A;  3VFI A;  5B6M A;  4NHW A;  2H6Y A;  2V41 A;  4V2L A;  3RPP A;  5GSS A;  4ACS A;  1PL2 A;  1SK1 A;  2H30 A;  4POL A;  1K0O A;  2DJ1 A;  3IV4 A;  2C0F A;  1ERV A;  4MK3 A;  2XHF A;  5EY6 A;  2IN3 A;  4HU7 A;  4HUA A;  4CHS A;  4BVX B;  2C3N A;  2RM6 A;  3BCK A;  3VPQ A;  2CAQ A;  2XBQ A;  2FWG A;  1A24 A;  3DML A;  4TR3 A;  5DQY A;  3TB2 A;  1MD3 A;  1EEJ A;  3CSJ A;  4ISD A;  4JR4 A;  4DSR A;  3LW9 A;  4KW6 A;  4I97 A;  4LL4 B;  2OKA A;  1TI3 A;  3CSH A;  2DJ0 A;  3CRT A;  2VD1 A;  1SKS B;  3L0H A;  2LQO A;  3ERF A;  4KB3 A;  2YNX A;  4EF0 A;  4KX4 A;  4WR4 A;  3RAZ A;  2NPB A;  3DD3 A;  4ECI A;  3PIN A;  3KZQ A;  4I2T A;  3M1G A;  5IPG A;  3GST A;  1GSQ A;  4LA1 A;  4MJE A;  2MBT A;  1ZZY A;  2ON5 A;  4QL7 A;  3G7I A;  4TR0 A;  5JWQ B;  5HFG A;  4L8E A;  4D73 A;  2VIM A;  1PX7 A;  5DJL A;  1LBK A;  3VUR A;  2AHE A;  7GSS A;  5G5E A;  4TVE A;  5IPH A;  4EUY A;  4EL1 A;  1ZYN A;  1OE7 A;  1VF2 A;  4AJ7 A;  3FRC A;  2FHE A;  4IJ3 A;  3F3R A;  2DJJ A;  4L5O A;  2OA7 A;  3KJY A;  2OBK A;  3DRN A;  5KN1 A;  4MJC A;  3IA1 A;  4N0Z A;  2L6C A;  2H72 A;  2JU5 A;  2N5A A;  1GNW A;  4DVC A;  5A4W A;  2R0P A;  1T4Z A;  2R0G A;  2C3T A;  4IEL A;  4K7N A;  3ZL5 A;  3I43 A;  4WET A;  4E8H A;  3KH7 A;  4ZBB A;  2PUK C;  3CYN A;  5ECK B;  14GS A;  2WFC A;  3GH6 A;  1MD4 A;  2P31 A;  1J08 A;  3KGK A;  5IOW A;  3TKR A;  3FR6 A;  3GRX A;  5IIZ A;  1XZO A;  4ECC A;  1M99 A;  4ULX A;  1TK0 B;  1TK5 B;  4KDY A;  4K0G A;  1GSS A;  1HQO A;  3IK7 A;  2VL3 A;  1O81 A;  3HDC A;  1SL0 B;  2HSH A;  4XCS A;  3S9F A;  1URM A;  2QGV A;  2L4C A;  4PQ1 A;  2QSI A;  3GUS A;  1PL1 A;  3UVH A;  1A8Y A;  4WF5 A;  1RK4 A;  1OVN A;  2RM5 A;  3LWA A;  1X9W B;  3G9B A;  2YP6 A;  5EL8 A;  1V9W A;  3GKN A;  4WXT A;  3IC8 A;  1ZYP A;  3IRA A;  5DCH A;  4PX1 A;  3HZ8 A;  1J0F A;  2GSQ A;  1RW1 A;  5ELA A;  2ZNM A;  4YKG A;  3QAW A;  2FWF A;  4K9Z A;  2FGX A;  1WJK A;  3PPU A;  5CP1 A;  3I6A A;  20GS A;  1S3D A;  5LNK e;  1VF3 A;  2O7K A;  3TDG A;  4YAV A;  5J5N A;  13GS A;  3FEU A;  1EOG A;  3KMN A;  4ZXG A;  2ES7 A;  5ECO B;  3DVX A;  3IAM 2;  1GTB A;  1TI1 A;  2XC2 A;  2X99 A;  3TGZ A;  2DJ2 A;  2F51 A;  1PN0 A;  4RI7 A;  5HQP A;  1AC1 A;  1SKW B;  5D9V A;  3QD9 A;  2F8A A;  4KCA A;  4K5R A;  4Z2T A;  1A0F A;  2C3Q A;  2H1A A;  3EWL A;  1O85 A;  3GTU B;  2GZP A;  1BQ7 A;  1N8J A;  4ML1 A;  3ZFL A;  5JCG A;  5E59 A;  2WB9 A;  4ZIJ A;  2E0Q A;  2QA1 A;  4FH8 A;  3WD6 A;  5IMA A;  3D4M A;  1TJD A;  2H70 A;  5A4V A;  5B8B A;  2WCI A;  4Z7X A;  4NV2 A;  2O89 A;  3H8Q A;  1YEP A;  1TDI A;  3TJF A;  5COH A;  3HVN A;  1FAA A;  4IBP A;  4TXO A;  5JCW A;  3DIE A;  1WE0 A;  4IW9 A;  5BMU A;  2EIO A;  4L0U A;  2I3Y A;  2EIQ A;  1M3I A;  10GS A;  3IE3 A;  1KBN A;  1Z9H A;  3MYD A;  2MZC A;  4AGS A;  1ERT A;  1G6Y A;  2P5Q A;  1W4V A;  2R6K A;  3I9V 2;  2B1K A;  3WGE A;  4K5S A;  1XFL A;  4K7I A;  1TU7 A;  1WWJ A;  4OWY A;  4GSS A;  3A5I A;  4HU9 A;  3APO A;  5KN2 A;  4DSS B;  2MYG A;  3AY8 A;  3P2A A;  2O8V B;  2LRN A;  2VCV A;  3FHK A;  3VWU A;  3CTF A;  1YQ1 A;  4BVY B;  4ZBD A;  1G7O A;  4ZL8 A;  2I1U A;  3EVI A;  1GP1 A;  4EXJ A;  4XIH A;  4KUN A;  1TTZ A;  2L4Q A;  2QKE A;  3G7Y A;  2N5B A;  1SL2 B;  4USS A;  3ME7 A;  3QAG A;  2DMM A;  3KXO A;  4RI6 A;  3M9K A;  1EV4 A;  3M8N A;  4IS0 A;  4N11 A;  1R5P A;  4MF5 A;  3D22 A;  3DXB A;  3O76 A;  2M80 A;  4J56 E;  2YAN A;  2YCD A;  4OCF A;  1G7E A;  3I69 A;  5DJM A;  4WR5 A;  2DKI A;  1SEN A;  5G2Z A;  4JR6 A;  1PQN A;  2HLS A;  1ABA A;  4K6X A;  2YV7 A;  1M2A A;  5KN3 A;  3PR8 A;  1BG5 A;  3CXG A;  1ST9 A;  3WYW A;  2L5O A;  1JZW A;  4GCI A;  4TN8 A;  4KAE A;  1DUG A;  1GL8 A;  4MF7 A;  3UAR A;  3BD2 A;  2V1M A;  3L9S A;  4MJB A;  4RQX A;  3W8J A;  4TOP A;  2FCH A;  5F05 A;  5C00 A;  2FWE A;  4FYU A;  2HSY A;  1U6T A;  2GLR A;  1TP9 A;  5HR0 A;  3ZRE A;  3NOF A;  5ABR A;  2TRC P;  1JHB A;  11GS A;  5F0G A;  5HFK A;  1ML6 A;  3Q74 A;  1TKD B;  1XVW A;  3VK9 A;  2HT9 A;  3A5W A;  1DSB A;  3TJK A;  1GRX A;  1V58 A;  3MDK A;  5G1K A;  2WUL A;  4ZB8 A;  3IHQ A;  2LST A;  2YZH A;  5G31 A;  2GQM A;  4MH2 A;  2VAF A;  4H86 A;  3D5J A;  1AAZ A;  4POK A;  4NMU A;  2KP2 A;  2JL4 A;  4V2M A;  5DCG A;  4PGT A;  3MAK A;  1ZL9 A;  1ZYE A;  4IGJ A;  1E6B A;  1GTI A;  1JZD A;  1K0D A;  3L9U A;  3HZ4 A;  5ECR B;  2WGR A;  3GH9 A;  2BJX A;  4CY6 A;  1YKC A;  3GX8 A;  2HZE A;  4O5U A;  1TK8 B;  1N2A A;  2CX4 A;  1HNB A;  2OBI A;  5B7C A;  1EV9 A;  4TRX A;  1AIU A;  2B3S A;  2IIY A;  2MMZ A;  4XS4 A;  1XCC A;  2CVD A;  3GNJ A;  4G10 A;  2K6V A;  2A2R A;  4PNF A;  5CYY A;  1OC8 A;  5DAK B;  3SWL A;  3WT1 A;  3TRQ A;  2L57 A;  1MDI A;  4ZB6 A;  1S3C A;  3GKM A;  2O87 A;  3VWW A;  5F06 A;  3G7J A;  1K0B A;  4MPG A;  1FVJ A;  2BTO T;  1NSW A;  4MAB A;  2H6X A;  4JED A;  3QPM A;  1NW2 A;  2DLX A;  1SYX A;  4HQZ A;  5IOX A;  1S3A A;  2CV4 A;  4ILF A;  1FHE A;  5ECN B;  5CNW A;  3MIX A;  4TR1 A;  4KDU A;  3J7Y b;  3A2X A;  3LSZ A;  4MCU A;  4WBR D;  2D2Z A;  4PXO A;  3F0I A;  3C7M A;  4Z2R A;  4KA0 A;  2GVP A;  1EZK A;  1PGT A;  3GA4 A;  1M9A A;  4HI7 A;  5C04 A;  3QR6 A;  1FW1 A;  1OC9 B;  3F63 A;  4OFT A;  2H1D A;  4O92 A;  2WRT A;  3ZFB A;  4MNN A;  5LD0 A;  3U6V A;  2RLI A;  3F8U A;  2LJK A;  5AIS A;  1FB6 A;  2E2G A;  1JZR A;  5ECQ B;  4OMV A;  4OD7 A;  5IMZ A;  3ZTL A;  1Z6N A;  3QFA C;  2H71 A;  1AQV A;  5L71 A;  1GH2 A;  3GHA A;  1AQX A;  2B5Y A;  3C71 A;  1TW9 A;  2VL9 A;  4KGI A;  1XWA A;  1GSU A;  3C1S A;  2YJH A;  1U3I A;  3J7Y k;  1KTE A;  2IWT A;  1F9M A;  2FUG 2;  5DAL A;  3TJJ A;  2CX3 A;  1YY7 A;  1MEK A;  2FD3 A;  3KP9 A;  3LGC A;  4O32 A;  2NTO A;  4WEY A;  3A2V A;  1LJR A;  3VI7 A;  1T4Y A;  1SJ6 A;  2DIZ A;  1YF0 A;  2TIR A;  1A0R P;  2R4V A;  2X8G A;  3D21 A;  1QGV A;  4E8E A;  3K8N A;  2P5R A;  1MDJ A;  4JZQ A;  5ID2 A;  5HR2 A;  2HRK A;  4L0W A;  2EC4 A;  1NHY A;  18GS A;  3EC3 A;  3LYK A;  1T3B A;  4NPB A;  2VM2 A;  4OO4 A;  4ECB A;  3CBU A;  4LL1 B;  3QAV A;  2H73 A;  1X5D A;  3W6G A;  2XPD A;  4TXV A;  2DJ3 A;  2WZ9 A;  3M9J A;  5J41 A;  1X5C A;  5CRG A;  4BL7 A;  5H5S A;  3L9V A;  2YV9 A;  2ZUP A;  4HOJ A;  2CQ9 A;  1M7T A;  2VO4 A;  2JZT A;  5AIX A;  1PD2 1;  3C8E A;  2LJA A;  2L6D A;  2LV3 A;  4NWY A;  4YKF A;  2IFQ B;  1K0M A;  3NIV A;  4MF6 A;  1Z7P A;  4EIQ A;  3UMA A;  2JSZ A;  2DML A;  1BYE A;  1M9B A;  2H76 A;  2HRN A;  4EIP A;  3UAP A;  5ENU A;  5CRH A;  3P7X A;  5J3R A;  1ZCP A;  4PQI A;  2JZR A;  2CVB A;  3HHV A;  3HJM A;  3VWX A;  1VGL A;  3FYG A;  4MP4 A;  2LJR A;  1PKZ A;  5G30 A;  1H4O A;  2WS2 A;  4MH3 A;  3UEM A;  1PKW A;  1YDK A;  3ZIJ A;  3E3E A;  3CMI A;  1Q4J A;  1EGR A;  5ECI B;  2LKU A;  2PN8 A;  4IQA A;  4OO5 A;  1A8L A;  3GYK A;  2HE3 A;  2LTK A;  3MWH A;  2VCT A;  4GQC A;  4KCE A;  1OAZ A;  4LMV A;  4KDX A;  2E7P A;  3KEB A;  2HRA A;  3H79 A;  2LQQ A;  1T00 A;  1OKT A;  2CA8 A;  2GZY A;  3BOA A;  1EP7 A;  4G0K A;  5D9T A;  1O8X A;  3TRX A;  3DEX A;  5IQY A;  1H75 A;  3UL3 A;  2LNT A;  1GTA A;  4GST A;  3LOR A;  4MJA A;  3ZRD A;  2B7K A;  1ZOF A;  4GXZ A;  1GUL A;  2HZF A;  3M0F A;  1XW6 A;  2HXK A;  4V1A p;  1SU9 A;  2PVQ A;  2B5E A;  4G0L A;  2GS3 A;  3EU4 A;  4QL9 A;  4DEJ A;  5J9C A;  3APS A;  2VD0 A;  1KNG A;  4K2X A;  3UOM A;  2B5X A;  4KSM A;  3HVS A;  2AUV A;  4XTS A;  2HRF A;  3FR9 A;  2LUS A;  3C73 A;  1PFO A;  5BRT A;  1THO A;  4G19 A;  5ECM B;  1UA5 A;  1GUM A;  2H0I A;  2KUC A;  5GAP D;  1QQ2 A;  4Q5Q A;  5DDL A;  3TCO A;  4IKH A;  4ECJ A;  3F4S A;  3TOU A;  4F82 A;  3HJP A;  1HNA A;  3RHB A;  4NV5 A;  1DBY A;  5JWR B;  2F3M A;  4HEA 2;  3DVW A;  1Y25 A;  2DBC A;  5GZZ B;  2A4V A;  3ZIT A;  5GST A;  1PRX A;  2O85 A;  3A3T A;  1SD9 A;  1B9Y C;  2YWI A;  1BAY A;  1VF4 A;  1QUW A;  2MMN A;  3IAS 2;  2DKH A;  2YN1 A;  2E2M A;  1GNE A;  3FR3 A;  3L4N A;  3LJR A;  1PSQ A;  2AAW A;  5JWO B;  1S3R A;  3LG6 A;  3HCZ A;  1O73 A;  4BVX A;  4D73 B;  4N30 A;  5KOX A;  3NZN A;  1TU8 A;  3CQF A;  4KE3 A;  1FG4 A;  1CQH A;  2YPM A;  3ME8 A;  1T8E B;  2C80 A;  3ISO A;  4GF0 A;  4MMM A;  3GX0 A;  3LFL A;  1OYJ A;  2REM A;  2LRT A;  3FZ5 A;  3IHG A;  1QFN A;  2A2P A;  1M0U A;  1KEB A;  2UZ8 A;  2IPA A;  4HZ4 A;  1U3A A;  1WIK A;  1PX6 A;  4XS1 A;  3UIW A;  4X0X A;  1UVZ A;  1GLQ A;  3TKP A;  2OAD A;  2H66 A;  1XWB A;  5AN1 A;  2K8S A;  2RII A;  2V2G A;  3CSI A;  2DC5 A;  2MMO A;  4PQH A;  3VLN A;  2I9H A;  1X5E A;  4NHZ A;  4PUR A;  5CRD A;  4IHU A;  3KMO A;  4KND A;  2YWO A;  4CY8 A;  1M2B A;  3EUR A;  2VCQ A;  4MA9 A;  3QCP A;  1M2D A;  2VLU A;  4WKW A;  3LXT A;  2PBJ A;  1TRU A;  5H5Q A;  1F2E A;  3KIJ A;  3LEF A;  4XRA A;  1TRW A;  4FYB A;  4I5Q A;  4N0V A;  4PTS A;  1IYI A;  2HFD A;  4J57 E;  3QDN A;  1R4W A;  4WF4 A;  1YKA A;  3HVV A;  3TRP A;  4G0I A;  1GWC A;  1I9D A;  2DSA A;  3TOT A;  4HSC X;  3KTL A;  1PN9 A;  2H0G A;  1G0T A;  4MZW A;  1XOA A;  2L59 A;  2CZ3 A;  3EMP A;  2ALB A;  4F0C A;  1B4Q A;  4POB A;  5CAX A;  3KM6 A;  3GL5 A;  1V2A A;  6GSX A;  2M46 A;  1V98 A;  4K7O A;  1FO5 A;  5CRE A;  1T1V A;  3ZMK A;  3UJ1 A;  2I4A A;  2C8U A;  5AIV A;  5ECS A;  1WRY A;  3O3T A;  4FQU A;  1Z5Y E;  3TJG A;  2R37 A;  1USB A;  5FHI A;  3GL3 A;  3F4T A;  3TUE A;  1T7P B;  1WOU A;  4J2F A;  3PH9 A;  2PPT A;  4BWQ A;  1ERW A;  4ML6 A;  3GKX A;  4RUV A;  1K3O A;  2Z9S A;  5A5K A;  3BBY A;  3VPT A;  1R7H A;  2QA2 A;  5A4U A;  3IBH A;  1AUC A;  5AGY A;  1Q98 A;  2LNS A;  1RQM A;  2H8L A;  2B7J A;  1EOH A;  4V2N A;  1SD8 A;  3RBT A;  2OJL A;  4I6X A;  2PU9 C;  3ZVJ A;  4IJI A;  2GT5 A;  3MNG A;  1VRS D;  2IMD A;  2MBS A;  3HXS A;  4GLT A;  4IN0 A;  2GZZ A;  3GUR A;  3UBL A;  4GSN A;  2I81 A;  2VM1 A;  4QQ7 A;  3IXR A;  2X8C A;  3F9U A;  2L5L A;  3DWV A;  4TXO B;  1AQW A;  1ERU A;  1F6M C;  2FNO A;  1B8X A;  3H93 A;  4CDO A;  2YJ7 A;  2J23 A;  3F4R A;  2AB6 A;  1BX9 A;  4TKY A;  4F03 A;  1JFU A;  4POM A;  2VL2 A;  4AJ6 A;  2A2S A;  4OCE A;  2IMI A;  1EWX A;  2GDR A;  3EU3 A;  3Q19 A;  3RPN A;  3F6F A;  1FVK A;  3TKQ A;  3FMW A;  1THX A;  4EDZ A;  1UC7 A;  2C4J A;  3GTU A;  3FZ4 A;  3EE2 A;  5INY A;  2JSY A;  3KP8 A;  2H1G A;  1TRV A;  4K2D A;  5CRW A;  4JBB A;  3DGQ A;  3N5O A;  2X8H A;  3MSZ A;  2ZCT A;  3GMF A;  1U88 A;  1MDK A;  5F07 A;  3ERG A;  5D9X A;  4O5Q A;  2B6M A;  1K3L A;  4PNG A;  2GT6 A;  4KSO A;  1XPV A;  3R3E A;  4GTU A;  1WPI A;  4K1F A;  2DJK A;  2VUP A;  3EPT A;  2V6O A;  3P8W A;  1Z6M A;  5DQS A;  1GUH A;  1OC3 A;  3HD5 A;  4HJ2 A;  4ZIL A;  2C1Y A;  3F6D A;  3LYP A;  3TKS E;  3HY2 A;  4P3Y B;  1M3J A;  1O8W A;  3CTG A;  5IMD A;  4RQR A;  5J9B A;  3IR4 A;  2X64 A;  4I8B A;  1BJX A;  5FT3 A;  1Z3E A;  3WT2 A;  3FY7 A;  3ZVJ D;  1JLW A;  1TOF A;  1SKR B;  3TKS A;  2DIY A;  3KTB A;  4DSS A;  3HJO A;  3P90 A;  5KOW A;  1QMV A;  2KHP A;  1QK8 A;  4PUF C;  1K0N A;  3D0Z A;  1B9X C;  1QXH A;  12GS A;  3KD0 A;  5HFI A;  1NHO A;  2YOI A;  2FA4 A;  3A2W A;  2GTU A;  1K0C A;  3FW2 A;  4BVY A;  1V40 A;  1HYU A;  2KP1 A;  3APQ A;  2JAC A;  3KH9 A;  3RDW A;  4EE0 A;  1B4P A;  2OAC A;  2GQK A;  5IMV A;  3SBC A;  5EVO A;  4EDY A;  3ZIV A;  3IDV A;  5IMC A;  4MZC A;  5G5F A;  2H74 A;  3BCI A;  3Q6O A;  1K3Y A;  4IP1 A;  2F8F A;  3F3Q A;  19GS A;  1O6J A;  1J9B A;  3PGT A;  5ELG A;  2FWH A;  4ZL7 A;  2NDO A;  2AV4 A;  1XWC A;  4BIK A;  2X4A A;  1IYH A;  3R2Q A;  2K8V A;  3LQ7 A;  3GFK A;  5H5R A;  3WGD A;  3E0U A;  5DBQ A;  2GQL A;  3HYP A;  3KCM A;  3D4T A;  5EPF A;  3JCM L;  4JRR A;  2JAD A;  1BED A;  2WDU A;  1ACV A;  4N10 A;  2K18 A;  1GTU A;  6GSU A;  1WP0 A;  2H0H A;  1SJZ A;  1PMT A;  6GSY A;  3UBK A;  5GAN D;  2LS5 A;  2YZU A;  2CAI A;  2LRC A;  4LLR A;  4I2U A;  4EO3 A;  3W8S A;  1ON4 A;  3GKK A;  4K0N A;  4OFM A;  4MDC A;  2HZE B;  4K8M A;  4Q5N A;  2KLX A;  4ICY A;  2AJQ B;  3Q18 A;  5CO3 A;  1XOB A;  4HZ2 A;  4YH2 A;  2G0F A;  4FYC A;  1YF1 A;  4F0B A;  4IVF A;  4XS4 B;  2V32 A;  3H4K A;  3UVT A;  3V1W A;  1GSY A;  3O6T A;  1R26 A;  2VCZ A;  3GN3 A;  3E9J B;  1E2Y A;  1F3A A;  3HVX A;  4Q5F A;  2RUF A;  2HSM A;  2R0C A;  2MMA A;  2P0G A;  2VOC A;  3D6I A;  4HQS A;  1X0R A;  1XW5 A;  3IOS A;  2NBS A;  4X1U A;  4FO5 A;  2M72 A;  5E4W A;  4O7H A;  3ZZX A;  6GSS A;  4ID0 A;  1A2L A;  1ZYQ B;  2IMF A;  2ON7 A;  4LMW A;  5D8I A;  4ZBA A;  4EVM A;  4TR4 A;  2K9F A;  2N5F A;  2FY6 A;  3HKR A;  4TR1 B;  2B1L A;  3N9J A;  1GSE A;  1LU4 A;  4YQM A;  1XWG A;  2XBI A;  6GST A;  2PER A;  1A23 A;  3GSS A;  2YWM A;  2HI7 A;  3LXZ A;  5IMF A;  5DAK A;  5IO0 A;  3GIX A;  1SK0 A;  1VF1 A;  2PWJ A;  1SYR A;  1OE8 A;  2LEG A;  4YAP A;  1I5G A;  1OKD A;  3HA9 A;  5B8A A;  4BWS A;  2H75 A;  4Z2U A;  5LCZ A;  6GSV A;  1SK2 A;  1DE1 A;  2H1B A;  1W89 A;  4Q5R A;  4AF2 A;  1ZMA A;  2PMT A;  4CW9 A;  9GSS A;  3WGX A;  5ECL B;  3TJB A;  1FOH A;  4YQU A;  1HNC A;  1XW9 A;  2G2Q A;  3C1R A;  2VL2 C;  5HR3 A;  4HJM A;  17GS A;  2CVK A;  4O5R A;  5DAL B;  2CZ2 A;  1HD2 A;  3FK8 A;  2PGT A;  1U87 A;  1NM3 A;  5ECH B;  2H01 A;  1XIY A;  4DSQ A;  2TRX A;  2HYX A;  2OE3 A;  4XHM A;  1EP8 A;  5D93 A;  4JE1 A;  1FOV A;  4NAX A;  2A4H A;  1OC9 A;  1XVQ A;  1XWK A;  4AJ8 A;  2AYT A;  2J9H A;  1G6W A;  5ID2 B;  2RUE A;  1X9M B;  1YZX A;  2VCW A;  4HDE A;  4L5L A;  16GS A;  4TW5 A;  1UN2 A;  2QC7 A;  1X9S B;  4G9H A;  1GSF A;  1MTC A;  2C0E A;  5ECP B;  1O7U A;  1Z7R A;  2NVL A;  4OFN A;  3IK9 A;  3IPZ A; 
#chains in the Genus database with same CATH homology
 1R5A A;  1A2J A;  3ZYW A;  1ZGN A;  3IC4 A;  1F3B A;  4BL7 B;  2C0D A;  4EC0 A;  3L78 A;  4JU5 A;  1CQG A;  4KF9 A;  4IP6 A;  4XS6 A;  1XXU A;  2GSR A;  2OE0 A;  4XRD A;  3TKS C;  3VWV A;  1SL1 B;  4GWR A;  3ZLP A;  1A2M A;  5HR1 A;  5D96 A;  5DVB A;  1GLP A;  3EMX A;  1XBS A;  1Y6E A;  1PA3 A;  4FIW A;  4NXI A;  4MPF A;  4KH7 A;  4BPY A;  5B6N A;  3VI5 A;  4ZB9 A;  1YJ6 A;  2R5G A;  3QOU A;  5D9W A;  22GS A;  1GUK A;  5F8B A;  4V1A g;  8GSS A;  4X43 A;  2H19 A;  3U5R E;  2VLV A;  1B48 A;  2FLS A;  2EIR A;  4X4J A;  4PUA A;  1FB0 A;  1C72 A;  1JLV A;  2KOK A;  3EIN A;  4ZL9 A;  2VLT A;  3FZ9 A;  2CT6 A;  3GV1 A;  1K0A A;  6GSW A;  2C0G A;  1EEM A;  4IQ1 A;  4F2I A;  3QMX A;  2IMK A;  2V6K A;  2OE1 A;  1EGO A;  3ZML A;  2PVO C;  1F37 A;  2IFQ A;  3ED3 A;  5KEJ A;  1JZO A;  5J4U A;  4MZB A;  5IM9 A;  2BMX A;  1TXX A;  2VCX A;  1YEX A;  4MLY A;  1SJI A;  2IL3 A;  2GSS A;  4BA7 A;  1WMJ A;  2F9S A;  5G1L A;  2R3X A;  1DE2 A;  3QFB C;  5KN0 A;  1V57 A;  4GQF A;  2JZS A;  3OR5 A;  3FKF A;  5FWG A;  1ILO A;  2HNL A;  3DKS A;  2FA8 A;  2IJY A;  4WBJ A;  5IO2 A;  1AW9 A;  2GST A;  3RHC A;  2WJU A;  2IME A;  3FZA A;  4G2E A;  2R2J A;  1TRS A;  4EKZ A;  2H6Z A;  1AXD A;  3CRU A;  3EYT A;  3US3 A;  3ERW A;  2GGT A;  2YWN A;  5JCU A;  4A5P A;  3BJ5 A;  4YQV A;  4HS1 A;  4F9Z A;  5D73 A;  2X49 A;  3DYR A;  3H1N A;  3M3M A;  1GSD A;  4GRF A;  2XPE A;  3VFI A;  5B6M A;  4NHW A;  2H6Y A;  2V41 A;  4V2L A;  3RPP A;  5GSS A;  4ACS A;  1PL2 A;  1SK1 A;  2H30 A;  4POL A;  1K0O A;  2DJ1 A;  3IV4 A;  2C0F A;  1ERV A;  4MK3 A;  2XHF A;  5EY6 A;  2IN3 A;  4HU7 A;  4HUA A;  4CHS A;  4BVX B;  2C3N A;  2RM6 A;  3BCK A;  3VPQ A;  2CAQ A;  2XBQ A;  2FWG A;  1A24 A;  3DML A;  4TR3 A;  5DQY A;  3TB2 A;  1MD3 A;  1EEJ A;  3CSJ A;  4ISD A;  4JR4 A;  4DSR A;  3LW9 A;  4KW6 A;  4I97 A;  4LL4 B;  2OKA A;  1TI3 A;  3CSH A;  2DJ0 A;  3CRT A;  2VD1 A;  1SKS B;  3L0H A;  2LQO A;  3ERF A;  4KB3 A;  2YNX A;  4EF0 A;  4KX4 A;  4WR4 A;  3RAZ A;  2NPB A;  3DD3 A;  4ECI A;  3PIN A;  3KZQ A;  4I2T A;  3M1G A;  5IPG A;  3GST A;  1GSQ A;  4LA1 A;  4MJE A;  2MBT A;  1ZZY A;  2ON5 A;  4QL7 A;  3G7I A;  4TR0 A;  5JWQ B;  5HFG A;  4L8E A;  4D73 A;  2VIM A;  1PX7 A;  5DJL A;  1LBK A;  3VUR A;  2AHE A;  7GSS A;  5G5E A;  4TVE A;  5IPH A;  4EUY A;  4EL1 A;  1ZYN A;  1OE7 A;  1VF2 A;  4AJ7 A;  3FRC A;  2FHE A;  4IJ3 A;  3F3R A;  2DJJ A;  4L5O A;  2OA7 A;  3KJY A;  2OBK A;  3DRN A;  5KN1 A;  4MJC A;  3IA1 A;  4N0Z A;  2L6C A;  2H72 A;  2JU5 A;  2N5A A;  1GNW A;  4DVC A;  5A4W A;  2R0P A;  1T4Z A;  2R0G A;  2C3T A;  4IEL A;  4K7N A;  3ZL5 A;  3I43 A;  4WET A;  4E8H A;  3KH7 A;  4ZBB A;  2PUK C;  3CYN A;  5ECK B;  14GS A;  2WFC A;  3GH6 A;  1MD4 A;  2P31 A;  1J08 A;  3KGK A;  5IOW A;  3TKR A;  3FR6 A;  3GRX A;  5IIZ A;  1XZO A;  4ECC A;  1M99 A;  4ULX A;  1TK0 B;  1TK5 B;  4KDY A;  4K0G A;  1GSS A;  1HQO A;  3IK7 A;  2VL3 A;  1O81 A;  3HDC A;  1SL0 B;  2HSH A;  4XCS A;  3S9F A;  1URM A;  2QGV A;  2L4C A;  4PQ1 A;  2QSI A;  3GUS A;  1PL1 A;  3UVH A;  1A8Y A;  4WF5 A;  1RK4 A;  1OVN A;  2RM5 A;  3LWA A;  1X9W B;  3G9B A;  2YP6 A;  5EL8 A;  1V9W A;  3GKN A;  4WXT A;  3IC8 A;  1ZYP A;  3IRA A;  5DCH A;  4PX1 A;  3HZ8 A;  1J0F A;  2GSQ A;  1RW1 A;  5ELA A;  2ZNM A;  4YKG A;  3QAW A;  2FWF A;  4K9Z A;  2FGX A;  1WJK A;  3PPU A;  5CP1 A;  3I6A A;  20GS A;  1S3D A;  5LNK e;  1VF3 A;  2O7K A;  3TDG A;  4YAV A;  5J5N A;  13GS A;  3FEU A;  1EOG A;  3KMN A;  4ZXG A;  2ES7 A;  5ECO B;  3DVX A;  3IAM 2;  1GTB A;  1TI1 A;  2XC2 A;  2X99 A;  3TGZ A;  2DJ2 A;  2F51 A;  1PN0 A;  4RI7 A;  5HQP A;  1AC1 A;  1SKW B;  5D9V A;  3QD9 A;  2F8A A;  4KCA A;  4K5R A;  4Z2T A;  1A0F A;  2C3Q A;  2H1A A;  3EWL A;  1O85 A;  3GTU B;  2GZP A;  1BQ7 A;  1N8J A;  4ML1 A;  3ZFL A;  5JCG A;  5E59 A;  2WB9 A;  4ZIJ A;  2E0Q A;  2QA1 A;  4FH8 A;  3WD6 A;  5IMA A;  3D4M A;  1TJD A;  2H70 A;  5A4V A;  5B8B A;  2WCI A;  4Z7X A;  4NV2 A;  2O89 A;  3H8Q A;  1YEP A;  1TDI A;  3TJF A;  5COH A;  1FAA A;  4IBP A;  4TXO A;  5JCW A;  3DIE A;  1WE0 A;  4IW9 A;  5BMU A;  2EIO A;  4L0U A;  2I3Y A;  2EIQ A;  10GS A;  3IE3 A;  1KBN A;  1Z9H A;  3MYD A;  2MZC A;  4AGS A;  1ERT A;  1G6Y A;  2P5Q A;  1W4V A;  2R6K A;  3I9V 2;  2B1K A;  3WGE A;  4K5S A;  1XFL A;  4K7I A;  1TU7 A;  1WWJ A;  4OWY A;  4GSS A;  3A5I A;  4HU9 A;  3APO A;  5KN2 A;  4DSS B;  2MYG A;  3AY8 A;  3P2A A;  2O8V B;  2LRN A;  2VCV A;  3FHK A;  3VWU A;  3CTF A;  1YQ1 A;  4BVY B;  4ZBD A;  1G7O A;  4ZL8 A;  2I1U A;  3EVI A;  1GP1 A;  4EXJ A;  4XIH A;  4KUN A;  1TTZ A;  2L4Q A;  2QKE A;  3G7Y A;  2N5B A;  1SL2 B;  4USS A;  3ME7 A;  3QAG A;  2DMM A;  3KXO A;  4RI6 A;  3M9K A;  1EV4 A;  3M8N A;  4IS0 A;  4N11 A;  1R5P A;  4MF5 A;  3D22 A;  3DXB A;  3O76 A;  2M80 A;  4J56 E;  2YAN A;  2YCD A;  4OCF A;  1G7E A;  3I69 A;  5DJM A;  4WR5 A;  2DKI A;  1SEN A;  5G2Z A;  4JR6 A;  1PQN A;  2HLS A;  1ABA A;  4K6X A;  2YV7 A;  1M2A A;  5KN3 A;  3PR8 A;  1BG5 A;  3CXG A;  1ST9 A;  3WYW A;  2L5O A;  1JZW A;  4GCI A;  4TN8 A;  4KAE A;  1DUG A;  1GL8 A;  4MF7 A;  3UAR A;  3BD2 A;  2V1M A;  3L9S A;  4MJB A;  4RQX A;  3W8J A;  4TOP A;  2FCH A;  5F05 A;  5C00 A;  2FWE A;  4FYU A;  2HSY A;  1U6T A;  2GLR A;  1TP9 A;  5HR0 A;  3ZRE A;  3NOF A;  5ABR A;  2TRC P;  1JHB A;  11GS A;  5F0G A;  5HFK A;  1ML6 A;  3Q74 A;  1TKD B;  1XVW A;  3VK9 A;  2HT9 A;  3A5W A;  1DSB A;  3TJK A;  1GRX A;  1V58 A;  3MDK A;  5G1K A;  2WUL A;  4ZB8 A;  3IHQ A;  2LST A;  2YZH A;  5G31 A;  2GQM A;  4MH2 A;  2VAF A;  4H86 A;  3D5J A;  1AAZ A;  4POK A;  4NMU A;  2KP2 A;  2JL4 A;  4V2M A;  5DCG A;  4PGT A;  3MAK A;  1ZL9 A;  1ZYE A;  4IGJ A;  1E6B A;  1GTI A;  1JZD A;  1K0D A;  3L9U A;  3HZ4 A;  5ECR B;  2WGR A;  3GH9 A;  2BJX A;  4CY6 A;  1YKC A;  3GX8 A;  2HZE A;  4O5U A;  1TK8 B;  1N2A A;  2CX4 A;  1HNB A;  2OBI A;  5B7C A;  1EV9 A;  4TRX A;  1AIU A;  2B3S A;  2IIY A;  2MMZ A;  4XS4 A;  1XCC A;  2CVD A;  3GNJ A;  4G10 A;  2K6V A;  2A2R A;  4PNF A;  5CYY A;  1OC8 A;  5DAK B;  3SWL A;  3WT1 A;  3TRQ A;  2L57 A;  1MDI A;  4ZB6 A;  1S3C A;  3GKM A;  2O87 A;  3VWW A;  5F06 A;  3G7J A;  1K0B A;  4MPG A;  1FVJ A;  2BTO T;  1NSW A;  4MAB A;  2H6X A;  4JED A;  3QPM A;  1NW2 A;  2DLX A;  1SYX A;  4HQZ A;  5IOX A;  1S3A A;  2CV4 A;  4ILF A;  1FHE A;  5ECN B;  5CNW A;  3MIX A;  4TR1 A;  4KDU A;  3J7Y b;  3A2X A;  3LSZ A;  4MCU A;  4WBR D;  2D2Z A;  4PXO A;  3F0I A;  3C7M A;  4Z2R A;  4KA0 A;  2GVP A;  1EZK A;  1PGT A;  3GA4 A;  1M9A A;  4HI7 A;  5C04 A;  3QR6 A;  1FW1 A;  1OC9 B;  3F63 A;  4OFT A;  2H1D A;  4O92 A;  2WRT A;  3ZFB A;  4MNN A;  5LD0 A;  3U6V A;  2RLI A;  3F8U A;  2LJK A;  5AIS A;  1FB6 A;  2E2G A;  1JZR A;  5ECQ B;  4OMV A;  4OD7 A;  5IMZ A;  3ZTL A;  1Z6N A;  3QFA C;  2H71 A;  1AQV A;  5L71 A;  1GH2 A;  3GHA A;  1AQX A;  2B5Y A;  3C71 A;  1TW9 A;  2VL9 A;  4KGI A;  1XWA A;  1GSU A;  3C1S A;  2YJH A;  1U3I A;  3J7Y k;  1KTE A;  2IWT A;  1F9M A;  2FUG 2;  5DAL A;  3TJJ A;  2CX3 A;  1YY7 A;  1MEK A;  2FD3 A;  3KP9 A;  3LGC A;  4O32 A;  2NTO A;  4WEY A;  3A2V A;  1LJR A;  3VI7 A;  1T4Y A;  1SJ6 A;  2DIZ A;  1YF0 A;  2TIR A;  1A0R P;  2R4V A;  2X8G A;  3D21 A;  1QGV A;  4E8E A;  3K8N A;  2P5R A;  1MDJ A;  4JZQ A;  5ID2 A;  5HR2 A;  2HRK A;  4L0W A;  2EC4 A;  1NHY A;  18GS A;  3EC3 A;  3LYK A;  1T3B A;  4NPB A;  2VM2 A;  4OO4 A;  4ECB A;  3CBU A;  4LL1 B;  3QAV A;  2H73 A;  1X5D A;  3W6G A;  2XPD A;  4TXV A;  2DJ3 A;  2WZ9 A;  3M9J A;  5J41 A;  1X5C A;  5CRG A;  4BL7 A;  5H5S A;  3L9V A;  2YV9 A;  2ZUP A;  4HOJ A;  2CQ9 A;  1M7T A;  2VO4 A;  2JZT A;  5AIX A;  1PD2 1;  3C8E A;  2LJA A;  2L6D A;  2LV3 A;  4NWY A;  4YKF A;  2IFQ B;  1K0M A;  3NIV A;  4MF6 A;  1Z7P A;  4EIQ A;  3UMA A;  2JSZ A;  2DML A;  1BYE A;  1M9B A;  2H76 A;  2HRN A;  4EIP A;  3UAP A;  5ENU A;  5CRH A;  3P7X A;  5J3R A;  1ZCP A;  4PQI A;  2JZR A;  2CVB A;  3HHV A;  3HJM A;  3VWX A;  1VGL A;  3FYG A;  4MP4 A;  2LJR A;  1PKZ A;  5G30 A;  1H4O A;  2WS2 A;  4MH3 A;  3UEM A;  1PKW A;  1YDK A;  3ZIJ A;  3E3E A;  3CMI A;  1Q4J A;  1EGR A;  5ECI B;  2LKU A;  2PN8 A;  4IQA A;  4OO5 A;  1A8L A;  3GYK A;  2HE3 A;  2LTK A;  3MWH A;  2VCT A;  4GQC A;  4KCE A;  1OAZ A;  4LMV A;  4KDX A;  2E7P A;  3KEB A;  2HRA A;  3H79 A;  2LQQ A;  1T00 A;  1OKT A;  2CA8 A;  2GZY A;  3BOA A;  1EP7 A;  4G0K A;  5D9T A;  1O8X A;  3TRX A;  3DEX A;  5IQY A;  1H75 A;  3UL3 A;  2LNT A;  1GTA A;  4GST A;  3LOR A;  4MJA A;  3ZRD A;  2B7K A;  1ZOF A;  4GXZ A;  1GUL A;  2HZF A;  3M0F A;  1XW6 A;  2HXK A;  4V1A p;  1SU9 A;  2PVQ A;  2B5E A;  4G0L A;  2GS3 A;  3EU4 A;  4QL9 A;  4DEJ A;  5J9C A;  3APS A;  2VD0 A;  1KNG A;  4K2X A;  3UOM A;  2B5X A;  4KSM A;  3HVS A;  2AUV A;  4XTS A;  2HRF A;  3FR9 A;  2LUS A;  3C73 A;  5BRT A;  1THO A;  4G19 A;  5ECM B;  1UA5 A;  1GUM A;  2H0I A;  2KUC A;  5GAP D;  1QQ2 A;  4Q5Q A;  5DDL A;  3TCO A;  4IKH A;  4ECJ A;  3F4S A;  3TOU A;  4F82 A;  3HJP A;  1HNA A;  3RHB A;  4NV5 A;  1DBY A;  5JWR B;  2F3M A;  4HEA 2;  3DVW A;  1Y25 A;  2DBC A;  5GZZ B;  2A4V A;  3ZIT A;  5GST A;  1PRX A;  2O85 A;  3A3T A;  1SD9 A;  1B9Y C;  2YWI A;  1BAY A;  1VF4 A;  1QUW A;  2MMN A;  3IAS 2;  2DKH A;  2YN1 A;  2E2M A;  1GNE A;  3FR3 A;  3L4N A;  3LJR A;  1PSQ A;  2AAW A;  5JWO B;  3LG6 A;  3HCZ A;  1O73 A;  4BVX A;  4D73 B;  4N30 A;  5KOX A;  3NZN A;  1TU8 A;  4KE3 A;  1FG4 A;  1CQH A;  2YPM A;  3ME8 A;  1T8E B;  2C80 A;  3ISO A;  4GF0 A;  4MMM A;  3GX0 A;  3LFL A;  1OYJ A;  2REM A;  2LRT A;  3FZ5 A;  3IHG A;  1QFN A;  2A2P A;  1M0U A;  1KEB A;  2UZ8 A;  2IPA A;  4HZ4 A;  1U3A A;  1WIK A;  1PX6 A;  4XS1 A;  3UIW A;  4X0X A;  1UVZ A;  1GLQ A;  3TKP A;  2OAD A;  2H66 A;  1XWB A;  5AN1 A;  2K8S A;  2RII A;  2V2G A;  3CSI A;  2DC5 A;  2MMO A;  4PQH A;  3VLN A;  2I9H A;  1X5E A;  4NHZ A;  4PUR A;  5CRD A;  4IHU A;  3KMO A;  4KND A;  2YWO A;  4CY8 A;  1M2B A;  3EUR A;  2VCQ A;  4MA9 A;  3QCP A;  1M2D A;  2VLU A;  4WKW A;  3LXT A;  2PBJ A;  1TRU A;  5H5Q A;  1F2E A;  3KIJ A;  3LEF A;  4XRA A;  1TRW A;  4FYB A;  4I5Q A;  4N0V A;  4PTS A;  1IYI A;  2HFD A;  4J57 E;  3QDN A;  1R4W A;  4WF4 A;  1YKA A;  3HVV A;  3TRP A;  4G0I A;  1GWC A;  1I9D A;  2DSA A;  3TOT A;  3KTL A;  1PN9 A;  2H0G A;  1G0T A;  4MZW A;  1XOA A;  2L59 A;  2CZ3 A;  3EMP A;  2ALB A;  4F0C A;  1B4Q A;  4POB A;  5CAX A;  3KM6 A;  3GL5 A;  1V2A A;  6GSX A;  2M46 A;  1V98 A;  4K7O A;  1FO5 A;  5CRE A;  1T1V A;  3ZMK A;  3UJ1 A;  2I4A A;  2C8U A;  5AIV A;  5ECS A;  1WRY A;  3O3T A;  4FQU A;  1Z5Y E;  3TJG A;  2R37 A;  1USB A;  5FHI A;  3GL3 A;  3F4T A;  3TUE A;  1T7P B;  1WOU A;  4J2F A;  3PH9 A;  2PPT A;  4BWQ A;  1ERW A;  4ML6 A;  3GKX A;  4RUV A;  1K3O A;  2Z9S A;  5A5K A;  3BBY A;  3VPT A;  1R7H A;  2QA2 A;  5A4U A;  3IBH A;  1AUC A;  5AGY A;  1Q98 A;  2LNS A;  1RQM A;  2H8L A;  2B7J A;  1EOH A;  4V2N A;  1SD8 A;  3RBT A;  2OJL A;  4I6X A;  2PU9 C;  3ZVJ A;  4IJI A;  2GT5 A;  3MNG A;  1VRS D;  2IMD A;  2MBS A;  3HXS A;  4GLT A;  4IN0 A;  2GZZ A;  3GUR A;  3UBL A;  4GSN A;  2I81 A;  2VM1 A;  4QQ7 A;  3IXR A;  2X8C A;  3F9U A;  2L5L A;  3DWV A;  4TXO B;  1AQW A;  1ERU A;  1F6M C;  2FNO A;  1B8X A;  3H93 A;  4CDO A;  2YJ7 A;  2J23 A;  3F4R A;  2AB6 A;  1BX9 A;  4TKY A;  4F03 A;  1JFU A;  4POM A;  2VL2 A;  4AJ6 A;  2A2S A;  4OCE A;  2IMI A;  1EWX A;  2GDR A;  3EU3 A;  3Q19 A;  3RPN A;  3F6F A;  1FVK A;  3TKQ A;  3FMW A;  1THX A;  4EDZ A;  1UC7 A;  2C4J A;  3GTU A;  3FZ4 A;  3EE2 A;  5INY A;  2JSY A;  3KP8 A;  2H1G A;  1TRV A;  4K2D A;  5CRW A;  4JBB A;  3DGQ A;  3N5O A;  2X8H A;  3MSZ A;  2ZCT A;  3GMF A;  1U88 A;  1MDK A;  5F07 A;  3ERG A;  5D9X A;  4O5Q A;  2B6M A;  1K3L A;  4PNG A;  2GT6 A;  4KSO A;  1XPV A;  3R3E A;  4GTU A;  1WPI A;  4K1F A;  2DJK A;  2VUP A;  3EPT A;  2V6O A;  3P8W A;  1Z6M A;  5DQS A;  1GUH A;  1OC3 A;  3HD5 A;  4HJ2 A;  4ZIL A;  2C1Y A;  3F6D A;  3LYP A;  3TKS E;  3HY2 A;  4P3Y B;  1O8W A;  3CTG A;  5IMD A;  4RQR A;  5J9B A;  3IR4 A;  2X64 A;  4I8B A;  1BJX A;  5FT3 A;  1Z3E A;  3WT2 A;  3FY7 A;  3ZVJ D;  1JLW A;  1TOF A;  1SKR B;  3TKS A;  2DIY A;  3KTB A;  4DSS A;  3HJO A;  3P90 A;  5KOW A;  1QMV A;  2KHP A;  1QK8 A;  4PUF C;  1K0N A;  3D0Z A;  1B9X C;  1QXH A;  12GS A;  3KD0 A;  5HFI A;  1NHO A;  2YOI A;  2FA4 A;  3A2W A;  2GTU A;  1K0C A;  3FW2 A;  4BVY A;  1V40 A;  1HYU A;  2KP1 A;  3APQ A;  2JAC A;  3KH9 A;  3RDW A;  4EE0 A;  1B4P A;  2OAC A;  2GQK A;  5IMV A;  3SBC A;  5EVO A;  4EDY A;  3ZIV A;  3IDV A;  5IMC A;  4MZC A;  5G5F A;  2H74 A;  3BCI A;  3Q6O A;  1K3Y A;  4IP1 A;  2F8F A;  3F3Q A;  19GS A;  1O6J A;  1J9B A;  3PGT A;  5ELG A;  2FWH A;  4ZL7 A;  2NDO A;  2AV4 A;  1XWC A;  2X4A A;  1IYH A;  3R2Q A;  2K8V A;  3LQ7 A;  3GFK A;  5H5R A;  3WGD A;  3E0U A;  5DBQ A;  2GQL A;  3HYP A;  3KCM A;  3D4T A;  5EPF A;  3JCM L;  4JRR A;  2JAD A;  1BED A;  2WDU A;  1ACV A;  4N10 A;  2K18 A;  1GTU A;  6GSU A;  1WP0 A;  2H0H A;  1SJZ A;  1PMT A;  6GSY A;  3UBK A;  5GAN D;  2LS5 A;  2YZU A;  2CAI A;  2LRC A;  4LLR A;  4I2U A;  4EO3 A;  3W8S A;  1ON4 A;  3GKK A;  4K0N A;  4OFM A;  4MDC A;  2HZE B;  4K8M A;  4Q5N A;  2KLX A;  4ICY A;  2AJQ B;  3Q18 A;  5CO3 A;  1XOB A;  4HZ2 A;  4YH2 A;  2G0F A;  4FYC A;  1YF1 A;  4F0B A;  4IVF A;  4XS4 B;  2V32 A;  3H4K A;  3UVT A;  3V1W A;  1GSY A;  3O6T A;  1R26 A;  2VCZ A;  3GN3 A;  3E9J B;  1E2Y A;  1F3A A;  3HVX A;  4Q5F A;  2RUF A;  2HSM A;  2R0C A;  2MMA A;  2P0G A;  2VOC A;  3D6I A;  4HQS A;  1X0R A;  1XW5 A;  3IOS A;  2NBS A;  4X1U A;  4FO5 A;  2M72 A;  5E4W A;  4O7H A;  3ZZX A;  6GSS A;  4ID0 A;  1A2L A;  1ZYQ B;  2IMF A;  2ON7 A;  4LMW A;  5D8I A;  4ZBA A;  4EVM A;  4TR4 A;  2K9F A;  2N5F A;  2FY6 A;  3HKR A;  4TR1 B;  2B1L A;  3N9J A;  1GSE A;  1LU4 A;  4YQM A;  1XWG A;  2XBI A;  6GST A;  2PER A;  1A23 A;  3GSS A;  2YWM A;  2HI7 A;  3LXZ A;  5IMF A;  5DAK A;  5IO0 A;  3GIX A;  1SK0 A;  1VF1 A;  2PWJ A;  1SYR A;  1OE8 A;  2LEG A;  4YAP A;  1I5G A;  1OKD A;  3HA9 A;  5B8A A;  4BWS A;  2H75 A;  4Z2U A;  5LCZ A;  6GSV A;  1SK2 A;  1DE1 A;  2H1B A;  1W89 A;  4Q5R A;  4AF2 A;  1ZMA A;  2PMT A;  4CW9 A;  9GSS A;  3WGX A;  5ECL B;  3TJB A;  1FOH A;  4YQU A;  1HNC A;  1XW9 A;  2G2Q A;  3C1R A;  2VL2 C;  5HR3 A;  4HJM A;  17GS A;  2CVK A;  4O5R A;  5DAL B;  2CZ2 A;  1HD2 A;  3FK8 A;  2PGT A;  1U87 A;  1NM3 A;  5ECH B;  2H01 A;  1XIY A;  4DSQ A;  2TRX A;  2HYX A;  2OE3 A;  4XHM A;  1EP8 A;  5D93 A;  4JE1 A;  1FOV A;  4NAX A;  2A4H A;  1OC9 A;  1XVQ A;  1XWK A;  4AJ8 A;  2AYT A;  2J9H A;  1G6W A;  5ID2 B;  2RUE A;  1X9M B;  1YZX A;  2VCW A;  4HDE A;  4L5L A;  16GS A;  4TW5 A;  1UN2 A;  2QC7 A;  1X9S B;  4G9H A;  1GSF A;  1MTC A;  2C0E A;  5ECP B;  1O7U A;  1Z7R A;  2NVL A;  4OFN A;  3IK9 A;  3IPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...