3EYTA

Crystal structure of thioredoxin-like superfamily protein spoa0173
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
156
structure length
156
Chain Sequence
SNAMKAPELQIQQWFNSATDLTLADLRGKVIVIEAFQMLCPGCVMHGIPLAQKVRAAFPEDKVAVLGLHTVFEHHEAMTPISLKAFLHEYRIKFPVGVDQPGDGAMPRTMAAYQMRGTPSLLLIDKAGDLRAHHFGDVSELLLGAEIATLLGEAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein SPOA0173
publication title Crystal structure of Thioredoxin-like superfamily protein SPOA0173
rcsb
source organism Silicibacter pomeroyi
total genus 42
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3eytA00
3HZ8A 4G9HA 3EINA 3H4KA 4K7NA 4HS1A 5F06A 4KCAA 1G7EA 2IMDA 4AF2A 4ZB8A 5GSSA 2VCVA 3ERWA 2MBSA 3H93A 2B3SA 2B1KA 2V6OA 2OBIA 3GNJA 3HVVA 4G19A 4ZBAA 3D0ZA 17GSA 2IFQA 5CP1A 2M72A 3ZFLA 4DVCA 3G7JA 4WETA 1EEMA 3LQ7A 3KTBA 4PQHA 1QFNA 2OJLA 2REMA 1O8WA 4OD7A 4L0UA 1EV9A 4XHMA 3UBLA 4V2MA 4IVFA 2V6KA 1E6BA 2QGVA 3L9UA 2DLXA 2LNTA 1TDIA 2HRFA 2AAWA 4DSQA 5ID2B 5DBQA 5DJMA 3WT1A 1V57A 1BJXA 5E59A 2DIYA 3BBYA 1SKSB 4TN8A 2HE3A 3A2VA 1XBSA 5JCWA 4K8MA 3W6GA 5D96A 4OMVA 3F63A 2R3XA 1GSEA 2JSYA 1SKRB 1R4WA 1B9XC 4F0CA 1XXUA 1V9WA 4K0GA 2CV4A 5J5NA 5G30A 1OC9A 2LV3A 5D8IA 4IQAA 1A8YA 1JZOA 1GRXA 3ZFBA 1X9MB 4MZBA 1EOGA 2H6ZA 3D4MA 4KSOA 1OYJA 4F0BA 2LS5A 2YZUA 1M2AA 2GSTA 1UVZA 4MMMA 2WB9A 6GSSA 2DJ0A 1M7TA 4J56E 1ZL9A 2RLIA 1X9WB 1S3AA 2AJQB 2H73A 3KP9A 4MJCA 2CVDA 3EMPA 3LJRA 1BG5A 2ON5A 1SL2B 3G9BA 1BEDA 3C1SA 4HDEA 1SENA 1SJZA 1MDIA 4I2TA 3ME7A 4I97A 5CRHA 3GTUA 2JADA 3MWHA 5G5FA 2LTKA 1SKWB 1VF4A 4V2LA 4EDYA 1AQWA 1SJIA 1TRWA 1TJDA 2H6YA 3ZLPA 3TJGA 1PGTA 5KN0A 1MD4A 4HUAA 3TUEA 4KB3A 1FG4A 1ILOA 2Z9SA 3R2QA 4E8HA 4N0VA 4WR4A 2O87A 4K9ZA 1AC1A 1PMTA 2WCIA 2R2JA 1U87A 3HVXA 1TOFA 2OA7A 5F07A 5J4UA 3P90A 1THXA 1K0OA 1M9AA 3H8QA 4ZILA 1HNCA 5ENUA 3F0IA 1YF1A 3ZIJA 3G7YA 4BPYA 1TXXA 4MZWA 2OE1A 5L71A 5DQSA 4I8BA 3MNGA 2VAFA 4CHSA 3HYPA 2V32A 1ON4A 3J7Yk 1FVJA 4N10A 2MBTA 2CX3A 5GAND 1GLPA 1K0AA 3ZZXA 3KTLA 5GSTA 1TU8A 10GSA 4ZL7A 3LXZA 5D93A 5DALB 3VPTA 3G7IA 2H1AA 1YZXA 1G6YA 2HNLA 3ZMLA 2P31A 1RW1A 1MTCA 1XWBA 1CQHA 3UOMA 3TKSC 4KE3A 4WF4A 3HA9A 2V41A 1OE7A 2X8GA 2PUKC 3L9VA 1N2AA 2AUVA 4WBJA 1GTAA 3WGXA 2HT9A 2VL2C 2E7PA 2L5OA 1ST9A 4G2EA 4HQSA 5JWOB 4OFNA 2FA4A 5IMCA 3NOFA 4HU9A 1U3IA 4TXOA 2LJRA 2E2GA 3UEMA 1JHBA 1K0DA 3LGCA 4D73B 3FW2A 2C8UA 2O89A 2LRCA 3TKSA 3W8JA 2JSZA 4L8EA 3M9JA 3PGTA 1KNGA 3RPPA 1O7UA 1PL2A 2VL2A 3AY8A 3I9V2 1XW6A 1THOA 3MSZA 1F2EA 1E2YA 2GT6A 1DE2A 1K0NA 4NWYA 4KH7A 4BL7A 3GKNA 4ZBDA 5IIZA 1GSYA 1EGOA 1U3AA 3HY2A 4V2NA 2GSSA 5FT3A 1ZYEA 2RIIA 1SYRA 1WJKA 4ECJA 2FCHA 2DIZA 5HR2A 1WE0A 4MCUA 1Z3EA 1SYXA 5DJLA 3QPMA 4IP6A 1QXHA 5IOXA 2V1MA 3TRPA 2HZFA 4LMWA 8GSSA 1X9SB 1XW5A 1UC7A 4IELA 3IDVA 3IA1A 5ELAA 3ISOA 1EEJA 3I69A 4PNFA 2GGTA 3W8SA 5EL8A 22GSA 4MDCA 3KMOA 1AW9A 3UARA 2YJHA 3ZL5A 3UVTA 4GSTA 4IS0A 2GSQA 2VOCA 3IE3A 1F3BA 2JU5A 3E3EA 1IYIA 2I9HA 1BAYA 4FH8A 4GQCA 2IFQB 4JU5A 3M0FA 5C04A 3UJ1A 2B5YA 3IBHA 1AQXA 2YNXA 5G1LA 4GTUA 2VCQA 1O73A 2DJ1A 2C1YA 4ECCA 1BQ7A 3EU4A 1FB6A 5HFKA 3TRXA 4PUAA 5KN1A 2FWFA 1A23A 5IPHA 2GQLA 3DIEA 5EVOA 1GP1A 2KHPA 3D22A 1TW9A 4RI6A 5G1KA 3FEUA 4ZIJA 1HNAA 1XPVA 5AIXA 5IMAA 4HU7A 4TW5A 4XS4A 3GN3A 1I9DA 4HZ4A 4NXIA 2L57A 3WGDA 1Z7PA 5HFGA 1HQOA 1HYUA 1OKDA 4LLRA 5LNKe 2L4QA 4FIWA 2DJKA 4XIHA 3VURA 4KAEA 5CRGA 2PU9C 3KXOA 1AAZA 3QAWA 4HOJA 3GHAA 5B6NA 4GSNA 3F6FA 5GAPD 2H71A 3VWXA 4RI7A 4EVMA 14GSA 2DBCA 2I1UA 1O85A 2HFDA 5DVBA 2JL4A 1Z6MA 2K18A 3VPQA 1ZOFA 3IAS2 1IYHA 2I4AA 2H0GA 9GSSA 3DKSA 5ECPB 4MZCA 3WYWA 3UL3A 3WD6A 4IJIA 5IPGA 3FRCA 4YAPA 1QGVA 2VUPA 5F05A 2YOIA 2GQKA 4N11A 3GTUB 4IHUA 3EVIA 4P3YB 3KJYA 3GKMA 3TKRA 3LEFA 1N8JA 5KN2A 1ML6A 2DMLA 4EXJA 3BJ5A 3HHVA 5D73A 3GL5A 5HR0A 3LSZA 1FO5A 4WF5A 4TVEA 1XOAA 1B4QA 4XTSA 4DSRA 2EIRA 3EE2A 12GSA 1ERWA 1TRUA 3QD9A 4IP1A 1EOHA 1PL1A 4O92A 1AUCA 2C3NA 4XRAA 1XIYA 1WP0A 4MF7A 3CSJA 4Q5RA 4JR6A 1M0UA 1YY7A 3NIVA 7GSSA 3TRQA 1J0FA 2FNOA 1TI1A 2PPTA 4TR4A 2C0DA 2ON7A 1O6JA 5ECRB 2L4CA 3QMXA 5EPFA 3TJFA 2KP2A 1GLQA 3HZ4A 1DE1A 3LG6A 3O3TA 1W4VA 5IMVA 3RDWA 1OE8A 1A2JA 3QCPA 3A2WA 4FYCA 4KDYA 3H79A 3DMLA 1WRYA 2C0EA 2L6DA 2LEGA 1UA5A 4ZB9A 1NW2A 3C71A 4FO5A 1F3AA 4MJEA 3TJKA 1TRVA 3L0HA 4Q5QA 3V1WA 2AV4A 3FR9A 3GYKA 1VRSD 4EE0A 1K0BA 4TXOB 4OFTA 1YF0A 1DUGA 3NZNA 4BWSA 3KH7A 2MMNA 1K3OA 3RHBA 1VF1A 1AQVA 4LL1B 3QDNA 3TDGA 3F3QA 1ERVA 2VM1A 2IJYA 4QQ7A 3TKQA 6GSYA 5LD0A 2R37A 2GS3A 3RAZA 1SK1A 5D9WA 3FHKA 1PX7A 2HZEA 3CTGA 3P2AA 3Q6OA 3C8EA 1MDJA 3VI5A 2I81A 4JZQA 1XW9A 2DSAA 4MP4A 4MF5A 1A0FA 3PINA 2FD3A 3IAM2 1AIUA 2A2SA 3KIJA 4ZBBA 1O8XA 1B48A 4V1Ag 1NSWA 2MMZA 2PN8A 3ZVJA 1UN2A 3ERGA 1XZOA 2FGXA 3F8UA 5EY6A 4KDXA 6GSTA 4IBPA 3KM6A 2VCWA 3MAKA 4MA9A 13GSA 1KEBA 5DCHA 1T1VA 4AJ8A 4XS6A 2L59A 2PERA 3LORA 4GXZA 3EC3A 3UAPA 5FHIA 3ME8A 1PD21 2VCXA 3TCOA 3EURA 3EYTA 1T4YA 6GSXA 3A3TA 2YPMA 1FW1A 4H86A 4RQRA 3CYNA 4GSSA 4PQ1A 5IOWA 3VI7A 1GWCA 4ZL8A 4LA1A 3I43A 4NPBA 2F51A 4FYUA 3BCKA 5ECLB 4YQUA 3E0UA 1EP7A 4MJAA 5KEJA 4TKYA 4TR0A 1GSSA 4PX1A 1RK4A 2VO4A 3IOSA 3N9JA 2O8VB 2DMMA 3QOUA 3LFLA 5IMFA 3KD0A 4IQ1A 1PQNA 4POBA 4XRDA 4EF0A 4ILFA 1M2DA 1RQMA 3GX0A 2C3QA 1YEPA 1EP8A 4EL1A 3TJBA 3Q19A 4F9ZA 2FLSA 2C3TA 2IN3A 3D5JA 3L4NA 4TR1A 5G31A 4WR5A 3KGKA 2R6KA 4XS4B 1QQ2A 1JZRA 4E8EA 2F3MA 2HXKA 4IN0A 1ZGNA 1NHOA 3M8NA 1WPIA 3EMXA 2CZ3A 3ERFA 3ZTLA 5DAKA 4POMA 1U6TA 3C7MA 2N5AA 4K2DA 4YAVA 2XHFA 2VCZA 1K0MA 3CTFA 2XBQA 4ECBA 2L5LA 2H8LA 1T00A 2VD0A 4PXOA 1MDKA 4K1FA 2YV9A 5E4WA 5JWRB 2J23A 3CRTA 3E9JB 4ULXA 1FHEA 3HD5A 1Y25A 1GSUA 2OE0A 19GSA 4O7HA 1PN9A 3IXRA 2K6VA 1URMA 1WWJA 2HI7A 3QFBC 5D9VA 4QL9A 1X5DA 1PSQA 3CSHA 1TRSA 1SL0B 3VWVA 5C00A 3KH9A 2X64A 5D9XA 2MYGA 2DJ2A 2H6XA 2B6MA 3L9SA 4KCEA 2H19A 5ECIB 4CDOA 4IGJA 3FZAA 3GV1A 1BX9A 2H0IA 4L5OA 4O5RA 1S3CA 1ZZYA 3VK9A 4WXTA 1F9MA 2LRNA 4JE1A 4NHZA 2AHEA 5ECNB 1B8XA 3N5OA 2LJAA 1X5EA 2WJUA 3GFKA 4WEYA 1A24A 3CXGA 2YCDA 2YZHA 1LBKA 1GNWA 1GSFA 2MMAA 2CX4A 3CBUA 3GH9A 1T3BA 1YJ6A 3IK9A 3ZRDA 5H5QA 2GSRA 4WBRD 2BMXA 1SL1B 2YWNA 4MJBA 4NHWA 2TRXA 2VCTA 1M99A 5A4WA 16GSA 3H1NA 1JLVA 4OCEA 2FWHA 4J57E 4O32A 5HQPA 3QFAC 1K3YA 1TK8B 1GTIA 1Z6NA 2H1GA 1OAZA 3JCML 3KZQA 3M1GA 3GKKA 3O76A 5HFIA 4PURA 1SK0A 4ZL9A 3F4SA 5F0GA 5IO2A 1GSQA 3GUSA 5AISA 4XCSA 1SD9A 1XVWA 4HEA2 3TOUA 1TK0B 3UVHA 3CRUA 5IMZA 3C1RA 2YN1A 4EC0A 3RBTA 2KLXA 3US3A 2GVPA 3VWWA 1MEKA 4KDUA 4PQIA 4FYBA 3QAVA 3DGQA 1YEXA 2ZCTA 3P8WA 2WRTA 2HZEB 3UBKA 3F6DA 2FY6A 4EO3A 1ERTA 4AJ7A 1X0RA 5LCZA 1OVNA 2GZYA 2X8CA 2FA8A 3TGZA 2N5FA 1GL8A 4YQMA 1G0TA 2P5QA 3RPNA 1FVKA 4YH2A 2LQQA 2QKEA 2TRCP 4PGTA 2H30A 2C0FA 3P7XA 4GLTA 4HJ2A 2YANA 2J9HA 2CAQA 3WGEA 2H1DA 2HYXA 2TIRA 2IMIA 3QR6A 3BOAA 2IMKA 2H74A 5CRWA 1A2MA 1Q4JA 4AGSA 1VGLA 2WULA 2FHEA 1VF3A 4X1UA 2E2MA 3UMAA 4EUYA 5ABRA 2NTOA 3TKSE 2LSTA 2VLTA 2EIOA 3ZVJD 5J9BA 2XBIA 3FK8A 1EZKA 2GZZA 4F2IA 2MZCA 1QUWA 1XFLA 2PBJA 1X5CA 4BVYA 1PX6A 2F9SA 4PUFC 3BD2A 2H66A 4NAXA 1GTUA 2F8FA 2CA8A 2K8VA 4PNGA 2YWMA 3CMIA 2M46A 3IC4A 2QC7A 1ACVA 1B4PA 3HVSA 3TJJA 1USBA 2WDUA 4ACSA 4F03A 1AXDA 4V1Ap 3DWVA 3EWLA 2LJKA 4TR1B 3VFIA 2X8HA 4XS1A 3M3MA 3GSSA 3GL3A 4LL4B 1J08A 2WGRA 3KCMA 5CO3A 2DJJA 1O81A 4HQZA 3LYKA 5ECHB 2NBSA 3SWLA 3DVXA 2KOKA 5F8BA 1XWGA 3HJPA 2JACA 3EU3A 3OR5A 5DAKB 1G6WA 2YWOA 5JWQB 1Z9HA 4L5LA 1HD2A 1WMJA 2IPAA 4ML1A 1A2LA 1JLWA 5AN1A 2XPDA 3DYRA 4HZ2A 2GZPA 2NDOA 2FWEA 4NMUA 4QL7A 1K0CA 1M9BA 4GCIA 5FWGA 1Z7RA 5AGYA 4ISDA 3F4TA 4BVXA 1CQGA 4ECIA 2E0QA 2PVOC 4GRFA 4OO4A 3GURA 4K7OA 2PMTA 4TXVA 2K8SA 1DSBA 2H01A 2OE3A 4DSSA 1A0RP 1V2AA 4X0XA 2OKAA 1GNEA 2RM5A 5A5KA 6GSWA 5IQYA 3GIXA 5ECSA 2IMEA 1VF2A 3PR8A 4IW9A 5JCUA 2ES7A 3BCIA 3VWUA 3LYPA 5DCGA 4KGIA 2EC4A 1R5AA 2OACA 1SU9A 2HRNA 4ID0A 4POLA 4KA0A 4KW6A 3ZREA 4ZXGA 5D9TA 1XVQA 2MMOA 1R26A 4K6XA 1LJRA 1Y6EA 4F82A 2I3YA 3IHQA 6GSUA 2B1LA 5G2ZA 5JCGA 4Z7XA 1YDKA 2RUEA 5CNWA 1A8LA 2R5GA 3O6TA 1PKZA 5COHA 4JRRA 3DVWA 1TKDB 3TOTA 1ZYQB 4TR3A 2F8AA 1XOBA 5B7CA 4I6XA 2PGTA 5B6MA 1H75A 2LQOA 2VM2A 4NV5A 1JFUA 4GF0A 2LUSA 1TU7A 3DEXA 4OO5A 3ED3A 3HKRA 1JZWA 3FKFA 2CQ9A 2M80A 2CAIA 1YKCA 3RHCA 3U6VA 2RUFA 4MF6A 4K0NA 4ZB6A 4KSMA 2CVBA 3APQA 5CRDA 3HCZA 3ZIVA 3FZ5A 1J9BA 3KP8A 5INYA 4I5QA 3D6IA 4I2UA 4ML6A 1MD3A 1OKTA 5IMDA 1T7PB 2H0HA 1F37A 2JZTA 2C0GA 2B7KA 2OBKA 3KMNA 4MPGA 1PKWA 3IR4A 3D21A 4IJ3A 4IKHA 5CYYA 1YQ1A 2WFCA 1JZDA 3Q18A 2O85A 5ID2A 1TP9A 4X43A 2C4JA 4JEDA 5DDLA 2CVKA 2EIQA 2QSIA 1F6MC 2ZUPA 1I5GA 5CAXA 2DC5A 3DRNA 5B8AA 2HSYA 4BWQA 3FR6A 2GDRA 1QMVA 2PVQA 2O7KA 3DXBA 1Z5YE 1GUMA 5ECKB 3APOA 2VD1A 1SD8A 2ZNMA 3U5RE 1GTBA 5ECMB 2L6CA 2FUG2 2G0FA 1GSDA 1S3DA 2LKUA 1DBYA 2K9FA 4AJ6A 5IM9A 2YP6A 2IMFA 3ZMKA 5J9CA 2WS2A 5KN3A 2B5EA 5J3RA 1SJ6A 2YWIA 3GX8A 4YQVA 1OC3A 4POKA 3K8NA 3GH6A 1WOUA 4TOPA 4MH2A 1U88A 3C73A 1NM3A 1W89A 20GSA 2R4VA 4HJMA 3QAGA 1H4OA 3A2XA 3VLNA 2H75A 2FWGA 3IV4A 3APSA 4N30A 4BA7A 3FY7A 2GTUA 4MABA 3FZ9A 4KUNA 5G5EA 1EGRA 2LNSA 2BTOT 2H76A 2ALBA 2BJXA 3HDCA 5IO0A 3LXTA 2C80A 5ECQB 3ZYWA 2DJ3A 4LMVA 5H5RA 2D2ZA 4NV2A 2H72A 1XCCA 2N5BA 1ZCPA 1OC8A 2JZSA 1XWCA 1YKAA 3FYGA 4G10A 1ABAA 1QK8A 1NHYA 2GT5A 2VIMA 1GULA 5HR1A 2V2GA 3TKPA 2YV7A 3I6AA 4Q5NA 3F4RA 5AIVA 3ZITA 3L78A 2LRTA 2XPEA 4RQXA 5A4UA 2X99A 1TI3A 4EDZA 3GA4A 5GZZB 3HXSA 3PH9A 3D4TA 2CT6A 1XWAA 3F9UA 1GUKA 1C72A 2B5XA 18GSA 2NPBA 1PRXA 3GKXA 3GSTA 1EV4A 3KEBA 1FAAA 3FZ4A 2IL3A 3J7Yb 4GQFA 1V98A 4KNDA 5DALA 5B8BA 3CSIA 2VL3A 2IIYA 2HLSA 3LWAA 1WIKA 1SK2A 1T8EB 1M2BA 3IRAA 1LU4A 1EWXA 5J41A 2WZ9A 2IWTA 1PA3A 2KUCA 4HI7A 3Q74A 5HR3A 2G2QA 2CZ2A 1R7HA 4OWYA 1V40A 2H1BA 4CW9A 2A4VA 2YJ7A 2PWJA 1TTZA 4MH3A 2HSHA 4MLYA 2A2RA 2JZRA 4RUVA 3FR3A 4OCFA 3HJMA 1OC9B 2VL9A 3IPZA 1FB0A 5A4VA 1ZMAA 3M9KA 3GRXA 3MDKA 3TB2A 2AYTA 4D73A 1KBNA 4DSSB 2H70A 5DQYA 1GUHA 1GH2A 2P0GA 1V58A 2AB6A 2VLUA 1G7OA 4MPFA 4K7IA 4DEJA 1ERUA 3A5WA 5ELGA 4N0ZA 2B7JA 2OADA 4GWRA 5H5SA 3WT2A 4EKZA 5ECOB 4JBBA 4Q5FA 2VLVA 4WKWA 2GQMA 2XC2A 2RM6A 1T4ZA 4J2FA 1KTEA 2KP1A 4JR4A 1B9YC 1XWKA 3SBCA 3GMFA 3UIWA 6GSVA 3IK7A 4OFMA 1Q98A 2NVLA 4L0WA 5CREA 3DD3A 4MK3A 3HJOA 1TK5B 3F3RA 1BYEA 1K3LA 1R5PA 4TRXA 4KX4A 11GSA 1HNBA 2P5RA 3S9FA 1FOVA 2GLRA
chains in the Genus database with same CATH superfamily
3HZ8A 4G9HA 3EINA 1ZYPA 3H4KA 4K7NA 4HS1A 5F06A 4KCAA 1G7EA 2IMDA 4AF2A 4ZB8A 5GSSA 2VCVA 3ERWA 2MBSA 3H93A 1S3RA 2B3SA 2B1KA 2V6OA 2OBIA 3GNJA 3HVVA 4G19A 4ZBAA 3D0ZA 17GSA 4EIQA 2IFQA 5CP1A 2M72A 3ZFLA 4DVCA 3G7JA 4WETA 1EEMA 3LQ7A 3KTBA 4PQHA 1QFNA 2OJLA 2REMA 1O8WA 4OD7A 4L0UA 1EV9A 4XHMA 3UBLA 4V2MA 4IVFA 2V6KA 1E6BA 2QGVA 3L9UA 2DLXA 2LNTA 1TDIA 2HRFA 2AAWA 4DSQA 5ID2B 5DBQA 5DJMA 3WT1A 1V57A 1BJXA 5E59A 2DIYA 3BBYA 1SKSB 4TN8A 2HE3A 3A2VA 1XBSA 5JCWA 4K8MA 3W6GA 5D96A 4OMVA 3F63A 2R3XA 1GSEA 2JSYA 1SKRB 1R4WA 1B9XC 4F0CA 1XXUA 1V9WA 4K0GA 2CV4A 5J5NA 5G30A 1OC9A 2LV3A 4CY6A 5D8IA 4IQAA 1A8YA 1JZOA 1GRXA 3ZFBA 1X9MB 4MZBA 3LW9A 1EOGA 2H6ZA 3D4MA 4KSOA 1OYJA 4F0BA 2LS5A 2YZUA 1M2AA 2GSTA 1UVZA 4MMMA 2WB9A 6GSSA 2DJ0A 1M7TA 4J56E 1ZL9A 2RLIA 4K5RA 1X9WB 1S3AA 2AJQB 2H73A 3KP9A 4MJCA 2CVDA 3EMPA 3LJRA 1BG5A 2ON5A 1SL2B 3G9BA 1BEDA 3C1SA 4HDEA 1SENA 1SJZA 1MDIA 4I2TA 3ME7A 4I97A 5CRHA 3GTUA 2JADA 3MWHA 5G5FA 2LTKA 1SKWB 1VF4A 4V2LA 4EDYA 1PFOA 1AQWA 1SJIA 1TRWA 1TJDA 2H6YA 3ZLPA 3TJGA 1PGTA 5KN0A 1MD4A 4HUAA 3TUEA 4KB3A 1FG4A 1ILOA 2Z9SA 3R2QA 4E8HA 4N0VA 4WR4A 2O87A 4K9ZA 1AC1A 1PMTA 2WCIA 2R2JA 1U87A 3HVXA 1TOFA 2OA7A 5F07A 5J4UA 3P90A 1THXA 1K0OA 1M9AA 3H8QA 4ZILA 1HNCA 5ENUA 3F0IA 1YF1A 3ZIJA 3G7YA 4BPYA 1TXXA 4MZWA 2OE1A 5L71A 5DQSA 4I8BA 3MNGA 2VAFA 4CHSA 3HYPA 2V32A 1ON4A 3J7Yk 1FVJA 4N10A 2MBTA 2CX3A 5GAND 1GLPA 1K0AA 3ZZXA 3KTLA 5GSTA 1TU8A 10GSA 4ZL7A 3LXZA 5D93A 5DALB 3VPTA 3G7IA 2H1AA 1YZXA 1G6YA 2HNLA 3ZMLA 2P31A 1RW1A 1MTCA 1XWBA 1CQHA 3UOMA 3TKSC 4KE3A 4WF4A 3HA9A 2V41A 1OE7A 2X8GA 2PUKC 3IHGA 3L9VA 1N2AA 2AUVA 4WBJA 1GTAA 3WGXA 2HT9A 2VL2C 2E7PA 2L5OA 1ST9A 4G2EA 4HQSA 5JWOB 4OFNA 2FA4A 5IMCA 3NOFA 4HU9A 1U3IA 4TXOA 2LJRA 2E2GA 3UEMA 1JHBA 1K0DA 3LGCA 4D73B 3FW2A 2C8UA 2O89A 2LRCA 3TKSA 3W8JA 2JSZA 4L8EA 3M9JA 3PGTA 1KNGA 3RPPA 1O7UA 1PL2A 4CY8A 2VL2A 3AY8A 3I9V2 1XW6A 1THOA 3MSZA 1FOHA 1F2EA 1E2YA 2GT6A 1DE2A 1K0NA 4NWYA 4KH7A 4BL7A 3GKNA 4ZBDA 5IIZA 1GSYA 1EGOA 1U3AA 3HY2A 4V2NA 2GSSA 5FT3A 1ZYEA 2RIIA 1SYRA 1WJKA 4ECJA 2FCHA 2DIZA 5HR2A 1WE0A 4MCUA 1Z3EA 1SYXA 5DJLA 3QPMA 4IP6A 1QXHA 5IOXA 2V1MA 3TRPA 2HZFA 4LMWA 8GSSA 1X9SB 1XW5A 1UC7A 4IELA 3IDVA 3IA1A 5ELAA 3ISOA 1EEJA 3I69A 4PNFA 2GGTA 3W8SA 5EL8A 22GSA 4MDCA 3KMOA 1AW9A 3UARA 2YJHA 3ZL5A 3UVTA 4GSTA 4IS0A 2GSQA 2VOCA 3IE3A 1F3BA 2JU5A 3E3EA 1IYIA 2I9HA 1BAYA 4FH8A 4GQCA 2IFQB 4JU5A 3M0FA 5C04A 3UJ1A 2B5YA 3IBHA 1AQXA 2YNXA 5G1LA 4GTUA 2VCQA 1O73A 2DJ1A 2C1YA 4ECCA 1BQ7A 3EU4A 1FB6A 5HFKA 3TRXA 4PUAA 5KN1A 2FWFA 1A23A 5IPHA 3A5IA 2GQLA 3DIEA 5EVOA 1GP1A 2KHPA 3D22A 1TW9A 4RI6A 5G1KA 3FEUA 4ZIJA 1HNAA 1XPVA 5AIXA 5IMAA 4HU7A 4TW5A 4XS4A 3GN3A 1I9DA 4HZ4A 4NXIA 2L57A 3WGDA 1Z7PA 5HFGA 1HQOA 1HYUA 1OKDA 4LLRA 5LNKe 4MNNA 3EPTA 2L4QA 4FIWA 2DJKA 4XIHA 3VURA 4KAEA 5CRGA 2PU9C 3KXOA 1AAZA 3QAWA 4HOJA 2X49A 3GHAA 5B6NA 4GSNA 2R0PA 3F6FA 5GAPD 2H71A 3VWXA 4RI7A 4EVMA 14GSA 2DBCA 2I1UA 1O85A 2HFDA 5DVBA 2JL4A 1Z6MA 2K18A 3VPQA 1ZOFA 3IAS2 1IYHA 2I4AA 2H0GA 9GSSA 3DKSA 5ECPB 4MZCA 3WYWA 3UL3A 3WD6A 4IJIA 5IPGA 3FRCA 4YAPA 1QGVA 2VUPA 5F05A 2YOIA 2GQKA 4N11A 3GTUB 4IHUA 3EVIA 4P3YB 3KJYA 3GKMA 3TKRA 3LEFA 1N8JA 5KN2A 1ML6A 2DMLA 4EXJA 3BJ5A 3HHVA 4Z2UA 5D73A 3GL5A 5HR0A 3LSZA 4YKGA 1FO5A 4WF5A 4TVEA 1XOAA 1B4QA 4XTSA 4DSRA 2EIRA 3EE2A 12GSA 1ERWA 1TRUA 3QD9A 4IP1A 1EOHA 1PL1A 4O92A 1AUCA 2C3NA 4XRAA 1XIYA 1WP0A 4MF7A 3CSJA 4Q5RA 4JR6A 1M0UA 1YY7A 3NIVA 7GSSA 3TRQA 1J0FA 2FNOA 1TI1A 2PPTA 4TR4A 2C0DA 2ON7A 1O6JA 5ECRB 2L4CA 3QMXA 5EPFA 5KOWA 3TJFA 2KP2A 1GLQA 3HZ4A 1DE1A 3LG6A 3O3TA 1W4VA 5IMVA 3RDWA 1OE8A 1A2JA 3QCPA 3A2WA 3PPUA 4FYCA 4KDYA 3H79A 3DMLA 1WRYA 2C0EA 2L6DA 2LEGA 1UA5A 4ZB9A 1NW2A 3C71A 4FO5A 1F3AA 4MJEA 3TJKA 1TRVA 3L0HA 4Q5QA 3V1WA 2AV4A 3FR9A 3GYKA 1VRSD 4EE0A 1K0BA 4TXOB 4OFTA 1YF0A 1DUGA 4KF9A 5KOXA 3NZNA 4BWSA 3KH7A 2MMNA 1K3OA 3RHBA 1VF1A 1AQVA 4LL1B 3QDNA 4FQUA 3F3QA 3TDGA 1ERVA 2VM1A 2IJYA 4QQ7A 3TKQA 6GSYA 5LD0A 2R37A 2GS3A 3RAZA 1SK1A 5D9WA 3FHKA 1PX7A 2HZEA 3CTGA 3P2AA 3Q6OA 3C8EA 2QA2A 1MDJA 3VI5A 2I81A 4JZQA 4BL7B 1XW9A 2DSAA 4MP4A 4MF5A 1A0FA 3PINA 2FD3A 3IAM2 1AIUA 2A2SA 3KIJA 4ZBBA 1O8XA 1B48A 4V1Ag 1NSWA 2MMZA 2PN8A 3ZVJA 1UN2A 3ERGA 1XZOA 2FGXA 3F8UA 5EY6A 2R0CA 4KDXA 6GSTA 4IBPA 3KM6A 2VCWA 3MAKA 4MA9A 13GSA 1KEBA 5DCHA 1T1VA 4AJ8A 5BRTA 4XS6A 2L59A 2PERA 3LORA 4GXZA 3EC3A 3UAPA 5FHIA 4K2XA 3ME8A 1PD21 2VCXA 3TCOA 3EURA 3EYTA 1T4YA 6GSXA 3A3TA 2YPMA 1FW1A 4H86A 4RQRA 3CYNA 4GSSA 4PQ1A 5IOWA 3VI7A 1GWCA 4ZL8A 4LA1A 3I43A 4NPBA 2F51A 4FYUA 3BCKA 5ECLB 4YQUA 3E0UA 1EP7A 3MIXA 4MJAA 5KEJA 4TKYA 4TR0A 1GSSA 4PX1A 1RK4A 2VO4A 3IOSA 3N9JA 2O8VB 2DMMA 3QOUA 3LFLA 5IMFA 3KD0A 4IQ1A 1PQNA 4POBA 4XRDA 4EF0A 4ILFA 1M2DA 1RQMA 3GX0A 2C3QA 1YEPA 1EP8A 4EL1A 3TJBA 3Q19A 4F9ZA 2FLSA 2C3TA 2IN3A 3D5JA 3L4NA 4TR1A 5G31A 4WR5A 3KGKA 2R6KA 4XS4B 1QQ2A 1JZRA 4E8EA 2F3MA 2HXKA 4IN0A 1ZGNA 1NHOA 3M8NA 1WPIA 3MYDA 3EMXA 2CZ3A 3ERFA 2A4HA 3ZTLA 5DAKA 4POMA 1U6TA 3C7MA 2N5AA 4K2DA 4YAVA 1M3JA 2XHFA 2VCZA 1K0MA 3CTFA 2XBQA 4ECBA 2L5LA 2H8LA 1T00A 2VD0A 4PXOA 1MDKA 4K1FA 2YV9A 5E4WA 5JWRB 2J23A 3CRTA 3E9JB 4ULXA 1FHEA 3HD5A 1Y25A 1GSUA 2OE0A 19GSA 4O7HA 1PN9A 3IXRA 2K6VA 1URMA 1WWJA 2HI7A 3QFBC 5D9VA 4QL9A 1X5DA 1PSQA 3CSHA 3IC8A 1TRSA 1SL0B 3VWVA 5C00A 3KH9A 2X64A 5D9XA 2MYGA 2DJ2A 2H6XA 2B6MA 3L9SA 4KCEA 2H19A 2A2PA 5ECIB 4CDOA 4IGJA 3FZAA 3GV1A 1BX9A 2H0IA 4L5OA 4O5RA 1S3CA 1ZZYA 3VK9A 4WXTA 1F9MA 2LRNA 4JE1A 4NHZA 2AHEA 4O5QA 5ECNB 1B8XA 3N5OA 2LJAA 4Z2TA 1X5EA 2WJUA 3GFKA 4WEYA 1A24A 3CXGA 4EIPA 2YCDA 2YZHA 1LBKA 1GNWA 1GSFA 2MMAA 2CX4A 3CBUA 3GH9A 1T3BA 1YJ6A 3IK9A 3ZRDA 5H5QA 2GSRA 4WBRD 2BMXA 1SL1B 2YWNA 4MJBA 4NHWA 2TRXA 2VCTA 1M99A 5A4WA 16GSA 3H1NA 1PN0A 1JLVA 4OCEA 2FWHA 4J57E 4O32A 5HQPA 3QFAC 1K3YA 1TK8B 1GTIA 1Z6NA 2H1GA 1OAZA 3JCML 3KZQA 3M1GA 3GKKA 3O76A 5HFIA 4PURA 1SK0A 4ZL9A 3F4SA 3HVNA 5F0GA 5IO2A 1GSQA 3GUSA 5AISA 4XCSA 1SD9A 1XVWA 4HEA2 3TOUA 3CQFA 1TK0B 3UVHA 3CRUA 5IMZA 3C1RA 2YN1A 4EC0A 3RBTA 2KLXA 3US3A 2GVPA 3VWWA 1MEKA 4KDUA 4PQIA 4FYBA 4G0LA 2R0GA 3QAVA 3DGQA 1YEXA 2ZCTA 4BVXB 3P8WA 2WRTA 2HZEB 3UBKA 3F6DA 2FY6A 2UZ8A 4EO3A 2DKIA 4O5UA 1ERTA 4AJ7A 1X0RA 5LCZA 1OVNA 2GZYA 2X8CA 2FA8A 3TGZA 2N5FA 1GL8A 4YQMA 1G0TA 2P5QA 3RPNA 3R3EA 1FVKA 4YH2A 2LQQA 2QKEA 2TRCP 4PGTA 2H30A 2C0FA 3P7XA 4GLTA 4HJ2A 2YANA 2J9HA 2CAQA 3WGEA 2H1DA 4ICYA 2HYXA 2TIRA 2IMIA 3QR6A 3BOAA 2IMKA 2H74A 5CRWA 1A2MA 1Q4JA 4AGSA 1VGLA 2WULA 2FHEA 1VF3A 4X1UA 2E2MA 3UMAA 4EUYA 5ABRA 2NTOA 3TKSE 2LSTA 2VLTA 2EIOA 3ZVJD 5J9BA 2XBIA 3FK8A 1EZKA 2GZZA 4F2IA 2MZCA 4USSA 1QUWA 1XFLA 2PBJA 1X5CA 4BVYA 1PX6A 2F9SA 4PUFC 3BD2A 2H66A 4NAXA 1GTUA 2F8FA 2CA8A 2K8VA 4PNGA 2YWMA 3CMIA 2M46A 3IC4A 2QC7A 1ACVA 1B4PA 3HVSA 3TJJA 1USBA 2WDUA 4ACSA 4F03A 1AXDA 4V1Ap 3DWVA 3EWLA 1ZYNA 2LJKA 4TR1B 3VFIA 2X8HA 4XS1A 3M3MA 3GSSA 3GL3A 4LL4B 1J08A 2WGRA 3KCMA 5CO3A 2DJJA 1O81A 4HQZA 3LYKA 5ECHB 2NBSA 3SWLA 3DVXA 2KOKA 5F8BA 1XWGA 3HJPA 2JACA 3EU3A 3OR5A 5DAKB 1G6WA 2YWOA 5JWQB 1Z9HA 4L5LA 1HD2A 1WMJA 2IPAA 4ML1A 1A2LA 1JLWA 5AN1A 2XPDA 3DYRA 4HZ2A 2GZPA 2NDOA 2FWEA 4NMUA 4QL7A 1K0CA 1M9BA 4GCIA 5FWGA 1Z7RA 5AGYA 4ISDA 3F4TA 4BVXA 1CQGA 4ECIA 2E0QA 2PVOC 4GRFA 4OO4A 3GURA 4K7OA 2PMTA 4TXVA 2K8SA 1DSBA 2H01A 2OE3A 4DSSA 1A0RP 3FMWA 1V2AA 4X0XA 2OKAA 1GNEA 2RM5A 5A5KA 6GSWA 5IQYA 3GIXA 5ECSA 2IMEA 1VF2A 3PR8A 4IW9A 5JCUA 2ES7A 3BCIA 3VWUA 3LYPA 5DCGA 4KGIA 2EC4A 1R5AA 2OACA 1SU9A 2HRNA 4G0KA 4ID0A 4POLA 4KA0A 4KW6A 3ZREA 4ZXGA 2QA1A 5D9TA 1XVQA 2MMOA 1R26A 4K6XA 1LJRA 1Y6EA 4F82A 2I3YA 3IHQA 6GSUA 2B1LA 5G2ZA 5JCGA 4Z7XA 1YDKA 2RUEA 5CNWA 1A8LA 2R5GA 3O6TA 1PKZA 5COHA 4JRRA 3DVWA 1TKDB 4YKFA 3TOTA 1ZYQB 4TR3A 2F8AA 1XOBA 5B7CA 4I6XA 2PGTA 5B6MA 2X4AA 1H75A 2LQOA 2VM2A 4NV5A 1JFUA 4GF0A 2LUSA 1TU7A 3DEXA 4OO5A 3ED3A 3HKRA 1JZWA 3FKFA 2CQ9A 2M80A 2CAIA 1YKCA 3RHCA 3U6VA 2RUFA 4MF6A 4K0NA 4ZB6A 4KSMA 2CVBA 3APQA 5CRDA 3HCZA 3ZIVA 3FZ5A 1J9BA 3KP8A 5INYA 4I5QA 3D6IA 4I2UA 4ML6A 1MD3A 1OKTA 5IMDA 1T7PB 2H0HA 1F37A 2JZTA 4Z2RA 2C0GA 2B7KA 2OBKA 3KMNA 4MPGA 1PKWA 3IR4A 3D21A 4IJ3A 4IKHA 5CYYA 1YQ1A 2WFCA 1JZDA 3Q18A 2O85A 5ID2A 1TP9A 4X43A 2C4JA 2HSMA 4JEDA 5DDLA 2CVKA 2EIQA 2QSIA 1F6MC 2ZUPA 1I5GA 5CAXA 2DC5A 3DRNA 5B8AA 2HSYA 4BWQA 1M3IA 3FR6A 2GDRA 1QMVA 2PVQA 2O7KA 3DXBA 1Z5YE 1GUMA 5ECKB 3APOA 2VD1A 1SD8A 2ZNMA 3U5RE 1GTBA 5ECMB 2L6CA 2FUG2 2G0FA 1GSDA 1S3DA 2LKUA 1DBYA 2K9FA 4AJ6A 5IM9A 2YP6A 2IMFA 3ZMKA 5J9CA 2WS2A 5KN3A 2B5EA 5J3RA 1SJ6A 2YWIA 3GX8A 4YQVA 1OC3A 4POKA 3K8NA 3GH6A 1WOUA 4TOPA 4MH2A 1U88A 3C73A 1NM3A 1W89A 20GSA 2R4VA 4HJMA 3QAGA 1H4OA 3A2XA 3VLNA 2H75A 2FWGA 3IV4A 3APSA 4N30A 4BA7A 3FY7A 2GTUA 4MABA 3FZ9A 4KUNA 5G5EA 1EGRA 2LNSA 2BTOT 2H76A 2ALBA 2BJXA 3HDCA 5IO0A 4BIKA 3LXTA 2C80A 5ECQB 3ZYWA 2DJ3A 4LMVA 5H5RA 2D2ZA 4NV2A 2H72A 1XCCA 2N5BA 5BMUA 2HRAA 1ZCPA 1OC8A 2JZSA 1XWCA 1YKAA 4BVYB 3FYGA 4G10A 1ABAA 1QK8A 1NHYA 2GT5A 2VIMA 1GULA 5HR1A 2V2GA 3TKPA 2YV7A 3I6AA 4Q5NA 4G0IA 3F4RA 5AIVA 3ZITA 3L78A 1XG8A 2LRTA 2XPEA 4RQXA 5A4UA 2X99A 1TI3A 4EDZA 3GA4A 5GZZB 3HXSA 3PH9A 3D4TA 2CT6A 1XWAA 3F9UA 1GUKA 1C72A 2B5XA 4K5SA 18GSA 2NPBA 1PRXA 3GKXA 3GSTA 1EV4A 3KEBA 1FAAA 3FZ4A 2IL3A 3J7Yb 4GQFA 1V98A 4KNDA 5DALA 5B8BA 3CSIA 2VL3A 2IIYA 4A5PA 2HLSA 3LWAA 1WIKA 1SK2A 1T8EB 1M2BA 3IRAA 1LU4A 1EWXA 5J41A 2WZ9A 2IWTA 1PA3A 2KUCA 4HI7A 3Q74A 5HR3A 2G2QA 2CZ2A 1R7HA 4OWYA 4HSCX 1V40A 2H1BA 4CW9A 2A4VA 2YJ7A 2PWJA 1TTZA 4MH3A 2DKHA 2HSHA 4MLYA 2A2RA 2JZRA 4RUVA 3FR3A 4OCFA 3HJMA 1OC9B 2VL9A 3IPZA 1FB0A 5A4VA 1ZMAA 3M9KA 3GRXA 3MDKA 3TB2A 2AYTA 4D73A 1KBNA 4DSSB 2H70A 5DQYA 1GUHA 1GH2A 2P0GA 1V58A 2AB6A 2VLUA 1G7OA 4MPFA 4X4JA 4PTSA 4K7IA 4DEJA 1ERUA 3A5WA 5ELGA 4N0ZA 2B7JA 2OADA 4GWRA 5H5SA 3WT2A 4EKZA 5ECOB 4JBBA 4Q5FA 2VLVA 4WKWA 2GQMA 2XC2A 2RM6A 1T4ZA 4J2FA 1KTEA 2KP1A 2HRKA 4JR4A 1B9YC 1XWKA 3SBCA 3GMFA 3UIWA 6GSVA 3IK7A 4OFMA 1Q98A 2NVLA 4L0WA 5CREA 3DD3A 4MK3A 3HJOA 1TK5B 3F3RA 1BYEA 1K3LA 1R5PA 4TRXA 4KX4A 11GSA 1HNBA 2P5RA 3S9FA 1FOVA 2GLRA
chains in the Genus database with same CATH topology
3HZ8A 4G9HA 3EINA 1ZYPA 3H4KA 4K7NA 4HS1A 5F06A 4KCAA 1G7EA 2IMDA 4AF2A 4ZB8A 5GSSA 2VCVA 3ERWA 2MBSA 3H93A 2B3SA 2B1KA 2V6OA 2OBIA 3GNJA 3HVVA 4G19A 4ZBAA 3D0ZA 17GSA 4EIQA 2IFQA 5CP1A 2M72A 3ZFLA 4DVCA 3G7JA 4WETA 1EEMA 3LQ7A 3KTBA 4PQHA 1QFNA 2OJLA 2REMA 1O8WA 4OD7A 4L0UA 1EV9A 4XHMA 3UBLA 4V2MA 4IVFA 2V6KA 1E6BA 2QGVA 3L9UA 2DLXA 2LNTA 1TDIA 2HRFA 2AAWA 4DSQA 5ID2B 5DBQA 5DJMA 3WT1A 1V57A 1BJXA 5E59A 2DIYA 3BBYA 1SKSB 4TN8A 2HE3A 3A2VA 1XBSA 5JCWA 4K8MA 3W6GA 5D96A 4OMVA 3F63A 2R3XA 1GSEA 2JSYA 1SKRB 1R4WA 1B9XC 4F0CA 1XXUA 1V9WA 4K0GA 2CV4A 5J5NA 5G30A 1OC9A 2LV3A 4CY6A 5D8IA 4IQAA 1A8YA 1JZOA 1GRXA 3ZFBA 1X9MB 4MZBA 3LW9A 1EOGA 2H6ZA 3D4MA 4KSOA 1OYJA 4F0BA 2LS5A 2YZUA 1M2AA 2GSTA 1UVZA 4MMMA 2WB9A 6GSSA 2DJ0A 1M7TA 4J56E 1ZL9A 2RLIA 4K5RA 1X9WB 1S3AA 2AJQB 2H73A 3KP9A 4MJCA 2CVDA 3EMPA 3LJRA 1BG5A 2ON5A 1SL2B 3G9BA 1BEDA 3C1SA 4HDEA 1SENA 1SJZA 1MDIA 4I2TA 3ME7A 4I97A 5CRHA 3GTUA 2JADA 3MWHA 5G5FA 2LTKA 1SKWB 1VF4A 4V2LA 4EDYA 1AQWA 1SJIA 1TRWA 1TJDA 2H6YA 3ZLPA 3TJGA 1PGTA 5KN0A 1MD4A 4HUAA 3TUEA 4KB3A 1FG4A 1ILOA 2Z9SA 3R2QA 4E8HA 4N0VA 4WR4A 2O87A 4K9ZA 1AC1A 1PMTA 2WCIA 2R2JA 1U87A 3HVXA 1TOFA 2OA7A 5F07A 5J4UA 3P90A 1THXA 1K0OA 1M9AA 3H8QA 4ZILA 1HNCA 5ENUA 3F0IA 1YF1A 3ZIJA 3G7YA 4BPYA 1TXXA 4MZWA 2OE1A 5L71A 5DQSA 4I8BA 3MNGA 2VAFA 4CHSA 3HYPA 2V32A 1ON4A 3J7Yk 1FVJA 4N10A 2MBTA 2CX3A 5GAND 1GLPA 1K0AA 3ZZXA 3KTLA 5GSTA 1TU8A 10GSA 4ZL7A 3LXZA 5D93A 5DALB 3VPTA 3G7IA 2H1AA 1YZXA 1G6YA 2HNLA 3ZMLA 2P31A 1RW1A 1MTCA 1XWBA 1CQHA 3UOMA 3TKSC 4KE3A 4WF4A 3HA9A 2V41A 1OE7A 2X8GA 2PUKC 3IHGA 3L9VA 1N2AA 2AUVA 4WBJA 1GTAA 3WGXA 2HT9A 2VL2C 2E7PA 2L5OA 1ST9A 4G2EA 4HQSA 5JWOB 4OFNA 2FA4A 5IMCA 3NOFA 4HU9A 1U3IA 4TXOA 2LJRA 2E2GA 3UEMA 1JHBA 1K0DA 3LGCA 4D73B 3FW2A 2C8UA 2O89A 2LRCA 3TKSA 3W8JA 2JSZA 4L8EA 3M9JA 3PGTA 1KNGA 3RPPA 1O7UA 1PL2A 4CY8A 2VL2A 3AY8A 3I9V2 1XW6A 1THOA 3MSZA 1FOHA 1F2EA 1E2YA 2GT6A 1DE2A 1K0NA 4NWYA 4KH7A 4BL7A 3GKNA 4ZBDA 5IIZA 1GSYA 1EGOA 1U3AA 3HY2A 4V2NA 2GSSA 5FT3A 1ZYEA 2RIIA 1SYRA 1WJKA 4ECJA 2FCHA 2DIZA 5HR2A 1WE0A 4MCUA 1Z3EA 1SYXA 5DJLA 3QPMA 4IP6A 1QXHA 5IOXA 2V1MA 3TRPA 2HZFA 4LMWA 8GSSA 1X9SB 1XW5A 1UC7A 4IELA 3IDVA 3IA1A 5ELAA 3ISOA 1EEJA 3I69A 4PNFA 2GGTA 3W8SA 5EL8A 22GSA 4MDCA 3KMOA 1AW9A 3UARA 2YJHA 3ZL5A 3UVTA 4GSTA 4IS0A 2GSQA 2VOCA 3IE3A 1F3BA 2JU5A 3E3EA 1IYIA 2I9HA 1BAYA 4FH8A 4GQCA 2IFQB 4JU5A 3M0FA 5C04A 3UJ1A 2B5YA 3IBHA 1AQXA 2YNXA 5G1LA 4GTUA 2VCQA 1O73A 2DJ1A 2C1YA 4ECCA 1BQ7A 3EU4A 1FB6A 5HFKA 3TRXA 4PUAA 5KN1A 2FWFA 1A23A 5IPHA 3A5IA 2GQLA 3DIEA 5EVOA 1GP1A 2KHPA 3D22A 1TW9A 4RI6A 5G1KA 3FEUA 4ZIJA 1HNAA 1XPVA 5AIXA 5IMAA 4HU7A 4TW5A 4XS4A 3GN3A 1I9DA 4HZ4A 4NXIA 2L57A 3WGDA 1Z7PA 5HFGA 1HQOA 1HYUA 1OKDA 4LLRA 5LNKe 4MNNA 3EPTA 2L4QA 4FIWA 2DJKA 4XIHA 3VURA 4KAEA 5CRGA 2PU9C 3KXOA 1AAZA 3QAWA 4HOJA 2X49A 3GHAA 5B6NA 4GSNA 2R0PA 3F6FA 5GAPD 2H71A 3VWXA 4RI7A 4EVMA 14GSA 2DBCA 2I1UA 1O85A 2HFDA 5DVBA 2JL4A 1Z6MA 2K18A 3VPQA 1ZOFA 3IAS2 1IYHA 2I4AA 2H0GA 9GSSA 3DKSA 5ECPB 4MZCA 3WYWA 3UL3A 3WD6A 4IJIA 5IPGA 3FRCA 4YAPA 1QGVA 2VUPA 5F05A 2YOIA 2GQKA 4N11A 3GTUB 4IHUA 3EVIA 4P3YB 3KJYA 3GKMA 3TKRA 3LEFA 1N8JA 5KN2A 1ML6A 2DMLA 4EXJA 3BJ5A 3HHVA 4Z2UA 5D73A 3GL5A 5HR0A 3LSZA 4YKGA 1FO5A 4WF5A 4TVEA 1XOAA 1B4QA 4XTSA 4DSRA 2EIRA 3EE2A 12GSA 1ERWA 1TRUA 3QD9A 4IP1A 1EOHA 1PL1A 4O92A 1AUCA 2C3NA 4XRAA 1XIYA 1WP0A 4MF7A 3CSJA 4Q5RA 4JR6A 1M0UA 1YY7A 3NIVA 7GSSA 3TRQA 1J0FA 2FNOA 1TI1A 2PPTA 4TR4A 2C0DA 2ON7A 1O6JA 5ECRB 2L4CA 3QMXA 5EPFA 5KOWA 3TJFA 2KP2A 1GLQA 3HZ4A 1DE1A 3LG6A 3O3TA 1W4VA 5IMVA 3RDWA 1OE8A 1A2JA 3QCPA 3A2WA 3PPUA 4FYCA 4KDYA 3H79A 3DMLA 1WRYA 2C0EA 2L6DA 2LEGA 1UA5A 4ZB9A 1NW2A 3C71A 4FO5A 1F3AA 4MJEA 3TJKA 1TRVA 3L0HA 4Q5QA 3V1WA 2AV4A 3FR9A 3GYKA 1VRSD 4EE0A 1K0BA 4TXOB 4OFTA 1YF0A 1DUGA 4KF9A 5KOXA 3NZNA 4BWSA 3KH7A 2MMNA 1K3OA 3RHBA 1VF1A 1AQVA 4LL1B 3QDNA 4FQUA 3F3QA 3TDGA 1ERVA 2VM1A 2IJYA 4QQ7A 3TKQA 6GSYA 5LD0A 2R37A 2GS3A 3RAZA 1SK1A 5D9WA 3FHKA 1PX7A 2HZEA 3CTGA 3P2AA 3Q6OA 3C8EA 2QA2A 1MDJA 3VI5A 2I81A 4JZQA 4BL7B 1XW9A 2DSAA 4MP4A 4MF5A 1A0FA 3PINA 2FD3A 3IAM2 1AIUA 2A2SA 3KIJA 4ZBBA 1O8XA 1B48A 4V1Ag 1NSWA 2MMZA 2PN8A 3ZVJA 1UN2A 3ERGA 1XZOA 2FGXA 3F8UA 5EY6A 2R0CA 4KDXA 6GSTA 4IBPA 3KM6A 2VCWA 3MAKA 4MA9A 13GSA 1KEBA 5DCHA 1T1VA 4AJ8A 5BRTA 4XS6A 2L59A 2PERA 3LORA 4GXZA 3EC3A 3UAPA 5FHIA 4K2XA 3ME8A 1PD21 2VCXA 3TCOA 3EURA 3EYTA 1T4YA 6GSXA 3A3TA 2YPMA 1FW1A 4H86A 4RQRA 3CYNA 4GSSA 4PQ1A 5IOWA 3VI7A 1GWCA 4ZL8A 4LA1A 3I43A 4NPBA 2F51A 4FYUA 3BCKA 5ECLB 4YQUA 3E0UA 1EP7A 3MIXA 4MJAA 5KEJA 4TKYA 4TR0A 1GSSA 4PX1A 1RK4A 2VO4A 3IOSA 3N9JA 2O8VB 2DMMA 3QOUA 3LFLA 5IMFA 3KD0A 4IQ1A 1PQNA 4POBA 4XRDA 4EF0A 4ILFA 1M2DA 1RQMA 3GX0A 2C3QA 1YEPA 1EP8A 4EL1A 3TJBA 3Q19A 4F9ZA 2FLSA 2C3TA 2IN3A 3D5JA 3L4NA 4TR1A 5G31A 4WR5A 3KGKA 2R6KA 4XS4B 1QQ2A 1JZRA 4E8EA 2F3MA 2HXKA 4IN0A 1ZGNA 1NHOA 3M8NA 1WPIA 3MYDA 3EMXA 2CZ3A 3ERFA 2A4HA 3ZTLA 5DAKA 4POMA 1U6TA 3C7MA 2N5AA 4K2DA 4YAVA 2XHFA 2VCZA 1K0MA 3CTFA 2XBQA 4ECBA 2L5LA 2H8LA 1T00A 2VD0A 4PXOA 1MDKA 4K1FA 2YV9A 5E4WA 5JWRB 2J23A 3CRTA 3E9JB 4ULXA 1FHEA 3HD5A 1Y25A 1GSUA 2OE0A 19GSA 4O7HA 1PN9A 3IXRA 2K6VA 1URMA 1WWJA 2HI7A 3QFBC 5D9VA 4QL9A 1X5DA 1PSQA 3CSHA 3IC8A 1TRSA 1SL0B 3VWVA 5C00A 3KH9A 2X64A 5D9XA 2MYGA 2DJ2A 2H6XA 2B6MA 3L9SA 4KCEA 2H19A 2A2PA 5ECIB 4CDOA 4IGJA 3FZAA 3GV1A 1BX9A 2H0IA 4L5OA 4O5RA 1S3CA 1ZZYA 3VK9A 4WXTA 1F9MA 2LRNA 4JE1A 4NHZA 2AHEA 4O5QA 5ECNB 1B8XA 3N5OA 2LJAA 4Z2TA 1X5EA 2WJUA 3GFKA 4WEYA 1A24A 3CXGA 4EIPA 2YCDA 2YZHA 1LBKA 1GNWA 1GSFA 2MMAA 2CX4A 3CBUA 3GH9A 1T3BA 1YJ6A 3IK9A 3ZRDA 5H5QA 2GSRA 4WBRD 2BMXA 1SL1B 2YWNA 4MJBA 4NHWA 2TRXA 2VCTA 1M99A 5A4WA 16GSA 3H1NA 1PN0A 1JLVA 4OCEA 2FWHA 4J57E 4O32A 5HQPA 3QFAC 1K3YA 1TK8B 1GTIA 1Z6NA 2H1GA 1OAZA 3JCML 3KZQA 3M1GA 3GKKA 3O76A 5HFIA 4PURA 1SK0A 4ZL9A 3F4SA 5F0GA 5IO2A 1GSQA 3GUSA 5AISA 4XCSA 1SD9A 1XVWA 4HEA2 3TOUA 1TK0B 3UVHA 3CRUA 5IMZA 3C1RA 2YN1A 4EC0A 3RBTA 2KLXA 3US3A 2GVPA 3VWWA 1MEKA 4KDUA 4PQIA 4FYBA 4G0LA 2R0GA 3QAVA 3DGQA 1YEXA 2ZCTA 4BVXB 3P8WA 2WRTA 2HZEB 3UBKA 3F6DA 2FY6A 2UZ8A 4EO3A 2DKIA 4O5UA 1ERTA 4AJ7A 1X0RA 5LCZA 1OVNA 2GZYA 2X8CA 2FA8A 3TGZA 2N5FA 1GL8A 4YQMA 1G0TA 2P5QA 3RPNA 3R3EA 1FVKA 4YH2A 2LQQA 2QKEA 2TRCP 4PGTA 2H30A 2C0FA 3P7XA 4GLTA 4HJ2A 2YANA 2J9HA 2CAQA 3WGEA 2H1DA 4ICYA 2HYXA 2TIRA 2IMIA 3QR6A 3BOAA 2IMKA 2H74A 5CRWA 1A2MA 1Q4JA 4AGSA 1VGLA 2WULA 2FHEA 1VF3A 4X1UA 2E2MA 3UMAA 4EUYA 5ABRA 2NTOA 3TKSE 2LSTA 2VLTA 2EIOA 3ZVJD 5J9BA 2XBIA 3FK8A 1EZKA 2GZZA 4F2IA 2MZCA 4USSA 1QUWA 1XFLA 2PBJA 1X5CA 4BVYA 1PX6A 2F9SA 4PUFC 3BD2A 2H66A 4NAXA 1GTUA 2F8FA 2CA8A 2K8VA 4PNGA 2YWMA 3CMIA 2M46A 3IC4A 2QC7A 1ACVA 1B4PA 3HVSA 3TJJA 1USBA 2WDUA 4ACSA 4F03A 1AXDA 4V1Ap 3DWVA 3EWLA 1ZYNA 2LJKA 4TR1B 3VFIA 2X8HA 4XS1A 3M3MA 3GSSA 3GL3A 4LL4B 1J08A 2WGRA 3KCMA 5CO3A 2DJJA 1O81A 4HQZA 3LYKA 5ECHB 2NBSA 3SWLA 3DVXA 2KOKA 5F8BA 1XWGA 3HJPA 2JACA 3EU3A 3OR5A 5DAKB 1G6WA 2YWOA 5JWQB 1Z9HA 4L5LA 1HD2A 1WMJA 2IPAA 4ML1A 1A2LA 1JLWA 5AN1A 2XPDA 3DYRA 4HZ2A 2GZPA 2NDOA 2FWEA 4NMUA 4QL7A 1K0CA 1M9BA 4GCIA 5FWGA 1Z7RA 5AGYA 4ISDA 3F4TA 4BVXA 1CQGA 4ECIA 2E0QA 2PVOC 4GRFA 4OO4A 3GURA 4K7OA 2PMTA 4TXVA 2K8SA 1DSBA 2H01A 2OE3A 4DSSA 1A0RP 3FMWA 1V2AA 4X0XA 2OKAA 1GNEA 2RM5A 5A5KA 6GSWA 5IQYA 3GIXA 5ECSA 2IMEA 1VF2A 3PR8A 4IW9A 5JCUA 2ES7A 3BCIA 3VWUA 3LYPA 5DCGA 4KGIA 2EC4A 1R5AA 2OACA 1SU9A 2HRNA 4G0KA 4ID0A 4POLA 4KA0A 4KW6A 3ZREA 4ZXGA 2QA1A 5D9TA 1XVQA 2MMOA 1R26A 4K6XA 1LJRA 1Y6EA 4F82A 2I3YA 3IHQA 6GSUA 2B1LA 5G2ZA 5JCGA 4Z7XA 1YDKA 2RUEA 5CNWA 1A8LA 2R5GA 3O6TA 1PKZA 5COHA 4JRRA 3DVWA 1TKDB 4YKFA 3TOTA 1ZYQB 4TR3A 2F8AA 1XOBA 5B7CA 4I6XA 2PGTA 5B6MA 2X4AA 1H75A 2LQOA 2VM2A 4NV5A 1JFUA 4GF0A 2LUSA 1TU7A 3DEXA 4OO5A 3ED3A 3HKRA 1JZWA 3FKFA 2CQ9A 2M80A 2CAIA 1YKCA 3RHCA 3U6VA 2RUFA 4MF6A 4K0NA 4ZB6A 4KSMA 2CVBA 3APQA 5CRDA 3HCZA 3ZIVA 3FZ5A 1J9BA 3KP8A 5INYA 4I5QA 3D6IA 4I2UA 4ML6A 1MD3A 1OKTA 5IMDA 1T7PB 2H0HA 1F37A 2JZTA 4Z2RA 2C0GA 2B7KA 2OBKA 3KMNA 4MPGA 1PKWA 3IR4A 3D21A 4IJ3A 4IKHA 5CYYA 1YQ1A 2WFCA 1JZDA 3Q18A 2O85A 5ID2A 1TP9A 4X43A 2C4JA 2HSMA 4JEDA 5DDLA 2CVKA 2EIQA 2QSIA 1F6MC 2ZUPA 1I5GA 5CAXA 2DC5A 3DRNA 5B8AA 2HSYA 4BWQA 3FR6A 2GDRA 1QMVA 2PVQA 2O7KA 3DXBA 1Z5YE 1GUMA 5ECKB 3APOA 2VD1A 1SD8A 2ZNMA 3U5RE 1GTBA 5ECMB 2L6CA 2FUG2 2G0FA 1GSDA 1S3DA 2LKUA 1DBYA 2K9FA 4AJ6A 5IM9A 2YP6A 2IMFA 3ZMKA 5J9CA 2WS2A 5KN3A 2B5EA 5J3RA 1SJ6A 2YWIA 3GX8A 4YQVA 1OC3A 4POKA 3K8NA 3GH6A 1WOUA 4TOPA 4MH2A 1U88A 3C73A 1NM3A 1W89A 20GSA 2R4VA 4HJMA 3QAGA 1H4OA 3A2XA 3VLNA 2H75A 2FWGA 3IV4A 3APSA 4N30A 4BA7A 3FY7A 2GTUA 4MABA 3FZ9A 4KUNA 5G5EA 1EGRA 2LNSA 2BTOT 2H76A 2ALBA 2BJXA 3HDCA 5IO0A 3LXTA 2C80A 5ECQB 3ZYWA 2DJ3A 4LMVA 5H5RA 2D2ZA 4NV2A 2H72A 1XCCA 2N5BA 5BMUA 2HRAA 1ZCPA 1OC8A 2JZSA 1XWCA 1YKAA 4BVYB 3FYGA 4G10A 1ABAA 1QK8A 1NHYA 2GT5A 2VIMA 1GULA 5HR1A 2V2GA 3TKPA 2YV7A 3I6AA 4Q5NA 4G0IA 3F4RA 5AIVA 3ZITA 3L78A 2LRTA 2XPEA 4RQXA 5A4UA 2X99A 1TI3A 4EDZA 3GA4A 5GZZB 3HXSA 3PH9A 3D4TA 2CT6A 1XWAA 3F9UA 1GUKA 1C72A 2B5XA 4K5SA 18GSA 2NPBA 1PRXA 3GKXA 3GSTA 1EV4A 3KEBA 1FAAA 3FZ4A 2IL3A 3J7Yb 4GQFA 1V98A 4KNDA 5DALA 5B8BA 3CSIA 2VL3A 2IIYA 4A5PA 2HLSA 3LWAA 1WIKA 1SK2A 1T8EB 1M2BA 3IRAA 1LU4A 1EWXA 5J41A 2WZ9A 2IWTA 1PA3A 2KUCA 4HI7A 3Q74A 5HR3A 2G2QA 2CZ2A 1R7HA 4OWYA 1V40A 2H1BA 4CW9A 2A4VA 2YJ7A 2PWJA 1TTZA 4MH3A 2DKHA 2HSHA 4MLYA 2A2RA 2JZRA 4RUVA 3FR3A 4OCFA 3HJMA 1OC9B 2VL9A 3IPZA 1FB0A 5A4VA 1ZMAA 3M9KA 3GRXA 3MDKA 3TB2A 2AYTA 4D73A 1KBNA 4DSSB 2H70A 5DQYA 1GUHA 1GH2A 2P0GA 1V58A 2AB6A 2VLUA 1G7OA 4MPFA 4X4JA 4PTSA 4K7IA 4DEJA 1ERUA 3A5WA 5ELGA 4N0ZA 2B7JA 2OADA 4GWRA 5H5SA 3WT2A 4EKZA 5ECOB 4JBBA 4Q5FA 2VLVA 4WKWA 2GQMA 2XC2A 2RM6A 1T4ZA 4J2FA 1KTEA 2KP1A 2HRKA 4JR4A 1B9YC 1XWKA 3SBCA 3GMFA 3UIWA 6GSVA 3IK7A 4OFMA 1Q98A 2NVLA 4L0WA 5CREA 3DD3A 4MK3A 3HJOA 1TK5B 3F3RA 1BYEA 1K3LA 1R5PA 4TRXA 4KX4A 11GSA 1HNBA 2P5RA 3S9FA 1FOVA 2GLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HZ8 A;  4G9H A;  3EIN A;  3H4K A;  4K7N A;  4HS1 A;  5F06 A;  4KCA A;  1G7E A;  2IMD A;  4AF2 A;  4ZB8 A;  5GSS A;  2VCV A;  3ERW A;  2MBS A;  3H93 A;  2B3S A;  2B1K A;  2V6O A;  2OBI A;  3GNJ A;  3HVV A;  4G19 A;  4ZBA A;  3D0Z A;  17GS A;  2IFQ A;  5CP1 A;  2M72 A;  3ZFL A;  4DVC A;  3G7J A;  4WET A;  1EEM A;  3LQ7 A;  3KTB A;  4PQH A;  1QFN A;  2OJL A;  2REM A;  1O8W A;  4OD7 A;  4L0U A;  1EV9 A;  4XHM A;  3UBL A;  4V2M A;  4IVF A;  2V6K A;  1E6B A;  2QGV A;  3L9U A;  2DLX A;  2LNT A;  1TDI A;  2HRF A;  2AAW A;  4DSQ A;  5ID2 B;  5DBQ A;  5DJM A;  3WT1 A;  1V57 A;  1BJX A;  5E59 A;  2DIY A;  3BBY A;  1SKS B;  4TN8 A;  2HE3 A;  3A2V A;  1XBS A;  5JCW A;  4K8M A;  3W6G A;  5D96 A;  4OMV A;  3F63 A;  2R3X A;  1GSE A;  2JSY A;  1SKR B;  1R4W A;  1B9X C;  4F0C A;  1XXU A;  1V9W A;  4K0G A;  2CV4 A;  5J5N A;  5G30 A;  1OC9 A;  2LV3 A;  5D8I A;  4IQA A;  1A8Y A;  1JZO A;  1GRX A;  3ZFB A;  1X9M B;  4MZB A;  1EOG A;  2H6Z A;  3D4M A;  4KSO A;  1OYJ A;  4F0B A;  2LS5 A;  2YZU A;  1M2A A;  2GST A;  1UVZ A;  4MMM A;  2WB9 A;  6GSS A;  2DJ0 A;  1M7T A;  4J56 E;  1ZL9 A;  2RLI A;  1X9W B;  1S3A A;  2AJQ B;  2H73 A;  3KP9 A;  4MJC A;  2CVD A;  3EMP A;  3LJR A;  1BG5 A;  2ON5 A;  1SL2 B;  3G9B A;  1BED A;  3C1S A;  4HDE A;  1SEN A;  1SJZ A;  1MDI A;  4I2T A;  3ME7 A;  4I97 A;  5CRH A;  3GTU A;  2JAD A;  3MWH A;  5G5F A;  2LTK A;  1SKW B;  1VF4 A;  4V2L A;  4EDY A;  1AQW A;  1SJI A;  1TRW A;  1TJD A;  2H6Y A;  3ZLP A;  3TJG A;  1PGT A;  5KN0 A;  1MD4 A;  4HUA A;  3TUE A;  4KB3 A;  1FG4 A;  1ILO A;  2Z9S A;  3R2Q A;  4E8H A;  4N0V A;  4WR4 A;  2O87 A;  4K9Z A;  1AC1 A;  1PMT A;  2WCI A;  2R2J A;  1U87 A;  3HVX A;  1TOF A;  2OA7 A;  5F07 A;  5J4U A;  3P90 A;  1THX A;  1K0O A;  1M9A A;  3H8Q A;  4ZIL A;  1HNC A;  5ENU A;  3F0I A;  1YF1 A;  3ZIJ A;  3G7Y A;  4BPY A;  1TXX A;  4MZW A;  2OE1 A;  5L71 A;  5DQS A;  4I8B A;  3MNG A;  2VAF A;  4CHS A;  3HYP A;  2V32 A;  1ON4 A;  3J7Y k;  1FVJ A;  4N10 A;  2MBT A;  2CX3 A;  5GAN D;  1GLP A;  1K0A A;  3ZZX A;  3KTL A;  5GST A;  1TU8 A;  10GS A;  4ZL7 A;  3LXZ A;  5D93 A;  5DAL B;  3VPT A;  3G7I A;  2H1A A;  1YZX A;  1G6Y A;  2HNL A;  3ZML A;  2P31 A;  1RW1 A;  1MTC A;  1XWB A;  1CQH A;  3UOM A;  3TKS C;  4KE3 A;  4WF4 A;  3HA9 A;  2V41 A;  1OE7 A;  2X8G A;  2PUK C;  3L9V A;  1N2A A;  2AUV A;  4WBJ A;  1GTA A;  3WGX A;  2HT9 A;  2VL2 C;  2E7P A;  2L5O A;  1ST9 A;  4G2E A;  4HQS A;  5JWO B;  4OFN A;  2FA4 A;  5IMC A;  3NOF A;  4HU9 A;  1U3I A;  4TXO A;  2LJR A;  2E2G A;  3UEM A;  1JHB A;  1K0D A;  3LGC A;  4D73 B;  3FW2 A;  2C8U A;  2O89 A;  2LRC A;  3TKS A;  3W8J A;  2JSZ A;  4L8E A;  3M9J A;  3PGT A;  1KNG A;  3RPP A;  1O7U A;  1PL2 A;  2VL2 A;  3AY8 A;  3I9V 2;  1XW6 A;  1THO A;  3MSZ A;  1F2E A;  1E2Y A;  2GT6 A;  1DE2 A;  1K0N A;  4NWY A;  4KH7 A;  4BL7 A;  3GKN A;  4ZBD A;  5IIZ A;  1GSY A;  1EGO A;  1U3A A;  3HY2 A;  4V2N A;  2GSS A;  5FT3 A;  1ZYE A;  2RII A;  1SYR A;  1WJK A;  4ECJ A;  2FCH A;  2DIZ A;  5HR2 A;  1WE0 A;  4MCU A;  1Z3E A;  1SYX A;  5DJL A;  3QPM A;  4IP6 A;  1QXH A;  5IOX A;  2V1M A;  3TRP A;  2HZF A;  4LMW A;  8GSS A;  1X9S B;  1XW5 A;  1UC7 A;  4IEL A;  3IDV A;  3IA1 A;  5ELA A;  3ISO A;  1EEJ A;  3I69 A;  4PNF A;  2GGT A;  3W8S A;  5EL8 A;  22GS A;  4MDC A;  3KMO A;  1AW9 A;  3UAR A;  2YJH A;  3ZL5 A;  3UVT A;  4GST A;  4IS0 A;  2GSQ A;  2VOC A;  3IE3 A;  1F3B A;  2JU5 A;  3E3E A;  1IYI A;  2I9H A;  1BAY A;  4FH8 A;  4GQC A;  2IFQ B;  4JU5 A;  3M0F A;  5C04 A;  3UJ1 A;  2B5Y A;  3IBH A;  1AQX A;  2YNX A;  5G1L A;  4GTU A;  2VCQ A;  1O73 A;  2DJ1 A;  2C1Y A;  4ECC A;  1BQ7 A;  3EU4 A;  1FB6 A;  5HFK A;  3TRX A;  4PUA A;  5KN1 A;  2FWF A;  1A23 A;  5IPH A;  2GQL A;  3DIE A;  5EVO A;  1GP1 A;  2KHP A;  3D22 A;  1TW9 A;  4RI6 A;  5G1K A;  3FEU A;  4ZIJ A;  1HNA A;  1XPV A;  5AIX A;  5IMA A;  4HU7 A;  4TW5 A;  4XS4 A;  3GN3 A;  1I9D A;  4HZ4 A;  4NXI A;  2L57 A;  3WGD A;  1Z7P A;  5HFG A;  1HQO A;  1HYU A;  1OKD A;  4LLR A;  5LNK e;  2L4Q A;  4FIW A;  2DJK A;  4XIH A;  3VUR A;  4KAE A;  5CRG A;  2PU9 C;  3KXO A;  1AAZ A;  3QAW A;  4HOJ A;  3GHA A;  5B6N A;  4GSN A;  3F6F A;  5GAP D;  2H71 A;  3VWX A;  4RI7 A;  4EVM A;  14GS A;  2DBC A;  2I1U A;  1O85 A;  2HFD A;  5DVB A;  2JL4 A;  1Z6M A;  2K18 A;  3VPQ A;  1ZOF A;  3IAS 2;  1IYH A;  2I4A A;  2H0G A;  9GSS A;  3DKS A;  5ECP B;  4MZC A;  3WYW A;  3UL3 A;  3WD6 A;  4IJI A;  5IPG A;  3FRC A;  4YAP A;  1QGV A;  2VUP A;  5F05 A;  2YOI A;  2GQK A;  4N11 A;  3GTU B;  4IHU A;  3EVI A;  4P3Y B;  3KJY A;  3GKM A;  3TKR A;  3LEF A;  1N8J A;  5KN2 A;  1ML6 A;  2DML A;  4EXJ A;  3BJ5 A;  3HHV A;  5D73 A;  3GL5 A;  5HR0 A;  3LSZ A;  1FO5 A;  4WF5 A;  4TVE A;  1XOA A;  1B4Q A;  4XTS A;  4DSR A;  2EIR A;  3EE2 A;  12GS A;  1ERW A;  1TRU A;  3QD9 A;  4IP1 A;  1EOH A;  1PL1 A;  4O92 A;  1AUC A;  2C3N A;  4XRA A;  1XIY A;  1WP0 A;  4MF7 A;  3CSJ A;  4Q5R A;  4JR6 A;  1M0U A;  1YY7 A;  3NIV A;  7GSS A;  3TRQ A;  1J0F A;  2FNO A;  1TI1 A;  2PPT A;  4TR4 A;  2C0D A;  2ON7 A;  1O6J A;  5ECR B;  2L4C A;  3QMX A;  5EPF A;  3TJF A;  2KP2 A;  1GLQ A;  3HZ4 A;  1DE1 A;  3LG6 A;  3O3T A;  1W4V A;  5IMV A;  3RDW A;  1OE8 A;  1A2J A;  3QCP A;  3A2W A;  4FYC A;  4KDY A;  3H79 A;  3DML A;  1WRY A;  2C0E A;  2L6D A;  2LEG A;  1UA5 A;  4ZB9 A;  1NW2 A;  3C71 A;  4FO5 A;  1F3A A;  4MJE A;  3TJK A;  1TRV A;  3L0H A;  4Q5Q A;  3V1W A;  2AV4 A;  3FR9 A;  3GYK A;  1VRS D;  4EE0 A;  1K0B A;  4TXO B;  4OFT A;  1YF0 A;  1DUG A;  3NZN A;  4BWS A;  3KH7 A;  2MMN A;  1K3O A;  3RHB A;  1VF1 A;  1AQV A;  4LL1 B;  3QDN A;  3TDG A;  3F3Q A;  1ERV A;  2VM1 A;  2IJY A;  4QQ7 A;  3TKQ A;  6GSY A;  5LD0 A;  2R37 A;  2GS3 A;  3RAZ A;  1SK1 A;  5D9W A;  3FHK A;  1PX7 A;  2HZE A;  3CTG A;  3P2A A;  3Q6O A;  3C8E A;  1MDJ A;  3VI5 A;  2I81 A;  4JZQ A;  1XW9 A;  2DSA A;  4MP4 A;  4MF5 A;  1A0F A;  3PIN A;  2FD3 A;  3IAM 2;  1AIU A;  2A2S A;  3KIJ A;  4ZBB A;  1O8X A;  1B48 A;  4V1A g;  1NSW A;  2MMZ A;  2PN8 A;  3ZVJ A;  1UN2 A;  3ERG A;  1XZO A;  2FGX A;  3F8U A;  5EY6 A;  4KDX A;  6GST A;  4IBP A;  3KM6 A;  2VCW A;  3MAK A;  4MA9 A;  13GS A;  1KEB A;  5DCH A;  1T1V A;  4AJ8 A;  4XS6 A;  2L59 A;  2PER A;  3LOR A;  4GXZ A;  3EC3 A;  3UAP A;  5FHI A;  3ME8 A;  1PD2 1;  2VCX A;  3TCO A;  3EUR A;  3EYT A;  1T4Y A;  6GSX A;  3A3T A;  2YPM A;  1FW1 A;  4H86 A;  4RQR A;  3CYN A;  4GSS A;  4PQ1 A;  5IOW A;  3VI7 A;  1GWC A;  4ZL8 A;  4LA1 A;  3I43 A;  4NPB A;  2F51 A;  4FYU A;  3BCK A;  5ECL B;  4YQU A;  3E0U A;  1EP7 A;  4MJA A;  5KEJ A;  4TKY A;  4TR0 A;  1GSS A;  4PX1 A;  1RK4 A;  2VO4 A;  3IOS A;  3N9J A;  2O8V B;  2DMM A;  3QOU A;  3LFL A;  5IMF A;  3KD0 A;  4IQ1 A;  1PQN A;  4POB A;  4XRD A;  4EF0 A;  4ILF A;  1M2D A;  1RQM A;  3GX0 A;  2C3Q A;  1YEP A;  1EP8 A;  4EL1 A;  3TJB A;  3Q19 A;  4F9Z A;  2FLS A;  2C3T A;  2IN3 A;  3D5J A;  3L4N A;  4TR1 A;  5G31 A;  4WR5 A;  3KGK A;  2R6K A;  4XS4 B;  1QQ2 A;  1JZR A;  4E8E A;  2F3M A;  2HXK A;  4IN0 A;  1ZGN A;  1NHO A;  3M8N A;  1WPI A;  3EMX A;  2CZ3 A;  3ERF A;  3ZTL A;  5DAK A;  4POM A;  1U6T A;  3C7M A;  2N5A A;  4K2D A;  4YAV A;  2XHF A;  2VCZ A;  1K0M A;  3CTF A;  2XBQ A;  4ECB A;  2L5L A;  2H8L A;  1T00 A;  2VD0 A;  4PXO A;  1MDK A;  4K1F A;  2YV9 A;  5E4W A;  5JWR B;  2J23 A;  3CRT A;  3E9J B;  4ULX A;  1FHE A;  3HD5 A;  1Y25 A;  1GSU A;  2OE0 A;  19GS A;  4O7H A;  1PN9 A;  3IXR A;  2K6V A;  1URM A;  1WWJ A;  2HI7 A;  3QFB C;  5D9V A;  4QL9 A;  1X5D A;  1PSQ A;  3CSH A;  1TRS A;  1SL0 B;  3VWV A;  5C00 A;  3KH9 A;  2X64 A;  5D9X A;  2MYG A;  2DJ2 A;  2H6X A;  2B6M A;  3L9S A;  4KCE A;  2H19 A;  5ECI B;  4CDO A;  4IGJ A;  3FZA A;  3GV1 A;  1BX9 A;  2H0I A;  4L5O A;  4O5R A;  1S3C A;  1ZZY A;  3VK9 A;  4WXT A;  1F9M A;  2LRN A;  4JE1 A;  4NHZ A;  2AHE A;  5ECN B;  1B8X A;  3N5O A;  2LJA A;  1X5E A;  2WJU A;  3GFK A;  4WEY A;  1A24 A;  3CXG A;  2YCD A;  2YZH A;  1LBK A;  1GNW A;  1GSF A;  2MMA A;  2CX4 A;  3CBU A;  3GH9 A;  1T3B A;  1YJ6 A;  3IK9 A;  3ZRD A;  5H5Q A;  2GSR A;  4WBR D;  2BMX A;  1SL1 B;  2YWN A;  4MJB A;  4NHW A;  2TRX A;  2VCT A;  1M99 A;  5A4W A;  16GS A;  3H1N A;  1JLV A;  4OCE A;  2FWH A;  4J57 E;  4O32 A;  5HQP A;  3QFA C;  1K3Y A;  1TK8 B;  1GTI A;  1Z6N A;  2H1G A;  1OAZ A;  3JCM L;  3KZQ A;  3M1G A;  3GKK A;  3O76 A;  5HFI A;  4PUR A;  1SK0 A;  4ZL9 A;  3F4S A;  5F0G A;  5IO2 A;  1GSQ A;  3GUS A;  5AIS A;  4XCS A;  1SD9 A;  1XVW A;  4HEA 2;  3TOU A;  1TK0 B;  3UVH A;  3CRU A;  5IMZ A;  3C1R A;  2YN1 A;  4EC0 A;  3RBT A;  2KLX A;  3US3 A;  2GVP A;  3VWW A;  1MEK A;  4KDU A;  4PQI A;  4FYB A;  3QAV A;  3DGQ A;  1YEX A;  2ZCT A;  3P8W A;  2WRT A;  2HZE B;  3UBK A;  3F6D A;  2FY6 A;  4EO3 A;  1ERT A;  4AJ7 A;  1X0R A;  5LCZ A;  1OVN A;  2GZY A;  2X8C A;  2FA8 A;  3TGZ A;  2N5F A;  1GL8 A;  4YQM A;  1G0T A;  2P5Q A;  3RPN A;  1FVK A;  4YH2 A;  2LQQ A;  2QKE A;  2TRC P;  4PGT A;  2H30 A;  2C0F A;  3P7X A;  4GLT A;  4HJ2 A;  2YAN A;  2J9H A;  2CAQ A;  3WGE A;  2H1D A;  2HYX A;  2TIR A;  2IMI A;  3QR6 A;  3BOA A;  2IMK A;  2H74 A;  5CRW A;  1A2M A;  1Q4J A;  4AGS A;  1VGL A;  2WUL A;  2FHE A;  1VF3 A;  4X1U A;  2E2M A;  3UMA A;  4EUY A;  5ABR A;  2NTO A;  3TKS E;  2LST A;  2VLT A;  2EIO A;  3ZVJ D;  5J9B A;  2XBI A;  3FK8 A;  1EZK A;  2GZZ A;  4F2I A;  2MZC A;  1QUW A;  1XFL A;  2PBJ A;  1X5C A;  4BVY A;  1PX6 A;  2F9S A;  4PUF C;  3BD2 A;  2H66 A;  4NAX A;  1GTU A;  2F8F A;  2CA8 A;  2K8V A;  4PNG A;  2YWM A;  3CMI A;  2M46 A;  3IC4 A;  2QC7 A;  1ACV A;  1B4P A;  3HVS A;  3TJJ A;  1USB A;  2WDU A;  4ACS A;  4F03 A;  1AXD A;  4V1A p;  3DWV A;  3EWL A;  2LJK A;  4TR1 B;  3VFI A;  2X8H A;  4XS1 A;  3M3M A;  3GSS A;  3GL3 A;  4LL4 B;  1J08 A;  2WGR A;  3KCM A;  5CO3 A;  2DJJ A;  1O81 A;  4HQZ A;  3LYK A;  5ECH B;  2NBS A;  3SWL A;  3DVX A;  2KOK A;  5F8B A;  1XWG A;  3HJP A;  2JAC A;  3EU3 A;  3OR5 A;  5DAK B;  1G6W A;  2YWO A;  5JWQ B;  1Z9H A;  4L5L A;  1HD2 A;  1WMJ A;  2IPA A;  4ML1 A;  1A2L A;  1JLW A;  5AN1 A;  2XPD A;  3DYR A;  4HZ2 A;  2GZP A;  2NDO A;  2FWE A;  4NMU A;  4QL7 A;  1K0C A;  1M9B A;  4GCI A;  5FWG A;  1Z7R A;  5AGY A;  4ISD A;  3F4T A;  4BVX A;  1CQG A;  4ECI A;  2E0Q A;  2PVO C;  4GRF A;  4OO4 A;  3GUR A;  4K7O A;  2PMT A;  4TXV A;  2K8S A;  1DSB A;  2H01 A;  2OE3 A;  4DSS A;  1A0R P;  1V2A A;  4X0X A;  2OKA A;  1GNE A;  2RM5 A;  5A5K A;  6GSW A;  5IQY A;  3GIX A;  5ECS A;  2IME A;  1VF2 A;  3PR8 A;  4IW9 A;  5JCU A;  2ES7 A;  3BCI A;  3VWU A;  3LYP A;  5DCG A;  4KGI A;  2EC4 A;  1R5A A;  2OAC A;  1SU9 A;  2HRN A;  4ID0 A;  4POL A;  4KA0 A;  4KW6 A;  3ZRE A;  4ZXG A;  5D9T A;  1XVQ A;  2MMO A;  1R26 A;  4K6X A;  1LJR A;  1Y6E A;  4F82 A;  2I3Y A;  3IHQ A;  6GSU A;  2B1L A;  5G2Z A;  5JCG A;  4Z7X A;  1YDK A;  2RUE A;  5CNW A;  1A8L A;  2R5G A;  3O6T A;  1PKZ A;  5COH A;  4JRR A;  3DVW A;  1TKD B;  3TOT A;  1ZYQ B;  4TR3 A;  2F8A A;  1XOB A;  5B7C A;  4I6X A;  2PGT A;  5B6M A;  1H75 A;  2LQO A;  2VM2 A;  4NV5 A;  1JFU A;  4GF0 A;  2LUS A;  1TU7 A;  3DEX A;  4OO5 A;  3ED3 A;  3HKR A;  1JZW A;  3FKF A;  2CQ9 A;  2M80 A;  2CAI A;  1YKC A;  3RHC A;  3U6V A;  2RUF A;  4MF6 A;  4K0N A;  4ZB6 A;  4KSM A;  2CVB A;  3APQ A;  5CRD A;  3HCZ A;  3ZIV A;  3FZ5 A;  1J9B A;  3KP8 A;  5INY A;  4I5Q A;  3D6I A;  4I2U A;  4ML6 A;  1MD3 A;  1OKT A;  5IMD A;  1T7P B;  2H0H A;  1F37 A;  2JZT A;  2C0G A;  2B7K A;  2OBK A;  3KMN A;  4MPG A;  1PKW A;  3IR4 A;  3D21 A;  4IJ3 A;  4IKH A;  5CYY A;  1YQ1 A;  2WFC A;  1JZD A;  3Q18 A;  2O85 A;  5ID2 A;  1TP9 A;  4X43 A;  2C4J A;  4JED A;  5DDL A;  2CVK A;  2EIQ A;  2QSI A;  1F6M C;  2ZUP A;  1I5G A;  5CAX A;  2DC5 A;  3DRN A;  5B8A A;  2HSY A;  4BWQ A;  3FR6 A;  2GDR A;  1QMV A;  2PVQ A;  2O7K A;  3DXB A;  1Z5Y E;  1GUM A;  5ECK B;  3APO A;  2VD1 A;  1SD8 A;  2ZNM A;  3U5R E;  1GTB A;  5ECM B;  2L6C A;  2FUG 2;  2G0F A;  1GSD A;  1S3D A;  2LKU A;  1DBY A;  2K9F A;  4AJ6 A;  5IM9 A;  2YP6 A;  2IMF A;  3ZMK A;  5J9C A;  2WS2 A;  5KN3 A;  2B5E A;  5J3R A;  1SJ6 A;  2YWI A;  3GX8 A;  4YQV A;  1OC3 A;  4POK A;  3K8N A;  3GH6 A;  1WOU A;  4TOP A;  4MH2 A;  1U88 A;  3C73 A;  1NM3 A;  1W89 A;  20GS A;  2R4V A;  4HJM A;  3QAG A;  1H4O A;  3A2X A;  3VLN A;  2H75 A;  2FWG A;  3IV4 A;  3APS A;  4N30 A;  4BA7 A;  3FY7 A;  2GTU A;  4MAB A;  3FZ9 A;  4KUN A;  5G5E A;  1EGR A;  2LNS A;  2BTO T;  2H76 A;  2ALB A;  2BJX A;  3HDC A;  5IO0 A;  3LXT A;  2C80 A;  5ECQ B;  3ZYW A;  2DJ3 A;  4LMV A;  5H5R A;  2D2Z A;  4NV2 A;  2H72 A;  1XCC A;  2N5B A;  1ZCP A;  1OC8 A;  2JZS A;  1XWC A;  1YKA A;  3FYG A;  4G10 A;  1ABA A;  1QK8 A;  1NHY A;  2GT5 A;  2VIM A;  1GUL A;  5HR1 A;  2V2G A;  3TKP A;  2YV7 A;  3I6A A;  4Q5N A;  3F4R A;  5AIV A;  3ZIT A;  3L78 A;  2LRT A;  2XPE A;  4RQX A;  5A4U A;  2X99 A;  1TI3 A;  4EDZ A;  3GA4 A;  5GZZ B;  3HXS A;  3PH9 A;  3D4T A;  2CT6 A;  1XWA A;  3F9U A;  1GUK A;  1C72 A;  2B5X A;  18GS A;  2NPB A;  1PRX A;  3GKX A;  3GST A;  1EV4 A;  3KEB A;  1FAA A;  3FZ4 A;  2IL3 A;  3J7Y b;  4GQF A;  1V98 A;  4KND A;  5DAL A;  5B8B A;  3CSI A;  2VL3 A;  2IIY A;  2HLS A;  3LWA A;  1WIK A;  1SK2 A;  1T8E B;  1M2B A;  3IRA A;  1LU4 A;  1EWX A;  5J41 A;  2WZ9 A;  2IWT A;  1PA3 A;  2KUC A;  4HI7 A;  3Q74 A;  5HR3 A;  2G2Q A;  2CZ2 A;  1R7H A;  4OWY A;  1V40 A;  2H1B A;  4CW9 A;  2A4V A;  2YJ7 A;  2PWJ A;  1TTZ A;  4MH3 A;  2HSH A;  4MLY A;  2A2R A;  2JZR A;  4RUV A;  3FR3 A;  4OCF A;  3HJM A;  1OC9 B;  2VL9 A;  3IPZ A;  1FB0 A;  5A4V A;  1ZMA A;  3M9K A;  3GRX A;  3MDK A;  3TB2 A;  2AYT A;  4D73 A;  1KBN A;  4DSS B;  2H70 A;  5DQY A;  1GUH A;  1GH2 A;  2P0G A;  1V58 A;  2AB6 A;  2VLU A;  1G7O A;  4MPF A;  4K7I A;  4DEJ A;  1ERU A;  3A5W A;  5ELG A;  4N0Z A;  2B7J A;  2OAD A;  4GWR A;  5H5S A;  3WT2 A;  4EKZ A;  5ECO B;  4JBB A;  4Q5F A;  2VLV A;  4WKW A;  2GQM A;  2XC2 A;  2RM6 A;  1T4Z A;  4J2F A;  1KTE A;  2KP1 A;  4JR4 A;  1B9Y C;  1XWK A;  3SBC A;  3GMF A;  3UIW A;  6GSV A;  3IK7 A;  4OFM A;  1Q98 A;  2NVL A;  4L0W A;  5CRE A;  3DD3 A;  4MK3 A;  3HJO A;  1TK5 B;  3F3R A;  1BYE A;  1K3L A;  1R5P A;  4TRX A;  4KX4 A;  11GS A;  1HNB A;  2P5R A;  3S9F A;  1FOV A;  2GLR A; 
#chains in the Genus database with same CATH topology
 3HZ8 A;  4G9H A;  3EIN A;  1ZYP A;  3H4K A;  4K7N A;  4HS1 A;  5F06 A;  4KCA A;  1G7E A;  2IMD A;  4AF2 A;  4ZB8 A;  5GSS A;  2VCV A;  3ERW A;  2MBS A;  3H93 A;  1S3R A;  2B3S A;  2B1K A;  2V6O A;  2OBI A;  3GNJ A;  3HVV A;  4G19 A;  4ZBA A;  3D0Z A;  17GS A;  4EIQ A;  2IFQ A;  5CP1 A;  2M72 A;  3ZFL A;  4DVC A;  3G7J A;  4WET A;  1EEM A;  3LQ7 A;  3KTB A;  4PQH A;  1QFN A;  2OJL A;  2REM A;  1O8W A;  4OD7 A;  4L0U A;  1EV9 A;  4XHM A;  3UBL A;  4V2M A;  4IVF A;  2V6K A;  1E6B A;  2QGV A;  3L9U A;  2DLX A;  2LNT A;  1TDI A;  2HRF A;  2AAW A;  4DSQ A;  5ID2 B;  5DBQ A;  5DJM A;  3WT1 A;  1V57 A;  1BJX A;  5E59 A;  2DIY A;  3BBY A;  1SKS B;  4TN8 A;  2HE3 A;  3A2V A;  1XBS A;  5JCW A;  4K8M A;  3W6G A;  5D96 A;  4OMV A;  3F63 A;  2R3X A;  1GSE A;  2JSY A;  1SKR B;  1R4W A;  1B9X C;  4F0C A;  1XXU A;  1V9W A;  4K0G A;  2CV4 A;  5J5N A;  5G30 A;  1OC9 A;  2LV3 A;  4CY6 A;  5D8I A;  4IQA A;  1A8Y A;  1JZO A;  1GRX A;  3ZFB A;  1X9M B;  4MZB A;  3LW9 A;  1EOG A;  2H6Z A;  3D4M A;  4KSO A;  1OYJ A;  4F0B A;  2LS5 A;  2YZU A;  1M2A A;  2GST A;  1UVZ A;  4MMM A;  2WB9 A;  6GSS A;  2DJ0 A;  1M7T A;  4J56 E;  1ZL9 A;  2RLI A;  4K5R A;  1X9W B;  1S3A A;  2AJQ B;  2H73 A;  3KP9 A;  4MJC A;  2CVD A;  3EMP A;  3LJR A;  1BG5 A;  2ON5 A;  1SL2 B;  3G9B A;  1BED A;  3C1S A;  4HDE A;  1SEN A;  1SJZ A;  1MDI A;  4I2T A;  3ME7 A;  4I97 A;  5CRH A;  3GTU A;  2JAD A;  3MWH A;  5G5F A;  2LTK A;  1SKW B;  1VF4 A;  4V2L A;  4EDY A;  1PFO A;  1AQW A;  1SJI A;  1TRW A;  1TJD A;  2H6Y A;  3ZLP A;  3TJG A;  1PGT A;  5KN0 A;  1MD4 A;  4HUA A;  3TUE A;  4KB3 A;  1FG4 A;  1ILO A;  2Z9S A;  3R2Q A;  4E8H A;  4N0V A;  4WR4 A;  2O87 A;  4K9Z A;  1AC1 A;  1PMT A;  2WCI A;  2R2J A;  1U87 A;  3HVX A;  1TOF A;  2OA7 A;  5F07 A;  5J4U A;  3P90 A;  1THX A;  1K0O A;  1M9A A;  3H8Q A;  4ZIL A;  1HNC A;  5ENU A;  3F0I A;  1YF1 A;  3ZIJ A;  3G7Y A;  4BPY A;  1TXX A;  4MZW A;  2OE1 A;  5L71 A;  5DQS A;  4I8B A;  3MNG A;  2VAF A;  4CHS A;  3HYP A;  2V32 A;  1ON4 A;  3J7Y k;  1FVJ A;  4N10 A;  2MBT A;  2CX3 A;  5GAN D;  1GLP A;  1K0A A;  3ZZX A;  3KTL A;  5GST A;  1TU8 A;  10GS A;  4ZL7 A;  3LXZ A;  5D93 A;  5DAL B;  3VPT A;  3G7I A;  2H1A A;  1YZX A;  1G6Y A;  2HNL A;  3ZML A;  2P31 A;  1RW1 A;  1MTC A;  1XWB A;  1CQH A;  3UOM A;  3TKS C;  4KE3 A;  4WF4 A;  3HA9 A;  2V41 A;  1OE7 A;  2X8G A;  2PUK C;  3IHG A;  3L9V A;  1N2A A;  2AUV A;  4WBJ A;  1GTA A;  3WGX A;  2HT9 A;  2VL2 C;  2E7P A;  2L5O A;  1ST9 A;  4G2E A;  4HQS A;  5JWO B;  4OFN A;  2FA4 A;  5IMC A;  3NOF A;  4HU9 A;  1U3I A;  4TXO A;  2LJR A;  2E2G A;  3UEM A;  1JHB A;  1K0D A;  3LGC A;  4D73 B;  3FW2 A;  2C8U A;  2O89 A;  2LRC A;  3TKS A;  3W8J A;  2JSZ A;  4L8E A;  3M9J A;  3PGT A;  1KNG A;  3RPP A;  1O7U A;  1PL2 A;  4CY8 A;  2VL2 A;  3AY8 A;  3I9V 2;  1XW6 A;  1THO A;  3MSZ A;  1FOH A;  1F2E A;  1E2Y A;  2GT6 A;  1DE2 A;  1K0N A;  4NWY A;  4KH7 A;  4BL7 A;  3GKN A;  4ZBD A;  5IIZ A;  1GSY A;  1EGO A;  1U3A A;  3HY2 A;  4V2N A;  2GSS A;  5FT3 A;  1ZYE A;  2RII A;  1SYR A;  1WJK A;  4ECJ A;  2FCH A;  2DIZ A;  5HR2 A;  1WE0 A;  4MCU A;  1Z3E A;  1SYX A;  5DJL A;  3QPM A;  4IP6 A;  1QXH A;  5IOX A;  2V1M A;  3TRP A;  2HZF A;  4LMW A;  8GSS A;  1X9S B;  1XW5 A;  1UC7 A;  4IEL A;  3IDV A;  3IA1 A;  5ELA A;  3ISO A;  1EEJ A;  3I69 A;  4PNF A;  2GGT A;  3W8S A;  5EL8 A;  22GS A;  4MDC A;  3KMO A;  1AW9 A;  3UAR A;  2YJH A;  3ZL5 A;  3UVT A;  4GST A;  4IS0 A;  2GSQ A;  2VOC A;  3IE3 A;  1F3B A;  2JU5 A;  3E3E A;  1IYI A;  2I9H A;  1BAY A;  4FH8 A;  4GQC A;  2IFQ B;  4JU5 A;  3M0F A;  5C04 A;  3UJ1 A;  2B5Y A;  3IBH A;  1AQX A;  2YNX A;  5G1L A;  4GTU A;  2VCQ A;  1O73 A;  2DJ1 A;  2C1Y A;  4ECC A;  1BQ7 A;  3EU4 A;  1FB6 A;  5HFK A;  3TRX A;  4PUA A;  5KN1 A;  2FWF A;  1A23 A;  5IPH A;  3A5I A;  2GQL A;  3DIE A;  5EVO A;  1GP1 A;  2KHP A;  3D22 A;  1TW9 A;  4RI6 A;  5G1K A;  3FEU A;  4ZIJ A;  1HNA A;  1XPV A;  5AIX A;  5IMA A;  4HU7 A;  4TW5 A;  4XS4 A;  3GN3 A;  1I9D A;  4HZ4 A;  4NXI A;  2L57 A;  3WGD A;  1Z7P A;  5HFG A;  1HQO A;  1HYU A;  1OKD A;  4LLR A;  5LNK e;  4MNN A;  3EPT A;  2L4Q A;  4FIW A;  2DJK A;  4XIH A;  3VUR A;  4KAE A;  5CRG A;  2PU9 C;  3KXO A;  1AAZ A;  3QAW A;  4HOJ A;  2X49 A;  3GHA A;  5B6N A;  4GSN A;  2R0P A;  3F6F A;  5GAP D;  2H71 A;  3VWX A;  4RI7 A;  4EVM A;  14GS A;  2DBC A;  2I1U A;  1O85 A;  2HFD A;  5DVB A;  2JL4 A;  1Z6M A;  2K18 A;  3VPQ A;  1ZOF A;  3IAS 2;  1IYH A;  2I4A A;  2H0G A;  9GSS A;  3DKS A;  5ECP B;  4MZC A;  3WYW A;  3UL3 A;  3WD6 A;  4IJI A;  5IPG A;  3FRC A;  4YAP A;  1QGV A;  2VUP A;  5F05 A;  2YOI A;  2GQK A;  4N11 A;  3GTU B;  4IHU A;  3EVI A;  4P3Y B;  3KJY A;  3GKM A;  3TKR A;  3LEF A;  1N8J A;  5KN2 A;  1ML6 A;  2DML A;  4EXJ A;  3BJ5 A;  3HHV A;  4Z2U A;  5D73 A;  3GL5 A;  5HR0 A;  3LSZ A;  4YKG A;  1FO5 A;  4WF5 A;  4TVE A;  1XOA A;  1B4Q A;  4XTS A;  4DSR A;  2EIR A;  3EE2 A;  12GS A;  1ERW A;  1TRU A;  3QD9 A;  4IP1 A;  1EOH A;  1PL1 A;  4O92 A;  1AUC A;  2C3N A;  4XRA A;  1XIY A;  1WP0 A;  4MF7 A;  3CSJ A;  4Q5R A;  4JR6 A;  1M0U A;  1YY7 A;  3NIV A;  7GSS A;  3TRQ A;  1J0F A;  2FNO A;  1TI1 A;  2PPT A;  4TR4 A;  2C0D A;  2ON7 A;  1O6J A;  5ECR B;  2L4C A;  3QMX A;  5EPF A;  5KOW A;  3TJF A;  2KP2 A;  1GLQ A;  3HZ4 A;  1DE1 A;  3LG6 A;  3O3T A;  1W4V A;  5IMV A;  3RDW A;  1OE8 A;  1A2J A;  3QCP A;  3A2W A;  3PPU A;  4FYC A;  4KDY A;  3H79 A;  3DML A;  1WRY A;  2C0E A;  2L6D A;  2LEG A;  1UA5 A;  4ZB9 A;  1NW2 A;  3C71 A;  4FO5 A;  1F3A A;  4MJE A;  3TJK A;  1TRV A;  3L0H A;  4Q5Q A;  3V1W A;  2AV4 A;  3FR9 A;  3GYK A;  1VRS D;  4EE0 A;  1K0B A;  4TXO B;  4OFT A;  1YF0 A;  1DUG A;  4KF9 A;  5KOX A;  3NZN A;  4BWS A;  3KH7 A;  2MMN A;  1K3O A;  3RHB A;  1VF1 A;  1AQV A;  4LL1 B;  3QDN A;  4FQU A;  3F3Q A;  3TDG A;  1ERV A;  2VM1 A;  2IJY A;  4QQ7 A;  3TKQ A;  6GSY A;  5LD0 A;  2R37 A;  2GS3 A;  3RAZ A;  1SK1 A;  5D9W A;  3FHK A;  1PX7 A;  2HZE A;  3CTG A;  3P2A A;  3Q6O A;  3C8E A;  2QA2 A;  1MDJ A;  3VI5 A;  2I81 A;  4JZQ A;  4BL7 B;  1XW9 A;  2DSA A;  4MP4 A;  4MF5 A;  1A0F A;  3PIN A;  2FD3 A;  3IAM 2;  1AIU A;  2A2S A;  3KIJ A;  4ZBB A;  1O8X A;  1B48 A;  4V1A g;  1NSW A;  2MMZ A;  2PN8 A;  3ZVJ A;  1UN2 A;  3ERG A;  1XZO A;  2FGX A;  3F8U A;  5EY6 A;  2R0C A;  4KDX A;  6GST A;  4IBP A;  3KM6 A;  2VCW A;  3MAK A;  4MA9 A;  13GS A;  1KEB A;  5DCH A;  1T1V A;  4AJ8 A;  5BRT A;  4XS6 A;  2L59 A;  2PER A;  3LOR A;  4GXZ A;  3EC3 A;  3UAP A;  5FHI A;  4K2X A;  3ME8 A;  1PD2 1;  2VCX A;  3TCO A;  3EUR A;  3EYT A;  1T4Y A;  6GSX A;  3A3T A;  2YPM A;  1FW1 A;  4H86 A;  4RQR A;  3CYN A;  4GSS A;  4PQ1 A;  5IOW A;  3VI7 A;  1GWC A;  4ZL8 A;  4LA1 A;  3I43 A;  4NPB A;  2F51 A;  4FYU A;  3BCK A;  5ECL B;  4YQU A;  3E0U A;  1EP7 A;  3MIX A;  4MJA A;  5KEJ A;  4TKY A;  4TR0 A;  1GSS A;  4PX1 A;  1RK4 A;  2VO4 A;  3IOS A;  3N9J A;  2O8V B;  2DMM A;  3QOU A;  3LFL A;  5IMF A;  3KD0 A;  4IQ1 A;  1PQN A;  4POB A;  4XRD A;  4EF0 A;  4ILF A;  1M2D A;  1RQM A;  3GX0 A;  2C3Q A;  1YEP A;  1EP8 A;  4EL1 A;  3TJB A;  3Q19 A;  4F9Z A;  2FLS A;  2C3T A;  2IN3 A;  3D5J A;  3L4N A;  4TR1 A;  5G31 A;  4WR5 A;  3KGK A;  2R6K A;  4XS4 B;  1QQ2 A;  1JZR A;  4E8E A;  2F3M A;  2HXK A;  4IN0 A;  1ZGN A;  1NHO A;  3M8N A;  1WPI A;  3MYD A;  3EMX A;  2CZ3 A;  3ERF A;  2A4H A;  3ZTL A;  5DAK A;  4POM A;  1U6T A;  3C7M A;  2N5A A;  4K2D A;  4YAV A;  1M3J A;  2XHF A;  2VCZ A;  1K0M A;  3CTF A;  2XBQ A;  4ECB A;  2L5L A;  2H8L A;  1T00 A;  2VD0 A;  4PXO A;  1MDK A;  4K1F A;  2YV9 A;  5E4W A;  5JWR B;  2J23 A;  3CRT A;  3E9J B;  4ULX A;  1FHE A;  3HD5 A;  1Y25 A;  1GSU A;  2OE0 A;  19GS A;  4O7H A;  1PN9 A;  3IXR A;  2K6V A;  1URM A;  1WWJ A;  2HI7 A;  3QFB C;  5D9V A;  4QL9 A;  1X5D A;  1PSQ A;  3CSH A;  3IC8 A;  1TRS A;  1SL0 B;  3VWV A;  5C00 A;  3KH9 A;  2X64 A;  5D9X A;  2MYG A;  2DJ2 A;  2H6X A;  2B6M A;  3L9S A;  4KCE A;  2H19 A;  2A2P A;  5ECI B;  4CDO A;  4IGJ A;  3FZA A;  3GV1 A;  1BX9 A;  2H0I A;  4L5O A;  4O5R A;  1S3C A;  1ZZY A;  3VK9 A;  4WXT A;  1F9M A;  2LRN A;  4JE1 A;  4NHZ A;  2AHE A;  4O5Q A;  5ECN B;  1B8X A;  3N5O A;  2LJA A;  4Z2T A;  1X5E A;  2WJU A;  3GFK A;  4WEY A;  1A24 A;  3CXG A;  4EIP A;  2YCD A;  2YZH A;  1LBK A;  1GNW A;  1GSF A;  2MMA A;  2CX4 A;  3CBU A;  3GH9 A;  1T3B A;  1YJ6 A;  3IK9 A;  3ZRD A;  5H5Q A;  2GSR A;  4WBR D;  2BMX A;  1SL1 B;  2YWN A;  4MJB A;  4NHW A;  2TRX A;  2VCT A;  1M99 A;  5A4W A;  16GS A;  3H1N A;  1PN0 A;  1JLV A;  4OCE A;  2FWH A;  4J57 E;  4O32 A;  5HQP A;  3QFA C;  1K3Y A;  1TK8 B;  1GTI A;  1Z6N A;  2H1G A;  1OAZ A;  3JCM L;  3KZQ A;  3M1G A;  3GKK A;  3O76 A;  5HFI A;  4PUR A;  1SK0 A;  4ZL9 A;  3F4S A;  3HVN A;  5F0G A;  5IO2 A;  1GSQ A;  3GUS A;  5AIS A;  4XCS A;  1SD9 A;  1XVW A;  4HEA 2;  3TOU A;  3CQF A;  1TK0 B;  3UVH A;  3CRU A;  5IMZ A;  3C1R A;  2YN1 A;  4EC0 A;  3RBT A;  2KLX A;  3US3 A;  2GVP A;  3VWW A;  1MEK A;  4KDU A;  4PQI A;  4FYB A;  4G0L A;  2R0G A;  3QAV A;  3DGQ A;  1YEX A;  2ZCT A;  4BVX B;  3P8W A;  2WRT A;  2HZE B;  3UBK A;  3F6D A;  2FY6 A;  2UZ8 A;  4EO3 A;  2DKI A;  4O5U A;  1ERT A;  4AJ7 A;  1X0R A;  5LCZ A;  1OVN A;  2GZY A;  2X8C A;  2FA8 A;  3TGZ A;  2N5F A;  1GL8 A;  4YQM A;  1G0T A;  2P5Q A;  3RPN A;  3R3E A;  1FVK A;  4YH2 A;  2LQQ A;  2QKE A;  2TRC P;  4PGT A;  2H30 A;  2C0F A;  3P7X A;  4GLT A;  4HJ2 A;  2YAN A;  2J9H A;  2CAQ A;  3WGE A;  2H1D A;  4ICY A;  2HYX A;  2TIR A;  2IMI A;  3QR6 A;  3BOA A;  2IMK A;  2H74 A;  5CRW A;  1A2M A;  1Q4J A;  4AGS A;  1VGL A;  2WUL A;  2FHE A;  1VF3 A;  4X1U A;  2E2M A;  3UMA A;  4EUY A;  5ABR A;  2NTO A;  3TKS E;  2LST A;  2VLT A;  2EIO A;  3ZVJ D;  5J9B A;  2XBI A;  3FK8 A;  1EZK A;  2GZZ A;  4F2I A;  2MZC A;  4USS A;  1QUW A;  1XFL A;  2PBJ A;  1X5C A;  4BVY A;  1PX6 A;  2F9S A;  4PUF C;  3BD2 A;  2H66 A;  4NAX A;  1GTU A;  2F8F A;  2CA8 A;  2K8V A;  4PNG A;  2YWM A;  3CMI A;  2M46 A;  3IC4 A;  2QC7 A;  1ACV A;  1B4P A;  3HVS A;  3TJJ A;  1USB A;  2WDU A;  4ACS A;  4F03 A;  1AXD A;  4V1A p;  3DWV A;  3EWL A;  1ZYN A;  2LJK A;  4TR1 B;  3VFI A;  2X8H A;  4XS1 A;  3M3M A;  3GSS A;  3GL3 A;  4LL4 B;  1J08 A;  2WGR A;  3KCM A;  5CO3 A;  2DJJ A;  1O81 A;  4HQZ A;  3LYK A;  5ECH B;  2NBS A;  3SWL A;  3DVX A;  2KOK A;  5F8B A;  1XWG A;  3HJP A;  2JAC A;  3EU3 A;  3OR5 A;  5DAK B;  1G6W A;  2YWO A;  5JWQ B;  1Z9H A;  4L5L A;  1HD2 A;  1WMJ A;  2IPA A;  4ML1 A;  1A2L A;  1JLW A;  5AN1 A;  2XPD A;  3DYR A;  4HZ2 A;  2GZP A;  2NDO A;  2FWE A;  4NMU A;  4QL7 A;  1K0C A;  1M9B A;  4GCI A;  5FWG A;  1Z7R A;  5AGY A;  4ISD A;  3F4T A;  4BVX A;  1CQG A;  4ECI A;  2E0Q A;  2PVO C;  4GRF A;  4OO4 A;  3GUR A;  4K7O A;  2PMT A;  4TXV A;  2K8S A;  1DSB A;  2H01 A;  2OE3 A;  4DSS A;  1A0R P;  3FMW A;  1V2A A;  4X0X A;  2OKA A;  1GNE A;  2RM5 A;  5A5K A;  6GSW A;  5IQY A;  3GIX A;  5ECS A;  2IME A;  1VF2 A;  3PR8 A;  4IW9 A;  5JCU A;  2ES7 A;  3BCI A;  3VWU A;  3LYP A;  5DCG A;  4KGI A;  2EC4 A;  1R5A A;  2OAC A;  1SU9 A;  2HRN A;  4G0K A;  4ID0 A;  4POL A;  4KA0 A;  4KW6 A;  3ZRE A;  4ZXG A;  2QA1 A;  5D9T A;  1XVQ A;  2MMO A;  1R26 A;  4K6X A;  1LJR A;  1Y6E A;  4F82 A;  2I3Y A;  3IHQ A;  6GSU A;  2B1L A;  5G2Z A;  5JCG A;  4Z7X A;  1YDK A;  2RUE A;  5CNW A;  1A8L A;  2R5G A;  3O6T A;  1PKZ A;  5COH A;  4JRR A;  3DVW A;  1TKD B;  4YKF A;  3TOT A;  1ZYQ B;  4TR3 A;  2F8A A;  1XOB A;  5B7C A;  4I6X A;  2PGT A;  5B6M A;  2X4A A;  1H75 A;  2LQO A;  2VM2 A;  4NV5 A;  1JFU A;  4GF0 A;  2LUS A;  1TU7 A;  3DEX A;  4OO5 A;  3ED3 A;  3HKR A;  1JZW A;  3FKF A;  2CQ9 A;  2M80 A;  2CAI A;  1YKC A;  3RHC A;  3U6V A;  2RUF A;  4MF6 A;  4K0N A;  4ZB6 A;  4KSM A;  2CVB A;  3APQ A;  5CRD A;  3HCZ A;  3ZIV A;  3FZ5 A;  1J9B A;  3KP8 A;  5INY A;  4I5Q A;  3D6I A;  4I2U A;  4ML6 A;  1MD3 A;  1OKT A;  5IMD A;  1T7P B;  2H0H A;  1F37 A;  2JZT A;  4Z2R A;  2C0G A;  2B7K A;  2OBK A;  3KMN A;  4MPG A;  1PKW A;  3IR4 A;  3D21 A;  4IJ3 A;  4IKH A;  5CYY A;  1YQ1 A;  2WFC A;  1JZD A;  3Q18 A;  2O85 A;  5ID2 A;  1TP9 A;  4X43 A;  2C4J A;  2HSM A;  4JED A;  5DDL A;  2CVK A;  2EIQ A;  2QSI A;  1F6M C;  2ZUP A;  1I5G A;  5CAX A;  2DC5 A;  3DRN A;  5B8A A;  2HSY A;  4BWQ A;  1M3I A;  3FR6 A;  2GDR A;  1QMV A;  2PVQ A;  2O7K A;  3DXB A;  1Z5Y E;  1GUM A;  5ECK B;  3APO A;  2VD1 A;  1SD8 A;  2ZNM A;  3U5R E;  1GTB A;  5ECM B;  2L6C A;  2FUG 2;  2G0F A;  1GSD A;  1S3D A;  2LKU A;  1DBY A;  2K9F A;  4AJ6 A;  5IM9 A;  2YP6 A;  2IMF A;  3ZMK A;  5J9C A;  2WS2 A;  5KN3 A;  2B5E A;  5J3R A;  1SJ6 A;  2YWI A;  3GX8 A;  4YQV A;  1OC3 A;  4POK A;  3K8N A;  3GH6 A;  1WOU A;  4TOP A;  4MH2 A;  1U88 A;  3C73 A;  1NM3 A;  1W89 A;  20GS A;  2R4V A;  4HJM A;  3QAG A;  1H4O A;  3A2X A;  3VLN A;  2H75 A;  2FWG A;  3IV4 A;  3APS A;  4N30 A;  4BA7 A;  3FY7 A;  2GTU A;  4MAB A;  3FZ9 A;  4KUN A;  5G5E A;  1EGR A;  2LNS A;  2BTO T;  2H76 A;  2ALB A;  2BJX A;  3HDC A;  5IO0 A;  4BIK A;  3LXT A;  2C80 A;  5ECQ B;  3ZYW A;  2DJ3 A;  4LMV A;  5H5R A;  2D2Z A;  4NV2 A;  2H72 A;  1XCC A;  2N5B A;  5BMU A;  2HRA A;  1ZCP A;  1OC8 A;  2JZS A;  1XWC A;  1YKA A;  4BVY B;  3FYG A;  4G10 A;  1ABA A;  1QK8 A;  1NHY A;  2GT5 A;  2VIM A;  1GUL A;  5HR1 A;  2V2G A;  3TKP A;  2YV7 A;  3I6A A;  4Q5N A;  4G0I A;  3F4R A;  5AIV A;  3ZIT A;  3L78 A;  1XG8 A;  2LRT A;  2XPE A;  4RQX A;  5A4U A;  2X99 A;  1TI3 A;  4EDZ A;  3GA4 A;  5GZZ B;  3HXS A;  3PH9 A;  3D4T A;  2CT6 A;  1XWA A;  3F9U A;  1GUK A;  1C72 A;  2B5X A;  4K5S A;  18GS A;  2NPB A;  1PRX A;  3GKX A;  3GST A;  1EV4 A;  3KEB A;  1FAA A;  3FZ4 A;  2IL3 A;  3J7Y b;  4GQF A;  1V98 A;  4KND A;  5DAL A;  5B8B A;  3CSI A;  2VL3 A;  2IIY A;  4A5P A;  2HLS A;  3LWA A;  1WIK A;  1SK2 A;  1T8E B;  1M2B A;  3IRA A;  1LU4 A;  1EWX A;  5J41 A;  2WZ9 A;  2IWT A;  1PA3 A;  2KUC A;  4HI7 A;  3Q74 A;  5HR3 A;  2G2Q A;  2CZ2 A;  1R7H A;  4OWY A;  4HSC X;  1V40 A;  2H1B A;  4CW9 A;  2A4V A;  2YJ7 A;  2PWJ A;  1TTZ A;  4MH3 A;  2DKH A;  2HSH A;  4MLY A;  2A2R A;  2JZR A;  4RUV A;  3FR3 A;  4OCF A;  3HJM A;  1OC9 B;  2VL9 A;  3IPZ A;  1FB0 A;  5A4V A;  1ZMA A;  3M9K A;  3GRX A;  3MDK A;  3TB2 A;  2AYT A;  4D73 A;  1KBN A;  4DSS B;  2H70 A;  5DQY A;  1GUH A;  1GH2 A;  2P0G A;  1V58 A;  2AB6 A;  2VLU A;  1G7O A;  4MPF A;  4X4J A;  4PTS A;  4K7I A;  4DEJ A;  1ERU A;  3A5W A;  5ELG A;  4N0Z A;  2B7J A;  2OAD A;  4GWR A;  5H5S A;  3WT2 A;  4EKZ A;  5ECO B;  4JBB A;  4Q5F A;  2VLV A;  4WKW A;  2GQM A;  2XC2 A;  2RM6 A;  1T4Z A;  4J2F A;  1KTE A;  2KP1 A;  2HRK A;  4JR4 A;  1B9Y C;  1XWK A;  3SBC A;  3GMF A;  3UIW A;  6GSV A;  3IK7 A;  4OFM A;  1Q98 A;  2NVL A;  4L0W A;  5CRE A;  3DD3 A;  4MK3 A;  3HJO A;  1TK5 B;  3F3R A;  1BYE A;  1K3L A;  1R5P A;  4TRX A;  4KX4 A;  11GS A;  1HNB A;  2P5R A;  3S9F A;  1FOV A;  2GLR A; 
#chains in the Genus database with same CATH homology
 3HZ8 A;  4G9H A;  3EIN A;  1ZYP A;  3H4K A;  4K7N A;  4HS1 A;  5F06 A;  4KCA A;  1G7E A;  2IMD A;  4AF2 A;  4ZB8 A;  5GSS A;  2VCV A;  3ERW A;  2MBS A;  3H93 A;  2B3S A;  2B1K A;  2V6O A;  2OBI A;  3GNJ A;  3HVV A;  4G19 A;  4ZBA A;  3D0Z A;  17GS A;  4EIQ A;  2IFQ A;  5CP1 A;  2M72 A;  3ZFL A;  4DVC A;  3G7J A;  4WET A;  1EEM A;  3LQ7 A;  3KTB A;  4PQH A;  1QFN A;  2OJL A;  2REM A;  1O8W A;  4OD7 A;  4L0U A;  1EV9 A;  4XHM A;  3UBL A;  4V2M A;  4IVF A;  2V6K A;  1E6B A;  2QGV A;  3L9U A;  2DLX A;  2LNT A;  1TDI A;  2HRF A;  2AAW A;  4DSQ A;  5ID2 B;  5DBQ A;  5DJM A;  3WT1 A;  1V57 A;  1BJX A;  5E59 A;  2DIY A;  3BBY A;  1SKS B;  4TN8 A;  2HE3 A;  3A2V A;  1XBS A;  5JCW A;  4K8M A;  3W6G A;  5D96 A;  4OMV A;  3F63 A;  2R3X A;  1GSE A;  2JSY A;  1SKR B;  1R4W A;  1B9X C;  4F0C A;  1XXU A;  1V9W A;  4K0G A;  2CV4 A;  5J5N A;  5G30 A;  1OC9 A;  2LV3 A;  4CY6 A;  5D8I A;  4IQA A;  1A8Y A;  1JZO A;  1GRX A;  3ZFB A;  1X9M B;  4MZB A;  3LW9 A;  1EOG A;  2H6Z A;  3D4M A;  4KSO A;  1OYJ A;  4F0B A;  2LS5 A;  2YZU A;  1M2A A;  2GST A;  1UVZ A;  4MMM A;  2WB9 A;  6GSS A;  2DJ0 A;  1M7T A;  4J56 E;  1ZL9 A;  2RLI A;  4K5R A;  1X9W B;  1S3A A;  2AJQ B;  2H73 A;  3KP9 A;  4MJC A;  2CVD A;  3EMP A;  3LJR A;  1BG5 A;  2ON5 A;  1SL2 B;  3G9B A;  1BED A;  3C1S A;  4HDE A;  1SEN A;  1SJZ A;  1MDI A;  4I2T A;  3ME7 A;  4I97 A;  5CRH A;  3GTU A;  2JAD A;  3MWH A;  5G5F A;  2LTK A;  1SKW B;  1VF4 A;  4V2L A;  4EDY A;  1AQW A;  1SJI A;  1TRW A;  1TJD A;  2H6Y A;  3ZLP A;  3TJG A;  1PGT A;  5KN0 A;  1MD4 A;  4HUA A;  3TUE A;  4KB3 A;  1FG4 A;  1ILO A;  2Z9S A;  3R2Q A;  4E8H A;  4N0V A;  4WR4 A;  2O87 A;  4K9Z A;  1AC1 A;  1PMT A;  2WCI A;  2R2J A;  1U87 A;  3HVX A;  1TOF A;  2OA7 A;  5F07 A;  5J4U A;  3P90 A;  1THX A;  1K0O A;  1M9A A;  3H8Q A;  4ZIL A;  1HNC A;  5ENU A;  3F0I A;  1YF1 A;  3ZIJ A;  3G7Y A;  4BPY A;  1TXX A;  4MZW A;  2OE1 A;  5L71 A;  5DQS A;  4I8B A;  3MNG A;  2VAF A;  4CHS A;  3HYP A;  2V32 A;  1ON4 A;  3J7Y k;  1FVJ A;  4N10 A;  2MBT A;  2CX3 A;  5GAN D;  1GLP A;  1K0A A;  3ZZX A;  3KTL A;  5GST A;  1TU8 A;  10GS A;  4ZL7 A;  3LXZ A;  5D93 A;  5DAL B;  3VPT A;  3G7I A;  2H1A A;  1YZX A;  1G6Y A;  2HNL A;  3ZML A;  2P31 A;  1RW1 A;  1MTC A;  1XWB A;  1CQH A;  3UOM A;  3TKS C;  4KE3 A;  4WF4 A;  3HA9 A;  2V41 A;  1OE7 A;  2X8G A;  2PUK C;  3IHG A;  3L9V A;  1N2A A;  2AUV A;  4WBJ A;  1GTA A;  3WGX A;  2HT9 A;  2VL2 C;  2E7P A;  2L5O A;  1ST9 A;  4G2E A;  4HQS A;  5JWO B;  4OFN A;  2FA4 A;  5IMC A;  3NOF A;  4HU9 A;  1U3I A;  4TXO A;  2LJR A;  2E2G A;  3UEM A;  1JHB A;  1K0D A;  3LGC A;  4D73 B;  3FW2 A;  2C8U A;  2O89 A;  2LRC A;  3TKS A;  3W8J A;  2JSZ A;  4L8E A;  3M9J A;  3PGT A;  1KNG A;  3RPP A;  1O7U A;  1PL2 A;  4CY8 A;  2VL2 A;  3AY8 A;  3I9V 2;  1XW6 A;  1THO A;  3MSZ A;  1FOH A;  1F2E A;  1E2Y A;  2GT6 A;  1DE2 A;  1K0N A;  4NWY A;  4KH7 A;  4BL7 A;  3GKN A;  4ZBD A;  5IIZ A;  1GSY A;  1EGO A;  1U3A A;  3HY2 A;  4V2N A;  2GSS A;  5FT3 A;  1ZYE A;  2RII A;  1SYR A;  1WJK A;  4ECJ A;  2FCH A;  2DIZ A;  5HR2 A;  1WE0 A;  4MCU A;  1Z3E A;  1SYX A;  5DJL A;  3QPM A;  4IP6 A;  1QXH A;  5IOX A;  2V1M A;  3TRP A;  2HZF A;  4LMW A;  8GSS A;  1X9S B;  1XW5 A;  1UC7 A;  4IEL A;  3IDV A;  3IA1 A;  5ELA A;  3ISO A;  1EEJ A;  3I69 A;  4PNF A;  2GGT A;  3W8S A;  5EL8 A;  22GS A;  4MDC A;  3KMO A;  1AW9 A;  3UAR A;  2YJH A;  3ZL5 A;  3UVT A;  4GST A;  4IS0 A;  2GSQ A;  2VOC A;  3IE3 A;  1F3B A;  2JU5 A;  3E3E A;  1IYI A;  2I9H A;  1BAY A;  4FH8 A;  4GQC A;  2IFQ B;  4JU5 A;  3M0F A;  5C04 A;  3UJ1 A;  2B5Y A;  3IBH A;  1AQX A;  2YNX A;  5G1L A;  4GTU A;  2VCQ A;  1O73 A;  2DJ1 A;  2C1Y A;  4ECC A;  1BQ7 A;  3EU4 A;  1FB6 A;  5HFK A;  3TRX A;  4PUA A;  5KN1 A;  2FWF A;  1A23 A;  5IPH A;  3A5I A;  2GQL A;  3DIE A;  5EVO A;  1GP1 A;  2KHP A;  3D22 A;  1TW9 A;  4RI6 A;  5G1K A;  3FEU A;  4ZIJ A;  1HNA A;  1XPV A;  5AIX A;  5IMA A;  4HU7 A;  4TW5 A;  4XS4 A;  3GN3 A;  1I9D A;  4HZ4 A;  4NXI A;  2L57 A;  3WGD A;  1Z7P A;  5HFG A;  1HQO A;  1HYU A;  1OKD A;  4LLR A;  5LNK e;  4MNN A;  3EPT A;  2L4Q A;  4FIW A;  2DJK A;  4XIH A;  3VUR A;  4KAE A;  5CRG A;  2PU9 C;  3KXO A;  1AAZ A;  3QAW A;  4HOJ A;  2X49 A;  3GHA A;  5B6N A;  4GSN A;  2R0P A;  3F6F A;  5GAP D;  2H71 A;  3VWX A;  4RI7 A;  4EVM A;  14GS A;  2DBC A;  2I1U A;  1O85 A;  2HFD A;  5DVB A;  2JL4 A;  1Z6M A;  2K18 A;  3VPQ A;  1ZOF A;  3IAS 2;  1IYH A;  2I4A A;  2H0G A;  9GSS A;  3DKS A;  5ECP B;  4MZC A;  3WYW A;  3UL3 A;  3WD6 A;  4IJI A;  5IPG A;  3FRC A;  4YAP A;  1QGV A;  2VUP A;  5F05 A;  2YOI A;  2GQK A;  4N11 A;  3GTU B;  4IHU A;  3EVI A;  4P3Y B;  3KJY A;  3GKM A;  3TKR A;  3LEF A;  1N8J A;  5KN2 A;  1ML6 A;  2DML A;  4EXJ A;  3BJ5 A;  3HHV A;  4Z2U A;  5D73 A;  3GL5 A;  5HR0 A;  3LSZ A;  4YKG A;  1FO5 A;  4WF5 A;  4TVE A;  1XOA A;  1B4Q A;  4XTS A;  4DSR A;  2EIR A;  3EE2 A;  12GS A;  1ERW A;  1TRU A;  3QD9 A;  4IP1 A;  1EOH A;  1PL1 A;  4O92 A;  1AUC A;  2C3N A;  4XRA A;  1XIY A;  1WP0 A;  4MF7 A;  3CSJ A;  4Q5R A;  4JR6 A;  1M0U A;  1YY7 A;  3NIV A;  7GSS A;  3TRQ A;  1J0F A;  2FNO A;  1TI1 A;  2PPT A;  4TR4 A;  2C0D A;  2ON7 A;  1O6J A;  5ECR B;  2L4C A;  3QMX A;  5EPF A;  5KOW A;  3TJF A;  2KP2 A;  1GLQ A;  3HZ4 A;  1DE1 A;  3LG6 A;  3O3T A;  1W4V A;  5IMV A;  3RDW A;  1OE8 A;  1A2J A;  3QCP A;  3A2W A;  3PPU A;  4FYC A;  4KDY A;  3H79 A;  3DML A;  1WRY A;  2C0E A;  2L6D A;  2LEG A;  1UA5 A;  4ZB9 A;  1NW2 A;  3C71 A;  4FO5 A;  1F3A A;  4MJE A;  3TJK A;  1TRV A;  3L0H A;  4Q5Q A;  3V1W A;  2AV4 A;  3FR9 A;  3GYK A;  1VRS D;  4EE0 A;  1K0B A;  4TXO B;  4OFT A;  1YF0 A;  1DUG A;  4KF9 A;  5KOX A;  3NZN A;  4BWS A;  3KH7 A;  2MMN A;  1K3O A;  3RHB A;  1VF1 A;  1AQV A;  4LL1 B;  3QDN A;  4FQU A;  3F3Q A;  3TDG A;  1ERV A;  2VM1 A;  2IJY A;  4QQ7 A;  3TKQ A;  6GSY A;  5LD0 A;  2R37 A;  2GS3 A;  3RAZ A;  1SK1 A;  5D9W A;  3FHK A;  1PX7 A;  2HZE A;  3CTG A;  3P2A A;  3Q6O A;  3C8E A;  2QA2 A;  1MDJ A;  3VI5 A;  2I81 A;  4JZQ A;  4BL7 B;  1XW9 A;  2DSA A;  4MP4 A;  4MF5 A;  1A0F A;  3PIN A;  2FD3 A;  3IAM 2;  1AIU A;  2A2S A;  3KIJ A;  4ZBB A;  1O8X A;  1B48 A;  4V1A g;  1NSW A;  2MMZ A;  2PN8 A;  3ZVJ A;  1UN2 A;  3ERG A;  1XZO A;  2FGX A;  3F8U A;  5EY6 A;  2R0C A;  4KDX A;  6GST A;  4IBP A;  3KM6 A;  2VCW A;  3MAK A;  4MA9 A;  13GS A;  1KEB A;  5DCH A;  1T1V A;  4AJ8 A;  5BRT A;  4XS6 A;  2L59 A;  2PER A;  3LOR A;  4GXZ A;  3EC3 A;  3UAP A;  5FHI A;  4K2X A;  3ME8 A;  1PD2 1;  2VCX A;  3TCO A;  3EUR A;  3EYT A;  1T4Y A;  6GSX A;  3A3T A;  2YPM A;  1FW1 A;  4H86 A;  4RQR A;  3CYN A;  4GSS A;  4PQ1 A;  5IOW A;  3VI7 A;  1GWC A;  4ZL8 A;  4LA1 A;  3I43 A;  4NPB A;  2F51 A;  4FYU A;  3BCK A;  5ECL B;  4YQU A;  3E0U A;  1EP7 A;  3MIX A;  4MJA A;  5KEJ A;  4TKY A;  4TR0 A;  1GSS A;  4PX1 A;  1RK4 A;  2VO4 A;  3IOS A;  3N9J A;  2O8V B;  2DMM A;  3QOU A;  3LFL A;  5IMF A;  3KD0 A;  4IQ1 A;  1PQN A;  4POB A;  4XRD A;  4EF0 A;  4ILF A;  1M2D A;  1RQM A;  3GX0 A;  2C3Q A;  1YEP A;  1EP8 A;  4EL1 A;  3TJB A;  3Q19 A;  4F9Z A;  2FLS A;  2C3T A;  2IN3 A;  3D5J A;  3L4N A;  4TR1 A;  5G31 A;  4WR5 A;  3KGK A;  2R6K A;  4XS4 B;  1QQ2 A;  1JZR A;  4E8E A;  2F3M A;  2HXK A;  4IN0 A;  1ZGN A;  1NHO A;  3M8N A;  1WPI A;  3MYD A;  3EMX A;  2CZ3 A;  3ERF A;  2A4H A;  3ZTL A;  5DAK A;  4POM A;  1U6T A;  3C7M A;  2N5A A;  4K2D A;  4YAV A;  2XHF A;  2VCZ A;  1K0M A;  3CTF A;  2XBQ A;  4ECB A;  2L5L A;  2H8L A;  1T00 A;  2VD0 A;  4PXO A;  1MDK A;  4K1F A;  2YV9 A;  5E4W A;  5JWR B;  2J23 A;  3CRT A;  3E9J B;  4ULX A;  1FHE A;  3HD5 A;  1Y25 A;  1GSU A;  2OE0 A;  19GS A;  4O7H A;  1PN9 A;  3IXR A;  2K6V A;  1URM A;  1WWJ A;  2HI7 A;  3QFB C;  5D9V A;  4QL9 A;  1X5D A;  1PSQ A;  3CSH A;  3IC8 A;  1TRS A;  1SL0 B;  3VWV A;  5C00 A;  3KH9 A;  2X64 A;  5D9X A;  2MYG A;  2DJ2 A;  2H6X A;  2B6M A;  3L9S A;  4KCE A;  2H19 A;  2A2P A;  5ECI B;  4CDO A;  4IGJ A;  3FZA A;  3GV1 A;  1BX9 A;  2H0I A;  4L5O A;  4O5R A;  1S3C A;  1ZZY A;  3VK9 A;  4WXT A;  1F9M A;  2LRN A;  4JE1 A;  4NHZ A;  2AHE A;  4O5Q A;  5ECN B;  1B8X A;  3N5O A;  2LJA A;  4Z2T A;  1X5E A;  2WJU A;  3GFK A;  4WEY A;  1A24 A;  3CXG A;  4EIP A;  2YCD A;  2YZH A;  1LBK A;  1GNW A;  1GSF A;  2MMA A;  2CX4 A;  3CBU A;  3GH9 A;  1T3B A;  1YJ6 A;  3IK9 A;  3ZRD A;  5H5Q A;  2GSR A;  4WBR D;  2BMX A;  1SL1 B;  2YWN A;  4MJB A;  4NHW A;  2TRX A;  2VCT A;  1M99 A;  5A4W A;  16GS A;  3H1N A;  1PN0 A;  1JLV A;  4OCE A;  2FWH A;  4J57 E;  4O32 A;  5HQP A;  3QFA C;  1K3Y A;  1TK8 B;  1GTI A;  1Z6N A;  2H1G A;  1OAZ A;  3JCM L;  3KZQ A;  3M1G A;  3GKK A;  3O76 A;  5HFI A;  4PUR A;  1SK0 A;  4ZL9 A;  3F4S A;  5F0G A;  5IO2 A;  1GSQ A;  3GUS A;  5AIS A;  4XCS A;  1SD9 A;  1XVW A;  4HEA 2;  3TOU A;  1TK0 B;  3UVH A;  3CRU A;  5IMZ A;  3C1R A;  2YN1 A;  4EC0 A;  3RBT A;  2KLX A;  3US3 A;  2GVP A;  3VWW A;  1MEK A;  4KDU A;  4PQI A;  4FYB A;  4G0L A;  2R0G A;  3QAV A;  3DGQ A;  1YEX A;  2ZCT A;  4BVX B;  3P8W A;  2WRT A;  2HZE B;  3UBK A;  3F6D A;  2FY6 A;  2UZ8 A;  4EO3 A;  2DKI A;  4O5U A;  1ERT A;  4AJ7 A;  1X0R A;  5LCZ A;  1OVN A;  2GZY A;  2X8C A;  2FA8 A;  3TGZ A;  2N5F A;  1GL8 A;  4YQM A;  1G0T A;  2P5Q A;  3RPN A;  3R3E A;  1FVK A;  4YH2 A;  2LQQ A;  2QKE A;  2TRC P;  4PGT A;  2H30 A;  2C0F A;  3P7X A;  4GLT A;  4HJ2 A;  2YAN A;  2J9H A;  2CAQ A;  3WGE A;  2H1D A;  4ICY A;  2HYX A;  2TIR A;  2IMI A;  3QR6 A;  3BOA A;  2IMK A;  2H74 A;  5CRW A;  1A2M A;  1Q4J A;  4AGS A;  1VGL A;  2WUL A;  2FHE A;  1VF3 A;  4X1U A;  2E2M A;  3UMA A;  4EUY A;  5ABR A;  2NTO A;  3TKS E;  2LST A;  2VLT A;  2EIO A;  3ZVJ D;  5J9B A;  2XBI A;  3FK8 A;  1EZK A;  2GZZ A;  4F2I A;  2MZC A;  4USS A;  1QUW A;  1XFL A;  2PBJ A;  1X5C A;  4BVY A;  1PX6 A;  2F9S A;  4PUF C;  3BD2 A;  2H66 A;  4NAX A;  1GTU A;  2F8F A;  2CA8 A;  2K8V A;  4PNG A;  2YWM A;  3CMI A;  2M46 A;  3IC4 A;  2QC7 A;  1ACV A;  1B4P A;  3HVS A;  3TJJ A;  1USB A;  2WDU A;  4ACS A;  4F03 A;  1AXD A;  4V1A p;  3DWV A;  3EWL A;  1ZYN A;  2LJK A;  4TR1 B;  3VFI A;  2X8H A;  4XS1 A;  3M3M A;  3GSS A;  3GL3 A;  4LL4 B;  1J08 A;  2WGR A;  3KCM A;  5CO3 A;  2DJJ A;  1O81 A;  4HQZ A;  3LYK A;  5ECH B;  2NBS A;  3SWL A;  3DVX A;  2KOK A;  5F8B A;  1XWG A;  3HJP A;  2JAC A;  3EU3 A;  3OR5 A;  5DAK B;  1G6W A;  2YWO A;  5JWQ B;  1Z9H A;  4L5L A;  1HD2 A;  1WMJ A;  2IPA A;  4ML1 A;  1A2L A;  1JLW A;  5AN1 A;  2XPD A;  3DYR A;  4HZ2 A;  2GZP A;  2NDO A;  2FWE A;  4NMU A;  4QL7 A;  1K0C A;  1M9B A;  4GCI A;  5FWG A;  1Z7R A;  5AGY A;  4ISD A;  3F4T A;  4BVX A;  1CQG A;  4ECI A;  2E0Q A;  2PVO C;  4GRF A;  4OO4 A;  3GUR A;  4K7O A;  2PMT A;  4TXV A;  2K8S A;  1DSB A;  2H01 A;  2OE3 A;  4DSS A;  1A0R P;  3FMW A;  1V2A A;  4X0X A;  2OKA A;  1GNE A;  2RM5 A;  5A5K A;  6GSW A;  5IQY A;  3GIX A;  5ECS A;  2IME A;  1VF2 A;  3PR8 A;  4IW9 A;  5JCU A;  2ES7 A;  3BCI A;  3VWU A;  3LYP A;  5DCG A;  4KGI A;  2EC4 A;  1R5A A;  2OAC A;  1SU9 A;  2HRN A;  4G0K A;  4ID0 A;  4POL A;  4KA0 A;  4KW6 A;  3ZRE A;  4ZXG A;  2QA1 A;  5D9T A;  1XVQ A;  2MMO A;  1R26 A;  4K6X A;  1LJR A;  1Y6E A;  4F82 A;  2I3Y A;  3IHQ A;  6GSU A;  2B1L A;  5G2Z A;  5JCG A;  4Z7X A;  1YDK A;  2RUE A;  5CNW A;  1A8L A;  2R5G A;  3O6T A;  1PKZ A;  5COH A;  4JRR A;  3DVW A;  1TKD B;  4YKF A;  3TOT A;  1ZYQ B;  4TR3 A;  2F8A A;  1XOB A;  5B7C A;  4I6X A;  2PGT A;  5B6M A;  2X4A A;  1H75 A;  2LQO A;  2VM2 A;  4NV5 A;  1JFU A;  4GF0 A;  2LUS A;  1TU7 A;  3DEX A;  4OO5 A;  3ED3 A;  3HKR A;  1JZW A;  3FKF A;  2CQ9 A;  2M80 A;  2CAI A;  1YKC A;  3RHC A;  3U6V A;  2RUF A;  4MF6 A;  4K0N A;  4ZB6 A;  4KSM A;  2CVB A;  3APQ A;  5CRD A;  3HCZ A;  3ZIV A;  3FZ5 A;  1J9B A;  3KP8 A;  5INY A;  4I5Q A;  3D6I A;  4I2U A;  4ML6 A;  1MD3 A;  1OKT A;  5IMD A;  1T7P B;  2H0H A;  1F37 A;  2JZT A;  4Z2R A;  2C0G A;  2B7K A;  2OBK A;  3KMN A;  4MPG A;  1PKW A;  3IR4 A;  3D21 A;  4IJ3 A;  4IKH A;  5CYY A;  1YQ1 A;  2WFC A;  1JZD A;  3Q18 A;  2O85 A;  5ID2 A;  1TP9 A;  4X43 A;  2C4J A;  2HSM A;  4JED A;  5DDL A;  2CVK A;  2EIQ A;  2QSI A;  1F6M C;  2ZUP A;  1I5G A;  5CAX A;  2DC5 A;  3DRN A;  5B8A A;  2HSY A;  4BWQ A;  3FR6 A;  2GDR A;  1QMV A;  2PVQ A;  2O7K A;  3DXB A;  1Z5Y E;  1GUM A;  5ECK B;  3APO A;  2VD1 A;  1SD8 A;  2ZNM A;  3U5R E;  1GTB A;  5ECM B;  2L6C A;  2FUG 2;  2G0F A;  1GSD A;  1S3D A;  2LKU A;  1DBY A;  2K9F A;  4AJ6 A;  5IM9 A;  2YP6 A;  2IMF A;  3ZMK A;  5J9C A;  2WS2 A;  5KN3 A;  2B5E A;  5J3R A;  1SJ6 A;  2YWI A;  3GX8 A;  4YQV A;  1OC3 A;  4POK A;  3K8N A;  3GH6 A;  1WOU A;  4TOP A;  4MH2 A;  1U88 A;  3C73 A;  1NM3 A;  1W89 A;  20GS A;  2R4V A;  4HJM A;  3QAG A;  1H4O A;  3A2X A;  3VLN A;  2H75 A;  2FWG A;  3IV4 A;  3APS A;  4N30 A;  4BA7 A;  3FY7 A;  2GTU A;  4MAB A;  3FZ9 A;  4KUN A;  5G5E A;  1EGR A;  2LNS A;  2BTO T;  2H76 A;  2ALB A;  2BJX A;  3HDC A;  5IO0 A;  3LXT A;  2C80 A;  5ECQ B;  3ZYW A;  2DJ3 A;  4LMV A;  5H5R A;  2D2Z A;  4NV2 A;  2H72 A;  1XCC A;  2N5B A;  5BMU A;  2HRA A;  1ZCP A;  1OC8 A;  2JZS A;  1XWC A;  1YKA A;  4BVY B;  3FYG A;  4G10 A;  1ABA A;  1QK8 A;  1NHY A;  2GT5 A;  2VIM A;  1GUL A;  5HR1 A;  2V2G A;  3TKP A;  2YV7 A;  3I6A A;  4Q5N A;  4G0I A;  3F4R A;  5AIV A;  3ZIT A;  3L78 A;  2LRT A;  2XPE A;  4RQX A;  5A4U A;  2X99 A;  1TI3 A;  4EDZ A;  3GA4 A;  5GZZ B;  3HXS A;  3PH9 A;  3D4T A;  2CT6 A;  1XWA A;  3F9U A;  1GUK A;  1C72 A;  2B5X A;  4K5S A;  18GS A;  2NPB A;  1PRX A;  3GKX A;  3GST A;  1EV4 A;  3KEB A;  1FAA A;  3FZ4 A;  2IL3 A;  3J7Y b;  4GQF A;  1V98 A;  4KND A;  5DAL A;  5B8B A;  3CSI A;  2VL3 A;  2IIY A;  4A5P A;  2HLS A;  3LWA A;  1WIK A;  1SK2 A;  1T8E B;  1M2B A;  3IRA A;  1LU4 A;  1EWX A;  5J41 A;  2WZ9 A;  2IWT A;  1PA3 A;  2KUC A;  4HI7 A;  3Q74 A;  5HR3 A;  2G2Q A;  2CZ2 A;  1R7H A;  4OWY A;  1V40 A;  2H1B A;  4CW9 A;  2A4V A;  2YJ7 A;  2PWJ A;  1TTZ A;  4MH3 A;  2DKH A;  2HSH A;  4MLY A;  2A2R A;  2JZR A;  4RUV A;  3FR3 A;  4OCF A;  3HJM A;  1OC9 B;  2VL9 A;  3IPZ A;  1FB0 A;  5A4V A;  1ZMA A;  3M9K A;  3GRX A;  3MDK A;  3TB2 A;  2AYT A;  4D73 A;  1KBN A;  4DSS B;  2H70 A;  5DQY A;  1GUH A;  1GH2 A;  2P0G A;  1V58 A;  2AB6 A;  2VLU A;  1G7O A;  4MPF A;  4X4J A;  4PTS A;  4K7I A;  4DEJ A;  1ERU A;  3A5W A;  5ELG A;  4N0Z A;  2B7J A;  2OAD A;  4GWR A;  5H5S A;  3WT2 A;  4EKZ A;  5ECO B;  4JBB A;  4Q5F A;  2VLV A;  4WKW A;  2GQM A;  2XC2 A;  2RM6 A;  1T4Z A;  4J2F A;  1KTE A;  2KP1 A;  2HRK A;  4JR4 A;  1B9Y C;  1XWK A;  3SBC A;  3GMF A;  3UIW A;  6GSV A;  3IK7 A;  4OFM A;  1Q98 A;  2NVL A;  4L0W A;  5CRE A;  3DD3 A;  4MK3 A;  3HJO A;  1TK5 B;  3F3R A;  1BYE A;  1K3L A;  1R5P A;  4TRX A;  4KX4 A;  11GS A;  1HNB A;  2P5R A;  3S9F A;  1FOV A;  2GLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...