3EYTA

Crystal structure of thioredoxin-like superfamily protein spoa0173
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
156
structure length
156
Chain Sequence
SNAMKAPELQIQQWFNSATDLTLADLRGKVIVIEAFQMLCPGCVMHGIPLAQKVRAAFPEDKVAVLGLHTVFEHHEAMTPISLKAFLHEYRIKFPVGVDQPGDGAMPRTMAAYQMRGTPSLLLIDKAGDLRAHHFGDVSELLLGAEIATLLGEAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein SPOA0173
publication title Crystal structure of Thioredoxin-like superfamily protein SPOA0173
rcsb
source organism Silicibacter pomeroyi
molecule tags Structural genomics, unknown function
total genus 42
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3eytA00
3UEMA 1TXXA 5KN3A 2F8AA 2XBIA 4OFNA 1A2MA 4RI7A 3F4RA 2H0HA 1X9WB 3TJBA 1YQ1A 1Z6MA 2M72A 2MYGA 5F05A 2NBSA 2K9FA 3KGKA 4N0ZA 5F07A 4G10A 4LMWA 5GSTA 3RHBA 5KN1A 3LXZA 4BPYA 1OE7A 5GZZB 4GSTA 4TKYA 1TTZA 4ML6A 4MP4A 5E4WA 3QD9A 3FR9A 3L9UA 4MABA 2HZEB 2L6DA 3IXRA 1MDKA 3PH9A 2HZFA 4KH7A 4K8MA 5IO2A 5CRHA 4RQXA 4NWYA 1O7UA 3TDGA 2DC5A 5F0GA 3NZNA 2B5EA 2VCXA 1QK8A 1NHYA 1THOA 1GSFA 4ZB6A 2PN8A 3GX0A 3L9SA 3GL5A 5IOXA 1X5CA 3EE2A 4TR4A 9GSSA 4TVEA 4NHWA 3APQA 3KJYA 1O8WA 3FY7A 1O81A 4L8EA 3RDWA 2VLUA 2YN1A 3KM6A 2H6ZA 1M9BA 3HZ8A 3PINA 3ZTLA 2FWHA 1GTIA 4K9ZA 4ZB8A 1FG4A 1V9WA 3ZL5A 3E0UA 4KGIA 2P5RA 3M9KA 1XWGA 3FZ5A 2AJQB 12GSA 2I4AA 1Z3EA 2VM1A 4HQZA 4POBA 3HVSA 3UVHA 2D2ZA 6GSXA 2B7JA 4GSSA 3F3RA 3L9VA 3H8QA 1XWCA 5J41A 1FB6A 2N5AA 1R7HA 2B7KA 2H73A 1HQOA 3P7XA 3CRTA 2TIRA 4CHSA 5HFIA 2LV3A 3W8JA 4JU5A 1ML6A 5GSSA 1ACVA 1K3YA 5IMZA 3G7YA 1AQWA 2DJ2A 3I43A 2IJYA 2LKUA 2PERA 1Y6EA 3FZAA 1Y25A 1GSEA 4I2TA 1JLWA 2CAIA 4OO5A 4EUYA 4AGSA 4KE3A 4MCUA 3UAPA 20GSA 2DMMA 1O73A 2CX4A 2GLRA 2FWEA 1CQGA 3F63A 3D6IA 4JE1A 3DYRA 4GQFA 4AJ8A 5ECLB 3KTBA 5JCUA 4ILFA 2VD1A 5CP1A 5D9TA 13GSA 4EXJA 1EP8A 2X99A 1WWJA 2VL9A 5IMVA 1WMJA 2YOIA 3GKMA 2F51A 1GSQA 4ZL9A 1FO5A 2B3SA 2LS5A 1T1VA 2YZHA 2FA8A 3KH9A 4FH8A 3A2VA 1T4ZA 2VL2C 2H0IA 4ZL7A 2C3NA 1J9BA 2E2MA 3LFLA 1U88A 4XS4A 3VWUA 1NW2A 2IPAA 1TK5B 2CVDA 3UBLA 1GUHA 3A2WA 5DQYA 4E8HA 1HNCA 5A5KA 3HXSA 3DIEA 2A4VA 5IO0A 2CX3A 1T3BA 2X8CA 2VCTA 1FHEA 3CSJA 1Q4JA 1YKAA 1JZWA 1M2DA 4XHMA 1TOFA 1XWAA 2OBKA 2WJUA 4K7NA 1PQNA 4EC0A 1SJ6A 5FHIA 4YAPA 4Q5QA 1PL1A 1LU4A 5CYYA 2XPEA 1XWBA 4OO4A 2QGVA 5D9WA 3ZLPA 4GSNA 3ZMLA 1A24A 2REMA 3J7Yk 2LSTA 3IBHA 3KXOA 3NIVA 4K0GA 1B4QA 1GUMA 19GSA 4J2FA 5CO3A 3ED3A 1XPVA 5IMDA 1WPIA 1QMVA 2HSYA 1HYUA 3BOAA 5ECSA 4K2DA 1TP9A 3RPNA 1CQHA 4WF4A 4XS4B 5B6NA 2WB9A 2BJXA 2I9HA 4EDZA 3TJJA 1TRVA 5AIXA 2GSRA 2ON5A 4TR3A 2OE1A 4E8EA 1WOUA 3G9BA 1XW9A 3H93A 2VIMA 1A0FA 2F3MA 5IQYA 3US3A 3EVIA 3DVXA 3TGZA 3VWVA 1GNEA 4Q5NA 2ES7A 1SK1A 5CREA 3WT2A 5G1KA 5B7CA 1ZZYA 2BTOT 3VI5A 2K6VA 4HUAA 2WDUA 1R26A 5CRDA 2QKEA 4I97A 1U3IA 2HSHA 2B1LA 3IV4A 4TXOA 3TKRA 4YH2A 2AYTA 3HJOA 3UIWA 4GRFA 2J23A 3IK9A 1J0FA 1SYXA 17GSA 2AAWA 1GH2A 1JHBA 3SWLA 3HJMA 3EU4A 1TKDB 1Z9HA 1WRYA 1ZMAA 2CVKA 1S3AA 4MZBA 1SKWB 2DJJA 2X64A 2O7KA 4KCAA 3ERWA 3DXBA 5DCHA 5HR1A 3U5RE 2XBQA 3KIJA 4PQIA 3CSHA 4V2NA 4XCSA 1EP7A 2CZ3A 3FR6A 4ACSA 1DE2A 3LEFA 4LL4B 3WGEA 4F0BA 4MDCA 3QCPA 3GMFA 4ECBA 4LL1B 4PUFC 3EYTA 1EEMA 1SL1B 3DWVA 3IA1A 4MH3A 3HD5A 1XOBA 3GNJA 3TKSC 3DEXA 1BAYA 4TXOB 2YPMA 2LNTA 1YDKA 5DDLA 4PGTA 5JCWA 4KNDA 2LJRA 2VLVA 3A5WA 2O85A 1EOHA 3ZMKA 3EURA 4O32A 1G7OA 1TJDA 3CTGA 4XTSA 3LYPA 2K18A 2EIRA 3LSZA 2LJAA 2JADA 3ERFA 4K1FA 1OC8A 4NHZA 4OCFA 3TJKA 3M3MA 2HFDA 1O85A 2VCZA 2H01A 3IK7A 1K3LA 3HA9A 1M2BA 4TXVA 1UC7A 4X43A 1ST9A 2B5XA 3A3TA 4FIWA 4F2IA 4L5OA 5JWOB 4IQAA 3ZVJD 1AQVA 1VF3A 2DJKA 3GFKA 5HR0A 1XIYA 1C72A 2WS2A 2FHEA 5B8BA 5ECPB 4I8BA 1SENA 4OWYA 2FLSA 3F6DA 3MDKA 3TKPA 3RAZA 3ZYWA 3KTLA 3D21A 2LRCA 4KCEA 2RLIA 2JZSA 3ZITA 2H74A 4CW9A 2CA8A 5ECKB 1EV9A 1QUWA 2WGRA 1MTCA 4FYCA 1ZGNA 3F3QA 4N30A 4OFMA 5J9BA 2NDOA 4YQVA 4KA0A 2L6CA 4Q5FA 2IMFA 3UMAA 2VCWA 3IDVA 1GUKA 8GSSA 1VRSD 2PPTA 3F4SA 3LG6A 5F06A 3L78A 2CZ2A 2G0FA 5H5SA 1B8XA 3FKFA 4NMUA 4KUNA 3ZIJA 2GSTA 2JU5A 5D9XA 1YJ6A 3NOFA 3QPMA 3UVTA 3IOSA 2NVLA 3N9JA 1PN9A 1A8YA 3HYPA 3GN3A 3M8NA 3CRUA 4WF5A 2FWGA 3V1WA 2FWFA 1Z6NA 5KN0A 2WFCA 1M99A 5G2ZA 2TRCP 3IE3A 1OE8A 3DGQA 4HJMA 2OBIA 1SKRB 1TK0B 1G7EA 4L0WA 1R5AA 2XHFA 5DJMA 2ALBA 3K8NA 5JWQB 4YAVA 1M2AA 3GUSA 4HJ2A 2XPDA 4HU7A 3DVWA 1OKTA 3DRNA 5D96A 3HZ4A 4QL7A 4OFTA 4G9HA 5DCGA 1X9SB 1LBKA 2VOCA 4PQ1A 1JFUA 3G7IA 4L5LA 5ECHB 1ZL9A 5J9CA 1BQ7A 4YQUA 2EC4A 3VPTA 1U3AA 1HD2A 3ZREA 1H75A 2CVBA 3P2AA 1SL2B 2KP1A 3IC4A 4IJIA 4V1Ap 4EKZA 2H30A 3BBYA 4CDOA 3VWXA 2MMOA 4BWSA 1EGOA 5DJLA 4IQ1A 2E2GA 3VPQA 1OAZA 1EWXA 4IBPA 5COHA 3FK8A 3VURA 1WIKA 3GURA 3VI7A 2L5LA 2J9HA 4JZQA 4MF5A 1VF1A 1F37A 2FY6A 2IMEA 3TKQA 1BG5A 1TRSA 2DJ1A 4K7OA 1F3AA 3GKXA 4ZL8A 1F3BA 3KMNA 2P5QA 4I6XA 5F8BA 4MJAA 2CAQA 4MMMA 2IMKA 1V58A 4DSRA 2OADA 3IAM2 1S3CA 3IRAA 3WGXA 1TU8A 4EL1A 3RPPA 4L0UA 3ZIVA 3D4MA 1YY7A 1EZKA 1A0RP 2OJLA 2A2RA 2OA7A 2FCHA 4RUVA 3ME7A 2PMTA 3I9V2 1DE1A 4BVXA 4J57E 2YJHA 5HFGA 4MF7A 1QQ2A 2LTKA 4IP1A 2AUVA 2L4CA 1MDJA 2ZUPA 1GTUA 3GA4A 5GAPD 5B6MA 1R5PA 2LRNA 4MZCA 2VCQA 1EGRA 4EVMA 6GSWA 4XS6A 1E6BA 4GF0A 1TI1A 2DJ0A 3VFIA 2IMDA 2PBJA 3D22A 4JR4A 2VL2A 1K0BA 3ZVJA 2IFQA 1DBYA 4MJBA 1NM3A 4MPFA 1PKWA 1I9DA 7GSSA 2HRNA 1JLVA 3PGTA 1AXDA 4HDEA 3Q18A 3F8UA 4F0CA 5AGYA 1WP0A 4MK3A 3QAVA 2I3YA 1KNGA 1PL2A 2V41A 1IYIA 4G19A 3TRXA 4WR4A 2EIOA 5IPGA 5KEJA 3GRXA 3M9JA 3KEBA 3FRCA 3TOTA 3KD0A 3UBKA 4QL9A 2RIIA 4K7IA 2RUEA 1K0NA 2A2SA 2IL3A 5IIZA 2R4VA 5DAKA 3C8EA 3EMXA 1X9MB 16GSA 3APOA 3MWHA 3U6VA 3CTFA 4D73A 4WR5A 2TRXA 10GSA 3SBCA 1YEXA 5D8IA 1XOAA 4V2MA 2PGTA 3VK9A 4XIHA 1JZOA 2F8FA 2N5BA 1YF0A 4XRDA 2IFQB 1T7PB 2RM5A 4GLTA 2V2GA 5D73A 3R2QA 4N0VA 1E2YA 2F9SA 2GT5A 3GKNA 1YF1A 4ZBBA 2YNXA 5G5EA 2H70A 1X5DA 3GH9A 3UJ1A 2GQMA 3ME8A 1B9XC 4POKA 5EL8A 4HQSA 5IMCA 3MAKA 1YEPA 4EDYA 3O6TA 5DALA 4WBRD 5ID2A 2C4JA 2IWTA 3FYGA 1EV4A 2X8HA 1OC9A 1PSQA 2YWIA 6GSSA 2Z9SA 1LJRA 5LCZA 5CAXA 1PA3A 2R3XA 1DUGA 3C73A 3F0IA 1W89A 5DAKB 4WBJA 2MBSA 3QAGA 5B8AA 5HR3A 4D73B 1X5EA 1ZYQB 4KSMA 5AIVA 3KZQA 4JRRA 1O8XA 1T00A 2LJKA 3GX8A 3WD6A 3Q19A 1XWKA 1QXHA 1UN2A 1KEBA 4ZILA 4NPBA 18GSA 5HR2A 1SKSB 1FOVA 2AHEA 1URMA 4KB3A 5ECQB 1AIUA 5C04A 2LNSA 1YKCA 3C1RA 2H1GA 4IHUA 4POLA 4HU9A 1OVNA 5H5QA 3LXTA 4AF2A 6GSUA 4F03A 1MEKA 3FEUA 2YWMA 2HYXA 5DALB 3HY2A 5ID2B 3L0HA 1UA5A 1SU9A 1VF2A 1OC9B 1K0OA 3IAS2 1AC1A 3VWWA 2DSAA 5G30A 1GRXA 2H1DA 2KLXA 2C0FA 4ML1A 4POMA 1GSDA 2JL4A 2GZZA 1B48A 3ERGA 2L4QA 3TKSA 1KTEA 1XBSA 4LMVA 2BMXA 3C71A 1SL0B 1WE0A 3GHAA 3P90A 1BJXA 4ZB9A 1AW9A 3HCZA 2YWOA 2HNLA 4MLYA 1W4VA 1N2AA 2L5OA 2VO4A 3FR3A 4PNFA 5CRWA 4PURA 2E7PA 1HNAA 2RM6A 4N10A 1ON4A 3KMOA 3ZFBA 2DBCA 2HXKA 1JZDA 2VAFA 1PGTA 4EF0A 4BL7A 2V1MA 3MSZA 5FT3A 5ECRB 1Z7RA 2C80A 1FW1A 2P0GA 2N5FA 3I69A 5C00A 1TRUA 1SK0A 1THXA 2WZ9A 1TDIA 3EWLA 2L57A 3HVVA 1Q98A 1PX6A 2H75A 2KP2A 1A2JA 3N5OA 4NAXA 2CT6A 1AAZA 3Q6OA 3E9JB 1DSBA 2H6XA 4HI7A 4KDYA 4DVCA 3F9UA 2AB6A 2I1UA 1GLPA 5HQPA 3C7MA 4ZBAA 3J7Yb 2MMNA 1GULA 2LQQA 3DD3A 3H4KA 3D4TA 5G1LA 4LLRA 3GIXA 1SD8A 1BX9A 2PVQA 4ZXGA 2YJ7A 5ELGA 2B6MA 5J4UA 2IN3A 4TR1A 5EY6A 3TCOA 2DIYA 2GT6A 3O3TA 1XFLA 2H6YA 4Z7XA 5CNWA 3IPZA 4O5RA 2MMZA 4IS0A 2GZYA 2LUSA 2C8UA 3CSIA 2G2QA 1BYEA 2LQOA 2C3TA 4JBBA 4J56E 1JZRA 2VUPA 3UL3A 11GSA 2V6KA 3QR6A 2L59A 3D0ZA 4IGJA 2K8SA 3GTUA 5IMAA 4XRAA 1MD3A 3O76A 4KX4A 1EOGA 3WYWA 2GZPA 2FD3A 4LA1A 4TRXA 5DQSA 1PD21 3CXGA 4TN8A 1TW9A 5ECOB 3M0FA 4MA9A 2CV4A 2XC2A 3HHVA 4HZ2A 1HNBA 1I5GA 4V2LA 5ECNB 1PKZA 2PUKC 22GSA 2O87A 3H79A 3ZZXA 4F9ZA 1TK8B 2HT9A 1X0RA 1ERTA 4TR1B 4K6XA 2K8VA 1AQXA 3LJRA 4KDUA 1VGLA 5INYA 2VCVA 1F6MC 1K0MA 1NHOA 2P31A 1FAAA 1TRWA 1SJIA 3JCML 2DIZA 2E0QA 3EU3A 1Z7PA 4EE0A 4AJ7A 4RI6A 2YP6A 3IR4A 3GTUB 3GKKA 1A8LA 1PRXA 1GWCA 2HRFA 4DSQA 4MJEA 1WJKA 5EVOA 2DMLA 2PVOC 2V32A 3GYKA 2NPBA 3LQ7A 1G0TA 2IIYA 3AY8A 1XW5A 3QFAC 4HS1A 2VM2A 3CYNA 2ON7A 2FGXA 1MDIA 1J08A 4X1UA 4ECCA 5D9VA 4NV5A 1FVJA 2JZTA 3HJPA 2GSSA 2H76A 3LWAA 3QOUA 4ECJA 3KP8A 2MBTA 2HI7A 3WT1A 4PXOA 4G2EA 2JZRA 2GVPA 3LGCA 2DJ3A 3HDCA 14GSA 2OACA 3KH7A 2GDRA 2CQ9A 2I81A 3PR8A 6GSYA 4TOPA 5CRGA 1RK4A 1ABAA 4ZBDA 1G6WA 2YZUA 1GTAA 4HZ4A 1FB0A 5E59A 5IM9A 3GSTA 5AN1A 2FNOA 1NSWA 2MMAA 3M1GA 1USBA 1K0DA 2B1KA 2QC7A 1TI3A 3GH6A 1MD4A 5IOWA 4H86A 4K0NA 1GSUA 4MF6A 1YZXA 4PNGA 5JWRB 1B4PA 3TJFA 3FZ4A 5LD0A 2OE0A 4GWRA 3QAWA 1QFNA 5H5RA 3HKRA 4TR0A 2MZCA 3FW2A 4I2UA 4XS1A 2DLXA 4N11A 1SYRA 4NV2A 3DKSA 3I6AA 1F2EA 3TUEA 1T4YA 3GL3A 2V6OA 3TKSE 1GSSA 4EO3A 3KP9A 1OC3A 3OR5A 5J5NA 4ECIA 1ILOA 1VF4A 1GL8A 3TRQA 4X0XA 4F82A 2H1AA 2X8GA 3F6FA 3P8WA 4ISDA 6GSTA 1K0AA 2JACA 2KHPA 4RQRA 1GLQA 3APSA 4IN0A 1EEJA 1A2LA 1XVQA 3UARA 1ZOFA 3QFBC 2YV7A 2R5GA 1V57A 4IVFA 2WULA 3GV1A 3RHCA 4DSSA 4YQMA 1ERWA 4OD7A 2H0GA 1ZCPA 3FZ9A 5A4WA 1K3OA 1XXUA 2ZNMA 3L4NA 4ID0A 1QGVA 3EINA 3H1NA 2O8VB 4O92A 2KOKA 4IP6A 2GGTA 2LRTA 5G5FA 2YCDA 1H4OA 4FYUA 2M46A 4IJ3A 2QSIA 2KUCA 5FWGA 2FA4A 5DVBA 3TB2A 4MJCA 1XZOA 1U6TA 2PWJA 4GTUA 2NTOA 1M7TA 4QQ7A 2H71A 4HEA2 2YV9A 2EIQA 3F4TA 3QMXA 4Q5RA 1K0CA 5JCGA 4BA7A 3LYKA 1SD9A 4ULXA 4MPGA 2GQKA 3MNGA 3ZRDA 3BCIA 3VLNA 1G6YA 4MH2A 3WGDA 1ZYEA 1Z5YE 3HVXA 5J3RA 4IW9A 1R4WA 4PUAA 4DEJA 2GS3A 1V2AA 4KW6A 1GTBA 1M0UA 4KDXA 2M80A 3EC3A 3CBUA 4DSSB 1ERVA 2JSZA 3TRPA 1OYJA 3A2XA 1S3DA 5A4VA 5D93A 4GQCA 4GXZA 1XVWA 4AJ6A 1GSYA 3TOUA 2C1YA 4OCEA 4TW5A 4I5QA 2R6KA 5A4UA 5HFKA 5DBQA 5ECIB 4HOJA 2PU9C 1ERUA 5L71A 2YWNA 1UVZA 4KSOA 3E3EA 1GNWA 1GP1A 3EMPA 4PX1A 1N8JA 2GTUA 4BWQA 3W8SA 5ABRA 1T8EB 5ECMB 2H8LA 5AISA 3ISOA 5GAND 1M9AA 4FO5A 1RW1A 3KCMA 2C0EA 3CMIA 2RUFA 4IELA 1OKDA 3BJ5A 5IMFA 1SJZA 2GQLA 3ZFLA 3LORA 4FYBA 2GSQA 2LEGA 2H66A 3GSSA 3UOMA 4O7HA 3FHKA 1F9MA 1XCCA 1B9YC 2YANA 1XW6A 1BEDA 2C0GA 5G31A 3D5JA 2ZCTA 4JR6A 4KAEA 2OE3A 5IPHA 1U87A 1V40A 2HE3A 2WRTA 3Q74A 1TU7A 1A23A 4JEDA 4WXTA 2WCIA 3BD2A 3S9FA 3IHQA 4OMVA 4P3YB 1AUCA 2H19A 3RBTA 2C0DA 4WKWA 1PMTA 4ZIJA 3G7JA 3W6GA 1O6JA 2OKAA 3BCKA 2H1BA 1SK2A 4WETA 2R37A 4PQHA 4MZWA 1FVKA 2HZEA 2C3QA 2HLSA 1IYHA 3DMLA 2VD0A 3QDNA 2O89A 1V98A 4IKHA 4BVYA 5EPFA 1RQMA 2FUG2 2IMIA 5ELAA 3C1SA 3TJGA 2JSYA 5ENUA 5KN2A 2R2JA 1KBNA 2B5YA 1PX7A 4WEYA 6GSVA 4V1Ag 2H72A 4GCIA 4NXIA 2VL3A 5LNKe 2AV4A 2VLTA
chains in the Genus database with same CATH superfamily
3UEMA 1TXXA 5KN3A 2F8AA 2XBIA 4OFNA 1A2MA 4RI7A 3F4RA 2H0HA 1X9WB 4BL7B 3TJBA 1YQ1A 1Z6MA 2M72A 2MYGA 5F05A 2NBSA 5KOWA 2K9FA 2X49A 3KGKA 4N0ZA 5F07A 4G10A 4LMWA 5GSTA 3RHBA 5KN1A 4YKFA 3LXZA 4BPYA 1OE7A 2HRKA 5GZZB 4GSTA 4TKYA 1TTZA 4ML6A 4MP4A 5E4WA 3QD9A 3FR9A 3L9UA 4MABA 2HZEB 2L6DA 3IXRA 1MDKA 3PH9A 2HZFA 4KH7A 4K8MA 5IO2A 5CRHA 4RQXA 3IC8A 4NWYA 1O7UA 3TDGA 2DC5A 5F0GA 3NZNA 2B5EA 2VCXA 1QK8A 1NHYA 1THOA 1GSFA 4ZB6A 1ZYPA 2PN8A 3GX0A 3L9SA 3GL5A 5IOXA 1X5CA 3EE2A 4TR4A 9GSSA 4TVEA 4NHWA 3APQA 3KJYA 1O8WA 3FY7A 1O81A 4L8EA 3RDWA 2VLUA 2YN1A 3KM6A 2H6ZA 1M9BA 3HZ8A 3PINA 3ZTLA 2FWHA 1GTIA 4K9ZA 4ZB8A 1FG4A 1V9WA 3ZL5A 3E0UA 4KGIA 2P5RA 3M9KA 1XWGA 3FZ5A 2AJQB 12GSA 2I4AA 1Z3EA 2VM1A 4HQZA 4POBA 3HVSA 3UVHA 2D2ZA 6GSXA 2B7JA 4GSSA 3F3RA 3L9VA 3H8QA 4KF9A 1XWCA 5J41A 1FB6A 2N5AA 1R7HA 2B7KA 2H73A 1HQOA 3P7XA 3CRTA 2TIRA 4CHSA 5HFIA 2LV3A 3W8JA 4JU5A 1ML6A 5GSSA 1ACVA 1K3YA 5IMZA 3G7YA 1AQWA 2DJ2A 3I43A 2IJYA 2LKUA 2PERA 1Y6EA 4CY6A 3FZAA 1Y25A 1GSEA 4I2TA 1JLWA 2CAIA 4OO5A 4EUYA 4AGSA 4KE3A 4MCUA 3UAPA 20GSA 2DMMA 1O73A 2CX4A 2GLRA 2FWEA 1CQGA 3F63A 3D6IA 4JE1A 3DYRA 4GQFA 4AJ8A 5ECLB 3KTBA 5JCUA 4ILFA 4A5PA 2VD1A 5CP1A 5D9TA 13GSA 4EXJA 1EP8A 2X99A 1WWJA 2VL9A 5IMVA 1WMJA 2YOIA 3GKMA 2F51A 1GSQA 4ZL9A 1FO5A 2B3SA 2LS5A 1T1VA 2YZHA 2FA8A 3KH9A 4FH8A 3A2VA 1T4ZA 2VL2C 2H0IA 4ZL7A 2C3NA 1J9BA 2E2MA 3LFLA 1U88A 4XS4A 3VWUA 1NW2A 2IPAA 1TK5B 2CVDA 3UBLA 1GUHA 3A2WA 5DQYA 4E8HA 1HNCA 2QA1A 5A5KA 3HXSA 3DIEA 2A4VA 5IO0A 2CX3A 1T3BA 2X8CA 2VCTA 1FHEA 3CSJA 1Q4JA 1YKAA 1JZWA 1M2DA 4XHMA 1TOFA 1XWAA 2OBKA 2WJUA 4K7NA 1PQNA 4EC0A 1SJ6A 5FHIA 4YAPA 4Q5QA 1PL1A 1LU4A 5CYYA 2XPEA 1XWBA 4OO4A 2QGVA 5D9WA 3ZLPA 4GSNA 3ZMLA 1A24A 2REMA 3J7Yk 2LSTA 3IBHA 3KXOA 3NIVA 4K0GA 1B4QA 1GUMA 19GSA 4J2FA 5CO3A 3ED3A 1XPVA 5IMDA 1WPIA 1QMVA 2HSYA 1HYUA 3BOAA 5ECSA 4K2DA 1TP9A 3RPNA 1CQHA 4WF4A 4XS4B 5B6NA 2WB9A 2BJXA 2I9HA 4EDZA 3TJJA 1TRVA 5AIXA 2GSRA 2ON5A 4TR3A 2OE1A 4E8EA 1WOUA 3G9BA 1XW9A 3H93A 2VIMA 1A0FA 2F3MA 5IQYA 3US3A 3EVIA 3DVXA 3TGZA 3VWVA 1GNEA 4Q5NA 2UZ8A 2ES7A 1SK1A 3R3EA 5CREA 3WT2A 5G1KA 5B7CA 1ZZYA 2BTOT 3VI5A 2K6VA 4HUAA 2WDUA 1R26A 5CRDA 2QKEA 4I97A 1U3IA 2HSHA 2B1LA 3IV4A 4TXOA 3TKRA 4YH2A 2AYTA 3HJOA 3UIWA 4GRFA 2J23A 3IK9A 1J0FA 1SYXA 17GSA 2AAWA 4X4JA 1GH2A 1JHBA 3SWLA 3HJMA 3EU4A 1TKDB 1Z9HA 1WRYA 1ZMAA 2CVKA 4USSA 1S3AA 4MZBA 1SKWB 2DJJA 2X64A 2O7KA 4KCAA 3ERWA 3DXBA 5DCHA 5HR1A 3U5RE 2XBQA 3KIJA 4PQIA 3CSHA 4V2NA 4XCSA 1EP7A 2CZ3A 3FR6A 4ACSA 1DE2A 3LEFA 4LL4B 3WGEA 4F0BA 4MDCA 3QCPA 3GMFA 4ECBA 4LL1B 4PUFC 3EYTA 2X4AA 1EEMA 1SL1B 3DWVA 3IA1A 4MH3A 3HD5A 1XOBA 3GNJA 3TKSC 3DEXA 1BAYA 4TXOB 2YPMA 2LNTA 1YDKA 5DDLA 4PGTA 5JCWA 4KNDA 4G0IA 2LJRA 2VLVA 3A5WA 4Z2TA 2O85A 1EOHA 3ZMKA 3EURA 4O32A 1G7OA 1TJDA 3CTGA 4XTSA 3LYPA 2K18A 2EIRA 3LSZA 2LJAA 2JADA 3ERFA 4K1FA 1OC8A 4NHZA 4OCFA 3TJKA 3M3MA 2HFDA 3HVNA 1O85A 4K5SA 2VCZA 2H01A 3IK7A 1K3LA 3HA9A 1M2BA 4TXVA 1UC7A 4X43A 1ST9A 2B5XA 3A3TA 4FIWA 4F2IA 4L5OA 5JWOB 4IQAA 3ZVJD 1AQVA 1VF3A 2DJKA 3GFKA 5HR0A 1XIYA 1C72A 2WS2A 2FHEA 5B8BA 5ECPB 4I8BA 1SENA 4OWYA 2FLSA 3F6DA 3MDKA 3TKPA 3RAZA 3ZYWA 4K5RA 3KTLA 3D21A 2LRCA 4KCEA 2RLIA 2JZSA 3ZITA 2H74A 4CW9A 2CA8A 5ECKB 1EV9A 1QUWA 2WGRA 1MTCA 4FYCA 1ZGNA 3F3QA 4N30A 4OFMA 5J9BA 2NDOA 4YQVA 4EIQA 4KA0A 2L6CA 4MNNA 4Q5FA 2IMFA 3UMAA 2VCWA 3IDVA 1GUKA 8GSSA 1VRSD 2PPTA 3F4SA 3LG6A 5F06A 3L78A 2CZ2A 2G0FA 5H5SA 1B8XA 3FKFA 4NMUA 4KUNA 3ZIJA 2GSTA 2JU5A 5D9XA 1YJ6A 3NOFA 3QPMA 3UVTA 3IOSA 2NVLA 3N9JA 1PN9A 1A8YA 3HYPA 3GN3A 4BVYB 3M8NA 3CRUA 4WF5A 2FWGA 3V1WA 2FWFA 1Z6NA 3PPUA 5KN0A 2WFCA 1M99A 5G2ZA 2TRCP 1FOHA 3IE3A 1OE8A 3DGQA 4HJMA 2OBIA 1SKRB 1TK0B 1G7EA 4L0WA 1R5AA 2XHFA 5DJMA 2ALBA 3K8NA 5JWQB 4YAVA 1M2AA 3GUSA 4HJ2A 2XPDA 4HU7A 3DVWA 1OKTA 3DRNA 5D96A 3HZ4A 4QL7A 4OFTA 4G9HA 5DCGA 1X9SB 1LBKA 2VOCA 4PQ1A 1JFUA 3G7IA 4L5LA 5ECHB 1ZL9A 5J9CA 1BQ7A 4YQUA 2EC4A 3VPTA 1U3AA 1HD2A 3ZREA 1H75A 2CVBA 3P2AA 1SL2B 2KP1A 3IC4A 4IJIA 4V1Ap 4EKZA 2H30A 5BRTA 3BBYA 4CDOA 3VWXA 2MMOA 4BWSA 1EGOA 5DJLA 4IQ1A 2E2GA 3VPQA 1OAZA 1EWXA 4IBPA 4FQUA 5COHA 3FK8A 3VURA 1WIKA 3GURA 3VI7A 2L5LA 2J9HA 4JZQA 4MF5A 1VF1A 1F37A 2FY6A 2IMEA 3TKQA 1BG5A 1TRSA 2DJ1A 4K7OA 1F3AA 3GKXA 4ZL8A 1F3BA 3KMNA 2P5QA 4I6XA 5BMUA 5F8BA 4MJAA 2CAQA 4MMMA 2IMKA 1V58A 4DSRA 2OADA 3IAM2 1S3CA 3IRAA 3WGXA 1TU8A 4EL1A 3RPPA 4L0UA 2DKHA 3ZIVA 3D4MA 1YY7A 1EZKA 1A0RP 2OJLA 2A2RA 2OA7A 2FCHA 4RUVA 3ME7A 2PMTA 3I9V2 1DE1A 4BVXA 4J57E 2YJHA 5HFGA 4MF7A 1QQ2A 2LTKA 4IP1A 2AUVA 2L4CA 1MDJA 2ZUPA 1GTUA 3GA4A 5GAPD 5B6MA 1R5PA 2LRNA 4MZCA 2VCQA 1EGRA 4EVMA 6GSWA 4XS6A 1E6BA 4GF0A 1TI1A 2DJ0A 3VFIA 2IMDA 2PBJA 3D22A 4JR4A 2VL2A 1K0BA 3ZVJA 2IFQA 2DKIA 1DBYA 4MJBA 1NM3A 4MPFA 1PKWA 1I9DA 7GSSA 2HRNA 1JLVA 3PGTA 1AXDA 4G0KA 4HDEA 3Q18A 3F8UA 4F0CA 5AGYA 1WP0A 4MK3A 3QAVA 2I3YA 1KNGA 1PL2A 2V41A 1IYIA 4G19A 3TRXA 4WR4A 2EIOA 5IPGA 5KEJA 3GRXA 3M9JA 3KEBA 3FRCA 3TOTA 3KD0A 3UBKA 4QL9A 2RIIA 4K7IA 2RUEA 1K0NA 2A2SA 4BVXB 2IL3A 5IIZA 2R4VA 5DAKA 3C8EA 3EMXA 1X9MB 16GSA 3APOA 3MWHA 3U6VA 3CTFA 4D73A 4WR5A 2TRXA 10GSA 3SBCA 1YEXA 5D8IA 1XOAA 4V2MA 2PGTA 3VK9A 4XIHA 1JZOA 2F8FA 2N5BA 1YF0A 4XRDA 2IFQB 1T7PB 2RM5A 4GLTA 2V2GA 5D73A 3R2QA 4N0VA 1E2YA 2F9SA 2GT5A 3GKNA 1YF1A 3MYDA 4ZBBA 2YNXA 5G5EA 2H70A 4K2XA 1X5DA 3GH9A 3UJ1A 2GQMA 3ME8A 1B9XC 4POKA 5EL8A 4HQSA 5IMCA 3MAKA 1YEPA 4EDYA 3O6TA 5DALA 5KOXA 4WBRD 5ID2A 2C4JA 2IWTA 3FYGA 1EV4A 2X8HA 1OC9A 1PSQA 2YWIA 6GSSA 2Z9SA 1LJRA 5LCZA 5CAXA 1PA3A 2R3XA 1DUGA 3C73A 3F0IA 1W89A 5DAKB 4WBJA 2MBSA 3QAGA 5B8AA 5HR3A 4D73B 1X5EA 1ZYQB 4KSMA 5AIVA 3KZQA 4JRRA 1O8XA 1T00A 2LJKA 3GX8A 3WD6A 3Q19A 1XWKA 1QXHA 1UN2A 1KEBA 4ZILA 1PFOA 4NPBA 18GSA 5HR2A 1SKSB 1FOVA 2AHEA 1URMA 4KB3A 5ECQB 1AIUA 5C04A 4CY8A 2LNSA 1YKCA 3C1RA 2H1GA 4IHUA 4POLA 4HU9A 1OVNA 5H5QA 3LXTA 4AF2A 6GSUA 4F03A 1MEKA 3FEUA 2YWMA 2HYXA 5DALB 3HY2A 5ID2B 3L0HA 1UA5A 1VF2A 1SU9A 1OC9B 1K0OA 3IAS2 1AC1A 3VWWA 2DSAA 5G30A 1GRXA 2H1DA 2KLXA 2C0FA 4ML1A 4POMA 1GSDA 2JL4A 2GZZA 1B48A 3ERGA 2L4QA 2QA2A 3TKSA 1KTEA 1XBSA 2A2PA 4LMVA 2BMXA 3C71A 1SL0B 1WE0A 3GHAA 3P90A 1BJXA 4ZB9A 1AW9A 3HCZA 2YWOA 2HNLA 4MLYA 1W4VA 1N2AA 2L5OA 3A5IA 2VO4A 3FR3A 4PNFA 5CRWA 4PURA 2E7PA 1HNAA 2RM6A 4N10A 1ON4A 3KMOA 3ZFBA 2DBCA 2HXKA 1JZDA 2VAFA 1PGTA 4EF0A 4BL7A 2V1MA 3MSZA 5FT3A 5ECRB 1Z7RA 2C80A 1FW1A 2P0GA 4O5UA 2N5FA 3I69A 5C00A 1TRUA 1SK0A 1THXA 2WZ9A 1TDIA 3EWLA 2L57A 3HVVA 1Q98A 1PX6A 2H75A 2KP2A 1A2JA 3N5OA 4NAXA 2CT6A 1AAZA 3Q6OA 3E9JB 1DSBA 2H6XA 4HI7A 4KDYA 4DVCA 3F9UA 2AB6A 2I1UA 1GLPA 5HQPA 3C7MA 4ZBAA 1S3RA 3J7Yb 2MMNA 1GULA 2LQQA 4EIPA 3DD3A 3H4KA 3D4TA 5G1LA 4LLRA 3GIXA 1SD8A 1BX9A 2PVQA 4ZXGA 2YJ7A 5ELGA 2B6MA 5J4UA 2IN3A 4TR1A 5EY6A 3TCOA 2DIYA 2GT6A 3O3TA 1XFLA 2H6YA 4Z7XA 5CNWA 3IPZA 4O5RA 2MMZA 4IS0A 2GZYA 2LUSA 2C8UA 3CSIA 2G2QA 1BYEA 2LQOA 2C3TA 4JBBA 4J56E 1JZRA 2VUPA 3UL3A 11GSA 2V6KA 3QR6A 2L59A 3D0ZA 4IGJA 2K8SA 3GTUA 5IMAA 4XRAA 1MD3A 3O76A 4KX4A 1EOGA 3WYWA 2GZPA 2FD3A 4LA1A 4TRXA 5DQSA 1PD21 3CXGA 4TN8A 1TW9A 5ECOB 3M0FA 4MA9A 2CV4A 2XC2A 3HHVA 4HZ2A 1HNBA 1I5GA 4V2LA 5ECNB 1PKZA 2PUKC 22GSA 2O87A 3H79A 3ZZXA 4F9ZA 1TK8B 2HT9A 1X0RA 1ERTA 4TR1B 4K6XA 2K8VA 1AQXA 1M3JA 3LJRA 4KDUA 4Z2UA 1VGLA 5INYA 2VCVA 1F6MC 1K0MA 1NHOA 2P31A 1FAAA 1TRWA 1SJIA 3JCML 2DIZA 2E0QA 3EU3A 1Z7PA 4EE0A 4AJ7A 4RI6A 2YP6A 3IR4A 3GTUB 3GKKA 1A8LA 1PRXA 1GWCA 2HRFA 4DSQA 4MJEA 1WJKA 5EVOA 2DMLA 2PVOC 2V32A 3GYKA 2NPBA 3LQ7A 1G0TA 2IIYA 3AY8A 1XW5A 3QFAC 4G0LA 2VM2A 4HS1A 3CYNA 2ON7A 2FGXA 1MDIA 1J08A 4X1UA 4ECCA 5D9VA 4NV5A 2R0GA 1FVJA 2JZTA 3HJPA 2GSSA 2H76A 3LWAA 3QOUA 4ECJA 3KP8A 2MBTA 2HI7A 3WT1A 4PXOA 4G2EA 2JZRA 2GVPA 3CQFA 3LGCA 2DJ3A 3HDCA 14GSA 2OACA 3KH7A 2GDRA 2CQ9A 2I81A 3PR8A 6GSYA 4TOPA 5CRGA 1RK4A 1ABAA 4ZBDA 4Z2RA 1G6WA 2YZUA 1GTAA 4HZ4A 1FB0A 5E59A 5IM9A 3GSTA 5AN1A 2FNOA 1NSWA 2MMAA 3M1GA 1USBA 2R0PA 1K0DA 2B1KA 2QC7A 4YKGA 1TI3A 3GH6A 1MD4A 5IOWA 4H86A 4K0NA 1GSUA 4MF6A 1YZXA 4PNGA 5JWRB 1B4PA 3TJFA 2HSMA 3FZ4A 5LD0A 2OE0A 4GWRA 3MIXA 3QAWA 1QFNA 5H5RA 3HKRA 4TR0A 2MZCA 3FW2A 4I2UA 4XS1A 2DLXA 4N11A 1SYRA 4NV2A 3DKSA 4ICYA 3I6AA 1F2EA 3FMWA 3TUEA 1T4YA 3GL3A 2V6OA 3TKSE 1GSSA 4EO3A 3KP9A 1OC3A 3OR5A 5J5NA 4ECIA 1ILOA 1ZYNA 1VF4A 1GL8A 3TRQA 4X0XA 4F82A 2H1AA 2X8GA 3F6FA 3P8WA 4ISDA 6GSTA 1K0AA 2JACA 2KHPA 4RQRA 1GLQA 3APSA 4IN0A 1EEJA 1A2LA 1XVQA 3UARA 1ZOFA 3QFBC 2YV7A 2R5GA 1V57A 4IVFA 3LW9A 2WULA 3GV1A 3RHCA 4DSSA 4YQMA 1ERWA 4OD7A 2H0GA 1ZCPA 3FZ9A 5A4WA 1K3OA 1XXUA 2ZNMA 3L4NA 4ID0A 1QGVA 3EINA 3H1NA 2O8VB 4O92A 2KOKA 4IP6A 2GGTA 2LRTA 5G5FA 2YCDA 1H4OA 4FYUA 2M46A 4IJ3A 2QSIA 2KUCA 5FWGA 2FA4A 5DVBA 3TB2A 4MJCA 1XZOA 1U6TA 2PWJA 4GTUA 2NTOA 1M7TA 4QQ7A 2H71A 4HEA2 2YV9A 2EIQA 3F4TA 3EPTA 3QMXA 4Q5RA 1K0CA 5JCGA 4BA7A 3LYKA 1SD9A 4ULXA 4MPGA 2GQKA 3MNGA 3ZRDA 3BCIA 3VLNA 1G6YA 4MH2A 3WGDA 1ZYEA 2R0CA 1Z5YE 3HVXA 5J3RA 4IW9A 1R4WA 4PUAA 4DEJA 2GS3A 1V2AA 4KW6A 1GTBA 1M0UA 4KDXA 2M80A 3EC3A 3IHGA 3CBUA 4DSSB 1ERVA 2JSZA 3TRPA 1OYJA 3A2XA 1S3DA 5A4VA 5D93A 4GQCA 4GXZA 1XVWA 4AJ6A 1GSYA 3TOUA 2C1YA 4OCEA 4TW5A 4BIKA 4I5QA 2R6KA 5A4UA 5HFKA 5DBQA 5ECIB 4HOJA 4PTSA 2PU9C 1ERUA 5L71A 2YWNA 1UVZA 2A4HA 4KSOA 3E3EA 1GNWA 1GP1A 3EMPA 4PX1A 1N8JA 2GTUA 4BWQA 3W8SA 5ABRA 1T8EB 5ECMB 2H8LA 5AISA 3ISOA 5GAND 1M9AA 4FO5A 1RW1A 1M3IA 3KCMA 2C0EA 3CMIA 2RUFA 4IELA 1OKDA 3BJ5A 5IMFA 1SJZA 2GQLA 3ZFLA 3LORA 4FYBA 2GSQA 2LEGA 2H66A 3GSSA 3UOMA 4O7HA 3FHKA 1F9MA 1XCCA 1B9YC 2YANA 1XW6A 1BEDA 2C0GA 5G31A 3D5JA 2ZCTA 4JR6A 4KAEA 2OE3A 5IPHA 1U87A 1V40A 4HSCX 2HE3A 2WRTA 2HRAA 3Q74A 1PN0A 1TU7A 1A23A 4JEDA 4WXTA 2WCIA 3BD2A 3S9FA 3IHQA 4OMVA 4P3YB 1AUCA 2H19A 3RBTA 2C0DA 4WKWA 1PMTA 4ZIJA 3G7JA 3W6GA 1O6JA 2OKAA 3BCKA 2H1BA 1SK2A 4WETA 2R37A 4PQHA 4MZWA 1FVKA 2HZEA 2C3QA 2HLSA 1IYHA 3DMLA 2VD0A 3QDNA 2O89A 1V98A 4IKHA 4BVYA 5EPFA 1RQMA 2FUG2 2IMIA 5ELAA 3C1SA 3TJGA 2JSYA 5ENUA 5KN2A 2R2JA 1KBNA 2B5YA 1PX7A 1XG8A 4O5QA 4WEYA 6GSVA 4V1Ag 2H72A 4GCIA 4NXIA 2VL3A 5LNKe 2AV4A 2VLTA
chains in the Genus database with same CATH topology
3UEMA 1TXXA 5KN3A 2F8AA 2XBIA 4OFNA 1A2MA 4RI7A 3F4RA 2H0HA 1X9WB 4BL7B 3TJBA 1YQ1A 1Z6MA 2M72A 2MYGA 5F05A 2NBSA 5KOWA 2K9FA 2X49A 3KGKA 4N0ZA 5F07A 4G10A 4LMWA 5GSTA 3RHBA 5KN1A 4YKFA 3LXZA 4BPYA 1OE7A 2HRKA 5GZZB 4GSTA 4TKYA 1TTZA 4ML6A 4MP4A 5E4WA 3QD9A 3FR9A 3L9UA 4MABA 2HZEB 2L6DA 3IXRA 1MDKA 3PH9A 2HZFA 4KH7A 4K8MA 5IO2A 5CRHA 4RQXA 3IC8A 4NWYA 1O7UA 3TDGA 2DC5A 5F0GA 3NZNA 2B5EA 2VCXA 1QK8A 1NHYA 1THOA 1GSFA 4ZB6A 1ZYPA 2PN8A 3GX0A 3L9SA 3GL5A 5IOXA 1X5CA 3EE2A 4TR4A 9GSSA 4TVEA 4NHWA 3APQA 3KJYA 1O8WA 3FY7A 1O81A 4L8EA 3RDWA 2VLUA 2YN1A 3KM6A 2H6ZA 1M9BA 3HZ8A 3PINA 3ZTLA 2FWHA 1GTIA 4K9ZA 4ZB8A 1FG4A 1V9WA 3ZL5A 3E0UA 4KGIA 2P5RA 3M9KA 1XWGA 3FZ5A 2AJQB 12GSA 2I4AA 1Z3EA 2VM1A 4HQZA 4POBA 3HVSA 3UVHA 2D2ZA 6GSXA 2B7JA 4GSSA 3F3RA 3L9VA 3H8QA 4KF9A 1XWCA 5J41A 1FB6A 2N5AA 1R7HA 2B7KA 2H73A 1HQOA 3P7XA 3CRTA 2TIRA 4CHSA 5HFIA 2LV3A 3W8JA 4JU5A 1ML6A 5GSSA 1ACVA 1K3YA 5IMZA 3G7YA 1AQWA 2DJ2A 3I43A 2IJYA 2LKUA 2PERA 1Y6EA 4CY6A 3FZAA 1Y25A 1GSEA 4I2TA 1JLWA 2CAIA 4OO5A 4EUYA 4AGSA 4KE3A 4MCUA 3UAPA 20GSA 2DMMA 1O73A 2CX4A 2GLRA 2FWEA 1CQGA 3F63A 3D6IA 4JE1A 3DYRA 4GQFA 4AJ8A 5ECLB 3KTBA 5JCUA 4ILFA 4A5PA 2VD1A 5CP1A 5D9TA 13GSA 4EXJA 1EP8A 2X99A 1WWJA 2VL9A 5IMVA 1WMJA 2YOIA 3GKMA 2F51A 1GSQA 4ZL9A 1FO5A 2B3SA 2LS5A 1T1VA 2YZHA 2FA8A 3KH9A 4FH8A 3A2VA 1T4ZA 2VL2C 2H0IA 4ZL7A 2C3NA 1J9BA 2E2MA 3LFLA 1U88A 4XS4A 3VWUA 1NW2A 2IPAA 1TK5B 2CVDA 3UBLA 1GUHA 3A2WA 5DQYA 4E8HA 1HNCA 2QA1A 5A5KA 3HXSA 3DIEA 2A4VA 5IO0A 2CX3A 1T3BA 2X8CA 2VCTA 1FHEA 3CSJA 1Q4JA 1YKAA 1JZWA 1M2DA 4XHMA 1TOFA 1XWAA 2OBKA 2WJUA 4K7NA 1PQNA 4EC0A 1SJ6A 5FHIA 4YAPA 4Q5QA 1PL1A 1LU4A 5CYYA 2XPEA 1XWBA 4OO4A 2QGVA 5D9WA 3ZLPA 4GSNA 3ZMLA 1A24A 2REMA 3J7Yk 2LSTA 3IBHA 3KXOA 3NIVA 4K0GA 1B4QA 1GUMA 19GSA 4J2FA 5CO3A 3ED3A 1XPVA 5IMDA 1WPIA 1QMVA 2HSYA 1HYUA 3BOAA 5ECSA 4K2DA 1TP9A 3RPNA 1CQHA 4WF4A 4XS4B 5B6NA 2WB9A 2BJXA 2I9HA 4EDZA 3TJJA 1TRVA 5AIXA 2GSRA 2ON5A 4TR3A 2OE1A 4E8EA 1WOUA 3G9BA 1XW9A 3H93A 2VIMA 1A0FA 2F3MA 5IQYA 3US3A 3EVIA 3DVXA 3TGZA 3VWVA 1GNEA 4Q5NA 2UZ8A 2ES7A 1SK1A 3R3EA 5CREA 3WT2A 5G1KA 5B7CA 1ZZYA 2BTOT 3VI5A 2K6VA 4HUAA 2WDUA 1R26A 5CRDA 2QKEA 4I97A 1U3IA 2HSHA 2B1LA 3IV4A 4TXOA 3TKRA 4YH2A 2AYTA 3HJOA 3UIWA 4GRFA 2J23A 3IK9A 1J0FA 1SYXA 17GSA 2AAWA 4X4JA 1GH2A 1JHBA 3SWLA 3HJMA 3EU4A 1TKDB 1Z9HA 1WRYA 1ZMAA 2CVKA 4USSA 1S3AA 4MZBA 1SKWB 2DJJA 2X64A 2O7KA 4KCAA 3ERWA 3DXBA 5DCHA 5HR1A 3U5RE 2XBQA 3KIJA 4PQIA 3CSHA 4V2NA 4XCSA 1EP7A 2CZ3A 3FR6A 4ACSA 1DE2A 3LEFA 4LL4B 3WGEA 4F0BA 4MDCA 3QCPA 3GMFA 4ECBA 4LL1B 4PUFC 3EYTA 2X4AA 1EEMA 1SL1B 3DWVA 3IA1A 4MH3A 3HD5A 1XOBA 3GNJA 3TKSC 3DEXA 1BAYA 4TXOB 2YPMA 2LNTA 1YDKA 5DDLA 4PGTA 5JCWA 4KNDA 4G0IA 2LJRA 2VLVA 3A5WA 4Z2TA 2O85A 1EOHA 3ZMKA 3EURA 4O32A 1G7OA 1TJDA 3CTGA 4XTSA 3LYPA 2K18A 2EIRA 3LSZA 2LJAA 2JADA 3ERFA 4K1FA 1OC8A 4NHZA 4OCFA 3TJKA 3M3MA 2HFDA 1O85A 4K5SA 2VCZA 2H01A 3IK7A 1K3LA 3HA9A 1M2BA 4TXVA 1UC7A 4X43A 1ST9A 2B5XA 3A3TA 4FIWA 4F2IA 4L5OA 5JWOB 4IQAA 3ZVJD 1AQVA 1VF3A 2DJKA 3GFKA 5HR0A 1XIYA 1C72A 2WS2A 2FHEA 5B8BA 5ECPB 4I8BA 1SENA 4OWYA 2FLSA 3F6DA 3MDKA 3TKPA 3RAZA 3ZYWA 4K5RA 3KTLA 3D21A 2LRCA 4KCEA 2RLIA 2JZSA 3ZITA 2H74A 4CW9A 2CA8A 5ECKB 1EV9A 1QUWA 2WGRA 1MTCA 4FYCA 1ZGNA 3F3QA 4N30A 4OFMA 5J9BA 2NDOA 4YQVA 4EIQA 4KA0A 2L6CA 4MNNA 4Q5FA 2IMFA 3UMAA 2VCWA 3IDVA 1GUKA 8GSSA 1VRSD 2PPTA 3F4SA 3LG6A 5F06A 3L78A 2CZ2A 2G0FA 5H5SA 1B8XA 3FKFA 4NMUA 4KUNA 3ZIJA 2GSTA 2JU5A 5D9XA 1YJ6A 3NOFA 3QPMA 3UVTA 3IOSA 2NVLA 3N9JA 1PN9A 1A8YA 3HYPA 3GN3A 4BVYB 3M8NA 3CRUA 4WF5A 2FWGA 3V1WA 2FWFA 1Z6NA 3PPUA 5KN0A 2WFCA 1M99A 5G2ZA 2TRCP 1FOHA 3IE3A 1OE8A 3DGQA 4HJMA 2OBIA 1SKRB 1TK0B 1G7EA 4L0WA 1R5AA 2XHFA 5DJMA 2ALBA 3K8NA 5JWQB 4YAVA 1M2AA 3GUSA 4HJ2A 2XPDA 4HU7A 3DVWA 1OKTA 3DRNA 5D96A 3HZ4A 4QL7A 4OFTA 4G9HA 5DCGA 1X9SB 1LBKA 2VOCA 4PQ1A 1JFUA 3G7IA 4L5LA 5ECHB 1ZL9A 5J9CA 1BQ7A 4YQUA 2EC4A 3VPTA 1U3AA 1HD2A 3ZREA 1H75A 2CVBA 3P2AA 1SL2B 2KP1A 3IC4A 4IJIA 4V1Ap 4EKZA 2H30A 5BRTA 3BBYA 4CDOA 3VWXA 2MMOA 4BWSA 1EGOA 5DJLA 4IQ1A 2E2GA 3VPQA 1OAZA 1EWXA 4IBPA 4FQUA 5COHA 3FK8A 3VURA 1WIKA 3GURA 3VI7A 2L5LA 2J9HA 4JZQA 4MF5A 1VF1A 1F37A 2FY6A 2IMEA 3TKQA 1BG5A 1TRSA 2DJ1A 4K7OA 1F3AA 3GKXA 4ZL8A 1F3BA 3KMNA 2P5QA 4I6XA 5BMUA 5F8BA 4MJAA 2CAQA 4MMMA 2IMKA 1V58A 4DSRA 2OADA 3IAM2 1S3CA 3IRAA 3WGXA 1TU8A 4EL1A 3RPPA 4L0UA 2DKHA 3ZIVA 3D4MA 1YY7A 1EZKA 1A0RP 2OJLA 2A2RA 2OA7A 2FCHA 4RUVA 3ME7A 2PMTA 3I9V2 1DE1A 4BVXA 4J57E 2YJHA 5HFGA 4MF7A 1QQ2A 2LTKA 4IP1A 2AUVA 2L4CA 1MDJA 2ZUPA 1GTUA 3GA4A 5GAPD 5B6MA 1R5PA 2LRNA 4MZCA 2VCQA 1EGRA 4EVMA 6GSWA 4XS6A 1E6BA 4GF0A 1TI1A 2DJ0A 3VFIA 2IMDA 2PBJA 3D22A 4JR4A 2VL2A 1K0BA 3ZVJA 2IFQA 2DKIA 1DBYA 4MJBA 1NM3A 4MPFA 1PKWA 1I9DA 7GSSA 2HRNA 1JLVA 3PGTA 1AXDA 4G0KA 4HDEA 3Q18A 3F8UA 4F0CA 5AGYA 1WP0A 4MK3A 3QAVA 2I3YA 1KNGA 1PL2A 2V41A 1IYIA 4G19A 3TRXA 4WR4A 2EIOA 5IPGA 5KEJA 3GRXA 3M9JA 3KEBA 3FRCA 3TOTA 3KD0A 3UBKA 4QL9A 2RIIA 4K7IA 2RUEA 1K0NA 2A2SA 4BVXB 2IL3A 5IIZA 2R4VA 5DAKA 3C8EA 3EMXA 1X9MB 16GSA 3APOA 3MWHA 3U6VA 3CTFA 4D73A 4WR5A 2TRXA 10GSA 3SBCA 1YEXA 5D8IA 1XOAA 4V2MA 2PGTA 3VK9A 4XIHA 1JZOA 2F8FA 2N5BA 1YF0A 4XRDA 2IFQB 1T7PB 2RM5A 4GLTA 2V2GA 5D73A 3R2QA 4N0VA 1E2YA 2F9SA 2GT5A 3GKNA 1YF1A 3MYDA 4ZBBA 2YNXA 5G5EA 2H70A 4K2XA 1X5DA 3GH9A 3UJ1A 2GQMA 3ME8A 1B9XC 4POKA 5EL8A 4HQSA 5IMCA 3MAKA 1YEPA 4EDYA 3O6TA 5DALA 5KOXA 4WBRD 5ID2A 2C4JA 2IWTA 3FYGA 1EV4A 2X8HA 1OC9A 1PSQA 2YWIA 6GSSA 2Z9SA 1LJRA 5LCZA 5CAXA 1PA3A 2R3XA 1DUGA 3C73A 3F0IA 1W89A 5DAKB 4WBJA 2MBSA 3QAGA 5B8AA 5HR3A 4D73B 1X5EA 1ZYQB 4KSMA 5AIVA 3KZQA 4JRRA 1O8XA 1T00A 2LJKA 3GX8A 3WD6A 3Q19A 1XWKA 1QXHA 1UN2A 1KEBA 4ZILA 4NPBA 18GSA 5HR2A 1SKSB 1FOVA 2AHEA 1URMA 4KB3A 5ECQB 1AIUA 5C04A 4CY8A 2LNSA 1YKCA 3C1RA 2H1GA 4IHUA 4POLA 4HU9A 1OVNA 5H5QA 3LXTA 4AF2A 6GSUA 4F03A 1MEKA 3FEUA 2YWMA 2HYXA 5DALB 3HY2A 5ID2B 3L0HA 1UA5A 1SU9A 1VF2A 1OC9B 1K0OA 3IAS2 1AC1A 3VWWA 2DSAA 5G30A 1GRXA 2H1DA 2KLXA 2C0FA 4ML1A 4POMA 1GSDA 2JL4A 2GZZA 1B48A 3ERGA 2L4QA 2QA2A 3TKSA 1KTEA 1XBSA 2A2PA 4LMVA 2BMXA 3C71A 1SL0B 1WE0A 3GHAA 3P90A 1BJXA 4ZB9A 1AW9A 3HCZA 2YWOA 2HNLA 4MLYA 1W4VA 1N2AA 2L5OA 3A5IA 2VO4A 3FR3A 4PNFA 5CRWA 4PURA 2E7PA 1HNAA 2RM6A 4N10A 1ON4A 3KMOA 3ZFBA 2DBCA 2HXKA 1JZDA 2VAFA 1PGTA 4EF0A 4BL7A 2V1MA 3MSZA 5FT3A 5ECRB 1Z7RA 2C80A 1FW1A 2P0GA 4O5UA 2N5FA 3I69A 5C00A 1TRUA 1SK0A 1THXA 2WZ9A 1TDIA 3EWLA 2L57A 3HVVA 1Q98A 1PX6A 2H75A 2KP2A 1A2JA 3N5OA 4NAXA 2CT6A 1AAZA 3Q6OA 3E9JB 1DSBA 2H6XA 4HI7A 4KDYA 4DVCA 3F9UA 2AB6A 2I1UA 1GLPA 5HQPA 3C7MA 4ZBAA 3J7Yb 2MMNA 1GULA 2LQQA 4EIPA 3DD3A 3H4KA 3D4TA 5G1LA 4LLRA 3GIXA 1SD8A 1BX9A 2PVQA 4ZXGA 2YJ7A 5ELGA 2B6MA 5J4UA 2IN3A 4TR1A 5EY6A 3TCOA 2DIYA 2GT6A 3O3TA 1XFLA 2H6YA 4Z7XA 5CNWA 3IPZA 4O5RA 2MMZA 4IS0A 2GZYA 2LUSA 2C8UA 3CSIA 2G2QA 1BYEA 2LQOA 2C3TA 4JBBA 4J56E 1JZRA 2VUPA 3UL3A 11GSA 2V6KA 3QR6A 2L59A 3D0ZA 4IGJA 2K8SA 3GTUA 5IMAA 4XRAA 1MD3A 3O76A 4KX4A 1EOGA 3WYWA 2GZPA 2FD3A 4LA1A 4TRXA 5DQSA 1PD21 3CXGA 4TN8A 1TW9A 5ECOB 3M0FA 4MA9A 2CV4A 2XC2A 3HHVA 4HZ2A 1HNBA 1I5GA 4V2LA 5ECNB 1PKZA 2PUKC 22GSA 2O87A 3H79A 3ZZXA 4F9ZA 1TK8B 2HT9A 1X0RA 1ERTA 4TR1B 4K6XA 2K8VA 1AQXA 3LJRA 4KDUA 4Z2UA 1VGLA 5INYA 2VCVA 1F6MC 1K0MA 1NHOA 2P31A 1FAAA 1TRWA 1SJIA 3JCML 2DIZA 2E0QA 3EU3A 1Z7PA 4EE0A 4AJ7A 4RI6A 2YP6A 3IR4A 3GTUB 3GKKA 1A8LA 1PRXA 1GWCA 2HRFA 4DSQA 4MJEA 1WJKA 5EVOA 2DMLA 2PVOC 2V32A 3GYKA 2NPBA 3LQ7A 1G0TA 2IIYA 3AY8A 1XW5A 3QFAC 4G0LA 2VM2A 4HS1A 3CYNA 2ON7A 2FGXA 1MDIA 1J08A 4X1UA 4ECCA 5D9VA 4NV5A 2R0GA 1FVJA 2JZTA 3HJPA 2GSSA 2H76A 3LWAA 3QOUA 4ECJA 3KP8A 2MBTA 2HI7A 3WT1A 4PXOA 4G2EA 2JZRA 2GVPA 3LGCA 2DJ3A 3HDCA 14GSA 2OACA 3KH7A 2GDRA 2CQ9A 2I81A 3PR8A 6GSYA 4TOPA 5CRGA 1RK4A 1ABAA 4ZBDA 4Z2RA 1G6WA 2YZUA 1GTAA 4HZ4A 1FB0A 5E59A 5IM9A 3GSTA 5AN1A 2FNOA 1NSWA 2MMAA 3M1GA 1USBA 2R0PA 1K0DA 2B1KA 2QC7A 4YKGA 1TI3A 3GH6A 1MD4A 5IOWA 4H86A 4K0NA 1GSUA 4MF6A 1YZXA 4PNGA 5JWRB 1B4PA 3TJFA 2HSMA 3FZ4A 5LD0A 2OE0A 4GWRA 3MIXA 3QAWA 1QFNA 5H5RA 3HKRA 4TR0A 2MZCA 3FW2A 4I2UA 4XS1A 2DLXA 4N11A 1SYRA 4NV2A 3DKSA 4ICYA 3I6AA 1F2EA 3FMWA 3TUEA 1T4YA 3GL3A 2V6OA 3TKSE 1GSSA 4EO3A 3KP9A 1OC3A 3OR5A 5J5NA 4ECIA 1ILOA 1ZYNA 1VF4A 1GL8A 3TRQA 4X0XA 4F82A 2H1AA 2X8GA 3F6FA 3P8WA 4ISDA 6GSTA 1K0AA 2JACA 2KHPA 4RQRA 1GLQA 3APSA 4IN0A 1EEJA 1A2LA 1XVQA 3UARA 1ZOFA 3QFBC 2YV7A 2R5GA 1V57A 4IVFA 3LW9A 2WULA 3GV1A 3RHCA 4DSSA 4YQMA 1ERWA 4OD7A 2H0GA 1ZCPA 3FZ9A 5A4WA 1K3OA 1XXUA 2ZNMA 3L4NA 4ID0A 1QGVA 3EINA 3H1NA 2O8VB 4O92A 2KOKA 4IP6A 2GGTA 2LRTA 5G5FA 2YCDA 1H4OA 4FYUA 2M46A 4IJ3A 2QSIA 2KUCA 5FWGA 2FA4A 5DVBA 3TB2A 4MJCA 1XZOA 1U6TA 2PWJA 4GTUA 2NTOA 1M7TA 4QQ7A 2H71A 4HEA2 2YV9A 2EIQA 3F4TA 3EPTA 3QMXA 4Q5RA 1K0CA 5JCGA 4BA7A 3LYKA 1SD9A 4ULXA 4MPGA 2GQKA 3MNGA 3ZRDA 3BCIA 3VLNA 1G6YA 4MH2A 3WGDA 1ZYEA 2R0CA 1Z5YE 3HVXA 5J3RA 4IW9A 1R4WA 4PUAA 4DEJA 2GS3A 1V2AA 4KW6A 1GTBA 1M0UA 4KDXA 2M80A 3EC3A 3IHGA 3CBUA 4DSSB 1ERVA 2JSZA 3TRPA 1OYJA 3A2XA 1S3DA 5A4VA 5D93A 4GQCA 4GXZA 1XVWA 4AJ6A 1GSYA 3TOUA 2C1YA 4OCEA 4TW5A 4I5QA 2R6KA 5A4UA 5HFKA 5DBQA 5ECIB 4HOJA 4PTSA 2PU9C 1ERUA 5L71A 2YWNA 1UVZA 2A4HA 4KSOA 3E3EA 1GNWA 1GP1A 3EMPA 4PX1A 1N8JA 2GTUA 4BWQA 3W8SA 5ABRA 1T8EB 5ECMB 2H8LA 5AISA 3ISOA 5GAND 1M9AA 4FO5A 1RW1A 3KCMA 2C0EA 3CMIA 2RUFA 4IELA 1OKDA 3BJ5A 5IMFA 1SJZA 2GQLA 3ZFLA 3LORA 4FYBA 2GSQA 2LEGA 2H66A 3GSSA 3UOMA 4O7HA 3FHKA 1F9MA 1XCCA 1B9YC 2YANA 1XW6A 1BEDA 2C0GA 5G31A 3D5JA 2ZCTA 4JR6A 4KAEA 2OE3A 5IPHA 1U87A 1V40A 2HE3A 2WRTA 2HRAA 3Q74A 1PN0A 1TU7A 1A23A 4JEDA 4WXTA 2WCIA 3BD2A 3S9FA 3IHQA 4OMVA 4P3YB 1AUCA 2H19A 3RBTA 2C0DA 4WKWA 1PMTA 4ZIJA 3G7JA 3W6GA 1O6JA 2OKAA 3BCKA 2H1BA 1SK2A 4WETA 2R37A 4PQHA 4MZWA 1FVKA 2HZEA 2C3QA 2HLSA 1IYHA 3DMLA 2VD0A 3QDNA 2O89A 1V98A 4IKHA 4BVYA 5EPFA 1RQMA 2FUG2 2IMIA 5ELAA 3C1SA 3TJGA 2JSYA 5ENUA 5KN2A 2R2JA 1KBNA 2B5YA 1PX7A 4O5QA 4WEYA 6GSVA 4V1Ag 2H72A 4GCIA 4NXIA 2VL3A 5LNKe 2AV4A 2VLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UEM A;  1TXX A;  5KN3 A;  2F8A A;  2XBI A;  4OFN A;  1A2M A;  4RI7 A;  3F4R A;  2H0H A;  1X9W B;  3TJB A;  1YQ1 A;  1Z6M A;  2M72 A;  2MYG A;  5F05 A;  2NBS A;  2K9F A;  3KGK A;  4N0Z A;  5F07 A;  4G10 A;  4LMW A;  5GST A;  3RHB A;  5KN1 A;  3LXZ A;  4BPY A;  1OE7 A;  5GZZ B;  4GST A;  4TKY A;  1TTZ A;  4ML6 A;  4MP4 A;  5E4W A;  3QD9 A;  3FR9 A;  3L9U A;  4MAB A;  2HZE B;  2L6D A;  3IXR A;  1MDK A;  3PH9 A;  2HZF A;  4KH7 A;  4K8M A;  5IO2 A;  5CRH A;  4RQX A;  4NWY A;  1O7U A;  3TDG A;  2DC5 A;  5F0G A;  3NZN A;  2B5E A;  2VCX A;  1QK8 A;  1NHY A;  1THO A;  1GSF A;  4ZB6 A;  2PN8 A;  3GX0 A;  3L9S A;  3GL5 A;  5IOX A;  1X5C A;  3EE2 A;  4TR4 A;  9GSS A;  4TVE A;  4NHW A;  3APQ A;  3KJY A;  1O8W A;  3FY7 A;  1O81 A;  4L8E A;  3RDW A;  2VLU A;  2YN1 A;  3KM6 A;  2H6Z A;  1M9B A;  3HZ8 A;  3PIN A;  3ZTL A;  2FWH A;  1GTI A;  4K9Z A;  4ZB8 A;  1FG4 A;  1V9W A;  3ZL5 A;  3E0U A;  4KGI A;  2P5R A;  3M9K A;  1XWG A;  3FZ5 A;  2AJQ B;  12GS A;  2I4A A;  1Z3E A;  2VM1 A;  4HQZ A;  4POB A;  3HVS A;  3UVH A;  2D2Z A;  6GSX A;  2B7J A;  4GSS A;  3F3R A;  3L9V A;  3H8Q A;  1XWC A;  5J41 A;  1FB6 A;  2N5A A;  1R7H A;  2B7K A;  2H73 A;  1HQO A;  3P7X A;  3CRT A;  2TIR A;  4CHS A;  5HFI A;  2LV3 A;  3W8J A;  4JU5 A;  1ML6 A;  5GSS A;  1ACV A;  1K3Y A;  5IMZ A;  3G7Y A;  1AQW A;  2DJ2 A;  3I43 A;  2IJY A;  2LKU A;  2PER A;  1Y6E A;  3FZA A;  1Y25 A;  1GSE A;  4I2T A;  1JLW A;  2CAI A;  4OO5 A;  4EUY A;  4AGS A;  4KE3 A;  4MCU A;  3UAP A;  20GS A;  2DMM A;  1O73 A;  2CX4 A;  2GLR A;  2FWE A;  1CQG A;  3F63 A;  3D6I A;  4JE1 A;  3DYR A;  4GQF A;  4AJ8 A;  5ECL B;  3KTB A;  5JCU A;  4ILF A;  2VD1 A;  5CP1 A;  5D9T A;  13GS A;  4EXJ A;  1EP8 A;  2X99 A;  1WWJ A;  2VL9 A;  5IMV A;  1WMJ A;  2YOI A;  3GKM A;  2F51 A;  1GSQ A;  4ZL9 A;  1FO5 A;  2B3S A;  2LS5 A;  1T1V A;  2YZH A;  2FA8 A;  3KH9 A;  4FH8 A;  3A2V A;  1T4Z A;  2VL2 C;  2H0I A;  4ZL7 A;  2C3N A;  1J9B A;  2E2M A;  3LFL A;  1U88 A;  4XS4 A;  3VWU A;  1NW2 A;  2IPA A;  1TK5 B;  2CVD A;  3UBL A;  1GUH A;  3A2W A;  5DQY A;  4E8H A;  1HNC A;  5A5K A;  3HXS A;  3DIE A;  2A4V A;  5IO0 A;  2CX3 A;  1T3B A;  2X8C A;  2VCT A;  1FHE A;  3CSJ A;  1Q4J A;  1YKA A;  1JZW A;  1M2D A;  4XHM A;  1TOF A;  1XWA A;  2OBK A;  2WJU A;  4K7N A;  1PQN A;  4EC0 A;  1SJ6 A;  5FHI A;  4YAP A;  4Q5Q A;  1PL1 A;  1LU4 A;  5CYY A;  2XPE A;  1XWB A;  4OO4 A;  2QGV A;  5D9W A;  3ZLP A;  4GSN A;  3ZML A;  1A24 A;  2REM A;  3J7Y k;  2LST A;  3IBH A;  3KXO A;  3NIV A;  4K0G A;  1B4Q A;  1GUM A;  19GS A;  4J2F A;  5CO3 A;  3ED3 A;  1XPV A;  5IMD A;  1WPI A;  1QMV A;  2HSY A;  1HYU A;  3BOA A;  5ECS A;  4K2D A;  1TP9 A;  3RPN A;  1CQH A;  4WF4 A;  4XS4 B;  5B6N A;  2WB9 A;  2BJX A;  2I9H A;  4EDZ A;  3TJJ A;  1TRV A;  5AIX A;  2GSR A;  2ON5 A;  4TR3 A;  2OE1 A;  4E8E A;  1WOU A;  3G9B A;  1XW9 A;  3H93 A;  2VIM A;  1A0F A;  2F3M A;  5IQY A;  3US3 A;  3EVI A;  3DVX A;  3TGZ A;  3VWV A;  1GNE A;  4Q5N A;  2ES7 A;  1SK1 A;  5CRE A;  3WT2 A;  5G1K A;  5B7C A;  1ZZY A;  2BTO T;  3VI5 A;  2K6V A;  4HUA A;  2WDU A;  1R26 A;  5CRD A;  2QKE A;  4I97 A;  1U3I A;  2HSH A;  2B1L A;  3IV4 A;  4TXO A;  3TKR A;  4YH2 A;  2AYT A;  3HJO A;  3UIW A;  4GRF A;  2J23 A;  3IK9 A;  1J0F A;  1SYX A;  17GS A;  2AAW A;  1GH2 A;  1JHB A;  3SWL A;  3HJM A;  3EU4 A;  1TKD B;  1Z9H A;  1WRY A;  1ZMA A;  2CVK A;  1S3A A;  4MZB A;  1SKW B;  2DJJ A;  2X64 A;  2O7K A;  4KCA A;  3ERW A;  3DXB A;  5DCH A;  5HR1 A;  3U5R E;  2XBQ A;  3KIJ A;  4PQI A;  3CSH A;  4V2N A;  4XCS A;  1EP7 A;  2CZ3 A;  3FR6 A;  4ACS A;  1DE2 A;  3LEF A;  4LL4 B;  3WGE A;  4F0B A;  4MDC A;  3QCP A;  3GMF A;  4ECB A;  4LL1 B;  4PUF C;  3EYT A;  1EEM A;  1SL1 B;  3DWV A;  3IA1 A;  4MH3 A;  3HD5 A;  1XOB A;  3GNJ A;  3TKS C;  3DEX A;  1BAY A;  4TXO B;  2YPM A;  2LNT A;  1YDK A;  5DDL A;  4PGT A;  5JCW A;  4KND A;  2LJR A;  2VLV A;  3A5W A;  2O85 A;  1EOH A;  3ZMK A;  3EUR A;  4O32 A;  1G7O A;  1TJD A;  3CTG A;  4XTS A;  3LYP A;  2K18 A;  2EIR A;  3LSZ A;  2LJA A;  2JAD A;  3ERF A;  4K1F A;  1OC8 A;  4NHZ A;  4OCF A;  3TJK A;  3M3M A;  2HFD A;  1O85 A;  2VCZ A;  2H01 A;  3IK7 A;  1K3L A;  3HA9 A;  1M2B A;  4TXV A;  1UC7 A;  4X43 A;  1ST9 A;  2B5X A;  3A3T A;  4FIW A;  4F2I A;  4L5O A;  5JWO B;  4IQA A;  3ZVJ D;  1AQV A;  1VF3 A;  2DJK A;  3GFK A;  5HR0 A;  1XIY A;  1C72 A;  2WS2 A;  2FHE A;  5B8B A;  5ECP B;  4I8B A;  1SEN A;  4OWY A;  2FLS A;  3F6D A;  3MDK A;  3TKP A;  3RAZ A;  3ZYW A;  3KTL A;  3D21 A;  2LRC A;  4KCE A;  2RLI A;  2JZS A;  3ZIT A;  2H74 A;  4CW9 A;  2CA8 A;  5ECK B;  1EV9 A;  1QUW A;  2WGR A;  1MTC A;  4FYC A;  1ZGN A;  3F3Q A;  4N30 A;  4OFM A;  5J9B A;  2NDO A;  4YQV A;  4KA0 A;  2L6C A;  4Q5F A;  2IMF A;  3UMA A;  2VCW A;  3IDV A;  1GUK A;  8GSS A;  1VRS D;  2PPT A;  3F4S A;  3LG6 A;  5F06 A;  3L78 A;  2CZ2 A;  2G0F A;  5H5S A;  1B8X A;  3FKF A;  4NMU A;  4KUN A;  3ZIJ A;  2GST A;  2JU5 A;  5D9X A;  1YJ6 A;  3NOF A;  3QPM A;  3UVT A;  3IOS A;  2NVL A;  3N9J A;  1PN9 A;  1A8Y A;  3HYP A;  3GN3 A;  3M8N A;  3CRU A;  4WF5 A;  2FWG A;  3V1W A;  2FWF A;  1Z6N A;  5KN0 A;  2WFC A;  1M99 A;  5G2Z A;  2TRC P;  3IE3 A;  1OE8 A;  3DGQ A;  4HJM A;  2OBI A;  1SKR B;  1TK0 B;  1G7E A;  4L0W A;  1R5A A;  2XHF A;  5DJM A;  2ALB A;  3K8N A;  5JWQ B;  4YAV A;  1M2A A;  3GUS A;  4HJ2 A;  2XPD A;  4HU7 A;  3DVW A;  1OKT A;  3DRN A;  5D96 A;  3HZ4 A;  4QL7 A;  4OFT A;  4G9H A;  5DCG A;  1X9S B;  1LBK A;  2VOC A;  4PQ1 A;  1JFU A;  3G7I A;  4L5L A;  5ECH B;  1ZL9 A;  5J9C A;  1BQ7 A;  4YQU A;  2EC4 A;  3VPT A;  1U3A A;  1HD2 A;  3ZRE A;  1H75 A;  2CVB A;  3P2A A;  1SL2 B;  2KP1 A;  3IC4 A;  4IJI A;  4V1A p;  4EKZ A;  2H30 A;  3BBY A;  4CDO A;  3VWX A;  2MMO A;  4BWS A;  1EGO A;  5DJL A;  4IQ1 A;  2E2G A;  3VPQ A;  1OAZ A;  1EWX A;  4IBP A;  5COH A;  3FK8 A;  3VUR A;  1WIK A;  3GUR A;  3VI7 A;  2L5L A;  2J9H A;  4JZQ A;  4MF5 A;  1VF1 A;  1F37 A;  2FY6 A;  2IME A;  3TKQ A;  1BG5 A;  1TRS A;  2DJ1 A;  4K7O A;  1F3A A;  3GKX A;  4ZL8 A;  1F3B A;  3KMN A;  2P5Q A;  4I6X A;  5F8B A;  4MJA A;  2CAQ A;  4MMM A;  2IMK A;  1V58 A;  4DSR A;  2OAD A;  3IAM 2;  1S3C A;  3IRA A;  3WGX A;  1TU8 A;  4EL1 A;  3RPP A;  4L0U A;  3ZIV A;  3D4M A;  1YY7 A;  1EZK A;  1A0R P;  2OJL A;  2A2R A;  2OA7 A;  2FCH A;  4RUV A;  3ME7 A;  2PMT A;  3I9V 2;  1DE1 A;  4BVX A;  4J57 E;  2YJH A;  5HFG A;  4MF7 A;  1QQ2 A;  2LTK A;  4IP1 A;  2AUV A;  2L4C A;  1MDJ A;  2ZUP A;  1GTU A;  3GA4 A;  5GAP D;  5B6M A;  1R5P A;  2LRN A;  4MZC A;  2VCQ A;  1EGR A;  4EVM A;  6GSW A;  4XS6 A;  1E6B A;  4GF0 A;  1TI1 A;  2DJ0 A;  3VFI A;  2IMD A;  2PBJ A;  3D22 A;  4JR4 A;  2VL2 A;  1K0B A;  3ZVJ A;  2IFQ A;  1DBY A;  4MJB A;  1NM3 A;  4MPF A;  1PKW A;  1I9D A;  7GSS A;  2HRN A;  1JLV A;  3PGT A;  1AXD A;  4HDE A;  3Q18 A;  3F8U A;  4F0C A;  5AGY A;  1WP0 A;  4MK3 A;  3QAV A;  2I3Y A;  1KNG A;  1PL2 A;  2V41 A;  1IYI A;  4G19 A;  3TRX A;  4WR4 A;  2EIO A;  5IPG A;  5KEJ A;  3GRX A;  3M9J A;  3KEB A;  3FRC A;  3TOT A;  3KD0 A;  3UBK A;  4QL9 A;  2RII A;  4K7I A;  2RUE A;  1K0N A;  2A2S A;  2IL3 A;  5IIZ A;  2R4V A;  5DAK A;  3C8E A;  3EMX A;  1X9M B;  16GS A;  3APO A;  3MWH A;  3U6V A;  3CTF A;  4D73 A;  4WR5 A;  2TRX A;  10GS A;  3SBC A;  1YEX A;  5D8I A;  1XOA A;  4V2M A;  2PGT A;  3VK9 A;  4XIH A;  1JZO A;  2F8F A;  2N5B A;  1YF0 A;  4XRD A;  2IFQ B;  1T7P B;  2RM5 A;  4GLT A;  2V2G A;  5D73 A;  3R2Q A;  4N0V A;  1E2Y A;  2F9S A;  2GT5 A;  3GKN A;  1YF1 A;  4ZBB A;  2YNX A;  5G5E A;  2H70 A;  1X5D A;  3GH9 A;  3UJ1 A;  2GQM A;  3ME8 A;  1B9X C;  4POK A;  5EL8 A;  4HQS A;  5IMC A;  3MAK A;  1YEP A;  4EDY A;  3O6T A;  5DAL A;  4WBR D;  5ID2 A;  2C4J A;  2IWT A;  3FYG A;  1EV4 A;  2X8H A;  1OC9 A;  1PSQ A;  2YWI A;  6GSS A;  2Z9S A;  1LJR A;  5LCZ A;  5CAX A;  1PA3 A;  2R3X A;  1DUG A;  3C73 A;  3F0I A;  1W89 A;  5DAK B;  4WBJ A;  2MBS A;  3QAG A;  5B8A A;  5HR3 A;  4D73 B;  1X5E A;  1ZYQ B;  4KSM A;  5AIV A;  3KZQ A;  4JRR A;  1O8X A;  1T00 A;  2LJK A;  3GX8 A;  3WD6 A;  3Q19 A;  1XWK A;  1QXH A;  1UN2 A;  1KEB A;  4ZIL A;  4NPB A;  18GS A;  5HR2 A;  1SKS B;  1FOV A;  2AHE A;  1URM A;  4KB3 A;  5ECQ B;  1AIU A;  5C04 A;  2LNS A;  1YKC A;  3C1R A;  2H1G A;  4IHU A;  4POL A;  4HU9 A;  1OVN A;  5H5Q A;  3LXT A;  4AF2 A;  6GSU A;  4F03 A;  1MEK A;  3FEU A;  2YWM A;  2HYX A;  5DAL B;  3HY2 A;  5ID2 B;  3L0H A;  1UA5 A;  1SU9 A;  1VF2 A;  1OC9 B;  1K0O A;  3IAS 2;  1AC1 A;  3VWW A;  2DSA A;  5G30 A;  1GRX A;  2H1D A;  2KLX A;  2C0F A;  4ML1 A;  4POM A;  1GSD A;  2JL4 A;  2GZZ A;  1B48 A;  3ERG A;  2L4Q A;  3TKS A;  1KTE A;  1XBS A;  4LMV A;  2BMX A;  3C71 A;  1SL0 B;  1WE0 A;  3GHA A;  3P90 A;  1BJX A;  4ZB9 A;  1AW9 A;  3HCZ A;  2YWO A;  2HNL A;  4MLY A;  1W4V A;  1N2A A;  2L5O A;  2VO4 A;  3FR3 A;  4PNF A;  5CRW A;  4PUR A;  2E7P A;  1HNA A;  2RM6 A;  4N10 A;  1ON4 A;  3KMO A;  3ZFB A;  2DBC A;  2HXK A;  1JZD A;  2VAF A;  1PGT A;  4EF0 A;  4BL7 A;  2V1M A;  3MSZ A;  5FT3 A;  5ECR B;  1Z7R A;  2C80 A;  1FW1 A;  2P0G A;  2N5F A;  3I69 A;  5C00 A;  1TRU A;  1SK0 A;  1THX A;  2WZ9 A;  1TDI A;  3EWL A;  2L57 A;  3HVV A;  1Q98 A;  1PX6 A;  2H75 A;  2KP2 A;  1A2J A;  3N5O A;  4NAX A;  2CT6 A;  1AAZ A;  3Q6O A;  3E9J B;  1DSB A;  2H6X A;  4HI7 A;  4KDY A;  4DVC A;  3F9U A;  2AB6 A;  2I1U A;  1GLP A;  5HQP A;  3C7M A;  4ZBA A;  3J7Y b;  2MMN A;  1GUL A;  2LQQ A;  3DD3 A;  3H4K A;  3D4T A;  5G1L A;  4LLR A;  3GIX A;  1SD8 A;  1BX9 A;  2PVQ A;  4ZXG A;  2YJ7 A;  5ELG A;  2B6M A;  5J4U A;  2IN3 A;  4TR1 A;  5EY6 A;  3TCO A;  2DIY A;  2GT6 A;  3O3T A;  1XFL A;  2H6Y A;  4Z7X A;  5CNW A;  3IPZ A;  4O5R A;  2MMZ A;  4IS0 A;  2GZY A;  2LUS A;  2C8U A;  3CSI A;  2G2Q A;  1BYE A;  2LQO A;  2C3T A;  4JBB A;  4J56 E;  1JZR A;  2VUP A;  3UL3 A;  11GS A;  2V6K A;  3QR6 A;  2L59 A;  3D0Z A;  4IGJ A;  2K8S A;  3GTU A;  5IMA A;  4XRA A;  1MD3 A;  3O76 A;  4KX4 A;  1EOG A;  3WYW A;  2GZP A;  2FD3 A;  4LA1 A;  4TRX A;  5DQS A;  1PD2 1;  3CXG A;  4TN8 A;  1TW9 A;  5ECO B;  3M0F A;  4MA9 A;  2CV4 A;  2XC2 A;  3HHV A;  4HZ2 A;  1HNB A;  1I5G A;  4V2L A;  5ECN B;  1PKZ A;  2PUK C;  22GS A;  2O87 A;  3H79 A;  3ZZX A;  4F9Z A;  1TK8 B;  2HT9 A;  1X0R A;  1ERT A;  4TR1 B;  4K6X A;  2K8V A;  1AQX A;  3LJR A;  4KDU A;  1VGL A;  5INY A;  2VCV A;  1F6M C;  1K0M A;  1NHO A;  2P31 A;  1FAA A;  1TRW A;  1SJI A;  3JCM L;  2DIZ A;  2E0Q A;  3EU3 A;  1Z7P A;  4EE0 A;  4AJ7 A;  4RI6 A;  2YP6 A;  3IR4 A;  3GTU B;  3GKK A;  1A8L A;  1PRX A;  1GWC A;  2HRF A;  4DSQ A;  4MJE A;  1WJK A;  5EVO A;  2DML A;  2PVO C;  2V32 A;  3GYK A;  2NPB A;  3LQ7 A;  1G0T A;  2IIY A;  3AY8 A;  1XW5 A;  3QFA C;  4HS1 A;  2VM2 A;  3CYN A;  2ON7 A;  2FGX A;  1MDI A;  1J08 A;  4X1U A;  4ECC A;  5D9V A;  4NV5 A;  1FVJ A;  2JZT A;  3HJP A;  2GSS A;  2H76 A;  3LWA A;  3QOU A;  4ECJ A;  3KP8 A;  2MBT A;  2HI7 A;  3WT1 A;  4PXO A;  4G2E A;  2JZR A;  2GVP A;  3LGC A;  2DJ3 A;  3HDC A;  14GS A;  2OAC A;  3KH7 A;  2GDR A;  2CQ9 A;  2I81 A;  3PR8 A;  6GSY A;  4TOP A;  5CRG A;  1RK4 A;  1ABA A;  4ZBD A;  1G6W A;  2YZU A;  1GTA A;  4HZ4 A;  1FB0 A;  5E59 A;  5IM9 A;  3GST A;  5AN1 A;  2FNO A;  1NSW A;  2MMA A;  3M1G A;  1USB A;  1K0D A;  2B1K A;  2QC7 A;  1TI3 A;  3GH6 A;  1MD4 A;  5IOW A;  4H86 A;  4K0N A;  1GSU A;  4MF6 A;  1YZX A;  4PNG A;  5JWR B;  1B4P A;  3TJF A;  3FZ4 A;  5LD0 A;  2OE0 A;  4GWR A;  3QAW A;  1QFN A;  5H5R A;  3HKR A;  4TR0 A;  2MZC A;  3FW2 A;  4I2U A;  4XS1 A;  2DLX A;  4N11 A;  1SYR A;  4NV2 A;  3DKS A;  3I6A A;  1F2E A;  3TUE A;  1T4Y A;  3GL3 A;  2V6O A;  3TKS E;  1GSS A;  4EO3 A;  3KP9 A;  1OC3 A;  3OR5 A;  5J5N A;  4ECI A;  1ILO A;  1VF4 A;  1GL8 A;  3TRQ A;  4X0X A;  4F82 A;  2H1A A;  2X8G A;  3F6F A;  3P8W A;  4ISD A;  6GST A;  1K0A A;  2JAC A;  2KHP A;  4RQR A;  1GLQ A;  3APS A;  4IN0 A;  1EEJ A;  1A2L A;  1XVQ A;  3UAR A;  1ZOF A;  3QFB C;  2YV7 A;  2R5G A;  1V57 A;  4IVF A;  2WUL A;  3GV1 A;  3RHC A;  4DSS A;  4YQM A;  1ERW A;  4OD7 A;  2H0G A;  1ZCP A;  3FZ9 A;  5A4W A;  1K3O A;  1XXU A;  2ZNM A;  3L4N A;  4ID0 A;  1QGV A;  3EIN A;  3H1N A;  2O8V B;  4O92 A;  2KOK A;  4IP6 A;  2GGT A;  2LRT A;  5G5F A;  2YCD A;  1H4O A;  4FYU A;  2M46 A;  4IJ3 A;  2QSI A;  2KUC A;  5FWG A;  2FA4 A;  5DVB A;  3TB2 A;  4MJC A;  1XZO A;  1U6T A;  2PWJ A;  4GTU A;  2NTO A;  1M7T A;  4QQ7 A;  2H71 A;  4HEA 2;  2YV9 A;  2EIQ A;  3F4T A;  3QMX A;  4Q5R A;  1K0C A;  5JCG A;  4BA7 A;  3LYK A;  1SD9 A;  4ULX A;  4MPG A;  2GQK A;  3MNG A;  3ZRD A;  3BCI A;  3VLN A;  1G6Y A;  4MH2 A;  3WGD A;  1ZYE A;  1Z5Y E;  3HVX A;  5J3R A;  4IW9 A;  1R4W A;  4PUA A;  4DEJ A;  2GS3 A;  1V2A A;  4KW6 A;  1GTB A;  1M0U A;  4KDX A;  2M80 A;  3EC3 A;  3CBU A;  4DSS B;  1ERV A;  2JSZ A;  3TRP A;  1OYJ A;  3A2X A;  1S3D A;  5A4V A;  5D93 A;  4GQC A;  4GXZ A;  1XVW A;  4AJ6 A;  1GSY A;  3TOU A;  2C1Y A;  4OCE A;  4TW5 A;  4I5Q A;  2R6K A;  5A4U A;  5HFK A;  5DBQ A;  5ECI B;  4HOJ A;  2PU9 C;  1ERU A;  5L71 A;  2YWN A;  1UVZ A;  4KSO A;  3E3E A;  1GNW A;  1GP1 A;  3EMP A;  4PX1 A;  1N8J A;  2GTU A;  4BWQ A;  3W8S A;  5ABR A;  1T8E B;  5ECM B;  2H8L A;  5AIS A;  3ISO A;  5GAN D;  1M9A A;  4FO5 A;  1RW1 A;  3KCM A;  2C0E A;  3CMI A;  2RUF A;  4IEL A;  1OKD A;  3BJ5 A;  5IMF A;  1SJZ A;  2GQL A;  3ZFL A;  3LOR A;  4FYB A;  2GSQ A;  2LEG A;  2H66 A;  3GSS A;  3UOM A;  4O7H A;  3FHK A;  1F9M A;  1XCC A;  1B9Y C;  2YAN A;  1XW6 A;  1BED A;  2C0G A;  5G31 A;  3D5J A;  2ZCT A;  4JR6 A;  4KAE A;  2OE3 A;  5IPH A;  1U87 A;  1V40 A;  2HE3 A;  2WRT A;  3Q74 A;  1TU7 A;  1A23 A;  4JED A;  4WXT A;  2WCI A;  3BD2 A;  3S9F A;  3IHQ A;  4OMV A;  4P3Y B;  1AUC A;  2H19 A;  3RBT A;  2C0D A;  4WKW A;  1PMT A;  4ZIJ A;  3G7J A;  3W6G A;  1O6J A;  2OKA A;  3BCK A;  2H1B A;  1SK2 A;  4WET A;  2R37 A;  4PQH A;  4MZW A;  1FVK A;  2HZE A;  2C3Q A;  2HLS A;  1IYH A;  3DML A;  2VD0 A;  3QDN A;  2O89 A;  1V98 A;  4IKH A;  4BVY A;  5EPF A;  1RQM A;  2FUG 2;  2IMI A;  5ELA A;  3C1S A;  3TJG A;  2JSY A;  5ENU A;  5KN2 A;  2R2J A;  1KBN A;  2B5Y A;  1PX7 A;  4WEY A;  6GSV A;  4V1A g;  2H72 A;  4GCI A;  4NXI A;  2VL3 A;  5LNK e;  2AV4 A;  2VLT A; 
#chains in the Genus database with same CATH topology
 3UEM A;  1TXX A;  5KN3 A;  2F8A A;  2XBI A;  4OFN A;  1A2M A;  4RI7 A;  3F4R A;  2H0H A;  1X9W B;  4BL7 B;  3TJB A;  1YQ1 A;  1Z6M A;  2M72 A;  2MYG A;  5F05 A;  2NBS A;  5KOW A;  2K9F A;  2X49 A;  3KGK A;  4N0Z A;  5F07 A;  4G10 A;  4LMW A;  5GST A;  3RHB A;  5KN1 A;  4YKF A;  3LXZ A;  4BPY A;  1OE7 A;  2HRK A;  5GZZ B;  4GST A;  4TKY A;  1TTZ A;  4ML6 A;  4MP4 A;  5E4W A;  3QD9 A;  3FR9 A;  3L9U A;  4MAB A;  2HZE B;  2L6D A;  3IXR A;  1MDK A;  3PH9 A;  2HZF A;  4KH7 A;  4K8M A;  5IO2 A;  5CRH A;  4RQX A;  3IC8 A;  4NWY A;  1O7U A;  3TDG A;  2DC5 A;  5F0G A;  3NZN A;  2B5E A;  2VCX A;  1QK8 A;  1NHY A;  1THO A;  1GSF A;  4ZB6 A;  1ZYP A;  2PN8 A;  3GX0 A;  3L9S A;  3GL5 A;  5IOX A;  1X5C A;  3EE2 A;  4TR4 A;  9GSS A;  4TVE A;  4NHW A;  3APQ A;  3KJY A;  1O8W A;  3FY7 A;  1O81 A;  4L8E A;  3RDW A;  2VLU A;  2YN1 A;  3KM6 A;  2H6Z A;  1M9B A;  3HZ8 A;  3PIN A;  3ZTL A;  2FWH A;  1GTI A;  4K9Z A;  4ZB8 A;  1FG4 A;  1V9W A;  3ZL5 A;  3E0U A;  4KGI A;  2P5R A;  3M9K A;  1XWG A;  3FZ5 A;  2AJQ B;  12GS A;  2I4A A;  1Z3E A;  2VM1 A;  4HQZ A;  4POB A;  3HVS A;  3UVH A;  2D2Z A;  6GSX A;  2B7J A;  4GSS A;  3F3R A;  3L9V A;  3H8Q A;  4KF9 A;  1XWC A;  5J41 A;  1FB6 A;  2N5A A;  1R7H A;  2B7K A;  2H73 A;  1HQO A;  3P7X A;  3CRT A;  2TIR A;  4CHS A;  5HFI A;  2LV3 A;  3W8J A;  4JU5 A;  1ML6 A;  5GSS A;  1ACV A;  1K3Y A;  5IMZ A;  3G7Y A;  1AQW A;  2DJ2 A;  3I43 A;  2IJY A;  2LKU A;  2PER A;  1Y6E A;  4CY6 A;  3FZA A;  1Y25 A;  1GSE A;  4I2T A;  1JLW A;  2CAI A;  4OO5 A;  4EUY A;  4AGS A;  4KE3 A;  4MCU A;  3UAP A;  20GS A;  2DMM A;  1O73 A;  2CX4 A;  2GLR A;  2FWE A;  1CQG A;  3F63 A;  3D6I A;  4JE1 A;  3DYR A;  4GQF A;  4AJ8 A;  5ECL B;  3KTB A;  5JCU A;  4ILF A;  4A5P A;  2VD1 A;  5CP1 A;  5D9T A;  13GS A;  4EXJ A;  1EP8 A;  2X99 A;  1WWJ A;  2VL9 A;  5IMV A;  1WMJ A;  2YOI A;  3GKM A;  2F51 A;  1GSQ A;  4ZL9 A;  1FO5 A;  2B3S A;  2LS5 A;  1T1V A;  2YZH A;  2FA8 A;  3KH9 A;  4FH8 A;  3A2V A;  1T4Z A;  2VL2 C;  2H0I A;  4ZL7 A;  2C3N A;  1J9B A;  2E2M A;  3LFL A;  1U88 A;  4XS4 A;  3VWU A;  1NW2 A;  2IPA A;  1TK5 B;  2CVD A;  3UBL A;  1GUH A;  3A2W A;  5DQY A;  4E8H A;  1HNC A;  2QA1 A;  5A5K A;  3HXS A;  3DIE A;  2A4V A;  5IO0 A;  2CX3 A;  1T3B A;  2X8C A;  2VCT A;  1FHE A;  3CSJ A;  1Q4J A;  1YKA A;  1JZW A;  1M2D A;  4XHM A;  1TOF A;  1XWA A;  2OBK A;  2WJU A;  4K7N A;  1PQN A;  4EC0 A;  1SJ6 A;  5FHI A;  4YAP A;  4Q5Q A;  1PL1 A;  1LU4 A;  5CYY A;  2XPE A;  1XWB A;  4OO4 A;  2QGV A;  5D9W A;  3ZLP A;  4GSN A;  3ZML A;  1A24 A;  2REM A;  3J7Y k;  2LST A;  3IBH A;  3KXO A;  3NIV A;  4K0G A;  1B4Q A;  1GUM A;  19GS A;  4J2F A;  5CO3 A;  3ED3 A;  1XPV A;  5IMD A;  1WPI A;  1QMV A;  2HSY A;  1HYU A;  3BOA A;  5ECS A;  4K2D A;  1TP9 A;  3RPN A;  1CQH A;  4WF4 A;  4XS4 B;  5B6N A;  2WB9 A;  2BJX A;  2I9H A;  4EDZ A;  3TJJ A;  1TRV A;  5AIX A;  2GSR A;  2ON5 A;  4TR3 A;  2OE1 A;  4E8E A;  1WOU A;  3G9B A;  1XW9 A;  3H93 A;  2VIM A;  1A0F A;  2F3M A;  5IQY A;  3US3 A;  3EVI A;  3DVX A;  3TGZ A;  3VWV A;  1GNE A;  4Q5N A;  2UZ8 A;  2ES7 A;  1SK1 A;  3R3E A;  5CRE A;  3WT2 A;  5G1K A;  5B7C A;  1ZZY A;  2BTO T;  3VI5 A;  2K6V A;  4HUA A;  2WDU A;  1R26 A;  5CRD A;  2QKE A;  4I97 A;  1U3I A;  2HSH A;  2B1L A;  3IV4 A;  4TXO A;  3TKR A;  4YH2 A;  2AYT A;  3HJO A;  3UIW A;  4GRF A;  2J23 A;  3IK9 A;  1J0F A;  1SYX A;  17GS A;  2AAW A;  4X4J A;  1GH2 A;  1JHB A;  3SWL A;  3HJM A;  3EU4 A;  1TKD B;  1Z9H A;  1WRY A;  1ZMA A;  2CVK A;  4USS A;  1S3A A;  4MZB A;  1SKW B;  2DJJ A;  2X64 A;  2O7K A;  4KCA A;  3ERW A;  3DXB A;  5DCH A;  5HR1 A;  3U5R E;  2XBQ A;  3KIJ A;  4PQI A;  3CSH A;  4V2N A;  4XCS A;  1EP7 A;  2CZ3 A;  3FR6 A;  4ACS A;  1DE2 A;  3LEF A;  4LL4 B;  3WGE A;  4F0B A;  4MDC A;  3QCP A;  3GMF A;  4ECB A;  4LL1 B;  4PUF C;  3EYT A;  2X4A A;  1EEM A;  1SL1 B;  3DWV A;  3IA1 A;  4MH3 A;  3HD5 A;  1XOB A;  3GNJ A;  3TKS C;  3DEX A;  1BAY A;  4TXO B;  2YPM A;  2LNT A;  1YDK A;  5DDL A;  4PGT A;  5JCW A;  4KND A;  4G0I A;  2LJR A;  2VLV A;  3A5W A;  4Z2T A;  2O85 A;  1EOH A;  3ZMK A;  3EUR A;  4O32 A;  1G7O A;  1TJD A;  3CTG A;  4XTS A;  3LYP A;  2K18 A;  2EIR A;  3LSZ A;  2LJA A;  2JAD A;  3ERF A;  4K1F A;  1OC8 A;  4NHZ A;  4OCF A;  3TJK A;  3M3M A;  2HFD A;  3HVN A;  1O85 A;  4K5S A;  2VCZ A;  2H01 A;  3IK7 A;  1K3L A;  3HA9 A;  1M2B A;  4TXV A;  1UC7 A;  4X43 A;  1ST9 A;  2B5X A;  3A3T A;  4FIW A;  4F2I A;  4L5O A;  5JWO B;  4IQA A;  3ZVJ D;  1AQV A;  1VF3 A;  2DJK A;  3GFK A;  5HR0 A;  1XIY A;  1C72 A;  2WS2 A;  2FHE A;  5B8B A;  5ECP B;  4I8B A;  1SEN A;  4OWY A;  2FLS A;  3F6D A;  3MDK A;  3TKP A;  3RAZ A;  3ZYW A;  4K5R A;  3KTL A;  3D21 A;  2LRC A;  4KCE A;  2RLI A;  2JZS A;  3ZIT A;  2H74 A;  4CW9 A;  2CA8 A;  5ECK B;  1EV9 A;  1QUW A;  2WGR A;  1MTC A;  4FYC A;  1ZGN A;  3F3Q A;  4N30 A;  4OFM A;  5J9B A;  2NDO A;  4YQV A;  4EIQ A;  4KA0 A;  2L6C A;  4MNN A;  4Q5F A;  2IMF A;  3UMA A;  2VCW A;  3IDV A;  1GUK A;  8GSS A;  1VRS D;  2PPT A;  3F4S A;  3LG6 A;  5F06 A;  3L78 A;  2CZ2 A;  2G0F A;  5H5S A;  1B8X A;  3FKF A;  4NMU A;  4KUN A;  3ZIJ A;  2GST A;  2JU5 A;  5D9X A;  1YJ6 A;  3NOF A;  3QPM A;  3UVT A;  3IOS A;  2NVL A;  3N9J A;  1PN9 A;  1A8Y A;  3HYP A;  3GN3 A;  4BVY B;  3M8N A;  3CRU A;  4WF5 A;  2FWG A;  3V1W A;  2FWF A;  1Z6N A;  3PPU A;  5KN0 A;  2WFC A;  1M99 A;  5G2Z A;  2TRC P;  1FOH A;  3IE3 A;  1OE8 A;  3DGQ A;  4HJM A;  2OBI A;  1SKR B;  1TK0 B;  1G7E A;  4L0W A;  1R5A A;  2XHF A;  5DJM A;  2ALB A;  3K8N A;  5JWQ B;  4YAV A;  1M2A A;  3GUS A;  4HJ2 A;  2XPD A;  4HU7 A;  3DVW A;  1OKT A;  3DRN A;  5D96 A;  3HZ4 A;  4QL7 A;  4OFT A;  4G9H A;  5DCG A;  1X9S B;  1LBK A;  2VOC A;  4PQ1 A;  1JFU A;  3G7I A;  4L5L A;  5ECH B;  1ZL9 A;  5J9C A;  1BQ7 A;  4YQU A;  2EC4 A;  3VPT A;  1U3A A;  1HD2 A;  3ZRE A;  1H75 A;  2CVB A;  3P2A A;  1SL2 B;  2KP1 A;  3IC4 A;  4IJI A;  4V1A p;  4EKZ A;  2H30 A;  5BRT A;  3BBY A;  4CDO A;  3VWX A;  2MMO A;  4BWS A;  1EGO A;  5DJL A;  4IQ1 A;  2E2G A;  3VPQ A;  1OAZ A;  1EWX A;  4IBP A;  4FQU A;  5COH A;  3FK8 A;  3VUR A;  1WIK A;  3GUR A;  3VI7 A;  2L5L A;  2J9H A;  4JZQ A;  4MF5 A;  1VF1 A;  1F37 A;  2FY6 A;  2IME A;  3TKQ A;  1BG5 A;  1TRS A;  2DJ1 A;  4K7O A;  1F3A A;  3GKX A;  4ZL8 A;  1F3B A;  3KMN A;  2P5Q A;  4I6X A;  5BMU A;  5F8B A;  4MJA A;  2CAQ A;  4MMM A;  2IMK A;  1V58 A;  4DSR A;  2OAD A;  3IAM 2;  1S3C A;  3IRA A;  3WGX A;  1TU8 A;  4EL1 A;  3RPP A;  4L0U A;  2DKH A;  3ZIV A;  3D4M A;  1YY7 A;  1EZK A;  1A0R P;  2OJL A;  2A2R A;  2OA7 A;  2FCH A;  4RUV A;  3ME7 A;  2PMT A;  3I9V 2;  1DE1 A;  4BVX A;  4J57 E;  2YJH A;  5HFG A;  4MF7 A;  1QQ2 A;  2LTK A;  4IP1 A;  2AUV A;  2L4C A;  1MDJ A;  2ZUP A;  1GTU A;  3GA4 A;  5GAP D;  5B6M A;  1R5P A;  2LRN A;  4MZC A;  2VCQ A;  1EGR A;  4EVM A;  6GSW A;  4XS6 A;  1E6B A;  4GF0 A;  1TI1 A;  2DJ0 A;  3VFI A;  2IMD A;  2PBJ A;  3D22 A;  4JR4 A;  2VL2 A;  1K0B A;  3ZVJ A;  2IFQ A;  2DKI A;  1DBY A;  4MJB A;  1NM3 A;  4MPF A;  1PKW A;  1I9D A;  7GSS A;  2HRN A;  1JLV A;  3PGT A;  1AXD A;  4G0K A;  4HDE A;  3Q18 A;  3F8U A;  4F0C A;  5AGY A;  1WP0 A;  4MK3 A;  3QAV A;  2I3Y A;  1KNG A;  1PL2 A;  2V41 A;  1IYI A;  4G19 A;  3TRX A;  4WR4 A;  2EIO A;  5IPG A;  5KEJ A;  3GRX A;  3M9J A;  3KEB A;  3FRC A;  3TOT A;  3KD0 A;  3UBK A;  4QL9 A;  2RII A;  4K7I A;  2RUE A;  1K0N A;  2A2S A;  4BVX B;  2IL3 A;  5IIZ A;  2R4V A;  5DAK A;  3C8E A;  3EMX A;  1X9M B;  16GS A;  3APO A;  3MWH A;  3U6V A;  3CTF A;  4D73 A;  4WR5 A;  2TRX A;  10GS A;  3SBC A;  1YEX A;  5D8I A;  1XOA A;  4V2M A;  2PGT A;  3VK9 A;  4XIH A;  1JZO A;  2F8F A;  2N5B A;  1YF0 A;  4XRD A;  2IFQ B;  1T7P B;  2RM5 A;  4GLT A;  2V2G A;  5D73 A;  3R2Q A;  4N0V A;  1E2Y A;  2F9S A;  2GT5 A;  3GKN A;  1YF1 A;  3MYD A;  4ZBB A;  2YNX A;  5G5E A;  2H70 A;  4K2X A;  1X5D A;  3GH9 A;  3UJ1 A;  2GQM A;  3ME8 A;  1B9X C;  4POK A;  5EL8 A;  4HQS A;  5IMC A;  3MAK A;  1YEP A;  4EDY A;  3O6T A;  5DAL A;  5KOX A;  4WBR D;  5ID2 A;  2C4J A;  2IWT A;  3FYG A;  1EV4 A;  2X8H A;  1OC9 A;  1PSQ A;  2YWI A;  6GSS A;  2Z9S A;  1LJR A;  5LCZ A;  5CAX A;  1PA3 A;  2R3X A;  1DUG A;  3C73 A;  3F0I A;  1W89 A;  5DAK B;  4WBJ A;  2MBS A;  3QAG A;  5B8A A;  5HR3 A;  4D73 B;  1X5E A;  1ZYQ B;  4KSM A;  5AIV A;  3KZQ A;  4JRR A;  1O8X A;  1T00 A;  2LJK A;  3GX8 A;  3WD6 A;  3Q19 A;  1XWK A;  1QXH A;  1UN2 A;  1KEB A;  4ZIL A;  1PFO A;  4NPB A;  18GS A;  5HR2 A;  1SKS B;  1FOV A;  2AHE A;  1URM A;  4KB3 A;  5ECQ B;  1AIU A;  5C04 A;  4CY8 A;  2LNS A;  1YKC A;  3C1R A;  2H1G A;  4IHU A;  4POL A;  4HU9 A;  1OVN A;  5H5Q A;  3LXT A;  4AF2 A;  6GSU A;  4F03 A;  1MEK A;  3FEU A;  2YWM A;  2HYX A;  5DAL B;  3HY2 A;  5ID2 B;  3L0H A;  1UA5 A;  1VF2 A;  1SU9 A;  1OC9 B;  1K0O A;  3IAS 2;  1AC1 A;  3VWW A;  2DSA A;  5G30 A;  1GRX A;  2H1D A;  2KLX A;  2C0F A;  4ML1 A;  4POM A;  1GSD A;  2JL4 A;  2GZZ A;  1B48 A;  3ERG A;  2L4Q A;  2QA2 A;  3TKS A;  1KTE A;  1XBS A;  2A2P A;  4LMV A;  2BMX A;  3C71 A;  1SL0 B;  1WE0 A;  3GHA A;  3P90 A;  1BJX A;  4ZB9 A;  1AW9 A;  3HCZ A;  2YWO A;  2HNL A;  4MLY A;  1W4V A;  1N2A A;  2L5O A;  3A5I A;  2VO4 A;  3FR3 A;  4PNF A;  5CRW A;  4PUR A;  2E7P A;  1HNA A;  2RM6 A;  4N10 A;  1ON4 A;  3KMO A;  3ZFB A;  2DBC A;  2HXK A;  1JZD A;  2VAF A;  1PGT A;  4EF0 A;  4BL7 A;  2V1M A;  3MSZ A;  5FT3 A;  5ECR B;  1Z7R A;  2C80 A;  1FW1 A;  2P0G A;  4O5U A;  2N5F A;  3I69 A;  5C00 A;  1TRU A;  1SK0 A;  1THX A;  2WZ9 A;  1TDI A;  3EWL A;  2L57 A;  3HVV A;  1Q98 A;  1PX6 A;  2H75 A;  2KP2 A;  1A2J A;  3N5O A;  4NAX A;  2CT6 A;  1AAZ A;  3Q6O A;  3E9J B;  1DSB A;  2H6X A;  4HI7 A;  4KDY A;  4DVC A;  3F9U A;  2AB6 A;  2I1U A;  1GLP A;  5HQP A;  3C7M A;  4ZBA A;  1S3R A;  3J7Y b;  2MMN A;  1GUL A;  2LQQ A;  4EIP A;  3DD3 A;  3H4K A;  3D4T A;  5G1L A;  4LLR A;  3GIX A;  1SD8 A;  1BX9 A;  2PVQ A;  4ZXG A;  2YJ7 A;  5ELG A;  2B6M A;  5J4U A;  2IN3 A;  4TR1 A;  5EY6 A;  3TCO A;  2DIY A;  2GT6 A;  3O3T A;  1XFL A;  2H6Y A;  4Z7X A;  5CNW A;  3IPZ A;  4O5R A;  2MMZ A;  4IS0 A;  2GZY A;  2LUS A;  2C8U A;  3CSI A;  2G2Q A;  1BYE A;  2LQO A;  2C3T A;  4JBB A;  4J56 E;  1JZR A;  2VUP A;  3UL3 A;  11GS A;  2V6K A;  3QR6 A;  2L59 A;  3D0Z A;  4IGJ A;  2K8S A;  3GTU A;  5IMA A;  4XRA A;  1MD3 A;  3O76 A;  4KX4 A;  1EOG A;  3WYW A;  2GZP A;  2FD3 A;  4LA1 A;  4TRX A;  5DQS A;  1PD2 1;  3CXG A;  4TN8 A;  1TW9 A;  5ECO B;  3M0F A;  4MA9 A;  2CV4 A;  2XC2 A;  3HHV A;  4HZ2 A;  1HNB A;  1I5G A;  4V2L A;  5ECN B;  1PKZ A;  2PUK C;  22GS A;  2O87 A;  3H79 A;  3ZZX A;  4F9Z A;  1TK8 B;  2HT9 A;  1X0R A;  1ERT A;  4TR1 B;  4K6X A;  2K8V A;  1AQX A;  1M3J A;  3LJR A;  4KDU A;  4Z2U A;  1VGL A;  5INY A;  2VCV A;  1F6M C;  1K0M A;  1NHO A;  2P31 A;  1FAA A;  1TRW A;  1SJI A;  3JCM L;  2DIZ A;  2E0Q A;  3EU3 A;  1Z7P A;  4EE0 A;  4AJ7 A;  4RI6 A;  2YP6 A;  3IR4 A;  3GTU B;  3GKK A;  1A8L A;  1PRX A;  1GWC A;  2HRF A;  4DSQ A;  4MJE A;  1WJK A;  5EVO A;  2DML A;  2PVO C;  2V32 A;  3GYK A;  2NPB A;  3LQ7 A;  1G0T A;  2IIY A;  3AY8 A;  1XW5 A;  3QFA C;  4G0L A;  2VM2 A;  4HS1 A;  3CYN A;  2ON7 A;  2FGX A;  1MDI A;  1J08 A;  4X1U A;  4ECC A;  5D9V A;  4NV5 A;  2R0G A;  1FVJ A;  2JZT A;  3HJP A;  2GSS A;  2H76 A;  3LWA A;  3QOU A;  4ECJ A;  3KP8 A;  2MBT A;  2HI7 A;  3WT1 A;  4PXO A;  4G2E A;  2JZR A;  2GVP A;  3CQF A;  3LGC A;  2DJ3 A;  3HDC A;  14GS A;  2OAC A;  3KH7 A;  2GDR A;  2CQ9 A;  2I81 A;  3PR8 A;  6GSY A;  4TOP A;  5CRG A;  1RK4 A;  1ABA A;  4ZBD A;  4Z2R A;  1G6W A;  2YZU A;  1GTA A;  4HZ4 A;  1FB0 A;  5E59 A;  5IM9 A;  3GST A;  5AN1 A;  2FNO A;  1NSW A;  2MMA A;  3M1G A;  1USB A;  2R0P A;  1K0D A;  2B1K A;  2QC7 A;  4YKG A;  1TI3 A;  3GH6 A;  1MD4 A;  5IOW A;  4H86 A;  4K0N A;  1GSU A;  4MF6 A;  1YZX A;  4PNG A;  5JWR B;  1B4P A;  3TJF A;  2HSM A;  3FZ4 A;  5LD0 A;  2OE0 A;  4GWR A;  3MIX A;  3QAW A;  1QFN A;  5H5R A;  3HKR A;  4TR0 A;  2MZC A;  3FW2 A;  4I2U A;  4XS1 A;  2DLX A;  4N11 A;  1SYR A;  4NV2 A;  3DKS A;  4ICY A;  3I6A A;  1F2E A;  3FMW A;  3TUE A;  1T4Y A;  3GL3 A;  2V6O A;  3TKS E;  1GSS A;  4EO3 A;  3KP9 A;  1OC3 A;  3OR5 A;  5J5N A;  4ECI A;  1ILO A;  1ZYN A;  1VF4 A;  1GL8 A;  3TRQ A;  4X0X A;  4F82 A;  2H1A A;  2X8G A;  3F6F A;  3P8W A;  4ISD A;  6GST A;  1K0A A;  2JAC A;  2KHP A;  4RQR A;  1GLQ A;  3APS A;  4IN0 A;  1EEJ A;  1A2L A;  1XVQ A;  3UAR A;  1ZOF A;  3QFB C;  2YV7 A;  2R5G A;  1V57 A;  4IVF A;  3LW9 A;  2WUL A;  3GV1 A;  3RHC A;  4DSS A;  4YQM A;  1ERW A;  4OD7 A;  2H0G A;  1ZCP A;  3FZ9 A;  5A4W A;  1K3O A;  1XXU A;  2ZNM A;  3L4N A;  4ID0 A;  1QGV A;  3EIN A;  3H1N A;  2O8V B;  4O92 A;  2KOK A;  4IP6 A;  2GGT A;  2LRT A;  5G5F A;  2YCD A;  1H4O A;  4FYU A;  2M46 A;  4IJ3 A;  2QSI A;  2KUC A;  5FWG A;  2FA4 A;  5DVB A;  3TB2 A;  4MJC A;  1XZO A;  1U6T A;  2PWJ A;  4GTU A;  2NTO A;  1M7T A;  4QQ7 A;  2H71 A;  4HEA 2;  2YV9 A;  2EIQ A;  3F4T A;  3EPT A;  3QMX A;  4Q5R A;  1K0C A;  5JCG A;  4BA7 A;  3LYK A;  1SD9 A;  4ULX A;  4MPG A;  2GQK A;  3MNG A;  3ZRD A;  3BCI A;  3VLN A;  1G6Y A;  4MH2 A;  3WGD A;  1ZYE A;  2R0C A;  1Z5Y E;  3HVX A;  5J3R A;  4IW9 A;  1R4W A;  4PUA A;  4DEJ A;  2GS3 A;  1V2A A;  4KW6 A;  1GTB A;  1M0U A;  4KDX A;  2M80 A;  3EC3 A;  3IHG A;  3CBU A;  4DSS B;  1ERV A;  2JSZ A;  3TRP A;  1OYJ A;  3A2X A;  1S3D A;  5A4V A;  5D93 A;  4GQC A;  4GXZ A;  1XVW A;  4AJ6 A;  1GSY A;  3TOU A;  2C1Y A;  4OCE A;  4TW5 A;  4BIK A;  4I5Q A;  2R6K A;  5A4U A;  5HFK A;  5DBQ A;  5ECI B;  4HOJ A;  4PTS A;  2PU9 C;  1ERU A;  5L71 A;  2YWN A;  1UVZ A;  2A4H A;  4KSO A;  3E3E A;  1GNW A;  1GP1 A;  3EMP A;  4PX1 A;  1N8J A;  2GTU A;  4BWQ A;  3W8S A;  5ABR A;  1T8E B;  5ECM B;  2H8L A;  5AIS A;  3ISO A;  5GAN D;  1M9A A;  4FO5 A;  1RW1 A;  1M3I A;  3KCM A;  2C0E A;  3CMI A;  2RUF A;  4IEL A;  1OKD A;  3BJ5 A;  5IMF A;  1SJZ A;  2GQL A;  3ZFL A;  3LOR A;  4FYB A;  2GSQ A;  2LEG A;  2H66 A;  3GSS A;  3UOM A;  4O7H A;  3FHK A;  1F9M A;  1XCC A;  1B9Y C;  2YAN A;  1XW6 A;  1BED A;  2C0G A;  5G31 A;  3D5J A;  2ZCT A;  4JR6 A;  4KAE A;  2OE3 A;  5IPH A;  1U87 A;  1V40 A;  4HSC X;  2HE3 A;  2WRT A;  2HRA A;  3Q74 A;  1PN0 A;  1TU7 A;  1A23 A;  4JED A;  4WXT A;  2WCI A;  3BD2 A;  3S9F A;  3IHQ A;  4OMV A;  4P3Y B;  1AUC A;  2H19 A;  3RBT A;  2C0D A;  4WKW A;  1PMT A;  4ZIJ A;  3G7J A;  3W6G A;  1O6J A;  2OKA A;  3BCK A;  2H1B A;  1SK2 A;  4WET A;  2R37 A;  4PQH A;  4MZW A;  1FVK A;  2HZE A;  2C3Q A;  2HLS A;  1IYH A;  3DML A;  2VD0 A;  3QDN A;  2O89 A;  1V98 A;  4IKH A;  4BVY A;  5EPF A;  1RQM A;  2FUG 2;  2IMI A;  5ELA A;  3C1S A;  3TJG A;  2JSY A;  5ENU A;  5KN2 A;  2R2J A;  1KBN A;  2B5Y A;  1PX7 A;  1XG8 A;  4O5Q A;  4WEY A;  6GSV A;  4V1A g;  2H72 A;  4GCI A;  4NXI A;  2VL3 A;  5LNK e;  2AV4 A;  2VLT A; 
#chains in the Genus database with same CATH homology
 3UEM A;  1TXX A;  5KN3 A;  2F8A A;  2XBI A;  4OFN A;  1A2M A;  4RI7 A;  3F4R A;  2H0H A;  1X9W B;  4BL7 B;  3TJB A;  1YQ1 A;  1Z6M A;  2M72 A;  2MYG A;  5F05 A;  2NBS A;  5KOW A;  2K9F A;  2X49 A;  3KGK A;  4N0Z A;  5F07 A;  4G10 A;  4LMW A;  5GST A;  3RHB A;  5KN1 A;  4YKF A;  3LXZ A;  4BPY A;  1OE7 A;  2HRK A;  5GZZ B;  4GST A;  4TKY A;  1TTZ A;  4ML6 A;  4MP4 A;  5E4W A;  3QD9 A;  3FR9 A;  3L9U A;  4MAB A;  2HZE B;  2L6D A;  3IXR A;  1MDK A;  3PH9 A;  2HZF A;  4KH7 A;  4K8M A;  5IO2 A;  5CRH A;  4RQX A;  3IC8 A;  4NWY A;  1O7U A;  3TDG A;  2DC5 A;  5F0G A;  3NZN A;  2B5E A;  2VCX A;  1QK8 A;  1NHY A;  1THO A;  1GSF A;  4ZB6 A;  1ZYP A;  2PN8 A;  3GX0 A;  3L9S A;  3GL5 A;  5IOX A;  1X5C A;  3EE2 A;  4TR4 A;  9GSS A;  4TVE A;  4NHW A;  3APQ A;  3KJY A;  1O8W A;  3FY7 A;  1O81 A;  4L8E A;  3RDW A;  2VLU A;  2YN1 A;  3KM6 A;  2H6Z A;  1M9B A;  3HZ8 A;  3PIN A;  3ZTL A;  2FWH A;  1GTI A;  4K9Z A;  4ZB8 A;  1FG4 A;  1V9W A;  3ZL5 A;  3E0U A;  4KGI A;  2P5R A;  3M9K A;  1XWG A;  3FZ5 A;  2AJQ B;  12GS A;  2I4A A;  1Z3E A;  2VM1 A;  4HQZ A;  4POB A;  3HVS A;  3UVH A;  2D2Z A;  6GSX A;  2B7J A;  4GSS A;  3F3R A;  3L9V A;  3H8Q A;  4KF9 A;  1XWC A;  5J41 A;  1FB6 A;  2N5A A;  1R7H A;  2B7K A;  2H73 A;  1HQO A;  3P7X A;  3CRT A;  2TIR A;  4CHS A;  5HFI A;  2LV3 A;  3W8J A;  4JU5 A;  1ML6 A;  5GSS A;  1ACV A;  1K3Y A;  5IMZ A;  3G7Y A;  1AQW A;  2DJ2 A;  3I43 A;  2IJY A;  2LKU A;  2PER A;  1Y6E A;  4CY6 A;  3FZA A;  1Y25 A;  1GSE A;  4I2T A;  1JLW A;  2CAI A;  4OO5 A;  4EUY A;  4AGS A;  4KE3 A;  4MCU A;  3UAP A;  20GS A;  2DMM A;  1O73 A;  2CX4 A;  2GLR A;  2FWE A;  1CQG A;  3F63 A;  3D6I A;  4JE1 A;  3DYR A;  4GQF A;  4AJ8 A;  5ECL B;  3KTB A;  5JCU A;  4ILF A;  4A5P A;  2VD1 A;  5CP1 A;  5D9T A;  13GS A;  4EXJ A;  1EP8 A;  2X99 A;  1WWJ A;  2VL9 A;  5IMV A;  1WMJ A;  2YOI A;  3GKM A;  2F51 A;  1GSQ A;  4ZL9 A;  1FO5 A;  2B3S A;  2LS5 A;  1T1V A;  2YZH A;  2FA8 A;  3KH9 A;  4FH8 A;  3A2V A;  1T4Z A;  2VL2 C;  2H0I A;  4ZL7 A;  2C3N A;  1J9B A;  2E2M A;  3LFL A;  1U88 A;  4XS4 A;  3VWU A;  1NW2 A;  2IPA A;  1TK5 B;  2CVD A;  3UBL A;  1GUH A;  3A2W A;  5DQY A;  4E8H A;  1HNC A;  2QA1 A;  5A5K A;  3HXS A;  3DIE A;  2A4V A;  5IO0 A;  2CX3 A;  1T3B A;  2X8C A;  2VCT A;  1FHE A;  3CSJ A;  1Q4J A;  1YKA A;  1JZW A;  1M2D A;  4XHM A;  1TOF A;  1XWA A;  2OBK A;  2WJU A;  4K7N A;  1PQN A;  4EC0 A;  1SJ6 A;  5FHI A;  4YAP A;  4Q5Q A;  1PL1 A;  1LU4 A;  5CYY A;  2XPE A;  1XWB A;  4OO4 A;  2QGV A;  5D9W A;  3ZLP A;  4GSN A;  3ZML A;  1A24 A;  2REM A;  3J7Y k;  2LST A;  3IBH A;  3KXO A;  3NIV A;  4K0G A;  1B4Q A;  1GUM A;  19GS A;  4J2F A;  5CO3 A;  3ED3 A;  1XPV A;  5IMD A;  1WPI A;  1QMV A;  2HSY A;  1HYU A;  3BOA A;  5ECS A;  4K2D A;  1TP9 A;  3RPN A;  1CQH A;  4WF4 A;  4XS4 B;  5B6N A;  2WB9 A;  2BJX A;  2I9H A;  4EDZ A;  3TJJ A;  1TRV A;  5AIX A;  2GSR A;  2ON5 A;  4TR3 A;  2OE1 A;  4E8E A;  1WOU A;  3G9B A;  1XW9 A;  3H93 A;  2VIM A;  1A0F A;  2F3M A;  5IQY A;  3US3 A;  3EVI A;  3DVX A;  3TGZ A;  3VWV A;  1GNE A;  4Q5N A;  2UZ8 A;  2ES7 A;  1SK1 A;  3R3E A;  5CRE A;  3WT2 A;  5G1K A;  5B7C A;  1ZZY A;  2BTO T;  3VI5 A;  2K6V A;  4HUA A;  2WDU A;  1R26 A;  5CRD A;  2QKE A;  4I97 A;  1U3I A;  2HSH A;  2B1L A;  3IV4 A;  4TXO A;  3TKR A;  4YH2 A;  2AYT A;  3HJO A;  3UIW A;  4GRF A;  2J23 A;  3IK9 A;  1J0F A;  1SYX A;  17GS A;  2AAW A;  4X4J A;  1GH2 A;  1JHB A;  3SWL A;  3HJM A;  3EU4 A;  1TKD B;  1Z9H A;  1WRY A;  1ZMA A;  2CVK A;  4USS A;  1S3A A;  4MZB A;  1SKW B;  2DJJ A;  2X64 A;  2O7K A;  4KCA A;  3ERW A;  3DXB A;  5DCH A;  5HR1 A;  3U5R E;  2XBQ A;  3KIJ A;  4PQI A;  3CSH A;  4V2N A;  4XCS A;  1EP7 A;  2CZ3 A;  3FR6 A;  4ACS A;  1DE2 A;  3LEF A;  4LL4 B;  3WGE A;  4F0B A;  4MDC A;  3QCP A;  3GMF A;  4ECB A;  4LL1 B;  4PUF C;  3EYT A;  2X4A A;  1EEM A;  1SL1 B;  3DWV A;  3IA1 A;  4MH3 A;  3HD5 A;  1XOB A;  3GNJ A;  3TKS C;  3DEX A;  1BAY A;  4TXO B;  2YPM A;  2LNT A;  1YDK A;  5DDL A;  4PGT A;  5JCW A;  4KND A;  4G0I A;  2LJR A;  2VLV A;  3A5W A;  4Z2T A;  2O85 A;  1EOH A;  3ZMK A;  3EUR A;  4O32 A;  1G7O A;  1TJD A;  3CTG A;  4XTS A;  3LYP A;  2K18 A;  2EIR A;  3LSZ A;  2LJA A;  2JAD A;  3ERF A;  4K1F A;  1OC8 A;  4NHZ A;  4OCF A;  3TJK A;  3M3M A;  2HFD A;  1O85 A;  4K5S A;  2VCZ A;  2H01 A;  3IK7 A;  1K3L A;  3HA9 A;  1M2B A;  4TXV A;  1UC7 A;  4X43 A;  1ST9 A;  2B5X A;  3A3T A;  4FIW A;  4F2I A;  4L5O A;  5JWO B;  4IQA A;  3ZVJ D;  1AQV A;  1VF3 A;  2DJK A;  3GFK A;  5HR0 A;  1XIY A;  1C72 A;  2WS2 A;  2FHE A;  5B8B A;  5ECP B;  4I8B A;  1SEN A;  4OWY A;  2FLS A;  3F6D A;  3MDK A;  3TKP A;  3RAZ A;  3ZYW A;  4K5R A;  3KTL A;  3D21 A;  2LRC A;  4KCE A;  2RLI A;  2JZS A;  3ZIT A;  2H74 A;  4CW9 A;  2CA8 A;  5ECK B;  1EV9 A;  1QUW A;  2WGR A;  1MTC A;  4FYC A;  1ZGN A;  3F3Q A;  4N30 A;  4OFM A;  5J9B A;  2NDO A;  4YQV A;  4EIQ A;  4KA0 A;  2L6C A;  4MNN A;  4Q5F A;  2IMF A;  3UMA A;  2VCW A;  3IDV A;  1GUK A;  8GSS A;  1VRS D;  2PPT A;  3F4S A;  3LG6 A;  5F06 A;  3L78 A;  2CZ2 A;  2G0F A;  5H5S A;  1B8X A;  3FKF A;  4NMU A;  4KUN A;  3ZIJ A;  2GST A;  2JU5 A;  5D9X A;  1YJ6 A;  3NOF A;  3QPM A;  3UVT A;  3IOS A;  2NVL A;  3N9J A;  1PN9 A;  1A8Y A;  3HYP A;  3GN3 A;  4BVY B;  3M8N A;  3CRU A;  4WF5 A;  2FWG A;  3V1W A;  2FWF A;  1Z6N A;  3PPU A;  5KN0 A;  2WFC A;  1M99 A;  5G2Z A;  2TRC P;  1FOH A;  3IE3 A;  1OE8 A;  3DGQ A;  4HJM A;  2OBI A;  1SKR B;  1TK0 B;  1G7E A;  4L0W A;  1R5A A;  2XHF A;  5DJM A;  2ALB A;  3K8N A;  5JWQ B;  4YAV A;  1M2A A;  3GUS A;  4HJ2 A;  2XPD A;  4HU7 A;  3DVW A;  1OKT A;  3DRN A;  5D96 A;  3HZ4 A;  4QL7 A;  4OFT A;  4G9H A;  5DCG A;  1X9S B;  1LBK A;  2VOC A;  4PQ1 A;  1JFU A;  3G7I A;  4L5L A;  5ECH B;  1ZL9 A;  5J9C A;  1BQ7 A;  4YQU A;  2EC4 A;  3VPT A;  1U3A A;  1HD2 A;  3ZRE A;  1H75 A;  2CVB A;  3P2A A;  1SL2 B;  2KP1 A;  3IC4 A;  4IJI A;  4V1A p;  4EKZ A;  2H30 A;  5BRT A;  3BBY A;  4CDO A;  3VWX A;  2MMO A;  4BWS A;  1EGO A;  5DJL A;  4IQ1 A;  2E2G A;  3VPQ A;  1OAZ A;  1EWX A;  4IBP A;  4FQU A;  5COH A;  3FK8 A;  3VUR A;  1WIK A;  3GUR A;  3VI7 A;  2L5L A;  2J9H A;  4JZQ A;  4MF5 A;  1VF1 A;  1F37 A;  2FY6 A;  2IME A;  3TKQ A;  1BG5 A;  1TRS A;  2DJ1 A;  4K7O A;  1F3A A;  3GKX A;  4ZL8 A;  1F3B A;  3KMN A;  2P5Q A;  4I6X A;  5BMU A;  5F8B A;  4MJA A;  2CAQ A;  4MMM A;  2IMK A;  1V58 A;  4DSR A;  2OAD A;  3IAM 2;  1S3C A;  3IRA A;  3WGX A;  1TU8 A;  4EL1 A;  3RPP A;  4L0U A;  2DKH A;  3ZIV A;  3D4M A;  1YY7 A;  1EZK A;  1A0R P;  2OJL A;  2A2R A;  2OA7 A;  2FCH A;  4RUV A;  3ME7 A;  2PMT A;  3I9V 2;  1DE1 A;  4BVX A;  4J57 E;  2YJH A;  5HFG A;  4MF7 A;  1QQ2 A;  2LTK A;  4IP1 A;  2AUV A;  2L4C A;  1MDJ A;  2ZUP A;  1GTU A;  3GA4 A;  5GAP D;  5B6M A;  1R5P A;  2LRN A;  4MZC A;  2VCQ A;  1EGR A;  4EVM A;  6GSW A;  4XS6 A;  1E6B A;  4GF0 A;  1TI1 A;  2DJ0 A;  3VFI A;  2IMD A;  2PBJ A;  3D22 A;  4JR4 A;  2VL2 A;  1K0B A;  3ZVJ A;  2IFQ A;  2DKI A;  1DBY A;  4MJB A;  1NM3 A;  4MPF A;  1PKW A;  1I9D A;  7GSS A;  2HRN A;  1JLV A;  3PGT A;  1AXD A;  4G0K A;  4HDE A;  3Q18 A;  3F8U A;  4F0C A;  5AGY A;  1WP0 A;  4MK3 A;  3QAV A;  2I3Y A;  1KNG A;  1PL2 A;  2V41 A;  1IYI A;  4G19 A;  3TRX A;  4WR4 A;  2EIO A;  5IPG A;  5KEJ A;  3GRX A;  3M9J A;  3KEB A;  3FRC A;  3TOT A;  3KD0 A;  3UBK A;  4QL9 A;  2RII A;  4K7I A;  2RUE A;  1K0N A;  2A2S A;  4BVX B;  2IL3 A;  5IIZ A;  2R4V A;  5DAK A;  3C8E A;  3EMX A;  1X9M B;  16GS A;  3APO A;  3MWH A;  3U6V A;  3CTF A;  4D73 A;  4WR5 A;  2TRX A;  10GS A;  3SBC A;  1YEX A;  5D8I A;  1XOA A;  4V2M A;  2PGT A;  3VK9 A;  4XIH A;  1JZO A;  2F8F A;  2N5B A;  1YF0 A;  4XRD A;  2IFQ B;  1T7P B;  2RM5 A;  4GLT A;  2V2G A;  5D73 A;  3R2Q A;  4N0V A;  1E2Y A;  2F9S A;  2GT5 A;  3GKN A;  1YF1 A;  3MYD A;  4ZBB A;  2YNX A;  5G5E A;  2H70 A;  4K2X A;  1X5D A;  3GH9 A;  3UJ1 A;  2GQM A;  3ME8 A;  1B9X C;  4POK A;  5EL8 A;  4HQS A;  5IMC A;  3MAK A;  1YEP A;  4EDY A;  3O6T A;  5DAL A;  5KOX A;  4WBR D;  5ID2 A;  2C4J A;  2IWT A;  3FYG A;  1EV4 A;  2X8H A;  1OC9 A;  1PSQ A;  2YWI A;  6GSS A;  2Z9S A;  1LJR A;  5LCZ A;  5CAX A;  1PA3 A;  2R3X A;  1DUG A;  3C73 A;  3F0I A;  1W89 A;  5DAK B;  4WBJ A;  2MBS A;  3QAG A;  5B8A A;  5HR3 A;  4D73 B;  1X5E A;  1ZYQ B;  4KSM A;  5AIV A;  3KZQ A;  4JRR A;  1O8X A;  1T00 A;  2LJK A;  3GX8 A;  3WD6 A;  3Q19 A;  1XWK A;  1QXH A;  1UN2 A;  1KEB A;  4ZIL A;  4NPB A;  18GS A;  5HR2 A;  1SKS B;  1FOV A;  2AHE A;  1URM A;  4KB3 A;  5ECQ B;  1AIU A;  5C04 A;  4CY8 A;  2LNS A;  1YKC A;  3C1R A;  2H1G A;  4IHU A;  4POL A;  4HU9 A;  1OVN A;  5H5Q A;  3LXT A;  4AF2 A;  6GSU A;  4F03 A;  1MEK A;  3FEU A;  2YWM A;  2HYX A;  5DAL B;  3HY2 A;  5ID2 B;  3L0H A;  1UA5 A;  1SU9 A;  1VF2 A;  1OC9 B;  1K0O A;  3IAS 2;  1AC1 A;  3VWW A;  2DSA A;  5G30 A;  1GRX A;  2H1D A;  2KLX A;  2C0F A;  4ML1 A;  4POM A;  1GSD A;  2JL4 A;  2GZZ A;  1B48 A;  3ERG A;  2L4Q A;  2QA2 A;  3TKS A;  1KTE A;  1XBS A;  2A2P A;  4LMV A;  2BMX A;  3C71 A;  1SL0 B;  1WE0 A;  3GHA A;  3P90 A;  1BJX A;  4ZB9 A;  1AW9 A;  3HCZ A;  2YWO A;  2HNL A;  4MLY A;  1W4V A;  1N2A A;  2L5O A;  3A5I A;  2VO4 A;  3FR3 A;  4PNF A;  5CRW A;  4PUR A;  2E7P A;  1HNA A;  2RM6 A;  4N10 A;  1ON4 A;  3KMO A;  3ZFB A;  2DBC A;  2HXK A;  1JZD A;  2VAF A;  1PGT A;  4EF0 A;  4BL7 A;  2V1M A;  3MSZ A;  5FT3 A;  5ECR B;  1Z7R A;  2C80 A;  1FW1 A;  2P0G A;  4O5U A;  2N5F A;  3I69 A;  5C00 A;  1TRU A;  1SK0 A;  1THX A;  2WZ9 A;  1TDI A;  3EWL A;  2L57 A;  3HVV A;  1Q98 A;  1PX6 A;  2H75 A;  2KP2 A;  1A2J A;  3N5O A;  4NAX A;  2CT6 A;  1AAZ A;  3Q6O A;  3E9J B;  1DSB A;  2H6X A;  4HI7 A;  4KDY A;  4DVC A;  3F9U A;  2AB6 A;  2I1U A;  1GLP A;  5HQP A;  3C7M A;  4ZBA A;  3J7Y b;  2MMN A;  1GUL A;  2LQQ A;  4EIP A;  3DD3 A;  3H4K A;  3D4T A;  5G1L A;  4LLR A;  3GIX A;  1SD8 A;  1BX9 A;  2PVQ A;  4ZXG A;  2YJ7 A;  5ELG A;  2B6M A;  5J4U A;  2IN3 A;  4TR1 A;  5EY6 A;  3TCO A;  2DIY A;  2GT6 A;  3O3T A;  1XFL A;  2H6Y A;  4Z7X A;  5CNW A;  3IPZ A;  4O5R A;  2MMZ A;  4IS0 A;  2GZY A;  2LUS A;  2C8U A;  3CSI A;  2G2Q A;  1BYE A;  2LQO A;  2C3T A;  4JBB A;  4J56 E;  1JZR A;  2VUP A;  3UL3 A;  11GS A;  2V6K A;  3QR6 A;  2L59 A;  3D0Z A;  4IGJ A;  2K8S A;  3GTU A;  5IMA A;  4XRA A;  1MD3 A;  3O76 A;  4KX4 A;  1EOG A;  3WYW A;  2GZP A;  2FD3 A;  4LA1 A;  4TRX A;  5DQS A;  1PD2 1;  3CXG A;  4TN8 A;  1TW9 A;  5ECO B;  3M0F A;  4MA9 A;  2CV4 A;  2XC2 A;  3HHV A;  4HZ2 A;  1HNB A;  1I5G A;  4V2L A;  5ECN B;  1PKZ A;  2PUK C;  22GS A;  2O87 A;  3H79 A;  3ZZX A;  4F9Z A;  1TK8 B;  2HT9 A;  1X0R A;  1ERT A;  4TR1 B;  4K6X A;  2K8V A;  1AQX A;  3LJR A;  4KDU A;  4Z2U A;  1VGL A;  5INY A;  2VCV A;  1F6M C;  1K0M A;  1NHO A;  2P31 A;  1FAA A;  1TRW A;  1SJI A;  3JCM L;  2DIZ A;  2E0Q A;  3EU3 A;  1Z7P A;  4EE0 A;  4AJ7 A;  4RI6 A;  2YP6 A;  3IR4 A;  3GTU B;  3GKK A;  1A8L A;  1PRX A;  1GWC A;  2HRF A;  4DSQ A;  4MJE A;  1WJK A;  5EVO A;  2DML A;  2PVO C;  2V32 A;  3GYK A;  2NPB A;  3LQ7 A;  1G0T A;  2IIY A;  3AY8 A;  1XW5 A;  3QFA C;  4G0L A;  2VM2 A;  4HS1 A;  3CYN A;  2ON7 A;  2FGX A;  1MDI A;  1J08 A;  4X1U A;  4ECC A;  5D9V A;  4NV5 A;  2R0G A;  1FVJ A;  2JZT A;  3HJP A;  2GSS A;  2H76 A;  3LWA A;  3QOU A;  4ECJ A;  3KP8 A;  2MBT A;  2HI7 A;  3WT1 A;  4PXO A;  4G2E A;  2JZR A;  2GVP A;  3LGC A;  2DJ3 A;  3HDC A;  14GS A;  2OAC A;  3KH7 A;  2GDR A;  2CQ9 A;  2I81 A;  3PR8 A;  6GSY A;  4TOP A;  5CRG A;  1RK4 A;  1ABA A;  4ZBD A;  4Z2R A;  1G6W A;  2YZU A;  1GTA A;  4HZ4 A;  1FB0 A;  5E59 A;  5IM9 A;  3GST A;  5AN1 A;  2FNO A;  1NSW A;  2MMA A;  3M1G A;  1USB A;  2R0P A;  1K0D A;  2B1K A;  2QC7 A;  4YKG A;  1TI3 A;  3GH6 A;  1MD4 A;  5IOW A;  4H86 A;  4K0N A;  1GSU A;  4MF6 A;  1YZX A;  4PNG A;  5JWR B;  1B4P A;  3TJF A;  2HSM A;  3FZ4 A;  5LD0 A;  2OE0 A;  4GWR A;  3MIX A;  3QAW A;  1QFN A;  5H5R A;  3HKR A;  4TR0 A;  2MZC A;  3FW2 A;  4I2U A;  4XS1 A;  2DLX A;  4N11 A;  1SYR A;  4NV2 A;  3DKS A;  4ICY A;  3I6A A;  1F2E A;  3FMW A;  3TUE A;  1T4Y A;  3GL3 A;  2V6O A;  3TKS E;  1GSS A;  4EO3 A;  3KP9 A;  1OC3 A;  3OR5 A;  5J5N A;  4ECI A;  1ILO A;  1ZYN A;  1VF4 A;  1GL8 A;  3TRQ A;  4X0X A;  4F82 A;  2H1A A;  2X8G A;  3F6F A;  3P8W A;  4ISD A;  6GST A;  1K0A A;  2JAC A;  2KHP A;  4RQR A;  1GLQ A;  3APS A;  4IN0 A;  1EEJ A;  1A2L A;  1XVQ A;  3UAR A;  1ZOF A;  3QFB C;  2YV7 A;  2R5G A;  1V57 A;  4IVF A;  3LW9 A;  2WUL A;  3GV1 A;  3RHC A;  4DSS A;  4YQM A;  1ERW A;  4OD7 A;  2H0G A;  1ZCP A;  3FZ9 A;  5A4W A;  1K3O A;  1XXU A;  2ZNM A;  3L4N A;  4ID0 A;  1QGV A;  3EIN A;  3H1N A;  2O8V B;  4O92 A;  2KOK A;  4IP6 A;  2GGT A;  2LRT A;  5G5F A;  2YCD A;  1H4O A;  4FYU A;  2M46 A;  4IJ3 A;  2QSI A;  2KUC A;  5FWG A;  2FA4 A;  5DVB A;  3TB2 A;  4MJC A;  1XZO A;  1U6T A;  2PWJ A;  4GTU A;  2NTO A;  1M7T A;  4QQ7 A;  2H71 A;  4HEA 2;  2YV9 A;  2EIQ A;  3F4T A;  3EPT A;  3QMX A;  4Q5R A;  1K0C A;  5JCG A;  4BA7 A;  3LYK A;  1SD9 A;  4ULX A;  4MPG A;  2GQK A;  3MNG A;  3ZRD A;  3BCI A;  3VLN A;  1G6Y A;  4MH2 A;  3WGD A;  1ZYE A;  2R0C A;  1Z5Y E;  3HVX A;  5J3R A;  4IW9 A;  1R4W A;  4PUA A;  4DEJ A;  2GS3 A;  1V2A A;  4KW6 A;  1GTB A;  1M0U A;  4KDX A;  2M80 A;  3EC3 A;  3IHG A;  3CBU A;  4DSS B;  1ERV A;  2JSZ A;  3TRP A;  1OYJ A;  3A2X A;  1S3D A;  5A4V A;  5D93 A;  4GQC A;  4GXZ A;  1XVW A;  4AJ6 A;  1GSY A;  3TOU A;  2C1Y A;  4OCE A;  4TW5 A;  4I5Q A;  2R6K A;  5A4U A;  5HFK A;  5DBQ A;  5ECI B;  4HOJ A;  4PTS A;  2PU9 C;  1ERU A;  5L71 A;  2YWN A;  1UVZ A;  2A4H A;  4KSO A;  3E3E A;  1GNW A;  1GP1 A;  3EMP A;  4PX1 A;  1N8J A;  2GTU A;  4BWQ A;  3W8S A;  5ABR A;  1T8E B;  5ECM B;  2H8L A;  5AIS A;  3ISO A;  5GAN D;  1M9A A;  4FO5 A;  1RW1 A;  3KCM A;  2C0E A;  3CMI A;  2RUF A;  4IEL A;  1OKD A;  3BJ5 A;  5IMF A;  1SJZ A;  2GQL A;  3ZFL A;  3LOR A;  4FYB A;  2GSQ A;  2LEG A;  2H66 A;  3GSS A;  3UOM A;  4O7H A;  3FHK A;  1F9M A;  1XCC A;  1B9Y C;  2YAN A;  1XW6 A;  1BED A;  2C0G A;  5G31 A;  3D5J A;  2ZCT A;  4JR6 A;  4KAE A;  2OE3 A;  5IPH A;  1U87 A;  1V40 A;  2HE3 A;  2WRT A;  2HRA A;  3Q74 A;  1PN0 A;  1TU7 A;  1A23 A;  4JED A;  4WXT A;  2WCI A;  3BD2 A;  3S9F A;  3IHQ A;  4OMV A;  4P3Y B;  1AUC A;  2H19 A;  3RBT A;  2C0D A;  4WKW A;  1PMT A;  4ZIJ A;  3G7J A;  3W6G A;  1O6J A;  2OKA A;  3BCK A;  2H1B A;  1SK2 A;  4WET A;  2R37 A;  4PQH A;  4MZW A;  1FVK A;  2HZE A;  2C3Q A;  2HLS A;  1IYH A;  3DML A;  2VD0 A;  3QDN A;  2O89 A;  1V98 A;  4IKH A;  4BVY A;  5EPF A;  1RQM A;  2FUG 2;  2IMI A;  5ELA A;  3C1S A;  3TJG A;  2JSY A;  5ENU A;  5KN2 A;  2R2J A;  1KBN A;  2B5Y A;  1PX7 A;  4O5Q A;  4WEY A;  6GSV A;  4V1A g;  2H72 A;  4GCI A;  4NXI A;  2VL3 A;  5LNK e;  2AV4 A;  2VLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...